1SL8A

Calcium-loaded apo-aequorin from aequorea victoria
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
181
structure length
181
Chain Sequence
NPKWIGRHKHMFNFLDVNHNGRISLDEMVYKASDIVINNLGATPEQAKRHKDAVEAFFGGAGMKYGVETEWPEYIEGWKRLASEELKRYSKNQITLIRLWGDALFDIIDKDQNGAISLDEWKAYTKSAGIIQSSEDCEETFRVCDIDESGQLDVDEMTRQHLGFWYTMDPACEKLYGGAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aequorin 1
publication title All three Ca2+-binding loops of photoproteins bind calcium ions: The crystal structures of calcium-loaded apo-aequorin and apo-obelin.
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Luminescent protein
total genus 73
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 2004-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1sl8A00
4YGDB 3TUYC 4CLNA 1CFPA 3IQQA 3DVKA 1LXFC 1UHIA 1S26D 1RK9A 2LLTA 4ORBB 4YGBB 1F55A 1XFXO 2D8NA 5DKQA 3TS5B 2PMYA 2ZNDA 2K7DA 1TNQA 3EK7A 5D69A 4CFQA 2M1UA 1JF2A 2PASA 1QLKA 1K2HA 3DF0A 3O4YA 2ZN9A 1B8LA 2K2AA 3I5HB 1KFXL 2SASA 3O2PA 1DT7B 2GGZA 1N2DA 2WOSA 1M46A 1RECA 1EG4A 3KO0A 2F3YA 2ZRSA 2Y5IA 4YBHB 1FBVA 1ZUZA 2COLB 1JC2A 1OSAA 1U5IA 4GGFA 2JTTA 1FW4A 4MEWA 4PE4A 3EK4A 1EG3A 2M3WA 3VRQA 1W7IB 1B7TZ 1S6JA 1QASA 2BL0C 1IKUA 3EVUA 1KQMC 4N5XA 1A2XA 2JULA 1F70A 3JVTB 3O78A 4YI8A 1SK6D 2KFHA 1J7RA 1FPWA 4GBAA 1MF8B 1XYDA 2VRGA 1YRTB 1K93D 3IF7A 1WRLA 2L4HA 3GK1A 4GFTA 2JNXA 1CTRA 4GGFC 2M29A 5CSIA 2BCXA 2JWWA 1F4QA 2JXLA 2M7LA 2JXCA 2KHNA 5HKZA 1ZMZA 1S6IA 1QXPA 3CZTX 2LMVA 2G2BA 4Q04A 2GGMA 1F8HA 1DJYA 1TRFA 2F3ZA 4XYNA 2M49B 2LVJA 2KSPA 3EKJA 4QJ3B 2H2KA 2BCAA 3BUXB 3PLFB 1EXRA 1IGVA 1ZFSA 1IJ6A 1DTLA 2I2RE 3WNXB 1MUXA 4WQ3A 1JBAA 4JPZB 1ALVA 4JWQA 1YTZC 3I5GB 3EVVA 2SCPA 1TNXA 1BU3A 1SNLA 1SL7A 2KBIA 1K95A 4MSPA 1CMFA 3LK0A 1EL4A 1Y1UA 4BY5A 1NCYA 4PHKA 1AUIB 4PHJA 3SG3A 2JT8A 4GNKB 2WC8A 3I5IC 1OMDA 1TCFA 4UPGA 2LV7A 1CDNA 1PULA 1QJTA 4NDDA 3OB2B 1M63B 4I5LB 3OHMB 3BUWB 1NPQA 1PK0D 2KFFA 1DJGA 4D1EA 1NYAA 1N65A 2EC6C 4OKHA 3PALA 1CLBA 2LM5A 2KQ6A 2CT9A 3RM1A 2JPTA 2KI6C 2WCBA 2ZFDA 1JWDA 3KEVA 5CSJA 2KAYA 2KDHA 4PE1A 1CDLA 3VRNA 5JJGA 1OQPA 3NSIA 5G08A 5HLOA 3BUOB 1FI5A 4WQ2A 2L98A 2MA2A 1M45A 5I2OA 1KFUL 1OMVA 3E3RA 1KWOB 1XVJA 1CFCA 2LVIA 3HCMA 2CXJA 2L5XB 2LVVA 3H4SE 3RLZA 1DF0B 2MLFC 1UWOA 1N0YA 3EK8A 2HF5A 1S6CA 1YUTA 1YX7A 2CBLA 5HYDA 5K89A 1G33A 3PSRA 1IWQA 4GPLB 2F33A 2JT3A 4XJKB 1EJ3A 3BYAA 1MQ1A 2BE6A 1EH2A 1K9UA 1KK8B 2OS8C 2ZNEA 1C7VA 1K94A 2LAPA 3PATA 1IG5A 2NCPA 1C07A 1DMOA 1BLQA 3I5FB 1QVIY 1RJVA 1S3PA 2K0JA 3SIBA 3SG4A 1E8AA 1ZOTB 1M39A 1SBJA 1AJ4A 1SCMB 1NWDA 1UURA 1UUSA 2EHBA 1D1OA 3AKAA 4R1EA 1L2OC 2Y1NA 5HKWA 4M2PA 4PHMA 4A4BA 3BOWB 1PSBA 1TCOB 3FS7A 3SG7A 1Y0VH 3SJSA 1BR1B 1VRKA 2I7AA 1NSHA 1WDCC 2M8UA 3TUYB 5HKYA 3SG6A 3OX5A 1CDMA 2H61A 3KF9A 2I94A 3LLEA 2G9BA 1XO5A 1XFYO 1SR6C 1UHJA 1B4CA 2JZIA 1PSRA 5CSNA 3AAKA 1AHRA 2K7CA 1XFUO 2ZRTA 4FQOA 1WLZA 2K61A 4PALA 1NUBA 1QVIZ 1QX2A 2Q4UA 4I5KA 1MR8A 2OTGC 4OV2A 1J7OA 1KQVA 4CFRA 4PCWA 3MSEB 1SMGA 5DKRA 2KI6D 4DRWA 2BBNA 2JC2A 1DJHA 1SPYA 3BQ3A 1DJIA 1MXEA 2JOJA 4PE7A 4QJ4B 3DF0B 1YX8A 2BL0B 1IH0A 1KQMB 2AUCA 2KAXA 2MAZA 1R2UA 1ODBA 1XFWO 2BKHB 4OR9B 1NIWA 2JRFA 1Y1AA 4OCIA 5B8IB 4DCKA 4MZKA 1NX0A 2WORA 1B9AA 4HRGA 1U5IB 2CTNA 1SCVA 4MRXA 3KHEA 4MLWA 2Y4QA 1H8BA 3VRRA 2R2IA 4YGAA 1GQMA 4ORAB 1QX5B 2PSRA 1SYMA 1KSOA 1NCXA 2BKIB 4IL1A 1KSMA 1BODA 3PM8A 2DOQA 4YGEB 3PN7C 5GQQC 2GV5A 1K96A 1KCYA 2BE4A 2KYFA 4P2YB 3PFVA 1SY9A 2NLNA 2MRDA 3CR2A 5AFPA 1NX3A 1SL8A 3CS1A 1F54A 1JSAA 1KFXS 1CLLA 3OP0A 1BF5A 1BOCA 5F6TA 1GGWA 1W7JB 2LANA 1TNWA 5J3XA 4ZCUA 1LA3A 5ER4X 1TTXA 2M9GA 1OOJA 2LP2A 2BECA 5I8NA 4MZJA 4NDBA 4PE0A 3D10A 5KU1A 2CCMA 1LVCD 1YRUB 2HETA 5FYXA 1AVSA 1MWNA 1QLSA 3C1VA 2FJUB 1CKKA 1QV0A 3I5IB 1HT9A 1LKJA 2JU0A 1BR4B 2JNFA 1AJ5A 4YI9A 1S1EA 1A75A 3O6BA 3EKHA 4NQGA 3VROA 1YVHA 5I2LA 3SG5A 4C0LA 2OPOA 2EC6B 2M1KB 3DVEA 3K21A 2BBMA 2O5GA 1S36A 1RTP1 4WRIA 3CWGA 2LNKA 1FF1A 1QIWA 2LHLA 3HX4A 1OZSA 1Y6WA 2LVKA 3VGOA 4AOMA 1K9PA 1QATA 3JTDC 4PHNA 1K90D 1PRWA 1IQ3A 1A03A 2KI4C 1TIZA 1J1DA 2KGBC 3D0YB 1DJZA 3TDUA 3ZWHA 2L50A 2KBMA 3TDZA 2WCEA 3A8RA 2B1UA 3DVJA 2L0PA 3BOWA 1DGUA 3JVTC 5AXIA 2QPTA 2NXQA 4MZLA 1BT6A 2Q91A 3FWBA 2JTZA 1MHOA 2FOTA 4ICBA 1OZOA 2M0RA 3EVRA 2K7BA 3TS5C 1MXLC 2V53A 2OS8B 1IRJA 4C0KA 1SKTA 5PALA 1B8RA 1BJFA 3DVMA 4JQ0D 1YVLA 2PALA 3I5HC 1G8IA 2FCDA 5TNCA 4HSZA 1YR5A 4M2OA 2K7OA 3VRPA 1QV1A 1M31A 4MBEA 5AANA 1RROA 2E30A 1AK8A 4ORCB 5DKNA 4C0JA 2LCPA 4USLA 1TOPA 1QIVA 1WY9A 3LK1A 2AMIA 1L2OB 2CNPA 2WNDA 2JT0A 3CR5X 3BXKA 3M0WA 4HREE 1YUUA 5CSFA 1GJYA 1UP5A 4FTGA 4A4CA 2KAVA 1XK4A 2H61C 2L4IA 1WDCB 2HQ8A 1KFUS 1H4BA 1V1FA 3NXAA 1CM1A 2LMUA 4I5JA 4ETOA 3A4UB 1B47A 5I2QA 1JFKA 1F71A 3KPXA 3LL8B 5HLVA 1CM4A 2MJWB 1OMRA 1SR6B 4I5NB 3FWCA 1WRZA 4AQJA 1J1EA 1KK7Y 1CMGA 1TNPA 5CPVA 1SW8A 1K8UA 2FCEA 3IQOA 1XK4C 1UHKA 1G4YR 2KYCA 2PVBA 1LA0A 2OTGB 1LINA 1RFJA 4MVFA 1ALWA 1K9KA 4YRUA 3FIAA 3TZ1A 1IQ5A 1L7ZA 2K8MB 2LLSA 1CB1A 1JUOA 1Q80A 2LE9B 3SIAA 4PDZA 1XFZO 1X02A 1HQVA 4N1FA 2MBXA 5KSZA 2KGRA 1YUSA 3I5GC 3WXAA 2L51A 5D7FA 3OB1B 1Y1XA 1F4OA 1WLMA 4DIRA 4DS7A 1RWYA 1DVIA 1UHHA 1J7PA 2KNEA 2F2PA 2Y1MA 3ZNIA 4ZCVA 4BY4A 1S5GY 1JFJA 1PALA 3NSOA 4L9MA 2LMTA 4F0ZB 2I18A 1CLMA 1DGVA 3WHUB 1DJWA 1DJXA 1KK7Z 1A29A 1JF0A 2O60A 1BG1A 2LUCA 3BUNB 3ICBA 3NSKA 1FI6A 3CR4X 2P6BB 3PN7B 2WCFA 4AQIA 4M2QA 5BPJA 4E68A 1B8CA 2M7NA 1DF0A 4MRYA 1NX2A 2KOTA 2KQYA 3AAJA 4GUKA 1CNPA 2LLUA 1CFFA 2M97A 1UHNA 3AKBA 4P5OE 2MHHA 4XJKA 1KWOC 3F45A 4CIDA 3CGAA 5AEQA 2HQWA 1BMOA 1ZACA 3D0YA 1NP8A 4TNCA 2IS9A 5JOLA 1V1GA 3TDIA 3LCPC 1GGZA 3BUMB 4HRHA 1S5GZ 2LHIA 2RGIA 1YURA 2LP3A 1J7QA 4N1GA 2LUXA 2LC5A 4QJ5B 1QX7A 1IJ5A 5KTYA 2HPSA 2AAOA 2ISDA 5ER5A 2EGDA 2ZN8A 4MN0A 1KK8C 1B1GA 2F2OA 3DD4A 4NDCA 4DUQA 3CLNA 2KFGA 1SRAA 3I5FC 2TN4A 2BCBA 1R6PA 1XA5A 1QS7A 3OX6A 4CPVA 1A4PA 1OE9B 1SL9A 1PVBA 2A4JA 1A75B 2K2FA 3GOFA 5IBWA 1CDPA 2NZ0A 3GK2A 1SCMC 1J55A 3SG2A 4OVNF 1NX1A 4U8DA 3WHTB 2MLEC 2F8PA 3JTDB 1NCZA 4GAOA 3CTNA 1C7WA 1QTXA 2L2EA 2KI4B 1CFDA 1B7TY 1PVAA 3NSLA 3QRXA 5AERA 1TN4A 2E6WA 1WRKA 4YGCB 2QACA 2ZKMX 1AP4A 2PRUA 3GK4X 4GGNA 2JQ6A 1XFVO 2NCOA
chains in the Genus database with same CATH superfamily
4YGDB 3S0AA 3TUYC 4CLNA 3D74A 1Z2CB 3S0EA 1CFPA 3IQQA 3DVKA 1LXFC 1UHIA 1S26D 1RK9A 1TWOA 2LLTA 4ORBB 4YGBB 1F55A 1XFXO 3D78A 2D8NA 5DKQA 3TS5B 2PMYA 2ZNDA 2K7DA 1TNQA 3EK7A 5D69A 4CFQA 2M1UA 1JF2A 2PASA 1QLKA 1K2HA 3DF0A 3O4YA 2ZN9A 1B8LA 2K2AA 2WCJA 1KFXL 2SASA 3I5HB 3O2PA 2GGZA 1DT7B 1N2DA 2WOSA 1M46A 1RECA 1EG4A 3KO0A 1DQEA 2F3YA 2ZRSA 2Y5IA 4YBHB 3OBVA 2WCHA 1FBVA 1ZUZA 2COLB 1JC2A 1SSEB 1OSAA 1U5IA 4GGFA 2JTTA 1FW4A 4MEWA 4PE4A 3EK4A 2P70A 1EG3A 2M3WA 3VRQA 1W7IB 1ORGA 1B7TZ 1S6JA 1QASA 2BL0C 1IKUA 3EVUA 1KQMC 4N5XA 1A2XA 2JULA 1F70A 1OOFA 3JVTB 3O78A 4FQTA 1SK6D 1TUZA 2KFHA 1J7RA 4YI8A 1FPWA 4GBAA 1MF8B 1XYDA 2VRGA 1YRTB 3DY9A 1K93D 3B7AA 1WRLA 2L4HA 3GK1A 3IF7A 2JNXA 1CTRA 3O4XA 2M29A 4GGFC 2BCXA 2JWWA 5CSIA 1F4QA 2JXLA 2KLDA 2M7LA 2JXCA 2KHNA 3EG5B 5HKZA 1ZMZA 1S6IA 1QXPA 3CDNA 3CZTX 2LMVA 2G2BA 1W9ZA 4Q04A 2GGMA 1F8HA 1DJYA 1TRFA 2F3ZA 1TUJA 4XYNA 2M49B 2LVJA 2KSPA 3EKJA 4QJ3B 3D76A 2H2KA 2BCAA 3BUXB 3PLFB 1EXRA 1IGVA 1ZFSA 1IJ6A 1DTLA 2I2RE 3WNXB 1MUXA 4WQ3A 3CZ0A 1JBAA 4JPZB 1ALVA 2WC6A 4JWQA 3DYEA 1YTZC 3I5GB 3EVVA 2SCPA 1TNXA 1BU3A 1SNLA 1SL7A 2KBIA 1K95A 1OW4A 4MSPA 1CMFA 3BFHA 3LK0A 1EL4A 1Y1UA 4BY5A 1NCYA 4PHKA 1AUIB 4PHJA 3SG3A 4KYNA 2JT8A 4GNKB 2WC8A 3I5IC 1OMDA 1TCFA 2BAPA 2L2CA 4UPGA 2LV7A 1CDNA 1PULA 1QJTA 4NDDA 3OB2B 1M63B 4I5LB 3OHMB 3BUWB 1NPQA 1PK0D 2KFFA 1DJGA 4D1EA 1NYAA 1N65A 3CZ1A 2EC6C 4OKHA 2QEHA 3PALA 3BFAA 1CLBA 2LM5A 2KQ6A 2P71A 2CT9A 3RM1A 2JPTA 2KI6C 2WCBA 3R1VA 5FI2A 2ZFDA 1JWDA 3KEVA 5CSJA 2KAYA 2KDHA 4PE1A 1CDLA 3VRNA 2K60A 5JJGA 1OQPA 3NSIA 5G08A 5HLOA 3BUOB 4JD9A 4WQ2A 1FI5A 2L98A 2MA2A 1M45A 5I2OA 1KFUL 1GM0A 1OMVA 3E3RA 1KWOB 1XVJA 3L4AA 1CFCA 2LVIA 3HCMA 2CXJA 3VB1A 2L5XB 1QWVA 2LVVA 3H4SE 3RLZA 1DF0B 2MLFC 3S0DA 1UWOA 1N0YA 3EK8A 2HF5A 1S6CA 1YUTA 1YX7A 2CBLA 5HYDA 5K89A 1G33A 3PSRA 1IWQA 4GPLB 2F33A 2JT3A 3B6XA 4XJKB 1EJ3A 3BYAA 1MQ1A 2BE6A 1EH2A 1K9UA 1KK8B 2OS8C 2ZNEA 1C7VA 1K94A 2LAPA 2WCKA 3PATA 1IG5A 2NCPA 1C07A 1DMOA 1BLQA 3I5FB 1QVIY 1OOIX 1RJVA 3IVTA 1S3PA 2K0JA 3SIBA 3SG4A 1Z4HA 1E8AA 1ZOTB 1M39A 1SBJA 1AJ4A 1SCMB 1NWDA 1UURA 1UUSA 2EHBA 3PM2A 4OZDA 3UNWA 1D1OA 3AKAA 4R1EA 1L2OC 3S0GA 2Y1NA 5HKWA 4M2PA 4PHMA 4A4BA 3BOWB 1PSBA 1TCOB 3FS7A 3SG7A 1Y0VH 3FE9A 3SJSA 1BR1B 1VRKA 2I7AA 1NSHA 1WDCC 3RZSA 2M8UA 3TUYB 5HKYA 2KPHA 3SG6A 3OX5A 1CDMA 2H61A 3KF9A 2I94A 3LLEA 2G9BA 1XO5A 1XFYO 1SR6C 1UHJA 1B4CA 2JZIA 1PSRA 5CSNA 3AAKA 1AHRA 2K7CA 1XFUO 2ZRTA 4FQOA 1WLZA 3NGVA 2K61A 4PALA 1NUBA 1QVIZ 1QX2A 2BNXA 2Q4UA 1MR8A 2OTGC 4I5KA 4OV2A 1J7OA 1KQVA 4CFRA 4PCWA 3MSEB 1SMGA 5DKRA 2KI6D 4DRWA 2BBNA 2JC2A 3SS4A 1DJHA 1SPYA 3BQ3A 1DJIA 1MXEA 2JOJA 3DXLA 4PE7A 4QJ4B 3DF0B 1YX8A 2WCLA 2BL0B 3FE6A 1IH0A 1KQMB 2AUCA 2KAXA 2MAZA 1R2UA 1ODBA 1XFWO 2BKHB 4OR9B 1NIWA 2JRFA 1Y1AA 4OCIA 5B8IB 4DCKA 4MZKA 1NX0A 3FE8A 1XFRA 2WORA 4IJ7A 1B9AA 4HRGA 1U5IB 2CTNA 1SCVA 4MRXA 3S0BA 3KHEA 4MLWA 2Y4QA 1H8BA 3VRRA 2R2IA 4YGAA 1GQMA 4ORAB 1QX5B 2PSRA 1SYMA 1KSOA 1NCXA 2BKIB 4IL1A 1KSMA 1BODA 3SS3A 3PM8A 2DOQA 4YGEB 3PN7C 5GQQC 2GV5A 1K96A 1KCYA 2BE4A 2KYFA 4P2YB 3PFVA 1SY9A 2NLNA 2MRDA 3CR2A 5AFPA 1NX3A 1SL8A 3CS1A 3SS5A 1F54A 1JSAA 3B88A 3PJIA 1KFXS 1CLLA 3OP0A 1BF5A 1BOCA 5F6TA 1GGWA 1W7JB 2LANA 1TNWA 5J3XA 4ZCUA 1LA3A 5ER4X 1TTXA 2M9GA 1OOJA 2LP2A 2BECA 5I8NA 4MZJA 4NDBA 4PE0A 3D10A 5KU1A 2CCMA 1LVCD 1YRUB 2HETA 3R1OA 5FYXA 1AVSA 1DEKA 1MWNA 1QLSA 3C1VA 2FJUB 1CKKA 2PYQA 1QV0A 3I5IB 5FI7A 1HT9A 1LKJA 2JU0A 1BR4B 3CZ2A 2JNFA 3UO9A 1AJ5A 4YI9A 1S1EA 1A75A 3O6BA 3EKHA 4NQGA 3VROA 1YVHA 5I2LA 3CABA 3SG5A 4C0LA 2OPOA 2EC6B 2M1KB 3DVEA 3K21A 2BBMA 2O5GA 1S36A 1RTP1 4WRIA 3CWGA 2LNKA 1FF1A 1C3ZA 1QIWA 2LHLA 3HX4A 1OZSA 1Y6WA 2LVKA 3VGOA 4F7FA 4AOMA 3CYZA 1K9PA 1QATA 3JTDC 4PHNA 1K90D 2QEVA 1PRWA 1IQ3A 1A03A 2KI4C 1TIZA 1J1DA 2KGBC 3D0YB 1DJZA 3TDUA 3ZWHA 2L50A 3D75A 1C3YA 3L47A 2KBMA 5D3OA 3TDZA 2WCEA 3B86A 3A8RA 2B1UA 3DVJA 2L0PA 3BOWA 1DGUA 3JVTC 5AXIA 2QPTA 2NXQA 4MZLA 1BT6A 2Q91A 5FI6A 3FWBA 2JTZA 3S0FA 1MHOA 2FOTA 4ICBA 1OZOA 2M0RA 3EVRA 2K7BA 3TS5C 1MXLC 2V53A 2QEOA 2OS8B 2WC5A 1IRJA 4INWA 4C0KA 1SKTA 3OGNA 5PALA 1B8RA 1BJFA 3DVMA 4JQ0D 1YVLA 2PALA 3I5HC 1G8IA 2FCDA 5TNCA 4HSZA 1YR5A 4M2OA 2K7OA 3VRPA 1QV1A 1M31A 4MBEA 5AANA 1RROA 3DZTA 2E30A 3NHIA 3D77A 1AK8A 4ORCB 5DKNA 4C0JA 2LCPA 4USLA 1TOPA 1QIVA 1WY9A 3LK1A 2AMIA 1L2OB 2CNPA 2WNDA 2JT0A 3CR5X 3BXKA 3M0WA 4HREE 1YUUA 5CSFA 1GJYA 2ERBA 1UP5A 4FTGA 4A4CA 2JPOA 1XK4A 2H61C 2KAVA 1WDCB 2HQ8A 1KFUS 2L4IA 1H4BA 1V1FA 3NXAA 1CM1A 2LMUA 4I5JA 4ETOA 3A4UB 1B47A 5I2QA 1JFKA 1F71A 5I94A 3KPXA 3LL8B 5HLVA 1CM4A 2MJWB 1OMRA 1SR6B 4I5NB 3FWCA 1WRZA 4AQJA 1J1EA 1KK7Y 1CMGA 1TNPA 5CPVA 1SW8A 1K8UA 2FCEA 2QDIA 3IQOA 1XK4C 1UHKA 3BFBA 2WCMA 1G4YR 2KYCA 2PVBA 1OOGA 1LA0A 2H8VA 1IIOA 2YGUA 2OTGB 1LINA 1RFJA 4MVFA 1ALWA 1K9KA 4YRUA 3FIAA 3TZ1A 1IQ5A 1L7ZA 2K8MB 2LLSA 1LS8A 1CB1A 1JUOA 1Q80A 2LE9B 2PQLA 3SIAA 4PDZA 1XFZO 1X02A 1HQVA 4N1FA 2MBXA 5KSZA 2KGRA 1YUSA 3I5GC 3WXAA 2L51A 5D7FA 3OB1B 1OOHA 3V2LA 1Y1XA 3QMEA 1F4OA 1WLMA 3L4LA 4PT1A 4DIRA 1RWYA 1DVIA 1UHHA 4DS7A 1J7PA 1DELA 2KNEA 2F2PA 2Y1MA 3ZNIA 4ZCVA 4BY4A 1S5GY 1JFJA 1PALA 3NSOA 4L9MA 2LMTA 4F0ZB 3B87A 2I18A 1CLMA 1DGVA 3WHUB 1DJWA 1DJXA 1KK7Z 1A29A 1JF0A 2O60A 2L5YA 5HL1A 1BG1A 2LUCA 3BUNB 3ICBA 5EL2A 3N7HA 3NSKA 4INXA 1FI6A 3CR4X 2P6BB 3PN7B 1T14A 2WCFA 4AQIA 4M2QA 5BPJA 4E68A 1B8CA 2M7NA 1DF0A 4MRYA 1NX2A 2QEBA 2KOTA 2KQYA 3AAJA 4GUKA 5DICA 1CNPA 2LLUA 1CFFA 3NHTA 2M97A 1UHNA 3D73A 3AKBA 4P5OE 2MHHA 2GTEA 4XJKA 1KWOC 3F45A 4CIDA 3CGAA 5AEQA 2HQWA 2KLEA 1BMOA 1ZACA 3D0YA 1NP8A 4TNCA 2IS9A 5JOLA 1V1GA 3TDIA 3LCPC 1GGZA 3BUMB 3K1EA 4HRHA 1S5GZ 2LHIA 2RGIA 1YURA 2LP3A 4JKTA 1J7QA 4N1GA 3R1PA 2LUXA 2LC5A 4QJ5B 1QX7A 1IJ5A 5KTYA 2HPSA 2AAOA 4GFTA 2ISDA 5ER5A 2EGDA 2ZN8A 4MN0A 1KK8C 1B1GA 2F2OA 3Q8IA 3DD4A 1P28A 4NDCA 4DUQA 2FJYA 2KFGA 3CLNA 1SRAA 3I5FC 2TN4A 2BCBA 1R6PA 1XA5A 1QS7A 3OX6A 4CPVA 1A4PA 1OE9B 1SL9A 1DC1A 1PVBA 2A4JA 1A75B 2K2FA 3GOFA 5IBWA 1CDPA 2NZ0A 3GK2A 1SCMC 1J55A 3SG2A 3BJHA 4OVNF 1NX1A 4U8DA 3WHTB 2MLEC 2F8PA 3JTDB 1NCZA 4GAOA 3CTNA 1C7WA 1QTXA 2L2EA 2KI4B 1CFDA 1B7TY 1PVAA 3NSLA 3QRXA 5AERA 1TN4A 2E6WA 1WRKA 4YGCB 2QACA 2ZKMX 1AP4A 2PRUA 3GK4X 4GGNA 2JQ6A 1XFVO 3R72A 2NCOA
chains in the Genus database with same CATH topology
4YGDB 3TUYC 4CLNA 1CFPA 3IQQA 3DVKA 1LXFC 1UHIA 1S26D 1RK9A 2LLTA 4ORBB 4YGBB 1F55A 1XFXO 2D8NA 5DKQA 3TS5B 2PMYA 2ZNDA 2K7DA 1TNQA 3EK7A 5D69A 4CFQA 2M1UA 1JF2A 2PASA 1QLKA 1K2HA 3DF0A 3O4YA 2ZN9A 1B8LA 2K2AA 3I5HB 1KFXL 2SASA 3O2PA 1DT7B 2GGZA 1N2DA 2WOSA 1M46A 1RECA 1EG4A 3KO0A 2F3YA 2ZRSA 2Y5IA 4YBHB 1FBVA 1ZUZA 2COLB 1JC2A 1OSAA 1U5IA 4GGFA 2JTTA 1FW4A 4MEWA 4PE4A 3EK4A 1EG3A 2M3WA 3VRQA 1W7IB 1B7TZ 1S6JA 1QASA 2BL0C 1IKUA 3EVUA 1KQMC 4N5XA 1A2XA 2JULA 1F70A 3JVTB 3O78A 4YI8A 1SK6D 2KFHA 1J7RA 1FPWA 4GBAA 1MF8B 1XYDA 2VRGA 1YRTB 1K93D 3IF7A 1WRLA 2L4HA 3GK1A 4GFTA 2JNXA 1CTRA 4GGFC 2M29A 5CSIA 2BCXA 2JWWA 1F4QA 2JXLA 2M7LA 2JXCA 2KHNA 5HKZA 1ZMZA 1S6IA 1QXPA 3CZTX 2LMVA 2G2BA 4Q04A 2GGMA 1F8HA 1DJYA 1TRFA 2F3ZA 4XYNA 2M49B 2LVJA 2KSPA 3EKJA 4QJ3B 2H2KA 2BCAA 3BUXB 3PLFB 1EXRA 1IGVA 1ZFSA 1IJ6A 1DTLA 2I2RE 3WNXB 1MUXA 4WQ3A 1JBAA 4JPZB 1ALVA 4JWQA 1YTZC 3I5GB 3EVVA 2SCPA 1TNXA 1BU3A 1SNLA 1SL7A 2KBIA 1K95A 4MSPA 1CMFA 3LK0A 1EL4A 1Y1UA 4BY5A 1NCYA 4PHKA 1AUIB 4PHJA 3SG3A 2JT8A 4GNKB 2WC8A 3I5IC 1OMDA 1TCFA 4UPGA 2LV7A 1CDNA 1PULA 1QJTA 4NDDA 3OB2B 1M63B 4I5LB 3OHMB 3BUWB 1NPQA 1PK0D 2KFFA 1DJGA 4D1EA 1NYAA 1N65A 2EC6C 4OKHA 3PALA 1CLBA 2LM5A 2KQ6A 2CT9A 3RM1A 2JPTA 2KI6C 2WCBA 2ZFDA 1JWDA 3KEVA 5CSJA 2KAYA 2KDHA 4PE1A 1CDLA 3VRNA 5JJGA 1OQPA 3NSIA 5G08A 5HLOA 3BUOB 1FI5A 4WQ2A 2L98A 2MA2A 1M45A 5I2OA 1KFUL 1OMVA 3E3RA 1KWOB 1XVJA 1CFCA 2LVIA 3HCMA 2CXJA 2L5XB 2LVVA 3H4SE 3RLZA 1DF0B 2MLFC 1UWOA 1N0YA 3EK8A 2HF5A 1S6CA 1YUTA 1YX7A 2CBLA 5HYDA 5K89A 1G33A 3PSRA 1IWQA 4GPLB 2F33A 2JT3A 4XJKB 1EJ3A 3BYAA 1MQ1A 2BE6A 1EH2A 1K9UA 1KK8B 2OS8C 2ZNEA 1C7VA 1K94A 2LAPA 3PATA 1IG5A 2NCPA 1C07A 1DMOA 1BLQA 3I5FB 1QVIY 1RJVA 1S3PA 2K0JA 3SIBA 3SG4A 1E8AA 1ZOTB 1M39A 1SBJA 1AJ4A 1SCMB 1NWDA 1UURA 1UUSA 2EHBA 1D1OA 3AKAA 4R1EA 1L2OC 2Y1NA 5HKWA 4M2PA 4PHMA 4A4BA 3BOWB 1PSBA 1TCOB 3FS7A 3SG7A 1Y0VH 3SJSA 1BR1B 1VRKA 2I7AA 1NSHA 1WDCC 2M8UA 3TUYB 5HKYA 3SG6A 3OX5A 1CDMA 2H61A 3KF9A 2I94A 3LLEA 2G9BA 1XO5A 1XFYO 1SR6C 1UHJA 1B4CA 2JZIA 1PSRA 5CSNA 3AAKA 1AHRA 2K7CA 1XFUO 2ZRTA 4FQOA 1WLZA 2K61A 4PALA 1NUBA 1QVIZ 1QX2A 2Q4UA 4I5KA 1MR8A 2OTGC 4OV2A 1J7OA 1KQVA 4CFRA 4PCWA 3MSEB 1SMGA 5DKRA 2KI6D 4DRWA 2BBNA 2JC2A 1DJHA 1SPYA 3BQ3A 1DJIA 1MXEA 2JOJA 4PE7A 4QJ4B 3DF0B 1YX8A 2BL0B 1IH0A 1KQMB 2AUCA 2KAXA 2MAZA 1R2UA 1ODBA 1XFWO 2BKHB 4OR9B 1NIWA 2JRFA 1Y1AA 4OCIA 5B8IB 4DCKA 4MZKA 1NX0A 2WORA 1B9AA 4HRGA 1U5IB 2CTNA 1SCVA 4MRXA 3KHEA 4MLWA 2Y4QA 1H8BA 3VRRA 2R2IA 4YGAA 1GQMA 4ORAB 1QX5B 2PSRA 1SYMA 1KSOA 1NCXA 2BKIB 4IL1A 1KSMA 1BODA 3PM8A 2DOQA 4YGEB 3PN7C 5GQQC 2GV5A 1K96A 1KCYA 2BE4A 2KYFA 4P2YB 3PFVA 1SY9A 2NLNA 2MRDA 3CR2A 5AFPA 1NX3A 1SL8A 3CS1A 1F54A 1JSAA 1KFXS 1CLLA 3OP0A 1BF5A 1BOCA 5F6TA 1GGWA 1W7JB 2LANA 1TNWA 5J3XA 4ZCUA 1LA3A 5ER4X 1TTXA 2M9GA 1OOJA 2LP2A 2BECA 5I8NA 4MZJA 4NDBA 4PE0A 3D10A 5KU1A 2CCMA 1LVCD 1YRUB 2HETA 5FYXA 1AVSA 1MWNA 1QLSA 3C1VA 2FJUB 1CKKA 1QV0A 3I5IB 1HT9A 1LKJA 2JU0A 1BR4B 2JNFA 1AJ5A 4YI9A 1S1EA 1A75A 3O6BA 3EKHA 4NQGA 3VROA 1YVHA 5I2LA 3SG5A 4C0LA 2OPOA 2EC6B 2M1KB 3DVEA 3K21A 2BBMA 2O5GA 1S36A 1RTP1 4WRIA 3CWGA 2LNKA 1FF1A 1QIWA 2LHLA 3HX4A 1OZSA 1Y6WA 2LVKA 3VGOA 4AOMA 1K9PA 1QATA 3JTDC 4PHNA 1K90D 1PRWA 1IQ3A 1A03A 2KI4C 1TIZA 1J1DA 2KGBC 3D0YB 1DJZA 3TDUA 3ZWHA 2L50A 2KBMA 3TDZA 2WCEA 3A8RA 2B1UA 3DVJA 2L0PA 3BOWA 1DGUA 3JVTC 5AXIA 2QPTA 2NXQA 4MZLA 1BT6A 2Q91A 3FWBA 2JTZA 1MHOA 2FOTA 4ICBA 1OZOA 2M0RA 3EVRA 2K7BA 3TS5C 1MXLC 2V53A 2OS8B 1IRJA 4C0KA 1SKTA 5PALA 1B8RA 1BJFA 3DVMA 4JQ0D 1YVLA 2PALA 3I5HC 1G8IA 2FCDA 5TNCA 4HSZA 1YR5A 4M2OA 2K7OA 3VRPA 1QV1A 1M31A 4MBEA 5AANA 1RROA 2E30A 1AK8A 4ORCB 5DKNA 4C0JA 2LCPA 4USLA 1TOPA 1QIVA 1WY9A 3LK1A 2AMIA 1L2OB 2CNPA 2WNDA 2JT0A 3CR5X 3BXKA 3M0WA 4HREE 1YUUA 5CSFA 1GJYA 1UP5A 4FTGA 4A4CA 2KAVA 1XK4A 2H61C 2L4IA 1WDCB 2HQ8A 1KFUS 1H4BA 1V1FA 3NXAA 1CM1A 2LMUA 4I5JA 4ETOA 3A4UB 1B47A 5I2QA 1JFKA 1F71A 3KPXA 3LL8B 5HLVA 1CM4A 2MJWB 1OMRA 1SR6B 4I5NB 3FWCA 1WRZA 4AQJA 1J1EA 1KK7Y 1CMGA 1TNPA 5CPVA 1SW8A 1K8UA 2FCEA 3IQOA 1XK4C 1UHKA 1G4YR 2KYCA 2PVBA 1LA0A 2OTGB 1LINA 1RFJA 4MVFA 1ALWA 1K9KA 4YRUA 3FIAA 3TZ1A 1IQ5A 1L7ZA 2K8MB 2LLSA 1CB1A 1JUOA 1Q80A 2LE9B 3SIAA 4PDZA 1XFZO 1X02A 1HQVA 4N1FA 2MBXA 5KSZA 2KGRA 1YUSA 3I5GC 3WXAA 2L51A 5D7FA 3OB1B 1Y1XA 1F4OA 1WLMA 4DIRA 4DS7A 1RWYA 1DVIA 1UHHA 1J7PA 2KNEA 2F2PA 2Y1MA 3ZNIA 4ZCVA 4BY4A 1S5GY 1JFJA 1PALA 3NSOA 4L9MA 2LMTA 4F0ZB 2I18A 1CLMA 1DGVA 3WHUB 1DJWA 1DJXA 1KK7Z 1A29A 1JF0A 2O60A 1BG1A 2LUCA 3BUNB 3ICBA 3NSKA 1FI6A 3CR4X 2P6BB 3PN7B 2WCFA 4AQIA 4M2QA 5BPJA 4E68A 1B8CA 2M7NA 1DF0A 4MRYA 1NX2A 2KOTA 2KQYA 3AAJA 4GUKA 1CNPA 2LLUA 1CFFA 2M97A 1UHNA 3AKBA 4P5OE 2MHHA 4XJKA 1KWOC 3F45A 4CIDA 3CGAA 5AEQA 2HQWA 1BMOA 1ZACA 3D0YA 1NP8A 4TNCA 2IS9A 5JOLA 1V1GA 3TDIA 3LCPC 1GGZA 3BUMB 4HRHA 1S5GZ 2LHIA 2RGIA 1YURA 2LP3A 1J7QA 4N1GA 2LUXA 2LC5A 4QJ5B 1QX7A 1IJ5A 5KTYA 2HPSA 2AAOA 2ISDA 5ER5A 2EGDA 2ZN8A 4MN0A 1KK8C 1B1GA 2F2OA 3DD4A 4NDCA 4DUQA 3CLNA 2KFGA 1SRAA 3I5FC 2TN4A 2BCBA 1R6PA 1XA5A 1QS7A 3OX6A 4CPVA 1A4PA 1OE9B 1SL9A 1PVBA 2A4JA 1A75B 2K2FA 3GOFA 5IBWA 1CDPA 2NZ0A 3GK2A 1SCMC 1J55A 3SG2A 4OVNF 1NX1A 4U8DA 3WHTB 2MLEC 2F8PA 3JTDB 1NCZA 4GAOA 3CTNA 1C7WA 1QTXA 2L2EA 2KI4B 1CFDA 1B7TY 1PVAA 3NSLA 3QRXA 5AERA 1TN4A 2E6WA 1WRKA 4YGCB 2QACA 2ZKMX 1AP4A 2PRUA 3GK4X 4GGNA 2JQ6A 1XFVO 2NCOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YGD B;  3TUY C;  4CLN A;  1CFP A;  3IQQ A;  3DVK A;  1LXF C;  1UHI A;  1S26 D;  1RK9 A;  2LLT A;  4ORB B;  4YGB B;  1F55 A;  1XFX O;  2D8N A;  5DKQ A;  3TS5 B;  2PMY A;  2ZND A;  2K7D A;  1TNQ A;  3EK7 A;  5D69 A;  4CFQ A;  2M1U A;  1JF2 A;  2PAS A;  1QLK A;  1K2H A;  3DF0 A;  3O4Y A;  2ZN9 A;  1B8L A;  2K2A A;  3I5H B;  1KFX L;  2SAS A;  3O2P A;  1DT7 B;  2GGZ A;  1N2D A;  2WOS A;  1M46 A;  1REC A;  1EG4 A;  3KO0 A;  2F3Y A;  2ZRS A;  2Y5I A;  4YBH B;  1FBV A;  1ZUZ A;  2COL B;  1JC2 A;  1OSA A;  1U5I A;  4GGF A;  2JTT A;  1FW4 A;  4MEW A;  4PE4 A;  3EK4 A;  1EG3 A;  2M3W A;  3VRQ A;  1W7I B;  1B7T Z;  1S6J A;  1QAS A;  2BL0 C;  1IKU A;  3EVU A;  1KQM C;  4N5X A;  1A2X A;  2JUL A;  1F70 A;  3JVT B;  3O78 A;  4YI8 A;  1SK6 D;  2KFH A;  1J7R A;  1FPW A;  4GBA A;  1MF8 B;  1XYD A;  2VRG A;  1YRT B;  1K93 D;  3IF7 A;  1WRL A;  2L4H A;  3GK1 A;  4GFT A;  2JNX A;  1CTR A;  4GGF C;  2M29 A;  5CSI A;  2BCX A;  2JWW A;  1F4Q A;  2JXL A;  2M7L A;  2JXC A;  2KHN A;  5HKZ A;  1ZMZ A;  1S6I A;  1QXP A;  3CZT X;  2LMV A;  2G2B A;  4Q04 A;  2GGM A;  1F8H A;  1DJY A;  1TRF A;  2F3Z A;  4XYN A;  2M49 B;  2LVJ A;  2KSP A;  3EKJ A;  4QJ3 B;  2H2K A;  2BCA A;  3BUX B;  3PLF B;  1EXR A;  1IGV A;  1ZFS A;  1IJ6 A;  1DTL A;  2I2R E;  3WNX B;  1MUX A;  4WQ3 A;  1JBA A;  4JPZ B;  1ALV A;  4JWQ A;  1YTZ C;  3I5G B;  3EVV A;  2SCP A;  1TNX A;  1BU3 A;  1SNL A;  1SL7 A;  2KBI A;  1K95 A;  4MSP A;  1CMF A;  3LK0 A;  1EL4 A;  1Y1U A;  4BY5 A;  1NCY A;  4PHK A;  1AUI B;  4PHJ A;  3SG3 A;  2JT8 A;  4GNK B;  2WC8 A;  3I5I C;  1OMD A;  1TCF A;  4UPG A;  2LV7 A;  1CDN A;  1PUL A;  1QJT A;  4NDD A;  3OB2 B;  1M63 B;  4I5L B;  3OHM B;  3BUW B;  1NPQ A;  1PK0 D;  2KFF A;  1DJG A;  4D1E A;  1NYA A;  1N65 A;  2EC6 C;  4OKH A;  3PAL A;  1CLB A;  2LM5 A;  2KQ6 A;  2CT9 A;  3RM1 A;  2JPT A;  2KI6 C;  2WCB A;  2ZFD A;  1JWD A;  3KEV A;  5CSJ A;  2KAY A;  2KDH A;  4PE1 A;  1CDL A;  3VRN A;  5JJG A;  1OQP A;  3NSI A;  5G08 A;  5HLO A;  3BUO B;  1FI5 A;  4WQ2 A;  2L98 A;  2MA2 A;  1M45 A;  5I2O A;  1KFU L;  1OMV A;  3E3R A;  1KWO B;  1XVJ A;  1CFC A;  2LVI A;  3HCM A;  2CXJ A;  2L5X B;  2LVV A;  3H4S E;  3RLZ A;  1DF0 B;  2MLF C;  1UWO A;  1N0Y A;  3EK8 A;  2HF5 A;  1S6C A;  1YUT A;  1YX7 A;  2CBL A;  5HYD A;  5K89 A;  1G33 A;  3PSR A;  1IWQ A;  4GPL B;  2F33 A;  2JT3 A;  4XJK B;  1EJ3 A;  3BYA A;  1MQ1 A;  2BE6 A;  1EH2 A;  1K9U A;  1KK8 B;  2OS8 C;  2ZNE A;  1C7V A;  1K94 A;  2LAP A;  3PAT A;  1IG5 A;  2NCP A;  1C07 A;  1DMO A;  1BLQ A;  3I5F B;  1QVI Y;  1RJV A;  1S3P A;  2K0J A;  3SIB A;  3SG4 A;  1E8A A;  1ZOT B;  1M39 A;  1SBJ A;  1AJ4 A;  1SCM B;  1NWD A;  1UUR A;  1UUS A;  2EHB A;  1D1O A;  3AKA A;  4R1E A;  1L2O C;  2Y1N A;  5HKW A;  4M2P A;  4PHM A;  4A4B A;  3BOW B;  1PSB A;  1TCO B;  3FS7 A;  3SG7 A;  1Y0V H;  3SJS A;  1BR1 B;  1VRK A;  2I7A A;  1NSH A;  1WDC C;  2M8U A;  3TUY B;  5HKY A;  3SG6 A;  3OX5 A;  1CDM A;  2H61 A;  3KF9 A;  2I94 A;  3LLE A;  2G9B A;  1XO5 A;  1XFY O;  1SR6 C;  1UHJ A;  1B4C A;  2JZI A;  1PSR A;  5CSN A;  3AAK A;  1AHR A;  2K7C A;  1XFU O;  2ZRT A;  4FQO A;  1WLZ A;  2K61 A;  4PAL A;  1NUB A;  1QVI Z;  1QX2 A;  2Q4U A;  4I5K A;  1MR8 A;  2OTG C;  4OV2 A;  1J7O A;  1KQV A;  4CFR A;  4PCW A;  3MSE B;  1SMG A;  5DKR A;  2KI6 D;  4DRW A;  2BBN A;  2JC2 A;  1DJH A;  1SPY A;  3BQ3 A;  1DJI A;  1MXE A;  2JOJ A;  4PE7 A;  4QJ4 B;  3DF0 B;  1YX8 A;  2BL0 B;  1IH0 A;  1KQM B;  2AUC A;  2KAX A;  2MAZ A;  1R2U A;  1ODB A;  1XFW O;  2BKH B;  4OR9 B;  1NIW A;  2JRF A;  1Y1A A;  4OCI A;  5B8I B;  4DCK A;  4MZK A;  1NX0 A;  2WOR A;  1B9A A;  4HRG A;  1U5I B;  2CTN A;  1SCV A;  4MRX A;  3KHE A;  4MLW A;  2Y4Q A;  1H8B A;  3VRR A;  2R2I A;  4YGA A;  1GQM A;  4ORA B;  1QX5 B;  2PSR A;  1SYM A;  1KSO A;  1NCX A;  2BKI B;  4IL1 A;  1KSM A;  1BOD A;  3PM8 A;  2DOQ A;  4YGE B;  3PN7 C;  5GQQ C;  2GV5 A;  1K96 A;  1KCY A;  2BE4 A;  2KYF A;  4P2Y B;  3PFV A;  1SY9 A;  2NLN A;  2MRD A;  3CR2 A;  5AFP A;  1NX3 A;  1SL8 A;  3CS1 A;  1F54 A;  1JSA A;  1KFX S;  1CLL A;  3OP0 A;  1BF5 A;  1BOC A;  5F6T A;  1GGW A;  1W7J B;  2LAN A;  1TNW A;  5J3X A;  4ZCU A;  1LA3 A;  5ER4 X;  1TTX A;  2M9G A;  1OOJ A;  2LP2 A;  2BEC A;  5I8N A;  4MZJ A;  4NDB A;  4PE0 A;  3D10 A;  5KU1 A;  2CCM A;  1LVC D;  1YRU B;  2HET A;  5FYX A;  1AVS A;  1MWN A;  1QLS A;  3C1V A;  2FJU B;  1CKK A;  1QV0 A;  3I5I B;  1HT9 A;  1LKJ A;  2JU0 A;  1BR4 B;  2JNF A;  1AJ5 A;  4YI9 A;  1S1E A;  1A75 A;  3O6B A;  3EKH A;  4NQG A;  3VRO A;  1YVH A;  5I2L A;  3SG5 A;  4C0L A;  2OPO A;  2EC6 B;  2M1K B;  3DVE A;  3K21 A;  2BBM A;  2O5G A;  1S36 A;  1RTP 1;  4WRI A;  3CWG A;  2LNK A;  1FF1 A;  1QIW A;  2LHL A;  3HX4 A;  1OZS A;  1Y6W A;  2LVK A;  3VGO A;  4AOM A;  1K9P A;  1QAT A;  3JTD C;  4PHN A;  1K90 D;  1PRW A;  1IQ3 A;  1A03 A;  2KI4 C;  1TIZ A;  1J1D A;  2KGB C;  3D0Y B;  1DJZ A;  3TDU A;  3ZWH A;  2L50 A;  2KBM A;  3TDZ A;  2WCE A;  3A8R A;  2B1U A;  3DVJ A;  2L0P A;  3BOW A;  1DGU A;  3JVT C;  5AXI A;  2QPT A;  2NXQ A;  4MZL A;  1BT6 A;  2Q91 A;  3FWB A;  2JTZ A;  1MHO A;  2FOT A;  4ICB A;  1OZO A;  2M0R A;  3EVR A;  2K7B A;  3TS5 C;  1MXL C;  2V53 A;  2OS8 B;  1IRJ A;  4C0K A;  1SKT A;  5PAL A;  1B8R A;  1BJF A;  3DVM A;  4JQ0 D;  1YVL A;  2PAL A;  3I5H C;  1G8I A;  2FCD A;  5TNC A;  4HSZ A;  1YR5 A;  4M2O A;  2K7O A;  3VRP A;  1QV1 A;  1M31 A;  4MBE A;  5AAN A;  1RRO A;  2E30 A;  1AK8 A;  4ORC B;  5DKN A;  4C0J A;  2LCP A;  4USL A;  1TOP A;  1QIV A;  1WY9 A;  3LK1 A;  2AMI A;  1L2O B;  2CNP A;  2WND A;  2JT0 A;  3CR5 X;  3BXK A;  3M0W A;  4HRE E;  1YUU A;  5CSF A;  1GJY A;  1UP5 A;  4FTG A;  4A4C A;  2KAV A;  1XK4 A;  2H61 C;  2L4I A;  1WDC B;  2HQ8 A;  1KFU S;  1H4B A;  1V1F A;  3NXA A;  1CM1 A;  2LMU A;  4I5J A;  4ETO A;  3A4U B;  1B47 A;  5I2Q A;  1JFK A;  1F71 A;  3KPX A;  3LL8 B;  5HLV A;  1CM4 A;  2MJW B;  1OMR A;  1SR6 B;  4I5N B;  3FWC A;  1WRZ A;  4AQJ A;  1J1E A;  1KK7 Y;  1CMG A;  1TNP A;  5CPV A;  1SW8 A;  1K8U A;  2FCE A;  3IQO A;  1XK4 C;  1UHK A;  1G4Y R;  2KYC A;  2PVB A;  1LA0 A;  2OTG B;  1LIN A;  1RFJ A;  4MVF A;  1ALW A;  1K9K A;  4YRU A;  3FIA A;  3TZ1 A;  1IQ5 A;  1L7Z A;  2K8M B;  2LLS A;  1CB1 A;  1JUO A;  1Q80 A;  2LE9 B;  3SIA A;  4PDZ A;  1XFZ O;  1X02 A;  1HQV A;  4N1F A;  2MBX A;  5KSZ A;  2KGR A;  1YUS A;  3I5G C;  3WXA A;  2L51 A;  5D7F A;  3OB1 B;  1Y1X A;  1F4O A;  1WLM A;  4DIR A;  4DS7 A;  1RWY A;  1DVI A;  1UHH A;  1J7P A;  2KNE A;  2F2P A;  2Y1M A;  3ZNI A;  4ZCV A;  4BY4 A;  1S5G Y;  1JFJ A;  1PAL A;  3NSO A;  4L9M A;  2LMT A;  4F0Z B;  2I18 A;  1CLM A;  1DGV A;  3WHU B;  1DJW A;  1DJX A;  1KK7 Z;  1A29 A;  1JF0 A;  2O60 A;  1BG1 A;  2LUC A;  3BUN B;  3ICB A;  3NSK A;  1FI6 A;  3CR4 X;  2P6B B;  3PN7 B;  2WCF A;  4AQI A;  4M2Q A;  5BPJ A;  4E68 A;  1B8C A;  2M7N A;  1DF0 A;  4MRY A;  1NX2 A;  2KOT A;  2KQY A;  3AAJ A;  4GUK A;  1CNP A;  2LLU A;  1CFF A;  2M97 A;  1UHN A;  3AKB A;  4P5O E;  2MHH A;  4XJK A;  1KWO C;  3F45 A;  4CID A;  3CGA A;  5AEQ A;  2HQW A;  1BMO A;  1ZAC A;  3D0Y A;  1NP8 A;  4TNC A;  2IS9 A;  5JOL A;  1V1G A;  3TDI A;  3LCP C;  1GGZ A;  3BUM B;  4HRH A;  1S5G Z;  2LHI A;  2RGI A;  1YUR A;  2LP3 A;  1J7Q A;  4N1G A;  2LUX A;  2LC5 A;  4QJ5 B;  1QX7 A;  1IJ5 A;  5KTY A;  2HPS A;  2AAO A;  2ISD A;  5ER5 A;  2EGD A;  2ZN8 A;  4MN0 A;  1KK8 C;  1B1G A;  2F2O A;  3DD4 A;  4NDC A;  4DUQ A;  3CLN A;  2KFG A;  1SRA A;  3I5F C;  2TN4 A;  2BCB A;  1R6P A;  1XA5 A;  1QS7 A;  3OX6 A;  4CPV A;  1A4P A;  1OE9 B;  1SL9 A;  1PVB A;  2A4J A;  1A75 B;  2K2F A;  3GOF A;  5IBW A;  1CDP A;  2NZ0 A;  3GK2 A;  1SCM C;  1J55 A;  3SG2 A;  4OVN F;  1NX1 A;  4U8D A;  3WHT B;  2MLE C;  2F8P A;  3JTD B;  1NCZ A;  4GAO A;  3CTN A;  1C7W A;  1QTX A;  2L2E A;  2KI4 B;  1CFD A;  1B7T Y;  1PVA A;  3NSL A;  3QRX A;  5AER A;  1TN4 A;  2E6W A;  1WRK A;  4YGC B;  2QAC A;  2ZKM X;  1AP4 A;  2PRU A;  3GK4 X;  4GGN A;  2JQ6 A;  1XFV O;  2NCO A; 
#chains in the Genus database with same CATH topology
 4YGD B;  3S0A A;  3TUY C;  4CLN A;  3D74 A;  1Z2C B;  3S0E A;  1CFP A;  3IQQ A;  3DVK A;  1LXF C;  1UHI A;  1S26 D;  1RK9 A;  1TWO A;  2LLT A;  4ORB B;  4YGB B;  1F55 A;  1XFX O;  3D78 A;  2D8N A;  5DKQ A;  3TS5 B;  2PMY A;  2ZND A;  2K7D A;  1TNQ A;  3EK7 A;  5D69 A;  4CFQ A;  2M1U A;  1JF2 A;  2PAS A;  1QLK A;  1K2H A;  3DF0 A;  3O4Y A;  2ZN9 A;  1B8L A;  2K2A A;  2WCJ A;  1KFX L;  2SAS A;  3I5H B;  3O2P A;  2GGZ A;  1DT7 B;  1N2D A;  2WOS A;  1M46 A;  1REC A;  1EG4 A;  3KO0 A;  1DQE A;  2F3Y A;  2ZRS A;  2Y5I A;  4YBH B;  3OBV A;  2WCH A;  1FBV A;  1ZUZ A;  2COL B;  1JC2 A;  1SSE B;  1OSA A;  1U5I A;  4GGF A;  2JTT A;  1FW4 A;  4MEW A;  4PE4 A;  3EK4 A;  2P70 A;  1EG3 A;  2M3W A;  3VRQ A;  1W7I B;  1ORG A;  1B7T Z;  1S6J A;  1QAS A;  2BL0 C;  1IKU A;  3EVU A;  1KQM C;  4N5X A;  1A2X A;  2JUL A;  1F70 A;  1OOF A;  3JVT B;  3O78 A;  4FQT A;  1SK6 D;  1TUZ A;  2KFH A;  1J7R A;  4YI8 A;  1FPW A;  4GBA A;  1MF8 B;  1XYD A;  2VRG A;  1YRT B;  3DY9 A;  1K93 D;  3B7A A;  1WRL A;  2L4H A;  3GK1 A;  3IF7 A;  2JNX A;  1CTR A;  3O4X A;  2M29 A;  4GGF C;  2BCX A;  2JWW A;  5CSI A;  1F4Q A;  2JXL A;  2KLD A;  2M7L A;  2JXC A;  2KHN A;  3EG5 B;  5HKZ A;  1ZMZ A;  1S6I A;  1QXP A;  3CDN A;  3CZT X;  2LMV A;  2G2B A;  1W9Z A;  4Q04 A;  2GGM A;  1F8H A;  1DJY A;  1TRF A;  2F3Z A;  1TUJ A;  4XYN A;  2M49 B;  2LVJ A;  2KSP A;  3EKJ A;  4QJ3 B;  3D76 A;  2H2K A;  2BCA A;  3BUX B;  3PLF B;  1EXR A;  1IGV A;  1ZFS A;  1IJ6 A;  1DTL A;  2I2R E;  3WNX B;  1MUX A;  4WQ3 A;  3CZ0 A;  1JBA A;  4JPZ B;  1ALV A;  2WC6 A;  4JWQ A;  3DYE A;  1YTZ C;  3I5G B;  3EVV A;  2SCP A;  1TNX A;  1BU3 A;  1SNL A;  1SL7 A;  2KBI A;  1K95 A;  1OW4 A;  4MSP A;  1CMF A;  3BFH A;  3LK0 A;  1EL4 A;  1Y1U A;  4BY5 A;  1NCY A;  4PHK A;  1AUI B;  4PHJ A;  3SG3 A;  4KYN A;  2JT8 A;  4GNK B;  2WC8 A;  3I5I C;  1OMD A;  1TCF A;  2BAP A;  2L2C A;  4UPG A;  2LV7 A;  1CDN A;  1PUL A;  1QJT A;  4NDD A;  3OB2 B;  1M63 B;  4I5L B;  3OHM B;  3BUW B;  1NPQ A;  1PK0 D;  2KFF A;  1DJG A;  4D1E A;  1NYA A;  1N65 A;  3CZ1 A;  2EC6 C;  4OKH A;  2QEH A;  3PAL A;  3BFA A;  1CLB A;  2LM5 A;  2KQ6 A;  2P71 A;  2CT9 A;  3RM1 A;  2JPT A;  2KI6 C;  2WCB A;  3R1V A;  5FI2 A;  2ZFD A;  1JWD A;  3KEV A;  5CSJ A;  2KAY A;  2KDH A;  4PE1 A;  1CDL A;  3VRN A;  2K60 A;  5JJG A;  1OQP A;  3NSI A;  5G08 A;  5HLO A;  3BUO B;  4JD9 A;  4WQ2 A;  1FI5 A;  2L98 A;  2MA2 A;  1M45 A;  5I2O A;  1KFU L;  1GM0 A;  1OMV A;  3E3R A;  1KWO B;  1XVJ A;  3L4A A;  1CFC A;  2LVI A;  3HCM A;  2CXJ A;  3VB1 A;  2L5X B;  1QWV A;  2LVV A;  3H4S E;  3RLZ A;  1DF0 B;  2MLF C;  3S0D A;  1UWO A;  1N0Y A;  3EK8 A;  2HF5 A;  1S6C A;  1YUT A;  1YX7 A;  2CBL A;  5HYD A;  5K89 A;  1G33 A;  3PSR A;  1IWQ A;  4GPL B;  2F33 A;  2JT3 A;  3B6X A;  4XJK B;  1EJ3 A;  3BYA A;  1MQ1 A;  2BE6 A;  1EH2 A;  1K9U A;  1KK8 B;  2OS8 C;  2ZNE A;  1C7V A;  1K94 A;  2LAP A;  2WCK A;  3PAT A;  1IG5 A;  2NCP A;  1C07 A;  1DMO A;  1BLQ A;  3I5F B;  1QVI Y;  1OOI X;  1RJV A;  3IVT A;  1S3P A;  2K0J A;  3SIB A;  3SG4 A;  1Z4H A;  1E8A A;  1ZOT B;  1M39 A;  1SBJ A;  1AJ4 A;  1SCM B;  1NWD A;  1UUR A;  1UUS A;  2EHB A;  3PM2 A;  4OZD A;  3UNW A;  1D1O A;  3AKA A;  4R1E A;  1L2O C;  3S0G A;  2Y1N A;  5HKW A;  4M2P A;  4PHM A;  4A4B A;  3BOW B;  1PSB A;  1TCO B;  3FS7 A;  3SG7 A;  1Y0V H;  3FE9 A;  3SJS A;  1BR1 B;  1VRK A;  2I7A A;  1NSH A;  1WDC C;  3RZS A;  2M8U A;  3TUY B;  5HKY A;  2KPH A;  3SG6 A;  3OX5 A;  1CDM A;  2H61 A;  3KF9 A;  2I94 A;  3LLE A;  2G9B A;  1XO5 A;  1XFY O;  1SR6 C;  1UHJ A;  1B4C A;  2JZI A;  1PSR A;  5CSN A;  3AAK A;  1AHR A;  2K7C A;  1XFU O;  2ZRT A;  4FQO A;  1WLZ A;  3NGV A;  2K61 A;  4PAL A;  1NUB A;  1QVI Z;  1QX2 A;  2BNX A;  2Q4U A;  1MR8 A;  2OTG C;  4I5K A;  4OV2 A;  1J7O A;  1KQV A;  4CFR A;  4PCW A;  3MSE B;  1SMG A;  5DKR A;  2KI6 D;  4DRW A;  2BBN A;  2JC2 A;  3SS4 A;  1DJH A;  1SPY A;  3BQ3 A;  1DJI A;  1MXE A;  2JOJ A;  3DXL A;  4PE7 A;  4QJ4 B;  3DF0 B;  1YX8 A;  2WCL A;  2BL0 B;  3FE6 A;  1IH0 A;  1KQM B;  2AUC A;  2KAX A;  2MAZ A;  1R2U A;  1ODB A;  1XFW O;  2BKH B;  4OR9 B;  1NIW A;  2JRF A;  1Y1A A;  4OCI A;  5B8I B;  4DCK A;  4MZK A;  1NX0 A;  3FE8 A;  1XFR A;  2WOR A;  4IJ7 A;  1B9A A;  4HRG A;  1U5I B;  2CTN A;  1SCV A;  4MRX A;  3S0B A;  3KHE A;  4MLW A;  2Y4Q A;  1H8B A;  3VRR A;  2R2I A;  4YGA A;  1GQM A;  4ORA B;  1QX5 B;  2PSR A;  1SYM A;  1KSO A;  1NCX A;  2BKI B;  4IL1 A;  1KSM A;  1BOD A;  3SS3 A;  3PM8 A;  2DOQ A;  4YGE B;  3PN7 C;  5GQQ C;  2GV5 A;  1K96 A;  1KCY A;  2BE4 A;  2KYF A;  4P2Y B;  3PFV A;  1SY9 A;  2NLN A;  2MRD A;  3CR2 A;  5AFP A;  1NX3 A;  1SL8 A;  3CS1 A;  3SS5 A;  1F54 A;  1JSA A;  3B88 A;  3PJI A;  1KFX S;  1CLL A;  3OP0 A;  1BF5 A;  1BOC A;  5F6T A;  1GGW A;  1W7J B;  2LAN A;  1TNW A;  5J3X A;  4ZCU A;  1LA3 A;  5ER4 X;  1TTX A;  2M9G A;  1OOJ A;  2LP2 A;  2BEC A;  5I8N A;  4MZJ A;  4NDB A;  4PE0 A;  3D10 A;  5KU1 A;  2CCM A;  1LVC D;  1YRU B;  2HET A;  3R1O A;  5FYX A;  1AVS A;  1DEK A;  1MWN A;  1QLS A;  3C1V A;  2FJU B;  1CKK A;  2PYQ A;  1QV0 A;  3I5I B;  5FI7 A;  1HT9 A;  1LKJ A;  2JU0 A;  1BR4 B;  3CZ2 A;  2JNF A;  3UO9 A;  1AJ5 A;  4YI9 A;  1S1E A;  1A75 A;  3O6B A;  3EKH A;  4NQG A;  3VRO A;  1YVH A;  5I2L A;  3CAB A;  3SG5 A;  4C0L A;  2OPO A;  2EC6 B;  2M1K B;  3DVE A;  3K21 A;  2BBM A;  2O5G A;  1S36 A;  1RTP 1;  4WRI A;  3CWG A;  2LNK A;  1FF1 A;  1C3Z A;  1QIW A;  2LHL A;  3HX4 A;  1OZS A;  1Y6W A;  2LVK A;  3VGO A;  4F7F A;  4AOM A;  3CYZ A;  1K9P A;  1QAT A;  3JTD C;  4PHN A;  1K90 D;  2QEV A;  1PRW A;  1IQ3 A;  1A03 A;  2KI4 C;  1TIZ A;  1J1D A;  2KGB C;  3D0Y B;  1DJZ A;  3TDU A;  3ZWH A;  2L50 A;  3D75 A;  1C3Y A;  3L47 A;  2KBM A;  5D3O A;  3TDZ A;  2WCE A;  3B86 A;  3A8R A;  2B1U A;  3DVJ A;  2L0P A;  3BOW A;  1DGU A;  3JVT C;  5AXI A;  2QPT A;  2NXQ A;  4MZL A;  1BT6 A;  2Q91 A;  5FI6 A;  3FWB A;  2JTZ A;  3S0F A;  1MHO A;  2FOT A;  4ICB A;  1OZO A;  2M0R A;  3EVR A;  2K7B A;  3TS5 C;  1MXL C;  2V53 A;  2QEO A;  2OS8 B;  2WC5 A;  1IRJ A;  4INW A;  4C0K A;  1SKT A;  3OGN A;  5PAL A;  1B8R A;  1BJF A;  3DVM A;  4JQ0 D;  1YVL A;  2PAL A;  3I5H C;  1G8I A;  2FCD A;  5TNC A;  4HSZ A;  1YR5 A;  4M2O A;  2K7O A;  3VRP A;  1QV1 A;  1M31 A;  4MBE A;  5AAN A;  1RRO A;  3DZT A;  2E30 A;  3NHI A;  3D77 A;  1AK8 A;  4ORC B;  5DKN A;  4C0J A;  2LCP A;  4USL A;  1TOP A;  1QIV A;  1WY9 A;  3LK1 A;  2AMI A;  1L2O B;  2CNP A;  2WND A;  2JT0 A;  3CR5 X;  3BXK A;  3M0W A;  4HRE E;  1YUU A;  5CSF A;  1GJY A;  2ERB A;  1UP5 A;  4FTG A;  4A4C A;  2JPO A;  1XK4 A;  2H61 C;  2KAV A;  1WDC B;  2HQ8 A;  1KFU S;  2L4I A;  1H4B A;  1V1F A;  3NXA A;  1CM1 A;  2LMU A;  4I5J A;  4ETO A;  3A4U B;  1B47 A;  5I2Q A;  1JFK A;  1F71 A;  5I94 A;  3KPX A;  3LL8 B;  5HLV A;  1CM4 A;  2MJW B;  1OMR A;  1SR6 B;  4I5N B;  3FWC A;  1WRZ A;  4AQJ A;  1J1E A;  1KK7 Y;  1CMG A;  1TNP A;  5CPV A;  1SW8 A;  1K8U A;  2FCE A;  2QDI A;  3IQO A;  1XK4 C;  1UHK A;  3BFB A;  2WCM A;  1G4Y R;  2KYC A;  2PVB A;  1OOG A;  1LA0 A;  2H8V A;  1IIO A;  2YGU A;  2OTG B;  1LIN A;  1RFJ A;  4MVF A;  1ALW A;  1K9K A;  4YRU A;  3FIA A;  3TZ1 A;  1IQ5 A;  1L7Z A;  2K8M B;  2LLS A;  1LS8 A;  1CB1 A;  1JUO A;  1Q80 A;  2LE9 B;  2PQL A;  3SIA A;  4PDZ A;  1XFZ O;  1X02 A;  1HQV A;  4N1F A;  2MBX A;  5KSZ A;  2KGR A;  1YUS A;  3I5G C;  3WXA A;  2L51 A;  5D7F A;  3OB1 B;  1OOH A;  3V2L A;  1Y1X A;  3QME A;  1F4O A;  1WLM A;  3L4L A;  4PT1 A;  4DIR A;  1RWY A;  1DVI A;  1UHH A;  4DS7 A;  1J7P A;  1DEL A;  2KNE A;  2F2P A;  2Y1M A;  3ZNI A;  4ZCV A;  4BY4 A;  1S5G Y;  1JFJ A;  1PAL A;  3NSO A;  4L9M A;  2LMT A;  4F0Z B;  3B87 A;  2I18 A;  1CLM A;  1DGV A;  3WHU B;  1DJW A;  1DJX A;  1KK7 Z;  1A29 A;  1JF0 A;  2O60 A;  2L5Y A;  5HL1 A;  1BG1 A;  2LUC A;  3BUN B;  3ICB A;  5EL2 A;  3N7H A;  3NSK A;  4INX A;  1FI6 A;  3CR4 X;  2P6B B;  3PN7 B;  1T14 A;  2WCF A;  4AQI A;  4M2Q A;  5BPJ A;  4E68 A;  1B8C A;  2M7N A;  1DF0 A;  4MRY A;  1NX2 A;  2QEB A;  2KOT A;  2KQY A;  3AAJ A;  4GUK A;  5DIC A;  1CNP A;  2LLU A;  1CFF A;  3NHT A;  2M97 A;  1UHN A;  3D73 A;  3AKB A;  4P5O E;  2MHH A;  2GTE A;  4XJK A;  1KWO C;  3F45 A;  4CID A;  3CGA A;  5AEQ A;  2HQW A;  2KLE A;  1BMO A;  1ZAC A;  3D0Y A;  1NP8 A;  4TNC A;  2IS9 A;  5JOL A;  1V1G A;  3TDI A;  3LCP C;  1GGZ A;  3BUM B;  3K1E A;  4HRH A;  1S5G Z;  2LHI A;  2RGI A;  1YUR A;  2LP3 A;  4JKT A;  1J7Q A;  4N1G A;  3R1P A;  2LUX A;  2LC5 A;  4QJ5 B;  1QX7 A;  1IJ5 A;  5KTY A;  2HPS A;  2AAO A;  4GFT A;  2ISD A;  5ER5 A;  2EGD A;  2ZN8 A;  4MN0 A;  1KK8 C;  1B1G A;  2F2O A;  3Q8I A;  3DD4 A;  1P28 A;  4NDC A;  4DUQ A;  2FJY A;  2KFG A;  3CLN A;  1SRA A;  3I5F C;  2TN4 A;  2BCB A;  1R6P A;  1XA5 A;  1QS7 A;  3OX6 A;  4CPV A;  1A4P A;  1OE9 B;  1SL9 A;  1DC1 A;  1PVB A;  2A4J A;  1A75 B;  2K2F A;  3GOF A;  5IBW A;  1CDP A;  2NZ0 A;  3GK2 A;  1SCM C;  1J55 A;  3SG2 A;  3BJH A;  4OVN F;  1NX1 A;  4U8D A;  3WHT B;  2MLE C;  2F8P A;  3JTD B;  1NCZ A;  4GAO A;  3CTN A;  1C7W A;  1QTX A;  2L2E A;  2KI4 B;  1CFD A;  1B7T Y;  1PVA A;  3NSL A;  3QRX A;  5AER A;  1TN4 A;  2E6W A;  1WRK A;  4YGC B;  2QAC A;  2ZKM X;  1AP4 A;  2PRU A;  3GK4 X;  4GGN A;  2JQ6 A;  1XFV O;  3R72 A;  2NCO A; 
#chains in the Genus database with same CATH homology
 4YGD B;  3TUY C;  4CLN A;  1CFP A;  3IQQ A;  3DVK A;  1LXF C;  1UHI A;  1S26 D;  1RK9 A;  2LLT A;  4ORB B;  4YGB B;  1F55 A;  1XFX O;  2D8N A;  5DKQ A;  3TS5 B;  2PMY A;  2ZND A;  2K7D A;  1TNQ A;  3EK7 A;  5D69 A;  4CFQ A;  2M1U A;  1JF2 A;  2PAS A;  1QLK A;  1K2H A;  3DF0 A;  3O4Y A;  2ZN9 A;  1B8L A;  2K2A A;  3I5H B;  1KFX L;  2SAS A;  3O2P A;  1DT7 B;  2GGZ A;  1N2D A;  2WOS A;  1M46 A;  1REC A;  1EG4 A;  3KO0 A;  2F3Y A;  2ZRS A;  2Y5I A;  4YBH B;  1FBV A;  1ZUZ A;  2COL B;  1JC2 A;  1OSA A;  1U5I A;  4GGF A;  2JTT A;  1FW4 A;  4MEW A;  4PE4 A;  3EK4 A;  1EG3 A;  2M3W A;  3VRQ A;  1W7I B;  1B7T Z;  1S6J A;  1QAS A;  2BL0 C;  1IKU A;  3EVU A;  1KQM C;  4N5X A;  1A2X A;  2JUL A;  1F70 A;  3JVT B;  3O78 A;  4YI8 A;  1SK6 D;  2KFH A;  1J7R A;  1FPW A;  4GBA A;  1MF8 B;  1XYD A;  2VRG A;  1YRT B;  1K93 D;  3IF7 A;  1WRL A;  2L4H A;  3GK1 A;  4GFT A;  2JNX A;  1CTR A;  4GGF C;  2M29 A;  5CSI A;  2BCX A;  2JWW A;  1F4Q A;  2JXL A;  2M7L A;  2JXC A;  2KHN A;  5HKZ A;  1ZMZ A;  1S6I A;  1QXP A;  3CZT X;  2LMV A;  2G2B A;  4Q04 A;  2GGM A;  1F8H A;  1DJY A;  1TRF A;  2F3Z A;  4XYN A;  2M49 B;  2LVJ A;  2KSP A;  3EKJ A;  4QJ3 B;  2H2K A;  2BCA A;  3BUX B;  3PLF B;  1EXR A;  1IGV A;  1ZFS A;  1IJ6 A;  1DTL A;  2I2R E;  3WNX B;  1MUX A;  4WQ3 A;  1JBA A;  4JPZ B;  1ALV A;  4JWQ A;  1YTZ C;  3I5G B;  3EVV A;  2SCP A;  1TNX A;  1BU3 A;  1SNL A;  1SL7 A;  2KBI A;  1K95 A;  4MSP A;  1CMF A;  3LK0 A;  1EL4 A;  1Y1U A;  4BY5 A;  1NCY A;  4PHK A;  1AUI B;  4PHJ A;  3SG3 A;  2JT8 A;  4GNK B;  2WC8 A;  3I5I C;  1OMD A;  1TCF A;  4UPG A;  2LV7 A;  1CDN A;  1PUL A;  1QJT A;  4NDD A;  3OB2 B;  1M63 B;  4I5L B;  3OHM B;  3BUW B;  1NPQ A;  1PK0 D;  2KFF A;  1DJG A;  4D1E A;  1NYA A;  1N65 A;  2EC6 C;  4OKH A;  3PAL A;  1CLB A;  2LM5 A;  2KQ6 A;  2CT9 A;  3RM1 A;  2JPT A;  2KI6 C;  2WCB A;  2ZFD A;  1JWD A;  3KEV A;  5CSJ A;  2KAY A;  2KDH A;  4PE1 A;  1CDL A;  3VRN A;  5JJG A;  1OQP A;  3NSI A;  5G08 A;  5HLO A;  3BUO B;  1FI5 A;  4WQ2 A;  2L98 A;  2MA2 A;  1M45 A;  5I2O A;  1KFU L;  1OMV A;  3E3R A;  1KWO B;  1XVJ A;  1CFC A;  2LVI A;  3HCM A;  2CXJ A;  2L5X B;  2LVV A;  3H4S E;  3RLZ A;  1DF0 B;  2MLF C;  1UWO A;  1N0Y A;  3EK8 A;  2HF5 A;  1S6C A;  1YUT A;  1YX7 A;  2CBL A;  5HYD A;  5K89 A;  1G33 A;  3PSR A;  1IWQ A;  4GPL B;  2F33 A;  2JT3 A;  4XJK B;  1EJ3 A;  3BYA A;  1MQ1 A;  2BE6 A;  1EH2 A;  1K9U A;  1KK8 B;  2OS8 C;  2ZNE A;  1C7V A;  1K94 A;  2LAP A;  3PAT A;  1IG5 A;  2NCP A;  1C07 A;  1DMO A;  1BLQ A;  3I5F B;  1QVI Y;  1RJV A;  1S3P A;  2K0J A;  3SIB A;  3SG4 A;  1E8A A;  1ZOT B;  1M39 A;  1SBJ A;  1AJ4 A;  1SCM B;  1NWD A;  1UUR A;  1UUS A;  2EHB A;  1D1O A;  3AKA A;  4R1E A;  1L2O C;  2Y1N A;  5HKW A;  4M2P A;  4PHM A;  4A4B A;  3BOW B;  1PSB A;  1TCO B;  3FS7 A;  3SG7 A;  1Y0V H;  3SJS A;  1BR1 B;  1VRK A;  2I7A A;  1NSH A;  1WDC C;  2M8U A;  3TUY B;  5HKY A;  3SG6 A;  3OX5 A;  1CDM A;  2H61 A;  3KF9 A;  2I94 A;  3LLE A;  2G9B A;  1XO5 A;  1XFY O;  1SR6 C;  1UHJ A;  1B4C A;  2JZI A;  1PSR A;  5CSN A;  3AAK A;  1AHR A;  2K7C A;  1XFU O;  2ZRT A;  4FQO A;  1WLZ A;  2K61 A;  4PAL A;  1NUB A;  1QVI Z;  1QX2 A;  2Q4U A;  4I5K A;  1MR8 A;  2OTG C;  4OV2 A;  1J7O A;  1KQV A;  4CFR A;  4PCW A;  3MSE B;  1SMG A;  5DKR A;  2KI6 D;  4DRW A;  2BBN A;  2JC2 A;  1DJH A;  1SPY A;  3BQ3 A;  1DJI A;  1MXE A;  2JOJ A;  4PE7 A;  4QJ4 B;  3DF0 B;  1YX8 A;  2BL0 B;  1IH0 A;  1KQM B;  2AUC A;  2KAX A;  2MAZ A;  1R2U A;  1ODB A;  1XFW O;  2BKH B;  4OR9 B;  1NIW A;  2JRF A;  1Y1A A;  4OCI A;  5B8I B;  4DCK A;  4MZK A;  1NX0 A;  2WOR A;  1B9A A;  4HRG A;  1U5I B;  2CTN A;  1SCV A;  4MRX A;  3KHE A;  4MLW A;  2Y4Q A;  1H8B A;  3VRR A;  2R2I A;  4YGA A;  1GQM A;  4ORA B;  1QX5 B;  2PSR A;  1SYM A;  1KSO A;  1NCX A;  2BKI B;  4IL1 A;  1KSM A;  1BOD A;  3PM8 A;  2DOQ A;  4YGE B;  3PN7 C;  5GQQ C;  2GV5 A;  1K96 A;  1KCY A;  2BE4 A;  2KYF A;  4P2Y B;  3PFV A;  1SY9 A;  2NLN A;  2MRD A;  3CR2 A;  5AFP A;  1NX3 A;  1SL8 A;  3CS1 A;  1F54 A;  1JSA A;  1KFX S;  1CLL A;  3OP0 A;  1BF5 A;  1BOC A;  5F6T A;  1GGW A;  1W7J B;  2LAN A;  1TNW A;  5J3X A;  4ZCU A;  1LA3 A;  5ER4 X;  1TTX A;  2M9G A;  1OOJ A;  2LP2 A;  2BEC A;  5I8N A;  4MZJ A;  4NDB A;  4PE0 A;  3D10 A;  5KU1 A;  2CCM A;  1LVC D;  1YRU B;  2HET A;  5FYX A;  1AVS A;  1MWN A;  1QLS A;  3C1V A;  2FJU B;  1CKK A;  1QV0 A;  3I5I B;  1HT9 A;  1LKJ A;  2JU0 A;  1BR4 B;  2JNF A;  1AJ5 A;  4YI9 A;  1S1E A;  1A75 A;  3O6B A;  3EKH A;  4NQG A;  3VRO A;  1YVH A;  5I2L A;  3SG5 A;  4C0L A;  2OPO A;  2EC6 B;  2M1K B;  3DVE A;  3K21 A;  2BBM A;  2O5G A;  1S36 A;  1RTP 1;  4WRI A;  3CWG A;  2LNK A;  1FF1 A;  1QIW A;  2LHL A;  3HX4 A;  1OZS A;  1Y6W A;  2LVK A;  3VGO A;  4AOM A;  1K9P A;  1QAT A;  3JTD C;  4PHN A;  1K90 D;  1PRW A;  1IQ3 A;  1A03 A;  2KI4 C;  1TIZ A;  1J1D A;  2KGB C;  3D0Y B;  1DJZ A;  3TDU A;  3ZWH A;  2L50 A;  2KBM A;  3TDZ A;  2WCE A;  3A8R A;  2B1U A;  3DVJ A;  2L0P A;  3BOW A;  1DGU A;  3JVT C;  5AXI A;  2QPT A;  2NXQ A;  4MZL A;  1BT6 A;  2Q91 A;  3FWB A;  2JTZ A;  1MHO A;  2FOT A;  4ICB A;  1OZO A;  2M0R A;  3EVR A;  2K7B A;  3TS5 C;  1MXL C;  2V53 A;  2OS8 B;  1IRJ A;  4C0K A;  1SKT A;  5PAL A;  1B8R A;  1BJF A;  3DVM A;  4JQ0 D;  1YVL A;  2PAL A;  3I5H C;  1G8I A;  2FCD A;  5TNC A;  4HSZ A;  1YR5 A;  4M2O A;  2K7O A;  3VRP A;  1QV1 A;  1M31 A;  4MBE A;  5AAN A;  1RRO A;  2E30 A;  1AK8 A;  4ORC B;  5DKN A;  4C0J A;  2LCP A;  4USL A;  1TOP A;  1QIV A;  1WY9 A;  3LK1 A;  2AMI A;  1L2O B;  2CNP A;  2WND A;  2JT0 A;  3CR5 X;  3BXK A;  3M0W A;  4HRE E;  1YUU A;  5CSF A;  1GJY A;  1UP5 A;  4FTG A;  4A4C A;  2KAV A;  1XK4 A;  2H61 C;  2L4I A;  1WDC B;  2HQ8 A;  1KFU S;  1H4B A;  1V1F A;  3NXA A;  1CM1 A;  2LMU A;  4I5J A;  4ETO A;  3A4U B;  1B47 A;  5I2Q A;  1JFK A;  1F71 A;  3KPX A;  3LL8 B;  5HLV A;  1CM4 A;  2MJW B;  1OMR A;  1SR6 B;  4I5N B;  3FWC A;  1WRZ A;  4AQJ A;  1J1E A;  1KK7 Y;  1CMG A;  1TNP A;  5CPV A;  1SW8 A;  1K8U A;  2FCE A;  3IQO A;  1XK4 C;  1UHK A;  1G4Y R;  2KYC A;  2PVB A;  1LA0 A;  2OTG B;  1LIN A;  1RFJ A;  4MVF A;  1ALW A;  1K9K A;  4YRU A;  3FIA A;  3TZ1 A;  1IQ5 A;  1L7Z A;  2K8M B;  2LLS A;  1CB1 A;  1JUO A;  1Q80 A;  2LE9 B;  3SIA A;  4PDZ A;  1XFZ O;  1X02 A;  1HQV A;  4N1F A;  2MBX A;  5KSZ A;  2KGR A;  1YUS A;  3I5G C;  3WXA A;  2L51 A;  5D7F A;  3OB1 B;  1Y1X A;  1F4O A;  1WLM A;  4DIR A;  4DS7 A;  1RWY A;  1DVI A;  1UHH A;  1J7P A;  2KNE A;  2F2P A;  2Y1M A;  3ZNI A;  4ZCV A;  4BY4 A;  1S5G Y;  1JFJ A;  1PAL A;  3NSO A;  4L9M A;  2LMT A;  4F0Z B;  2I18 A;  1CLM A;  1DGV A;  3WHU B;  1DJW A;  1DJX A;  1KK7 Z;  1A29 A;  1JF0 A;  2O60 A;  1BG1 A;  2LUC A;  3BUN B;  3ICB A;  3NSK A;  1FI6 A;  3CR4 X;  2P6B B;  3PN7 B;  2WCF A;  4AQI A;  4M2Q A;  5BPJ A;  4E68 A;  1B8C A;  2M7N A;  1DF0 A;  4MRY A;  1NX2 A;  2KOT A;  2KQY A;  3AAJ A;  4GUK A;  1CNP A;  2LLU A;  1CFF A;  2M97 A;  1UHN A;  3AKB A;  4P5O E;  2MHH A;  4XJK A;  1KWO C;  3F45 A;  4CID A;  3CGA A;  5AEQ A;  2HQW A;  1BMO A;  1ZAC A;  3D0Y A;  1NP8 A;  4TNC A;  2IS9 A;  5JOL A;  1V1G A;  3TDI A;  3LCP C;  1GGZ A;  3BUM B;  4HRH A;  1S5G Z;  2LHI A;  2RGI A;  1YUR A;  2LP3 A;  1J7Q A;  4N1G A;  2LUX A;  2LC5 A;  4QJ5 B;  1QX7 A;  1IJ5 A;  5KTY A;  2HPS A;  2AAO A;  2ISD A;  5ER5 A;  2EGD A;  2ZN8 A;  4MN0 A;  1KK8 C;  1B1G A;  2F2O A;  3DD4 A;  4NDC A;  4DUQ A;  3CLN A;  2KFG A;  1SRA A;  3I5F C;  2TN4 A;  2BCB A;  1R6P A;  1XA5 A;  1QS7 A;  3OX6 A;  4CPV A;  1A4P A;  1OE9 B;  1SL9 A;  1PVB A;  2A4J A;  1A75 B;  2K2F A;  3GOF A;  5IBW A;  1CDP A;  2NZ0 A;  3GK2 A;  1SCM C;  1J55 A;  3SG2 A;  4OVN F;  1NX1 A;  4U8D A;  3WHT B;  2MLE C;  2F8P A;  3JTD B;  1NCZ A;  4GAO A;  3CTN A;  1C7W A;  1QTX A;  2L2E A;  2KI4 B;  1CFD A;  1B7T Y;  1PVA A;  3NSL A;  3QRX A;  5AER A;  1TN4 A;  2E6W A;  1WRK A;  4YGC B;  2QAC A;  2ZKM X;  1AP4 A;  2PRU A;  3GK4 X;  4GGN A;  2JQ6 A;  1XFV O;  2NCO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...