2M1UA

Solution structure of the small dictyostelium discoideium myosin light chain mlcb provides insights into iq-motif recognition of class i myosin myo1b
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
93
structure length
93
Chain Sequence
MGSSHHHHHHSSGLVPRGSHMSDEKTQLIEAFYNFDGDYDGFVSVEEFRGIIRDGLPMTEAEITEFFEAADPNNTGFIDYKAFAAMLYSVDES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords myosin light chain MlcB
publication title Structure of the small Dictyostelium discoideum myosin light chain MlcB provides insights into MyoB IQ motif recognition.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Contractile protein
total genus 10
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2012-12-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2m1uA01
1MR8A 1UHIA 1FI6A 1K9PA 3VROA 2LE9B 1ZACA 1TCOB 4N1FA 3SG7A 1XFXO 1W7IB 1Y1UA 1BOCA 2JT3A 1DJWA 2CXJA 1IQ3A 2L4IA 2AMIA 1WRZA 4F0ZB 1J7QA 3QRXA 1QX2A 4PE7A 4MRYA 1XFUO 2OTGC 1N65A 2MBXA 1BR4B 1TNQA 2BL0C 1PULA 2EHBA 3MSEB 1LA3A 2KYFA 5AANA 1D1OA 1YX7A 1FW4A 2KFGA 2O5GA 1YVLA 5KU1A 2LP3A 1IKUA 1CM4A 2Y5IA 4MLWA 1DT7B 1DJYA 1CFPA 3TS5B 3JVTB 2LVKA 4R1EA 4JPZB 1FPWA 1QTXA 1SYMA 1YRTB 4ORAB 3EKJA 3TDZA 1WRKA 4I5NB 1DGUA 4WQ2A 1V1FA 4PCWA 5CPVA 1PRWA 1DF0A 4DCKA 3LLEA 1QASA 2R2IA 1KSMA 2RGIA 1SRAA 2L0PA 1U5IA 1TRFA 2KGRA 3ICBA 2K0JA 3NSLA 4MZJA 1AP4A 4YGDB 3VRNA 3PSRA 1S5GY 3KHEA 1QXPA 2WC8A 4PDZA 1YTZC 4PALA 1DJIA 2HQWA 1KQMC 2MAZA 1PALA 4OV2A 5HYDA 2FCDA 4D1EA 1PVBA 1C07A 2HQ8A 1CLBA 1KK8B 1CB1A 2WNDA 3I5GC 5BPJA 1W7JB 1SW8A 1IQ5A 2E30A 1BJFA 2WCFA 2JRFA 2LC5A 1S5GZ 3O2PA 1PSBA 1CTRA 1OQPA 2CCMA 3TDUA 3OHMB 3JTDC 2CTNA 1XYDA 4JWQA 5HLVA 2ZN9A 4DS7A 4CFQA 2BKHB 2PSRA 2BL0B 5K89A 4GUKA 2WOSA 1BODA 4PHKA 1CMGA 2CT9A 3PN7C 1KCYA 2ZN8A 4XYNA 1FBVA 1DJZA 2DOQA 4I5JA 2KI6C 2VRGA 4MZLA 2V53A 4HRHA 5KSZA 1YURA 2TN4A 2IS9A 5CSIA 4QJ3B 2I2RE 2JNFA 1M39A 1QIWA 1B9AA 2JT8A 1CFCA 4C0LA 2EGDA 2F2OA 4OVNF 5B8IB 1RROA 2KSPA 1QJTA 4OCIA 2L2EA 2M0RA 4C0JA 3LK0A 1K94A 3BUWB 4UPGA 4MSPA 1YVHA 5TNCA 1A29A 1GGZA 5F6TA 1J1EA 1RECA 5FYXA 4WQ3A 2K7DA 1IJ6A 1B8LA 2KFFA 1HQVA 5DKRA 3FWCA 4XJKB 1JF0A 1SPYA 1XFZO 1J55A 2M1KB 1ALWA 3PM8A 1B47A 1KK7Y 2G2BA 1JBAA 2HF5A 2JPTA 1U5IB 2LVIA 2LAPA 1CLLA 1SL7A 1K9KA 2JU0A 5CSFA 3SG4A 2KAXA 3VRPA 1NPQA 5PALA 4WRIA 1QX5B 3O6BA 1PSRA 4YI9A 3D0YA 3KEVA 1L2OB 3GK2A 1LA0A 4I5KA 1RWYA 2PALA 3BUMB 1Y1XA 2KBIA 2KAVA 5I2OA 3DF0A 1KK7Z 1OOJA 2M9GA 1JC2A 3WHTB 3PLFB 2K2AA 3SIAA 4DUQA 2SASA 3CR2A 1S6JA 3BOWA 1JWDA 2LCPA 4ZCVA 1WRLA 1SBJA 3DVKA 1QLKA 2KI4B 2ZRSA 1F71A 2LV7A 1BT6A 1F4OA 1KSOA 3EK8A 1KFUL 2BBMA 4HRGA 1F55A 1UHKA 2JOJA 2K7OA 1AK8A 3VRQA 3LK1A 2K2FA 1K90D 1FF1A 2BE4A 2LVJA 1Y1AA 3I5HC 1TOPA 1M46A 3RLZA 1SR6B 3DD4A 3I5IB 4FTGA 5I8NA 1J7RA 4BY4A 1EXRA 1MHOA 1TTXA 3DVJA 1QV0A 2LHLA 3VGOA 1SL9A 3K21A 1TN4A 3PATA 1HT9A 2SCPA 1NP8A 1K9UA 1RTP1 2EC6C 4GPLB 4P2YB 4MN0A 4C0KA 4XJKA 1J7PA 2M7NA 2KNEA 5AEQA 1UURA 1WDCC 3GK4X 2D8NA 4PE1A 1SY9A 3I5FC 1OSAA 1RK9A 3EK7A 1KWOB 1MXLC 5DKNA 2COLB 4YI8A 2K7BA 3FS7A 2CNPA 1DVIA 4MRXA 4A4CA 4HSZA 1QS7A 4Q04A 1CKKA 1OMRA 5AERA 4NDBA 2JC2A 3D0YB 2AUCA 3TUYC 4OR9B 2FJUB 3NXAA 2PASA 1S1EA 5KTYA 1CLMA 3DF0B 2NZ0A 2LMVA 2BKIB 3EVVA 1K96A 4PHNA 3AKAA 2I7AA 4NQGA 2L98A 3NSOA 2MHHA 3NSIA 2BCBA 2OTGB 3BOWB 1CFFA 1S6IA 2MJWB 3A8RA 1NX1A 4P5OE 1OE9B 3BUNB 1RJVA 4QJ4B 3E3RA 2JXLA 3SG6A 1NX3A 3I5HB 2NCPA 2OS8C 3O78A 1Q80A 2ZKMX 3KF9A 1CM1A 5ER5A 5HKZA 1KFUS 1B7TY 2KOTA 1YX8A 3CR5X 4YRUA 1WLZA 3IF7A 1S26D 3GK1A 4AQIA 1K95A 2KDHA 1JUOA 2LNKA 5CSJA 3RM1A 2L51A 1G8IA 1TNPA 4AQJA 4CIDA 1ODBA 3CWGA 3SG3A 3LCPC 3EK4A 2FCEA 1MXEA 3OX6A 1ALVA 5DKQA 3SJSA 1K8UA 2KAYA 1KFXL 1YR5A 2F2PA 2KQYA 3WXAA 1B8CA 1B7TZ 1NSHA 1QLSA 2JNXA 4FQOA 1G33A 2G9BA 1ZMZA 1DGVA 1YUSA 1GJYA 2OPOA 4DIRA 4MVFA 1KQMB 3AAJA 4HREE 2L5XB 2LUXA 4DRWA 1YRUB 2Y4QA 3KPXA 3AAKA 1EH2A 1K93D 2AAOA 2NCOA 4GGFC 3I5GB 3SG2A 2Y1MA 2M97A 2ZNDA 1LXFC 1IG5A 2KBMA 4OKHA 1Y6WA 2F33A 2L50A 4GAOA 2ISDA 4CLNA 2JWWA 2P6BB 4MZKA 3JTDB 1H8BA 1NCZA 2LLTA 2GV5A 1A2XA 1SNLA 3A4UB 3FWBA 1NX2A 5J3XA 1JF2A 2BBNA 3ZNIA 1BF5A 1QVIY 4ZCUA 2Q91A 3PN7B 1JFJA 3D10A 1UP5A 2NXQA 5HKYA 4M2PA 1EJ3A 1SKTA 3VRRA 3EVUA 4AOMA 1CFDA 1UHHA 1Y0VH 2QPTA 4USLA 5HKWA 2FOTA 2M7LA 3JVTC 5CSNA 3WHUB 4E68A 1B8RA 3F45A 1E8AA 4GNKB 1JFKA 3KO0A 1MWNA 5AXIA 1ZUZA 2ZFDA 1TCFA 1M31A 1F70A 1NIWA 1AVSA 1LINA 1UUSA 3IQQA 5HLOA 3LL8B 4YGEB 2MRDA 2BECA 1UWOA 3HX4A 1K2HA 4ETOA 2O60A 1SCVA 2M29A 2A4JA 1R2UA 2CBLA 2JZIA 2KFHA 1NWDA 1IH0A 3BXKA 2K8MB 1XK4C 1IJ5A 3OX5A 1XFYO 2JQ6A 3CGAA 2LHIA 1IGVA 4N5XA 5I2LA 3O4YA 1J7OA 2K61A 1F54A 4MEWA 2GGMA 1DJHA 1KK8C 2F3ZA 3PFVA 1IRJA 1TNXA 2JTZA 2PVBA 1KFXS 1SL8A 4GFTA 1YUTA 2H61C 1QATA 3SG5A 5D69A 4CFRA 1AUIB 2B1UA 1X02A 1IWQA 4ORCB 1BLQA 1CMFA 2NLNA 1KQVA 3FIAA 2KQ6A 3GOFA 3OB2B 1SK6D 2M3WA 1VRKA 4N1GA 1CDLA 3AKBA 1SMGA 1ZOTB 2E6WA 3WNXB 2JULA 1L7ZA 1SCMC 2K7CA 3BUOB 1AHRA 1V1GA 1UHNA 1EG3A 4JQ0D 2F3YA 1QV1A 1FI5A 1S6CA 1TIZA 3EVRA 4PHJA 1YUUA 1DMOA 1AJ5A 1XO5A 3BYAA 5D7FA 4NDCA 1NX0A 3TDIA 1NYAA 2M8UA 1S36A 2LLUA 3PALA 4YGAA 1J1DA 1LKJA 4M2OA 2WORA 1TNWA 2PMYA 3SIBA 2Y1NA 2KHNA 1CDNA 3C1VA 2JXCA 2L4HA 2ZNEA 1NCYA 1MQ1A 1M45A 2KI6D 4M2QA 2LMTA 2MLEC 5JJGA 1PVAA 5IBWA 2I94A 3M0WA 1A03A 1XA5A 1XVJA 1CDPA 1CDMA 2LLSA 2WCEA 1JSAA 1DJXA 3OP0A 3TZ1A 2LANA 1A75B 2LUCA 2HETA 1NUBA 1F4QA 2WCBA 4PHMA 5ER4X 1AJ4A 2F8PA 2EC6B 4ORBB 1L2OC 4I5LB 1B1GA 4BY5A 1XFVO 1C7WA 4GGFA 1B4CA 1GQMA 1WDCB 5G08A 2KYCA 2JT0A 1MF8B 3I5FB 3DVMA 1PK0D 1SCMB 1M63B 2QACA 1OZSA 1EG4A 3CLNA 1CNPA 1OMDA 1LVCD 3IQOA 1BMOA 1BU3A 3BUXB 2LM5A 1GGWA 2BCXA 2MLFC 5I2QA 3CZTX 3TUYB 5AFPA 4PE0A 1F8HA 1ZFSA 2KI4C 2M1UA 5JOLA 3NSKA 2JTTA 2M49B 1DJGA 3EKHA 3CTNA 1WLMA 1WY9A 1A4PA 1S3PA 2BE6A 1H4BA 1QX7A 1R6PA 3H4SE 1N0YA 2ZRTA 2LVVA 2LP2A 1DTLA 4MBEA 3BQ3A 1G4YR 3DVEA 4U8DA 1DF0B 1SR6C 2OS8B 3I5IC 2HPSA 1NCXA 2H2KA 3OB1B 3TS5C 4GBAA 5GQQC 1BG1A 1UHJA 4YGCB 2GGZA 4QJ5B 2PRUA 1EL4A 1N2DA 4PE4A 4CPVA 1XFWO 1XK4A 2KGBC 4YGBB 3HCMA 4TNCA 1BR1B 4ICBA 4A4BA 1C7VA 4L9MA 4NDDA 1QIVA 1MUXA 1QVIZ 2BCAA 4IL1A 4GGNA 2I18A 2LMUA 1RFJA 4YBHB 1OMVA 1A75A 1KWOC 2Q4UA 2H61A 1OZOA 3CR4X 2MA2A 3ZWHA 3CS1A
chains in the Genus database with same CATH superfamily
1MR8A 1UHIA 3O4XA 1FI6A 3VB1A 2WCKA 1K9PA 3VROA 2WCLA 2LE9B 1ZACA 1TCOB 4N1FA 3CZ0A 3SG7A 1XFXO 1W7IB 1Y1UA 3L4AA 1BOCA 2JT3A 3SS4A 1DJWA 2CXJA 1IQ3A 2L4IA 2YGUA 1TUJA 2AMIA 1WRZA 4F0ZB 1J7QA 2BNXA 3QRXA 1QX2A 4PE7A 4MRYA 1XFUO 2OTGC 1N65A 2MBXA 1BR4B 1TNQA 2BL0C 1PULA 1W9ZA 2EHBA 3MSEB 1LA3A 2KYFA 5AANA 3S0DA 1YX7A 1FW4A 3D76A 2KFGA 1D1OA 3R1PA 2O5GA 1YVLA 5KU1A 1GM0A 2LP3A 1IKUA 1CM4A 2Y5IA 4MLWA 1DT7B 1DJYA 1CFPA 3TS5B 3JVTB 2LVKA 4R1EA 4JPZB 1FPWA 1QTXA 5EL2A 1SYMA 1YRTB 4ORAB 3EKJA 3TDZA 1ORGA 1WRKA 4I5NB 1DGUA 4WQ2A 1V1FA 4PCWA 5CPVA 1PRWA 1DF0A 4DCKA 3LLEA 1QASA 2R2IA 5DICA 1KSMA 2RGIA 1SRAA 2L0PA 1U5IA 1TRFA 2KGRA 3ICBA 2K0JA 3NSLA 4MZJA 1AP4A 4YGDB 3VRNA 3PSRA 1S5GY 4PT1A 3KHEA 1QXPA 2WC8A 4PDZA 1YTZC 4PALA 1DJIA 2HQWA 1KQMC 1P28A 2MAZA 1PALA 4OV2A 5HYDA 5HL1A 2FCDA 4D1EA 1PVBA 1C07A 2HQ8A 1CLBA 1KK8B 1CB1A 2WNDA 3I5GC 5BPJA 1W7JB 1SW8A 3N7HA 1IQ5A 2E30A 1BJFA 2WCFA 2JRFA 3DZTA 2LC5A 1S5GZ 3O2PA 1PSBA 1CTRA 1OQPA 2CCMA 3TDUA 3OHMB 2KLEA 3JTDC 2CTNA 1XYDA 4JWQA 2WC5A 2ZN9A 5HLVA 4DS7A 4CFQA 2BKHB 2PSRA 2BL0B 5K89A 4GUKA 2WOSA 3BFAA 1BODA 4PHKA 1CMGA 2CT9A 3PN7C 1KCYA 2ZN8A 4XYNA 3NHTA 1FBVA 1DJZA 2DOQA 4I5JA 2KI6C 2VRGA 4MZLA 2V53A 4HRHA 5KSZA 1YURA 2TN4A 1Z2CB 2IS9A 5CSIA 4QJ3B 2I2RE 2JNFA 1M39A 1QIWA 1B9AA 2JT8A 1CFCA 4C0LA 2EGDA 2F2OA 4OVNF 5B8IB 1RROA 5I94A 2KSPA 1QJTA 4OCIA 2L2EA 2M0RA 4C0JA 3LK0A 1K94A 3BUWB 3SS5A 4UPGA 4MSPA 1YVHA 5TNCA 1A29A 1GGZA 5F6TA 1J1EA 1RECA 5FYXA 4WQ3A 2K7DA 1IJ6A 1B8LA 2KFFA 1HQVA 5DKRA 3FWCA 4XJKB 1JF0A 1SPYA 1XFZO 1J55A 2M1KB 1ALWA 3PM8A 1B47A 3Q8IA 1KK7Y 2G2BA 1JBAA 2HF5A 2JPTA 1U5IB 2LVIA 2LAPA 1CLLA 1SL7A 1K9KA 2FJYA 2JU0A 5CSFA 3SG4A 2KAXA 3VRPA 1NPQA 2WCMA 2L2CA 5FI6A 5PALA 4WRIA 1QX5B 3O6BA 1PSRA 4YI9A 3D0YA 3KEVA 1L2OB 3GK2A 1LA0A 4I5KA 1RWYA 2PALA 3BUMB 1DC1A 1Y1XA 2KBIA 2KAVA 5I2OA 3DF0A 1KK7Z 2WC6A 3K1EA 1OOJA 2M9GA 1JC2A 3WHTB 3PLFB 2K2AA 3SIAA 4DUQA 2BAPA 2SASA 3CR2A 1S6JA 3BOWA 2PYQA 3S0BA 1JWDA 2LCPA 4ZCVA 1WRLA 1SBJA 3L47A 3DVKA 1QLKA 2KI4B 2ZRSA 1F71A 2LV7A 1BT6A 1F4OA 1KSOA 3D74A 3EK8A 1KFUL 2BBMA 4HRGA 1C3YA 1F55A 2K60A 1UHKA 2JOJA 2K7OA 1AK8A 3VRQA 3LK1A 2K2FA 1K90D 1FF1A 2BE4A 2LVJA 1Y1AA 3I5HC 1TOPA 1M46A 3RLZA 1SR6B 3DD4A 3I5IB 4FTGA 5I8NA 2QEVA 1J7RA 4BY4A 1EXRA 1MHOA 1TTXA 3DVJA 1QV0A 2LHLA 3VGOA 1SL9A 3K21A 1TN4A 3PATA 3S0AA 1HT9A 2SCPA 3S0GA 1NP8A 1K9UA 1RTP1 2EC6C 4GPLB 4P2YB 4MN0A 4C0KA 4XJKA 1J7PA 1DQEA 1OW4A 4INWA 2M7NA 2KNEA 5AEQA 5FI2A 1UURA 1WDCC 3GK4X 2D8NA 4PE1A 1SY9A 3I5FC 1OSAA 1RK9A 3EK7A 1KWOB 1MXLC 5DKNA 2COLB 4YI8A 2K7BA 3FS7A 2PQLA 2CNPA 1DVIA 4MRXA 4A4CA 4HSZA 1QS7A 4Q04A 1CKKA 1OMRA 5AERA 1SSEB 4NDBA 2JC2A 3BJHA 3D0YB 2AUCA 3TUYC 4OR9B 2FJUB 3NXAA 2PASA 1S1EA 3OBVA 1CLMA 5KTYA 3DF0B 1OOHA 2NZ0A 2LMVA 2BKIB 3EVVA 1K96A 4PHNA 3AKAA 2I7AA 3L4LA 4NQGA 2L98A 3NHIA 1OOGA 2MHHA 3NSIA 1DEKA 2BCBA 3NSOA 2OTGB 3BOWB 3D77A 1CFFA 1S6IA 2MJWB 3A8RA 1NX1A 4P5OE 1T14A 2P70A 1OE9B 3DXLA 3BUNB 1RJVA 4QJ4B 3E3RA 2JXLA 3SG6A 1NX3A 3I5HB 2ERBA 2NCPA 2OS8C 3O78A 2GTEA 3RZSA 1Q80A 2ZKMX 3KF9A 1CM1A 5ER5A 5HKZA 1KFUS 1B7TY 2KOTA 3B88A 3DY9A 1YX8A 3CR5X 4YRUA 1WLZA 3IF7A 1S26D 3GK1A 4AQIA 1K95A 2KDHA 1JUOA 2LNKA 5CSJA 3RM1A 2L51A 1G8IA 1TNPA 4AQJA 4CIDA 1ODBA 1QWVA 3CWGA 3SG3A 3LCPC 3EK4A 2FCEA 1MXEA 3OX6A 1TWOA 1ALVA 5DKQA 3SJSA 1K8UA 2KAYA 1KFXL 1YR5A 2F2PA 2KQYA 3WXAA 1XFRA 1B8CA 1B7TZ 1NSHA 1QLSA 2JNXA 4FQOA 1G33A 2G9BA 3D78A 1ZMZA 4JD9A 1DGVA 1YUSA 1GJYA 2OPOA 4DIRA 3NGVA 4MVFA 4FQTA 3CYZA 1KQMB 3AAJA 4HREE 2L5XB 2LUXA 4DRWA 1YRUB 2Y4QA 3KPXA 1C3ZA 3AAKA 2QDIA 1EH2A 1K93D 2AAOA 2NCOA 4GGFC 3I5GB 3SG2A 2Y1MA 2M97A 2ZNDA 1LXFC 1IG5A 2KBMA 4OKHA 1Y6WA 2F33A 2L50A 4GAOA 2ISDA 4CLNA 2JWWA 2P6BB 4MZKA 3JTDB 1H8BA 1NCZA 2LLTA 2GV5A 1A2XA 1SNLA 3A4UB 3FWBA 1NX2A 5J3XA 1JF2A 2BBNA 3ZNIA 1BF5A 1QVIY 4ZCUA 2Q91A 3PN7B 1JFJA 3BFHA 1UP5A 2NXQA 3D10A 4M2PA 1EJ3A 1SKTA 5HKYA 3VRRA 1TUZA 3EVUA 4AOMA 1CFDA 1UHHA 1Y0VH 2QPTA 4USLA 5HKWA 2FOTA 3D75A 3JVTC 5CSNA 2M7LA 3SS3A 1B8RA 3WHUB 3F45A 4E68A 1E8AA 4GNKB 1JFKA 3KO0A 1MWNA 5AXIA 1ZUZA 2ZFDA 4IJ7A 1TCFA 1M31A 1F70A 1NIWA 1AVSA 1LINA 1UUSA 3PJIA 3IQQA 5HLOA 3QMEA 3DYEA 3LL8B 4YGEB 2MRDA 2BECA 1UWOA 3HX4A 1K2HA 4ETOA 2O60A 1SCVA 2M29A 2A4JA 1R2UA 2CBLA 2JZIA 2KFHA 1NWDA 1IH0A 3BXKA 3UNWA 1DELA 2K8MB 1XK4C 1IJ5A 3OX5A 1XFYO 2JQ6A 3CGAA 2LHIA 1IGVA 4N5XA 3FE6A 5I2LA 3O4YA 1J7OA 2K61A 1F54A 4MEWA 2GGMA 1DJHA 1KK8C 2F3ZA 3PFVA 1IRJA 1TNXA 2JTZA 3CZ1A 2PVBA 1KFXS 1SL8A 4GFTA 1YUTA 3S0FA 2H61C 1QATA 4KYNA 3SG5A 5D69A 4CFRA 1AUIB 2B1UA 1X02A 1IWQA 4ORCB 1BLQA 1CMFA 2NLNA 1LS8A 3CDNA 1KQVA 3FIAA 2KQ6A 3GOFA 3OB2B 1SK6D 2M3WA 1VRKA 4N1GA 1CDLA 1Z4HA 1SMGA 1ZOTB 2E6WA 3AKBA 3B7AA 2JULA 1OOIX 1L7ZA 5D3OA 3WNXB 1SCMC 2K7CA 3BUOB 1AHRA 1V1GA 1UHNA 1EG3A 4JQ0D 2F3YA 1QV1A 1FI5A 1S6CA 1TIZA 2QEBA 3EVRA 4PHJA 1YUUA 1DMOA 1IIOA 3B86A 1AJ5A 1XO5A 3BYAA 3D73A 4NDCA 1NX0A 5D7FA 3TDIA 1NYAA 2M8UA 1S36A 2LLUA 3PALA 4YGAA 1J1DA 1LKJA 4M2OA 2WORA 3CABA 3FE8A 1TNWA 2PMYA 3SIBA 2WCHA 2Y1NA 2KHNA 1CDNA 3C1VA 2KPHA 3EG5B 2JXCA 2JPOA 2L4HA 2ZNEA 3FE9A 4OZDA 1NCYA 1MQ1A 1M45A 2KI6D 4JKTA 4M2QA 2LMTA 2MLEC 5JJGA 2L5YA 1PVAA 5IBWA 2I94A 3M0WA 1A03A 1XA5A 1XVJA 4INXA 1CDPA 1CDMA 2LLSA 2H8VA 2WCEA 1JSAA 1DJXA 3OP0A 3TZ1A 2LANA 1A75B 2LUCA 2HETA 1NUBA 1F4QA 2WCBA 4PHMA 5ER4X 1AJ4A 2F8PA 2EC6B 4ORBB 1L2OC 4I5LB 1B1GA 4BY5A 1XFVO 1C7WA 4GGFA 1B4CA 1GQMA 1WDCB 5G08A 2QEHA 2KYCA 2JT0A 1MF8B 3I5FB 3DVMA 1PK0D 1SCMB 1M63B 2QACA 1OZSA 3BFBA 3UO9A 1EG4A 3CLNA 3IVTA 1OMDA 1LVCD 1CNPA 3IQOA 1BMOA 1BU3A 3BUXB 1OOFA 2LM5A 3R1VA 1GGWA 2BCXA 2MLFC 3R1OA 5I2QA 3CZTX 2P71A 3TUYB 5AFPA 4PE0A 1F8HA 1ZFSA 2KI4C 2M1UA 5JOLA 3PM2A 3CZ2A 3S0EA 3NSKA 3V2LA 2JTTA 2M49B 1DJGA 3EKHA 3CTNA 1WLMA 1WY9A 1A4PA 1S3PA 2BE6A 1H4BA 1QX7A 1R6PA 3H4SE 1N0YA 5FI7A 2ZRTA 2LVVA 2LP2A 1DTLA 4MBEA 3BQ3A 1G4YR 2KLDA 3DVEA 3R72A 2QEOA 4U8DA 1DF0B 1SR6C 2OS8B 3I5IC 4F7FA 2HPSA 1NCXA 2H2KA 3OB1B 3B6XA 4GBAA 5GQQC 3TS5C 1BG1A 1UHJA 4YGCB 2GGZA 4QJ5B 2PRUA 1EL4A 1N2DA 4PE4A 4CPVA 1XFWO 1XK4A 3B87A 2KGBC 4YGBB 3HCMA 4TNCA 1BR1B 2WCJA 4ICBA 4A4BA 4L9MA 1C7VA 4NDDA 1QIVA 1MUXA 1QVIZ 2BCAA 4IL1A 4GGNA 2I18A 2LMUA 1RFJA 4YBHB 1OMVA 1A75A 1KWOC 2Q4UA 2H61A 1OZOA 3CR4X 3OGNA 2MA2A 3ZWHA 3CS1A
chains in the Genus database with same CATH topology
1MR8A 1UHIA 1FI6A 1K9PA 3VROA 2LE9B 1ZACA 1TCOB 4N1FA 3SG7A 1XFXO 1W7IB 1Y1UA 1BOCA 2JT3A 1DJWA 2CXJA 1IQ3A 2L4IA 2AMIA 1WRZA 4F0ZB 1J7QA 3QRXA 1QX2A 4PE7A 4MRYA 1XFUO 2OTGC 1N65A 2MBXA 1BR4B 1TNQA 2BL0C 1PULA 2EHBA 3MSEB 1LA3A 2KYFA 5AANA 1D1OA 1YX7A 1FW4A 2KFGA 2O5GA 1YVLA 5KU1A 2LP3A 1IKUA 1CM4A 2Y5IA 4MLWA 1DT7B 1DJYA 1CFPA 3TS5B 3JVTB 2LVKA 4R1EA 4JPZB 1FPWA 1QTXA 1SYMA 1YRTB 4ORAB 3EKJA 3TDZA 1WRKA 4I5NB 1DGUA 4WQ2A 1V1FA 4PCWA 5CPVA 1PRWA 1DF0A 4DCKA 3LLEA 1QASA 2R2IA 1KSMA 2RGIA 1SRAA 2L0PA 1U5IA 1TRFA 2KGRA 3ICBA 2K0JA 3NSLA 4MZJA 1AP4A 4YGDB 3VRNA 3PSRA 1S5GY 3KHEA 1QXPA 2WC8A 4PDZA 1YTZC 4PALA 1DJIA 2HQWA 1KQMC 2MAZA 1PALA 4OV2A 5HYDA 2FCDA 4D1EA 1PVBA 1C07A 2HQ8A 1CLBA 1KK8B 1CB1A 2WNDA 3I5GC 5BPJA 1W7JB 1SW8A 1IQ5A 2E30A 1BJFA 2WCFA 2JRFA 2LC5A 1S5GZ 3O2PA 1PSBA 1CTRA 1OQPA 2CCMA 3TDUA 3OHMB 3JTDC 2CTNA 1XYDA 4JWQA 5HLVA 2ZN9A 4DS7A 4CFQA 2BKHB 2PSRA 2BL0B 5K89A 4GUKA 2WOSA 1BODA 4PHKA 1CMGA 2CT9A 3PN7C 1KCYA 2ZN8A 4XYNA 1FBVA 1DJZA 2DOQA 4I5JA 2KI6C 2VRGA 4MZLA 2V53A 4HRHA 5KSZA 1YURA 2TN4A 2IS9A 5CSIA 4QJ3B 2I2RE 2JNFA 1M39A 1QIWA 1B9AA 2JT8A 1CFCA 4C0LA 2EGDA 2F2OA 4OVNF 5B8IB 1RROA 2KSPA 1QJTA 4OCIA 2L2EA 2M0RA 4C0JA 3LK0A 1K94A 3BUWB 4UPGA 4MSPA 1YVHA 5TNCA 1A29A 1GGZA 5F6TA 1J1EA 1RECA 5FYXA 4WQ3A 2K7DA 1IJ6A 1B8LA 2KFFA 1HQVA 5DKRA 3FWCA 4XJKB 1JF0A 1SPYA 1XFZO 1J55A 2M1KB 1ALWA 3PM8A 1B47A 1KK7Y 2G2BA 1JBAA 2HF5A 2JPTA 1U5IB 2LVIA 2LAPA 1CLLA 1SL7A 1K9KA 2JU0A 5CSFA 3SG4A 2KAXA 3VRPA 1NPQA 5PALA 4WRIA 1QX5B 3O6BA 1PSRA 4YI9A 3D0YA 3KEVA 1L2OB 3GK2A 1LA0A 4I5KA 1RWYA 2PALA 3BUMB 1Y1XA 2KBIA 2KAVA 5I2OA 3DF0A 1KK7Z 1OOJA 2M9GA 1JC2A 3WHTB 3PLFB 2K2AA 3SIAA 4DUQA 2SASA 3CR2A 1S6JA 3BOWA 1JWDA 2LCPA 4ZCVA 1WRLA 1SBJA 3DVKA 1QLKA 2KI4B 2ZRSA 1F71A 2LV7A 1BT6A 1F4OA 1KSOA 3EK8A 1KFUL 2BBMA 4HRGA 1F55A 1UHKA 2JOJA 2K7OA 1AK8A 3VRQA 3LK1A 2K2FA 1K90D 1FF1A 2BE4A 2LVJA 1Y1AA 3I5HC 1TOPA 1M46A 3RLZA 1SR6B 3DD4A 3I5IB 4FTGA 5I8NA 1J7RA 4BY4A 1EXRA 1MHOA 1TTXA 3DVJA 1QV0A 2LHLA 3VGOA 1SL9A 3K21A 1TN4A 3PATA 1HT9A 2SCPA 1NP8A 1K9UA 1RTP1 2EC6C 4GPLB 4P2YB 4MN0A 4C0KA 4XJKA 1J7PA 2M7NA 2KNEA 5AEQA 1UURA 1WDCC 3GK4X 2D8NA 4PE1A 1SY9A 3I5FC 1OSAA 1RK9A 3EK7A 1KWOB 1MXLC 5DKNA 2COLB 4YI8A 2K7BA 3FS7A 2CNPA 1DVIA 4MRXA 4A4CA 4HSZA 1QS7A 4Q04A 1CKKA 1OMRA 5AERA 4NDBA 2JC2A 3D0YB 2AUCA 3TUYC 4OR9B 2FJUB 3NXAA 2PASA 1S1EA 5KTYA 1CLMA 3DF0B 2NZ0A 2LMVA 2BKIB 3EVVA 1K96A 4PHNA 3AKAA 2I7AA 4NQGA 2L98A 3NSOA 2MHHA 3NSIA 2BCBA 2OTGB 3BOWB 1CFFA 1S6IA 2MJWB 3A8RA 1NX1A 4P5OE 1OE9B 3BUNB 1RJVA 4QJ4B 3E3RA 2JXLA 3SG6A 1NX3A 3I5HB 2NCPA 2OS8C 3O78A 1Q80A 2ZKMX 3KF9A 1CM1A 5ER5A 5HKZA 1KFUS 1B7TY 2KOTA 1YX8A 3CR5X 4YRUA 1WLZA 3IF7A 1S26D 3GK1A 4AQIA 1K95A 2KDHA 1JUOA 2LNKA 5CSJA 3RM1A 2L51A 1G8IA 1TNPA 4AQJA 4CIDA 1ODBA 3CWGA 3SG3A 3LCPC 3EK4A 2FCEA 1MXEA 3OX6A 1ALVA 5DKQA 3SJSA 1K8UA 2KAYA 1KFXL 1YR5A 2F2PA 2KQYA 3WXAA 1B8CA 1B7TZ 1NSHA 1QLSA 2JNXA 4FQOA 1G33A 2G9BA 1ZMZA 1DGVA 1YUSA 1GJYA 2OPOA 4DIRA 4MVFA 1KQMB 3AAJA 4HREE 2L5XB 2LUXA 4DRWA 1YRUB 2Y4QA 3KPXA 3AAKA 1EH2A 1K93D 2AAOA 2NCOA 4GGFC 3I5GB 3SG2A 2Y1MA 2M97A 2ZNDA 1LXFC 1IG5A 2KBMA 4OKHA 1Y6WA 2F33A 2L50A 4GAOA 2ISDA 4CLNA 2JWWA 2P6BB 4MZKA 3JTDB 1H8BA 1NCZA 2LLTA 2GV5A 1A2XA 1SNLA 3A4UB 3FWBA 1NX2A 5J3XA 1JF2A 2BBNA 3ZNIA 1BF5A 1QVIY 4ZCUA 2Q91A 3PN7B 1JFJA 3D10A 1UP5A 2NXQA 5HKYA 4M2PA 1EJ3A 1SKTA 3VRRA 3EVUA 4AOMA 1CFDA 1UHHA 1Y0VH 2QPTA 4USLA 5HKWA 2FOTA 2M7LA 3JVTC 5CSNA 3WHUB 4E68A 1B8RA 3F45A 1E8AA 4GNKB 1JFKA 3KO0A 1MWNA 5AXIA 1ZUZA 2ZFDA 1TCFA 1M31A 1F70A 1NIWA 1AVSA 1LINA 1UUSA 3IQQA 5HLOA 3LL8B 4YGEB 2MRDA 2BECA 1UWOA 3HX4A 1K2HA 4ETOA 2O60A 1SCVA 2M29A 2A4JA 1R2UA 2CBLA 2JZIA 2KFHA 1NWDA 1IH0A 3BXKA 2K8MB 1XK4C 1IJ5A 3OX5A 1XFYO 2JQ6A 3CGAA 2LHIA 1IGVA 4N5XA 5I2LA 3O4YA 1J7OA 2K61A 1F54A 4MEWA 2GGMA 1DJHA 1KK8C 2F3ZA 3PFVA 1IRJA 1TNXA 2JTZA 2PVBA 1KFXS 1SL8A 4GFTA 1YUTA 2H61C 1QATA 3SG5A 5D69A 4CFRA 1AUIB 2B1UA 1X02A 1IWQA 4ORCB 1BLQA 1CMFA 2NLNA 1KQVA 3FIAA 2KQ6A 3GOFA 3OB2B 1SK6D 2M3WA 1VRKA 4N1GA 1CDLA 3AKBA 1SMGA 1ZOTB 2E6WA 3WNXB 2JULA 1L7ZA 1SCMC 2K7CA 3BUOB 1AHRA 1V1GA 1UHNA 1EG3A 4JQ0D 2F3YA 1QV1A 1FI5A 1S6CA 1TIZA 3EVRA 4PHJA 1YUUA 1DMOA 1AJ5A 1XO5A 3BYAA 5D7FA 4NDCA 1NX0A 3TDIA 1NYAA 2M8UA 1S36A 2LLUA 3PALA 4YGAA 1J1DA 1LKJA 4M2OA 2WORA 1TNWA 2PMYA 3SIBA 2Y1NA 2KHNA 1CDNA 3C1VA 2JXCA 2L4HA 2ZNEA 1NCYA 1MQ1A 1M45A 2KI6D 4M2QA 2LMTA 2MLEC 5JJGA 1PVAA 5IBWA 2I94A 3M0WA 1A03A 1XA5A 1XVJA 1CDPA 1CDMA 2LLSA 2WCEA 1JSAA 1DJXA 3OP0A 3TZ1A 2LANA 1A75B 2LUCA 2HETA 1NUBA 1F4QA 2WCBA 4PHMA 5ER4X 1AJ4A 2F8PA 2EC6B 4ORBB 1L2OC 4I5LB 1B1GA 4BY5A 1XFVO 1C7WA 4GGFA 1B4CA 1GQMA 1WDCB 5G08A 2KYCA 2JT0A 1MF8B 3I5FB 3DVMA 1PK0D 1SCMB 1M63B 2QACA 1OZSA 1EG4A 3CLNA 1CNPA 1OMDA 1LVCD 3IQOA 1BMOA 1BU3A 3BUXB 2LM5A 1GGWA 2BCXA 2MLFC 5I2QA 3CZTX 3TUYB 5AFPA 4PE0A 1F8HA 1ZFSA 2KI4C 2M1UA 5JOLA 3NSKA 2JTTA 2M49B 1DJGA 3EKHA 3CTNA 1WLMA 1WY9A 1A4PA 1S3PA 2BE6A 1H4BA 1QX7A 1R6PA 3H4SE 1N0YA 2ZRTA 2LVVA 2LP2A 1DTLA 4MBEA 3BQ3A 1G4YR 3DVEA 4U8DA 1DF0B 1SR6C 2OS8B 3I5IC 2HPSA 1NCXA 2H2KA 3OB1B 3TS5C 4GBAA 5GQQC 1BG1A 1UHJA 4YGCB 2GGZA 4QJ5B 2PRUA 1EL4A 1N2DA 4PE4A 4CPVA 1XFWO 1XK4A 2KGBC 4YGBB 3HCMA 4TNCA 1BR1B 4ICBA 4A4BA 1C7VA 4L9MA 4NDDA 1QIVA 1MUXA 1QVIZ 2BCAA 4IL1A 4GGNA 2I18A 2LMUA 1RFJA 4YBHB 1OMVA 1A75A 1KWOC 2Q4UA 2H61A 1OZOA 3CR4X 2MA2A 3ZWHA 3CS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MR8 A;  1UHI A;  1FI6 A;  1K9P A;  3VRO A;  2LE9 B;  1ZAC A;  1TCO B;  4N1F A;  3SG7 A;  1XFX O;  1W7I B;  1Y1U A;  1BOC A;  2JT3 A;  1DJW A;  2CXJ A;  1IQ3 A;  2L4I A;  2AMI A;  1WRZ A;  4F0Z B;  1J7Q A;  3QRX A;  1QX2 A;  4PE7 A;  4MRY A;  1XFU O;  2OTG C;  1N65 A;  2MBX A;  1BR4 B;  1TNQ A;  2BL0 C;  1PUL A;  2EHB A;  3MSE B;  1LA3 A;  2KYF A;  5AAN A;  1D1O A;  1YX7 A;  1FW4 A;  2KFG A;  2O5G A;  1YVL A;  5KU1 A;  2LP3 A;  1IKU A;  1CM4 A;  2Y5I A;  4MLW A;  1DT7 B;  1DJY A;  1CFP A;  3TS5 B;  3JVT B;  2LVK A;  4R1E A;  4JPZ B;  1FPW A;  1QTX A;  1SYM A;  1YRT B;  4ORA B;  3EKJ A;  3TDZ A;  1WRK A;  4I5N B;  1DGU A;  4WQ2 A;  1V1F A;  4PCW A;  5CPV A;  1PRW A;  1DF0 A;  4DCK A;  3LLE A;  1QAS A;  2R2I A;  1KSM A;  2RGI A;  1SRA A;  2L0P A;  1U5I A;  1TRF A;  2KGR A;  3ICB A;  2K0J A;  3NSL A;  4MZJ A;  1AP4 A;  4YGD B;  3VRN A;  3PSR A;  1S5G Y;  3KHE A;  1QXP A;  2WC8 A;  4PDZ A;  1YTZ C;  4PAL A;  1DJI A;  2HQW A;  1KQM C;  2MAZ A;  1PAL A;  4OV2 A;  5HYD A;  2FCD A;  4D1E A;  1PVB A;  1C07 A;  2HQ8 A;  1CLB A;  1KK8 B;  1CB1 A;  2WND A;  3I5G C;  5BPJ A;  1W7J B;  1SW8 A;  1IQ5 A;  2E30 A;  1BJF A;  2WCF A;  2JRF A;  2LC5 A;  1S5G Z;  3O2P A;  1PSB A;  1CTR A;  1OQP A;  2CCM A;  3TDU A;  3OHM B;  3JTD C;  2CTN A;  1XYD A;  4JWQ A;  5HLV A;  2ZN9 A;  4DS7 A;  4CFQ A;  2BKH B;  2PSR A;  2BL0 B;  5K89 A;  4GUK A;  2WOS A;  1BOD A;  4PHK A;  1CMG A;  2CT9 A;  3PN7 C;  1KCY A;  2ZN8 A;  4XYN A;  1FBV A;  1DJZ A;  2DOQ A;  4I5J A;  2KI6 C;  2VRG A;  4MZL A;  2V53 A;  4HRH A;  5KSZ A;  1YUR A;  2TN4 A;  2IS9 A;  5CSI A;  4QJ3 B;  2I2R E;  2JNF A;  1M39 A;  1QIW A;  1B9A A;  2JT8 A;  1CFC A;  4C0L A;  2EGD A;  2F2O A;  4OVN F;  5B8I B;  1RRO A;  2KSP A;  1QJT A;  4OCI A;  2L2E A;  2M0R A;  4C0J A;  3LK0 A;  1K94 A;  3BUW B;  4UPG A;  4MSP A;  1YVH A;  5TNC A;  1A29 A;  1GGZ A;  5F6T A;  1J1E A;  1REC A;  5FYX A;  4WQ3 A;  2K7D A;  1IJ6 A;  1B8L A;  2KFF A;  1HQV A;  5DKR A;  3FWC A;  4XJK B;  1JF0 A;  1SPY A;  1XFZ O;  1J55 A;  2M1K B;  1ALW A;  3PM8 A;  1B47 A;  1KK7 Y;  2G2B A;  1JBA A;  2HF5 A;  2JPT A;  1U5I B;  2LVI A;  2LAP A;  1CLL A;  1SL7 A;  1K9K A;  2JU0 A;  5CSF A;  3SG4 A;  2KAX A;  3VRP A;  1NPQ A;  5PAL A;  4WRI A;  1QX5 B;  3O6B A;  1PSR A;  4YI9 A;  3D0Y A;  3KEV A;  1L2O B;  3GK2 A;  1LA0 A;  4I5K A;  1RWY A;  2PAL A;  3BUM B;  1Y1X A;  2KBI A;  2KAV A;  5I2O A;  3DF0 A;  1KK7 Z;  1OOJ A;  2M9G A;  1JC2 A;  3WHT B;  3PLF B;  2K2A A;  3SIA A;  4DUQ A;  2SAS A;  3CR2 A;  1S6J A;  3BOW A;  1JWD A;  2LCP A;  4ZCV A;  1WRL A;  1SBJ A;  3DVK A;  1QLK A;  2KI4 B;  2ZRS A;  1F71 A;  2LV7 A;  1BT6 A;  1F4O A;  1KSO A;  3EK8 A;  1KFU L;  2BBM A;  4HRG A;  1F55 A;  1UHK A;  2JOJ A;  2K7O A;  1AK8 A;  3VRQ A;  3LK1 A;  2K2F A;  1K90 D;  1FF1 A;  2BE4 A;  2LVJ A;  1Y1A A;  3I5H C;  1TOP A;  1M46 A;  3RLZ A;  1SR6 B;  3DD4 A;  3I5I B;  4FTG A;  5I8N A;  1J7R A;  4BY4 A;  1EXR A;  1MHO A;  1TTX A;  3DVJ A;  1QV0 A;  2LHL A;  3VGO A;  1SL9 A;  3K21 A;  1TN4 A;  3PAT A;  1HT9 A;  2SCP A;  1NP8 A;  1K9U A;  1RTP 1;  2EC6 C;  4GPL B;  4P2Y B;  4MN0 A;  4C0K A;  4XJK A;  1J7P A;  2M7N A;  2KNE A;  5AEQ A;  1UUR A;  1WDC C;  3GK4 X;  2D8N A;  4PE1 A;  1SY9 A;  3I5F C;  1OSA A;  1RK9 A;  3EK7 A;  1KWO B;  1MXL C;  5DKN A;  2COL B;  4YI8 A;  2K7B A;  3FS7 A;  2CNP A;  1DVI A;  4MRX A;  4A4C A;  4HSZ A;  1QS7 A;  4Q04 A;  1CKK A;  1OMR A;  5AER A;  4NDB A;  2JC2 A;  3D0Y B;  2AUC A;  3TUY C;  4OR9 B;  2FJU B;  3NXA A;  2PAS A;  1S1E A;  5KTY A;  1CLM A;  3DF0 B;  2NZ0 A;  2LMV A;  2BKI B;  3EVV A;  1K96 A;  4PHN A;  3AKA A;  2I7A A;  4NQG A;  2L98 A;  3NSO A;  2MHH A;  3NSI A;  2BCB A;  2OTG B;  3BOW B;  1CFF A;  1S6I A;  2MJW B;  3A8R A;  1NX1 A;  4P5O E;  1OE9 B;  3BUN B;  1RJV A;  4QJ4 B;  3E3R A;  2JXL A;  3SG6 A;  1NX3 A;  3I5H B;  2NCP A;  2OS8 C;  3O78 A;  1Q80 A;  2ZKM X;  3KF9 A;  1CM1 A;  5ER5 A;  5HKZ A;  1KFU S;  1B7T Y;  2KOT A;  1YX8 A;  3CR5 X;  4YRU A;  1WLZ A;  3IF7 A;  1S26 D;  3GK1 A;  4AQI A;  1K95 A;  2KDH A;  1JUO A;  2LNK A;  5CSJ A;  3RM1 A;  2L51 A;  1G8I A;  1TNP A;  4AQJ A;  4CID A;  1ODB A;  3CWG A;  3SG3 A;  3LCP C;  3EK4 A;  2FCE A;  1MXE A;  3OX6 A;  1ALV A;  5DKQ A;  3SJS A;  1K8U A;  2KAY A;  1KFX L;  1YR5 A;  2F2P A;  2KQY A;  3WXA A;  1B8C A;  1B7T Z;  1NSH A;  1QLS A;  2JNX A;  4FQO A;  1G33 A;  2G9B A;  1ZMZ A;  1DGV A;  1YUS A;  1GJY A;  2OPO A;  4DIR A;  4MVF A;  1KQM B;  3AAJ A;  4HRE E;  2L5X B;  2LUX A;  4DRW A;  1YRU B;  2Y4Q A;  3KPX A;  3AAK A;  1EH2 A;  1K93 D;  2AAO A;  2NCO A;  4GGF C;  3I5G B;  3SG2 A;  2Y1M A;  2M97 A;  2ZND A;  1LXF C;  1IG5 A;  2KBM A;  4OKH A;  1Y6W A;  2F33 A;  2L50 A;  4GAO A;  2ISD A;  4CLN A;  2JWW A;  2P6B B;  4MZK A;  3JTD B;  1H8B A;  1NCZ A;  2LLT A;  2GV5 A;  1A2X A;  1SNL A;  3A4U B;  3FWB A;  1NX2 A;  5J3X A;  1JF2 A;  2BBN A;  3ZNI A;  1BF5 A;  1QVI Y;  4ZCU A;  2Q91 A;  3PN7 B;  1JFJ A;  3D10 A;  1UP5 A;  2NXQ A;  5HKY A;  4M2P A;  1EJ3 A;  1SKT A;  3VRR A;  3EVU A;  4AOM A;  1CFD A;  1UHH A;  1Y0V H;  2QPT A;  4USL A;  5HKW A;  2FOT A;  2M7L A;  3JVT C;  5CSN A;  3WHU B;  4E68 A;  1B8R A;  3F45 A;  1E8A A;  4GNK B;  1JFK A;  3KO0 A;  1MWN A;  5AXI A;  1ZUZ A;  2ZFD A;  1TCF A;  1M31 A;  1F70 A;  1NIW A;  1AVS A;  1LIN A;  1UUS A;  3IQQ A;  5HLO A;  3LL8 B;  4YGE B;  2MRD A;  2BEC A;  1UWO A;  3HX4 A;  1K2H A;  4ETO A;  2O60 A;  1SCV A;  2M29 A;  2A4J A;  1R2U A;  2CBL A;  2JZI A;  2KFH A;  1NWD A;  1IH0 A;  3BXK A;  2K8M B;  1XK4 C;  1IJ5 A;  3OX5 A;  1XFY O;  2JQ6 A;  3CGA A;  2LHI A;  1IGV A;  4N5X A;  5I2L A;  3O4Y A;  1J7O A;  2K61 A;  1F54 A;  4MEW A;  2GGM A;  1DJH A;  1KK8 C;  2F3Z A;  3PFV A;  1IRJ A;  1TNX A;  2JTZ A;  2PVB A;  1KFX S;  1SL8 A;  4GFT A;  1YUT A;  2H61 C;  1QAT A;  3SG5 A;  5D69 A;  4CFR A;  1AUI B;  2B1U A;  1X02 A;  1IWQ A;  4ORC B;  1BLQ A;  1CMF A;  2NLN A;  1KQV A;  3FIA A;  2KQ6 A;  3GOF A;  3OB2 B;  1SK6 D;  2M3W A;  1VRK A;  4N1G A;  1CDL A;  3AKB A;  1SMG A;  1ZOT B;  2E6W A;  3WNX B;  2JUL A;  1L7Z A;  1SCM C;  2K7C A;  3BUO B;  1AHR A;  1V1G A;  1UHN A;  1EG3 A;  4JQ0 D;  2F3Y A;  1QV1 A;  1FI5 A;  1S6C A;  1TIZ A;  3EVR A;  4PHJ A;  1YUU A;  1DMO A;  1AJ5 A;  1XO5 A;  3BYA A;  5D7F A;  4NDC A;  1NX0 A;  3TDI A;  1NYA A;  2M8U A;  1S36 A;  2LLU A;  3PAL A;  4YGA A;  1J1D A;  1LKJ A;  4M2O A;  2WOR A;  1TNW A;  2PMY A;  3SIB A;  2Y1N A;  2KHN A;  1CDN A;  3C1V A;  2JXC A;  2L4H A;  2ZNE A;  1NCY A;  1MQ1 A;  1M45 A;  2KI6 D;  4M2Q A;  2LMT A;  2MLE C;  5JJG A;  1PVA A;  5IBW A;  2I94 A;  3M0W A;  1A03 A;  1XA5 A;  1XVJ A;  1CDP A;  1CDM A;  2LLS A;  2WCE A;  1JSA A;  1DJX A;  3OP0 A;  3TZ1 A;  2LAN A;  1A75 B;  2LUC A;  2HET A;  1NUB A;  1F4Q A;  2WCB A;  4PHM A;  5ER4 X;  1AJ4 A;  2F8P A;  2EC6 B;  4ORB B;  1L2O C;  4I5L B;  1B1G A;  4BY5 A;  1XFV O;  1C7W A;  4GGF A;  1B4C A;  1GQM A;  1WDC B;  5G08 A;  2KYC A;  2JT0 A;  1MF8 B;  3I5F B;  3DVM A;  1PK0 D;  1SCM B;  1M63 B;  2QAC A;  1OZS A;  1EG4 A;  3CLN A;  1CNP A;  1OMD A;  1LVC D;  3IQO A;  1BMO A;  1BU3 A;  3BUX B;  2LM5 A;  1GGW A;  2BCX A;  2MLF C;  5I2Q A;  3CZT X;  3TUY B;  5AFP A;  4PE0 A;  1F8H A;  1ZFS A;  2KI4 C;  2M1U A;  5JOL A;  3NSK A;  2JTT A;  2M49 B;  1DJG A;  3EKH A;  3CTN A;  1WLM A;  1WY9 A;  1A4P A;  1S3P A;  2BE6 A;  1H4B A;  1QX7 A;  1R6P A;  3H4S E;  1N0Y A;  2ZRT A;  2LVV A;  2LP2 A;  1DTL A;  4MBE A;  3BQ3 A;  1G4Y R;  3DVE A;  4U8D A;  1DF0 B;  1SR6 C;  2OS8 B;  3I5I C;  2HPS A;  1NCX A;  2H2K A;  3OB1 B;  3TS5 C;  4GBA A;  5GQQ C;  1BG1 A;  1UHJ A;  4YGC B;  2GGZ A;  4QJ5 B;  2PRU A;  1EL4 A;  1N2D A;  4PE4 A;  4CPV A;  1XFW O;  1XK4 A;  2KGB C;  4YGB B;  3HCM A;  4TNC A;  1BR1 B;  4ICB A;  4A4B A;  1C7V A;  4L9M A;  4NDD A;  1QIV A;  1MUX A;  1QVI Z;  2BCA A;  4IL1 A;  4GGN A;  2I18 A;  2LMU A;  1RFJ A;  4YBH B;  1OMV A;  1A75 A;  1KWO C;  2Q4U A;  2H61 A;  1OZO A;  3CR4 X;  2MA2 A;  3ZWH A;  3CS1 A; 
#chains in the Genus database with same CATH topology
 1MR8 A;  1UHI A;  3O4X A;  1FI6 A;  3VB1 A;  2WCK A;  1K9P A;  3VRO A;  2WCL A;  2LE9 B;  1ZAC A;  1TCO B;  4N1F A;  3CZ0 A;  3SG7 A;  1XFX O;  1W7I B;  1Y1U A;  3L4A A;  1BOC A;  2JT3 A;  3SS4 A;  1DJW A;  2CXJ A;  1IQ3 A;  2L4I A;  2YGU A;  1TUJ A;  2AMI A;  1WRZ A;  4F0Z B;  1J7Q A;  2BNX A;  3QRX A;  1QX2 A;  4PE7 A;  4MRY A;  1XFU O;  2OTG C;  1N65 A;  2MBX A;  1BR4 B;  1TNQ A;  2BL0 C;  1PUL A;  1W9Z A;  2EHB A;  3MSE B;  1LA3 A;  2KYF A;  5AAN A;  3S0D A;  1YX7 A;  1FW4 A;  3D76 A;  2KFG A;  1D1O A;  3R1P A;  2O5G A;  1YVL A;  5KU1 A;  1GM0 A;  2LP3 A;  1IKU A;  1CM4 A;  2Y5I A;  4MLW A;  1DT7 B;  1DJY A;  1CFP A;  3TS5 B;  3JVT B;  2LVK A;  4R1E A;  4JPZ B;  1FPW A;  1QTX A;  5EL2 A;  1SYM A;  1YRT B;  4ORA B;  3EKJ A;  3TDZ A;  1ORG A;  1WRK A;  4I5N B;  1DGU A;  4WQ2 A;  1V1F A;  4PCW A;  5CPV A;  1PRW A;  1DF0 A;  4DCK A;  3LLE A;  1QAS A;  2R2I A;  5DIC A;  1KSM A;  2RGI A;  1SRA A;  2L0P A;  1U5I A;  1TRF A;  2KGR A;  3ICB A;  2K0J A;  3NSL A;  4MZJ A;  1AP4 A;  4YGD B;  3VRN A;  3PSR A;  1S5G Y;  4PT1 A;  3KHE A;  1QXP A;  2WC8 A;  4PDZ A;  1YTZ C;  4PAL A;  1DJI A;  2HQW A;  1KQM C;  1P28 A;  2MAZ A;  1PAL A;  4OV2 A;  5HYD A;  5HL1 A;  2FCD A;  4D1E A;  1PVB A;  1C07 A;  2HQ8 A;  1CLB A;  1KK8 B;  1CB1 A;  2WND A;  3I5G C;  5BPJ A;  1W7J B;  1SW8 A;  3N7H A;  1IQ5 A;  2E30 A;  1BJF A;  2WCF A;  2JRF A;  3DZT A;  2LC5 A;  1S5G Z;  3O2P A;  1PSB A;  1CTR A;  1OQP A;  2CCM A;  3TDU A;  3OHM B;  2KLE A;  3JTD C;  2CTN A;  1XYD A;  4JWQ A;  2WC5 A;  2ZN9 A;  5HLV A;  4DS7 A;  4CFQ A;  2BKH B;  2PSR A;  2BL0 B;  5K89 A;  4GUK A;  2WOS A;  3BFA A;  1BOD A;  4PHK A;  1CMG A;  2CT9 A;  3PN7 C;  1KCY A;  2ZN8 A;  4XYN A;  3NHT A;  1FBV A;  1DJZ A;  2DOQ A;  4I5J A;  2KI6 C;  2VRG A;  4MZL A;  2V53 A;  4HRH A;  5KSZ A;  1YUR A;  2TN4 A;  1Z2C B;  2IS9 A;  5CSI A;  4QJ3 B;  2I2R E;  2JNF A;  1M39 A;  1QIW A;  1B9A A;  2JT8 A;  1CFC A;  4C0L A;  2EGD A;  2F2O A;  4OVN F;  5B8I B;  1RRO A;  5I94 A;  2KSP A;  1QJT A;  4OCI A;  2L2E A;  2M0R A;  4C0J A;  3LK0 A;  1K94 A;  3BUW B;  3SS5 A;  4UPG A;  4MSP A;  1YVH A;  5TNC A;  1A29 A;  1GGZ A;  5F6T A;  1J1E A;  1REC A;  5FYX A;  4WQ3 A;  2K7D A;  1IJ6 A;  1B8L A;  2KFF A;  1HQV A;  5DKR A;  3FWC A;  4XJK B;  1JF0 A;  1SPY A;  1XFZ O;  1J55 A;  2M1K B;  1ALW A;  3PM8 A;  1B47 A;  3Q8I A;  1KK7 Y;  2G2B A;  1JBA A;  2HF5 A;  2JPT A;  1U5I B;  2LVI A;  2LAP A;  1CLL A;  1SL7 A;  1K9K A;  2FJY A;  2JU0 A;  5CSF A;  3SG4 A;  2KAX A;  3VRP A;  1NPQ A;  2WCM A;  2L2C A;  5FI6 A;  5PAL A;  4WRI A;  1QX5 B;  3O6B A;  1PSR A;  4YI9 A;  3D0Y A;  3KEV A;  1L2O B;  3GK2 A;  1LA0 A;  4I5K A;  1RWY A;  2PAL A;  3BUM B;  1DC1 A;  1Y1X A;  2KBI A;  2KAV A;  5I2O A;  3DF0 A;  1KK7 Z;  2WC6 A;  3K1E A;  1OOJ A;  2M9G A;  1JC2 A;  3WHT B;  3PLF B;  2K2A A;  3SIA A;  4DUQ A;  2BAP A;  2SAS A;  3CR2 A;  1S6J A;  3BOW A;  2PYQ A;  3S0B A;  1JWD A;  2LCP A;  4ZCV A;  1WRL A;  1SBJ A;  3L47 A;  3DVK A;  1QLK A;  2KI4 B;  2ZRS A;  1F71 A;  2LV7 A;  1BT6 A;  1F4O A;  1KSO A;  3D74 A;  3EK8 A;  1KFU L;  2BBM A;  4HRG A;  1C3Y A;  1F55 A;  2K60 A;  1UHK A;  2JOJ A;  2K7O A;  1AK8 A;  3VRQ A;  3LK1 A;  2K2F A;  1K90 D;  1FF1 A;  2BE4 A;  2LVJ A;  1Y1A A;  3I5H C;  1TOP A;  1M46 A;  3RLZ A;  1SR6 B;  3DD4 A;  3I5I B;  4FTG A;  5I8N A;  2QEV A;  1J7R A;  4BY4 A;  1EXR A;  1MHO A;  1TTX A;  3DVJ A;  1QV0 A;  2LHL A;  3VGO A;  1SL9 A;  3K21 A;  1TN4 A;  3PAT A;  3S0A A;  1HT9 A;  2SCP A;  3S0G A;  1NP8 A;  1K9U A;  1RTP 1;  2EC6 C;  4GPL B;  4P2Y B;  4MN0 A;  4C0K A;  4XJK A;  1J7P A;  1DQE A;  1OW4 A;  4INW A;  2M7N A;  2KNE A;  5AEQ A;  5FI2 A;  1UUR A;  1WDC C;  3GK4 X;  2D8N A;  4PE1 A;  1SY9 A;  3I5F C;  1OSA A;  1RK9 A;  3EK7 A;  1KWO B;  1MXL C;  5DKN A;  2COL B;  4YI8 A;  2K7B A;  3FS7 A;  2PQL A;  2CNP A;  1DVI A;  4MRX A;  4A4C A;  4HSZ A;  1QS7 A;  4Q04 A;  1CKK A;  1OMR A;  5AER A;  1SSE B;  4NDB A;  2JC2 A;  3BJH A;  3D0Y B;  2AUC A;  3TUY C;  4OR9 B;  2FJU B;  3NXA A;  2PAS A;  1S1E A;  3OBV A;  1CLM A;  5KTY A;  3DF0 B;  1OOH A;  2NZ0 A;  2LMV A;  2BKI B;  3EVV A;  1K96 A;  4PHN A;  3AKA A;  2I7A A;  3L4L A;  4NQG A;  2L98 A;  3NHI A;  1OOG A;  2MHH A;  3NSI A;  1DEK A;  2BCB A;  3NSO A;  2OTG B;  3BOW B;  3D77 A;  1CFF A;  1S6I A;  2MJW B;  3A8R A;  1NX1 A;  4P5O E;  1T14 A;  2P70 A;  1OE9 B;  3DXL A;  3BUN B;  1RJV A;  4QJ4 B;  3E3R A;  2JXL A;  3SG6 A;  1NX3 A;  3I5H B;  2ERB A;  2NCP A;  2OS8 C;  3O78 A;  2GTE A;  3RZS A;  1Q80 A;  2ZKM X;  3KF9 A;  1CM1 A;  5ER5 A;  5HKZ A;  1KFU S;  1B7T Y;  2KOT A;  3B88 A;  3DY9 A;  1YX8 A;  3CR5 X;  4YRU A;  1WLZ A;  3IF7 A;  1S26 D;  3GK1 A;  4AQI A;  1K95 A;  2KDH A;  1JUO A;  2LNK A;  5CSJ A;  3RM1 A;  2L51 A;  1G8I A;  1TNP A;  4AQJ A;  4CID A;  1ODB A;  1QWV A;  3CWG A;  3SG3 A;  3LCP C;  3EK4 A;  2FCE A;  1MXE A;  3OX6 A;  1TWO A;  1ALV A;  5DKQ A;  3SJS A;  1K8U A;  2KAY A;  1KFX L;  1YR5 A;  2F2P A;  2KQY A;  3WXA A;  1XFR A;  1B8C A;  1B7T Z;  1NSH A;  1QLS A;  2JNX A;  4FQO A;  1G33 A;  2G9B A;  3D78 A;  1ZMZ A;  4JD9 A;  1DGV A;  1YUS A;  1GJY A;  2OPO A;  4DIR A;  3NGV A;  4MVF A;  4FQT A;  3CYZ A;  1KQM B;  3AAJ A;  4HRE E;  2L5X B;  2LUX A;  4DRW A;  1YRU B;  2Y4Q A;  3KPX A;  1C3Z A;  3AAK A;  2QDI A;  1EH2 A;  1K93 D;  2AAO A;  2NCO A;  4GGF C;  3I5G B;  3SG2 A;  2Y1M A;  2M97 A;  2ZND A;  1LXF C;  1IG5 A;  2KBM A;  4OKH A;  1Y6W A;  2F33 A;  2L50 A;  4GAO A;  2ISD A;  4CLN A;  2JWW A;  2P6B B;  4MZK A;  3JTD B;  1H8B A;  1NCZ A;  2LLT A;  2GV5 A;  1A2X A;  1SNL A;  3A4U B;  3FWB A;  1NX2 A;  5J3X A;  1JF2 A;  2BBN A;  3ZNI A;  1BF5 A;  1QVI Y;  4ZCU A;  2Q91 A;  3PN7 B;  1JFJ A;  3BFH A;  1UP5 A;  2NXQ A;  3D10 A;  4M2P A;  1EJ3 A;  1SKT A;  5HKY A;  3VRR A;  1TUZ A;  3EVU A;  4AOM A;  1CFD A;  1UHH A;  1Y0V H;  2QPT A;  4USL A;  5HKW A;  2FOT A;  3D75 A;  3JVT C;  5CSN A;  2M7L A;  3SS3 A;  1B8R A;  3WHU B;  3F45 A;  4E68 A;  1E8A A;  4GNK B;  1JFK A;  3KO0 A;  1MWN A;  5AXI A;  1ZUZ A;  2ZFD A;  4IJ7 A;  1TCF A;  1M31 A;  1F70 A;  1NIW A;  1AVS A;  1LIN A;  1UUS A;  3PJI A;  3IQQ A;  5HLO A;  3QME A;  3DYE A;  3LL8 B;  4YGE B;  2MRD A;  2BEC A;  1UWO A;  3HX4 A;  1K2H A;  4ETO A;  2O60 A;  1SCV A;  2M29 A;  2A4J A;  1R2U A;  2CBL A;  2JZI A;  2KFH A;  1NWD A;  1IH0 A;  3BXK A;  3UNW A;  1DEL A;  2K8M B;  1XK4 C;  1IJ5 A;  3OX5 A;  1XFY O;  2JQ6 A;  3CGA A;  2LHI A;  1IGV A;  4N5X A;  3FE6 A;  5I2L A;  3O4Y A;  1J7O A;  2K61 A;  1F54 A;  4MEW A;  2GGM A;  1DJH A;  1KK8 C;  2F3Z A;  3PFV A;  1IRJ A;  1TNX A;  2JTZ A;  3CZ1 A;  2PVB A;  1KFX S;  1SL8 A;  4GFT A;  1YUT A;  3S0F A;  2H61 C;  1QAT A;  4KYN A;  3SG5 A;  5D69 A;  4CFR A;  1AUI B;  2B1U A;  1X02 A;  1IWQ A;  4ORC B;  1BLQ A;  1CMF A;  2NLN A;  1LS8 A;  3CDN A;  1KQV A;  3FIA A;  2KQ6 A;  3GOF A;  3OB2 B;  1SK6 D;  2M3W A;  1VRK A;  4N1G A;  1CDL A;  1Z4H A;  1SMG A;  1ZOT B;  2E6W A;  3AKB A;  3B7A A;  2JUL A;  1OOI X;  1L7Z A;  5D3O A;  3WNX B;  1SCM C;  2K7C A;  3BUO B;  1AHR A;  1V1G A;  1UHN A;  1EG3 A;  4JQ0 D;  2F3Y A;  1QV1 A;  1FI5 A;  1S6C A;  1TIZ A;  2QEB A;  3EVR A;  4PHJ A;  1YUU A;  1DMO A;  1IIO A;  3B86 A;  1AJ5 A;  1XO5 A;  3BYA A;  3D73 A;  4NDC A;  1NX0 A;  5D7F A;  3TDI A;  1NYA A;  2M8U A;  1S36 A;  2LLU A;  3PAL A;  4YGA A;  1J1D A;  1LKJ A;  4M2O A;  2WOR A;  3CAB A;  3FE8 A;  1TNW A;  2PMY A;  3SIB A;  2WCH A;  2Y1N A;  2KHN A;  1CDN A;  3C1V A;  2KPH A;  3EG5 B;  2JXC A;  2JPO A;  2L4H A;  2ZNE A;  3FE9 A;  4OZD A;  1NCY A;  1MQ1 A;  1M45 A;  2KI6 D;  4JKT A;  4M2Q A;  2LMT A;  2MLE C;  5JJG A;  2L5Y A;  1PVA A;  5IBW A;  2I94 A;  3M0W A;  1A03 A;  1XA5 A;  1XVJ A;  4INX A;  1CDP A;  1CDM A;  2LLS A;  2H8V A;  2WCE A;  1JSA A;  1DJX A;  3OP0 A;  3TZ1 A;  2LAN A;  1A75 B;  2LUC A;  2HET A;  1NUB A;  1F4Q A;  2WCB A;  4PHM A;  5ER4 X;  1AJ4 A;  2F8P A;  2EC6 B;  4ORB B;  1L2O C;  4I5L B;  1B1G A;  4BY5 A;  1XFV O;  1C7W A;  4GGF A;  1B4C A;  1GQM A;  1WDC B;  5G08 A;  2QEH A;  2KYC A;  2JT0 A;  1MF8 B;  3I5F B;  3DVM A;  1PK0 D;  1SCM B;  1M63 B;  2QAC A;  1OZS A;  3BFB A;  3UO9 A;  1EG4 A;  3CLN A;  3IVT A;  1OMD A;  1LVC D;  1CNP A;  3IQO A;  1BMO A;  1BU3 A;  3BUX B;  1OOF A;  2LM5 A;  3R1V A;  1GGW A;  2BCX A;  2MLF C;  3R1O A;  5I2Q A;  3CZT X;  2P71 A;  3TUY B;  5AFP A;  4PE0 A;  1F8H A;  1ZFS A;  2KI4 C;  2M1U A;  5JOL A;  3PM2 A;  3CZ2 A;  3S0E A;  3NSK A;  3V2L A;  2JTT A;  2M49 B;  1DJG A;  3EKH A;  3CTN A;  1WLM A;  1WY9 A;  1A4P A;  1S3P A;  2BE6 A;  1H4B A;  1QX7 A;  1R6P A;  3H4S E;  1N0Y A;  5FI7 A;  2ZRT A;  2LVV A;  2LP2 A;  1DTL A;  4MBE A;  3BQ3 A;  1G4Y R;  2KLD A;  3DVE A;  3R72 A;  2QEO A;  4U8D A;  1DF0 B;  1SR6 C;  2OS8 B;  3I5I C;  4F7F A;  2HPS A;  1NCX A;  2H2K A;  3OB1 B;  3B6X A;  4GBA A;  5GQQ C;  3TS5 C;  1BG1 A;  1UHJ A;  4YGC B;  2GGZ A;  4QJ5 B;  2PRU A;  1EL4 A;  1N2D A;  4PE4 A;  4CPV A;  1XFW O;  1XK4 A;  3B87 A;  2KGB C;  4YGB B;  3HCM A;  4TNC A;  1BR1 B;  2WCJ A;  4ICB A;  4A4B A;  4L9M A;  1C7V A;  4NDD A;  1QIV A;  1MUX A;  1QVI Z;  2BCA A;  4IL1 A;  4GGN A;  2I18 A;  2LMU A;  1RFJ A;  4YBH B;  1OMV A;  1A75 A;  1KWO C;  2Q4U A;  2H61 A;  1OZO A;  3CR4 X;  3OGN A;  2MA2 A;  3ZWH A;  3CS1 A; 
#chains in the Genus database with same CATH homology
 1MR8 A;  1UHI A;  1FI6 A;  1K9P A;  3VRO A;  2LE9 B;  1ZAC A;  1TCO B;  4N1F A;  3SG7 A;  1XFX O;  1W7I B;  1Y1U A;  1BOC A;  2JT3 A;  1DJW A;  2CXJ A;  1IQ3 A;  2L4I A;  2AMI A;  1WRZ A;  4F0Z B;  1J7Q A;  3QRX A;  1QX2 A;  4PE7 A;  4MRY A;  1XFU O;  2OTG C;  1N65 A;  2MBX A;  1BR4 B;  1TNQ A;  2BL0 C;  1PUL A;  2EHB A;  3MSE B;  1LA3 A;  2KYF A;  5AAN A;  1D1O A;  1YX7 A;  1FW4 A;  2KFG A;  2O5G A;  1YVL A;  5KU1 A;  2LP3 A;  1IKU A;  1CM4 A;  2Y5I A;  4MLW A;  1DT7 B;  1DJY A;  1CFP A;  3TS5 B;  3JVT B;  2LVK A;  4R1E A;  4JPZ B;  1FPW A;  1QTX A;  1SYM A;  1YRT B;  4ORA B;  3EKJ A;  3TDZ A;  1WRK A;  4I5N B;  1DGU A;  4WQ2 A;  1V1F A;  4PCW A;  5CPV A;  1PRW A;  1DF0 A;  4DCK A;  3LLE A;  1QAS A;  2R2I A;  1KSM A;  2RGI A;  1SRA A;  2L0P A;  1U5I A;  1TRF A;  2KGR A;  3ICB A;  2K0J A;  3NSL A;  4MZJ A;  1AP4 A;  4YGD B;  3VRN A;  3PSR A;  1S5G Y;  3KHE A;  1QXP A;  2WC8 A;  4PDZ A;  1YTZ C;  4PAL A;  1DJI A;  2HQW A;  1KQM C;  2MAZ A;  1PAL A;  4OV2 A;  5HYD A;  2FCD A;  4D1E A;  1PVB A;  1C07 A;  2HQ8 A;  1CLB A;  1KK8 B;  1CB1 A;  2WND A;  3I5G C;  5BPJ A;  1W7J B;  1SW8 A;  1IQ5 A;  2E30 A;  1BJF A;  2WCF A;  2JRF A;  2LC5 A;  1S5G Z;  3O2P A;  1PSB A;  1CTR A;  1OQP A;  2CCM A;  3TDU A;  3OHM B;  3JTD C;  2CTN A;  1XYD A;  4JWQ A;  5HLV A;  2ZN9 A;  4DS7 A;  4CFQ A;  2BKH B;  2PSR A;  2BL0 B;  5K89 A;  4GUK A;  2WOS A;  1BOD A;  4PHK A;  1CMG A;  2CT9 A;  3PN7 C;  1KCY A;  2ZN8 A;  4XYN A;  1FBV A;  1DJZ A;  2DOQ A;  4I5J A;  2KI6 C;  2VRG A;  4MZL A;  2V53 A;  4HRH A;  5KSZ A;  1YUR A;  2TN4 A;  2IS9 A;  5CSI A;  4QJ3 B;  2I2R E;  2JNF A;  1M39 A;  1QIW A;  1B9A A;  2JT8 A;  1CFC A;  4C0L A;  2EGD A;  2F2O A;  4OVN F;  5B8I B;  1RRO A;  2KSP A;  1QJT A;  4OCI A;  2L2E A;  2M0R A;  4C0J A;  3LK0 A;  1K94 A;  3BUW B;  4UPG A;  4MSP A;  1YVH A;  5TNC A;  1A29 A;  1GGZ A;  5F6T A;  1J1E A;  1REC A;  5FYX A;  4WQ3 A;  2K7D A;  1IJ6 A;  1B8L A;  2KFF A;  1HQV A;  5DKR A;  3FWC A;  4XJK B;  1JF0 A;  1SPY A;  1XFZ O;  1J55 A;  2M1K B;  1ALW A;  3PM8 A;  1B47 A;  1KK7 Y;  2G2B A;  1JBA A;  2HF5 A;  2JPT A;  1U5I B;  2LVI A;  2LAP A;  1CLL A;  1SL7 A;  1K9K A;  2JU0 A;  5CSF A;  3SG4 A;  2KAX A;  3VRP A;  1NPQ A;  5PAL A;  4WRI A;  1QX5 B;  3O6B A;  1PSR A;  4YI9 A;  3D0Y A;  3KEV A;  1L2O B;  3GK2 A;  1LA0 A;  4I5K A;  1RWY A;  2PAL A;  3BUM B;  1Y1X A;  2KBI A;  2KAV A;  5I2O A;  3DF0 A;  1KK7 Z;  1OOJ A;  2M9G A;  1JC2 A;  3WHT B;  3PLF B;  2K2A A;  3SIA A;  4DUQ A;  2SAS A;  3CR2 A;  1S6J A;  3BOW A;  1JWD A;  2LCP A;  4ZCV A;  1WRL A;  1SBJ A;  3DVK A;  1QLK A;  2KI4 B;  2ZRS A;  1F71 A;  2LV7 A;  1BT6 A;  1F4O A;  1KSO A;  3EK8 A;  1KFU L;  2BBM A;  4HRG A;  1F55 A;  1UHK A;  2JOJ A;  2K7O A;  1AK8 A;  3VRQ A;  3LK1 A;  2K2F A;  1K90 D;  1FF1 A;  2BE4 A;  2LVJ A;  1Y1A A;  3I5H C;  1TOP A;  1M46 A;  3RLZ A;  1SR6 B;  3DD4 A;  3I5I B;  4FTG A;  5I8N A;  1J7R A;  4BY4 A;  1EXR A;  1MHO A;  1TTX A;  3DVJ A;  1QV0 A;  2LHL A;  3VGO A;  1SL9 A;  3K21 A;  1TN4 A;  3PAT A;  1HT9 A;  2SCP A;  1NP8 A;  1K9U A;  1RTP 1;  2EC6 C;  4GPL B;  4P2Y B;  4MN0 A;  4C0K A;  4XJK A;  1J7P A;  2M7N A;  2KNE A;  5AEQ A;  1UUR A;  1WDC C;  3GK4 X;  2D8N A;  4PE1 A;  1SY9 A;  3I5F C;  1OSA A;  1RK9 A;  3EK7 A;  1KWO B;  1MXL C;  5DKN A;  2COL B;  4YI8 A;  2K7B A;  3FS7 A;  2CNP A;  1DVI A;  4MRX A;  4A4C A;  4HSZ A;  1QS7 A;  4Q04 A;  1CKK A;  1OMR A;  5AER A;  4NDB A;  2JC2 A;  3D0Y B;  2AUC A;  3TUY C;  4OR9 B;  2FJU B;  3NXA A;  2PAS A;  1S1E A;  5KTY A;  1CLM A;  3DF0 B;  2NZ0 A;  2LMV A;  2BKI B;  3EVV A;  1K96 A;  4PHN A;  3AKA A;  2I7A A;  4NQG A;  2L98 A;  3NSO A;  2MHH A;  3NSI A;  2BCB A;  2OTG B;  3BOW B;  1CFF A;  1S6I A;  2MJW B;  3A8R A;  1NX1 A;  4P5O E;  1OE9 B;  3BUN B;  1RJV A;  4QJ4 B;  3E3R A;  2JXL A;  3SG6 A;  1NX3 A;  3I5H B;  2NCP A;  2OS8 C;  3O78 A;  1Q80 A;  2ZKM X;  3KF9 A;  1CM1 A;  5ER5 A;  5HKZ A;  1KFU S;  1B7T Y;  2KOT A;  1YX8 A;  3CR5 X;  4YRU A;  1WLZ A;  3IF7 A;  1S26 D;  3GK1 A;  4AQI A;  1K95 A;  2KDH A;  1JUO A;  2LNK A;  5CSJ A;  3RM1 A;  2L51 A;  1G8I A;  1TNP A;  4AQJ A;  4CID A;  1ODB A;  3CWG A;  3SG3 A;  3LCP C;  3EK4 A;  2FCE A;  1MXE A;  3OX6 A;  1ALV A;  5DKQ A;  3SJS A;  1K8U A;  2KAY A;  1KFX L;  1YR5 A;  2F2P A;  2KQY A;  3WXA A;  1B8C A;  1B7T Z;  1NSH A;  1QLS A;  2JNX A;  4FQO A;  1G33 A;  2G9B A;  1ZMZ A;  1DGV A;  1YUS A;  1GJY A;  2OPO A;  4DIR A;  4MVF A;  1KQM B;  3AAJ A;  4HRE E;  2L5X B;  2LUX A;  4DRW A;  1YRU B;  2Y4Q A;  3KPX A;  3AAK A;  1EH2 A;  1K93 D;  2AAO A;  2NCO A;  4GGF C;  3I5G B;  3SG2 A;  2Y1M A;  2M97 A;  2ZND A;  1LXF C;  1IG5 A;  2KBM A;  4OKH A;  1Y6W A;  2F33 A;  2L50 A;  4GAO A;  2ISD A;  4CLN A;  2JWW A;  2P6B B;  4MZK A;  3JTD B;  1H8B A;  1NCZ A;  2LLT A;  2GV5 A;  1A2X A;  1SNL A;  3A4U B;  3FWB A;  1NX2 A;  5J3X A;  1JF2 A;  2BBN A;  3ZNI A;  1BF5 A;  1QVI Y;  4ZCU A;  2Q91 A;  3PN7 B;  1JFJ A;  3D10 A;  1UP5 A;  2NXQ A;  5HKY A;  4M2P A;  1EJ3 A;  1SKT A;  3VRR A;  3EVU A;  4AOM A;  1CFD A;  1UHH A;  1Y0V H;  2QPT A;  4USL A;  5HKW A;  2FOT A;  2M7L A;  3JVT C;  5CSN A;  3WHU B;  4E68 A;  1B8R A;  3F45 A;  1E8A A;  4GNK B;  1JFK A;  3KO0 A;  1MWN A;  5AXI A;  1ZUZ A;  2ZFD A;  1TCF A;  1M31 A;  1F70 A;  1NIW A;  1AVS A;  1LIN A;  1UUS A;  3IQQ A;  5HLO A;  3LL8 B;  4YGE B;  2MRD A;  2BEC A;  1UWO A;  3HX4 A;  1K2H A;  4ETO A;  2O60 A;  1SCV A;  2M29 A;  2A4J A;  1R2U A;  2CBL A;  2JZI A;  2KFH A;  1NWD A;  1IH0 A;  3BXK A;  2K8M B;  1XK4 C;  1IJ5 A;  3OX5 A;  1XFY O;  2JQ6 A;  3CGA A;  2LHI A;  1IGV A;  4N5X A;  5I2L A;  3O4Y A;  1J7O A;  2K61 A;  1F54 A;  4MEW A;  2GGM A;  1DJH A;  1KK8 C;  2F3Z A;  3PFV A;  1IRJ A;  1TNX A;  2JTZ A;  2PVB A;  1KFX S;  1SL8 A;  4GFT A;  1YUT A;  2H61 C;  1QAT A;  3SG5 A;  5D69 A;  4CFR A;  1AUI B;  2B1U A;  1X02 A;  1IWQ A;  4ORC B;  1BLQ A;  1CMF A;  2NLN A;  1KQV A;  3FIA A;  2KQ6 A;  3GOF A;  3OB2 B;  1SK6 D;  2M3W A;  1VRK A;  4N1G A;  1CDL A;  3AKB A;  1SMG A;  1ZOT B;  2E6W A;  3WNX B;  2JUL A;  1L7Z A;  1SCM C;  2K7C A;  3BUO B;  1AHR A;  1V1G A;  1UHN A;  1EG3 A;  4JQ0 D;  2F3Y A;  1QV1 A;  1FI5 A;  1S6C A;  1TIZ A;  3EVR A;  4PHJ A;  1YUU A;  1DMO A;  1AJ5 A;  1XO5 A;  3BYA A;  5D7F A;  4NDC A;  1NX0 A;  3TDI A;  1NYA A;  2M8U A;  1S36 A;  2LLU A;  3PAL A;  4YGA A;  1J1D A;  1LKJ A;  4M2O A;  2WOR A;  1TNW A;  2PMY A;  3SIB A;  2Y1N A;  2KHN A;  1CDN A;  3C1V A;  2JXC A;  2L4H A;  2ZNE A;  1NCY A;  1MQ1 A;  1M45 A;  2KI6 D;  4M2Q A;  2LMT A;  2MLE C;  5JJG A;  1PVA A;  5IBW A;  2I94 A;  3M0W A;  1A03 A;  1XA5 A;  1XVJ A;  1CDP A;  1CDM A;  2LLS A;  2WCE A;  1JSA A;  1DJX A;  3OP0 A;  3TZ1 A;  2LAN A;  1A75 B;  2LUC A;  2HET A;  1NUB A;  1F4Q A;  2WCB A;  4PHM A;  5ER4 X;  1AJ4 A;  2F8P A;  2EC6 B;  4ORB B;  1L2O C;  4I5L B;  1B1G A;  4BY5 A;  1XFV O;  1C7W A;  4GGF A;  1B4C A;  1GQM A;  1WDC B;  5G08 A;  2KYC A;  2JT0 A;  1MF8 B;  3I5F B;  3DVM A;  1PK0 D;  1SCM B;  1M63 B;  2QAC A;  1OZS A;  1EG4 A;  3CLN A;  1CNP A;  1OMD A;  1LVC D;  3IQO A;  1BMO A;  1BU3 A;  3BUX B;  2LM5 A;  1GGW A;  2BCX A;  2MLF C;  5I2Q A;  3CZT X;  3TUY B;  5AFP A;  4PE0 A;  1F8H A;  1ZFS A;  2KI4 C;  2M1U A;  5JOL A;  3NSK A;  2JTT A;  2M49 B;  1DJG A;  3EKH A;  3CTN A;  1WLM A;  1WY9 A;  1A4P A;  1S3P A;  2BE6 A;  1H4B A;  1QX7 A;  1R6P A;  3H4S E;  1N0Y A;  2ZRT A;  2LVV A;  2LP2 A;  1DTL A;  4MBE A;  3BQ3 A;  1G4Y R;  3DVE A;  4U8D A;  1DF0 B;  1SR6 C;  2OS8 B;  3I5I C;  2HPS A;  1NCX A;  2H2K A;  3OB1 B;  3TS5 C;  4GBA A;  5GQQ C;  1BG1 A;  1UHJ A;  4YGC B;  2GGZ A;  4QJ5 B;  2PRU A;  1EL4 A;  1N2D A;  4PE4 A;  4CPV A;  1XFW O;  1XK4 A;  2KGB C;  4YGB B;  3HCM A;  4TNC A;  1BR1 B;  4ICB A;  4A4B A;  1C7V A;  4L9M A;  4NDD A;  1QIV A;  1MUX A;  1QVI Z;  2BCA A;  4IL1 A;  4GGN A;  2I18 A;  2LMU A;  1RFJ A;  4YBH B;  1OMV A;  1A75 A;  1KWO C;  2Q4U A;  2H61 A;  1OZO A;  3CR4 X;  2MA2 A;  3ZWH A;  3CS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...