1OZOA

Three-dimensional solution structure of apo-s100p protein determined by nmr spectroscopy
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
95
structure length
95
Chain Sequence
MTELEAAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSASHKYFEKTGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-100P protein
publication title NMR structure of the Apo-S100P protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 32
structure length 95
sequence length 95
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ozoA00
3TDZA 4CPVA 1FBVA 1QLKA 2LMUA 3TUYC 5ER4X 2JZIA 1F54A 2HQ8A 1J7RA 4JPZB 4YGDB 1QTXA 1DGUA 1CLLA 1WLZA 2K7BA 4BY4A 1EG4A 1AJ4A 2CTNA 1CDLA 2M8UA 4WRIA 3AAKA 5CSJA 1QX2A 1EXRA 1TIZA 1GGZA 1AHRA 1YX8A 1M31A 1J1EA 2WCEA 1PRWA 1TN4A 1TCFA 1PSRA 1G8IA 1UURA 2WORA 3BOWA 3LK0A 2AAOA 1YTZC 2ZRTA 3ZWHA 4OV2A 1NWDA 1OMRA 4MN0A 1MHOA 1LA0A 2BKHB 1SYMA 2LP3A 2K8MB 2WNDA 2BECA 3PM8A 1L7ZA 2BCAA 1NPQA 4FTGA 1A75B 1ALWA 4D1EA 1F70A 1UP5A 2FCDA 1W7IB 2H61C 3BOWB 3PN7C 1SW8A 5AANA 2LE9B 2E30A 2M0RA 1PALA 3D0YB 1XYDA 3GK2A 2Q4UA 2KAYA 2LVVA 3CS1A 4E68A 2JXCA 4PHNA 2GV5A 5G08A 1S5GZ 3JVTC 1DJGA 1DJHA 3LLEA 1Y0VH 2JQ6A 4PE4A 3TDUA 2MHHA 1CFCA 5HKWA 2CBLA 4GPLB 5KTYA 2L4IA 3GOFA 3IQQA 4OR9B 3FIAA 1CFFA 4USLA 4ICBA 2OTGB 3CR2A 1AK8A 4GBAA 1KWOB 3OB1B 3SG3A 3WHTB 2CT9A 1XK4C 4BY5A 4XJKA 1SKTA 2IS9A 5AXIA 1EJ3A 1PK0D 3WNXB 1AVSA 3SG5A 1M63B 2MLFC 5I8NA 2KFHA 4MZLA 2KBIA 1JFKA 1B47A 1KSMA 2LNKA 1TNPA 4U8DA 1IJ5A 4MEWA 3F45A 2A4JA 1OZOA 1NCXA 5HLOA 1BF5A 4NDDA 1Q80A 4QJ3B 4PE1A 2ZRSA 1IQ5A 1KK8B 1QLSA 1MF8B 2F3YA 2L51A 1BODA 3DD4A 1DJWA 1S6CA 2K2FA 4OVNF 2JTZA 1JWDA 1IWQA 4P2YB 2LMVA 4DS7A 1CLMA 3NSLA 2MJWB 1J55A 4MRXA 2KAVA 2OPOA 2MRDA 4MSPA 4I5LB 5DKRA 2ZN9A 4ORBB 1UUSA 3I5HB 3MSEB 1ZACA 1J7OA 1DTLA 1S36A 3LK1A 1IH0A 1UWOA 1NP8A 2ZKMX 2KBMA 4PCWA 1NX2A 1JUOA 4ZCUA 2CXJA 2SCPA 3SIAA 4YGCB 3KEVA 2LLSA 4GGFC 1MR8A 2BE4A 2COLB 5DKQA 3EK4A 4I5NB 3NSOA 4GUKA 4ORCB 3WXAA 1C7VA 2HPSA 1E8AA 3GK4X 1ZMZA 4IL1A 1EG3A 1IGVA 2JNFA 1IKUA 1DJIA 2OTGC 1K9PA 3NSKA 3EVVA 1KWOC 2KQYA 1A29A 3WHUB 5CPVA 1SK6D 1KFXS 1MUXA 3CR5X 4PHJA 3I5IB 1JFJA 2BBNA 5AERA 1J1DA 3BXKA 3O2PA 4MBEA 1YUUA 1M46A 3OX5A 4MZJA 3FS7A 1OE9B 2PASA 5HKZA 1F4QA 1TNWA 1EL4A 4OKHA 2KI6D 2G9BA 1KQVA 3LL8B 4P5OE 5HYDA 1OMDA 3PFVA 2L98A 1NSHA 5I2LA 2F2OA 2KYCA 1B7TY 1YR5A 3EK7A 3O4YA 2QACA 5FYXA 1SNLA 1FW4A 1KK8C 5JJGA 1MXEA 1NX3A 1BU3A 1XFYO 4GGNA 2MBXA 2H2KA 4AQJA 2LMTA 4OCIA 2ZNEA 2D8NA 2QPTA 3AAJA 4TNCA 1SL8A 3SJSA 3ZNIA 2M1UA 2KHNA 3KO0A 3ICBA 1JBAA 1WLMA 3VGOA 3I5HC 4C0KA 2G2BA 1TCOB 4I5KA 5HKYA 1R6PA 4C0LA 1LA3A 2M29A 1H8BA 5F6TA 2L2EA 1NX1A 1B4CA 1RK9A 2KQ6A 1QX7A 1R2UA 3BUXB 1XFUO 1IRJA 2K61A 3KPXA 2FCEA 1UHIA 2I7AA 3M0WA 2K7DA 1AJ5A 1MQ1A 1D1OA 1KFXL 1XFWO 5AEQA 2LM5A 5D69A 4PE7A 4YBHB 2KNEA 5J3XA 2JC2A 5I2OA 1OZSA 2HF5A 2PRUA 2WCBA 1CM1A 1CDMA 3I5IC 1QV0A 1CDPA 2ZNDA 1NYAA 2TN4A 4JQ0D 2JPTA 1WRZA 4N1GA 3NXAA 3VRPA 3CGAA 1WRKA 2M49B 3BUOB 4MVFA 1CFPA 2GGMA 1S6JA 2EHBA 1N2DA 2JU0A 3JTDB 1BR1B 3BYAA 2ZN8A 1YUSA 1RJVA 1K2HA 3FWBA 3O6BA 3DVJA 2Q91A 5K89A 2MLEC 1M39A 1V1FA 2BCXA 2K2AA 3CTNA 2LAPA 5TNCA 1B8LA 2HETA 3BUNB 1RFJA 1BG1A 1S26D 1UHHA 1V1GA 2JT3A 4DUQA 3SG6A 2E6WA 2KI4B 4XJKB 1H4BA 2KYFA 1K93D 3A8RA 2LUCA 3E3RA 4HRHA 1NUBA 2F3ZA 1YVLA 1SMGA 1KK7Y 1DJXA 2BKIB 1MWNA 1RTP1 1NX0A 1TRFA 4QJ4B 1VRKA 2MA2A 3IQOA 2KSPA 1IQ3A 1L2OB 1S3PA 1FI6A 2LV7A 1F8HA 1IG5A 2OS8B 1CTRA 1XO5A 1X02A 4GFTA 2I94A 1EH2A 1YRUB 5JOLA 1QV1A 1ZFSA 4GNKB 1B8CA 1PVAA 1SRAA 1HT9A 1TNQA 4I5JA 3BUWB 2BL0B 4HRGA 4PE0A 1RROA 4AOMA 1SL7A 1QX5B 1A4PA 2WOSA 4A4CA 4DIRA 3BQ3A 2LCPA 1GJYA 1GGWA 3KF9A 1N65A 4R1EA 1TTXA 5BPJA 1S1EA 1CMFA 2JXLA 3OB2B 2L5XB 2LANA 4NQGA 1QASA 5CSIA 3RLZA 4JWQA 4F0ZB 3FWCA 4WQ2A 3VRNA 3JTDC 1PSBA 3VROA 3VRRA 5PALA 4NDBA 2K7CA 2BBMA 1N0YA 3DF0A 1QIVA 1CB1A 4GAOA 1BOCA 5KU1A 1W7JB 1HQVA 1K9UA 3PALA 1CMGA 1K96A 1K95A 4QJ5B 3DVEA 1PVBA 5DKNA 1MXLC 1TNXA 3AKBA 4AQIA 1FI5A 4HSZA 5HLVA 2CCMA 2KI4C 1BR4B 1OOJA 1TOPA 2EC6B 3GK1A 1CM4A 2WC8A 3I5GB 2KGRA 1KSOA 2BE6A 2KI6C 2NCPA 2NXQA 3A4UB 1LKJA 4MLWA 1XK4A 2LLTA 1B9AA 1ALVA 3OHMB 3EVUA 2PMYA 4YI8A 2WCFA 1L2OC 2LP2A 3NSIA 1JSAA 5ER5A 1DJYA 3EK8A 2L50A 1BJFA 2OS8C 5CSNA 1KCYA 1DGVA 1XVJA 1Y1UA 3D10A 2I2RE 2M9GA 1UHKA 4CFRA 2BL0C 1BMOA 1DJZA 3K21A 2M7NA 1YRTB 1KFUS 2I18A 2ISDA 2L4HA 1QJTA 2KFFA 1SL9A 1F55A 5CSFA 3C1VA 1GQMA 3TDIA 2EGDA 2LUXA 1SBJA 4PHMA 1KK7Z 2GGZA 1Y1XA 2VRGA 4WQ3A 1DVIA 3VRQA 2BCBA 1A75A 1NIWA 1KQMB 2K0JA 2NLNA 4YI9A 3I5FB 5AFPA 2PVBA 2JT8A 1OQPA 2AMIA 3O78A 1XFVO 1YUTA 2FJUB 1M45A 1JF2A 3D0YA 4FQOA 1K90D 1SR6C 1QVIY 1YURA 2L0PA 4DRWA 2P6BB 4CLNA 1Y6WA 5D7FA 2JULA 4MRYA 4GGFA 1XFXO 2LVKA 3EKHA 1BT6A 3DVMA 1YX7A 3SIBA 1B1GA 4DCKA 1QXPA 2K7OA 2EC6C 1CFDA 1CNPA 1FPWA 4N1FA 2MAZA 3I5GC 1NCYA 2FOTA 3OP0A 1K9KA 1C07A 1B8RA 2PSRA 1PULA 1DF0A 2ZFDA 2LLUA 4PDZA 3CLNA 1A03A 1UHNA 1LINA 2O60A 2M7LA 3SG4A 3PSRA 1KFUL 2JTTA 3TZ1A 3EVRA 5B8IB 2R2IA 4HREE 2F8PA 4CIDA 1ZUZA 1DF0B 4M2QA 3TS5B 4ORAB 2JWWA 3SG2A 1A2XA 3CR4X 2JRFA 2HQWA 4YGAA 1WDCB 2LHLA 2M1KB 3DVKA 1CLBA 3H4SE 1B7TZ 1CDNA 5KSZA 3BUMB 1CKKA 2LHIA 1SCMB 4NDCA 1NCZA 2SASA 1IJ6A 4PHKA 1SY9A 1G33A 2F33A 1QS7A 3TUYB 1KQMC 1WRLA 2JT0A 2V53A 5GQQC 2JOJA 4MZKA 3HX4A 3I5FC 3KHEA 4UPGA 1ZOTB 1AUIB 1J7PA 1BLQA 1LXFC 4XYNA 1S6IA 4M2PA 1OMVA 4YGBB 2KAXA 1JC2A 3IF7A 1DMOA 1S5GY 3OX6A 2PALA 1RECA 4PALA 1FF1A 2AUCA 2O5GA 1G4YR 1OSAA 1QIWA 1RWYA 2H61A 4N5XA 2JNXA 1SCVA 4ZCVA 1XFZO 1YVHA 2RGIA 3EKJA 2LVIA 2F2PA 4Q04A 2Y1NA 1SR6B 4L9MA 2Y5IA 4A4BA 4YGEB 2KOTA 1F4OA 2M97A 2M3WA 3RM1A 2Y1MA 3DF0B 3HCMA 5IBWA 2B1UA 3PN7B 2NZ0A 3QRXA 1JF0A 2Y4QA 1AP4A 1XA5A 2NCOA 1J7QA 3AKAA 3LCPC 1U5IA 4M2OA 1QVIZ 1C7WA 4ETOA 4YRUA 3JVTB 1F71A 1LVCD 3TS5C 4C0JA 1Y1AA 3PLFB 3SG7A 1UHJA 5I2QA 1WY9A 1WDCC 1K8UA 2KFGA 3PATA 2LC5A 1QATA 3CWGA 2KGBC 2CNPA 2DOQA 1SPYA 1K94A 3CZTX 2LVJA 1DT7B 1U5IB 4CFQA 2KDHA 1SCMC 1ODBA
chains in the Genus database with same CATH superfamily
2PQLA 3TDZA 4CPVA 1FBVA 1QLKA 2LMUA 2KPHA 3TUYC 5ER4X 2JZIA 1F54A 2HQ8A 1J7RA 4JPZB 1C3YA 4YGDB 1QTXA 1DGUA 1CLLA 1WLZA 2K7BA 4BY4A 1EG4A 3D73A 1AJ4A 2CTNA 1CDLA 2M8UA 4WRIA 1OOGA 3AAKA 5CSJA 1QX2A 1EXRA 1TIZA 1GGZA 1AHRA 1YX8A 1M31A 1J1EA 3R1OA 2WCEA 1PRWA 1TN4A 1TCFA 1PSRA 1G8IA 1UURA 2WORA 3BOWA 3LK0A 2FJYA 2AAOA 3BFBA 1YTZC 2ZRTA 3ZWHA 4OV2A 1NWDA 1OMRA 4MN0A 1MHOA 1LA0A 2BKHB 1SYMA 2LP3A 2K8MB 2WNDA 2BECA 3PM8A 1L7ZA 2BCAA 1NPQA 4FTGA 1A75B 1ALWA 3OBVA 4D1EA 1F70A 1UP5A 2FCDA 1W7IB 2H61C 3BOWB 3PN7C 2KLDA 1SW8A 3FE9A 2LE9B 2E30A 2M0RA 5AANA 1PALA 3D0YB 1XYDA 3GK2A 3SS3A 2Q4UA 1TUJA 1ORGA 2KAYA 2LVVA 3CS1A 2JXCA 3EG5B 3QMEA 4PHNA 4E68A 2GV5A 5G08A 1S5GZ 3JVTC 1DJGA 1DJHA 3LLEA 1Y0VH 2JQ6A 4PE4A 3O4XA 3TDUA 2MHHA 1CFCA 5HKWA 2CBLA 4GPLB 5KTYA 2L4IA 3GOFA 3IQQA 4OR9B 3FIAA 1CFFA 4USLA 4ICBA 2OTGB 3CR2A 1AK8A 4GBAA 1KWOB 3OB1B 3SG3A 3WHTB 3S0GA 2CT9A 1XK4C 4BY5A 1SSEB 3RZSA 4XJKA 1SKTA 2IS9A 1OOHA 5AXIA 1PK0D 1EJ3A 1DQEA 3WNXB 5FI7A 1GM0A 1AVSA 3SG5A 1M63B 2MLFC 5I8NA 2KFHA 4MZLA 3K1EA 2KBIA 1JFKA 3CABA 1B47A 1KSMA 2LNKA 1TNPA 4U8DA 1IJ5A 4MEWA 3F45A 2A4JA 1C7VA 1OZOA 1NCXA 3DYEA 5HLOA 1BF5A 4NDDA 3S0AA 1Q80A 4QJ3B 4PE1A 2ZRSA 1IQ5A 2GTEA 3B86A 1KK8B 1QLSA 1MF8B 2F3YA 2L51A 1BODA 3DD4A 1DJWA 1S6CA 2K2FA 4OVNF 2JTZA 1JWDA 1IWQA 4P2YB 2LMVA 3PJIA 4DS7A 1CLMA 3NSLA 2MJWB 1J55A 4MRXA 2KAVA 2OPOA 2MRDA 4MSPA 4I5LB 5DKRA 2ZN9A 4ORBB 1UUSA 1XFRA 3I5HB 3MSEB 1ZACA 1J7OA 1DTLA 1S36A 1TUZA 3LK1A 1IH0A 1UWOA 1NP8A 1OW4A 3BFAA 2ZKMX 2KBMA 3VB1A 2P71A 1NX2A 4PCWA 4FQTA 1JUOA 4ZCUA 2CXJA 2SCPA 3SIAA 4YGCB 3KEVA 2LLSA 4GGFC 1MR8A 2BE4A 2COLB 5DKQA 3EK4A 4I5NB 3NSOA 4GUKA 4ORCB 3NHTA 3WXAA 2HPSA 1E8AA 3GK4X 1DEKA 1ZMZA 4IL1A 1EG3A 1IGVA 2JNFA 1IKUA 1DJIA 2OTGC 1K9PA 3NSKA 3EVVA 1KWOC 2KQYA 1A29A 3WHUB 3FE8A 5CPVA 1SK6D 1KFXS 1MUXA 3CR5X 3D76A 3I5IB 4PHJA 1JFJA 2BBNA 1C3ZA 3BJHA 1J1DA 3BXKA 3O2PA 4MBEA 5AERA 1YUUA 1M46A 3OX5A 3R72A 4MZJA 3FS7A 1OE9B 2PASA 5HKZA 1F4QA 1TNWA 1EL4A 4OKHA 5HL1A 2KI6D 2G9BA 1KQVA 3LL8B 4P5OE 5HYDA 1OMDA 1QWVA 3PFVA 2L98A 2QEOA 1NSHA 5I2LA 2F2OA 3SS5A 2KYCA 1B7TY 1YR5A 3EK7A 3O4YA 1TWOA 2QACA 5FYXA 3L4LA 1SNLA 1FW4A 1KK8C 5JJGA 2QEHA 1MXEA 1NX3A 1BU3A 1XFYO 4GGNA 2MBXA 2H2KA 4AQJA 2LMTA 4OCIA 2ZNEA 2D8NA 1Z2CB 2QPTA 3AAJA 1SL8A 4TNCA 3SJSA 3ZNIA 2M1UA 2KHNA 3D77A 3KO0A 3ICBA 1JBAA 1WLMA 3VGOA 3I5HC 4C0KA 2G2BA 1TCOB 2P70A 3CZ2A 4I5KA 5HKYA 1R6PA 4C0LA 1LA3A 2WCHA 3CYZA 2M29A 1H8BA 2YGUA 5F6TA 2L2EA 1NX1A 1B4CA 1RK9A 2KQ6A 1QX7A 1R2UA 3BUXB 1XFUO 1IRJA 2K61A 3KPXA 2FCEA 1UHIA 2I7AA 3M0WA 2K7DA 1AJ5A 1MQ1A 3OGNA 1D1OA 1KFXL 1XFWO 5AEQA 2LM5A 5D69A 4PE7A 4YBHB 1T14A 2KNEA 5J3XA 3R1VA 2JC2A 5I2OA 1OZSA 2HF5A 2PRUA 2WCBA 1CM1A 1CDMA 3I5IC 1QV0A 1CDPA 2ZNDA 1NYAA 2TN4A 4JQ0D 2JPTA 1WRZA 4N1GA 3NXAA 3VRPA 3CGAA 1WRKA 2M49B 3BUOB 4MVFA 1CFPA 2GGMA 1S6JA 3V2LA 2EHBA 1N2DA 2JU0A 3S0EA 3JTDB 1BR1B 3BYAA 2ZN8A 1YUSA 1RJVA 1K2HA 3FWBA 5D3OA 3O6BA 3S0DA 3IVTA 3DVJA 2Q91A 5K89A 2MLEC 1M39A 1V1FA 2BCXA 2K2AA 5I94A 3CTNA 2LAPA 5TNCA 1B8LA 2BAPA 2HETA 3BUNB 1RFJA 1BG1A 1S26D 1UHHA 1V1GA 2JT3A 3UNWA 4DUQA 3SG6A 4INWA 2E6WA 2KI4B 4XJKB 1H4BA 2KYFA 1K93D 3A8RA 2LUCA 3E3RA 4HRHA 1NUBA 2F3ZA 1YVLA 1SMGA 1KK7Y 1DJXA 2BKIB 2ERBA 1MWNA 1RTP1 1NX0A 1TRFA 2WC5A 1VRKA 2MA2A 3IQOA 4QJ4B 3CDNA 2KSPA 1IQ3A 1L2OB 1S3PA 1FI6A 3NHIA 2LV7A 1F8HA 1IG5A 2OS8B 1CTRA 1XO5A 1X02A 4GFTA 2I94A 1EH2A 1YRUB 5JOLA 1QV1A 1ZFSA 4GNKB 1B8CA 1PVAA 1SRAA 1HT9A 1TNQA 4I5JA 3BUWB 2BL0B 4HRGA 4PE0A 2L2CA 1RROA 4AOMA 1SL7A 1QX5B 1A4PA 2WOSA 4A4CA 4DIRA 3BQ3A 2LCPA 1GJYA 1GGWA 3KF9A 1N65A 4R1EA 1TTXA 5BPJA 2H8VA 1S1EA 1CMFA 2JXLA 3OB2B 2L5XB 2LANA 4NQGA 1QASA 5CSIA 2WCKA 3RLZA 3L4AA 4JWQA 4F0ZB 3FWCA 3D78A 4WQ2A 3JTDC 3VRNA 1PSBA 3VROA 3VRRA 5PALA 4NDBA 2K7CA 2BBMA 1N0YA 3DF0A 1QIVA 1CB1A 3S0BA 4GAOA 1BOCA 5KU1A 1W7JB 1HQVA 1K9UA 3FE6A 3PALA 1CMGA 1K96A 1K95A 4QJ5B 3DVEA 1PVBA 5DKNA 4IJ7A 1MXLC 1TNXA 3AKBA 4AQIA 3Q8IA 1FI5A 5DICA 4HSZA 5HLVA 2CCMA 2KI4C 1BR4B 1OOJA 1TOPA 2EC6B 3GK1A 1CM4A 2WC8A 3I5GB 2KGRA 1KSOA 2BE6A 2KI6C 2NCPA 2NXQA 3A4UB 1LKJA 2QEBA 4MLWA 1XK4A 1Z4HA 2LLTA 1B9AA 1ALVA 3OHMB 1LS8A 3D74A 3EVUA 2PMYA 4YI8A 2WCFA 1W9ZA 1L2OC 2LP2A 3NGVA 3NSIA 4INXA 5ER5A 1JSAA 1DJYA 3EK8A 2L50A 1BJFA 1OOFA 2OS8C 4F7FA 5CSNA 1KCYA 1DGVA 1XVJA 1Y1UA 3D10A 3CZ1A 2I2RE 2M9GA 1UHKA 4CFRA 5EL2A 2BL0C 1BMOA 1DJZA 3K21A 2M7NA 1YRTB 1KFUS 2I18A 2ISDA 2L4HA 2QEVA 4OZDA 1QJTA 2KFFA 1SL9A 1F55A 5CSFA 3C1VA 1GQMA 3TDIA 3D75A 2EGDA 2LUXA 1SBJA 4PHMA 1KK7Z 2GGZA 2K60A 3S0FA 1Y1XA 2VRGA 4WQ3A 1DVIA 3VRQA 2BCBA 1A75A 1NIWA 1KQMB 2K0JA 2NLNA 4YI9A 1DC1A 3UO9A 3I5FB 3BFHA 5AFPA 2PVBA 2JT8A 1OQPA 2AMIA 4PT1A 3O78A 1XFVO 1YUTA 2FJUB 1M45A 1JF2A 3D0YA 4FQOA 1K90D 1SR6C 4UPGA 1QVIY 1YURA 2L0PA 4DRWA 2P6BB 2WCJA 4CLNA 3PM2A 1Y6WA 5D7FA 2JULA 4MRYA 3R1PA 4GGFA 1XFXO 2LVKA 3EKHA 1BT6A 3B88A 3DVMA 1YX7A 3SIBA 1B1GA 4DCKA 1QXPA 2K7OA 2EC6C 1CFDA 1CNPA 1FPWA 4N1FA 3CZ0A 2MAZA 3I5GC 1NCYA 2FOTA 4JKTA 3OP0A 1K9KA 1C07A 1B8RA 2PSRA 1PULA 3DY9A 1DF0A 2ZFDA 1P28A 2LLUA 2WCLA 4PDZA 3CLNA 1A03A 1UHNA 1LINA 2O60A 2M7LA 3SG4A 2L5YA 3PSRA 1KFUL 2JTTA 3TZ1A 3EVRA 5B8IB 2R2IA 4HREE 2F8PA 4CIDA 2QDIA 1ZUZA 1DF0B 4M2QA 3TS5B 3B87A 2JWWA 3L47A 1A2XA 4ORAB 3SG2A 3CR4X 2JRFA 2HQWA 4YGAA 1WDCB 2LHLA 2M1KB 3DVKA 1CLBA 3H4SE 1B7TZ 1CDNA 5KSZA 3B7AA 3BUMB 1CKKA 2LHIA 1SCMB 2KLEA 1NCZA 4NDCA 2SASA 1IJ6A 1OOIX 1SY9A 1G33A 2F33A 3N7HA 4PHKA 1QS7A 3TUYB 1KQMC 1WRLA 1DELA 2JT0A 2V53A 2JOJA 4MZKA 3HX4A 3I5FC 3KHEA 5GQQC 1ZOTB 1AUIB 1J7PA 1BLQA 5FI6A 1LXFC 4XYNA 1S6IA 4M2PA 1OMVA 4YGBB 2KAXA 1JC2A 2PYQA 4JD9A 3IF7A 1DMOA 1S5GY 2JPOA 2BNXA 3OX6A 2PALA 1RECA 4PALA 1FF1A 2AUCA 2O5GA 3SS4A 1G4YR 1OSAA 1QIWA 1RWYA 2H61A 4N5XA 2JNXA 1SCVA 4ZCVA 1XFZO 1YVHA 2RGIA 3EKJA 2LVIA 2F2PA 4Q04A 2Y1NA 1SR6B 2WCMA 4L9MA 2Y5IA 4A4BA 4YGEB 2KOTA 2WC6A 1F4OA 2M97A 2M3WA 3RM1A 2Y1MA 3DZTA 3DF0B 3B6XA 3HCMA 5IBWA 2B1UA 3PN7B 3DXLA 2NZ0A 3QRXA 1JF0A 2Y4QA 1AP4A 1XA5A 2NCOA 1J7QA 5FI2A 3AKAA 3LCPC 1U5IA 4M2OA 1QVIZ 1C7WA 4ETOA 4YRUA 3JVTB 1F71A 1LVCD 3TS5C 4C0JA 1Y1AA 3PLFB 3SG7A 1UHJA 5I2QA 1WY9A 1WDCC 1IIOA 1K8UA 2KFGA 3PATA 2LC5A 1QATA 4KYNA 3CWGA 2KGBC 2CNPA 2DOQA 1SPYA 1K94A 3CZTX 2LVJA 1DT7B 1U5IB 4CFQA 2KDHA 1SCMC 1ODBA
chains in the Genus database with same CATH topology
3TDZA 4CPVA 1FBVA 1QLKA 2LMUA 3TUYC 5ER4X 2JZIA 1F54A 2HQ8A 1J7RA 4JPZB 4YGDB 1QTXA 1DGUA 1CLLA 1WLZA 2K7BA 4BY4A 1EG4A 1AJ4A 2CTNA 1CDLA 2M8UA 4WRIA 3AAKA 5CSJA 1QX2A 1EXRA 1TIZA 1GGZA 1AHRA 1YX8A 1M31A 1J1EA 2WCEA 1PRWA 1TN4A 1TCFA 1PSRA 1G8IA 1UURA 2WORA 3BOWA 3LK0A 2AAOA 1YTZC 2ZRTA 3ZWHA 4OV2A 1NWDA 1OMRA 4MN0A 1MHOA 1LA0A 2BKHB 1SYMA 2LP3A 2K8MB 2WNDA 2BECA 3PM8A 1L7ZA 2BCAA 1NPQA 4FTGA 1A75B 1ALWA 4D1EA 1F70A 1UP5A 2FCDA 1W7IB 2H61C 3BOWB 3PN7C 1SW8A 5AANA 2LE9B 2E30A 2M0RA 1PALA 3D0YB 1XYDA 3GK2A 2Q4UA 2KAYA 2LVVA 3CS1A 4E68A 2JXCA 4PHNA 2GV5A 5G08A 1S5GZ 3JVTC 1DJGA 1DJHA 3LLEA 1Y0VH 2JQ6A 4PE4A 3TDUA 2MHHA 1CFCA 5HKWA 2CBLA 4GPLB 5KTYA 2L4IA 3GOFA 3IQQA 4OR9B 3FIAA 1CFFA 4USLA 4ICBA 2OTGB 3CR2A 1AK8A 4GBAA 1KWOB 3OB1B 3SG3A 3WHTB 2CT9A 1XK4C 4BY5A 4XJKA 1SKTA 2IS9A 5AXIA 1EJ3A 1PK0D 3WNXB 1AVSA 3SG5A 1M63B 2MLFC 5I8NA 2KFHA 4MZLA 2KBIA 1JFKA 1B47A 1KSMA 2LNKA 1TNPA 4U8DA 1IJ5A 4MEWA 3F45A 2A4JA 1OZOA 1NCXA 5HLOA 1BF5A 4NDDA 1Q80A 4QJ3B 4PE1A 2ZRSA 1IQ5A 1KK8B 1QLSA 1MF8B 2F3YA 2L51A 1BODA 3DD4A 1DJWA 1S6CA 2K2FA 4OVNF 2JTZA 1JWDA 1IWQA 4P2YB 2LMVA 4DS7A 1CLMA 3NSLA 2MJWB 1J55A 4MRXA 2KAVA 2OPOA 2MRDA 4MSPA 4I5LB 5DKRA 2ZN9A 4ORBB 1UUSA 3I5HB 3MSEB 1ZACA 1J7OA 1DTLA 1S36A 3LK1A 1IH0A 1UWOA 1NP8A 2ZKMX 2KBMA 4PCWA 1NX2A 1JUOA 4ZCUA 2CXJA 2SCPA 3SIAA 4YGCB 3KEVA 2LLSA 4GGFC 1MR8A 2BE4A 2COLB 5DKQA 3EK4A 4I5NB 3NSOA 4GUKA 4ORCB 3WXAA 1C7VA 2HPSA 1E8AA 3GK4X 1ZMZA 4IL1A 1EG3A 1IGVA 2JNFA 1IKUA 1DJIA 2OTGC 1K9PA 3NSKA 3EVVA 1KWOC 2KQYA 1A29A 3WHUB 5CPVA 1SK6D 1KFXS 1MUXA 3CR5X 4PHJA 3I5IB 1JFJA 2BBNA 5AERA 1J1DA 3BXKA 3O2PA 4MBEA 1YUUA 1M46A 3OX5A 4MZJA 3FS7A 1OE9B 2PASA 5HKZA 1F4QA 1TNWA 1EL4A 4OKHA 2KI6D 2G9BA 1KQVA 3LL8B 4P5OE 5HYDA 1OMDA 3PFVA 2L98A 1NSHA 5I2LA 2F2OA 2KYCA 1B7TY 1YR5A 3EK7A 3O4YA 2QACA 5FYXA 1SNLA 1FW4A 1KK8C 5JJGA 1MXEA 1NX3A 1BU3A 1XFYO 4GGNA 2MBXA 2H2KA 4AQJA 2LMTA 4OCIA 2ZNEA 2D8NA 2QPTA 3AAJA 4TNCA 1SL8A 3SJSA 3ZNIA 2M1UA 2KHNA 3KO0A 3ICBA 1JBAA 1WLMA 3VGOA 3I5HC 4C0KA 2G2BA 1TCOB 4I5KA 5HKYA 1R6PA 4C0LA 1LA3A 2M29A 1H8BA 5F6TA 2L2EA 1NX1A 1B4CA 1RK9A 2KQ6A 1QX7A 1R2UA 3BUXB 1XFUO 1IRJA 2K61A 3KPXA 2FCEA 1UHIA 2I7AA 3M0WA 2K7DA 1AJ5A 1MQ1A 1D1OA 1KFXL 1XFWO 5AEQA 2LM5A 5D69A 4PE7A 4YBHB 2KNEA 5J3XA 2JC2A 5I2OA 1OZSA 2HF5A 2PRUA 2WCBA 1CM1A 1CDMA 3I5IC 1QV0A 1CDPA 2ZNDA 1NYAA 2TN4A 4JQ0D 2JPTA 1WRZA 4N1GA 3NXAA 3VRPA 3CGAA 1WRKA 2M49B 3BUOB 4MVFA 1CFPA 2GGMA 1S6JA 2EHBA 1N2DA 2JU0A 3JTDB 1BR1B 3BYAA 2ZN8A 1YUSA 1RJVA 1K2HA 3FWBA 3O6BA 3DVJA 2Q91A 5K89A 2MLEC 1M39A 1V1FA 2BCXA 2K2AA 3CTNA 2LAPA 5TNCA 1B8LA 2HETA 3BUNB 1RFJA 1BG1A 1S26D 1UHHA 1V1GA 2JT3A 4DUQA 3SG6A 2E6WA 2KI4B 4XJKB 1H4BA 2KYFA 1K93D 3A8RA 2LUCA 3E3RA 4HRHA 1NUBA 2F3ZA 1YVLA 1SMGA 1KK7Y 1DJXA 2BKIB 1MWNA 1RTP1 1NX0A 1TRFA 4QJ4B 1VRKA 2MA2A 3IQOA 2KSPA 1IQ3A 1L2OB 1S3PA 1FI6A 2LV7A 1F8HA 1IG5A 2OS8B 1CTRA 1XO5A 1X02A 4GFTA 2I94A 1EH2A 1YRUB 5JOLA 1QV1A 1ZFSA 4GNKB 1B8CA 1PVAA 1SRAA 1HT9A 1TNQA 4I5JA 3BUWB 2BL0B 4HRGA 4PE0A 1RROA 4AOMA 1SL7A 1QX5B 1A4PA 2WOSA 4A4CA 4DIRA 3BQ3A 2LCPA 1GJYA 1GGWA 3KF9A 1N65A 4R1EA 1TTXA 5BPJA 1S1EA 1CMFA 2JXLA 3OB2B 2L5XB 2LANA 4NQGA 1QASA 5CSIA 3RLZA 4JWQA 4F0ZB 3FWCA 4WQ2A 3VRNA 3JTDC 1PSBA 3VROA 3VRRA 5PALA 4NDBA 2K7CA 2BBMA 1N0YA 3DF0A 1QIVA 1CB1A 4GAOA 1BOCA 5KU1A 1W7JB 1HQVA 1K9UA 3PALA 1CMGA 1K96A 1K95A 4QJ5B 3DVEA 1PVBA 5DKNA 1MXLC 1TNXA 3AKBA 4AQIA 1FI5A 4HSZA 5HLVA 2CCMA 2KI4C 1BR4B 1OOJA 1TOPA 2EC6B 3GK1A 1CM4A 2WC8A 3I5GB 2KGRA 1KSOA 2BE6A 2KI6C 2NCPA 2NXQA 3A4UB 1LKJA 4MLWA 1XK4A 2LLTA 1B9AA 1ALVA 3OHMB 3EVUA 2PMYA 4YI8A 2WCFA 1L2OC 2LP2A 3NSIA 1JSAA 5ER5A 1DJYA 3EK8A 2L50A 1BJFA 2OS8C 5CSNA 1KCYA 1DGVA 1XVJA 1Y1UA 3D10A 2I2RE 2M9GA 1UHKA 4CFRA 2BL0C 1BMOA 1DJZA 3K21A 2M7NA 1YRTB 1KFUS 2I18A 2ISDA 2L4HA 1QJTA 2KFFA 1SL9A 1F55A 5CSFA 3C1VA 1GQMA 3TDIA 2EGDA 2LUXA 1SBJA 4PHMA 1KK7Z 2GGZA 1Y1XA 2VRGA 4WQ3A 1DVIA 3VRQA 2BCBA 1A75A 1NIWA 1KQMB 2K0JA 2NLNA 4YI9A 3I5FB 5AFPA 2PVBA 2JT8A 1OQPA 2AMIA 3O78A 1XFVO 1YUTA 2FJUB 1M45A 1JF2A 3D0YA 4FQOA 1K90D 1SR6C 1QVIY 1YURA 2L0PA 4DRWA 2P6BB 4CLNA 1Y6WA 5D7FA 2JULA 4MRYA 4GGFA 1XFXO 2LVKA 3EKHA 1BT6A 3DVMA 1YX7A 3SIBA 1B1GA 4DCKA 1QXPA 2K7OA 2EC6C 1CFDA 1CNPA 1FPWA 4N1FA 2MAZA 3I5GC 1NCYA 2FOTA 3OP0A 1K9KA 1C07A 1B8RA 2PSRA 1PULA 1DF0A 2ZFDA 2LLUA 4PDZA 3CLNA 1A03A 1UHNA 1LINA 2O60A 2M7LA 3SG4A 3PSRA 1KFUL 2JTTA 3TZ1A 3EVRA 5B8IB 2R2IA 4HREE 2F8PA 4CIDA 1ZUZA 1DF0B 4M2QA 3TS5B 4ORAB 2JWWA 3SG2A 1A2XA 3CR4X 2JRFA 2HQWA 4YGAA 1WDCB 2LHLA 2M1KB 3DVKA 1CLBA 3H4SE 1B7TZ 1CDNA 5KSZA 3BUMB 1CKKA 2LHIA 1SCMB 4NDCA 1NCZA 2SASA 1IJ6A 4PHKA 1SY9A 1G33A 2F33A 1QS7A 3TUYB 1KQMC 1WRLA 2JT0A 2V53A 5GQQC 2JOJA 4MZKA 3HX4A 3I5FC 3KHEA 4UPGA 1ZOTB 1AUIB 1J7PA 1BLQA 1LXFC 4XYNA 1S6IA 4M2PA 1OMVA 4YGBB 2KAXA 1JC2A 3IF7A 1DMOA 1S5GY 3OX6A 2PALA 1RECA 4PALA 1FF1A 2AUCA 2O5GA 1G4YR 1OSAA 1QIWA 1RWYA 2H61A 4N5XA 2JNXA 1SCVA 4ZCVA 1XFZO 1YVHA 2RGIA 3EKJA 2LVIA 2F2PA 4Q04A 2Y1NA 1SR6B 4L9MA 2Y5IA 4A4BA 4YGEB 2KOTA 1F4OA 2M97A 2M3WA 3RM1A 2Y1MA 3DF0B 3HCMA 5IBWA 2B1UA 3PN7B 2NZ0A 3QRXA 1JF0A 2Y4QA 1AP4A 1XA5A 2NCOA 1J7QA 3AKAA 3LCPC 1U5IA 4M2OA 1QVIZ 1C7WA 4ETOA 4YRUA 3JVTB 1F71A 1LVCD 3TS5C 4C0JA 1Y1AA 3PLFB 3SG7A 1UHJA 5I2QA 1WY9A 1WDCC 1K8UA 2KFGA 3PATA 2LC5A 1QATA 3CWGA 2KGBC 2CNPA 2DOQA 1SPYA 1K94A 3CZTX 2LVJA 1DT7B 1U5IB 4CFQA 2KDHA 1SCMC 1ODBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TDZ A;  4CPV A;  1FBV A;  1QLK A;  2LMU A;  3TUY C;  5ER4 X;  2JZI A;  1F54 A;  2HQ8 A;  1J7R A;  4JPZ B;  4YGD B;  1QTX A;  1DGU A;  1CLL A;  1WLZ A;  2K7B A;  4BY4 A;  1EG4 A;  1AJ4 A;  2CTN A;  1CDL A;  2M8U A;  4WRI A;  3AAK A;  5CSJ A;  1QX2 A;  1EXR A;  1TIZ A;  1GGZ A;  1AHR A;  1YX8 A;  1M31 A;  1J1E A;  2WCE A;  1PRW A;  1TN4 A;  1TCF A;  1PSR A;  1G8I A;  1UUR A;  2WOR A;  3BOW A;  3LK0 A;  2AAO A;  1YTZ C;  2ZRT A;  3ZWH A;  4OV2 A;  1NWD A;  1OMR A;  4MN0 A;  1MHO A;  1LA0 A;  2BKH B;  1SYM A;  2LP3 A;  2K8M B;  2WND A;  2BEC A;  3PM8 A;  1L7Z A;  2BCA A;  1NPQ A;  4FTG A;  1A75 B;  1ALW A;  4D1E A;  1F70 A;  1UP5 A;  2FCD A;  1W7I B;  2H61 C;  3BOW B;  3PN7 C;  1SW8 A;  5AAN A;  2LE9 B;  2E30 A;  2M0R A;  1PAL A;  3D0Y B;  1XYD A;  3GK2 A;  2Q4U A;  2KAY A;  2LVV A;  3CS1 A;  4E68 A;  2JXC A;  4PHN A;  2GV5 A;  5G08 A;  1S5G Z;  3JVT C;  1DJG A;  1DJH A;  3LLE A;  1Y0V H;  2JQ6 A;  4PE4 A;  3TDU A;  2MHH A;  1CFC A;  5HKW A;  2CBL A;  4GPL B;  5KTY A;  2L4I A;  3GOF A;  3IQQ A;  4OR9 B;  3FIA A;  1CFF A;  4USL A;  4ICB A;  2OTG B;  3CR2 A;  1AK8 A;  4GBA A;  1KWO B;  3OB1 B;  3SG3 A;  3WHT B;  2CT9 A;  1XK4 C;  4BY5 A;  4XJK A;  1SKT A;  2IS9 A;  5AXI A;  1EJ3 A;  1PK0 D;  3WNX B;  1AVS A;  3SG5 A;  1M63 B;  2MLF C;  5I8N A;  2KFH A;  4MZL A;  2KBI A;  1JFK A;  1B47 A;  1KSM A;  2LNK A;  1TNP A;  4U8D A;  1IJ5 A;  4MEW A;  3F45 A;  2A4J A;  1OZO A;  1NCX A;  5HLO A;  1BF5 A;  4NDD A;  1Q80 A;  4QJ3 B;  4PE1 A;  2ZRS A;  1IQ5 A;  1KK8 B;  1QLS A;  1MF8 B;  2F3Y A;  2L51 A;  1BOD A;  3DD4 A;  1DJW A;  1S6C A;  2K2F A;  4OVN F;  2JTZ A;  1JWD A;  1IWQ A;  4P2Y B;  2LMV A;  4DS7 A;  1CLM A;  3NSL A;  2MJW B;  1J55 A;  4MRX A;  2KAV A;  2OPO A;  2MRD A;  4MSP A;  4I5L B;  5DKR A;  2ZN9 A;  4ORB B;  1UUS A;  3I5H B;  3MSE B;  1ZAC A;  1J7O A;  1DTL A;  1S36 A;  3LK1 A;  1IH0 A;  1UWO A;  1NP8 A;  2ZKM X;  2KBM A;  4PCW A;  1NX2 A;  1JUO A;  4ZCU A;  2CXJ A;  2SCP A;  3SIA A;  4YGC B;  3KEV A;  2LLS A;  4GGF C;  1MR8 A;  2BE4 A;  2COL B;  5DKQ A;  3EK4 A;  4I5N B;  3NSO A;  4GUK A;  4ORC B;  3WXA A;  1C7V A;  2HPS A;  1E8A A;  3GK4 X;  1ZMZ A;  4IL1 A;  1EG3 A;  1IGV A;  2JNF A;  1IKU A;  1DJI A;  2OTG C;  1K9P A;  3NSK A;  3EVV A;  1KWO C;  2KQY A;  1A29 A;  3WHU B;  5CPV A;  1SK6 D;  1KFX S;  1MUX A;  3CR5 X;  4PHJ A;  3I5I B;  1JFJ A;  2BBN A;  5AER A;  1J1D A;  3BXK A;  3O2P A;  4MBE A;  1YUU A;  1M46 A;  3OX5 A;  4MZJ A;  3FS7 A;  1OE9 B;  2PAS A;  5HKZ A;  1F4Q A;  1TNW A;  1EL4 A;  4OKH A;  2KI6 D;  2G9B A;  1KQV A;  3LL8 B;  4P5O E;  5HYD A;  1OMD A;  3PFV A;  2L98 A;  1NSH A;  5I2L A;  2F2O A;  2KYC A;  1B7T Y;  1YR5 A;  3EK7 A;  3O4Y A;  2QAC A;  5FYX A;  1SNL A;  1FW4 A;  1KK8 C;  5JJG A;  1MXE A;  1NX3 A;  1BU3 A;  1XFY O;  4GGN A;  2MBX A;  2H2K A;  4AQJ A;  2LMT A;  4OCI A;  2ZNE A;  2D8N A;  2QPT A;  3AAJ A;  4TNC A;  1SL8 A;  3SJS A;  3ZNI A;  2M1U A;  2KHN A;  3KO0 A;  3ICB A;  1JBA A;  1WLM A;  3VGO A;  3I5H C;  4C0K A;  2G2B A;  1TCO B;  4I5K A;  5HKY A;  1R6P A;  4C0L A;  1LA3 A;  2M29 A;  1H8B A;  5F6T A;  2L2E A;  1NX1 A;  1B4C A;  1RK9 A;  2KQ6 A;  1QX7 A;  1R2U A;  3BUX B;  1XFU O;  1IRJ A;  2K61 A;  3KPX A;  2FCE A;  1UHI A;  2I7A A;  3M0W A;  2K7D A;  1AJ5 A;  1MQ1 A;  1D1O A;  1KFX L;  1XFW O;  5AEQ A;  2LM5 A;  5D69 A;  4PE7 A;  4YBH B;  2KNE A;  5J3X A;  2JC2 A;  5I2O A;  1OZS A;  2HF5 A;  2PRU A;  2WCB A;  1CM1 A;  1CDM A;  3I5I C;  1QV0 A;  1CDP A;  2ZND A;  1NYA A;  2TN4 A;  4JQ0 D;  2JPT A;  1WRZ A;  4N1G A;  3NXA A;  3VRP A;  3CGA A;  1WRK A;  2M49 B;  3BUO B;  4MVF A;  1CFP A;  2GGM A;  1S6J A;  2EHB A;  1N2D A;  2JU0 A;  3JTD B;  1BR1 B;  3BYA A;  2ZN8 A;  1YUS A;  1RJV A;  1K2H A;  3FWB A;  3O6B A;  3DVJ A;  2Q91 A;  5K89 A;  2MLE C;  1M39 A;  1V1F A;  2BCX A;  2K2A A;  3CTN A;  2LAP A;  5TNC A;  1B8L A;  2HET A;  3BUN B;  1RFJ A;  1BG1 A;  1S26 D;  1UHH A;  1V1G A;  2JT3 A;  4DUQ A;  3SG6 A;  2E6W A;  2KI4 B;  4XJK B;  1H4B A;  2KYF A;  1K93 D;  3A8R A;  2LUC A;  3E3R A;  4HRH A;  1NUB A;  2F3Z A;  1YVL A;  1SMG A;  1KK7 Y;  1DJX A;  2BKI B;  1MWN A;  1RTP 1;  1NX0 A;  1TRF A;  4QJ4 B;  1VRK A;  2MA2 A;  3IQO A;  2KSP A;  1IQ3 A;  1L2O B;  1S3P A;  1FI6 A;  2LV7 A;  1F8H A;  1IG5 A;  2OS8 B;  1CTR A;  1XO5 A;  1X02 A;  4GFT A;  2I94 A;  1EH2 A;  1YRU B;  5JOL A;  1QV1 A;  1ZFS A;  4GNK B;  1B8C A;  1PVA A;  1SRA A;  1HT9 A;  1TNQ A;  4I5J A;  3BUW B;  2BL0 B;  4HRG A;  4PE0 A;  1RRO A;  4AOM A;  1SL7 A;  1QX5 B;  1A4P A;  2WOS A;  4A4C A;  4DIR A;  3BQ3 A;  2LCP A;  1GJY A;  1GGW A;  3KF9 A;  1N65 A;  4R1E A;  1TTX A;  5BPJ A;  1S1E A;  1CMF A;  2JXL A;  3OB2 B;  2L5X B;  2LAN A;  4NQG A;  1QAS A;  5CSI A;  3RLZ A;  4JWQ A;  4F0Z B;  3FWC A;  4WQ2 A;  3VRN A;  3JTD C;  1PSB A;  3VRO A;  3VRR A;  5PAL A;  4NDB A;  2K7C A;  2BBM A;  1N0Y A;  3DF0 A;  1QIV A;  1CB1 A;  4GAO A;  1BOC A;  5KU1 A;  1W7J B;  1HQV A;  1K9U A;  3PAL A;  1CMG A;  1K96 A;  1K95 A;  4QJ5 B;  3DVE A;  1PVB A;  5DKN A;  1MXL C;  1TNX A;  3AKB A;  4AQI A;  1FI5 A;  4HSZ A;  5HLV A;  2CCM A;  2KI4 C;  1BR4 B;  1OOJ A;  1TOP A;  2EC6 B;  3GK1 A;  1CM4 A;  2WC8 A;  3I5G B;  2KGR A;  1KSO A;  2BE6 A;  2KI6 C;  2NCP A;  2NXQ A;  3A4U B;  1LKJ A;  4MLW A;  1XK4 A;  2LLT A;  1B9A A;  1ALV A;  3OHM B;  3EVU A;  2PMY A;  4YI8 A;  2WCF A;  1L2O C;  2LP2 A;  3NSI A;  1JSA A;  5ER5 A;  1DJY A;  3EK8 A;  2L50 A;  1BJF A;  2OS8 C;  5CSN A;  1KCY A;  1DGV A;  1XVJ A;  1Y1U A;  3D10 A;  2I2R E;  2M9G A;  1UHK A;  4CFR A;  2BL0 C;  1BMO A;  1DJZ A;  3K21 A;  2M7N A;  1YRT B;  1KFU S;  2I18 A;  2ISD A;  2L4H A;  1QJT A;  2KFF A;  1SL9 A;  1F55 A;  5CSF A;  3C1V A;  1GQM A;  3TDI A;  2EGD A;  2LUX A;  1SBJ A;  4PHM A;  1KK7 Z;  2GGZ A;  1Y1X A;  2VRG A;  4WQ3 A;  1DVI A;  3VRQ A;  2BCB A;  1A75 A;  1NIW A;  1KQM B;  2K0J A;  2NLN A;  4YI9 A;  3I5F B;  5AFP A;  2PVB A;  2JT8 A;  1OQP A;  2AMI A;  3O78 A;  1XFV O;  1YUT A;  2FJU B;  1M45 A;  1JF2 A;  3D0Y A;  4FQO A;  1K90 D;  1SR6 C;  1QVI Y;  1YUR A;  2L0P A;  4DRW A;  2P6B B;  4CLN A;  1Y6W A;  5D7F A;  2JUL A;  4MRY A;  4GGF A;  1XFX O;  2LVK A;  3EKH A;  1BT6 A;  3DVM A;  1YX7 A;  3SIB A;  1B1G A;  4DCK A;  1QXP A;  2K7O A;  2EC6 C;  1CFD A;  1CNP A;  1FPW A;  4N1F A;  2MAZ A;  3I5G C;  1NCY A;  2FOT A;  3OP0 A;  1K9K A;  1C07 A;  1B8R A;  2PSR A;  1PUL A;  1DF0 A;  2ZFD A;  2LLU A;  4PDZ A;  3CLN A;  1A03 A;  1UHN A;  1LIN A;  2O60 A;  2M7L A;  3SG4 A;  3PSR A;  1KFU L;  2JTT A;  3TZ1 A;  3EVR A;  5B8I B;  2R2I A;  4HRE E;  2F8P A;  4CID A;  1ZUZ A;  1DF0 B;  4M2Q A;  3TS5 B;  4ORA B;  2JWW A;  3SG2 A;  1A2X A;  3CR4 X;  2JRF A;  2HQW A;  4YGA A;  1WDC B;  2LHL A;  2M1K B;  3DVK A;  1CLB A;  3H4S E;  1B7T Z;  1CDN A;  5KSZ A;  3BUM B;  1CKK A;  2LHI A;  1SCM B;  4NDC A;  1NCZ A;  2SAS A;  1IJ6 A;  4PHK A;  1SY9 A;  1G33 A;  2F33 A;  1QS7 A;  3TUY B;  1KQM C;  1WRL A;  2JT0 A;  2V53 A;  5GQQ C;  2JOJ A;  4MZK A;  3HX4 A;  3I5F C;  3KHE A;  4UPG A;  1ZOT B;  1AUI B;  1J7P A;  1BLQ A;  1LXF C;  4XYN A;  1S6I A;  4M2P A;  1OMV A;  4YGB B;  2KAX A;  1JC2 A;  3IF7 A;  1DMO A;  1S5G Y;  3OX6 A;  2PAL A;  1REC A;  4PAL A;  1FF1 A;  2AUC A;  2O5G A;  1G4Y R;  1OSA A;  1QIW A;  1RWY A;  2H61 A;  4N5X A;  2JNX A;  1SCV A;  4ZCV A;  1XFZ O;  1YVH A;  2RGI A;  3EKJ A;  2LVI A;  2F2P A;  4Q04 A;  2Y1N A;  1SR6 B;  4L9M A;  2Y5I A;  4A4B A;  4YGE B;  2KOT A;  1F4O A;  2M97 A;  2M3W A;  3RM1 A;  2Y1M A;  3DF0 B;  3HCM A;  5IBW A;  2B1U A;  3PN7 B;  2NZ0 A;  3QRX A;  1JF0 A;  2Y4Q A;  1AP4 A;  1XA5 A;  2NCO A;  1J7Q A;  3AKA A;  3LCP C;  1U5I A;  4M2O A;  1QVI Z;  1C7W A;  4ETO A;  4YRU A;  3JVT B;  1F71 A;  1LVC D;  3TS5 C;  4C0J A;  1Y1A A;  3PLF B;  3SG7 A;  1UHJ A;  5I2Q A;  1WY9 A;  1WDC C;  1K8U A;  2KFG A;  3PAT A;  2LC5 A;  1QAT A;  3CWG A;  2KGB C;  2CNP A;  2DOQ A;  1SPY A;  1K94 A;  3CZT X;  2LVJ A;  1DT7 B;  1U5I B;  4CFQ A;  2KDH A;  1SCM C;  1ODB A; 
#chains in the Genus database with same CATH topology
 2PQL A;  3TDZ A;  4CPV A;  1FBV A;  1QLK A;  2LMU A;  2KPH A;  3TUY C;  5ER4 X;  2JZI A;  1F54 A;  2HQ8 A;  1J7R A;  4JPZ B;  1C3Y A;  4YGD B;  1QTX A;  1DGU A;  1CLL A;  1WLZ A;  2K7B A;  4BY4 A;  1EG4 A;  3D73 A;  1AJ4 A;  2CTN A;  1CDL A;  2M8U A;  4WRI A;  1OOG A;  3AAK A;  5CSJ A;  1QX2 A;  1EXR A;  1TIZ A;  1GGZ A;  1AHR A;  1YX8 A;  1M31 A;  1J1E A;  3R1O A;  2WCE A;  1PRW A;  1TN4 A;  1TCF A;  1PSR A;  1G8I A;  1UUR A;  2WOR A;  3BOW A;  3LK0 A;  2FJY A;  2AAO A;  3BFB A;  1YTZ C;  2ZRT A;  3ZWH A;  4OV2 A;  1NWD A;  1OMR A;  4MN0 A;  1MHO A;  1LA0 A;  2BKH B;  1SYM A;  2LP3 A;  2K8M B;  2WND A;  2BEC A;  3PM8 A;  1L7Z A;  2BCA A;  1NPQ A;  4FTG A;  1A75 B;  1ALW A;  3OBV A;  4D1E A;  1F70 A;  1UP5 A;  2FCD A;  1W7I B;  2H61 C;  3BOW B;  3PN7 C;  2KLD A;  1SW8 A;  3FE9 A;  2LE9 B;  2E30 A;  2M0R A;  5AAN A;  1PAL A;  3D0Y B;  1XYD A;  3GK2 A;  3SS3 A;  2Q4U A;  1TUJ A;  1ORG A;  2KAY A;  2LVV A;  3CS1 A;  2JXC A;  3EG5 B;  3QME A;  4PHN A;  4E68 A;  2GV5 A;  5G08 A;  1S5G Z;  3JVT C;  1DJG A;  1DJH A;  3LLE A;  1Y0V H;  2JQ6 A;  4PE4 A;  3O4X A;  3TDU A;  2MHH A;  1CFC A;  5HKW A;  2CBL A;  4GPL B;  5KTY A;  2L4I A;  3GOF A;  3IQQ A;  4OR9 B;  3FIA A;  1CFF A;  4USL A;  4ICB A;  2OTG B;  3CR2 A;  1AK8 A;  4GBA A;  1KWO B;  3OB1 B;  3SG3 A;  3WHT B;  3S0G A;  2CT9 A;  1XK4 C;  4BY5 A;  1SSE B;  3RZS A;  4XJK A;  1SKT A;  2IS9 A;  1OOH A;  5AXI A;  1PK0 D;  1EJ3 A;  1DQE A;  3WNX B;  5FI7 A;  1GM0 A;  1AVS A;  3SG5 A;  1M63 B;  2MLF C;  5I8N A;  2KFH A;  4MZL A;  3K1E A;  2KBI A;  1JFK A;  3CAB A;  1B47 A;  1KSM A;  2LNK A;  1TNP A;  4U8D A;  1IJ5 A;  4MEW A;  3F45 A;  2A4J A;  1C7V A;  1OZO A;  1NCX A;  3DYE A;  5HLO A;  1BF5 A;  4NDD A;  3S0A A;  1Q80 A;  4QJ3 B;  4PE1 A;  2ZRS A;  1IQ5 A;  2GTE A;  3B86 A;  1KK8 B;  1QLS A;  1MF8 B;  2F3Y A;  2L51 A;  1BOD A;  3DD4 A;  1DJW A;  1S6C A;  2K2F A;  4OVN F;  2JTZ A;  1JWD A;  1IWQ A;  4P2Y B;  2LMV A;  3PJI A;  4DS7 A;  1CLM A;  3NSL A;  2MJW B;  1J55 A;  4MRX A;  2KAV A;  2OPO A;  2MRD A;  4MSP A;  4I5L B;  5DKR A;  2ZN9 A;  4ORB B;  1UUS A;  1XFR A;  3I5H B;  3MSE B;  1ZAC A;  1J7O A;  1DTL A;  1S36 A;  1TUZ A;  3LK1 A;  1IH0 A;  1UWO A;  1NP8 A;  1OW4 A;  3BFA A;  2ZKM X;  2KBM A;  3VB1 A;  2P71 A;  1NX2 A;  4PCW A;  4FQT A;  1JUO A;  4ZCU A;  2CXJ A;  2SCP A;  3SIA A;  4YGC B;  3KEV A;  2LLS A;  4GGF C;  1MR8 A;  2BE4 A;  2COL B;  5DKQ A;  3EK4 A;  4I5N B;  3NSO A;  4GUK A;  4ORC B;  3NHT A;  3WXA A;  2HPS A;  1E8A A;  3GK4 X;  1DEK A;  1ZMZ A;  4IL1 A;  1EG3 A;  1IGV A;  2JNF A;  1IKU A;  1DJI A;  2OTG C;  1K9P A;  3NSK A;  3EVV A;  1KWO C;  2KQY A;  1A29 A;  3WHU B;  3FE8 A;  5CPV A;  1SK6 D;  1KFX S;  1MUX A;  3CR5 X;  3D76 A;  3I5I B;  4PHJ A;  1JFJ A;  2BBN A;  1C3Z A;  3BJH A;  1J1D A;  3BXK A;  3O2P A;  4MBE A;  5AER A;  1YUU A;  1M46 A;  3OX5 A;  3R72 A;  4MZJ A;  3FS7 A;  1OE9 B;  2PAS A;  5HKZ A;  1F4Q A;  1TNW A;  1EL4 A;  4OKH A;  5HL1 A;  2KI6 D;  2G9B A;  1KQV A;  3LL8 B;  4P5O E;  5HYD A;  1OMD A;  1QWV A;  3PFV A;  2L98 A;  2QEO A;  1NSH A;  5I2L A;  2F2O A;  3SS5 A;  2KYC A;  1B7T Y;  1YR5 A;  3EK7 A;  3O4Y A;  1TWO A;  2QAC A;  5FYX A;  3L4L A;  1SNL A;  1FW4 A;  1KK8 C;  5JJG A;  2QEH A;  1MXE A;  1NX3 A;  1BU3 A;  1XFY O;  4GGN A;  2MBX A;  2H2K A;  4AQJ A;  2LMT A;  4OCI A;  2ZNE A;  2D8N A;  1Z2C B;  2QPT A;  3AAJ A;  1SL8 A;  4TNC A;  3SJS A;  3ZNI A;  2M1U A;  2KHN A;  3D77 A;  3KO0 A;  3ICB A;  1JBA A;  1WLM A;  3VGO A;  3I5H C;  4C0K A;  2G2B A;  1TCO B;  2P70 A;  3CZ2 A;  4I5K A;  5HKY A;  1R6P A;  4C0L A;  1LA3 A;  2WCH A;  3CYZ A;  2M29 A;  1H8B A;  2YGU A;  5F6T A;  2L2E A;  1NX1 A;  1B4C A;  1RK9 A;  2KQ6 A;  1QX7 A;  1R2U A;  3BUX B;  1XFU O;  1IRJ A;  2K61 A;  3KPX A;  2FCE A;  1UHI A;  2I7A A;  3M0W A;  2K7D A;  1AJ5 A;  1MQ1 A;  3OGN A;  1D1O A;  1KFX L;  1XFW O;  5AEQ A;  2LM5 A;  5D69 A;  4PE7 A;  4YBH B;  1T14 A;  2KNE A;  5J3X A;  3R1V A;  2JC2 A;  5I2O A;  1OZS A;  2HF5 A;  2PRU A;  2WCB A;  1CM1 A;  1CDM A;  3I5I C;  1QV0 A;  1CDP A;  2ZND A;  1NYA A;  2TN4 A;  4JQ0 D;  2JPT A;  1WRZ A;  4N1G A;  3NXA A;  3VRP A;  3CGA A;  1WRK A;  2M49 B;  3BUO B;  4MVF A;  1CFP A;  2GGM A;  1S6J A;  3V2L A;  2EHB A;  1N2D A;  2JU0 A;  3S0E A;  3JTD B;  1BR1 B;  3BYA A;  2ZN8 A;  1YUS A;  1RJV A;  1K2H A;  3FWB A;  5D3O A;  3O6B A;  3S0D A;  3IVT A;  3DVJ A;  2Q91 A;  5K89 A;  2MLE C;  1M39 A;  1V1F A;  2BCX A;  2K2A A;  5I94 A;  3CTN A;  2LAP A;  5TNC A;  1B8L A;  2BAP A;  2HET A;  3BUN B;  1RFJ A;  1BG1 A;  1S26 D;  1UHH A;  1V1G A;  2JT3 A;  3UNW A;  4DUQ A;  3SG6 A;  4INW A;  2E6W A;  2KI4 B;  4XJK B;  1H4B A;  2KYF A;  1K93 D;  3A8R A;  2LUC A;  3E3R A;  4HRH A;  1NUB A;  2F3Z A;  1YVL A;  1SMG A;  1KK7 Y;  1DJX A;  2BKI B;  2ERB A;  1MWN A;  1RTP 1;  1NX0 A;  1TRF A;  2WC5 A;  1VRK A;  2MA2 A;  3IQO A;  4QJ4 B;  3CDN A;  2KSP A;  1IQ3 A;  1L2O B;  1S3P A;  1FI6 A;  3NHI A;  2LV7 A;  1F8H A;  1IG5 A;  2OS8 B;  1CTR A;  1XO5 A;  1X02 A;  4GFT A;  2I94 A;  1EH2 A;  1YRU B;  5JOL A;  1QV1 A;  1ZFS A;  4GNK B;  1B8C A;  1PVA A;  1SRA A;  1HT9 A;  1TNQ A;  4I5J A;  3BUW B;  2BL0 B;  4HRG A;  4PE0 A;  2L2C A;  1RRO A;  4AOM A;  1SL7 A;  1QX5 B;  1A4P A;  2WOS A;  4A4C A;  4DIR A;  3BQ3 A;  2LCP A;  1GJY A;  1GGW A;  3KF9 A;  1N65 A;  4R1E A;  1TTX A;  5BPJ A;  2H8V A;  1S1E A;  1CMF A;  2JXL A;  3OB2 B;  2L5X B;  2LAN A;  4NQG A;  1QAS A;  5CSI A;  2WCK A;  3RLZ A;  3L4A A;  4JWQ A;  4F0Z B;  3FWC A;  3D78 A;  4WQ2 A;  3JTD C;  3VRN A;  1PSB A;  3VRO A;  3VRR A;  5PAL A;  4NDB A;  2K7C A;  2BBM A;  1N0Y A;  3DF0 A;  1QIV A;  1CB1 A;  3S0B A;  4GAO A;  1BOC A;  5KU1 A;  1W7J B;  1HQV A;  1K9U A;  3FE6 A;  3PAL A;  1CMG A;  1K96 A;  1K95 A;  4QJ5 B;  3DVE A;  1PVB A;  5DKN A;  4IJ7 A;  1MXL C;  1TNX A;  3AKB A;  4AQI A;  3Q8I A;  1FI5 A;  5DIC A;  4HSZ A;  5HLV A;  2CCM A;  2KI4 C;  1BR4 B;  1OOJ A;  1TOP A;  2EC6 B;  3GK1 A;  1CM4 A;  2WC8 A;  3I5G B;  2KGR A;  1KSO A;  2BE6 A;  2KI6 C;  2NCP A;  2NXQ A;  3A4U B;  1LKJ A;  2QEB A;  4MLW A;  1XK4 A;  1Z4H A;  2LLT A;  1B9A A;  1ALV A;  3OHM B;  1LS8 A;  3D74 A;  3EVU A;  2PMY A;  4YI8 A;  2WCF A;  1W9Z A;  1L2O C;  2LP2 A;  3NGV A;  3NSI A;  4INX A;  5ER5 A;  1JSA A;  1DJY A;  3EK8 A;  2L50 A;  1BJF A;  1OOF A;  2OS8 C;  4F7F A;  5CSN A;  1KCY A;  1DGV A;  1XVJ A;  1Y1U A;  3D10 A;  3CZ1 A;  2I2R E;  2M9G A;  1UHK A;  4CFR A;  5EL2 A;  2BL0 C;  1BMO A;  1DJZ A;  3K21 A;  2M7N A;  1YRT B;  1KFU S;  2I18 A;  2ISD A;  2L4H A;  2QEV A;  4OZD A;  1QJT A;  2KFF A;  1SL9 A;  1F55 A;  5CSF A;  3C1V A;  1GQM A;  3TDI A;  3D75 A;  2EGD A;  2LUX A;  1SBJ A;  4PHM A;  1KK7 Z;  2GGZ A;  2K60 A;  3S0F A;  1Y1X A;  2VRG A;  4WQ3 A;  1DVI A;  3VRQ A;  2BCB A;  1A75 A;  1NIW A;  1KQM B;  2K0J A;  2NLN A;  4YI9 A;  1DC1 A;  3UO9 A;  3I5F B;  3BFH A;  5AFP A;  2PVB A;  2JT8 A;  1OQP A;  2AMI A;  4PT1 A;  3O78 A;  1XFV O;  1YUT A;  2FJU B;  1M45 A;  1JF2 A;  3D0Y A;  4FQO A;  1K90 D;  1SR6 C;  4UPG A;  1QVI Y;  1YUR A;  2L0P A;  4DRW A;  2P6B B;  2WCJ A;  4CLN A;  3PM2 A;  1Y6W A;  5D7F A;  2JUL A;  4MRY A;  3R1P A;  4GGF A;  1XFX O;  2LVK A;  3EKH A;  1BT6 A;  3B88 A;  3DVM A;  1YX7 A;  3SIB A;  1B1G A;  4DCK A;  1QXP A;  2K7O A;  2EC6 C;  1CFD A;  1CNP A;  1FPW A;  4N1F A;  3CZ0 A;  2MAZ A;  3I5G C;  1NCY A;  2FOT A;  4JKT A;  3OP0 A;  1K9K A;  1C07 A;  1B8R A;  2PSR A;  1PUL A;  3DY9 A;  1DF0 A;  2ZFD A;  1P28 A;  2LLU A;  2WCL A;  4PDZ A;  3CLN A;  1A03 A;  1UHN A;  1LIN A;  2O60 A;  2M7L A;  3SG4 A;  2L5Y A;  3PSR A;  1KFU L;  2JTT A;  3TZ1 A;  3EVR A;  5B8I B;  2R2I A;  4HRE E;  2F8P A;  4CID A;  2QDI A;  1ZUZ A;  1DF0 B;  4M2Q A;  3TS5 B;  3B87 A;  2JWW A;  3L47 A;  1A2X A;  4ORA B;  3SG2 A;  3CR4 X;  2JRF A;  2HQW A;  4YGA A;  1WDC B;  2LHL A;  2M1K B;  3DVK A;  1CLB A;  3H4S E;  1B7T Z;  1CDN A;  5KSZ A;  3B7A A;  3BUM B;  1CKK A;  2LHI A;  1SCM B;  2KLE A;  1NCZ A;  4NDC A;  2SAS A;  1IJ6 A;  1OOI X;  1SY9 A;  1G33 A;  2F33 A;  3N7H A;  4PHK A;  1QS7 A;  3TUY B;  1KQM C;  1WRL A;  1DEL A;  2JT0 A;  2V53 A;  2JOJ A;  4MZK A;  3HX4 A;  3I5F C;  3KHE A;  5GQQ C;  1ZOT B;  1AUI B;  1J7P A;  1BLQ A;  5FI6 A;  1LXF C;  4XYN A;  1S6I A;  4M2P A;  1OMV A;  4YGB B;  2KAX A;  1JC2 A;  2PYQ A;  4JD9 A;  3IF7 A;  1DMO A;  1S5G Y;  2JPO A;  2BNX A;  3OX6 A;  2PAL A;  1REC A;  4PAL A;  1FF1 A;  2AUC A;  2O5G A;  3SS4 A;  1G4Y R;  1OSA A;  1QIW A;  1RWY A;  2H61 A;  4N5X A;  2JNX A;  1SCV A;  4ZCV A;  1XFZ O;  1YVH A;  2RGI A;  3EKJ A;  2LVI A;  2F2P A;  4Q04 A;  2Y1N A;  1SR6 B;  2WCM A;  4L9M A;  2Y5I A;  4A4B A;  4YGE B;  2KOT A;  2WC6 A;  1F4O A;  2M97 A;  2M3W A;  3RM1 A;  2Y1M A;  3DZT A;  3DF0 B;  3B6X A;  3HCM A;  5IBW A;  2B1U A;  3PN7 B;  3DXL A;  2NZ0 A;  3QRX A;  1JF0 A;  2Y4Q A;  1AP4 A;  1XA5 A;  2NCO A;  1J7Q A;  5FI2 A;  3AKA A;  3LCP C;  1U5I A;  4M2O A;  1QVI Z;  1C7W A;  4ETO A;  4YRU A;  3JVT B;  1F71 A;  1LVC D;  3TS5 C;  4C0J A;  1Y1A A;  3PLF B;  3SG7 A;  1UHJ A;  5I2Q A;  1WY9 A;  1WDC C;  1IIO A;  1K8U A;  2KFG A;  3PAT A;  2LC5 A;  1QAT A;  4KYN A;  3CWG A;  2KGB C;  2CNP A;  2DOQ A;  1SPY A;  1K94 A;  3CZT X;  2LVJ A;  1DT7 B;  1U5I B;  4CFQ A;  2KDH A;  1SCM C;  1ODB A; 
#chains in the Genus database with same CATH homology
 3TDZ A;  4CPV A;  1FBV A;  1QLK A;  2LMU A;  3TUY C;  5ER4 X;  2JZI A;  1F54 A;  2HQ8 A;  1J7R A;  4JPZ B;  4YGD B;  1QTX A;  1DGU A;  1CLL A;  1WLZ A;  2K7B A;  4BY4 A;  1EG4 A;  1AJ4 A;  2CTN A;  1CDL A;  2M8U A;  4WRI A;  3AAK A;  5CSJ A;  1QX2 A;  1EXR A;  1TIZ A;  1GGZ A;  1AHR A;  1YX8 A;  1M31 A;  1J1E A;  2WCE A;  1PRW A;  1TN4 A;  1TCF A;  1PSR A;  1G8I A;  1UUR A;  2WOR A;  3BOW A;  3LK0 A;  2AAO A;  1YTZ C;  2ZRT A;  3ZWH A;  4OV2 A;  1NWD A;  1OMR A;  4MN0 A;  1MHO A;  1LA0 A;  2BKH B;  1SYM A;  2LP3 A;  2K8M B;  2WND A;  2BEC A;  3PM8 A;  1L7Z A;  2BCA A;  1NPQ A;  4FTG A;  1A75 B;  1ALW A;  4D1E A;  1F70 A;  1UP5 A;  2FCD A;  1W7I B;  2H61 C;  3BOW B;  3PN7 C;  1SW8 A;  5AAN A;  2LE9 B;  2E30 A;  2M0R A;  1PAL A;  3D0Y B;  1XYD A;  3GK2 A;  2Q4U A;  2KAY A;  2LVV A;  3CS1 A;  4E68 A;  2JXC A;  4PHN A;  2GV5 A;  5G08 A;  1S5G Z;  3JVT C;  1DJG A;  1DJH A;  3LLE A;  1Y0V H;  2JQ6 A;  4PE4 A;  3TDU A;  2MHH A;  1CFC A;  5HKW A;  2CBL A;  4GPL B;  5KTY A;  2L4I A;  3GOF A;  3IQQ A;  4OR9 B;  3FIA A;  1CFF A;  4USL A;  4ICB A;  2OTG B;  3CR2 A;  1AK8 A;  4GBA A;  1KWO B;  3OB1 B;  3SG3 A;  3WHT B;  2CT9 A;  1XK4 C;  4BY5 A;  4XJK A;  1SKT A;  2IS9 A;  5AXI A;  1EJ3 A;  1PK0 D;  3WNX B;  1AVS A;  3SG5 A;  1M63 B;  2MLF C;  5I8N A;  2KFH A;  4MZL A;  2KBI A;  1JFK A;  1B47 A;  1KSM A;  2LNK A;  1TNP A;  4U8D A;  1IJ5 A;  4MEW A;  3F45 A;  2A4J A;  1OZO A;  1NCX A;  5HLO A;  1BF5 A;  4NDD A;  1Q80 A;  4QJ3 B;  4PE1 A;  2ZRS A;  1IQ5 A;  1KK8 B;  1QLS A;  1MF8 B;  2F3Y A;  2L51 A;  1BOD A;  3DD4 A;  1DJW A;  1S6C A;  2K2F A;  4OVN F;  2JTZ A;  1JWD A;  1IWQ A;  4P2Y B;  2LMV A;  4DS7 A;  1CLM A;  3NSL A;  2MJW B;  1J55 A;  4MRX A;  2KAV A;  2OPO A;  2MRD A;  4MSP A;  4I5L B;  5DKR A;  2ZN9 A;  4ORB B;  1UUS A;  3I5H B;  3MSE B;  1ZAC A;  1J7O A;  1DTL A;  1S36 A;  3LK1 A;  1IH0 A;  1UWO A;  1NP8 A;  2ZKM X;  2KBM A;  4PCW A;  1NX2 A;  1JUO A;  4ZCU A;  2CXJ A;  2SCP A;  3SIA A;  4YGC B;  3KEV A;  2LLS A;  4GGF C;  1MR8 A;  2BE4 A;  2COL B;  5DKQ A;  3EK4 A;  4I5N B;  3NSO A;  4GUK A;  4ORC B;  3WXA A;  1C7V A;  2HPS A;  1E8A A;  3GK4 X;  1ZMZ A;  4IL1 A;  1EG3 A;  1IGV A;  2JNF A;  1IKU A;  1DJI A;  2OTG C;  1K9P A;  3NSK A;  3EVV A;  1KWO C;  2KQY A;  1A29 A;  3WHU B;  5CPV A;  1SK6 D;  1KFX S;  1MUX A;  3CR5 X;  4PHJ A;  3I5I B;  1JFJ A;  2BBN A;  5AER A;  1J1D A;  3BXK A;  3O2P A;  4MBE A;  1YUU A;  1M46 A;  3OX5 A;  4MZJ A;  3FS7 A;  1OE9 B;  2PAS A;  5HKZ A;  1F4Q A;  1TNW A;  1EL4 A;  4OKH A;  2KI6 D;  2G9B A;  1KQV A;  3LL8 B;  4P5O E;  5HYD A;  1OMD A;  3PFV A;  2L98 A;  1NSH A;  5I2L A;  2F2O A;  2KYC A;  1B7T Y;  1YR5 A;  3EK7 A;  3O4Y A;  2QAC A;  5FYX A;  1SNL A;  1FW4 A;  1KK8 C;  5JJG A;  1MXE A;  1NX3 A;  1BU3 A;  1XFY O;  4GGN A;  2MBX A;  2H2K A;  4AQJ A;  2LMT A;  4OCI A;  2ZNE A;  2D8N A;  2QPT A;  3AAJ A;  4TNC A;  1SL8 A;  3SJS A;  3ZNI A;  2M1U A;  2KHN A;  3KO0 A;  3ICB A;  1JBA A;  1WLM A;  3VGO A;  3I5H C;  4C0K A;  2G2B A;  1TCO B;  4I5K A;  5HKY A;  1R6P A;  4C0L A;  1LA3 A;  2M29 A;  1H8B A;  5F6T A;  2L2E A;  1NX1 A;  1B4C A;  1RK9 A;  2KQ6 A;  1QX7 A;  1R2U A;  3BUX B;  1XFU O;  1IRJ A;  2K61 A;  3KPX A;  2FCE A;  1UHI A;  2I7A A;  3M0W A;  2K7D A;  1AJ5 A;  1MQ1 A;  1D1O A;  1KFX L;  1XFW O;  5AEQ A;  2LM5 A;  5D69 A;  4PE7 A;  4YBH B;  2KNE A;  5J3X A;  2JC2 A;  5I2O A;  1OZS A;  2HF5 A;  2PRU A;  2WCB A;  1CM1 A;  1CDM A;  3I5I C;  1QV0 A;  1CDP A;  2ZND A;  1NYA A;  2TN4 A;  4JQ0 D;  2JPT A;  1WRZ A;  4N1G A;  3NXA A;  3VRP A;  3CGA A;  1WRK A;  2M49 B;  3BUO B;  4MVF A;  1CFP A;  2GGM A;  1S6J A;  2EHB A;  1N2D A;  2JU0 A;  3JTD B;  1BR1 B;  3BYA A;  2ZN8 A;  1YUS A;  1RJV A;  1K2H A;  3FWB A;  3O6B A;  3DVJ A;  2Q91 A;  5K89 A;  2MLE C;  1M39 A;  1V1F A;  2BCX A;  2K2A A;  3CTN A;  2LAP A;  5TNC A;  1B8L A;  2HET A;  3BUN B;  1RFJ A;  1BG1 A;  1S26 D;  1UHH A;  1V1G A;  2JT3 A;  4DUQ A;  3SG6 A;  2E6W A;  2KI4 B;  4XJK B;  1H4B A;  2KYF A;  1K93 D;  3A8R A;  2LUC A;  3E3R A;  4HRH A;  1NUB A;  2F3Z A;  1YVL A;  1SMG A;  1KK7 Y;  1DJX A;  2BKI B;  1MWN A;  1RTP 1;  1NX0 A;  1TRF A;  4QJ4 B;  1VRK A;  2MA2 A;  3IQO A;  2KSP A;  1IQ3 A;  1L2O B;  1S3P A;  1FI6 A;  2LV7 A;  1F8H A;  1IG5 A;  2OS8 B;  1CTR A;  1XO5 A;  1X02 A;  4GFT A;  2I94 A;  1EH2 A;  1YRU B;  5JOL A;  1QV1 A;  1ZFS A;  4GNK B;  1B8C A;  1PVA A;  1SRA A;  1HT9 A;  1TNQ A;  4I5J A;  3BUW B;  2BL0 B;  4HRG A;  4PE0 A;  1RRO A;  4AOM A;  1SL7 A;  1QX5 B;  1A4P A;  2WOS A;  4A4C A;  4DIR A;  3BQ3 A;  2LCP A;  1GJY A;  1GGW A;  3KF9 A;  1N65 A;  4R1E A;  1TTX A;  5BPJ A;  1S1E A;  1CMF A;  2JXL A;  3OB2 B;  2L5X B;  2LAN A;  4NQG A;  1QAS A;  5CSI A;  3RLZ A;  4JWQ A;  4F0Z B;  3FWC A;  4WQ2 A;  3VRN A;  3JTD C;  1PSB A;  3VRO A;  3VRR A;  5PAL A;  4NDB A;  2K7C A;  2BBM A;  1N0Y A;  3DF0 A;  1QIV A;  1CB1 A;  4GAO A;  1BOC A;  5KU1 A;  1W7J B;  1HQV A;  1K9U A;  3PAL A;  1CMG A;  1K96 A;  1K95 A;  4QJ5 B;  3DVE A;  1PVB A;  5DKN A;  1MXL C;  1TNX A;  3AKB A;  4AQI A;  1FI5 A;  4HSZ A;  5HLV A;  2CCM A;  2KI4 C;  1BR4 B;  1OOJ A;  1TOP A;  2EC6 B;  3GK1 A;  1CM4 A;  2WC8 A;  3I5G B;  2KGR A;  1KSO A;  2BE6 A;  2KI6 C;  2NCP A;  2NXQ A;  3A4U B;  1LKJ A;  4MLW A;  1XK4 A;  2LLT A;  1B9A A;  1ALV A;  3OHM B;  3EVU A;  2PMY A;  4YI8 A;  2WCF A;  1L2O C;  2LP2 A;  3NSI A;  1JSA A;  5ER5 A;  1DJY A;  3EK8 A;  2L50 A;  1BJF A;  2OS8 C;  5CSN A;  1KCY A;  1DGV A;  1XVJ A;  1Y1U A;  3D10 A;  2I2R E;  2M9G A;  1UHK A;  4CFR A;  2BL0 C;  1BMO A;  1DJZ A;  3K21 A;  2M7N A;  1YRT B;  1KFU S;  2I18 A;  2ISD A;  2L4H A;  1QJT A;  2KFF A;  1SL9 A;  1F55 A;  5CSF A;  3C1V A;  1GQM A;  3TDI A;  2EGD A;  2LUX A;  1SBJ A;  4PHM A;  1KK7 Z;  2GGZ A;  1Y1X A;  2VRG A;  4WQ3 A;  1DVI A;  3VRQ A;  2BCB A;  1A75 A;  1NIW A;  1KQM B;  2K0J A;  2NLN A;  4YI9 A;  3I5F B;  5AFP A;  2PVB A;  2JT8 A;  1OQP A;  2AMI A;  3O78 A;  1XFV O;  1YUT A;  2FJU B;  1M45 A;  1JF2 A;  3D0Y A;  4FQO A;  1K90 D;  1SR6 C;  1QVI Y;  1YUR A;  2L0P A;  4DRW A;  2P6B B;  4CLN A;  1Y6W A;  5D7F A;  2JUL A;  4MRY A;  4GGF A;  1XFX O;  2LVK A;  3EKH A;  1BT6 A;  3DVM A;  1YX7 A;  3SIB A;  1B1G A;  4DCK A;  1QXP A;  2K7O A;  2EC6 C;  1CFD A;  1CNP A;  1FPW A;  4N1F A;  2MAZ A;  3I5G C;  1NCY A;  2FOT A;  3OP0 A;  1K9K A;  1C07 A;  1B8R A;  2PSR A;  1PUL A;  1DF0 A;  2ZFD A;  2LLU A;  4PDZ A;  3CLN A;  1A03 A;  1UHN A;  1LIN A;  2O60 A;  2M7L A;  3SG4 A;  3PSR A;  1KFU L;  2JTT A;  3TZ1 A;  3EVR A;  5B8I B;  2R2I A;  4HRE E;  2F8P A;  4CID A;  1ZUZ A;  1DF0 B;  4M2Q A;  3TS5 B;  4ORA B;  2JWW A;  3SG2 A;  1A2X A;  3CR4 X;  2JRF A;  2HQW A;  4YGA A;  1WDC B;  2LHL A;  2M1K B;  3DVK A;  1CLB A;  3H4S E;  1B7T Z;  1CDN A;  5KSZ A;  3BUM B;  1CKK A;  2LHI A;  1SCM B;  4NDC A;  1NCZ A;  2SAS A;  1IJ6 A;  4PHK A;  1SY9 A;  1G33 A;  2F33 A;  1QS7 A;  3TUY B;  1KQM C;  1WRL A;  2JT0 A;  2V53 A;  5GQQ C;  2JOJ A;  4MZK A;  3HX4 A;  3I5F C;  3KHE A;  4UPG A;  1ZOT B;  1AUI B;  1J7P A;  1BLQ A;  1LXF C;  4XYN A;  1S6I A;  4M2P A;  1OMV A;  4YGB B;  2KAX A;  1JC2 A;  3IF7 A;  1DMO A;  1S5G Y;  3OX6 A;  2PAL A;  1REC A;  4PAL A;  1FF1 A;  2AUC A;  2O5G A;  1G4Y R;  1OSA A;  1QIW A;  1RWY A;  2H61 A;  4N5X A;  2JNX A;  1SCV A;  4ZCV A;  1XFZ O;  1YVH A;  2RGI A;  3EKJ A;  2LVI A;  2F2P A;  4Q04 A;  2Y1N A;  1SR6 B;  4L9M A;  2Y5I A;  4A4B A;  4YGE B;  2KOT A;  1F4O A;  2M97 A;  2M3W A;  3RM1 A;  2Y1M A;  3DF0 B;  3HCM A;  5IBW A;  2B1U A;  3PN7 B;  2NZ0 A;  3QRX A;  1JF0 A;  2Y4Q A;  1AP4 A;  1XA5 A;  2NCO A;  1J7Q A;  3AKA A;  3LCP C;  1U5I A;  4M2O A;  1QVI Z;  1C7W A;  4ETO A;  4YRU A;  3JVT B;  1F71 A;  1LVC D;  3TS5 C;  4C0J A;  1Y1A A;  3PLF B;  3SG7 A;  1UHJ A;  5I2Q A;  1WY9 A;  1WDC C;  1K8U A;  2KFG A;  3PAT A;  2LC5 A;  1QAT A;  3CWG A;  2KGB C;  2CNP A;  2DOQ A;  1SPY A;  1K94 A;  3CZT X;  2LVJ A;  1DT7 B;  1U5I B;  4CFQ A;  2KDH A;  1SCM C;  1ODB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...