1SL8A

Calcium-loaded apo-aequorin from aequorea victoria
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
181
structure length
181
Chain Sequence
b'NPKWIGRHKHMFNFLDVNHNGRISLDEMVYKASDIVINNLGATPEQAKRHKDAVEAFFGGAGMKYGVETEWPEYIEGWKRLASEELKRYSKNQITLIRLWGDALFDIIDKDQNGAISLDEWKAYTKSAGIIQSSEDCEETFRVCDIDESGQLDVDEMTRQHLGFWYTMDPACEKLYGGAVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aequorin 1
publication title All three Ca2+-binding loops of photoproteins bind calcium ions: The crystal structures of calcium-loaded apo-aequorin and apo-obelin.
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Luminescent protein
total genus 73
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 2004-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1sl8A00
4HRHA 2M97A 1QJTA 2LUCA 1GJYA 2Q4UA 2K7CA 1ALWA 1X02A 3FWBA 4GGFC 2G2BA 3VROA 1K96A 1JF0A 1IGVA 1QX2A 1Y1XA 3SG4A 3TDZA 4USLA 1KSMA 3TUYB 4XYNA 1S1EA 2CCMA 1DT7B 1NCXA 4PE4A 3ZNIA 3WXAA 1CNPA 1N2DA 2LNKA 2LANA 2PSRA 5J3XA 4YGAA 1LA3A 3HCMA 3PATA 2EC6B 2LMUA 2LVIA 1DGVA 1GQMA 1KFXL 3KF9A 3BOWB 4AOMA 3CZTX 1JWDA 1SRAA 2B1UA 3PM8A 1KQMB 3D10A 4TNCA 5HKYA 4M2PA 4JWQA 3VRNA 3EK7A 1F70A 1FBVA 1RFJA 1TCFA 1IH0A 4YGDB 4BY5A 1XFVO 1SPYA 2LAPA 1QIVA 4FQOA 3CR5X 3QRXA 5I2OA 3NSOA 1PRWA 1SYMA 2OTGB 4PHNA 2CTNA 2KAVA 2QACA 4MRYA 5CSFA 1XFUO 2MBXA 4HSZA 3SG3A 4AQJA 1AP4A 2JRFA 1QV1A 2E30A 1KSOA 1OSAA 4OR9B 1KK7Z 1AJ5A 1FI6A 1CDMA 1NX3A 3D0YA 1K8UA 1K93D 1AK8A 1CFFA 3NXAA 5G08A 2KOTA 2KHNA 3RLZA 4XJKA 1K2HA 3BYAA 1TNPA 2CBLA 3RM1A 4MVFA 1SK6D 1YVHA 3O6BA 2GGMA 2KFFA 1KK8C 3CR2A 2F8PA 2H61C 2BL0C 3KHEA 2WCFA 3C1VA 2NZ0A 1J1EA 1NX2A 3EVRA 1N65A 4YBHB 3AKAA 1G4YR 4P2YB 1ZACA 1CDNA 1QTXA 1IJ6A 2JT0A 2LHLA 3I5IC 3SIBA 1J55A 1B8LA 1DGUA 4PDZA 2BKIB 4C0KA 3E3RA 1CB1A 2L0PA 1AUIB 4D1EA 1TIZA 1SL8A 1A29A 3ZWHA 1B8RA 1IJ5A 1LXFC 4P5OE 1CFCA 2KAYA 3EK8A 1NX1A 1YVLA 2LUXA 1RTP1 3I5HC 1QXPA 3KO0A 3SG5A 2I18A 1Y1AA 1QS7A 2COLB 3LCPC 1B47A 4GGNA 3ICBA 1C7WA 2EGDA 4OKHA 1UP5A 2LMTA 5D69A 4A4CA 1PVAA 3JTDC 4ICBA 2P6BB 4MRXA 4PHMA 1GGZA 2H2KA 3TS5C 1B9AA 2LVVA 2ZKMX 4GAOA 4NDDA 3WNXB 1KK8B 2MHHA 2BL0B 1ZUZA 4M2QA 4NDCA 4JQ0D 1RROA 4PE0A 1B8CA 1YUUA 2LP3A 2KBMA 4YGEB 1LKJA 3NSLA 4HREE 3BOWA 2BE6A 2VRGA 3I5IB 4ETOA 1NCYA 1JF2A 2D8NA 4YI8A 1UHJA 1WRKA 1DF0B 1QATA 4I5NB 1Y0VH 2LLUA 1LINA 1R6PA 2LVJA 1SMGA 2KQ6A 4U8DA 1FF1A 2KSPA 3O78A 5HKZA 5PALA 3A4UB 1KQVA 3PSRA 4I5LB 2LV7A 5BPJA 1DJIA 4MEWA 3AAJA 2KI4C 2MRDA 2NCPA 5HLVA 1OE9B 5ER4X 1WY9A 3I5HB 1XK4A 1EG4A 2L51A 4YGCB 1L7ZA 4A4BA 3IQQA 1PULA 2JTZA 1UURA 1ALVA 2Y1NA 1S26D 1B7TZ 1DTLA 1S5GY 3JTDB 3TS5B 1XFZO 4GGFA 1CDLA 1YRTB 3OX5A 3EK4A 1NYAA 2QPTA 3OX6A 1NCZA 1RK9A 1CTRA 1QX7A 4DUQA 4ORBB 1QLKA 3SIAA 1CFPA 2MLFC 3I5GC 2JULA 2JXCA 5HKWA 1NIWA 5K89A 2MLEC 3SJSA 2PALA 3DVKA 2Y1MA 1PK0D 2LCPA 1SCVA 5JOLA 1M46A 3DVJA 2LHIA 4WQ2A 1S3PA 2WORA 5AFPA 1V1GA 3VRPA 1K95A 1BODA 4PHJA 2LMVA 2EHBA 2JT8A 4ZCUA 3VRRA 1WRZA 1ZFSA 4CFRA 5ER5A 1XO5A 4GNKB 3DVMA 5CSIA 5GQQC 1SKTA 1SNLA 2BBMA 2LLTA 3SG6A 2KI4B 3PFVA 2HETA 1KCYA 2WC8A 2ZN8A 5D7FA 3GOFA 2A4JA 4OV2A 4QJ5B 1TNXA 1UHHA 2ZRTA 2BKHB 2MA2A 1A4PA 3CLNA 1JC2A 5F6TA 2KNEA 1MR8A 5I2LA 3BUXB 1R2UA 1UUSA 4QJ4B 1Q80A 2JNFA 1V1FA 2KQYA 2O60A 1F4QA 1YTZC 1FPWA 1MWNA 1PALA 1A75B 5KSZA 1CM1A 1L2OC 3OHMB 2ZNEA 3LL8B 1TNWA 2H61A 3I5GB 3FS7A 1D1OA 1CLMA 4MZLA 1NWDA 2WCEA 1U5IB 2M3WA 3PN7C 2LC5A 3GK4X 1K90D 3LLEA 1KFUS 3BUOB 2JT3A 1OOJA 2K8MB 2Y5IA 4I5KA 1CKKA 3PALA 2KAXA 1JSAA 1MXEA 1FI5A 5AXIA 1J7PA 1BU3A 4MN0A 1G33A 2O5GA 2Y4QA 2M7NA 4ORCB 2KYFA 1K94A 2G9BA 2K7OA 4C0JA 1UHIA 1F8HA 2R2IA 1UWOA 2L5XB 1YR5A 2KGBC 3HX4A 1S6CA 4CIDA 1IQ3A 2JOJA 1SBJA 1UHKA 2JZIA 3DF0B 4BY4A 2HPSA 2L4HA 3I5FC 3D0YB 1H8BA 2I7AA 1A2XA 2M9GA 2Q91A 1M63B 3FIAA 1A03A 2SASA 1W7IB 1YRUB 2M1KB 2WOSA 1J1DA 2KYCA 3CTNA 1L2OB 1JFKA 1YX8A 1F4OA 1QX5B 1J7RA 1LVCD 2K0JA 5IBWA 4OVNF 3AAKA 1LA0A 2JC2A 5I8NA 5DKRA 3MSEB 2BBNA 1Y6WA 3BQ3A 2K7BA 1TTXA 3PN7B 1BR1B 1F71A 4MZJA 4N5XA 4WQ3A 2FCEA 1TNQA 2M29A 1RECA 3H4SE 5DKNA 3CR4X 5DKQA 3KEVA 4YRUA 1KFUL 3EVVA 2PRUA 5KU1A 2AMIA 1CLLA 1OZSA 3LK0A 1K9PA 3CGAA 4E68A 2TN4A 2ZFDA 1EXRA 1YURA 1IRJA 1OZOA 4DIRA 3OP0A 2L2EA 1RWYA 1NP8A 1XK4C 4MSPA 1F54A 2F3ZA 4PALA 2WNDA 1QASA 1DJGA 3BUWB 1KWOC 3I5FB 1WLZA 2K2FA 1DMOA 2DOQA 1MUXA 3TDIA 5KTYA 1JBAA 2CT9A 2F2PA 1KK7Y 1HQVA 4UPGA 4N1GA 5I2QA 1PSRA 4YGBB 5HLOA 2LVKA 3OB1B 1TN4A 2LLSA 1EH2A 1TRFA 3FWCA 1A75A 4DRWA 2AUCA 2ISDA 4MBEA 5AANA 5AERA 1CMGA 1WLMA 1SW8A 1EL4A 1WRLA 1NUBA 2M8UA 1PVBA 1DJXA 2M49B 2CNPA 4PCWA 2JPTA 1IWQA 1U5IA 2ZN9A 3GK2A 1WDCC 3SG7A 1K9KA 4AQIA 1IKUA 1JFJA 1F55A 3EKJA 3M0WA 5HYDA 2AAOA 1N0YA 2KDHA 3NSIA 2JQ6A 1NSHA 1HT9A 1TOPA 3EVUA 3AKBA 4GUKA 4CPVA 2GV5A 1NX0A 1BOCA 1UHNA 2HF5A 2OS8C 4GFTA 1XVJA 3CWGA 1S5GZ 2JWWA 4QJ3B 3BUMB 3JVTC 4CFQA 1BJFA 3LK1A 5CSJA 1SY9A 1MXLC 2SCPA 1S6IA 2F33A 2LP2A 4Q04A 2KGRA 3KPXA 1KWOB 3VGOA 1C7VA 2L50A 3DF0A 1EJ3A 2FOTA 1IQ5A 3NSKA 4DCKA 3TZ1A 1BT6A 1QV0A 1XFYO 4N1FA 2CXJA 3WHTB 1AHRA 2LE9B 4I5JA 1ODBA 3BUNB 1SL9A 1K9UA 1VRKA 2E6WA 1DJYA 1XFWO 2K2AA 4ZCVA 5AEQA 2HQ8A 4DS7A 2LM5A 1AJ4A 1SCMC 2PVBA 2OPOA 1FW4A 2BECA 1DVIA 2KI6C 1SR6C 1IG5A 3O4YA 2FJUB 1S36A 4F0ZB 1YX7A 2F3YA 2PASA 2NXQA 1C07A 1DF0A 3GK1A 4C0LA 4GBAA 1YUTA 2BCBA 4M2OA 1CLBA 2JNXA 1DJWA 4MLWA 1WDCB 4CLNA 2GGZA 2JU0A 4NDBA 1MHOA 2KBIA 1BR4B 4IL1A 1BG1A 1BF5A 3VRQA 1G8IA 1XFXO 1QVIY 2ZRSA 3SG2A 2OS8B 2IS9A 3EKHA 3K21A 1OMDA 2WCBA 2F2OA 5CSNA 4FTGA 3O2PA 1YUSA 3JVTB 2I94A 4PE1A 2M0RA 4MZKA 1B4CA 2V53A 5CPVA 2ZNDA 2KFGA 3CS1A 1J7QA 2PMYA 2BCXA 2JTTA 4XJKB 2L98A 2MAZA 2M7LA 3A8RA 1DJZA 2BE4A 5JJGA 1JUOA 4NQGA 1E8AA 3TUYC 5TNCA 3WHUB 1BMOA 1KFXS 4HRGA 5B8IB 1OQPA 4ORAB 2RGIA 2KI6D 1B7TY 4L9MA 2L4IA 4PE7A 1M31A 1SCMB 1MQ1A 3F45A 2EC6C 1M45A 1H4BA 1OMRA 1SR6B 1OMVA 2HQWA 1CMFA 2K7DA 2NCOA 1MF8B 3IF7A 3IQOA 5FYXA 3DD4A 1J7OA 1KQMC 1GGWA 4JPZB 1BLQA 1SL7A 2I2RE 1CM4A 1NPQA 3OB2B 2KFHA 1M39A 1B1GA 4R1EA 4WRIA 3PLFB 1RJVA 1QIWA 1XA5A 4GPLB 1DJHA 1CDPA 1QVIZ 2MJWB 1ZMZA 1S6JA 1W7JB 2OTGC 1XYDA 1QLSA 2JXLA 1AVSA 1CFDA 3BXKA 4OCIA 2M1UA 3TDUA 2FCDA 2K61A 1ZOTB 4PHKA 4YI9A 1TCOB 3DVEA 1Y1UA 2NLNA 1PSBA 1EG3A 2BCAA
chains in the Genus database with same CATH superfamily
4HRHA 3B86A 2M97A 1QJTA 2LUCA 1GJYA 2Q4UA 2K7CA 1ALWA 1X02A 3FWBA 4GGFC 2G2BA 3VROA 1K96A 1JF0A 1IGVA 1QX2A 1Y1XA 3SG4A 3TDZA 3S0FA 4USLA 1KSMA 3TUYB 4XYNA 1S1EA 2CCMA 1DT7B 1NCXA 4PE4A 3ZNIA 3UO9A 3WXAA 3D78A 1CNPA 1N2DA 2LNKA 2LANA 2PSRA 5J3XA 4YGAA 1LA3A 3HCMA 3PATA 2EC6B 2LMUA 2LVIA 1DGVA 1GQMA 1KFXL 3KF9A 3BOWB 4AOMA 3CZTX 1JWDA 1SRAA 2B1UA 3PM8A 1KQMB 3D10A 4TNCA 5HKYA 4M2PA 4JWQA 3VRNA 3EK7A 1C3YA 1F70A 1FBVA 1RFJA 1TCFA 1IH0A 4YGDB 4BY5A 1XFVO 1SPYA 2LAPA 2PQLA 1QIVA 4FQOA 3CR5X 3QRXA 5I2OA 5I94A 3NSOA 1PRWA 3RZSA 1SYMA 2WCKA 2OTGB 1DC1A 4PHNA 2CTNA 2KAVA 2QACA 4MRYA 5CSFA 5FI6A 1XFUO 1GM0A 2MBXA 4HSZA 3SG3A 4AQJA 1AP4A 2JRFA 1QV1A 2E30A 1KSOA 1OSAA 2H8VA 4OR9B 1KK7Z 1AJ5A 1FI6A 1CDMA 1NX3A 3D0YA 1K8UA 1K93D 1AK8A 1CFFA 1XFRA 3NXAA 5G08A 2KOTA 2KHNA 3D73A 3RLZA 4XJKA 1K2HA 3BYAA 1TNPA 1Z4HA 2CBLA 3RM1A 4MVFA 1SK6D 1YVHA 3O6BA 2GGMA 2KFFA 1OOIX 1KK8C 3FE6A 3CR2A 2F8PA 2H61C 2BL0C 3OGNA 3KHEA 2WC5A 2WCFA 5D3OA 3C1VA 2NZ0A 3D74A 1J1EA 1NX2A 3EVRA 1N65A 4YBHB 3AKAA 5HL1A 1G4YR 4P2YB 1ZACA 1CDNA 1QTXA 1IJ6A 2JT0A 2LHLA 3I5IC 3SIBA 1J55A 1B8LA 1DGUA 4PDZA 2BKIB 4C0KA 1W9ZA 3E3RA 1CB1A 2L0PA 1AUIB 4D1EA 1TIZA 5FI2A 1SL8A 1A29A 3ZWHA 1B8RA 1IJ5A 3V2LA 1LXFC 4P5OE 1CFCA 2KAYA 3EK8A 1SSEB 3OBVA 1NX1A 1YVLA 2LUXA 1RTP1 3I5HC 2WCJA 1QXPA 1C3ZA 3KO0A 3SG5A 2I18A 1Y1AA 1QS7A 2COLB 3LCPC 1B47A 4GGNA 3ICBA 1C7WA 2EGDA 4OKHA 1UP5A 2LMTA 5D69A 4A4CA 3S0BA 3B87A 1PVAA 3JTDC 4ICBA 2P6BB 4MRXA 2YGUA 1GGZA 2H2KA 4PHMA 3TS5C 1B9AA 3NHTA 2LVVA 2ZKMX 4GAOA 4NDDA 3WNXB 2QDIA 1KK8B 2MHHA 2QEBA 2BL0B 1ZUZA 4M2QA 4NDCA 4INXA 2WCHA 4JQ0D 1RROA 4PE0A 1B8CA 1YUUA 3VB1A 2LP3A 2KBMA 3D77A 4YGEB 1LKJA 3NSLA 4HREE 3BOWA 2BE6A 2VRGA 3I5IB 4ETOA 1NCYA 1JF2A 2D8NA 4YI8A 1UHJA 1WRKA 3BFBA 1DF0B 1QATA 4I5NB 1Y0VH 2LLUA 1LINA 1R6PA 2LVJA 1SMGA 2KQ6A 4U8DA 1FF1A 2KSPA 3O78A 5HKZA 5PALA 4KYNA 3A4UB 1KQVA 3PSRA 4I5LB 2LV7A 5BPJA 1DJIA 4MEWA 3AAJA 2P71A 2KI4C 2QEVA 2MRDA 2NCPA 5HLVA 1OE9B 5ER4X 1WY9A 3I5HB 1XK4A 3CZ1A 1EG4A 2L51A 2BAPA 1IIOA 4YGCB 1L7ZA 1TUZA 2KLDA 4A4BA 4JD9A 3IQQA 1PULA 2JTZA 1UURA 1ALVA 2Y1NA 1S26D 1B7TZ 1DTLA 1S5GY 3JTDB 3TS5B 1XFZO 4GGFA 1CDLA 1YRTB 3OX5A 3EK4A 1NYAA 2QPTA 3OX6A 1NCZA 3SS4A 1RK9A 1CTRA 1OW4A 1QX7A 4DUQA 4ORBB 3FE8A 1QLKA 3SIAA 1CFPA 2MLFC 3I5GC 2JULA 2JXCA 5HKWA 1NIWA 5K89A 2MLEC 3SJSA 2PALA 3DVKA 2Y1MA 1PK0D 2LCPA 1SCVA 5JOLA 1M46A 3DVJA 2LHIA 4WQ2A 1S3PA 2WORA 5AFPA 1V1GA 3VRPA 1K95A 1BODA 4PHJA 2LMVA 2EHBA 2JT8A 4ZCUA 3VRRA 5DICA 1WRZA 1ZFSA 4CFRA 5ER5A 1XO5A 4GNKB 3DVMA 5CSIA 5GQQC 1SKTA 3S0GA 1SNLA 2BBMA 2LLTA 3SG6A 2KI4B 3PFVA 2HETA 5EL2A 2WC8A 1KCYA 2ZN8A 3S0EA 5D7FA 3CDNA 2A4JA 3GOFA 4OV2A 4PT1A 4QJ5B 1OOGA 1TNXA 1UHHA 2ZRTA 2BKHB 1DQEA 2MA2A 1A4PA 3CLNA 1JC2A 5F6TA 2KNEA 1MR8A 5I2LA 3BUXB 1R2UA 1UUSA 4QJ4B 1Q80A 2JNFA 3D76A 1V1FA 2KQYA 2O60A 1F4QA 1YTZC 1FPWA 1MWNA 1PALA 1A75B 3L4AA 1CM1A 3FE9A 5KSZA 3K1EA 3BFAA 1L2OC 2JPOA 3OHMB 2BNXA 2ZNEA 3LL8B 1TNWA 2H61A 3I5GB 2BCAA 3FS7A 1D1OA 1CLMA 4MZLA 1NWDA 2WCEA 1U5IB 2M3WA 3PN7C 2LC5A 3GK4X 1K90D 3LLEA 1KFUS 3BUOB 2JT3A 1OOJA 2K8MB 2Y5IA 4I5KA 3PM2A 1CKKA 3PALA 2KAXA 1JSAA 1MXEA 1FI5A 5AXIA 1J7PA 1BU3A 4MN0A 1G33A 2O5GA 2Y4QA 2M7NA 3BFHA 3NHIA 2KYFA 4ORCB 1K94A 2G9BA 2K7OA 1Z2CB 1UHIA 4C0JA 2R2IA 1F8HA 1UWOA 2L5XB 1YR5A 2KGBC 3HX4A 1S6CA 4CIDA 1IQ3A 2JOJA 1SBJA 1UHKA 2JZIA 3DF0B 4BY4A 2HPSA 2L4HA 3I5FC 3D0YB 1H8BA 2I7AA 1A2XA 2M9GA 2Q91A 1M63B 3FIAA 1A03A 2SASA 1W7IB 1YRUB 2M1KB 2WOSA 1J1DA 2L5YA 2KYCA 3SS5A 3CTNA 1L2OB 1JFKA 1YX8A 1F4OA 1QX5B 1J7RA 1LVCD 1T14A 2K0JA 5IBWA 4OVNF 3AAKA 1LA0A 2JC2A 5I8NA 5DKRA 2FJYA 3MSEB 2BBNA 3D75A 2K60A 4IJ7A 1Y6WA 3BQ3A 1TWOA 2K7BA 1TTXA 3O4XA 3PN7B 1BR1B 1F71A 4MZJA 4N5XA 4WQ3A 2FCEA 1TNQA 2M29A 1RECA 3H4SE 5DKNA 3CR4X 5DKQA 3KEVA 4YRUA 1KFUL 3EVVA 2PRUA 5KU1A 2AMIA 4INWA 1CLLA 3DXLA 1OZSA 3LK0A 1K9PA 3CGAA 4E68A 2TN4A 2ZFDA 1EXRA 1YURA 2QEOA 1IRJA 1OZOA 4DIRA 3OP0A 2L2EA 1RWYA 1NP8A 1XK4C 4MSPA 3S0AA 1F54A 2F3ZA 2L2CA 4PALA 2WNDA 1QASA 1DJGA 3BUWB 1KWOC 3I5FB 1WLZA 2K2FA 1DMOA 2DOQA 1MUXA 3TDIA 5KTYA 1JBAA 2CT9A 2F2PA 2ERBA 1KK7Y 3B6XA 1HQVA 4UPGA 4N1GA 5I2QA 1PSRA 4YGBB 5HLOA 2LVKA 3OB1B 3N7HA 1TN4A 2LLSA 2WCLA 1DEKA 1EH2A 2P70A 1LS8A 1TRFA 3FWCA 4OZDA 1A75A 3PJIA 4JKTA 2AUCA 2ISDA 4MBEA 4DRWA 5AANA 5AERA 3S0DA 1CMGA 1WLMA 1SW8A 1EL4A 1WRLA 1NUBA 2M8UA 1PVBA 3QMEA 1DJXA 2M49B 2CNPA 4PCWA 2JPTA 1IWQA 1U5IA 2ZN9A 3GK2A 1WDCC 5FI7A 1K9KA 3SG7A 4AQIA 1IKUA 1JFJA 1F55A 2KPHA 3EKJA 3M0WA 5HYDA 2AAOA 1N0YA 2KDHA 3NSIA 2JQ6A 1NSHA 1HT9A 1TOPA 3EVUA 3R1OA 3AKBA 4GUKA 4CPVA 2GV5A 1NX0A 1BOCA 1DELA 1UHNA 2HF5A 2OS8C 4GFTA 1XVJA 3CWGA 1S5GZ 2JWWA 1OOFA 4QJ3B 3BUMB 3JVTC 4CFQA 1BJFA 3LK1A 5CSJA 1SY9A 1MXLC 2SCPA 1S6IA 1TUJA 2F33A 2LP2A 4Q04A 2KGRA 3KPXA 1KWOB 3VGOA 1C7VA 2L50A 3DF0A 1EJ3A 2FOTA 1IQ5A 2WCMA 3NSKA 4DCKA 3TZ1A 1BT6A 1QV0A 1XFYO 3Q8IA 4N1FA 2CXJA 3WHTB 1P28A 1AHRA 2LE9B 3B7AA 3L4LA 4I5JA 1ODBA 3BUNB 3R1PA 1SL9A 1VRKA 2E6WA 1DJYA 1XFWO 2K2AA 4ZCVA 5AEQA 2HQ8A 4DS7A 2LM5A 1AJ4A 1QWVA 1SCMC 2PVBA 2OPOA 1FW4A 2BECA 1DVIA 2KI6C 1SR6C 1IG5A 3O4YA 2FJUB 1S36A 4F0ZB 1YX7A 2F3YA 2PASA 2NXQA 1C07A 1DF0A 3CABA 3GK1A 4C0LA 4GBAA 1YUTA 2BCBA 4M2OA 3UNWA 1CLBA 2JNXA 1DJWA 4MLWA 1WDCB 2WC6A 4CLNA 2GGZA 2JU0A 4NDBA 1MHOA 3BJHA 4FQTA 2KBIA 1BR4B 4IL1A 1BG1A 1BF5A 3VRQA 1G8IA 1ORGA 1XFXO 1QVIY 2ZRSA 3SG2A 3IVTA 2OS8B 2IS9A 3EKHA 3K21A 1OMDA 2WCBA 3DY9A 2F2OA 3L47A 5CSNA 4FTGA 3O2PA 1YUSA 3SS3A 3JVTB 2I94A 4PE1A 2M0RA 4MZKA 1B4CA 2V53A 3DZTA 2ZNDA 3B88A 2KFGA 3CS1A 2KLEA 3R1VA 5CPVA 1J7QA 2PMYA 2BCXA 2JTTA 4XJKB 2L98A 2MAZA 3R72A 2M7LA 4F7FA 3A8RA 1DJZA 2BE4A 5JJGA 3CYZA 1JUOA 4NQGA 1E8AA 3TUYC 3DYEA 5TNCA 3WHUB 1BMOA 1KFXS 2QEHA 3EG5B 4HRGA 5B8IB 1OQPA 4ORAB 2RGIA 2KI6D 3NGVA 1B7TY 1OOHA 2L4IA 4L9MA 4PE7A 1M31A 1SCMB 1MQ1A 3F45A 2EC6C 3CZ2A 1M45A 1H4BA 1OMRA 1SR6B 1OMVA 2HQWA 1CMFA 2K7DA 2NCOA 1MF8B 2PYQA 3IF7A 3IQOA 5FYXA 2GTEA 3DD4A 1J7OA 1KQMC 1GGWA 4JPZB 1BLQA 1SL7A 2I2RE 1CM4A 1NPQA 3OB2B 2KFHA 1M39A 1B1GA 4R1EA 4WRIA 3PLFB 1RJVA 1QIWA 1XA5A 4GPLB 1DJHA 1CDPA 1QVIZ 2MJWB 1ZMZA 1S6JA 1W7JB 2OTGC 1XYDA 1QLSA 2JXLA 1AVSA 1CFDA 3BXKA 4OCIA 2M1UA 3TDUA 2FCDA 2K61A 1ZOTB 4PHKA 4YI9A 1TCOB 3CZ0A 3DVEA 1Y1UA 2NLNA 1PSBA 1EG3A 1K9UA
chains in the Genus database with same CATH topology
4HRHA 2M97A 1QJTA 2LUCA 1GJYA 2Q4UA 2K7CA 1ALWA 1X02A 3FWBA 4GGFC 2G2BA 3VROA 1K96A 1JF0A 1IGVA 1QX2A 1Y1XA 3SG4A 3TDZA 4USLA 1KSMA 3TUYB 4XYNA 1S1EA 2CCMA 1DT7B 1NCXA 4PE4A 3ZNIA 3WXAA 1CNPA 1N2DA 2LNKA 2LANA 2PSRA 5J3XA 4YGAA 1LA3A 3HCMA 3PATA 2EC6B 2LMUA 2LVIA 1DGVA 1GQMA 1KFXL 3KF9A 3BOWB 4AOMA 3CZTX 1JWDA 1SRAA 2B1UA 3PM8A 1KQMB 3D10A 4TNCA 5HKYA 4M2PA 4JWQA 3VRNA 3EK7A 1F70A 1FBVA 1RFJA 1TCFA 1IH0A 4YGDB 4BY5A 1XFVO 1SPYA 2LAPA 1QIVA 4FQOA 3CR5X 3QRXA 5I2OA 3NSOA 1PRWA 1SYMA 2OTGB 4PHNA 2CTNA 2KAVA 2QACA 4MRYA 5CSFA 1XFUO 2MBXA 4HSZA 3SG3A 4AQJA 1AP4A 2JRFA 1QV1A 2E30A 1KSOA 1OSAA 4OR9B 1KK7Z 1AJ5A 1FI6A 1CDMA 1NX3A 3D0YA 1K8UA 1K93D 1AK8A 1CFFA 3NXAA 5G08A 2KOTA 2KHNA 3RLZA 4XJKA 1K2HA 3BYAA 1TNPA 2CBLA 3RM1A 4MVFA 1SK6D 1YVHA 3O6BA 2GGMA 2KFFA 1KK8C 3CR2A 2F8PA 2H61C 2BL0C 3KHEA 2WCFA 3C1VA 2NZ0A 1J1EA 1NX2A 3EVRA 1N65A 4YBHB 3AKAA 1G4YR 4P2YB 1ZACA 1CDNA 1QTXA 1IJ6A 2JT0A 2LHLA 3I5IC 3SIBA 1J55A 1B8LA 1DGUA 4PDZA 2BKIB 4C0KA 3E3RA 1CB1A 2L0PA 1AUIB 4D1EA 1TIZA 1SL8A 1A29A 3ZWHA 1B8RA 1IJ5A 1LXFC 4P5OE 1CFCA 2KAYA 3EK8A 1NX1A 1YVLA 2LUXA 1RTP1 3I5HC 1QXPA 3KO0A 3SG5A 2I18A 1Y1AA 1QS7A 2COLB 3LCPC 1B47A 4GGNA 3ICBA 1C7WA 2EGDA 4OKHA 1UP5A 2LMTA 5D69A 4A4CA 1PVAA 3JTDC 4ICBA 2P6BB 4MRXA 4PHMA 1GGZA 2H2KA 3TS5C 1B9AA 2LVVA 2ZKMX 4GAOA 4NDDA 3WNXB 1KK8B 2MHHA 2BL0B 1ZUZA 4M2QA 4NDCA 4JQ0D 1RROA 4PE0A 1B8CA 1YUUA 2LP3A 2KBMA 4YGEB 1LKJA 3NSLA 4HREE 3BOWA 2BE6A 2VRGA 3I5IB 4ETOA 1NCYA 1JF2A 2D8NA 4YI8A 1UHJA 1WRKA 1DF0B 1QATA 4I5NB 1Y0VH 2LLUA 1LINA 1R6PA 2LVJA 1SMGA 2KQ6A 4U8DA 1FF1A 2KSPA 3O78A 5HKZA 5PALA 3A4UB 1KQVA 3PSRA 4I5LB 2LV7A 5BPJA 1DJIA 4MEWA 3AAJA 2KI4C 2MRDA 2NCPA 5HLVA 1OE9B 5ER4X 1WY9A 3I5HB 1XK4A 1EG4A 2L51A 4YGCB 1L7ZA 4A4BA 3IQQA 1PULA 2JTZA 1UURA 1ALVA 2Y1NA 1S26D 1B7TZ 1DTLA 1S5GY 3JTDB 3TS5B 1XFZO 4GGFA 1CDLA 1YRTB 3OX5A 3EK4A 1NYAA 2QPTA 3OX6A 1NCZA 1RK9A 1CTRA 1QX7A 4DUQA 4ORBB 1QLKA 3SIAA 1CFPA 2MLFC 3I5GC 2JULA 2JXCA 5HKWA 1NIWA 5K89A 2MLEC 3SJSA 2PALA 3DVKA 2Y1MA 1PK0D 2LCPA 1SCVA 5JOLA 1M46A 3DVJA 2LHIA 4WQ2A 1S3PA 2WORA 5AFPA 1V1GA 3VRPA 1K95A 1BODA 4PHJA 2LMVA 2EHBA 2JT8A 4ZCUA 3VRRA 1WRZA 1ZFSA 4CFRA 5ER5A 1XO5A 4GNKB 3DVMA 5CSIA 5GQQC 1SKTA 1SNLA 2BBMA 2LLTA 3SG6A 2KI4B 3PFVA 2HETA 1KCYA 2WC8A 2ZN8A 5D7FA 3GOFA 2A4JA 4OV2A 4QJ5B 1TNXA 1UHHA 2ZRTA 2BKHB 2MA2A 1A4PA 3CLNA 1JC2A 5F6TA 2KNEA 1MR8A 5I2LA 3BUXB 1R2UA 1UUSA 4QJ4B 1Q80A 2JNFA 1V1FA 2KQYA 2O60A 1F4QA 1YTZC 1FPWA 1MWNA 1PALA 1A75B 5KSZA 1CM1A 1L2OC 3OHMB 2ZNEA 3LL8B 1TNWA 2H61A 3I5GB 3FS7A 1D1OA 1CLMA 4MZLA 1NWDA 2WCEA 1U5IB 2M3WA 3PN7C 2LC5A 3GK4X 1K90D 3LLEA 1KFUS 3BUOB 2JT3A 1OOJA 2K8MB 2Y5IA 4I5KA 1CKKA 3PALA 2KAXA 1JSAA 1MXEA 1FI5A 5AXIA 1J7PA 1BU3A 4MN0A 1G33A 2O5GA 2Y4QA 2M7NA 4ORCB 2KYFA 1K94A 2G9BA 2K7OA 4C0JA 1UHIA 1F8HA 2R2IA 1UWOA 2L5XB 1YR5A 2KGBC 3HX4A 1S6CA 4CIDA 1IQ3A 2JOJA 1SBJA 1UHKA 2JZIA 3DF0B 4BY4A 2HPSA 2L4HA 3I5FC 3D0YB 1H8BA 2I7AA 1A2XA 2M9GA 2Q91A 1M63B 3FIAA 1A03A 2SASA 1W7IB 1YRUB 2M1KB 2WOSA 1J1DA 2KYCA 3CTNA 1L2OB 1JFKA 1YX8A 1F4OA 1QX5B 1J7RA 1LVCD 2K0JA 5IBWA 4OVNF 3AAKA 1LA0A 2JC2A 5I8NA 5DKRA 3MSEB 2BBNA 1Y6WA 3BQ3A 2K7BA 1TTXA 3PN7B 1BR1B 1F71A 4MZJA 4N5XA 4WQ3A 2FCEA 1TNQA 2M29A 1RECA 3H4SE 5DKNA 3CR4X 5DKQA 3KEVA 4YRUA 1KFUL 3EVVA 2PRUA 5KU1A 2AMIA 1CLLA 1OZSA 3LK0A 1K9PA 3CGAA 4E68A 2TN4A 2ZFDA 1EXRA 1YURA 1IRJA 1OZOA 4DIRA 3OP0A 2L2EA 1RWYA 1NP8A 1XK4C 4MSPA 1F54A 2F3ZA 4PALA 2WNDA 1QASA 1DJGA 3BUWB 1KWOC 3I5FB 1WLZA 2K2FA 1DMOA 2DOQA 1MUXA 3TDIA 5KTYA 1JBAA 2CT9A 2F2PA 1KK7Y 1HQVA 4UPGA 4N1GA 5I2QA 1PSRA 4YGBB 5HLOA 2LVKA 3OB1B 1TN4A 2LLSA 1EH2A 1TRFA 3FWCA 1A75A 4DRWA 2AUCA 2ISDA 4MBEA 5AANA 5AERA 1CMGA 1WLMA 1SW8A 1EL4A 1WRLA 1NUBA 2M8UA 1PVBA 1DJXA 2M49B 2CNPA 4PCWA 2JPTA 1IWQA 1U5IA 2ZN9A 3GK2A 1WDCC 3SG7A 1K9KA 4AQIA 1IKUA 1JFJA 1F55A 3EKJA 3M0WA 5HYDA 2AAOA 1N0YA 2KDHA 3NSIA 2JQ6A 1NSHA 1HT9A 1TOPA 3EVUA 3AKBA 4GUKA 4CPVA 2GV5A 1NX0A 1BOCA 1UHNA 2HF5A 2OS8C 4GFTA 1XVJA 3CWGA 1S5GZ 2JWWA 4QJ3B 3BUMB 3JVTC 4CFQA 1BJFA 3LK1A 5CSJA 1SY9A 1MXLC 2SCPA 1S6IA 2F33A 2LP2A 4Q04A 2KGRA 3KPXA 1KWOB 3VGOA 1C7VA 2L50A 3DF0A 1EJ3A 2FOTA 1IQ5A 3NSKA 4DCKA 3TZ1A 1BT6A 1QV0A 1XFYO 4N1FA 2CXJA 3WHTB 1AHRA 2LE9B 4I5JA 1ODBA 3BUNB 1SL9A 1K9UA 1VRKA 2E6WA 1DJYA 1XFWO 2K2AA 4ZCVA 5AEQA 2HQ8A 4DS7A 2LM5A 1AJ4A 1SCMC 2PVBA 2OPOA 1FW4A 2BECA 1DVIA 2KI6C 1SR6C 1IG5A 3O4YA 2FJUB 1S36A 4F0ZB 1YX7A 2F3YA 2PASA 2NXQA 1C07A 1DF0A 3GK1A 4C0LA 4GBAA 1YUTA 2BCBA 4M2OA 1CLBA 2JNXA 1DJWA 4MLWA 1WDCB 4CLNA 2GGZA 2JU0A 4NDBA 1MHOA 2KBIA 1BR4B 4IL1A 1BG1A 1BF5A 3VRQA 1G8IA 1XFXO 1QVIY 2ZRSA 3SG2A 2OS8B 2IS9A 3EKHA 3K21A 1OMDA 2WCBA 2F2OA 5CSNA 4FTGA 3O2PA 1YUSA 3JVTB 2I94A 4PE1A 2M0RA 4MZKA 1B4CA 2V53A 5CPVA 2ZNDA 2KFGA 3CS1A 1J7QA 2PMYA 2BCXA 2JTTA 4XJKB 2L98A 2MAZA 2M7LA 3A8RA 1DJZA 2BE4A 5JJGA 1JUOA 4NQGA 1E8AA 3TUYC 5TNCA 3WHUB 1BMOA 1KFXS 4HRGA 5B8IB 1OQPA 4ORAB 2RGIA 2KI6D 1B7TY 4L9MA 2L4IA 4PE7A 1M31A 1SCMB 1MQ1A 3F45A 2EC6C 1M45A 1H4BA 1OMRA 1SR6B 1OMVA 2HQWA 1CMFA 2K7DA 2NCOA 1MF8B 3IF7A 3IQOA 5FYXA 3DD4A 1J7OA 1KQMC 1GGWA 4JPZB 1BLQA 1SL7A 2I2RE 1CM4A 1NPQA 3OB2B 2KFHA 1M39A 1B1GA 4R1EA 4WRIA 3PLFB 1RJVA 1QIWA 1XA5A 4GPLB 1DJHA 1CDPA 1QVIZ 2MJWB 1ZMZA 1S6JA 1W7JB 2OTGC 1XYDA 1QLSA 2JXLA 1AVSA 1CFDA 3BXKA 4OCIA 2M1UA 3TDUA 2FCDA 2K61A 1ZOTB 4PHKA 4YI9A 1TCOB 3DVEA 1Y1UA 2NLNA 1PSBA 1EG3A 2BCAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HRH A;  2M97 A;  1QJT A;  2LUC A;  1GJY A;  2Q4U A;  2K7C A;  1ALW A;  1X02 A;  3FWB A;  4GGF C;  2G2B A;  3VRO A;  1K96 A;  1JF0 A;  1IGV A;  1QX2 A;  1Y1X A;  3SG4 A;  3TDZ A;  4USL A;  1KSM A;  3TUY B;  4XYN A;  1S1E A;  2CCM A;  1DT7 B;  1NCX A;  4PE4 A;  3ZNI A;  3WXA A;  1CNP A;  1N2D A;  2LNK A;  2LAN A;  2PSR A;  5J3X A;  4YGA A;  1LA3 A;  3HCM A;  3PAT A;  2EC6 B;  2LMU A;  2LVI A;  1DGV A;  1GQM A;  1KFX L;  3KF9 A;  3BOW B;  4AOM A;  3CZT X;  1JWD A;  1SRA A;  2B1U A;  3PM8 A;  1KQM B;  3D10 A;  4TNC A;  5HKY A;  4M2P A;  4JWQ A;  3VRN A;  3EK7 A;  1F70 A;  1FBV A;  1RFJ A;  1TCF A;  1IH0 A;  4YGD B;  4BY5 A;  1XFV O;  1SPY A;  2LAP A;  1QIV A;  4FQO A;  3CR5 X;  3QRX A;  5I2O A;  3NSO A;  1PRW A;  1SYM A;  2OTG B;  4PHN A;  2CTN A;  2KAV A;  2QAC A;  4MRY A;  5CSF A;  1XFU O;  2MBX A;  4HSZ A;  3SG3 A;  4AQJ A;  1AP4 A;  2JRF A;  1QV1 A;  2E30 A;  1KSO A;  1OSA A;  4OR9 B;  1KK7 Z;  1AJ5 A;  1FI6 A;  1CDM A;  1NX3 A;  3D0Y A;  1K8U A;  1K93 D;  1AK8 A;  1CFF A;  3NXA A;  5G08 A;  2KOT A;  2KHN A;  3RLZ A;  4XJK A;  1K2H A;  3BYA A;  1TNP A;  2CBL A;  3RM1 A;  4MVF A;  1SK6 D;  1YVH A;  3O6B A;  2GGM A;  2KFF A;  1KK8 C;  3CR2 A;  2F8P A;  2H61 C;  2BL0 C;  3KHE A;  2WCF A;  3C1V A;  2NZ0 A;  1J1E A;  1NX2 A;  3EVR A;  1N65 A;  4YBH B;  3AKA A;  1G4Y R;  4P2Y B;  1ZAC A;  1CDN A;  1QTX A;  1IJ6 A;  2JT0 A;  2LHL A;  3I5I C;  3SIB A;  1J55 A;  1B8L A;  1DGU A;  4PDZ A;  2BKI B;  4C0K A;  3E3R A;  1CB1 A;  2L0P A;  1AUI B;  4D1E A;  1TIZ A;  1SL8 A;  1A29 A;  3ZWH A;  1B8R A;  1IJ5 A;  1LXF C;  4P5O E;  1CFC A;  2KAY A;  3EK8 A;  1NX1 A;  1YVL A;  2LUX A;  1RTP 1;  3I5H C;  1QXP A;  3KO0 A;  3SG5 A;  2I18 A;  1Y1A A;  1QS7 A;  2COL B;  3LCP C;  1B47 A;  4GGN A;  3ICB A;  1C7W A;  2EGD A;  4OKH A;  1UP5 A;  2LMT A;  5D69 A;  4A4C A;  1PVA A;  3JTD C;  4ICB A;  2P6B B;  4MRX A;  4PHM A;  1GGZ A;  2H2K A;  3TS5 C;  1B9A A;  2LVV A;  2ZKM X;  4GAO A;  4NDD A;  3WNX B;  1KK8 B;  2MHH A;  2BL0 B;  1ZUZ A;  4M2Q A;  4NDC A;  4JQ0 D;  1RRO A;  4PE0 A;  1B8C A;  1YUU A;  2LP3 A;  2KBM A;  4YGE B;  1LKJ A;  3NSL A;  4HRE E;  3BOW A;  2BE6 A;  2VRG A;  3I5I B;  4ETO A;  1NCY A;  1JF2 A;  2D8N A;  4YI8 A;  1UHJ A;  1WRK A;  1DF0 B;  1QAT A;  4I5N B;  1Y0V H;  2LLU A;  1LIN A;  1R6P A;  2LVJ A;  1SMG A;  2KQ6 A;  4U8D A;  1FF1 A;  2KSP A;  3O78 A;  5HKZ A;  5PAL A;  3A4U B;  1KQV A;  3PSR A;  4I5L B;  2LV7 A;  5BPJ A;  1DJI A;  4MEW A;  3AAJ A;  2KI4 C;  2MRD A;  2NCP A;  5HLV A;  1OE9 B;  5ER4 X;  1WY9 A;  3I5H B;  1XK4 A;  1EG4 A;  2L51 A;  4YGC B;  1L7Z A;  4A4B A;  3IQQ A;  1PUL A;  2JTZ A;  1UUR A;  1ALV A;  2Y1N A;  1S26 D;  1B7T Z;  1DTL A;  1S5G Y;  3JTD B;  3TS5 B;  1XFZ O;  4GGF A;  1CDL A;  1YRT B;  3OX5 A;  3EK4 A;  1NYA A;  2QPT A;  3OX6 A;  1NCZ A;  1RK9 A;  1CTR A;  1QX7 A;  4DUQ A;  4ORB B;  1QLK A;  3SIA A;  1CFP A;  2MLF C;  3I5G C;  2JUL A;  2JXC A;  5HKW A;  1NIW A;  5K89 A;  2MLE C;  3SJS A;  2PAL A;  3DVK A;  2Y1M A;  1PK0 D;  2LCP A;  1SCV A;  5JOL A;  1M46 A;  3DVJ A;  2LHI A;  4WQ2 A;  1S3P A;  2WOR A;  5AFP A;  1V1G A;  3VRP A;  1K95 A;  1BOD A;  4PHJ A;  2LMV A;  2EHB A;  2JT8 A;  4ZCU A;  3VRR A;  1WRZ A;  1ZFS A;  4CFR A;  5ER5 A;  1XO5 A;  4GNK B;  3DVM A;  5CSI A;  5GQQ C;  1SKT A;  1SNL A;  2BBM A;  2LLT A;  3SG6 A;  2KI4 B;  3PFV A;  2HET A;  1KCY A;  2WC8 A;  2ZN8 A;  5D7F A;  3GOF A;  2A4J A;  4OV2 A;  4QJ5 B;  1TNX A;  1UHH A;  2ZRT A;  2BKH B;  2MA2 A;  1A4P A;  3CLN A;  1JC2 A;  5F6T A;  2KNE A;  1MR8 A;  5I2L A;  3BUX B;  1R2U A;  1UUS A;  4QJ4 B;  1Q80 A;  2JNF A;  1V1F A;  2KQY A;  2O60 A;  1F4Q A;  1YTZ C;  1FPW A;  1MWN A;  1PAL A;  1A75 B;  5KSZ A;  1CM1 A;  1L2O C;  3OHM B;  2ZNE A;  3LL8 B;  1TNW A;  2H61 A;  3I5G B;  3FS7 A;  1D1O A;  1CLM A;  4MZL A;  1NWD A;  2WCE A;  1U5I B;  2M3W A;  3PN7 C;  2LC5 A;  3GK4 X;  1K90 D;  3LLE A;  1KFU S;  3BUO B;  2JT3 A;  1OOJ A;  2K8M B;  2Y5I A;  4I5K A;  1CKK A;  3PAL A;  2KAX A;  1JSA A;  1MXE A;  1FI5 A;  5AXI A;  1J7P A;  1BU3 A;  4MN0 A;  1G33 A;  2O5G A;  2Y4Q A;  2M7N A;  4ORC B;  2KYF A;  1K94 A;  2G9B A;  2K7O A;  4C0J A;  1UHI A;  1F8H A;  2R2I A;  1UWO A;  2L5X B;  1YR5 A;  2KGB C;  3HX4 A;  1S6C A;  4CID A;  1IQ3 A;  2JOJ A;  1SBJ A;  1UHK A;  2JZI A;  3DF0 B;  4BY4 A;  2HPS A;  2L4H A;  3I5F C;  3D0Y B;  1H8B A;  2I7A A;  1A2X A;  2M9G A;  2Q91 A;  1M63 B;  3FIA A;  1A03 A;  2SAS A;  1W7I B;  1YRU B;  2M1K B;  2WOS A;  1J1D A;  2KYC A;  3CTN A;  1L2O B;  1JFK A;  1YX8 A;  1F4O A;  1QX5 B;  1J7R A;  1LVC D;  2K0J A;  5IBW A;  4OVN F;  3AAK A;  1LA0 A;  2JC2 A;  5I8N A;  5DKR A;  3MSE B;  2BBN A;  1Y6W A;  3BQ3 A;  2K7B A;  1TTX A;  3PN7 B;  1BR1 B;  1F71 A;  4MZJ A;  4N5X A;  4WQ3 A;  2FCE A;  1TNQ A;  2M29 A;  1REC A;  3H4S E;  5DKN A;  3CR4 X;  5DKQ A;  3KEV A;  4YRU A;  1KFU L;  3EVV A;  2PRU A;  5KU1 A;  2AMI A;  1CLL A;  1OZS A;  3LK0 A;  1K9P A;  3CGA A;  4E68 A;  2TN4 A;  2ZFD A;  1EXR A;  1YUR A;  1IRJ A;  1OZO A;  4DIR A;  3OP0 A;  2L2E A;  1RWY A;  1NP8 A;  1XK4 C;  4MSP A;  1F54 A;  2F3Z A;  4PAL A;  2WND A;  1QAS A;  1DJG A;  3BUW B;  1KWO C;  3I5F B;  1WLZ A;  2K2F A;  1DMO A;  2DOQ A;  1MUX A;  3TDI A;  5KTY A;  1JBA A;  2CT9 A;  2F2P A;  1KK7 Y;  1HQV A;  4UPG A;  4N1G A;  5I2Q A;  1PSR A;  4YGB B;  5HLO A;  2LVK A;  3OB1 B;  1TN4 A;  2LLS A;  1EH2 A;  1TRF A;  3FWC A;  1A75 A;  4DRW A;  2AUC A;  2ISD A;  4MBE A;  5AAN A;  5AER A;  1CMG A;  1WLM A;  1SW8 A;  1EL4 A;  1WRL A;  1NUB A;  2M8U A;  1PVB A;  1DJX A;  2M49 B;  2CNP A;  4PCW A;  2JPT A;  1IWQ A;  1U5I A;  2ZN9 A;  3GK2 A;  1WDC C;  3SG7 A;  1K9K A;  4AQI A;  1IKU A;  1JFJ A;  1F55 A;  3EKJ A;  3M0W A;  5HYD A;  2AAO A;  1N0Y A;  2KDH A;  3NSI A;  2JQ6 A;  1NSH A;  1HT9 A;  1TOP A;  3EVU A;  3AKB A;  4GUK A;  4CPV A;  2GV5 A;  1NX0 A;  1BOC A;  1UHN A;  2HF5 A;  2OS8 C;  4GFT A;  1XVJ A;  3CWG A;  1S5G Z;  2JWW A;  4QJ3 B;  3BUM B;  3JVT C;  4CFQ A;  1BJF A;  3LK1 A;  5CSJ A;  1SY9 A;  1MXL C;  2SCP A;  1S6I A;  2F33 A;  2LP2 A;  4Q04 A;  2KGR A;  3KPX A;  1KWO B;  3VGO A;  1C7V A;  2L50 A;  3DF0 A;  1EJ3 A;  2FOT A;  1IQ5 A;  3NSK A;  4DCK A;  3TZ1 A;  1BT6 A;  1QV0 A;  1XFY O;  4N1F A;  2CXJ A;  3WHT B;  1AHR A;  2LE9 B;  4I5J A;  1ODB A;  3BUN B;  1SL9 A;  1K9U A;  1VRK A;  2E6W A;  1DJY A;  1XFW O;  2K2A A;  4ZCV A;  5AEQ A;  2HQ8 A;  4DS7 A;  2LM5 A;  1AJ4 A;  1SCM C;  2PVB A;  2OPO A;  1FW4 A;  2BEC A;  1DVI A;  2KI6 C;  1SR6 C;  1IG5 A;  3O4Y A;  2FJU B;  1S36 A;  4F0Z B;  1YX7 A;  2F3Y A;  2PAS A;  2NXQ A;  1C07 A;  1DF0 A;  3GK1 A;  4C0L A;  4GBA A;  1YUT A;  2BCB A;  4M2O A;  1CLB A;  2JNX A;  1DJW A;  4MLW A;  1WDC B;  4CLN A;  2GGZ A;  2JU0 A;  4NDB A;  1MHO A;  2KBI A;  1BR4 B;  4IL1 A;  1BG1 A;  1BF5 A;  3VRQ A;  1G8I A;  1XFX O;  1QVI Y;  2ZRS A;  3SG2 A;  2OS8 B;  2IS9 A;  3EKH A;  3K21 A;  1OMD A;  2WCB A;  2F2O A;  5CSN A;  4FTG A;  3O2P A;  1YUS A;  3JVT B;  2I94 A;  4PE1 A;  2M0R A;  4MZK A;  1B4C A;  2V53 A;  5CPV A;  2ZND A;  2KFG A;  3CS1 A;  1J7Q A;  2PMY A;  2BCX A;  2JTT A;  4XJK B;  2L98 A;  2MAZ A;  2M7L A;  3A8R A;  1DJZ A;  2BE4 A;  5JJG A;  1JUO A;  4NQG A;  1E8A A;  3TUY C;  5TNC A;  3WHU B;  1BMO A;  1KFX S;  4HRG A;  5B8I B;  1OQP A;  4ORA B;  2RGI A;  2KI6 D;  1B7T Y;  4L9M A;  2L4I A;  4PE7 A;  1M31 A;  1SCM B;  1MQ1 A;  3F45 A;  2EC6 C;  1M45 A;  1H4B A;  1OMR A;  1SR6 B;  1OMV A;  2HQW A;  1CMF A;  2K7D A;  2NCO A;  1MF8 B;  3IF7 A;  3IQO A;  5FYX A;  3DD4 A;  1J7O A;  1KQM C;  1GGW A;  4JPZ B;  1BLQ A;  1SL7 A;  2I2R E;  1CM4 A;  1NPQ A;  3OB2 B;  2KFH A;  1M39 A;  1B1G A;  4R1E A;  4WRI A;  3PLF B;  1RJV A;  1QIW A;  1XA5 A;  4GPL B;  1DJH A;  1CDP A;  1QVI Z;  2MJW B;  1ZMZ A;  1S6J A;  1W7J B;  2OTG C;  1XYD A;  1QLS A;  2JXL A;  1AVS A;  1CFD A;  3BXK A;  4OCI A;  2M1U A;  3TDU A;  2FCD A;  2K61 A;  1ZOT B;  4PHK A;  4YI9 A;  1TCO B;  3DVE A;  1Y1U A;  2NLN A;  1PSB A;  1EG3 A;  2BCA A; 
#chains in the Genus database with same CATH topology
 4HRH A;  3B86 A;  2M97 A;  1QJT A;  2LUC A;  1GJY A;  2Q4U A;  2K7C A;  1ALW A;  1X02 A;  3FWB A;  4GGF C;  2G2B A;  3VRO A;  1K96 A;  1JF0 A;  1IGV A;  1QX2 A;  1Y1X A;  3SG4 A;  3TDZ A;  3S0F A;  4USL A;  1KSM A;  3TUY B;  4XYN A;  1S1E A;  2CCM A;  1DT7 B;  1NCX A;  4PE4 A;  3ZNI A;  3UO9 A;  3WXA A;  3D78 A;  1CNP A;  1N2D A;  2LNK A;  2LAN A;  2PSR A;  5J3X A;  4YGA A;  1LA3 A;  3HCM A;  3PAT A;  2EC6 B;  2LMU A;  2LVI A;  1DGV A;  1GQM A;  1KFX L;  3KF9 A;  3BOW B;  4AOM A;  3CZT X;  1JWD A;  1SRA A;  2B1U A;  3PM8 A;  1KQM B;  3D10 A;  4TNC A;  5HKY A;  4M2P A;  4JWQ A;  3VRN A;  3EK7 A;  1C3Y A;  1F70 A;  1FBV A;  1RFJ A;  1TCF A;  1IH0 A;  4YGD B;  4BY5 A;  1XFV O;  1SPY A;  2LAP A;  2PQL A;  1QIV A;  4FQO A;  3CR5 X;  3QRX A;  5I2O A;  5I94 A;  3NSO A;  1PRW A;  3RZS A;  1SYM A;  2WCK A;  2OTG B;  1DC1 A;  4PHN A;  2CTN A;  2KAV A;  2QAC A;  4MRY A;  5CSF A;  5FI6 A;  1XFU O;  1GM0 A;  2MBX A;  4HSZ A;  3SG3 A;  4AQJ A;  1AP4 A;  2JRF A;  1QV1 A;  2E30 A;  1KSO A;  1OSA A;  2H8V A;  4OR9 B;  1KK7 Z;  1AJ5 A;  1FI6 A;  1CDM A;  1NX3 A;  3D0Y A;  1K8U A;  1K93 D;  1AK8 A;  1CFF A;  1XFR A;  3NXA A;  5G08 A;  2KOT A;  2KHN A;  3D73 A;  3RLZ A;  4XJK A;  1K2H A;  3BYA A;  1TNP A;  1Z4H A;  2CBL A;  3RM1 A;  4MVF A;  1SK6 D;  1YVH A;  3O6B A;  2GGM A;  2KFF A;  1OOI X;  1KK8 C;  3FE6 A;  3CR2 A;  2F8P A;  2H61 C;  2BL0 C;  3OGN A;  3KHE A;  2WC5 A;  2WCF A;  5D3O A;  3C1V A;  2NZ0 A;  3D74 A;  1J1E A;  1NX2 A;  3EVR A;  1N65 A;  4YBH B;  3AKA A;  5HL1 A;  1G4Y R;  4P2Y B;  1ZAC A;  1CDN A;  1QTX A;  1IJ6 A;  2JT0 A;  2LHL A;  3I5I C;  3SIB A;  1J55 A;  1B8L A;  1DGU A;  4PDZ A;  2BKI B;  4C0K A;  1W9Z A;  3E3R A;  1CB1 A;  2L0P A;  1AUI B;  4D1E A;  1TIZ A;  5FI2 A;  1SL8 A;  1A29 A;  3ZWH A;  1B8R A;  1IJ5 A;  3V2L A;  1LXF C;  4P5O E;  1CFC A;  2KAY A;  3EK8 A;  1SSE B;  3OBV A;  1NX1 A;  1YVL A;  2LUX A;  1RTP 1;  3I5H C;  2WCJ A;  1QXP A;  1C3Z A;  3KO0 A;  3SG5 A;  2I18 A;  1Y1A A;  1QS7 A;  2COL B;  3LCP C;  1B47 A;  4GGN A;  3ICB A;  1C7W A;  2EGD A;  4OKH A;  1UP5 A;  2LMT A;  5D69 A;  4A4C A;  3S0B A;  3B87 A;  1PVA A;  3JTD C;  4ICB A;  2P6B B;  4MRX A;  2YGU A;  1GGZ A;  2H2K A;  4PHM A;  3TS5 C;  1B9A A;  3NHT A;  2LVV A;  2ZKM X;  4GAO A;  4NDD A;  3WNX B;  2QDI A;  1KK8 B;  2MHH A;  2QEB A;  2BL0 B;  1ZUZ A;  4M2Q A;  4NDC A;  4INX A;  2WCH A;  4JQ0 D;  1RRO A;  4PE0 A;  1B8C A;  1YUU A;  3VB1 A;  2LP3 A;  2KBM A;  3D77 A;  4YGE B;  1LKJ A;  3NSL A;  4HRE E;  3BOW A;  2BE6 A;  2VRG A;  3I5I B;  4ETO A;  1NCY A;  1JF2 A;  2D8N A;  4YI8 A;  1UHJ A;  1WRK A;  3BFB A;  1DF0 B;  1QAT A;  4I5N B;  1Y0V H;  2LLU A;  1LIN A;  1R6P A;  2LVJ A;  1SMG A;  2KQ6 A;  4U8D A;  1FF1 A;  2KSP A;  3O78 A;  5HKZ A;  5PAL A;  4KYN A;  3A4U B;  1KQV A;  3PSR A;  4I5L B;  2LV7 A;  5BPJ A;  1DJI A;  4MEW A;  3AAJ A;  2P71 A;  2KI4 C;  2QEV A;  2MRD A;  2NCP A;  5HLV A;  1OE9 B;  5ER4 X;  1WY9 A;  3I5H B;  1XK4 A;  3CZ1 A;  1EG4 A;  2L51 A;  2BAP A;  1IIO A;  4YGC B;  1L7Z A;  1TUZ A;  2KLD A;  4A4B A;  4JD9 A;  3IQQ A;  1PUL A;  2JTZ A;  1UUR A;  1ALV A;  2Y1N A;  1S26 D;  1B7T Z;  1DTL A;  1S5G Y;  3JTD B;  3TS5 B;  1XFZ O;  4GGF A;  1CDL A;  1YRT B;  3OX5 A;  3EK4 A;  1NYA A;  2QPT A;  3OX6 A;  1NCZ A;  3SS4 A;  1RK9 A;  1CTR A;  1OW4 A;  1QX7 A;  4DUQ A;  4ORB B;  3FE8 A;  1QLK A;  3SIA A;  1CFP A;  2MLF C;  3I5G C;  2JUL A;  2JXC A;  5HKW A;  1NIW A;  5K89 A;  2MLE C;  3SJS A;  2PAL A;  3DVK A;  2Y1M A;  1PK0 D;  2LCP A;  1SCV A;  5JOL A;  1M46 A;  3DVJ A;  2LHI A;  4WQ2 A;  1S3P A;  2WOR A;  5AFP A;  1V1G A;  3VRP A;  1K95 A;  1BOD A;  4PHJ A;  2LMV A;  2EHB A;  2JT8 A;  4ZCU A;  3VRR A;  5DIC A;  1WRZ A;  1ZFS A;  4CFR A;  5ER5 A;  1XO5 A;  4GNK B;  3DVM A;  5CSI A;  5GQQ C;  1SKT A;  3S0G A;  1SNL A;  2BBM A;  2LLT A;  3SG6 A;  2KI4 B;  3PFV A;  2HET A;  5EL2 A;  2WC8 A;  1KCY A;  2ZN8 A;  3S0E A;  5D7F A;  3CDN A;  2A4J A;  3GOF A;  4OV2 A;  4PT1 A;  4QJ5 B;  1OOG A;  1TNX A;  1UHH A;  2ZRT A;  2BKH B;  1DQE A;  2MA2 A;  1A4P A;  3CLN A;  1JC2 A;  5F6T A;  2KNE A;  1MR8 A;  5I2L A;  3BUX B;  1R2U A;  1UUS A;  4QJ4 B;  1Q80 A;  2JNF A;  3D76 A;  1V1F A;  2KQY A;  2O60 A;  1F4Q A;  1YTZ C;  1FPW A;  1MWN A;  1PAL A;  1A75 B;  3L4A A;  1CM1 A;  3FE9 A;  5KSZ A;  3K1E A;  3BFA A;  1L2O C;  2JPO A;  3OHM B;  2BNX A;  2ZNE A;  3LL8 B;  1TNW A;  2H61 A;  3I5G B;  2BCA A;  3FS7 A;  1D1O A;  1CLM A;  4MZL A;  1NWD A;  2WCE A;  1U5I B;  2M3W A;  3PN7 C;  2LC5 A;  3GK4 X;  1K90 D;  3LLE A;  1KFU S;  3BUO B;  2JT3 A;  1OOJ A;  2K8M B;  2Y5I A;  4I5K A;  3PM2 A;  1CKK A;  3PAL A;  2KAX A;  1JSA A;  1MXE A;  1FI5 A;  5AXI A;  1J7P A;  1BU3 A;  4MN0 A;  1G33 A;  2O5G A;  2Y4Q A;  2M7N A;  3BFH A;  3NHI A;  2KYF A;  4ORC B;  1K94 A;  2G9B A;  2K7O A;  1Z2C B;  1UHI A;  4C0J A;  2R2I A;  1F8H A;  1UWO A;  2L5X B;  1YR5 A;  2KGB C;  3HX4 A;  1S6C A;  4CID A;  1IQ3 A;  2JOJ A;  1SBJ A;  1UHK A;  2JZI A;  3DF0 B;  4BY4 A;  2HPS A;  2L4H A;  3I5F C;  3D0Y B;  1H8B A;  2I7A A;  1A2X A;  2M9G A;  2Q91 A;  1M63 B;  3FIA A;  1A03 A;  2SAS A;  1W7I B;  1YRU B;  2M1K B;  2WOS A;  1J1D A;  2L5Y A;  2KYC A;  3SS5 A;  3CTN A;  1L2O B;  1JFK A;  1YX8 A;  1F4O A;  1QX5 B;  1J7R A;  1LVC D;  1T14 A;  2K0J A;  5IBW A;  4OVN F;  3AAK A;  1LA0 A;  2JC2 A;  5I8N A;  5DKR A;  2FJY A;  3MSE B;  2BBN A;  3D75 A;  2K60 A;  4IJ7 A;  1Y6W A;  3BQ3 A;  1TWO A;  2K7B A;  1TTX A;  3O4X A;  3PN7 B;  1BR1 B;  1F71 A;  4MZJ A;  4N5X A;  4WQ3 A;  2FCE A;  1TNQ A;  2M29 A;  1REC A;  3H4S E;  5DKN A;  3CR4 X;  5DKQ A;  3KEV A;  4YRU A;  1KFU L;  3EVV A;  2PRU A;  5KU1 A;  2AMI A;  4INW A;  1CLL A;  3DXL A;  1OZS A;  3LK0 A;  1K9P A;  3CGA A;  4E68 A;  2TN4 A;  2ZFD A;  1EXR A;  1YUR A;  2QEO A;  1IRJ A;  1OZO A;  4DIR A;  3OP0 A;  2L2E A;  1RWY A;  1NP8 A;  1XK4 C;  4MSP A;  3S0A A;  1F54 A;  2F3Z A;  2L2C A;  4PAL A;  2WND A;  1QAS A;  1DJG A;  3BUW B;  1KWO C;  3I5F B;  1WLZ A;  2K2F A;  1DMO A;  2DOQ A;  1MUX A;  3TDI A;  5KTY A;  1JBA A;  2CT9 A;  2F2P A;  2ERB A;  1KK7 Y;  3B6X A;  1HQV A;  4UPG A;  4N1G A;  5I2Q A;  1PSR A;  4YGB B;  5HLO A;  2LVK A;  3OB1 B;  3N7H A;  1TN4 A;  2LLS A;  2WCL A;  1DEK A;  1EH2 A;  2P70 A;  1LS8 A;  1TRF A;  3FWC A;  4OZD A;  1A75 A;  3PJI A;  4JKT A;  2AUC A;  2ISD A;  4MBE A;  4DRW A;  5AAN A;  5AER A;  3S0D A;  1CMG A;  1WLM A;  1SW8 A;  1EL4 A;  1WRL A;  1NUB A;  2M8U A;  1PVB A;  3QME A;  1DJX A;  2M49 B;  2CNP A;  4PCW A;  2JPT A;  1IWQ A;  1U5I A;  2ZN9 A;  3GK2 A;  1WDC C;  5FI7 A;  1K9K A;  3SG7 A;  4AQI A;  1IKU A;  1JFJ A;  1F55 A;  2KPH A;  3EKJ A;  3M0W A;  5HYD A;  2AAO A;  1N0Y A;  2KDH A;  3NSI A;  2JQ6 A;  1NSH A;  1HT9 A;  1TOP A;  3EVU A;  3R1O A;  3AKB A;  4GUK A;  4CPV A;  2GV5 A;  1NX0 A;  1BOC A;  1DEL A;  1UHN A;  2HF5 A;  2OS8 C;  4GFT A;  1XVJ A;  3CWG A;  1S5G Z;  2JWW A;  1OOF A;  4QJ3 B;  3BUM B;  3JVT C;  4CFQ A;  1BJF A;  3LK1 A;  5CSJ A;  1SY9 A;  1MXL C;  2SCP A;  1S6I A;  1TUJ A;  2F33 A;  2LP2 A;  4Q04 A;  2KGR A;  3KPX A;  1KWO B;  3VGO A;  1C7V A;  2L50 A;  3DF0 A;  1EJ3 A;  2FOT A;  1IQ5 A;  2WCM A;  3NSK A;  4DCK A;  3TZ1 A;  1BT6 A;  1QV0 A;  1XFY O;  3Q8I A;  4N1F A;  2CXJ A;  3WHT B;  1P28 A;  1AHR A;  2LE9 B;  3B7A A;  3L4L A;  4I5J A;  1ODB A;  3BUN B;  3R1P A;  1SL9 A;  1VRK A;  2E6W A;  1DJY A;  1XFW O;  2K2A A;  4ZCV A;  5AEQ A;  2HQ8 A;  4DS7 A;  2LM5 A;  1AJ4 A;  1QWV A;  1SCM C;  2PVB A;  2OPO A;  1FW4 A;  2BEC A;  1DVI A;  2KI6 C;  1SR6 C;  1IG5 A;  3O4Y A;  2FJU B;  1S36 A;  4F0Z B;  1YX7 A;  2F3Y A;  2PAS A;  2NXQ A;  1C07 A;  1DF0 A;  3CAB A;  3GK1 A;  4C0L A;  4GBA A;  1YUT A;  2BCB A;  4M2O A;  3UNW A;  1CLB A;  2JNX A;  1DJW A;  4MLW A;  1WDC B;  2WC6 A;  4CLN A;  2GGZ A;  2JU0 A;  4NDB A;  1MHO A;  3BJH A;  4FQT A;  2KBI A;  1BR4 B;  4IL1 A;  1BG1 A;  1BF5 A;  3VRQ A;  1G8I A;  1ORG A;  1XFX O;  1QVI Y;  2ZRS A;  3SG2 A;  3IVT A;  2OS8 B;  2IS9 A;  3EKH A;  3K21 A;  1OMD A;  2WCB A;  3DY9 A;  2F2O A;  3L47 A;  5CSN A;  4FTG A;  3O2P A;  1YUS A;  3SS3 A;  3JVT B;  2I94 A;  4PE1 A;  2M0R A;  4MZK A;  1B4C A;  2V53 A;  3DZT A;  2ZND A;  3B88 A;  2KFG A;  3CS1 A;  2KLE A;  3R1V A;  5CPV A;  1J7Q A;  2PMY A;  2BCX A;  2JTT A;  4XJK B;  2L98 A;  2MAZ A;  3R72 A;  2M7L A;  4F7F A;  3A8R A;  1DJZ A;  2BE4 A;  5JJG A;  3CYZ A;  1JUO A;  4NQG A;  1E8A A;  3TUY C;  3DYE A;  5TNC A;  3WHU B;  1BMO A;  1KFX S;  2QEH A;  3EG5 B;  4HRG A;  5B8I B;  1OQP A;  4ORA B;  2RGI A;  2KI6 D;  3NGV A;  1B7T Y;  1OOH A;  2L4I A;  4L9M A;  4PE7 A;  1M31 A;  1SCM B;  1MQ1 A;  3F45 A;  2EC6 C;  3CZ2 A;  1M45 A;  1H4B A;  1OMR A;  1SR6 B;  1OMV A;  2HQW A;  1CMF A;  2K7D A;  2NCO A;  1MF8 B;  2PYQ A;  3IF7 A;  3IQO A;  5FYX A;  2GTE A;  3DD4 A;  1J7O A;  1KQM C;  1GGW A;  4JPZ B;  1BLQ A;  1SL7 A;  2I2R E;  1CM4 A;  1NPQ A;  3OB2 B;  2KFH A;  1M39 A;  1B1G A;  4R1E A;  4WRI A;  3PLF B;  1RJV A;  1QIW A;  1XA5 A;  4GPL B;  1DJH A;  1CDP A;  1QVI Z;  2MJW B;  1ZMZ A;  1S6J A;  1W7J B;  2OTG C;  1XYD A;  1QLS A;  2JXL A;  1AVS A;  1CFD A;  3BXK A;  4OCI A;  2M1U A;  3TDU A;  2FCD A;  2K61 A;  1ZOT B;  4PHK A;  4YI9 A;  1TCO B;  3CZ0 A;  3DVE A;  1Y1U A;  2NLN A;  1PSB A;  1EG3 A;  1K9U A; 
#chains in the Genus database with same CATH homology
 4HRH A;  2M97 A;  1QJT A;  2LUC A;  1GJY A;  2Q4U A;  2K7C A;  1ALW A;  1X02 A;  3FWB A;  4GGF C;  2G2B A;  3VRO A;  1K96 A;  1JF0 A;  1IGV A;  1QX2 A;  1Y1X A;  3SG4 A;  3TDZ A;  4USL A;  1KSM A;  3TUY B;  4XYN A;  1S1E A;  2CCM A;  1DT7 B;  1NCX A;  4PE4 A;  3ZNI A;  3WXA A;  1CNP A;  1N2D A;  2LNK A;  2LAN A;  2PSR A;  5J3X A;  4YGA A;  1LA3 A;  3HCM A;  3PAT A;  2EC6 B;  2LMU A;  2LVI A;  1DGV A;  1GQM A;  1KFX L;  3KF9 A;  3BOW B;  4AOM A;  3CZT X;  1JWD A;  1SRA A;  2B1U A;  3PM8 A;  1KQM B;  3D10 A;  4TNC A;  5HKY A;  4M2P A;  4JWQ A;  3VRN A;  3EK7 A;  1F70 A;  1FBV A;  1RFJ A;  1TCF A;  1IH0 A;  4YGD B;  4BY5 A;  1XFV O;  1SPY A;  2LAP A;  1QIV A;  4FQO A;  3CR5 X;  3QRX A;  5I2O A;  3NSO A;  1PRW A;  1SYM A;  2OTG B;  4PHN A;  2CTN A;  2KAV A;  2QAC A;  4MRY A;  5CSF A;  1XFU O;  2MBX A;  4HSZ A;  3SG3 A;  4AQJ A;  1AP4 A;  2JRF A;  1QV1 A;  2E30 A;  1KSO A;  1OSA A;  4OR9 B;  1KK7 Z;  1AJ5 A;  1FI6 A;  1CDM A;  1NX3 A;  3D0Y A;  1K8U A;  1K93 D;  1AK8 A;  1CFF A;  3NXA A;  5G08 A;  2KOT A;  2KHN A;  3RLZ A;  4XJK A;  1K2H A;  3BYA A;  1TNP A;  2CBL A;  3RM1 A;  4MVF A;  1SK6 D;  1YVH A;  3O6B A;  2GGM A;  2KFF A;  1KK8 C;  3CR2 A;  2F8P A;  2H61 C;  2BL0 C;  3KHE A;  2WCF A;  3C1V A;  2NZ0 A;  1J1E A;  1NX2 A;  3EVR A;  1N65 A;  4YBH B;  3AKA A;  1G4Y R;  4P2Y B;  1ZAC A;  1CDN A;  1QTX A;  1IJ6 A;  2JT0 A;  2LHL A;  3I5I C;  3SIB A;  1J55 A;  1B8L A;  1DGU A;  4PDZ A;  2BKI B;  4C0K A;  3E3R A;  1CB1 A;  2L0P A;  1AUI B;  4D1E A;  1TIZ A;  1SL8 A;  1A29 A;  3ZWH A;  1B8R A;  1IJ5 A;  1LXF C;  4P5O E;  1CFC A;  2KAY A;  3EK8 A;  1NX1 A;  1YVL A;  2LUX A;  1RTP 1;  3I5H C;  1QXP A;  3KO0 A;  3SG5 A;  2I18 A;  1Y1A A;  1QS7 A;  2COL B;  3LCP C;  1B47 A;  4GGN A;  3ICB A;  1C7W A;  2EGD A;  4OKH A;  1UP5 A;  2LMT A;  5D69 A;  4A4C A;  1PVA A;  3JTD C;  4ICB A;  2P6B B;  4MRX A;  4PHM A;  1GGZ A;  2H2K A;  3TS5 C;  1B9A A;  2LVV A;  2ZKM X;  4GAO A;  4NDD A;  3WNX B;  1KK8 B;  2MHH A;  2BL0 B;  1ZUZ A;  4M2Q A;  4NDC A;  4JQ0 D;  1RRO A;  4PE0 A;  1B8C A;  1YUU A;  2LP3 A;  2KBM A;  4YGE B;  1LKJ A;  3NSL A;  4HRE E;  3BOW A;  2BE6 A;  2VRG A;  3I5I B;  4ETO A;  1NCY A;  1JF2 A;  2D8N A;  4YI8 A;  1UHJ A;  1WRK A;  1DF0 B;  1QAT A;  4I5N B;  1Y0V H;  2LLU A;  1LIN A;  1R6P A;  2LVJ A;  1SMG A;  2KQ6 A;  4U8D A;  1FF1 A;  2KSP A;  3O78 A;  5HKZ A;  5PAL A;  3A4U B;  1KQV A;  3PSR A;  4I5L B;  2LV7 A;  5BPJ A;  1DJI A;  4MEW A;  3AAJ A;  2KI4 C;  2MRD A;  2NCP A;  5HLV A;  1OE9 B;  5ER4 X;  1WY9 A;  3I5H B;  1XK4 A;  1EG4 A;  2L51 A;  4YGC B;  1L7Z A;  4A4B A;  3IQQ A;  1PUL A;  2JTZ A;  1UUR A;  1ALV A;  2Y1N A;  1S26 D;  1B7T Z;  1DTL A;  1S5G Y;  3JTD B;  3TS5 B;  1XFZ O;  4GGF A;  1CDL A;  1YRT B;  3OX5 A;  3EK4 A;  1NYA A;  2QPT A;  3OX6 A;  1NCZ A;  1RK9 A;  1CTR A;  1QX7 A;  4DUQ A;  4ORB B;  1QLK A;  3SIA A;  1CFP A;  2MLF C;  3I5G C;  2JUL A;  2JXC A;  5HKW A;  1NIW A;  5K89 A;  2MLE C;  3SJS A;  2PAL A;  3DVK A;  2Y1M A;  1PK0 D;  2LCP A;  1SCV A;  5JOL A;  1M46 A;  3DVJ A;  2LHI A;  4WQ2 A;  1S3P A;  2WOR A;  5AFP A;  1V1G A;  3VRP A;  1K95 A;  1BOD A;  4PHJ A;  2LMV A;  2EHB A;  2JT8 A;  4ZCU A;  3VRR A;  1WRZ A;  1ZFS A;  4CFR A;  5ER5 A;  1XO5 A;  4GNK B;  3DVM A;  5CSI A;  5GQQ C;  1SKT A;  1SNL A;  2BBM A;  2LLT A;  3SG6 A;  2KI4 B;  3PFV A;  2HET A;  1KCY A;  2WC8 A;  2ZN8 A;  5D7F A;  3GOF A;  2A4J A;  4OV2 A;  4QJ5 B;  1TNX A;  1UHH A;  2ZRT A;  2BKH B;  2MA2 A;  1A4P A;  3CLN A;  1JC2 A;  5F6T A;  2KNE A;  1MR8 A;  5I2L A;  3BUX B;  1R2U A;  1UUS A;  4QJ4 B;  1Q80 A;  2JNF A;  1V1F A;  2KQY A;  2O60 A;  1F4Q A;  1YTZ C;  1FPW A;  1MWN A;  1PAL A;  1A75 B;  5KSZ A;  1CM1 A;  1L2O C;  3OHM B;  2ZNE A;  3LL8 B;  1TNW A;  2H61 A;  3I5G B;  3FS7 A;  1D1O A;  1CLM A;  4MZL A;  1NWD A;  2WCE A;  1U5I B;  2M3W A;  3PN7 C;  2LC5 A;  3GK4 X;  1K90 D;  3LLE A;  1KFU S;  3BUO B;  2JT3 A;  1OOJ A;  2K8M B;  2Y5I A;  4I5K A;  1CKK A;  3PAL A;  2KAX A;  1JSA A;  1MXE A;  1FI5 A;  5AXI A;  1J7P A;  1BU3 A;  4MN0 A;  1G33 A;  2O5G A;  2Y4Q A;  2M7N A;  4ORC B;  2KYF A;  1K94 A;  2G9B A;  2K7O A;  4C0J A;  1UHI A;  1F8H A;  2R2I A;  1UWO A;  2L5X B;  1YR5 A;  2KGB C;  3HX4 A;  1S6C A;  4CID A;  1IQ3 A;  2JOJ A;  1SBJ A;  1UHK A;  2JZI A;  3DF0 B;  4BY4 A;  2HPS A;  2L4H A;  3I5F C;  3D0Y B;  1H8B A;  2I7A A;  1A2X A;  2M9G A;  2Q91 A;  1M63 B;  3FIA A;  1A03 A;  2SAS A;  1W7I B;  1YRU B;  2M1K B;  2WOS A;  1J1D A;  2KYC A;  3CTN A;  1L2O B;  1JFK A;  1YX8 A;  1F4O A;  1QX5 B;  1J7R A;  1LVC D;  2K0J A;  5IBW A;  4OVN F;  3AAK A;  1LA0 A;  2JC2 A;  5I8N A;  5DKR A;  3MSE B;  2BBN A;  1Y6W A;  3BQ3 A;  2K7B A;  1TTX A;  3PN7 B;  1BR1 B;  1F71 A;  4MZJ A;  4N5X A;  4WQ3 A;  2FCE A;  1TNQ A;  2M29 A;  1REC A;  3H4S E;  5DKN A;  3CR4 X;  5DKQ A;  3KEV A;  4YRU A;  1KFU L;  3EVV A;  2PRU A;  5KU1 A;  2AMI A;  1CLL A;  1OZS A;  3LK0 A;  1K9P A;  3CGA A;  4E68 A;  2TN4 A;  2ZFD A;  1EXR A;  1YUR A;  1IRJ A;  1OZO A;  4DIR A;  3OP0 A;  2L2E A;  1RWY A;  1NP8 A;  1XK4 C;  4MSP A;  1F54 A;  2F3Z A;  4PAL A;  2WND A;  1QAS A;  1DJG A;  3BUW B;  1KWO C;  3I5F B;  1WLZ A;  2K2F A;  1DMO A;  2DOQ A;  1MUX A;  3TDI A;  5KTY A;  1JBA A;  2CT9 A;  2F2P A;  1KK7 Y;  1HQV A;  4UPG A;  4N1G A;  5I2Q A;  1PSR A;  4YGB B;  5HLO A;  2LVK A;  3OB1 B;  1TN4 A;  2LLS A;  1EH2 A;  1TRF A;  3FWC A;  1A75 A;  4DRW A;  2AUC A;  2ISD A;  4MBE A;  5AAN A;  5AER A;  1CMG A;  1WLM A;  1SW8 A;  1EL4 A;  1WRL A;  1NUB A;  2M8U A;  1PVB A;  1DJX A;  2M49 B;  2CNP A;  4PCW A;  2JPT A;  1IWQ A;  1U5I A;  2ZN9 A;  3GK2 A;  1WDC C;  3SG7 A;  1K9K A;  4AQI A;  1IKU A;  1JFJ A;  1F55 A;  3EKJ A;  3M0W A;  5HYD A;  2AAO A;  1N0Y A;  2KDH A;  3NSI A;  2JQ6 A;  1NSH A;  1HT9 A;  1TOP A;  3EVU A;  3AKB A;  4GUK A;  4CPV A;  2GV5 A;  1NX0 A;  1BOC A;  1UHN A;  2HF5 A;  2OS8 C;  4GFT A;  1XVJ A;  3CWG A;  1S5G Z;  2JWW A;  4QJ3 B;  3BUM B;  3JVT C;  4CFQ A;  1BJF A;  3LK1 A;  5CSJ A;  1SY9 A;  1MXL C;  2SCP A;  1S6I A;  2F33 A;  2LP2 A;  4Q04 A;  2KGR A;  3KPX A;  1KWO B;  3VGO A;  1C7V A;  2L50 A;  3DF0 A;  1EJ3 A;  2FOT A;  1IQ5 A;  3NSK A;  4DCK A;  3TZ1 A;  1BT6 A;  1QV0 A;  1XFY O;  4N1F A;  2CXJ A;  3WHT B;  1AHR A;  2LE9 B;  4I5J A;  1ODB A;  3BUN B;  1SL9 A;  1K9U A;  1VRK A;  2E6W A;  1DJY A;  1XFW O;  2K2A A;  4ZCV A;  5AEQ A;  2HQ8 A;  4DS7 A;  2LM5 A;  1AJ4 A;  1SCM C;  2PVB A;  2OPO A;  1FW4 A;  2BEC A;  1DVI A;  2KI6 C;  1SR6 C;  1IG5 A;  3O4Y A;  2FJU B;  1S36 A;  4F0Z B;  1YX7 A;  2F3Y A;  2PAS A;  2NXQ A;  1C07 A;  1DF0 A;  3GK1 A;  4C0L A;  4GBA A;  1YUT A;  2BCB A;  4M2O A;  1CLB A;  2JNX A;  1DJW A;  4MLW A;  1WDC B;  4CLN A;  2GGZ A;  2JU0 A;  4NDB A;  1MHO A;  2KBI A;  1BR4 B;  4IL1 A;  1BG1 A;  1BF5 A;  3VRQ A;  1G8I A;  1XFX O;  1QVI Y;  2ZRS A;  3SG2 A;  2OS8 B;  2IS9 A;  3EKH A;  3K21 A;  1OMD A;  2WCB A;  2F2O A;  5CSN A;  4FTG A;  3O2P A;  1YUS A;  3JVT B;  2I94 A;  4PE1 A;  2M0R A;  4MZK A;  1B4C A;  2V53 A;  5CPV A;  2ZND A;  2KFG A;  3CS1 A;  1J7Q A;  2PMY A;  2BCX A;  2JTT A;  4XJK B;  2L98 A;  2MAZ A;  2M7L A;  3A8R A;  1DJZ A;  2BE4 A;  5JJG A;  1JUO A;  4NQG A;  1E8A A;  3TUY C;  5TNC A;  3WHU B;  1BMO A;  1KFX S;  4HRG A;  5B8I B;  1OQP A;  4ORA B;  2RGI A;  2KI6 D;  1B7T Y;  4L9M A;  2L4I A;  4PE7 A;  1M31 A;  1SCM B;  1MQ1 A;  3F45 A;  2EC6 C;  1M45 A;  1H4B A;  1OMR A;  1SR6 B;  1OMV A;  2HQW A;  1CMF A;  2K7D A;  2NCO A;  1MF8 B;  3IF7 A;  3IQO A;  5FYX A;  3DD4 A;  1J7O A;  1KQM C;  1GGW A;  4JPZ B;  1BLQ A;  1SL7 A;  2I2R E;  1CM4 A;  1NPQ A;  3OB2 B;  2KFH A;  1M39 A;  1B1G A;  4R1E A;  4WRI A;  3PLF B;  1RJV A;  1QIW A;  1XA5 A;  4GPL B;  1DJH A;  1CDP A;  1QVI Z;  2MJW B;  1ZMZ A;  1S6J A;  1W7J B;  2OTG C;  1XYD A;  1QLS A;  2JXL A;  1AVS A;  1CFD A;  3BXK A;  4OCI A;  2M1U A;  3TDU A;  2FCD A;  2K61 A;  1ZOT B;  4PHK A;  4YI9 A;  1TCO B;  3DVE A;  1Y1U A;  2NLN A;  1PSB A;  1EG3 A;  2BCA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...