1SL8A

Calcium-loaded apo-aequorin from aequorea victoria
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
181
structure length
181
Chain Sequence
NPKWIGRHKHMFNFLDVNHNGRISLDEMVYKASDIVINNLGATPEQAKRHKDAVEAFFGGAGMKYGVETEWPEYIEGWKRLASEELKRYSKNQITLIRLWGDALFDIIDKDQNGAISLDEWKAYTKSAGIIQSSEDCEETFRVCDIDESGQLDVDEMTRQHLGFWYTMDPACEKLYGGAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Luminescent protein
molecule keywords Aequorin 1
publication title All three Ca2+-binding loops of photoproteins bind calcium ions: The crystal structures of calcium-loaded apo-aequorin and apo-obelin.
pubmed doi rcsb
source organism Aequorea victoria
total genus 73
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 2004-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1sl8A00
2M49B 1C7VA 1X02A 3AAJA 2NCPA 4I5LB 3OP0A 3BQ3A 3EKJA 1JSAA 1J55A 1PALA 1SR6B 2MAZA 1A29A 2Q91A 4CIDA 2JWWA 1MUXA 3BXKA 1FF1A 1YVLA 3CZTX 2KGRA 4WQ3A 1F71A 2WCFA 1K95A 1OZOA 2Y1NA 1A2XA 2K2AA 1H4BA 2NZ0A 1KWOC 1ZMZA 4PDZA 1PULA 1QTXA 2E30A 3CWGA 3PN7C 1XO5A 2KAXA 5HKWA 3OHMB 2HQWA 2MHHA 3I5IB 2LUCA 3WHTB 1YTZC 2WCBA 1RROA 3SJSA 2LVVA 1TOPA 1NYAA 2MLFC 2M8UA 1B4CA 5HYDA 1K9PA 2KHNA 2K7DA 5I2OA 3NSKA 3QRXA 3CGAA 3OX6A 1CDNA 2A4JA 1FI6A 3CLNA 4MZJA 4AOMA 1IJ5A 1KSOA 2H61C 2PVBA 2V53A 1CDMA 4DS7A 2K7BA 2OPOA 3KHEA 4DUQA 1QXPA 4GGFC 1QIVA 2JZIA 2K61A 1KFXS 4DRWA 4MRYA 1WDCC 3SIBA 1TCFA 1DJIA 3GK1A 4HRGA 2I18A 3TUYB 2L2EA 3GOFA 3NSOA 1AP4A 1CTRA 1SR6C 2KFFA 1A4PA 2BCXA 1ZACA 2AUCA 1YUUA 4XJKB 4F0ZB 1UURA 2K7OA 3VGOA 1QVIZ 1QJTA 1S6IA 2KSPA 1CFPA 1DMOA 2K8MB 2PSRA 2LMTA 2SCPA 3D10A 3ZWHA 4QJ3B 1EH2A 3BUOB 4YBHB 3RLZA 3D0YB 3OX5A 2M1KB 4WQ2A 2H61A 3I5IC 4L9MA 4MBEA 4PE0A 1YUSA 2G9BA 4M2QA 2WNDA 4MLWA 1LVCD 1ZUZA 5HLVA 2PRUA 1CFDA 1CB1A 4GGFA 1BG1A 1QASA 1UHHA 5JJGA 1F4OA 1DGVA 5PALA 2KGBC 3TS5C 2LCPA 2KAYA 1K8UA 2R2IA 5AANA 2I94A 3JVTB 2I7AA 1MXLC 1E8AA 2K2FA 4TNCA 1KK8B 2PASA 2K0JA 1BMOA 3LL8B 5ER5A 2KDHA 4JQ0D 1AJ4A 3O6BA 2BECA 1J1DA 1NWDA 3TUYC 3EK8A 1JC2A 1L7ZA 1PSBA 3FWBA 2LVIA 1PRWA 3C1VA 4MZLA 4YGCB 1IJ6A 5JOLA 5CSNA 1F54A 1S1EA 4Q04A 2F3ZA 1XA5A 1QVIY 3GK4X 1LA3A 3KF9A 2ZRTA 1BU3A 3DD4A 2OTGB 1XFZO 2GGMA 1EL4A 4OVNF 1YX7A 2EGDA 2BE4A 1QV1A 1EG4A 4MZKA 1AJ5A 2JRFA 4D1EA 1MF8B 1WRLA 5I8NA 2LAPA 4YGAA 3WXAA 1RWYA 2OS8B 1SCMB 2GGZA 2LM5A 1TNPA 1U5IB 1Y6WA 1PVBA 1M63B 2M7NA 3EVUA 4GGNA 1KFUL 1B8RA 2KYFA 2ZNEA 3SIAA 4U8DA 1TNWA 3FWCA 4OCIA 4YGBB 1BR4B 2WOSA 3ZNIA 4CPVA 2JU0A 1K96A 3VRNA 2L0PA 1NX1A 3JVTC 4MEWA 2BBMA 4CLNA 1KK8C 5AERA 1UHKA 1CDLA 1M39A 2LV7A 3EVVA 2KI4B 1WLZA 1KQVA 3GK2A 2O5GA 1IGVA 3PATA 4GFTA 4QJ5B 1DJWA 1JBAA 1TIZA 1EJ3A 2ZN8A 1CFFA 1IKUA 1AK8A 3D0YA 2WCEA 2COLB 5CPVA 2OTGC 2EC6C 2LVJA 3FIAA 2LMVA 2PALA 3IQOA 2KFHA 4NDCA 3DF0A 1SKTA 3I5GB 3LLEA 2FOTA 1JFJA 2I2RE 2F8PA 1BLQA 2VRGA 4M2PA 5CSFA 1J7QA 4P5OE 1J1EA 1HT9A 5BPJA 1QV0A 1SCMC 2OS8C 1MXEA 4FTGA 4PALA 3VRQA 3RM1A 1CM1A 3VRRA 1S5GZ 2KBIA 1QS7A 4YRUA 3DVMA 1B8CA 1QLSA 2TN4A 1FI5A 2JT0A 2KQYA 2WC8A 2LANA 1UHIA 1S36A 2LLTA 1MHOA 2L5XB 4I5KA 3TZ1A 1AHRA 2HF5A 4OKHA 3BYAA 1CLMA 5HKYA 3NSLA 2LE9B 1NX3A 1TRFA 4GAOA 2KI4C 1SW8A 2BE6A 1CLLA 2FJUB 1OMDA 2D8NA 3E3RA 3KPXA 1UHJA 4ORCB 2MRDA 1NX2A 3CR5X 2JOJA 1OOJA 1ALWA 3IF7A 4ETOA 3O4YA 1S6JA 1SPYA 3JTDB 3VROA 1Y1UA 2QPTA 4XYNA 4HREE 5DKRA 2EHBA 5I2QA 1NCZA 2LP3A 2ZFDA 1XYDA 2LNKA 1JF2A 1MWNA 2NXQA 4YGDB 3AKAA 2JPTA 3AAKA 3PALA 1U5IA 1Q80A 3H4SE 1AVSA 4PE4A 1YUTA 4NDBA 3I5GC 4PE7A 3SG5A 1B47A 3WHUB 1S5GY 5HLOA 3VRPA 1DJZA 1KK7Z 3BUXB 4UPGA 4ZCUA 1F8HA 5AFPA 4N1FA 1M46A 3TDZA 3SG6A 2M0RA 2JULA 3M0WA 1K90D 3WNXB 4YGEB 1ZOTB 1DF0B 3A8RA 1F70A 3DVJA 1YRTB 4M2OA 2LLUA 1OMRA 3PM8A 3SG2A 1JFKA 2BKIB 1GJYA 1IWQA 2SASA 1Y1XA 2M97A 4GPLB 3OB2B 3SG3A 5J3XA 5GQQC 2CNPA 3I5HB 5AEQA 4HSZA 1A03A 2JQ6A 1FPWA 4HRHA 2JTTA 1B8LA 2F2PA 2P6BB 2H2KA 1QIWA 2F3YA 1BR1B 2IS9A 2Y1MA 1MQ1A 1YURA 1J7OA 1RK9A 1K9KA 2E6WA 3BUWB 1Y0VH 3JTDC 1IH0A 5D7FA 1XFUO 2KFGA 4PHKA 2M29A 5FYXA 2WORA 2HETA 1M45A 2K7CA 1QX7A 2M7LA 4A4CA 1DJGA 3LK0A 4E68A 2ZN9A 1KFUS 1V1FA 2CBLA 1XFYO 3NXAA 2L98A 1J7PA 1PSRA 2ZRSA 2AMIA 1ALVA 1B7TZ 1KSMA 3BOWB 1IG5A 1SRAA 2M1UA 1MR8A 2ZKMX 1G33A 2JXLA 3KEVA 5I2LA 2JNFA 1UWOA 5K89A 1JWDA 2BCAA 1GGWA 2KOTA 1PK0D 1DGUA 3O78A 3TDIA 2KQ6A 5DKQA 1FBVA 1G8IA 1XFWO 1CLBA 3BUNB 3ICBA 4XJKA 1GGZA 4OV2A 5D69A 1H8BA 4BY5A 2BCBA 2FCDA 2LUXA 1SCVA 2L51A 1B1GA 4R1EA 1R2UA 1A75B 1XFVO 3EK4A 1WRKA 2HQ8A 4OR9B 2ZNDA 2MJWB 3LCPC 4GUKA 3A4UB 1OZSA 1UUSA 2BKHB 4C0KA 2FCEA 1BODA 1XK4C 4JWQA 3CR2A 1J7RA 1B7TY 3EVRA 2L4HA 4MRXA 5IBWA 3PSRA 2RGIA 1TN4A 4GBAA 1DF0A 1FW4A 1QLKA 2MA2A 1KCYA 2BL0B 1XVJA 4GNKB 1C07A 2JC2A 2BBNA 5CSIA 1V1GA 3CR4X 1DT7B 2MBXA 4PCWA 4N1GA 1Y1AA 1IQ5A 1IQ3A 1SL8A 5G08A 3NSIA 5B8IB 1K9UA 1TCOB 1KQMB 3PFVA 5CSJA 1L2OB 3EKHA 1PVAA 2KYCA 1RECA 1ODBA 1WY9A 4USLA 5HKZA 3SG4A 2DOQA 2JT3A 2KBMA 4NQGA 1OE9B 2O60A 1DJXA 4DIRA 3MSEB 5KSZA 1DVIA 3HCMA 2PMYA 1M31A 1RTP1 2M9GA 1XK4A 3DVEA 3TS5B 4CFRA 1SYMA 1NCXA 2F33A 2ISDA 1OQPA 1DTLA 1CFCA 1TTXA 2MLEC 1DJHA 1SK6D 2JNXA 3BOWA 1JUOA 5ER4X 1CMFA 2KAVA 2QACA 1W7IB 2M3WA 1NCYA 1QX5B 1S3PA 4MVFA 1RFJA 1SL9A 2LC5A 4ICBA 4YI9A 2AAOA 1KFXL 2KNEA 1F55A 4I5JA 3DVKA 1YX8A 1DJYA 1BT6A 2LHLA 2LVKA 2BL0C 4QJ4B 1W7JB 1WRZA 3I5FB 4C0JA 1QATA 1G4YR 1NPQA 1BOCA 2JT8A 1HQVA 2Y5IA 4IL1A 1K2HA 3O2PA 1UHNA 2LLSA 5F6TA 1RJVA 4PHJA 3HX4A 2LP2A 2CT9A 2CTNA 2Y4QA 3K21A 1LINA 1ZFSA 1KQMC 1L2OC 2CCMA 3TDUA 1A75A 3EK7A 1TNXA 3CTNA 4MN0A 4N5XA 2LHIA 4PHMA 1IRJA 1AUIB 3DF0B 1SMGA 3AKBA 1LA0A 4I5NB 4ORBB 1EG3A 3BUMB 2NCOA 4BY4A 2L4IA 2JXCA 5TNCA 3CS1A 1CNPA 3IQQA 1BF5A 2JTZA 1CKKA 1XFXO 4ORAB 4JPZB 2B1UA 1NIWA 1NP8A 1KK7Y 1N0YA 2NLNA 3LK1A 1GQMA 4PHNA 1TNQA 1QX2A 1SL7A 1C7WA 3PLFB 1N2DA 1F4QA 2Q4UA 1NUBA 1VRKA 1WLMA 1R6PA 1SNLA 2L50A 4C0LA 4ZCVA 3I5FC 4WRIA 1KWOB 2GV5A 3FS7A 1UP5A 1YRUB 1NSHA 1EXRA 2EC6B 3PN7B 1S6CA 1CDPA 1S26D 1K94A 4NDDA 3KO0A 5KTYA 1B9AA 2LMUA 1JF0A 3I5HC 4CFQA 2G2BA 1YVHA 4AQIA 4MSPA 1SY9A 5DKNA 4A4BA 1LKJA 4P2YB 4DCKA 4FQOA 4PE1A 2F2OA 1YR5A 2HPSA 1NX0A 1D1OA 1BJFA 1N65A 5AXIA 3OB1B 4AQJA 1CM4A 5KU1A 1LXFC 2KI6C 3F45A 2CXJA 1K93D 3SG7A 1SBJA 1WDCB 4YI8A 2KI6D 1CMGA 1OSAA 1OMVA
chains in the Genus database with same CATH superfamily
2M49B 1C7VA 1X02A 3AAJA 2NCPA 4I5LB 3OP0A 1OW4A 3BQ3A 3EKJA 1JSAA 1J55A 1PALA 1SR6B 2MAZA 1A29A 2Q91A 3S0EA 2JWWA 1MUXA 4CIDA 3BXKA 1FF1A 1YVLA 5FI2A 4FQTA 3CZTX 3FE8A 2KGRA 4WQ3A 1F71A 2WCFA 1K95A 1OZOA 2Y1NA 1A2XA 2K2AA 1H4BA 2NZ0A 1KWOC 1ZMZA 4PDZA 1PULA 1QTXA 2E30A 3CWGA 3PN7C 1XO5A 2KAXA 5HKWA 3OHMB 2HQWA 2MHHA 3I5IB 3SS3A 2LUCA 3WHTB 1TWOA 1YTZC 2WCBA 1RROA 3SJSA 2LVVA 1TOPA 1NYAA 2MLFC 2M8UA 1B4CA 5HYDA 1K9PA 2KHNA 2K7DA 5I2OA 3NSKA 3QRXA 3CGAA 3OX6A 1CDNA 2A4JA 2FJYA 3CLNA 1FI6A 4MZJA 4AOMA 1IJ5A 1KSOA 2H61C 2PVBA 2V53A 3R1VA 1CDMA 3B6XA 4DS7A 2K7BA 2OPOA 3KHEA 3QMEA 1QXPA 4DUQA 4GGFC 1QIVA 2JZIA 2K61A 1KFXS 4DRWA 4MRYA 3O4XA 1WDCC 3SIBA 1TCFA 1DJIA 3GK1A 4HRGA 2I18A 3TUYB 3N7HA 2L2EA 3S0DA 3GOFA 3NSOA 1AP4A 1CTRA 1SR6C 2KFFA 1W9ZA 1A4PA 2BCXA 1ZACA 2AUCA 1YUUA 4PT1A 4XJKB 4F0ZB 1UURA 3D75A 2K7OA 4OZDA 4INWA 1QVIZ 1QJTA 1S6IA 2KSPA 3VGOA 1CFPA 2K8MB 2PSRA 2LMTA 2SCPA 3D10A 3ZWHA 4QJ3B 1EH2A 1Z2CB 3BUOB 4YBHB 3RLZA 3D0YB 3OX5A 2M1KB 3BFBA 4WQ2A 2H61A 3I5IC 4L9MA 4MBEA 4PE0A 1YUSA 2G9BA 4M2QA 2WNDA 4MLWA 1LVCD 1ZUZA 5HLVA 2PRUA 1CFDA 1CB1A 4GGFA 1BG1A 1QASA 1UHHA 5JJGA 1F4OA 1DGVA 5PALA 2KGBC 3TS5C 2LCPA 2KAYA 1K8UA 2R2IA 5AANA 2I94A 3JVTB 1C3ZA 2I7AA 3RZSA 1MXLC 1E8AA 4INXA 2K2FA 3B7AA 4TNCA 1KK8B 2PASA 3D74A 5FI6A 2K0JA 1BMOA 3LL8B 5ER5A 2KDHA 4JQ0D 1AJ4A 3O6BA 2BECA 1J1DA 1NWDA 2WCLA 3PJIA 3TUYC 3EK8A 1JC2A 1L7ZA 1PSBA 3FWBA 3Q8IA 2LVIA 1PRWA 2K60A 1IIOA 3C1VA 4MZLA 4YGCB 1OOIX 1IJ6A 5D3OA 3DZTA 5CSNA 5JOLA 3IVTA 1F54A 1S1EA 4Q04A 2F3ZA 1XA5A 1QVIY 1OOFA 3GK4X 1LA3A 3KF9A 2ZRTA 1BU3A 3DD4A 2OTGB 1XFZO 2GGMA 1EL4A 4OVNF 1YX7A 2EGDA 3NGVA 2BE4A 1QV1A 1EG4A 4MZKA 1AJ5A 2JRFA 1OOHA 4D1EA 1MF8B 1WRLA 5I8NA 2LAPA 4YGAA 3WXAA 1RWYA 2OS8B 1SCMB 2GGZA 2LM5A 1TNPA 1U5IB 1Y6WA 1PVBA 1M63B 3R1PA 2M7NA 3EVUA 4GGNA 1KFUL 1B8RA 2KYFA 2ZNEA 3SIAA 3D77A 4JKTA 4U8DA 1TNWA 3FWCA 4OCIA 2BAPA 4YGBB 1BR4B 2WOSA 3OGNA 3ZNIA 2JU0A 1K96A 3VRNA 4CPVA 2L0PA 3DYEA 1NX1A 3JVTC 4MEWA 3CABA 2BBMA 4CLNA 5HL1A 1KK8C 5AERA 3CDNA 1UHKA 3CZ2A 1CDLA 1M39A 2LV7A 3EVVA 2KI4B 1WLZA 1KQVA 3GK2A 2O5GA 1IGVA 3PATA 4GFTA 4QJ5B 1DJWA 1JBAA 1TIZA 1EJ3A 2ZN8A 3B87A 5EL2A 1CFFA 1IKUA 1AK8A 3D0YA 2WCEA 3DXLA 2COLB 5CPVA 2OTGC 2QEVA 2EC6C 2LVJA 3FIAA 2LMVA 2PALA 3IQOA 2WC6A 2KFHA 4NDCA 4KYNA 3DF0A 1SKTA 3I5GB 3LLEA 2FOTA 1JFJA 2P71A 2I2RE 2F8PA 1BLQA 2VRGA 4M2PA 5CSFA 5FI7A 1J7QA 4P5OE 1J1EA 1HT9A 5BPJA 1QV0A 1SCMC 2OS8C 1MXEA 4FTGA 4PALA 3VRQA 3RM1A 3SS4A 1CM1A 3VRRA 1S5GZ 2KBIA 1QS7A 4F7FA 4YRUA 3DVMA 1B8CA 1QLSA 2TN4A 1FI5A 2JT0A 2KQYA 3PM2A 2WC8A 2LANA 1UHIA 1S36A 2LLTA 1MHOA 2L5XB 4I5KA 3TZ1A 1AHRA 2HF5A 4OKHA 3BYAA 1CLMA 5HKYA 3NSLA 2LE9B 1NX3A 1TRFA 3K1EA 4GAOA 2KI4C 1SW8A 1CLLA 2BE6A 2FJUB 3SS5A 3UO9A 1OMDA 2D8NA 3E3RA 3KPXA 1UHJA 4ORCB 2MRDA 1NX2A 3CR5X 2JOJA 3L47A 1OOJA 1ALWA 3IF7A 4ETOA 3O4YA 1S6JA 1SPYA 3JTDB 3VROA 1Y1UA 2QPTA 3CZ0A 4XYNA 2KLDA 4HREE 5DKRA 2EHBA 5I2QA 1NCZA 2LP3A 2ZFDA 1XYDA 2LNKA 1JF2A 1MWNA 2NXQA 4YGDB 3AKAA 2JPTA 2QEOA 3AAKA 1U5IA 1Q80A 3H4SE 1AVSA 3PALA 4PE4A 1YUTA 4NDBA 3I5GC 4PE7A 2QEHA 3SG5A 1B47A 3WHUB 1S5GY 5HLOA 3VRPA 1DC1A 1DJZA 1KK7Z 3BUXB 4UPGA 4ZCUA 1F8HA 5AFPA 4N1FA 1M46A 2WCKA 3SG6A 3TDZA 2L5YA 2M0RA 2JULA 3M0WA 1K90D 1DQEA 4YGEB 1ZOTB 1DF0B 3WNXB 3A8RA 1F70A 3DVJA 1YRTB 4M2OA 2LLUA 1OMRA 3S0FA 3PM8A 3SG2A 1JFKA 2BKIB 1GJYA 1IWQA 2SASA 1Y1XA 2M97A 4GPLB 3OB2B 3SG3A 3D73A 5GQQC 5J3XA 2CNPA 3I5HB 5AEQA 2QDIA 4HSZA 1A03A 2JQ6A 1FPWA 4HRHA 2JTTA 4IJ7A 1B8LA 3EG5B 2F2PA 2P6BB 2H2KA 1QIWA 2F3YA 1BR1B 2IS9A 2Y1MA 1MQ1A 1YURA 1J7OA 1RK9A 1K9KA 2E6WA 3BUWB 1Y0VH 3JTDC 1IH0A 5D7FA 1XFUO 2KFGA 4PHKA 2M29A 5FYXA 2WORA 2HETA 1M45A 2K7CA 1QX7A 2M7LA 2L2CA 4A4CA 1DJGA 3LK0A 4E68A 2ZN9A 1KFUS 2WCHA 1V1FA 2CBLA 1XFYO 3NXAA 2L98A 3L4AA 1J7PA 1PSRA 2ZRSA 2AMIA 1ALVA 1B7TZ 1KSMA 3BOWB 1IG5A 1Z4HA 1SRAA 2M1UA 1MR8A 2ZKMX 3UNWA 1G33A 2JXLA 3KEVA 3S0BA 5I2LA 2JNFA 1UWOA 3BFAA 5K89A 1JWDA 2BCAA 1GGWA 2KOTA 1PK0D 1LS8A 1DGUA 3O78A 2JPOA 3TDIA 2KQ6A 5DKQA 1FBVA 3S0GA 1G8IA 1XFWO 3NHTA 3BUNB 1CLBA 3ICBA 3L4LA 4XJKA 1P28A 1GM0A 1GGZA 4OV2A 5D69A 1H8BA 4BY5A 2BCBA 2FCDA 2LUXA 1SCVA 2L51A 1B1GA 4R1EA 1R2UA 1A75B 1XFVO 3EK4A 1WRKA 2HQ8A 4OR9B 2ZNDA 2MJWB 3LCPC 4GUKA 3A4UB 1OZSA 1UUSA 2BKHB 4C0KA 2FCEA 1BODA 1XK4C 4JWQA 3CR2A 1J7RA 2YGUA 1B7TY 3EVRA 2L4HA 4MRXA 5IBWA 1QWVA 2BNXA 3PSRA 2RGIA 1TN4A 4GBAA 1DF0A 1FW4A 1QLKA 2MA2A 1KCYA 3BFHA 2BL0B 1OOGA 1XVJA 4GNKB 1C07A 2JC2A 2BBNA 5CSIA 1V1GA 3CR4X 1DT7B 2MBXA 1XFRA 4PCWA 4N1GA 1Y1AA 1IQ5A 1IQ3A 1SL8A 5G08A 3NSIA 5B8IB 1TUJA 1K9UA 1TCOB 1KQMB 3PFVA 5CSJA 1L2OB 3EKHA 1DEKA 2PYQA 1PVAA 2KYCA 1RECA 1ODBA 1WY9A 4USLA 5HKZA 3SG4A 2DOQA 3NHIA 2JT3A 2KBMA 4NQGA 1OE9B 2O60A 1DJXA 4DIRA 3MSEB 5KSZA 1DVIA 3HCMA 2PMYA 1M31A 1RTP1 2M9GA 1XK4A 3DVEA 3TS5B 4CFRA 3DY9A 1SYMA 1NCXA 2F33A 2ISDA 1OQPA 1DELA 2QEBA 5I94A 1DTLA 1CFCA 1TTXA 3B88A 2MLEC 1DJHA 1SK6D 2JNXA 3BOWA 1JUOA 5ER4X 1CMFA 2KAVA 2QACA 1W7IB 2M3WA 1NCYA 1QX5B 1S3PA 4MVFA 1RFJA 1SL9A 2LC5A 4ICBA 4JD9A 4YI9A 2AAOA 1KFXL 2KNEA 1F55A 4I5JA 3DVKA 1YX8A 1DJYA 3R1OA 1BT6A 2LHLA 3VB1A 2LVKA 2BL0C 2GTEA 1W7JB 4QJ4B 1WRZA 2ERBA 3I5FB 4C0JA 1QATA 1G4YR 1NPQA 1BOCA 2JT8A 1HQVA 2Y5IA 4IL1A 1K2HA 3O2PA 1UHNA 2LLSA 5F6TA 3B86A 1RJVA 4PHJA 3HX4A 2LP2A 2CT9A 3FE6A 2CTNA 2Y4QA 3K21A 1LINA 1ZFSA 1KQMC 1ORGA 2P70A 1DMOA 1L2OC 2CCMA 2H8VA 3TDUA 1A75A 3EK7A 1TNXA 1SSEB 3CTNA 4MN0A 4N5XA 2KPHA 2LHIA 4PHMA 1IRJA 1AUIB 3DF0B 1SMGA 3AKBA 1LA0A 4I5NB 4ORBB 1EG3A 3BUMB 2WCJA 3CZ1A 2NCOA 4BY4A 2L4IA 2JXCA 5TNCA 3CS1A 1CNPA 3IQQA 1BF5A 2JTZA 1CKKA 1XFXO 4ORAB 2PQLA 4JPZB 2B1UA 1NIWA 3OBVA 1NP8A 1KK7Y 1N0YA 1T14A 2NLNA 1GQMA 3LK1A 4PHNA 1TNQA 1QX2A 1SL7A 1C7WA 3PLFB 1N2DA 1F4QA 2Q4UA 1NUBA 1VRKA 1TUZA 1WLMA 1R6PA 1SNLA 2L50A 4C0LA 3FE9A 4ZCVA 3I5FC 3D78A 1KWOB 2GV5A 3FS7A 1UP5A 4WRIA 1YRUB 1NSHA 1EXRA 2EC6B 5DICA 1C3YA 3PN7B 1S6CA 1CDPA 1S26D 3S0AA 1K94A 4NDDA 3KO0A 5KTYA 1B9AA 2LMUA 3D76A 1JF0A 3I5HC 4CFQA 2G2BA 1YVHA 4AQIA 2KLEA 4MSPA 1SY9A 5DKNA 4A4BA 1LKJA 4P2YB 4DCKA 4FQOA 3CYZA 3R72A 4PE1A 3V2LA 2F2OA 1YR5A 2WC5A 2HPSA 1NX0A 1D1OA 1BJFA 1N65A 5AXIA 3OB1B 4AQJA 1CM4A 5KU1A 1LXFC 2KI6C 3F45A 2CXJA 1K93D 2WCMA 3SG7A 3BJHA 1SBJA 1WDCB 4YI8A 2KI6D 1CMGA 1OSAA 1OMVA
chains in the Genus database with same CATH topology
2M49B 1C7VA 1X02A 3AAJA 2NCPA 4I5LB 3OP0A 3BQ3A 3EKJA 1JSAA 1J55A 1PALA 1SR6B 2MAZA 1A29A 2Q91A 4CIDA 2JWWA 1MUXA 3BXKA 1FF1A 1YVLA 3CZTX 2KGRA 4WQ3A 1F71A 2WCFA 1K95A 1OZOA 2Y1NA 1A2XA 2K2AA 1H4BA 2NZ0A 1KWOC 1ZMZA 4PDZA 1PULA 1QTXA 2E30A 3CWGA 3PN7C 1XO5A 2KAXA 5HKWA 3OHMB 2HQWA 2MHHA 3I5IB 2LUCA 3WHTB 1YTZC 2WCBA 1RROA 3SJSA 2LVVA 1TOPA 1NYAA 2MLFC 2M8UA 1B4CA 5HYDA 1K9PA 2KHNA 2K7DA 5I2OA 3NSKA 3QRXA 3CGAA 3OX6A 1CDNA 2A4JA 1FI6A 3CLNA 4MZJA 4AOMA 1IJ5A 1KSOA 2H61C 2PVBA 2V53A 1CDMA 4DS7A 2K7BA 2OPOA 3KHEA 4DUQA 1QXPA 4GGFC 1QIVA 2JZIA 2K61A 1KFXS 4DRWA 4MRYA 1WDCC 3SIBA 1TCFA 1DJIA 3GK1A 4HRGA 2I18A 3TUYB 2L2EA 3GOFA 3NSOA 1AP4A 1CTRA 1SR6C 2KFFA 1A4PA 2BCXA 1ZACA 2AUCA 1YUUA 4XJKB 4F0ZB 1UURA 2K7OA 3VGOA 1QVIZ 1QJTA 1S6IA 2KSPA 1CFPA 1DMOA 2K8MB 2PSRA 2LMTA 2SCPA 3D10A 3ZWHA 4QJ3B 1EH2A 3BUOB 4YBHB 3RLZA 3D0YB 3OX5A 2M1KB 4WQ2A 2H61A 3I5IC 4L9MA 4MBEA 4PE0A 1YUSA 2G9BA 4M2QA 2WNDA 4MLWA 1LVCD 1ZUZA 5HLVA 2PRUA 1CFDA 1CB1A 4GGFA 1BG1A 1QASA 1UHHA 5JJGA 1F4OA 1DGVA 5PALA 2KGBC 3TS5C 2LCPA 2KAYA 1K8UA 2R2IA 5AANA 2I94A 3JVTB 2I7AA 1MXLC 1E8AA 2K2FA 4TNCA 1KK8B 2PASA 2K0JA 1BMOA 3LL8B 5ER5A 2KDHA 4JQ0D 1AJ4A 3O6BA 2BECA 1J1DA 1NWDA 3TUYC 3EK8A 1JC2A 1L7ZA 1PSBA 3FWBA 2LVIA 1PRWA 3C1VA 4MZLA 4YGCB 1IJ6A 5JOLA 5CSNA 1F54A 1S1EA 4Q04A 2F3ZA 1XA5A 1QVIY 3GK4X 1LA3A 3KF9A 2ZRTA 1BU3A 3DD4A 2OTGB 1XFZO 2GGMA 1EL4A 4OVNF 1YX7A 2EGDA 2BE4A 1QV1A 1EG4A 4MZKA 1AJ5A 2JRFA 4D1EA 1MF8B 1WRLA 5I8NA 2LAPA 4YGAA 3WXAA 1RWYA 2OS8B 1SCMB 2GGZA 2LM5A 1TNPA 1U5IB 1Y6WA 1PVBA 1M63B 2M7NA 3EVUA 4GGNA 1KFUL 1B8RA 2KYFA 2ZNEA 3SIAA 4U8DA 1TNWA 3FWCA 4OCIA 4YGBB 1BR4B 2WOSA 3ZNIA 4CPVA 2JU0A 1K96A 3VRNA 2L0PA 1NX1A 3JVTC 4MEWA 2BBMA 4CLNA 1KK8C 5AERA 1UHKA 1CDLA 1M39A 2LV7A 3EVVA 2KI4B 1WLZA 1KQVA 3GK2A 2O5GA 1IGVA 3PATA 4GFTA 4QJ5B 1DJWA 1JBAA 1TIZA 1EJ3A 2ZN8A 1CFFA 1IKUA 1AK8A 3D0YA 2WCEA 2COLB 5CPVA 2OTGC 2EC6C 2LVJA 3FIAA 2LMVA 2PALA 3IQOA 2KFHA 4NDCA 3DF0A 1SKTA 3I5GB 3LLEA 2FOTA 1JFJA 2I2RE 2F8PA 1BLQA 2VRGA 4M2PA 5CSFA 1J7QA 4P5OE 1J1EA 1HT9A 5BPJA 1QV0A 1SCMC 2OS8C 1MXEA 4FTGA 4PALA 3VRQA 3RM1A 1CM1A 3VRRA 1S5GZ 2KBIA 1QS7A 4YRUA 3DVMA 1B8CA 1QLSA 2TN4A 1FI5A 2JT0A 2KQYA 2WC8A 2LANA 1UHIA 1S36A 2LLTA 1MHOA 2L5XB 4I5KA 3TZ1A 1AHRA 2HF5A 4OKHA 3BYAA 1CLMA 5HKYA 3NSLA 2LE9B 1NX3A 1TRFA 4GAOA 2KI4C 1SW8A 2BE6A 1CLLA 2FJUB 1OMDA 2D8NA 3E3RA 3KPXA 1UHJA 4ORCB 2MRDA 1NX2A 3CR5X 2JOJA 1OOJA 1ALWA 3IF7A 4ETOA 3O4YA 1S6JA 1SPYA 3JTDB 3VROA 1Y1UA 2QPTA 4XYNA 4HREE 5DKRA 2EHBA 5I2QA 1NCZA 2LP3A 2ZFDA 1XYDA 2LNKA 1JF2A 1MWNA 2NXQA 4YGDB 3AKAA 2JPTA 3AAKA 3PALA 1U5IA 1Q80A 3H4SE 1AVSA 4PE4A 1YUTA 4NDBA 3I5GC 4PE7A 3SG5A 1B47A 3WHUB 1S5GY 5HLOA 3VRPA 1DJZA 1KK7Z 3BUXB 4UPGA 4ZCUA 1F8HA 5AFPA 4N1FA 1M46A 3TDZA 3SG6A 2M0RA 2JULA 3M0WA 1K90D 3WNXB 4YGEB 1ZOTB 1DF0B 3A8RA 1F70A 3DVJA 1YRTB 4M2OA 2LLUA 1OMRA 3PM8A 3SG2A 1JFKA 2BKIB 1GJYA 1IWQA 2SASA 1Y1XA 2M97A 4GPLB 3OB2B 3SG3A 5J3XA 5GQQC 2CNPA 3I5HB 5AEQA 4HSZA 1A03A 2JQ6A 1FPWA 4HRHA 2JTTA 1B8LA 2F2PA 2P6BB 2H2KA 1QIWA 2F3YA 1BR1B 2IS9A 2Y1MA 1MQ1A 1YURA 1J7OA 1RK9A 1K9KA 2E6WA 3BUWB 1Y0VH 3JTDC 1IH0A 5D7FA 1XFUO 2KFGA 4PHKA 2M29A 5FYXA 2WORA 2HETA 1M45A 2K7CA 1QX7A 2M7LA 4A4CA 1DJGA 3LK0A 4E68A 2ZN9A 1KFUS 1V1FA 2CBLA 1XFYO 3NXAA 2L98A 1J7PA 1PSRA 2ZRSA 2AMIA 1ALVA 1B7TZ 1KSMA 3BOWB 1IG5A 1SRAA 2M1UA 1MR8A 2ZKMX 1G33A 2JXLA 3KEVA 5I2LA 2JNFA 1UWOA 5K89A 1JWDA 2BCAA 1GGWA 2KOTA 1PK0D 1DGUA 3O78A 3TDIA 2KQ6A 5DKQA 1FBVA 1G8IA 1XFWO 1CLBA 3BUNB 3ICBA 4XJKA 1GGZA 4OV2A 5D69A 1H8BA 4BY5A 2BCBA 2FCDA 2LUXA 1SCVA 2L51A 1B1GA 4R1EA 1R2UA 1A75B 1XFVO 3EK4A 1WRKA 2HQ8A 4OR9B 2ZNDA 2MJWB 3LCPC 4GUKA 3A4UB 1OZSA 1UUSA 2BKHB 4C0KA 2FCEA 1BODA 1XK4C 4JWQA 3CR2A 1J7RA 1B7TY 3EVRA 2L4HA 4MRXA 5IBWA 3PSRA 2RGIA 1TN4A 4GBAA 1DF0A 1FW4A 1QLKA 2MA2A 1KCYA 2BL0B 1XVJA 4GNKB 1C07A 2JC2A 2BBNA 5CSIA 1V1GA 3CR4X 1DT7B 2MBXA 4PCWA 4N1GA 1Y1AA 1IQ5A 1IQ3A 1SL8A 5G08A 3NSIA 5B8IB 1K9UA 1TCOB 1KQMB 3PFVA 5CSJA 1L2OB 3EKHA 1PVAA 2KYCA 1RECA 1ODBA 1WY9A 4USLA 5HKZA 3SG4A 2DOQA 2JT3A 2KBMA 4NQGA 1OE9B 2O60A 1DJXA 4DIRA 3MSEB 5KSZA 1DVIA 3HCMA 2PMYA 1M31A 1RTP1 2M9GA 1XK4A 3DVEA 3TS5B 4CFRA 1SYMA 1NCXA 2F33A 2ISDA 1OQPA 1DTLA 1CFCA 1TTXA 2MLEC 1DJHA 1SK6D 2JNXA 3BOWA 1JUOA 5ER4X 1CMFA 2KAVA 2QACA 1W7IB 2M3WA 1NCYA 1QX5B 1S3PA 4MVFA 1RFJA 1SL9A 2LC5A 4ICBA 4YI9A 2AAOA 1KFXL 2KNEA 1F55A 4I5JA 3DVKA 1YX8A 1DJYA 1BT6A 2LHLA 2LVKA 2BL0C 4QJ4B 1W7JB 1WRZA 3I5FB 4C0JA 1QATA 1G4YR 1NPQA 1BOCA 2JT8A 1HQVA 2Y5IA 4IL1A 1K2HA 3O2PA 1UHNA 2LLSA 5F6TA 1RJVA 4PHJA 3HX4A 2LP2A 2CT9A 2CTNA 2Y4QA 3K21A 1LINA 1ZFSA 1KQMC 1L2OC 2CCMA 3TDUA 1A75A 3EK7A 1TNXA 3CTNA 4MN0A 4N5XA 2LHIA 4PHMA 1IRJA 1AUIB 3DF0B 1SMGA 3AKBA 1LA0A 4I5NB 4ORBB 1EG3A 3BUMB 2NCOA 4BY4A 2L4IA 2JXCA 5TNCA 3CS1A 1CNPA 3IQQA 1BF5A 2JTZA 1CKKA 1XFXO 4ORAB 4JPZB 2B1UA 1NIWA 1NP8A 1KK7Y 1N0YA 2NLNA 3LK1A 1GQMA 4PHNA 1TNQA 1QX2A 1SL7A 1C7WA 3PLFB 1N2DA 1F4QA 2Q4UA 1NUBA 1VRKA 1WLMA 1R6PA 1SNLA 2L50A 4C0LA 4ZCVA 3I5FC 4WRIA 1KWOB 2GV5A 3FS7A 1UP5A 1YRUB 1NSHA 1EXRA 2EC6B 3PN7B 1S6CA 1CDPA 1S26D 1K94A 4NDDA 3KO0A 5KTYA 1B9AA 2LMUA 1JF0A 3I5HC 4CFQA 2G2BA 1YVHA 4AQIA 4MSPA 1SY9A 5DKNA 4A4BA 1LKJA 4P2YB 4DCKA 4FQOA 4PE1A 2F2OA 1YR5A 2HPSA 1NX0A 1D1OA 1BJFA 1N65A 5AXIA 3OB1B 4AQJA 1CM4A 5KU1A 1LXFC 2KI6C 3F45A 2CXJA 1K93D 3SG7A 1SBJA 1WDCB 4YI8A 2KI6D 1CMGA 1OSAA 1OMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M49 B;  1C7V A;  1X02 A;  3AAJ A;  2NCP A;  4I5L B;  3OP0 A;  3BQ3 A;  3EKJ A;  1JSA A;  1J55 A;  1PAL A;  1SR6 B;  2MAZ A;  1A29 A;  2Q91 A;  4CID A;  2JWW A;  1MUX A;  3BXK A;  1FF1 A;  1YVL A;  3CZT X;  2KGR A;  4WQ3 A;  1F71 A;  2WCF A;  1K95 A;  1OZO A;  2Y1N A;  1A2X A;  2K2A A;  1H4B A;  2NZ0 A;  1KWO C;  1ZMZ A;  4PDZ A;  1PUL A;  1QTX A;  2E30 A;  3CWG A;  3PN7 C;  1XO5 A;  2KAX A;  5HKW A;  3OHM B;  2HQW A;  2MHH A;  3I5I B;  2LUC A;  3WHT B;  1YTZ C;  2WCB A;  1RRO A;  3SJS A;  2LVV A;  1TOP A;  1NYA A;  2MLF C;  2M8U A;  1B4C A;  5HYD A;  1K9P A;  2KHN A;  2K7D A;  5I2O A;  3NSK A;  3QRX A;  3CGA A;  3OX6 A;  1CDN A;  2A4J A;  1FI6 A;  3CLN A;  4MZJ A;  4AOM A;  1IJ5 A;  1KSO A;  2H61 C;  2PVB A;  2V53 A;  1CDM A;  4DS7 A;  2K7B A;  2OPO A;  3KHE A;  4DUQ A;  1QXP A;  4GGF C;  1QIV A;  2JZI A;  2K61 A;  1KFX S;  4DRW A;  4MRY A;  1WDC C;  3SIB A;  1TCF A;  1DJI A;  3GK1 A;  4HRG A;  2I18 A;  3TUY B;  2L2E A;  3GOF A;  3NSO A;  1AP4 A;  1CTR A;  1SR6 C;  2KFF A;  1A4P A;  2BCX A;  1ZAC A;  2AUC A;  1YUU A;  4XJK B;  4F0Z B;  1UUR A;  2K7O A;  3VGO A;  1QVI Z;  1QJT A;  1S6I A;  2KSP A;  1CFP A;  1DMO A;  2K8M B;  2PSR A;  2LMT A;  2SCP A;  3D10 A;  3ZWH A;  4QJ3 B;  1EH2 A;  3BUO B;  4YBH B;  3RLZ A;  3D0Y B;  3OX5 A;  2M1K B;  4WQ2 A;  2H61 A;  3I5I C;  4L9M A;  4MBE A;  4PE0 A;  1YUS A;  2G9B A;  4M2Q A;  2WND A;  4MLW A;  1LVC D;  1ZUZ A;  5HLV A;  2PRU A;  1CFD A;  1CB1 A;  4GGF A;  1BG1 A;  1QAS A;  1UHH A;  5JJG A;  1F4O A;  1DGV A;  5PAL A;  2KGB C;  3TS5 C;  2LCP A;  2KAY A;  1K8U A;  2R2I A;  5AAN A;  2I94 A;  3JVT B;  2I7A A;  1MXL C;  1E8A A;  2K2F A;  4TNC A;  1KK8 B;  2PAS A;  2K0J A;  1BMO A;  3LL8 B;  5ER5 A;  2KDH A;  4JQ0 D;  1AJ4 A;  3O6B A;  2BEC A;  1J1D A;  1NWD A;  3TUY C;  3EK8 A;  1JC2 A;  1L7Z A;  1PSB A;  3FWB A;  2LVI A;  1PRW A;  3C1V A;  4MZL A;  4YGC B;  1IJ6 A;  5JOL A;  5CSN A;  1F54 A;  1S1E A;  4Q04 A;  2F3Z A;  1XA5 A;  1QVI Y;  3GK4 X;  1LA3 A;  3KF9 A;  2ZRT A;  1BU3 A;  3DD4 A;  2OTG B;  1XFZ O;  2GGM A;  1EL4 A;  4OVN F;  1YX7 A;  2EGD A;  2BE4 A;  1QV1 A;  1EG4 A;  4MZK A;  1AJ5 A;  2JRF A;  4D1E A;  1MF8 B;  1WRL A;  5I8N A;  2LAP A;  4YGA A;  3WXA A;  1RWY A;  2OS8 B;  1SCM B;  2GGZ A;  2LM5 A;  1TNP A;  1U5I B;  1Y6W A;  1PVB A;  1M63 B;  2M7N A;  3EVU A;  4GGN A;  1KFU L;  1B8R A;  2KYF A;  2ZNE A;  3SIA A;  4U8D A;  1TNW A;  3FWC A;  4OCI A;  4YGB B;  1BR4 B;  2WOS A;  3ZNI A;  4CPV A;  2JU0 A;  1K96 A;  3VRN A;  2L0P A;  1NX1 A;  3JVT C;  4MEW A;  2BBM A;  4CLN A;  1KK8 C;  5AER A;  1UHK A;  1CDL A;  1M39 A;  2LV7 A;  3EVV A;  2KI4 B;  1WLZ A;  1KQV A;  3GK2 A;  2O5G A;  1IGV A;  3PAT A;  4GFT A;  4QJ5 B;  1DJW A;  1JBA A;  1TIZ A;  1EJ3 A;  2ZN8 A;  1CFF A;  1IKU A;  1AK8 A;  3D0Y A;  2WCE A;  2COL B;  5CPV A;  2OTG C;  2EC6 C;  2LVJ A;  3FIA A;  2LMV A;  2PAL A;  3IQO A;  2KFH A;  4NDC A;  3DF0 A;  1SKT A;  3I5G B;  3LLE A;  2FOT A;  1JFJ A;  2I2R E;  2F8P A;  1BLQ A;  2VRG A;  4M2P A;  5CSF A;  1J7Q A;  4P5O E;  1J1E A;  1HT9 A;  5BPJ A;  1QV0 A;  1SCM C;  2OS8 C;  1MXE A;  4FTG A;  4PAL A;  3VRQ A;  3RM1 A;  1CM1 A;  3VRR A;  1S5G Z;  2KBI A;  1QS7 A;  4YRU A;  3DVM A;  1B8C A;  1QLS A;  2TN4 A;  1FI5 A;  2JT0 A;  2KQY A;  2WC8 A;  2LAN A;  1UHI A;  1S36 A;  2LLT A;  1MHO A;  2L5X B;  4I5K A;  3TZ1 A;  1AHR A;  2HF5 A;  4OKH A;  3BYA A;  1CLM A;  5HKY A;  3NSL A;  2LE9 B;  1NX3 A;  1TRF A;  4GAO A;  2KI4 C;  1SW8 A;  2BE6 A;  1CLL A;  2FJU B;  1OMD A;  2D8N A;  3E3R A;  3KPX A;  1UHJ A;  4ORC B;  2MRD A;  1NX2 A;  3CR5 X;  2JOJ A;  1OOJ A;  1ALW A;  3IF7 A;  4ETO A;  3O4Y A;  1S6J A;  1SPY A;  3JTD B;  3VRO A;  1Y1U A;  2QPT A;  4XYN A;  4HRE E;  5DKR A;  2EHB A;  5I2Q A;  1NCZ A;  2LP3 A;  2ZFD A;  1XYD A;  2LNK A;  1JF2 A;  1MWN A;  2NXQ A;  4YGD B;  3AKA A;  2JPT A;  3AAK A;  3PAL A;  1U5I A;  1Q80 A;  3H4S E;  1AVS A;  4PE4 A;  1YUT A;  4NDB A;  3I5G C;  4PE7 A;  3SG5 A;  1B47 A;  3WHU B;  1S5G Y;  5HLO A;  3VRP A;  1DJZ A;  1KK7 Z;  3BUX B;  4UPG A;  4ZCU A;  1F8H A;  5AFP A;  4N1F A;  1M46 A;  3TDZ A;  3SG6 A;  2M0R A;  2JUL A;  3M0W A;  1K90 D;  3WNX B;  4YGE B;  1ZOT B;  1DF0 B;  3A8R A;  1F70 A;  3DVJ A;  1YRT B;  4M2O A;  2LLU A;  1OMR A;  3PM8 A;  3SG2 A;  1JFK A;  2BKI B;  1GJY A;  1IWQ A;  2SAS A;  1Y1X A;  2M97 A;  4GPL B;  3OB2 B;  3SG3 A;  5J3X A;  5GQQ C;  2CNP A;  3I5H B;  5AEQ A;  4HSZ A;  1A03 A;  2JQ6 A;  1FPW A;  4HRH A;  2JTT A;  1B8L A;  2F2P A;  2P6B B;  2H2K A;  1QIW A;  2F3Y A;  1BR1 B;  2IS9 A;  2Y1M A;  1MQ1 A;  1YUR A;  1J7O A;  1RK9 A;  1K9K A;  2E6W A;  3BUW B;  1Y0V H;  3JTD C;  1IH0 A;  5D7F A;  1XFU O;  2KFG A;  4PHK A;  2M29 A;  5FYX A;  2WOR A;  2HET A;  1M45 A;  2K7C A;  1QX7 A;  2M7L A;  4A4C A;  1DJG A;  3LK0 A;  4E68 A;  2ZN9 A;  1KFU S;  1V1F A;  2CBL A;  1XFY O;  3NXA A;  2L98 A;  1J7P A;  1PSR A;  2ZRS A;  2AMI A;  1ALV A;  1B7T Z;  1KSM A;  3BOW B;  1IG5 A;  1SRA A;  2M1U A;  1MR8 A;  2ZKM X;  1G33 A;  2JXL A;  3KEV A;  5I2L A;  2JNF A;  1UWO A;  5K89 A;  1JWD A;  2BCA A;  1GGW A;  2KOT A;  1PK0 D;  1DGU A;  3O78 A;  3TDI A;  2KQ6 A;  5DKQ A;  1FBV A;  1G8I A;  1XFW O;  1CLB A;  3BUN B;  3ICB A;  4XJK A;  1GGZ A;  4OV2 A;  5D69 A;  1H8B A;  4BY5 A;  2BCB A;  2FCD A;  2LUX A;  1SCV A;  2L51 A;  1B1G A;  4R1E A;  1R2U A;  1A75 B;  1XFV O;  3EK4 A;  1WRK A;  2HQ8 A;  4OR9 B;  2ZND A;  2MJW B;  3LCP C;  4GUK A;  3A4U B;  1OZS A;  1UUS A;  2BKH B;  4C0K A;  2FCE A;  1BOD A;  1XK4 C;  4JWQ A;  3CR2 A;  1J7R A;  1B7T Y;  3EVR A;  2L4H A;  4MRX A;  5IBW A;  3PSR A;  2RGI A;  1TN4 A;  4GBA A;  1DF0 A;  1FW4 A;  1QLK A;  2MA2 A;  1KCY A;  2BL0 B;  1XVJ A;  4GNK B;  1C07 A;  2JC2 A;  2BBN A;  5CSI A;  1V1G A;  3CR4 X;  1DT7 B;  2MBX A;  4PCW A;  4N1G A;  1Y1A A;  1IQ5 A;  1IQ3 A;  1SL8 A;  5G08 A;  3NSI A;  5B8I B;  1K9U A;  1TCO B;  1KQM B;  3PFV A;  5CSJ A;  1L2O B;  3EKH A;  1PVA A;  2KYC A;  1REC A;  1ODB A;  1WY9 A;  4USL A;  5HKZ A;  3SG4 A;  2DOQ A;  2JT3 A;  2KBM A;  4NQG A;  1OE9 B;  2O60 A;  1DJX A;  4DIR A;  3MSE B;  5KSZ A;  1DVI A;  3HCM A;  2PMY A;  1M31 A;  1RTP 1;  2M9G A;  1XK4 A;  3DVE A;  3TS5 B;  4CFR A;  1SYM A;  1NCX A;  2F33 A;  2ISD A;  1OQP A;  1DTL A;  1CFC A;  1TTX A;  2MLE C;  1DJH A;  1SK6 D;  2JNX A;  3BOW A;  1JUO A;  5ER4 X;  1CMF A;  2KAV A;  2QAC A;  1W7I B;  2M3W A;  1NCY A;  1QX5 B;  1S3P A;  4MVF A;  1RFJ A;  1SL9 A;  2LC5 A;  4ICB A;  4YI9 A;  2AAO A;  1KFX L;  2KNE A;  1F55 A;  4I5J A;  3DVK A;  1YX8 A;  1DJY A;  1BT6 A;  2LHL A;  2LVK A;  2BL0 C;  4QJ4 B;  1W7J B;  1WRZ A;  3I5F B;  4C0J A;  1QAT A;  1G4Y R;  1NPQ A;  1BOC A;  2JT8 A;  1HQV A;  2Y5I A;  4IL1 A;  1K2H A;  3O2P A;  1UHN A;  2LLS A;  5F6T A;  1RJV A;  4PHJ A;  3HX4 A;  2LP2 A;  2CT9 A;  2CTN A;  2Y4Q A;  3K21 A;  1LIN A;  1ZFS A;  1KQM C;  1L2O C;  2CCM A;  3TDU A;  1A75 A;  3EK7 A;  1TNX A;  3CTN A;  4MN0 A;  4N5X A;  2LHI A;  4PHM A;  1IRJ A;  1AUI B;  3DF0 B;  1SMG A;  3AKB A;  1LA0 A;  4I5N B;  4ORB B;  1EG3 A;  3BUM B;  2NCO A;  4BY4 A;  2L4I A;  2JXC A;  5TNC A;  3CS1 A;  1CNP A;  3IQQ A;  1BF5 A;  2JTZ A;  1CKK A;  1XFX O;  4ORA B;  4JPZ B;  2B1U A;  1NIW A;  1NP8 A;  1KK7 Y;  1N0Y A;  2NLN A;  3LK1 A;  1GQM A;  4PHN A;  1TNQ A;  1QX2 A;  1SL7 A;  1C7W A;  3PLF B;  1N2D A;  1F4Q A;  2Q4U A;  1NUB A;  1VRK A;  1WLM A;  1R6P A;  1SNL A;  2L50 A;  4C0L A;  4ZCV A;  3I5F C;  4WRI A;  1KWO B;  2GV5 A;  3FS7 A;  1UP5 A;  1YRU B;  1NSH A;  1EXR A;  2EC6 B;  3PN7 B;  1S6C A;  1CDP A;  1S26 D;  1K94 A;  4NDD A;  3KO0 A;  5KTY A;  1B9A A;  2LMU A;  1JF0 A;  3I5H C;  4CFQ A;  2G2B A;  1YVH A;  4AQI A;  4MSP A;  1SY9 A;  5DKN A;  4A4B A;  1LKJ A;  4P2Y B;  4DCK A;  4FQO A;  4PE1 A;  2F2O A;  1YR5 A;  2HPS A;  1NX0 A;  1D1O A;  1BJF A;  1N65 A;  5AXI A;  3OB1 B;  4AQJ A;  1CM4 A;  5KU1 A;  1LXF C;  2KI6 C;  3F45 A;  2CXJ A;  1K93 D;  3SG7 A;  1SBJ A;  1WDC B;  4YI8 A;  2KI6 D;  1CMG A;  1OSA A;  1OMV A; 
#chains in the Genus database with same CATH topology
 2M49 B;  1C7V A;  1X02 A;  3AAJ A;  2NCP A;  4I5L B;  3OP0 A;  1OW4 A;  3BQ3 A;  3EKJ A;  1JSA A;  1J55 A;  1PAL A;  1SR6 B;  2MAZ A;  1A29 A;  2Q91 A;  3S0E A;  2JWW A;  1MUX A;  4CID A;  3BXK A;  1FF1 A;  1YVL A;  5FI2 A;  4FQT A;  3CZT X;  3FE8 A;  2KGR A;  4WQ3 A;  1F71 A;  2WCF A;  1K95 A;  1OZO A;  2Y1N A;  1A2X A;  2K2A A;  1H4B A;  2NZ0 A;  1KWO C;  1ZMZ A;  4PDZ A;  1PUL A;  1QTX A;  2E30 A;  3CWG A;  3PN7 C;  1XO5 A;  2KAX A;  5HKW A;  3OHM B;  2HQW A;  2MHH A;  3I5I B;  3SS3 A;  2LUC A;  3WHT B;  1TWO A;  1YTZ C;  2WCB A;  1RRO A;  3SJS A;  2LVV A;  1TOP A;  1NYA A;  2MLF C;  2M8U A;  1B4C A;  5HYD A;  1K9P A;  2KHN A;  2K7D A;  5I2O A;  3NSK A;  3QRX A;  3CGA A;  3OX6 A;  1CDN A;  2A4J A;  2FJY A;  3CLN A;  1FI6 A;  4MZJ A;  4AOM A;  1IJ5 A;  1KSO A;  2H61 C;  2PVB A;  2V53 A;  3R1V A;  1CDM A;  3B6X A;  4DS7 A;  2K7B A;  2OPO A;  3KHE A;  3QME A;  1QXP A;  4DUQ A;  4GGF C;  1QIV A;  2JZI A;  2K61 A;  1KFX S;  4DRW A;  4MRY A;  3O4X A;  1WDC C;  3SIB A;  1TCF A;  1DJI A;  3GK1 A;  4HRG A;  2I18 A;  3TUY B;  3N7H A;  2L2E A;  3S0D A;  3GOF A;  3NSO A;  1AP4 A;  1CTR A;  1SR6 C;  2KFF A;  1W9Z A;  1A4P A;  2BCX A;  1ZAC A;  2AUC A;  1YUU A;  4PT1 A;  4XJK B;  4F0Z B;  1UUR A;  3D75 A;  2K7O A;  4OZD A;  4INW A;  1QVI Z;  1QJT A;  1S6I A;  2KSP A;  3VGO A;  1CFP A;  2K8M B;  2PSR A;  2LMT A;  2SCP A;  3D10 A;  3ZWH A;  4QJ3 B;  1EH2 A;  1Z2C B;  3BUO B;  4YBH B;  3RLZ A;  3D0Y B;  3OX5 A;  2M1K B;  3BFB A;  4WQ2 A;  2H61 A;  3I5I C;  4L9M A;  4MBE A;  4PE0 A;  1YUS A;  2G9B A;  4M2Q A;  2WND A;  4MLW A;  1LVC D;  1ZUZ A;  5HLV A;  2PRU A;  1CFD A;  1CB1 A;  4GGF A;  1BG1 A;  1QAS A;  1UHH A;  5JJG A;  1F4O A;  1DGV A;  5PAL A;  2KGB C;  3TS5 C;  2LCP A;  2KAY A;  1K8U A;  2R2I A;  5AAN A;  2I94 A;  3JVT B;  1C3Z A;  2I7A A;  3RZS A;  1MXL C;  1E8A A;  4INX A;  2K2F A;  3B7A A;  4TNC A;  1KK8 B;  2PAS A;  3D74 A;  5FI6 A;  2K0J A;  1BMO A;  3LL8 B;  5ER5 A;  2KDH A;  4JQ0 D;  1AJ4 A;  3O6B A;  2BEC A;  1J1D A;  1NWD A;  2WCL A;  3PJI A;  3TUY C;  3EK8 A;  1JC2 A;  1L7Z A;  1PSB A;  3FWB A;  3Q8I A;  2LVI A;  1PRW A;  2K60 A;  1IIO A;  3C1V A;  4MZL A;  4YGC B;  1OOI X;  1IJ6 A;  5D3O A;  3DZT A;  5CSN A;  5JOL A;  3IVT A;  1F54 A;  1S1E A;  4Q04 A;  2F3Z A;  1XA5 A;  1QVI Y;  1OOF A;  3GK4 X;  1LA3 A;  3KF9 A;  2ZRT A;  1BU3 A;  3DD4 A;  2OTG B;  1XFZ O;  2GGM A;  1EL4 A;  4OVN F;  1YX7 A;  2EGD A;  3NGV A;  2BE4 A;  1QV1 A;  1EG4 A;  4MZK A;  1AJ5 A;  2JRF A;  1OOH A;  4D1E A;  1MF8 B;  1WRL A;  5I8N A;  2LAP A;  4YGA A;  3WXA A;  1RWY A;  2OS8 B;  1SCM B;  2GGZ A;  2LM5 A;  1TNP A;  1U5I B;  1Y6W A;  1PVB A;  1M63 B;  3R1P A;  2M7N A;  3EVU A;  4GGN A;  1KFU L;  1B8R A;  2KYF A;  2ZNE A;  3SIA A;  3D77 A;  4JKT A;  4U8D A;  1TNW A;  3FWC A;  4OCI A;  2BAP A;  4YGB B;  1BR4 B;  2WOS A;  3OGN A;  3ZNI A;  2JU0 A;  1K96 A;  3VRN A;  4CPV A;  2L0P A;  3DYE A;  1NX1 A;  3JVT C;  4MEW A;  3CAB A;  2BBM A;  4CLN A;  5HL1 A;  1KK8 C;  5AER A;  3CDN A;  1UHK A;  3CZ2 A;  1CDL A;  1M39 A;  2LV7 A;  3EVV A;  2KI4 B;  1WLZ A;  1KQV A;  3GK2 A;  2O5G A;  1IGV A;  3PAT A;  4GFT A;  4QJ5 B;  1DJW A;  1JBA A;  1TIZ A;  1EJ3 A;  2ZN8 A;  3B87 A;  5EL2 A;  1CFF A;  1IKU A;  1AK8 A;  3D0Y A;  2WCE A;  3DXL A;  2COL B;  5CPV A;  2OTG C;  2QEV A;  2EC6 C;  2LVJ A;  3FIA A;  2LMV A;  2PAL A;  3IQO A;  2WC6 A;  2KFH A;  4NDC A;  4KYN A;  3DF0 A;  1SKT A;  3I5G B;  3LLE A;  2FOT A;  1JFJ A;  2P71 A;  2I2R E;  2F8P A;  1BLQ A;  2VRG A;  4M2P A;  5CSF A;  5FI7 A;  1J7Q A;  4P5O E;  1J1E A;  1HT9 A;  5BPJ A;  1QV0 A;  1SCM C;  2OS8 C;  1MXE A;  4FTG A;  4PAL A;  3VRQ A;  3RM1 A;  3SS4 A;  1CM1 A;  3VRR A;  1S5G Z;  2KBI A;  1QS7 A;  4F7F A;  4YRU A;  3DVM A;  1B8C A;  1QLS A;  2TN4 A;  1FI5 A;  2JT0 A;  2KQY A;  3PM2 A;  2WC8 A;  2LAN A;  1UHI A;  1S36 A;  2LLT A;  1MHO A;  2L5X B;  4I5K A;  3TZ1 A;  1AHR A;  2HF5 A;  4OKH A;  3BYA A;  1CLM A;  5HKY A;  3NSL A;  2LE9 B;  1NX3 A;  1TRF A;  3K1E A;  4GAO A;  2KI4 C;  1SW8 A;  1CLL A;  2BE6 A;  2FJU B;  3SS5 A;  3UO9 A;  1OMD A;  2D8N A;  3E3R A;  3KPX A;  1UHJ A;  4ORC B;  2MRD A;  1NX2 A;  3CR5 X;  2JOJ A;  3L47 A;  1OOJ A;  1ALW A;  3IF7 A;  4ETO A;  3O4Y A;  1S6J A;  1SPY A;  3JTD B;  3VRO A;  1Y1U A;  2QPT A;  3CZ0 A;  4XYN A;  2KLD A;  4HRE E;  5DKR A;  2EHB A;  5I2Q A;  1NCZ A;  2LP3 A;  2ZFD A;  1XYD A;  2LNK A;  1JF2 A;  1MWN A;  2NXQ A;  4YGD B;  3AKA A;  2JPT A;  2QEO A;  3AAK A;  1U5I A;  1Q80 A;  3H4S E;  1AVS A;  3PAL A;  4PE4 A;  1YUT A;  4NDB A;  3I5G C;  4PE7 A;  2QEH A;  3SG5 A;  1B47 A;  3WHU B;  1S5G Y;  5HLO A;  3VRP A;  1DC1 A;  1DJZ A;  1KK7 Z;  3BUX B;  4UPG A;  4ZCU A;  1F8H A;  5AFP A;  4N1F A;  1M46 A;  2WCK A;  3SG6 A;  3TDZ A;  2L5Y A;  2M0R A;  2JUL A;  3M0W A;  1K90 D;  1DQE A;  4YGE B;  1ZOT B;  1DF0 B;  3WNX B;  3A8R A;  1F70 A;  3DVJ A;  1YRT B;  4M2O A;  2LLU A;  1OMR A;  3S0F A;  3PM8 A;  3SG2 A;  1JFK A;  2BKI B;  1GJY A;  1IWQ A;  2SAS A;  1Y1X A;  2M97 A;  4GPL B;  3OB2 B;  3SG3 A;  3D73 A;  5GQQ C;  5J3X A;  2CNP A;  3I5H B;  5AEQ A;  2QDI A;  4HSZ A;  1A03 A;  2JQ6 A;  1FPW A;  4HRH A;  2JTT A;  4IJ7 A;  1B8L A;  3EG5 B;  2F2P A;  2P6B B;  2H2K A;  1QIW A;  2F3Y A;  1BR1 B;  2IS9 A;  2Y1M A;  1MQ1 A;  1YUR A;  1J7O A;  1RK9 A;  1K9K A;  2E6W A;  3BUW B;  1Y0V H;  3JTD C;  1IH0 A;  5D7F A;  1XFU O;  2KFG A;  4PHK A;  2M29 A;  5FYX A;  2WOR A;  2HET A;  1M45 A;  2K7C A;  1QX7 A;  2M7L A;  2L2C A;  4A4C A;  1DJG A;  3LK0 A;  4E68 A;  2ZN9 A;  1KFU S;  2WCH A;  1V1F A;  2CBL A;  1XFY O;  3NXA A;  2L98 A;  3L4A A;  1J7P A;  1PSR A;  2ZRS A;  2AMI A;  1ALV A;  1B7T Z;  1KSM A;  3BOW B;  1IG5 A;  1Z4H A;  1SRA A;  2M1U A;  1MR8 A;  2ZKM X;  3UNW A;  1G33 A;  2JXL A;  3KEV A;  3S0B A;  5I2L A;  2JNF A;  1UWO A;  3BFA A;  5K89 A;  1JWD A;  2BCA A;  1GGW A;  2KOT A;  1PK0 D;  1LS8 A;  1DGU A;  3O78 A;  2JPO A;  3TDI A;  2KQ6 A;  5DKQ A;  1FBV A;  3S0G A;  1G8I A;  1XFW O;  3NHT A;  3BUN B;  1CLB A;  3ICB A;  3L4L A;  4XJK A;  1P28 A;  1GM0 A;  1GGZ A;  4OV2 A;  5D69 A;  1H8B A;  4BY5 A;  2BCB A;  2FCD A;  2LUX A;  1SCV A;  2L51 A;  1B1G A;  4R1E A;  1R2U A;  1A75 B;  1XFV O;  3EK4 A;  1WRK A;  2HQ8 A;  4OR9 B;  2ZND A;  2MJW B;  3LCP C;  4GUK A;  3A4U B;  1OZS A;  1UUS A;  2BKH B;  4C0K A;  2FCE A;  1BOD A;  1XK4 C;  4JWQ A;  3CR2 A;  1J7R A;  2YGU A;  1B7T Y;  3EVR A;  2L4H A;  4MRX A;  5IBW A;  1QWV A;  2BNX A;  3PSR A;  2RGI A;  1TN4 A;  4GBA A;  1DF0 A;  1FW4 A;  1QLK A;  2MA2 A;  1KCY A;  3BFH A;  2BL0 B;  1OOG A;  1XVJ A;  4GNK B;  1C07 A;  2JC2 A;  2BBN A;  5CSI A;  1V1G A;  3CR4 X;  1DT7 B;  2MBX A;  1XFR A;  4PCW A;  4N1G A;  1Y1A A;  1IQ5 A;  1IQ3 A;  1SL8 A;  5G08 A;  3NSI A;  5B8I B;  1TUJ A;  1K9U A;  1TCO B;  1KQM B;  3PFV A;  5CSJ A;  1L2O B;  3EKH A;  1DEK A;  2PYQ A;  1PVA A;  2KYC A;  1REC A;  1ODB A;  1WY9 A;  4USL A;  5HKZ A;  3SG4 A;  2DOQ A;  3NHI A;  2JT3 A;  2KBM A;  4NQG A;  1OE9 B;  2O60 A;  1DJX A;  4DIR A;  3MSE B;  5KSZ A;  1DVI A;  3HCM A;  2PMY A;  1M31 A;  1RTP 1;  2M9G A;  1XK4 A;  3DVE A;  3TS5 B;  4CFR A;  3DY9 A;  1SYM A;  1NCX A;  2F33 A;  2ISD A;  1OQP A;  1DEL A;  2QEB A;  5I94 A;  1DTL A;  1CFC A;  1TTX A;  3B88 A;  2MLE C;  1DJH A;  1SK6 D;  2JNX A;  3BOW A;  1JUO A;  5ER4 X;  1CMF A;  2KAV A;  2QAC A;  1W7I B;  2M3W A;  1NCY A;  1QX5 B;  1S3P A;  4MVF A;  1RFJ A;  1SL9 A;  2LC5 A;  4ICB A;  4JD9 A;  4YI9 A;  2AAO A;  1KFX L;  2KNE A;  1F55 A;  4I5J A;  3DVK A;  1YX8 A;  1DJY A;  3R1O A;  1BT6 A;  2LHL A;  3VB1 A;  2LVK A;  2BL0 C;  2GTE A;  1W7J B;  4QJ4 B;  1WRZ A;  2ERB A;  3I5F B;  4C0J A;  1QAT A;  1G4Y R;  1NPQ A;  1BOC A;  2JT8 A;  1HQV A;  2Y5I A;  4IL1 A;  1K2H A;  3O2P A;  1UHN A;  2LLS A;  5F6T A;  3B86 A;  1RJV A;  4PHJ A;  3HX4 A;  2LP2 A;  2CT9 A;  3FE6 A;  2CTN A;  2Y4Q A;  3K21 A;  1LIN A;  1ZFS A;  1KQM C;  1ORG A;  2P70 A;  1DMO A;  1L2O C;  2CCM A;  2H8V A;  3TDU A;  1A75 A;  3EK7 A;  1TNX A;  1SSE B;  3CTN A;  4MN0 A;  4N5X A;  2KPH A;  2LHI A;  4PHM A;  1IRJ A;  1AUI B;  3DF0 B;  1SMG A;  3AKB A;  1LA0 A;  4I5N B;  4ORB B;  1EG3 A;  3BUM B;  2WCJ A;  3CZ1 A;  2NCO A;  4BY4 A;  2L4I A;  2JXC A;  5TNC A;  3CS1 A;  1CNP A;  3IQQ A;  1BF5 A;  2JTZ A;  1CKK A;  1XFX O;  4ORA B;  2PQL A;  4JPZ B;  2B1U A;  1NIW A;  3OBV A;  1NP8 A;  1KK7 Y;  1N0Y A;  1T14 A;  2NLN A;  1GQM A;  3LK1 A;  4PHN A;  1TNQ A;  1QX2 A;  1SL7 A;  1C7W A;  3PLF B;  1N2D A;  1F4Q A;  2Q4U A;  1NUB A;  1VRK A;  1TUZ A;  1WLM A;  1R6P A;  1SNL A;  2L50 A;  4C0L A;  3FE9 A;  4ZCV A;  3I5F C;  3D78 A;  1KWO B;  2GV5 A;  3FS7 A;  1UP5 A;  4WRI A;  1YRU B;  1NSH A;  1EXR A;  2EC6 B;  5DIC A;  1C3Y A;  3PN7 B;  1S6C A;  1CDP A;  1S26 D;  3S0A A;  1K94 A;  4NDD A;  3KO0 A;  5KTY A;  1B9A A;  2LMU A;  3D76 A;  1JF0 A;  3I5H C;  4CFQ A;  2G2B A;  1YVH A;  4AQI A;  2KLE A;  4MSP A;  1SY9 A;  5DKN A;  4A4B A;  1LKJ A;  4P2Y B;  4DCK A;  4FQO A;  3CYZ A;  3R72 A;  4PE1 A;  3V2L A;  2F2O A;  1YR5 A;  2WC5 A;  2HPS A;  1NX0 A;  1D1O A;  1BJF A;  1N65 A;  5AXI A;  3OB1 B;  4AQJ A;  1CM4 A;  5KU1 A;  1LXF C;  2KI6 C;  3F45 A;  2CXJ A;  1K93 D;  2WCM A;  3SG7 A;  3BJH A;  1SBJ A;  1WDC B;  4YI8 A;  2KI6 D;  1CMG A;  1OSA A;  1OMV A; 
#chains in the Genus database with same CATH homology
 2M49 B;  1C7V A;  1X02 A;  3AAJ A;  2NCP A;  4I5L B;  3OP0 A;  3BQ3 A;  3EKJ A;  1JSA A;  1J55 A;  1PAL A;  1SR6 B;  2MAZ A;  1A29 A;  2Q91 A;  4CID A;  2JWW A;  1MUX A;  3BXK A;  1FF1 A;  1YVL A;  3CZT X;  2KGR A;  4WQ3 A;  1F71 A;  2WCF A;  1K95 A;  1OZO A;  2Y1N A;  1A2X A;  2K2A A;  1H4B A;  2NZ0 A;  1KWO C;  1ZMZ A;  4PDZ A;  1PUL A;  1QTX A;  2E30 A;  3CWG A;  3PN7 C;  1XO5 A;  2KAX A;  5HKW A;  3OHM B;  2HQW A;  2MHH A;  3I5I B;  2LUC A;  3WHT B;  1YTZ C;  2WCB A;  1RRO A;  3SJS A;  2LVV A;  1TOP A;  1NYA A;  2MLF C;  2M8U A;  1B4C A;  5HYD A;  1K9P A;  2KHN A;  2K7D A;  5I2O A;  3NSK A;  3QRX A;  3CGA A;  3OX6 A;  1CDN A;  2A4J A;  1FI6 A;  3CLN A;  4MZJ A;  4AOM A;  1IJ5 A;  1KSO A;  2H61 C;  2PVB A;  2V53 A;  1CDM A;  4DS7 A;  2K7B A;  2OPO A;  3KHE A;  4DUQ A;  1QXP A;  4GGF C;  1QIV A;  2JZI A;  2K61 A;  1KFX S;  4DRW A;  4MRY A;  1WDC C;  3SIB A;  1TCF A;  1DJI A;  3GK1 A;  4HRG A;  2I18 A;  3TUY B;  2L2E A;  3GOF A;  3NSO A;  1AP4 A;  1CTR A;  1SR6 C;  2KFF A;  1A4P A;  2BCX A;  1ZAC A;  2AUC A;  1YUU A;  4XJK B;  4F0Z B;  1UUR A;  2K7O A;  3VGO A;  1QVI Z;  1QJT A;  1S6I A;  2KSP A;  1CFP A;  1DMO A;  2K8M B;  2PSR A;  2LMT A;  2SCP A;  3D10 A;  3ZWH A;  4QJ3 B;  1EH2 A;  3BUO B;  4YBH B;  3RLZ A;  3D0Y B;  3OX5 A;  2M1K B;  4WQ2 A;  2H61 A;  3I5I C;  4L9M A;  4MBE A;  4PE0 A;  1YUS A;  2G9B A;  4M2Q A;  2WND A;  4MLW A;  1LVC D;  1ZUZ A;  5HLV A;  2PRU A;  1CFD A;  1CB1 A;  4GGF A;  1BG1 A;  1QAS A;  1UHH A;  5JJG A;  1F4O A;  1DGV A;  5PAL A;  2KGB C;  3TS5 C;  2LCP A;  2KAY A;  1K8U A;  2R2I A;  5AAN A;  2I94 A;  3JVT B;  2I7A A;  1MXL C;  1E8A A;  2K2F A;  4TNC A;  1KK8 B;  2PAS A;  2K0J A;  1BMO A;  3LL8 B;  5ER5 A;  2KDH A;  4JQ0 D;  1AJ4 A;  3O6B A;  2BEC A;  1J1D A;  1NWD A;  3TUY C;  3EK8 A;  1JC2 A;  1L7Z A;  1PSB A;  3FWB A;  2LVI A;  1PRW A;  3C1V A;  4MZL A;  4YGC B;  1IJ6 A;  5JOL A;  5CSN A;  1F54 A;  1S1E A;  4Q04 A;  2F3Z A;  1XA5 A;  1QVI Y;  3GK4 X;  1LA3 A;  3KF9 A;  2ZRT A;  1BU3 A;  3DD4 A;  2OTG B;  1XFZ O;  2GGM A;  1EL4 A;  4OVN F;  1YX7 A;  2EGD A;  2BE4 A;  1QV1 A;  1EG4 A;  4MZK A;  1AJ5 A;  2JRF A;  4D1E A;  1MF8 B;  1WRL A;  5I8N A;  2LAP A;  4YGA A;  3WXA A;  1RWY A;  2OS8 B;  1SCM B;  2GGZ A;  2LM5 A;  1TNP A;  1U5I B;  1Y6W A;  1PVB A;  1M63 B;  2M7N A;  3EVU A;  4GGN A;  1KFU L;  1B8R A;  2KYF A;  2ZNE A;  3SIA A;  4U8D A;  1TNW A;  3FWC A;  4OCI A;  4YGB B;  1BR4 B;  2WOS A;  3ZNI A;  4CPV A;  2JU0 A;  1K96 A;  3VRN A;  2L0P A;  1NX1 A;  3JVT C;  4MEW A;  2BBM A;  4CLN A;  1KK8 C;  5AER A;  1UHK A;  1CDL A;  1M39 A;  2LV7 A;  3EVV A;  2KI4 B;  1WLZ A;  1KQV A;  3GK2 A;  2O5G A;  1IGV A;  3PAT A;  4GFT A;  4QJ5 B;  1DJW A;  1JBA A;  1TIZ A;  1EJ3 A;  2ZN8 A;  1CFF A;  1IKU A;  1AK8 A;  3D0Y A;  2WCE A;  2COL B;  5CPV A;  2OTG C;  2EC6 C;  2LVJ A;  3FIA A;  2LMV A;  2PAL A;  3IQO A;  2KFH A;  4NDC A;  3DF0 A;  1SKT A;  3I5G B;  3LLE A;  2FOT A;  1JFJ A;  2I2R E;  2F8P A;  1BLQ A;  2VRG A;  4M2P A;  5CSF A;  1J7Q A;  4P5O E;  1J1E A;  1HT9 A;  5BPJ A;  1QV0 A;  1SCM C;  2OS8 C;  1MXE A;  4FTG A;  4PAL A;  3VRQ A;  3RM1 A;  1CM1 A;  3VRR A;  1S5G Z;  2KBI A;  1QS7 A;  4YRU A;  3DVM A;  1B8C A;  1QLS A;  2TN4 A;  1FI5 A;  2JT0 A;  2KQY A;  2WC8 A;  2LAN A;  1UHI A;  1S36 A;  2LLT A;  1MHO A;  2L5X B;  4I5K A;  3TZ1 A;  1AHR A;  2HF5 A;  4OKH A;  3BYA A;  1CLM A;  5HKY A;  3NSL A;  2LE9 B;  1NX3 A;  1TRF A;  4GAO A;  2KI4 C;  1SW8 A;  2BE6 A;  1CLL A;  2FJU B;  1OMD A;  2D8N A;  3E3R A;  3KPX A;  1UHJ A;  4ORC B;  2MRD A;  1NX2 A;  3CR5 X;  2JOJ A;  1OOJ A;  1ALW A;  3IF7 A;  4ETO A;  3O4Y A;  1S6J A;  1SPY A;  3JTD B;  3VRO A;  1Y1U A;  2QPT A;  4XYN A;  4HRE E;  5DKR A;  2EHB A;  5I2Q A;  1NCZ A;  2LP3 A;  2ZFD A;  1XYD A;  2LNK A;  1JF2 A;  1MWN A;  2NXQ A;  4YGD B;  3AKA A;  2JPT A;  3AAK A;  3PAL A;  1U5I A;  1Q80 A;  3H4S E;  1AVS A;  4PE4 A;  1YUT A;  4NDB A;  3I5G C;  4PE7 A;  3SG5 A;  1B47 A;  3WHU B;  1S5G Y;  5HLO A;  3VRP A;  1DJZ A;  1KK7 Z;  3BUX B;  4UPG A;  4ZCU A;  1F8H A;  5AFP A;  4N1F A;  1M46 A;  3TDZ A;  3SG6 A;  2M0R A;  2JUL A;  3M0W A;  1K90 D;  3WNX B;  4YGE B;  1ZOT B;  1DF0 B;  3A8R A;  1F70 A;  3DVJ A;  1YRT B;  4M2O A;  2LLU A;  1OMR A;  3PM8 A;  3SG2 A;  1JFK A;  2BKI B;  1GJY A;  1IWQ A;  2SAS A;  1Y1X A;  2M97 A;  4GPL B;  3OB2 B;  3SG3 A;  5J3X A;  5GQQ C;  2CNP A;  3I5H B;  5AEQ A;  4HSZ A;  1A03 A;  2JQ6 A;  1FPW A;  4HRH A;  2JTT A;  1B8L A;  2F2P A;  2P6B B;  2H2K A;  1QIW A;  2F3Y A;  1BR1 B;  2IS9 A;  2Y1M A;  1MQ1 A;  1YUR A;  1J7O A;  1RK9 A;  1K9K A;  2E6W A;  3BUW B;  1Y0V H;  3JTD C;  1IH0 A;  5D7F A;  1XFU O;  2KFG A;  4PHK A;  2M29 A;  5FYX A;  2WOR A;  2HET A;  1M45 A;  2K7C A;  1QX7 A;  2M7L A;  4A4C A;  1DJG A;  3LK0 A;  4E68 A;  2ZN9 A;  1KFU S;  1V1F A;  2CBL A;  1XFY O;  3NXA A;  2L98 A;  1J7P A;  1PSR A;  2ZRS A;  2AMI A;  1ALV A;  1B7T Z;  1KSM A;  3BOW B;  1IG5 A;  1SRA A;  2M1U A;  1MR8 A;  2ZKM X;  1G33 A;  2JXL A;  3KEV A;  5I2L A;  2JNF A;  1UWO A;  5K89 A;  1JWD A;  2BCA A;  1GGW A;  2KOT A;  1PK0 D;  1DGU A;  3O78 A;  3TDI A;  2KQ6 A;  5DKQ A;  1FBV A;  1G8I A;  1XFW O;  1CLB A;  3BUN B;  3ICB A;  4XJK A;  1GGZ A;  4OV2 A;  5D69 A;  1H8B A;  4BY5 A;  2BCB A;  2FCD A;  2LUX A;  1SCV A;  2L51 A;  1B1G A;  4R1E A;  1R2U A;  1A75 B;  1XFV O;  3EK4 A;  1WRK A;  2HQ8 A;  4OR9 B;  2ZND A;  2MJW B;  3LCP C;  4GUK A;  3A4U B;  1OZS A;  1UUS A;  2BKH B;  4C0K A;  2FCE A;  1BOD A;  1XK4 C;  4JWQ A;  3CR2 A;  1J7R A;  1B7T Y;  3EVR A;  2L4H A;  4MRX A;  5IBW A;  3PSR A;  2RGI A;  1TN4 A;  4GBA A;  1DF0 A;  1FW4 A;  1QLK A;  2MA2 A;  1KCY A;  2BL0 B;  1XVJ A;  4GNK B;  1C07 A;  2JC2 A;  2BBN A;  5CSI A;  1V1G A;  3CR4 X;  1DT7 B;  2MBX A;  4PCW A;  4N1G A;  1Y1A A;  1IQ5 A;  1IQ3 A;  1SL8 A;  5G08 A;  3NSI A;  5B8I B;  1K9U A;  1TCO B;  1KQM B;  3PFV A;  5CSJ A;  1L2O B;  3EKH A;  1PVA A;  2KYC A;  1REC A;  1ODB A;  1WY9 A;  4USL A;  5HKZ A;  3SG4 A;  2DOQ A;  2JT3 A;  2KBM A;  4NQG A;  1OE9 B;  2O60 A;  1DJX A;  4DIR A;  3MSE B;  5KSZ A;  1DVI A;  3HCM A;  2PMY A;  1M31 A;  1RTP 1;  2M9G A;  1XK4 A;  3DVE A;  3TS5 B;  4CFR A;  1SYM A;  1NCX A;  2F33 A;  2ISD A;  1OQP A;  1DTL A;  1CFC A;  1TTX A;  2MLE C;  1DJH A;  1SK6 D;  2JNX A;  3BOW A;  1JUO A;  5ER4 X;  1CMF A;  2KAV A;  2QAC A;  1W7I B;  2M3W A;  1NCY A;  1QX5 B;  1S3P A;  4MVF A;  1RFJ A;  1SL9 A;  2LC5 A;  4ICB A;  4YI9 A;  2AAO A;  1KFX L;  2KNE A;  1F55 A;  4I5J A;  3DVK A;  1YX8 A;  1DJY A;  1BT6 A;  2LHL A;  2LVK A;  2BL0 C;  4QJ4 B;  1W7J B;  1WRZ A;  3I5F B;  4C0J A;  1QAT A;  1G4Y R;  1NPQ A;  1BOC A;  2JT8 A;  1HQV A;  2Y5I A;  4IL1 A;  1K2H A;  3O2P A;  1UHN A;  2LLS A;  5F6T A;  1RJV A;  4PHJ A;  3HX4 A;  2LP2 A;  2CT9 A;  2CTN A;  2Y4Q A;  3K21 A;  1LIN A;  1ZFS A;  1KQM C;  1L2O C;  2CCM A;  3TDU A;  1A75 A;  3EK7 A;  1TNX A;  3CTN A;  4MN0 A;  4N5X A;  2LHI A;  4PHM A;  1IRJ A;  1AUI B;  3DF0 B;  1SMG A;  3AKB A;  1LA0 A;  4I5N B;  4ORB B;  1EG3 A;  3BUM B;  2NCO A;  4BY4 A;  2L4I A;  2JXC A;  5TNC A;  3CS1 A;  1CNP A;  3IQQ A;  1BF5 A;  2JTZ A;  1CKK A;  1XFX O;  4ORA B;  4JPZ B;  2B1U A;  1NIW A;  1NP8 A;  1KK7 Y;  1N0Y A;  2NLN A;  3LK1 A;  1GQM A;  4PHN A;  1TNQ A;  1QX2 A;  1SL7 A;  1C7W A;  3PLF B;  1N2D A;  1F4Q A;  2Q4U A;  1NUB A;  1VRK A;  1WLM A;  1R6P A;  1SNL A;  2L50 A;  4C0L A;  4ZCV A;  3I5F C;  4WRI A;  1KWO B;  2GV5 A;  3FS7 A;  1UP5 A;  1YRU B;  1NSH A;  1EXR A;  2EC6 B;  3PN7 B;  1S6C A;  1CDP A;  1S26 D;  1K94 A;  4NDD A;  3KO0 A;  5KTY A;  1B9A A;  2LMU A;  1JF0 A;  3I5H C;  4CFQ A;  2G2B A;  1YVH A;  4AQI A;  4MSP A;  1SY9 A;  5DKN A;  4A4B A;  1LKJ A;  4P2Y B;  4DCK A;  4FQO A;  4PE1 A;  2F2O A;  1YR5 A;  2HPS A;  1NX0 A;  1D1O A;  1BJF A;  1N65 A;  5AXI A;  3OB1 B;  4AQJ A;  1CM4 A;  5KU1 A;  1LXF C;  2KI6 C;  3F45 A;  2CXJ A;  1K93 D;  3SG7 A;  1SBJ A;  1WDC B;  4YI8 A;  2KI6 D;  1CMG A;  1OSA A;  1OMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...