2MRDA

Solution structure of human ca2+-loaded s100a4 cys-free mutant
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
101
structure length
101
Chain Sequence
MASPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYSVFLSSIAMMSNEFFEGFPDKQPRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of human calcium-bound S100A4 mutated at four cysteine loci
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Protein S100-A4
total genus 37
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2mrdA00
3NSOA 3RM1A 1IQ3A 3VRPA 2B1UA 2H61C 5I8NA 1CTRA 4MZKA 5D69A 1C7VA 1PSRA 2WNDA 2ZRSA 1SYMA 3QRXA 1SL8A 4L9MA 3PSRA 2EHBA 2M49B 5GQQC 1QTXA 2JULA 2O5GA 2BCXA 1FF1A 2KI4B 1BR4B 1V1GA 2WOSA 1RFJA 1LA3A 3PALA 1IKUA 5FYXA 5DKNA 2A4JA 4BY4A 1OMDA 5G08A 1MF8B 4PCWA 1LA0A 1R6PA 2KYFA 2MRDA 1RWYA 2BBNA 1K95A 3HX4A 1A2XA 1MWNA 3DVJA 4GBAA 1JWDA 3CZTX 5K89A 1B7TZ 3CWGA 1K2HA 1QATA 2H2KA 2LVKA 2GGMA 2LVJA 1UP5A 3GK4X 4OR9B 2ISDA 1B4CA 1PSBA 1N65A 3D0YA 5AERA 3LK0A 2LHIA 1XK4A 3BOWA 3BUNB 2PSRA 2NCPA 3A8RA 1G33A 1CKKA 1XK4C 1AHRA 1AK8A 5TNCA 1NCXA 3EK7A 3NSIA 4MRXA 5HKWA 2JXLA 1MUXA 1PRWA 1RTP1 1TCFA 2LUCA 3SG6A 4GPLB 1DJZA 3LK1A 1M31A 5AFPA 1TNQA 2RGIA 2F33A 2LMVA 4OV2A 1XFXO 1F54A 1IH0A 2HETA 2LVVA 1WRZA 2ZN8A 1LVCD 3DF0A 4YI9A 5HLVA 3BUOB 1YRTB 3TDZA 2LAPA 3JTDB 2PMYA 1J1EA 2NCOA 2JT3A 2R2IA 2WC8A 2M9GA 1QX2A 2JQ6A 3M0WA 4NDDA 5DKRA 1KQMB 3H4SE 4PE7A 2PALA 1B7TY 3PM8A 4WRIA 2M1KB 3SG4A 2Q91A 4C0JA 1EG3A 3F45A 4YGCB 1IJ6A 1NP8A 2KI6D 1TIZA 1Y0VH 1YVLA 3PLFB 4GGFA 4DCKA 1UURA 1WDCC 1IQ5A 1YX8A 4NDCA 3TUYB 2LM5A 3SG7A 1R2UA 1S6JA 4GNKB 3FWBA 4NDBA 3PN7B 2OS8C 3TUYC 1CB1A 1F4QA 4P2YB 2OS8B 4CIDA 1S3PA 1NX2A 1SL7A 2EGDA 4DRWA 1JF2A 1A29A 2KGRA 3GK2A 1LKJA 1XO5A 2K7CA 5KSZA 5B8IB 1IG5A 3EVUA 5D7FA 2KGBC 1ZMZA 1DTLA 1QVIZ 2KSPA 1CLLA 1S1EA 4JPZB 1CFPA 3IQOA 2JTZA 3A4UB 2L4IA 2JTTA 2OPOA 1CFFA 4YGDB 1K9UA 1NX0A 4MRYA 1A75A 1WLZA 1G8IA 2K0JA 1ALVA 1H8BA 3OP0A 2JT0A 2KBIA 1JF0A 2G9BA 1CDMA 4Q04A 1UHHA 4OCIA 2NLNA 5CSJA 2JNFA 4MVFA 2LP3A 3LCPC 5IBWA 4PALA 4PE0A 1BF5A 1EG4A 1AVSA 2K7DA 3KHEA 1VRKA 1BODA 1SMGA 4JQ0D 2FCEA 1QVIY 4HRGA 1DGUA 1M63B 3SIAA 1J7OA 4GGFC 1QIWA 1KFUL 4R1EA 1TRFA 1YURA 4XJKA 2SASA 2LV7A 2GGZA 3WXAA 2ZFDA 1OQPA 4BY5A 2BECA 1CMGA 2V53A 1GGWA 1F8HA 3EKHA 3HCMA 2KAVA 2KAXA 3JVTC 1GQMA 2BCAA 1HQVA 2LLSA 2JT8A 1IRJA 1W7IB 1CLBA 2DOQA 3WHUB 1DJXA 1K9KA 1TOPA 3O2PA 1QASA 1EH2A 2MLFC 2CBLA 3FWCA 2JXCA 1CDLA 5CPVA 1CFDA 3AAJA 1JC2A 1BT6A 1S26D 3D10A 3GK1A 4N5XA 3SIBA 1KFXS 5I2QA 1DVIA 1OZSA 3CS1A 4MLWA 4I5LB 1X02A 2JNXA 4ORBB 5CSIA 1AJ4A 5KTYA 1MXLC 3TDUA 2LP2A 1J1DA 4A4CA 2MLEC 1ZFSA 2VRGA 5HLOA 1TCOB 3OHMB 1N2DA 5PALA 1KSMA 3CR5X 1NCZA 1PK0D 1NIWA 1FW4A 1KFXL 4UPGA 2FCDA 2M8UA 2KQ6A 4C0LA 2Q4UA 2ZNDA 4F0ZB 3EKJA 1BLQA 5AEQA 2BBMA 2F3ZA 3O4YA 5J3XA 1WRKA 4NQGA 4USLA 4AQIA 2LNKA 1DF0B 4MSPA 2HQWA 1M45A 3O6BA 2HQ8A 1OZOA 3PN7C 2L2EA 1SKTA 2WCEA 2Y4QA 4FQOA 1KK8B 2EC6C 1U5IA 1ODBA 4JWQA 1SCVA 2KFHA 2ZN9A 3DVMA 1NPQA 1J55A 2LMTA 2LCPA 3VRQA 4I5JA 2AMIA 4ZCVA 4YRUA 2SCPA 3AKAA 1ALWA 2KNEA 1L2OC 1QS7A 4N1FA 1MHOA 2M0RA 3BUXB 3TDIA 1SY9A 2FOTA 1V1FA 1G4YR 2AUCA 2E6WA 1BG1A 4HRHA 1B1GA 2QPTA 3VRRA 1OSAA 1AUIB 2ZNEA 3LL8B 3WNXB 1ZUZA 1JFJA 3KEVA 2KDHA 4FTGA 2NZ0A 3BUMB 1JUOA 3OB1B 2HF5A 3DVKA 2F8PA 2I94A 2KI4C 1AP4A 4GUKA 5JJGA 3D0YB 3CTNA 2BL0C 3VROA 3BOWB 1BR1B 1TN4A 4ORAB 1F71A 1WY9A 3NSLA 1M39A 3RLZA 2F3YA 4HSZA 1E8AA 2CTNA 2Y5IA 1B47A 1CMFA 2M29A 1TNXA 1S6IA 3I5HB 4M2QA 1YX7A 5HKYA 1GGZA 2Y1NA 1F55A 2I18A 4XYNA 1KCYA 1XFWO 3E3RA 4WQ2A 4ZCUA 5HYDA 3DF0B 4QJ3B 3NXAA 3SJSA 1S6CA 1Y1UA 1MQ1A 2BE4A 5DKQA 4GGNA 2HPSA 1PALA 3I5GC 3AAKA 4PHNA 2D8NA 2G2BA 4M2PA 2I2RE 2L98A 4A4BA 4QJ4B 2COLB 4PDZA 3PATA 3OX5A 1ZOTB 1AJ5A 4YI8A 1H4BA 2H61A 1S5GZ 1S36A 3BXKA 1J7QA 1EL4A 1TNPA 4YGEB 1JBAA 2E30A 3JTDC 1NCYA 4GFTA 3O78A 1XFUO 2NXQA 3CGAA 3PFVA 4PHMA 2MBXA 3OB2B 4QJ5B 2M97A 5ER5A 3SG2A 4PHJA 3I5GB 2L0PA 1LINA 1NYAA 2BKHB 2K61A 1XFVO 2OTGB 3BYAA 3TS5C 1RJVA 2O60A 1K94A 1JFKA 4E68A 1YUUA 3C1VA 1QLSA 3OX6A 1OMRA 4C0KA 3WHTB 4P5OE 2KOTA 2GV5A 1QV0A 2MA2A 1XFYO 2M3WA 1OE9B 1B8RA 1IJ5A 4DUQA 1YRUB 3CLNA 2AAOA 1YVHA 1QLKA 1SRAA 2JOJA 1CLMA 1KQMC 1KFUS 1QX7A 5I2OA 1XA5A 5CSNA 1N0YA 1BMOA 2LLUA 3FS7A 3IQQA 1S5GY 1EJ3A 1K8UA 2LHLA 1CFCA 1CM4A 1TNWA 4CFQA 2PRUA 2JRFA 1BOCA 1DJWA 1FBVA 1CNPA 1PVAA 4MZLA 4GAOA 1RK9A 1UHNA 2L50A 2MAZA 4YGBB 1LXFC 1DJYA 2LVIA 3AKBA 3NSKA 1QIVA 2MHHA 3BUWB 1CM1A 2JZIA 2BKIB 1D1OA 1A4PA 3I5HC 2LC5A 3JVTB 2L4HA 1GJYA 4XJKB 1YUTA 1PVBA 2JC2A 4AQJA 4PE4A 1XYDA 1OMVA 2M7NA 2JWWA 1Y1AA 4ICBA 2FJUB 3ZWHA 3I5FC 1Q80A 2BL0B 1SR6B 1DJHA 2BCBA 1MXEA 4PE1A 1B8CA 2ZRTA 2CNPA 1FI5A 3EK4A 1YTZC 4AOMA 1HT9A 1FI6A 3TZ1A 1A75B 2KFGA 2LE9B 4M2OA 2JPTA 1NUBA 1YR5A 4I5NB 3KO0A 1QXPA 1DT7B 1FPWA 4YBHB 1SW8A 4U8DA 3IF7A 2KI6C 1OOJA 1UHIA 2WORA 1WLMA 4DS7A 4TNCA 5AANA 1YUSA 2L5XB 4N1GA 1K90D 1UWOA 1CDNA 2LMUA 4DIRA 3EK8A 2CT9A 1M46A 1XFZO 1SCMB 1F4OA 4D1EA 3LLEA 4YGAA 1SBJA 3I5FB 1DJIA 1SR6C 5BPJA 1NX1A 1QX5B 2M1UA 1RECA 2I7AA 1J7PA 2QACA 1L2OB 2KBMA 2P6BB 1EXRA 4OVNF 5AXIA 1SNLA 2WCBA 1KSOA 2TN4A 5F6TA 2PASA 4HREE 3SG5A 4CLNA 4MEWA 2WCFA 3K21A 5I2LA 3BQ3A 1L7ZA 1UHJA 2LUXA 3DD4A 3ICBA 1RROA 1B9AA 1BU3A 1UUSA 1QJTA 2M7LA 1KWOB 1MR8A 3FIAA 1XVJA 2K7OA 2ZKMX 2L51A 2Y1MA 1IGVA 1BJFA 1KWOC 1NX3A 4MZJA 1DMOA 4MN0A 1A03A 2K2AA 5KU1A 1C07A 2KYCA 2MJWB 5HKZA 1DJGA 5JOLA 3TS5B 4MBEA 1SL9A 4CPVA 3DVEA 1K96A 2CXJA 3MSEB 1K9PA 1K93D 3EVRA 2K2FA 1W7JB 1ZACA 1TTXA 1QV1A 2K8MB 1KK7Z 2KHNA 3I5IC 2KAYA 3ZNIA 1Y1XA 3CR4X 1KQVA 3I5IB 2F2PA 2EC6B 1DGVA 5CSFA 3VRNA 1NSHA 1Y6WA 5ER4X 2JU0A 1CDPA 1SCMC 3GOFA 2LANA 1KK8C 4WQ3A 2PVBA 1B8LA 3CR2A 1PULA 1KK7Y 2OTGC 3KF9A 3EVVA 2IS9A 3KPXA 1F70A 1SPYA 1JSAA 4ORCB 3VGOA 4OKHA 1DF0A 1WRLA 1IWQA 2LLTA 3SG3A 2F2OA 1C7WA 1J7RA 4CFRA 4ETOA 2K7BA 2BE6A 2KQYA 1WDCB 2CCMA 1SK6D 4PHKA 4I5KA 1NWDA 4IL1A 1U5IB 1UHKA 2KFFA
chains in the Genus database with same CATH superfamily
3NSOA 3RM1A 1IQ3A 3VRPA 2B1UA 2H61C 3DXLA 5I8NA 1CTRA 4MZKA 5D69A 1C7VA 1PSRA 2WNDA 2ZRSA 1SYMA 3QRXA 1SL8A 4L9MA 3PSRA 2QEHA 2EHBA 2M49B 5GQQC 1QTXA 2JULA 2O5GA 3S0DA 2KLEA 2FJYA 2BCXA 1FF1A 2KI4B 1BR4B 1V1GA 2WOSA 1RFJA 1LA3A 3PALA 4IJ7A 1IKUA 5FYXA 5DKNA 1DQEA 2A4JA 1OMDA 5G08A 4BY4A 3S0AA 1MF8B 4PCWA 1LA0A 1R6PA 2KYFA 2MRDA 1RWYA 2BBNA 1K95A 3HX4A 3CZ0A 1A2XA 1MWNA 3DVJA 4GBAA 3UNWA 1JWDA 3R1OA 4JD9A 1TWOA 3CZTX 5K89A 1B7TZ 3CWGA 1K2HA 1QATA 2H2KA 2LVKA 2GGMA 2LVJA 1UP5A 3GK4X 4OR9B 2ISDA 1B4CA 3V2LA 1PSBA 1N65A 3D0YA 5AERA 3D77A 2GTEA 3LK0A 2LHIA 1XK4A 3BOWA 3BUNB 3DZTA 2PSRA 3PM2A 2NCPA 1OOIX 3A8RA 1G33A 1CKKA 1XK4C 1AHRA 1AK8A 5TNCA 1NCXA 3EK7A 3OBVA 3NSIA 3B86A 4MRXA 5HKWA 1Z4HA 2JXLA 5EL2A 3R72A 1MUXA 1PRWA 1RTP1 1TCFA 2WCLA 2WCJA 3NGVA 2LUCA 5FI2A 4GPLB 3SG6A 1DJZA 3LK1A 1M31A 5AFPA 1TNQA 2KLDA 2RGIA 2F33A 2LMVA 3NHIA 4OV2A 1XFXO 1F54A 1IH0A 2HETA 1P28A 1WRZA 2LVVA 1LVCD 2ZN8A 3DF0A 4YI9A 5HLVA 3BUOB 1YRTB 3TDZA 2LAPA 3JTDB 2PMYA 1J1EA 2NCOA 2JT3A 2R2IA 2WC8A 2M9GA 1QX2A 2JQ6A 3M0WA 4NDDA 5DKRA 1KQMB 3H4SE 3SS5A 4PE7A 2PALA 1B7TY 3PM8A 4WRIA 2M1KB 2H8VA 3SG4A 2Q91A 4C0JA 1EG3A 3F45A 4YGCB 1IJ6A 1NP8A 2KI6D 1TIZA 1Y0VH 1YVLA 3PLFB 4GGFA 4DCKA 1UURA 1WDCC 1IQ5A 1YX8A 2BAPA 4NDCA 2LM5A 3SG7A 1R2UA 1S6JA 3TUYB 4GNKB 3FWBA 4NDBA 3PN7B 2OS8C 3TUYC 1CB1A 1F4QA 4P2YB 2OS8B 5DICA 4CIDA 1S3PA 1NX2A 1SL7A 2EGDA 4DRWA 1JF2A 1A29A 2KGRA 3GK2A 1LKJA 1XO5A 2K7CA 5KSZA 5B8IB 1IG5A 3EVUA 5D7FA 2KGBC 1ZMZA 1DTLA 1QVIZ 2KSPA 1CLLA 1S1EA 2YGUA 4JPZB 3IQOA 1CFPA 2JTZA 3A4UB 2L4IA 2JTTA 2OPOA 1CFFA 4YGDB 1K9UA 1NX0A 4MRYA 1A75A 1WLZA 2P70A 1G8IA 2K0JA 1ALVA 1H8BA 3OP0A 2JT0A 2KBIA 1JF0A 3FE6A 2G9BA 1CDMA 4Q04A 1UHHA 4OCIA 2NLNA 5CSJA 2JNFA 3DYEA 4MVFA 3B7AA 2LP3A 3LCPC 3B6XA 5IBWA 4PALA 4PE0A 1BF5A 1EG4A 1AVSA 1OW4A 2K7DA 3KHEA 1VRKA 3R1VA 1BODA 1SMGA 3D78A 4JQ0D 2FCEA 1QVIY 4HRGA 1DGUA 1M63B 2L5YA 3SIAA 1J7OA 4GGFC 2WC6A 1QIWA 1KFUL 4R1EA 1TRFA 1YURA 4XJKA 2SASA 2LV7A 2GGZA 3WXAA 1QWVA 2ZFDA 1OQPA 4BY5A 2BECA 1CMGA 2V53A 1GGWA 1F8HA 3EKHA 3HCMA 2KAVA 2KAXA 3JVTC 1GQMA 2BCAA 2QEBA 1HQVA 2LLSA 2JT8A 1IRJA 1W7IB 3WNXB 1CLBA 2DOQA 3WHUB 1DJXA 1K9KA 1TOPA 3O2PA 1QASA 1EH2A 2MLFC 5HL1A 2CBLA 3FWCA 2JXCA 2ERBA 1CDLA 5CPVA 1CFDA 2QEOA 3AAJA 3S0EA 1BT6A 1S26D 3D10A 3GK1A 1JC2A 4PT1A 4N5XA 3SIBA 1KFXS 3SS3A 5I2QA 1DVIA 1OZSA 3CS1A 4KYNA 4MLWA 4I5LB 1X02A 2JNXA 3B88A 4ORBB 5CSIA 1AJ4A 5KTYA 1MXLC 3TDUA 3UO9A 2LP2A 1J1DA 4A4CA 4FQTA 2MLEC 1ZFSA 2VRGA 2P71A 1TUZA 5HLOA 1TCOB 3OHMB 5FI7A 1N2DA 5PALA 1KSMA 3CR5X 1NCZA 1PK0D 3BFBA 1NIWA 1FW4A 1KFXL 4UPGA 2FCDA 2L2CA 2M8UA 1LS8A 2KQ6A 3L4LA 4C0LA 2Q4UA 3CZ1A 2ZNDA 1DELA 4F0ZB 3EKJA 1BLQA 5AEQA 2BBMA 2F3ZA 3D76A 3N7HA 3O4YA 5J3XA 1WRKA 4NQGA 4USLA 4AQIA 2LNKA 1DF0B 4MSPA 2HQWA 1M45A 3O6BA 2HQ8A 1OZOA 3PN7C 2L2EA 1SKTA 2WCEA 2Y4QA 4FQOA 3S0GA 1KK8B 3K1EA 2EC6C 1U5IA 1ODBA 4JWQA 1SCVA 2KFHA 2ZN9A 3DVMA 2WCKA 1NPQA 1J55A 2LMTA 2LCPA 3VRQA 4I5JA 3L4AA 2AMIA 4ZCVA 4YRUA 2SCPA 3AKAA 1ALWA 2KNEA 3QMEA 1L2OC 1QS7A 4N1FA 1MHOA 2M0RA 3BUXB 3TDIA 1SY9A 2FOTA 1V1FA 1G4YR 2AUCA 3SS4A 2E6WA 1BG1A 4HRHA 1B1GA 3O4XA 2QPTA 3VRRA 1OSAA 1AUIB 2ZNEA 3CYZA 3LL8B 1ZUZA 4OZDA 3KEVA 2KDHA 1JFJA 4FTGA 2NZ0A 3BUMB 1JUOA 3OB1B 2PQLA 3S0FA 2HF5A 3RZSA 3D74A 3DVKA 2F8PA 2I94A 2KPHA 2KI4C 1AP4A 4GUKA 5JJGA 3D0YB 3CTNA 2BL0C 3VROA 3BOWB 1BR1B 1TN4A 4ORAB 1F71A 1OOFA 1WY9A 3NSLA 1M39A 3RLZA 2F3YA 4HSZA 1E8AA 2CTNA 2Y5IA 1B47A 4F7FA 2M29A 1CMFA 1TNXA 1S6IA 1C3YA 3I5HB 5D3OA 4M2QA 1OOGA 1YX7A 1SSEB 2WCMA 5HKYA 1GGZA 2Y1NA 2WC5A 1F55A 2I18A 4XYNA 3Q8IA 1KCYA 1XFWO 3E3RA 4WQ2A 4ZCUA 5HYDA 3DF0B 2JPOA 4QJ3B 3NXAA 3SJSA 1S6CA 1Y1UA 1MQ1A 2BE4A 5DKQA 4GGNA 2HPSA 1PALA 3I5GC 3AAKA 4PHNA 2D8NA 2G2BA 4M2PA 2I2RE 3B87A 2L98A 3L47A 4A4BA 4QJ4B 2QDIA 2COLB 4PDZA 1DC1A 3PATA 3BFAA 3OX5A 1C3ZA 1IIOA 1ZOTB 1AJ5A 4YI8A 1H4BA 2H61A 1S5GZ 1S36A 3BXKA 1J7QA 1EL4A 1TNPA 3R1PA 4YGEB 1JBAA 2E30A 3JTDC 1NCYA 4GFTA 3O78A 1XFUO 2NXQA 3CGAA 3PFVA 4PHMA 2MBXA 3OB2B 2K60A 4QJ5B 2M97A 5ER5A 3SG2A 4PHJA 3I5GB 2L0PA 1LINA 1NYAA 2BKHB 2K61A 1XFVO 2OTGB 3BYAA 3TS5C 1RJVA 2O60A 1K94A 1JFKA 4E68A 1YUUA 3C1VA 1QLSA 3OX6A 1OMRA 4C0KA 3WHTB 4P5OE 2KOTA 2GV5A 3CABA 1QV0A 2MA2A 1XFYO 2M3WA 3FE9A 1OE9B 1B8RA 1IJ5A 4DUQA 1YRUB 3CLNA 2AAOA 1YVHA 1QLKA 1SRAA 2JOJA 1CLMA 1KQMC 3PJIA 1KFUS 1QX7A 5I2OA 1XA5A 5CSNA 1N0YA 1BMOA 2LLUA 3FS7A 2WCHA 3NHTA 3IQQA 1S5GY 1EJ3A 1K8UA 2LHLA 1CFCA 1CM4A 1TNWA 4CFQA 2PRUA 2JRFA 1BOCA 1DJWA 1FBVA 1CNPA 1PVAA 4MZLA 4GAOA 1RK9A 1UHNA 2L50A 2MAZA 4YGBB 1LXFC 1DJYA 2LVIA 3AKBA 1TUJA 1QIVA 2MHHA 3NSKA 5FI6A 3BUWB 1CM1A 2JZIA 2BKIB 1D1OA 1A4PA 2BNXA 3I5HC 2LC5A 1W9ZA 3DY9A 2L4HA 1GJYA 3BJHA 3JVTB 4XJKB 1YUTA 1PVBA 4JKTA 2JC2A 4AQJA 4PE4A 1XYDA 1OMVA 2M7NA 3EG5B 2JWWA 1Y1AA 4ICBA 4INXA 2FJUB 3ZWHA 3I5FC 1Q80A 2BL0B 1SR6B 1DJHA 2BCBA 1MXEA 4PE1A 1B8CA 1T14A 2CNPA 2ZRTA 1FI5A 3EK4A 1YTZC 4AOMA 1HT9A 1FI6A 3TZ1A 1A75B 2KFGA 3OGNA 2LE9B 1Z2CB 5I94A 4M2OA 2JPTA 1NUBA 1YR5A 4I5NB 3KO0A 1QXPA 1DT7B 1FPWA 3CZ2A 4YBHB 1SW8A 4U8DA 3IF7A 2KI6C 1OOJA 1UHIA 2PYQA 1WLMA 2WORA 4TNCA 5AANA 4DS7A 1YUSA 2L5XB 4N1GA 1K90D 1UWOA 1CDNA 2LMUA 4DIRA 1OOHA 3EK8A 2CT9A 1M46A 1XFZO 1DEKA 1SCMB 1F4OA 4D1EA 3LLEA 4YGAA 1SBJA 3I5FB 1DJIA 1SR6C 5BPJA 1NX1A 1QX5B 2M1UA 1RECA 2I7AA 1J7PA 2QACA 1L2OB 2KBMA 2P6BB 1EXRA 4OVNF 5AXIA 1SNLA 2WCBA 1KSOA 2TN4A 5F6TA 2PASA 3CDNA 4HREE 3SG5A 4CLNA 4MEWA 2WCFA 3K21A 5I2LA 3BQ3A 1L7ZA 1UHJA 2LUXA 3DD4A 3ICBA 1RROA 1B9AA 1BU3A 1UUSA 1QJTA 2M7LA 1KWOB 1MR8A 3FIAA 1XVJA 2K7OA 2ZKMX 2L51A 2Y1MA 1IGVA 1BJFA 1KWOC 1NX3A 4MZJA 1DMOA 4MN0A 1A03A 2K2AA 5KU1A 1C07A 2KYCA 2MJWB 5HKZA 1DJGA 5JOLA 3TS5B 4INWA 4MBEA 1SL9A 4CPVA 1ORGA 3DVEA 1K96A 2CXJA 3D73A 3MSEB 2QEVA 1K9PA 1K93D 3EVRA 2K2FA 1W7JB 3FE8A 1ZACA 1TTXA 1QV1A 2K8MB 1KK7Z 2KHNA 3I5IC 3S0BA 2KAYA 3VB1A 3ZNIA 1Y1XA 1XFRA 3CR4X 3I5IB 2F2PA 1KQVA 2EC6B 1DGVA 5CSFA 3VRNA 1NSHA 1Y6WA 5ER4X 2JU0A 1CDPA 1SCMC 3GOFA 2LANA 1KK8C 1GM0A 4WQ3A 2PVBA 1B8LA 3CR2A 3D75A 1PULA 1KK7Y 2OTGC 3KF9A 3EVVA 2IS9A 3KPXA 1F70A 1SPYA 1JSAA 4ORCB 3VGOA 4OKHA 1DF0A 1WRLA 1IWQA 2LLTA 3SG3A 2F2OA 1C7WA 1J7RA 3IVTA 4CFRA 4ETOA 2K7BA 2BE6A 2KQYA 1WDCB 2CCMA 1SK6D 3BFHA 4PHKA 4I5KA 1NWDA 4IL1A 1U5IB 1UHKA 2KFFA
chains in the Genus database with same CATH topology
3NSOA 3RM1A 1IQ3A 3VRPA 2B1UA 2H61C 5I8NA 1CTRA 4MZKA 5D69A 1C7VA 1PSRA 2WNDA 2ZRSA 1SYMA 3QRXA 1SL8A 4L9MA 3PSRA 2EHBA 2M49B 5GQQC 1QTXA 2JULA 2O5GA 2BCXA 1FF1A 2KI4B 1BR4B 1V1GA 2WOSA 1RFJA 1LA3A 3PALA 1IKUA 5FYXA 5DKNA 2A4JA 4BY4A 1OMDA 5G08A 1MF8B 4PCWA 1LA0A 1R6PA 2KYFA 2MRDA 1RWYA 2BBNA 1K95A 3HX4A 1A2XA 1MWNA 3DVJA 4GBAA 1JWDA 3CZTX 5K89A 1B7TZ 3CWGA 1K2HA 1QATA 2H2KA 2LVKA 2GGMA 2LVJA 1UP5A 3GK4X 4OR9B 2ISDA 1B4CA 1PSBA 1N65A 3D0YA 5AERA 3LK0A 2LHIA 1XK4A 3BOWA 3BUNB 2PSRA 2NCPA 3A8RA 1G33A 1CKKA 1XK4C 1AHRA 1AK8A 5TNCA 1NCXA 3EK7A 3NSIA 4MRXA 5HKWA 2JXLA 1MUXA 1PRWA 1RTP1 1TCFA 2LUCA 3SG6A 4GPLB 1DJZA 3LK1A 1M31A 5AFPA 1TNQA 2RGIA 2F33A 2LMVA 4OV2A 1XFXO 1F54A 1IH0A 2HETA 2LVVA 1WRZA 2ZN8A 1LVCD 3DF0A 4YI9A 5HLVA 3BUOB 1YRTB 3TDZA 2LAPA 3JTDB 2PMYA 1J1EA 2NCOA 2JT3A 2R2IA 2WC8A 2M9GA 1QX2A 2JQ6A 3M0WA 4NDDA 5DKRA 1KQMB 3H4SE 4PE7A 2PALA 1B7TY 3PM8A 4WRIA 2M1KB 3SG4A 2Q91A 4C0JA 1EG3A 3F45A 4YGCB 1IJ6A 1NP8A 2KI6D 1TIZA 1Y0VH 1YVLA 3PLFB 4GGFA 4DCKA 1UURA 1WDCC 1IQ5A 1YX8A 4NDCA 3TUYB 2LM5A 3SG7A 1R2UA 1S6JA 4GNKB 3FWBA 4NDBA 3PN7B 2OS8C 3TUYC 1CB1A 1F4QA 4P2YB 2OS8B 4CIDA 1S3PA 1NX2A 1SL7A 2EGDA 4DRWA 1JF2A 1A29A 2KGRA 3GK2A 1LKJA 1XO5A 2K7CA 5KSZA 5B8IB 1IG5A 3EVUA 5D7FA 2KGBC 1ZMZA 1DTLA 1QVIZ 2KSPA 1CLLA 1S1EA 4JPZB 1CFPA 3IQOA 2JTZA 3A4UB 2L4IA 2JTTA 2OPOA 1CFFA 4YGDB 1K9UA 1NX0A 4MRYA 1A75A 1WLZA 1G8IA 2K0JA 1ALVA 1H8BA 3OP0A 2JT0A 2KBIA 1JF0A 2G9BA 1CDMA 4Q04A 1UHHA 4OCIA 2NLNA 5CSJA 2JNFA 4MVFA 2LP3A 3LCPC 5IBWA 4PALA 4PE0A 1BF5A 1EG4A 1AVSA 2K7DA 3KHEA 1VRKA 1BODA 1SMGA 4JQ0D 2FCEA 1QVIY 4HRGA 1DGUA 1M63B 3SIAA 1J7OA 4GGFC 1QIWA 1KFUL 4R1EA 1TRFA 1YURA 4XJKA 2SASA 2LV7A 2GGZA 3WXAA 2ZFDA 1OQPA 4BY5A 2BECA 1CMGA 2V53A 1GGWA 1F8HA 3EKHA 3HCMA 2KAVA 2KAXA 3JVTC 1GQMA 2BCAA 1HQVA 2LLSA 2JT8A 1IRJA 1W7IB 1CLBA 2DOQA 3WHUB 1DJXA 1K9KA 1TOPA 3O2PA 1QASA 1EH2A 2MLFC 2CBLA 3FWCA 2JXCA 1CDLA 5CPVA 1CFDA 3AAJA 1JC2A 1BT6A 1S26D 3D10A 3GK1A 4N5XA 3SIBA 1KFXS 5I2QA 1DVIA 1OZSA 3CS1A 4MLWA 4I5LB 1X02A 2JNXA 4ORBB 5CSIA 1AJ4A 5KTYA 1MXLC 3TDUA 2LP2A 1J1DA 4A4CA 2MLEC 1ZFSA 2VRGA 5HLOA 1TCOB 3OHMB 1N2DA 5PALA 1KSMA 3CR5X 1NCZA 1PK0D 1NIWA 1FW4A 1KFXL 4UPGA 2FCDA 2M8UA 2KQ6A 4C0LA 2Q4UA 2ZNDA 4F0ZB 3EKJA 1BLQA 5AEQA 2BBMA 2F3ZA 3O4YA 5J3XA 1WRKA 4NQGA 4USLA 4AQIA 2LNKA 1DF0B 4MSPA 2HQWA 1M45A 3O6BA 2HQ8A 1OZOA 3PN7C 2L2EA 1SKTA 2WCEA 2Y4QA 4FQOA 1KK8B 2EC6C 1U5IA 1ODBA 4JWQA 1SCVA 2KFHA 2ZN9A 3DVMA 1NPQA 1J55A 2LMTA 2LCPA 3VRQA 4I5JA 2AMIA 4ZCVA 4YRUA 2SCPA 3AKAA 1ALWA 2KNEA 1L2OC 1QS7A 4N1FA 1MHOA 2M0RA 3BUXB 3TDIA 1SY9A 2FOTA 1V1FA 1G4YR 2AUCA 2E6WA 1BG1A 4HRHA 1B1GA 2QPTA 3VRRA 1OSAA 1AUIB 2ZNEA 3LL8B 3WNXB 1ZUZA 1JFJA 3KEVA 2KDHA 4FTGA 2NZ0A 3BUMB 1JUOA 3OB1B 2HF5A 3DVKA 2F8PA 2I94A 2KI4C 1AP4A 4GUKA 5JJGA 3D0YB 3CTNA 2BL0C 3VROA 3BOWB 1BR1B 1TN4A 4ORAB 1F71A 1WY9A 3NSLA 1M39A 3RLZA 2F3YA 4HSZA 1E8AA 2CTNA 2Y5IA 1B47A 1CMFA 2M29A 1TNXA 1S6IA 3I5HB 4M2QA 1YX7A 5HKYA 1GGZA 2Y1NA 1F55A 2I18A 4XYNA 1KCYA 1XFWO 3E3RA 4WQ2A 4ZCUA 5HYDA 3DF0B 4QJ3B 3NXAA 3SJSA 1S6CA 1Y1UA 1MQ1A 2BE4A 5DKQA 4GGNA 2HPSA 1PALA 3I5GC 3AAKA 4PHNA 2D8NA 2G2BA 4M2PA 2I2RE 2L98A 4A4BA 4QJ4B 2COLB 4PDZA 3PATA 3OX5A 1ZOTB 1AJ5A 4YI8A 1H4BA 2H61A 1S5GZ 1S36A 3BXKA 1J7QA 1EL4A 1TNPA 4YGEB 1JBAA 2E30A 3JTDC 1NCYA 4GFTA 3O78A 1XFUO 2NXQA 3CGAA 3PFVA 4PHMA 2MBXA 3OB2B 4QJ5B 2M97A 5ER5A 3SG2A 4PHJA 3I5GB 2L0PA 1LINA 1NYAA 2BKHB 2K61A 1XFVO 2OTGB 3BYAA 3TS5C 1RJVA 2O60A 1K94A 1JFKA 4E68A 1YUUA 3C1VA 1QLSA 3OX6A 1OMRA 4C0KA 3WHTB 4P5OE 2KOTA 2GV5A 1QV0A 2MA2A 1XFYO 2M3WA 1OE9B 1B8RA 1IJ5A 4DUQA 1YRUB 3CLNA 2AAOA 1YVHA 1QLKA 1SRAA 2JOJA 1CLMA 1KQMC 1KFUS 1QX7A 5I2OA 1XA5A 5CSNA 1N0YA 1BMOA 2LLUA 3FS7A 3IQQA 1S5GY 1EJ3A 1K8UA 2LHLA 1CFCA 1CM4A 1TNWA 4CFQA 2PRUA 2JRFA 1BOCA 1DJWA 1FBVA 1CNPA 1PVAA 4MZLA 4GAOA 1RK9A 1UHNA 2L50A 2MAZA 4YGBB 1LXFC 1DJYA 2LVIA 3AKBA 3NSKA 1QIVA 2MHHA 3BUWB 1CM1A 2JZIA 2BKIB 1D1OA 1A4PA 3I5HC 2LC5A 3JVTB 2L4HA 1GJYA 4XJKB 1YUTA 1PVBA 2JC2A 4AQJA 4PE4A 1XYDA 1OMVA 2M7NA 2JWWA 1Y1AA 4ICBA 2FJUB 3ZWHA 3I5FC 1Q80A 2BL0B 1SR6B 1DJHA 2BCBA 1MXEA 4PE1A 1B8CA 2ZRTA 2CNPA 1FI5A 3EK4A 1YTZC 4AOMA 1HT9A 1FI6A 3TZ1A 1A75B 2KFGA 2LE9B 4M2OA 2JPTA 1NUBA 1YR5A 4I5NB 3KO0A 1QXPA 1DT7B 1FPWA 4YBHB 1SW8A 4U8DA 3IF7A 2KI6C 1OOJA 1UHIA 2WORA 1WLMA 4DS7A 4TNCA 5AANA 1YUSA 2L5XB 4N1GA 1K90D 1UWOA 1CDNA 2LMUA 4DIRA 3EK8A 2CT9A 1M46A 1XFZO 1SCMB 1F4OA 4D1EA 3LLEA 4YGAA 1SBJA 3I5FB 1DJIA 1SR6C 5BPJA 1NX1A 1QX5B 2M1UA 1RECA 2I7AA 1J7PA 2QACA 1L2OB 2KBMA 2P6BB 1EXRA 4OVNF 5AXIA 1SNLA 2WCBA 1KSOA 2TN4A 5F6TA 2PASA 4HREE 3SG5A 4CLNA 4MEWA 2WCFA 3K21A 5I2LA 3BQ3A 1L7ZA 1UHJA 2LUXA 3DD4A 3ICBA 1RROA 1B9AA 1BU3A 1UUSA 1QJTA 2M7LA 1KWOB 1MR8A 3FIAA 1XVJA 2K7OA 2ZKMX 2L51A 2Y1MA 1IGVA 1BJFA 1KWOC 1NX3A 4MZJA 1DMOA 4MN0A 1A03A 2K2AA 5KU1A 1C07A 2KYCA 2MJWB 5HKZA 1DJGA 5JOLA 3TS5B 4MBEA 1SL9A 4CPVA 3DVEA 1K96A 2CXJA 3MSEB 1K9PA 1K93D 3EVRA 2K2FA 1W7JB 1ZACA 1TTXA 1QV1A 2K8MB 1KK7Z 2KHNA 3I5IC 2KAYA 3ZNIA 1Y1XA 3CR4X 1KQVA 3I5IB 2F2PA 2EC6B 1DGVA 5CSFA 3VRNA 1NSHA 1Y6WA 5ER4X 2JU0A 1CDPA 1SCMC 3GOFA 2LANA 1KK8C 4WQ3A 2PVBA 1B8LA 3CR2A 1PULA 1KK7Y 2OTGC 3KF9A 3EVVA 2IS9A 3KPXA 1F70A 1SPYA 1JSAA 4ORCB 3VGOA 4OKHA 1DF0A 1WRLA 1IWQA 2LLTA 3SG3A 2F2OA 1C7WA 1J7RA 4CFRA 4ETOA 2K7BA 2BE6A 2KQYA 1WDCB 2CCMA 1SK6D 4PHKA 4I5KA 1NWDA 4IL1A 1U5IB 1UHKA 2KFFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NSO A;  3RM1 A;  1IQ3 A;  3VRP A;  2B1U A;  2H61 C;  5I8N A;  1CTR A;  4MZK A;  5D69 A;  1C7V A;  1PSR A;  2WND A;  2ZRS A;  1SYM A;  3QRX A;  1SL8 A;  4L9M A;  3PSR A;  2EHB A;  2M49 B;  5GQQ C;  1QTX A;  2JUL A;  2O5G A;  2BCX A;  1FF1 A;  2KI4 B;  1BR4 B;  1V1G A;  2WOS A;  1RFJ A;  1LA3 A;  3PAL A;  1IKU A;  5FYX A;  5DKN A;  2A4J A;  4BY4 A;  1OMD A;  5G08 A;  1MF8 B;  4PCW A;  1LA0 A;  1R6P A;  2KYF A;  2MRD A;  1RWY A;  2BBN A;  1K95 A;  3HX4 A;  1A2X A;  1MWN A;  3DVJ A;  4GBA A;  1JWD A;  3CZT X;  5K89 A;  1B7T Z;  3CWG A;  1K2H A;  1QAT A;  2H2K A;  2LVK A;  2GGM A;  2LVJ A;  1UP5 A;  3GK4 X;  4OR9 B;  2ISD A;  1B4C A;  1PSB A;  1N65 A;  3D0Y A;  5AER A;  3LK0 A;  2LHI A;  1XK4 A;  3BOW A;  3BUN B;  2PSR A;  2NCP A;  3A8R A;  1G33 A;  1CKK A;  1XK4 C;  1AHR A;  1AK8 A;  5TNC A;  1NCX A;  3EK7 A;  3NSI A;  4MRX A;  5HKW A;  2JXL A;  1MUX A;  1PRW A;  1RTP 1;  1TCF A;  2LUC A;  3SG6 A;  4GPL B;  1DJZ A;  3LK1 A;  1M31 A;  5AFP A;  1TNQ A;  2RGI A;  2F33 A;  2LMV A;  4OV2 A;  1XFX O;  1F54 A;  1IH0 A;  2HET A;  2LVV A;  1WRZ A;  2ZN8 A;  1LVC D;  3DF0 A;  4YI9 A;  5HLV A;  3BUO B;  1YRT B;  3TDZ A;  2LAP A;  3JTD B;  2PMY A;  1J1E A;  2NCO A;  2JT3 A;  2R2I A;  2WC8 A;  2M9G A;  1QX2 A;  2JQ6 A;  3M0W A;  4NDD A;  5DKR A;  1KQM B;  3H4S E;  4PE7 A;  2PAL A;  1B7T Y;  3PM8 A;  4WRI A;  2M1K B;  3SG4 A;  2Q91 A;  4C0J A;  1EG3 A;  3F45 A;  4YGC B;  1IJ6 A;  1NP8 A;  2KI6 D;  1TIZ A;  1Y0V H;  1YVL A;  3PLF B;  4GGF A;  4DCK A;  1UUR A;  1WDC C;  1IQ5 A;  1YX8 A;  4NDC A;  3TUY B;  2LM5 A;  3SG7 A;  1R2U A;  1S6J A;  4GNK B;  3FWB A;  4NDB A;  3PN7 B;  2OS8 C;  3TUY C;  1CB1 A;  1F4Q A;  4P2Y B;  2OS8 B;  4CID A;  1S3P A;  1NX2 A;  1SL7 A;  2EGD A;  4DRW A;  1JF2 A;  1A29 A;  2KGR A;  3GK2 A;  1LKJ A;  1XO5 A;  2K7C A;  5KSZ A;  5B8I B;  1IG5 A;  3EVU A;  5D7F A;  2KGB C;  1ZMZ A;  1DTL A;  1QVI Z;  2KSP A;  1CLL A;  1S1E A;  4JPZ B;  1CFP A;  3IQO A;  2JTZ A;  3A4U B;  2L4I A;  2JTT A;  2OPO A;  1CFF A;  4YGD B;  1K9U A;  1NX0 A;  4MRY A;  1A75 A;  1WLZ A;  1G8I A;  2K0J A;  1ALV A;  1H8B A;  3OP0 A;  2JT0 A;  2KBI A;  1JF0 A;  2G9B A;  1CDM A;  4Q04 A;  1UHH A;  4OCI A;  2NLN A;  5CSJ A;  2JNF A;  4MVF A;  2LP3 A;  3LCP C;  5IBW A;  4PAL A;  4PE0 A;  1BF5 A;  1EG4 A;  1AVS A;  2K7D A;  3KHE A;  1VRK A;  1BOD A;  1SMG A;  4JQ0 D;  2FCE A;  1QVI Y;  4HRG A;  1DGU A;  1M63 B;  3SIA A;  1J7O A;  4GGF C;  1QIW A;  1KFU L;  4R1E A;  1TRF A;  1YUR A;  4XJK A;  2SAS A;  2LV7 A;  2GGZ A;  3WXA A;  2ZFD A;  1OQP A;  4BY5 A;  2BEC A;  1CMG A;  2V53 A;  1GGW A;  1F8H A;  3EKH A;  3HCM A;  2KAV A;  2KAX A;  3JVT C;  1GQM A;  2BCA A;  1HQV A;  2LLS A;  2JT8 A;  1IRJ A;  1W7I B;  1CLB A;  2DOQ A;  3WHU B;  1DJX A;  1K9K A;  1TOP A;  3O2P A;  1QAS A;  1EH2 A;  2MLF C;  2CBL A;  3FWC A;  2JXC A;  1CDL A;  5CPV A;  1CFD A;  3AAJ A;  1JC2 A;  1BT6 A;  1S26 D;  3D10 A;  3GK1 A;  4N5X A;  3SIB A;  1KFX S;  5I2Q A;  1DVI A;  1OZS A;  3CS1 A;  4MLW A;  4I5L B;  1X02 A;  2JNX A;  4ORB B;  5CSI A;  1AJ4 A;  5KTY A;  1MXL C;  3TDU A;  2LP2 A;  1J1D A;  4A4C A;  2MLE C;  1ZFS A;  2VRG A;  5HLO A;  1TCO B;  3OHM B;  1N2D A;  5PAL A;  1KSM A;  3CR5 X;  1NCZ A;  1PK0 D;  1NIW A;  1FW4 A;  1KFX L;  4UPG A;  2FCD A;  2M8U A;  2KQ6 A;  4C0L A;  2Q4U A;  2ZND A;  4F0Z B;  3EKJ A;  1BLQ A;  5AEQ A;  2BBM A;  2F3Z A;  3O4Y A;  5J3X A;  1WRK A;  4NQG A;  4USL A;  4AQI A;  2LNK A;  1DF0 B;  4MSP A;  2HQW A;  1M45 A;  3O6B A;  2HQ8 A;  1OZO A;  3PN7 C;  2L2E A;  1SKT A;  2WCE A;  2Y4Q A;  4FQO A;  1KK8 B;  2EC6 C;  1U5I A;  1ODB A;  4JWQ A;  1SCV A;  2KFH A;  2ZN9 A;  3DVM A;  1NPQ A;  1J55 A;  2LMT A;  2LCP A;  3VRQ A;  4I5J A;  2AMI A;  4ZCV A;  4YRU A;  2SCP A;  3AKA A;  1ALW A;  2KNE A;  1L2O C;  1QS7 A;  4N1F A;  1MHO A;  2M0R A;  3BUX B;  3TDI A;  1SY9 A;  2FOT A;  1V1F A;  1G4Y R;  2AUC A;  2E6W A;  1BG1 A;  4HRH A;  1B1G A;  2QPT A;  3VRR A;  1OSA A;  1AUI B;  2ZNE A;  3LL8 B;  3WNX B;  1ZUZ A;  1JFJ A;  3KEV A;  2KDH A;  4FTG A;  2NZ0 A;  3BUM B;  1JUO A;  3OB1 B;  2HF5 A;  3DVK A;  2F8P A;  2I94 A;  2KI4 C;  1AP4 A;  4GUK A;  5JJG A;  3D0Y B;  3CTN A;  2BL0 C;  3VRO A;  3BOW B;  1BR1 B;  1TN4 A;  4ORA B;  1F71 A;  1WY9 A;  3NSL A;  1M39 A;  3RLZ A;  2F3Y A;  4HSZ A;  1E8A A;  2CTN A;  2Y5I A;  1B47 A;  1CMF A;  2M29 A;  1TNX A;  1S6I A;  3I5H B;  4M2Q A;  1YX7 A;  5HKY A;  1GGZ A;  2Y1N A;  1F55 A;  2I18 A;  4XYN A;  1KCY A;  1XFW O;  3E3R A;  4WQ2 A;  4ZCU A;  5HYD A;  3DF0 B;  4QJ3 B;  3NXA A;  3SJS A;  1S6C A;  1Y1U A;  1MQ1 A;  2BE4 A;  5DKQ A;  4GGN A;  2HPS A;  1PAL A;  3I5G C;  3AAK A;  4PHN A;  2D8N A;  2G2B A;  4M2P A;  2I2R E;  2L98 A;  4A4B A;  4QJ4 B;  2COL B;  4PDZ A;  3PAT A;  3OX5 A;  1ZOT B;  1AJ5 A;  4YI8 A;  1H4B A;  2H61 A;  1S5G Z;  1S36 A;  3BXK A;  1J7Q A;  1EL4 A;  1TNP A;  4YGE B;  1JBA A;  2E30 A;  3JTD C;  1NCY A;  4GFT A;  3O78 A;  1XFU O;  2NXQ A;  3CGA A;  3PFV A;  4PHM A;  2MBX A;  3OB2 B;  4QJ5 B;  2M97 A;  5ER5 A;  3SG2 A;  4PHJ A;  3I5G B;  2L0P A;  1LIN A;  1NYA A;  2BKH B;  2K61 A;  1XFV O;  2OTG B;  3BYA A;  3TS5 C;  1RJV A;  2O60 A;  1K94 A;  1JFK A;  4E68 A;  1YUU A;  3C1V A;  1QLS A;  3OX6 A;  1OMR A;  4C0K A;  3WHT B;  4P5O E;  2KOT A;  2GV5 A;  1QV0 A;  2MA2 A;  1XFY O;  2M3W A;  1OE9 B;  1B8R A;  1IJ5 A;  4DUQ A;  1YRU B;  3CLN A;  2AAO A;  1YVH A;  1QLK A;  1SRA A;  2JOJ A;  1CLM A;  1KQM C;  1KFU S;  1QX7 A;  5I2O A;  1XA5 A;  5CSN A;  1N0Y A;  1BMO A;  2LLU A;  3FS7 A;  3IQQ A;  1S5G Y;  1EJ3 A;  1K8U A;  2LHL A;  1CFC A;  1CM4 A;  1TNW A;  4CFQ A;  2PRU A;  2JRF A;  1BOC A;  1DJW A;  1FBV A;  1CNP A;  1PVA A;  4MZL A;  4GAO A;  1RK9 A;  1UHN A;  2L50 A;  2MAZ A;  4YGB B;  1LXF C;  1DJY A;  2LVI A;  3AKB A;  3NSK A;  1QIV A;  2MHH A;  3BUW B;  1CM1 A;  2JZI A;  2BKI B;  1D1O A;  1A4P A;  3I5H C;  2LC5 A;  3JVT B;  2L4H A;  1GJY A;  4XJK B;  1YUT A;  1PVB A;  2JC2 A;  4AQJ A;  4PE4 A;  1XYD A;  1OMV A;  2M7N A;  2JWW A;  1Y1A A;  4ICB A;  2FJU B;  3ZWH A;  3I5F C;  1Q80 A;  2BL0 B;  1SR6 B;  1DJH A;  2BCB A;  1MXE A;  4PE1 A;  1B8C A;  2ZRT A;  2CNP A;  1FI5 A;  3EK4 A;  1YTZ C;  4AOM A;  1HT9 A;  1FI6 A;  3TZ1 A;  1A75 B;  2KFG A;  2LE9 B;  4M2O A;  2JPT A;  1NUB A;  1YR5 A;  4I5N B;  3KO0 A;  1QXP A;  1DT7 B;  1FPW A;  4YBH B;  1SW8 A;  4U8D A;  3IF7 A;  2KI6 C;  1OOJ A;  1UHI A;  2WOR A;  1WLM A;  4DS7 A;  4TNC A;  5AAN A;  1YUS A;  2L5X B;  4N1G A;  1K90 D;  1UWO A;  1CDN A;  2LMU A;  4DIR A;  3EK8 A;  2CT9 A;  1M46 A;  1XFZ O;  1SCM B;  1F4O A;  4D1E A;  3LLE A;  4YGA A;  1SBJ A;  3I5F B;  1DJI A;  1SR6 C;  5BPJ A;  1NX1 A;  1QX5 B;  2M1U A;  1REC A;  2I7A A;  1J7P A;  2QAC A;  1L2O B;  2KBM A;  2P6B B;  1EXR A;  4OVN F;  5AXI A;  1SNL A;  2WCB A;  1KSO A;  2TN4 A;  5F6T A;  2PAS A;  4HRE E;  3SG5 A;  4CLN A;  4MEW A;  2WCF A;  3K21 A;  5I2L A;  3BQ3 A;  1L7Z A;  1UHJ A;  2LUX A;  3DD4 A;  3ICB A;  1RRO A;  1B9A A;  1BU3 A;  1UUS A;  1QJT A;  2M7L A;  1KWO B;  1MR8 A;  3FIA A;  1XVJ A;  2K7O A;  2ZKM X;  2L51 A;  2Y1M A;  1IGV A;  1BJF A;  1KWO C;  1NX3 A;  4MZJ A;  1DMO A;  4MN0 A;  1A03 A;  2K2A A;  5KU1 A;  1C07 A;  2KYC A;  2MJW B;  5HKZ A;  1DJG A;  5JOL A;  3TS5 B;  4MBE A;  1SL9 A;  4CPV A;  3DVE A;  1K96 A;  2CXJ A;  3MSE B;  1K9P A;  1K93 D;  3EVR A;  2K2F A;  1W7J B;  1ZAC A;  1TTX A;  1QV1 A;  2K8M B;  1KK7 Z;  2KHN A;  3I5I C;  2KAY A;  3ZNI A;  1Y1X A;  3CR4 X;  1KQV A;  3I5I B;  2F2P A;  2EC6 B;  1DGV A;  5CSF A;  3VRN A;  1NSH A;  1Y6W A;  5ER4 X;  2JU0 A;  1CDP A;  1SCM C;  3GOF A;  2LAN A;  1KK8 C;  4WQ3 A;  2PVB A;  1B8L A;  3CR2 A;  1PUL A;  1KK7 Y;  2OTG C;  3KF9 A;  3EVV A;  2IS9 A;  3KPX A;  1F70 A;  1SPY A;  1JSA A;  4ORC B;  3VGO A;  4OKH A;  1DF0 A;  1WRL A;  1IWQ A;  2LLT A;  3SG3 A;  2F2O A;  1C7W A;  1J7R A;  4CFR A;  4ETO A;  2K7B A;  2BE6 A;  2KQY A;  1WDC B;  2CCM A;  1SK6 D;  4PHK A;  4I5K A;  1NWD A;  4IL1 A;  1U5I B;  1UHK A;  2KFF A; 
#chains in the Genus database with same CATH topology
 3NSO A;  3RM1 A;  1IQ3 A;  3VRP A;  2B1U A;  2H61 C;  3DXL A;  5I8N A;  1CTR A;  4MZK A;  5D69 A;  1C7V A;  1PSR A;  2WND A;  2ZRS A;  1SYM A;  3QRX A;  1SL8 A;  4L9M A;  3PSR A;  2QEH A;  2EHB A;  2M49 B;  5GQQ C;  1QTX A;  2JUL A;  2O5G A;  3S0D A;  2KLE A;  2FJY A;  2BCX A;  1FF1 A;  2KI4 B;  1BR4 B;  1V1G A;  2WOS A;  1RFJ A;  1LA3 A;  3PAL A;  4IJ7 A;  1IKU A;  5FYX A;  5DKN A;  1DQE A;  2A4J A;  1OMD A;  5G08 A;  4BY4 A;  3S0A A;  1MF8 B;  4PCW A;  1LA0 A;  1R6P A;  2KYF A;  2MRD A;  1RWY A;  2BBN A;  1K95 A;  3HX4 A;  3CZ0 A;  1A2X A;  1MWN A;  3DVJ A;  4GBA A;  3UNW A;  1JWD A;  3R1O A;  4JD9 A;  1TWO A;  3CZT X;  5K89 A;  1B7T Z;  3CWG A;  1K2H A;  1QAT A;  2H2K A;  2LVK A;  2GGM A;  2LVJ A;  1UP5 A;  3GK4 X;  4OR9 B;  2ISD A;  1B4C A;  3V2L A;  1PSB A;  1N65 A;  3D0Y A;  5AER A;  3D77 A;  2GTE A;  3LK0 A;  2LHI A;  1XK4 A;  3BOW A;  3BUN B;  3DZT A;  2PSR A;  3PM2 A;  2NCP A;  1OOI X;  3A8R A;  1G33 A;  1CKK A;  1XK4 C;  1AHR A;  1AK8 A;  5TNC A;  1NCX A;  3EK7 A;  3OBV A;  3NSI A;  3B86 A;  4MRX A;  5HKW A;  1Z4H A;  2JXL A;  5EL2 A;  3R72 A;  1MUX A;  1PRW A;  1RTP 1;  1TCF A;  2WCL A;  2WCJ A;  3NGV A;  2LUC A;  5FI2 A;  4GPL B;  3SG6 A;  1DJZ A;  3LK1 A;  1M31 A;  5AFP A;  1TNQ A;  2KLD A;  2RGI A;  2F33 A;  2LMV A;  3NHI A;  4OV2 A;  1XFX O;  1F54 A;  1IH0 A;  2HET A;  1P28 A;  1WRZ A;  2LVV A;  1LVC D;  2ZN8 A;  3DF0 A;  4YI9 A;  5HLV A;  3BUO B;  1YRT B;  3TDZ A;  2LAP A;  3JTD B;  2PMY A;  1J1E A;  2NCO A;  2JT3 A;  2R2I A;  2WC8 A;  2M9G A;  1QX2 A;  2JQ6 A;  3M0W A;  4NDD A;  5DKR A;  1KQM B;  3H4S E;  3SS5 A;  4PE7 A;  2PAL A;  1B7T Y;  3PM8 A;  4WRI A;  2M1K B;  2H8V A;  3SG4 A;  2Q91 A;  4C0J A;  1EG3 A;  3F45 A;  4YGC B;  1IJ6 A;  1NP8 A;  2KI6 D;  1TIZ A;  1Y0V H;  1YVL A;  3PLF B;  4GGF A;  4DCK A;  1UUR A;  1WDC C;  1IQ5 A;  1YX8 A;  2BAP A;  4NDC A;  2LM5 A;  3SG7 A;  1R2U A;  1S6J A;  3TUY B;  4GNK B;  3FWB A;  4NDB A;  3PN7 B;  2OS8 C;  3TUY C;  1CB1 A;  1F4Q A;  4P2Y B;  2OS8 B;  5DIC A;  4CID A;  1S3P A;  1NX2 A;  1SL7 A;  2EGD A;  4DRW A;  1JF2 A;  1A29 A;  2KGR A;  3GK2 A;  1LKJ A;  1XO5 A;  2K7C A;  5KSZ A;  5B8I B;  1IG5 A;  3EVU A;  5D7F A;  2KGB C;  1ZMZ A;  1DTL A;  1QVI Z;  2KSP A;  1CLL A;  1S1E A;  2YGU A;  4JPZ B;  3IQO A;  1CFP A;  2JTZ A;  3A4U B;  2L4I A;  2JTT A;  2OPO A;  1CFF A;  4YGD B;  1K9U A;  1NX0 A;  4MRY A;  1A75 A;  1WLZ A;  2P70 A;  1G8I A;  2K0J A;  1ALV A;  1H8B A;  3OP0 A;  2JT0 A;  2KBI A;  1JF0 A;  3FE6 A;  2G9B A;  1CDM A;  4Q04 A;  1UHH A;  4OCI A;  2NLN A;  5CSJ A;  2JNF A;  3DYE A;  4MVF A;  3B7A A;  2LP3 A;  3LCP C;  3B6X A;  5IBW A;  4PAL A;  4PE0 A;  1BF5 A;  1EG4 A;  1AVS A;  1OW4 A;  2K7D A;  3KHE A;  1VRK A;  3R1V A;  1BOD A;  1SMG A;  3D78 A;  4JQ0 D;  2FCE A;  1QVI Y;  4HRG A;  1DGU A;  1M63 B;  2L5Y A;  3SIA A;  1J7O A;  4GGF C;  2WC6 A;  1QIW A;  1KFU L;  4R1E A;  1TRF A;  1YUR A;  4XJK A;  2SAS A;  2LV7 A;  2GGZ A;  3WXA A;  1QWV A;  2ZFD A;  1OQP A;  4BY5 A;  2BEC A;  1CMG A;  2V53 A;  1GGW A;  1F8H A;  3EKH A;  3HCM A;  2KAV A;  2KAX A;  3JVT C;  1GQM A;  2BCA A;  2QEB A;  1HQV A;  2LLS A;  2JT8 A;  1IRJ A;  1W7I B;  3WNX B;  1CLB A;  2DOQ A;  3WHU B;  1DJX A;  1K9K A;  1TOP A;  3O2P A;  1QAS A;  1EH2 A;  2MLF C;  5HL1 A;  2CBL A;  3FWC A;  2JXC A;  2ERB A;  1CDL A;  5CPV A;  1CFD A;  2QEO A;  3AAJ A;  3S0E A;  1BT6 A;  1S26 D;  3D10 A;  3GK1 A;  1JC2 A;  4PT1 A;  4N5X A;  3SIB A;  1KFX S;  3SS3 A;  5I2Q A;  1DVI A;  1OZS A;  3CS1 A;  4KYN A;  4MLW A;  4I5L B;  1X02 A;  2JNX A;  3B88 A;  4ORB B;  5CSI A;  1AJ4 A;  5KTY A;  1MXL C;  3TDU A;  3UO9 A;  2LP2 A;  1J1D A;  4A4C A;  4FQT A;  2MLE C;  1ZFS A;  2VRG A;  2P71 A;  1TUZ A;  5HLO A;  1TCO B;  3OHM B;  5FI7 A;  1N2D A;  5PAL A;  1KSM A;  3CR5 X;  1NCZ A;  1PK0 D;  3BFB A;  1NIW A;  1FW4 A;  1KFX L;  4UPG A;  2FCD A;  2L2C A;  2M8U A;  1LS8 A;  2KQ6 A;  3L4L A;  4C0L A;  2Q4U A;  3CZ1 A;  2ZND A;  1DEL A;  4F0Z B;  3EKJ A;  1BLQ A;  5AEQ A;  2BBM A;  2F3Z A;  3D76 A;  3N7H A;  3O4Y A;  5J3X A;  1WRK A;  4NQG A;  4USL A;  4AQI A;  2LNK A;  1DF0 B;  4MSP A;  2HQW A;  1M45 A;  3O6B A;  2HQ8 A;  1OZO A;  3PN7 C;  2L2E A;  1SKT A;  2WCE A;  2Y4Q A;  4FQO A;  3S0G A;  1KK8 B;  3K1E A;  2EC6 C;  1U5I A;  1ODB A;  4JWQ A;  1SCV A;  2KFH A;  2ZN9 A;  3DVM A;  2WCK A;  1NPQ A;  1J55 A;  2LMT A;  2LCP A;  3VRQ A;  4I5J A;  3L4A A;  2AMI A;  4ZCV A;  4YRU A;  2SCP A;  3AKA A;  1ALW A;  2KNE A;  3QME A;  1L2O C;  1QS7 A;  4N1F A;  1MHO A;  2M0R A;  3BUX B;  3TDI A;  1SY9 A;  2FOT A;  1V1F A;  1G4Y R;  2AUC A;  3SS4 A;  2E6W A;  1BG1 A;  4HRH A;  1B1G A;  3O4X A;  2QPT A;  3VRR A;  1OSA A;  1AUI B;  2ZNE A;  3CYZ A;  3LL8 B;  1ZUZ A;  4OZD A;  3KEV A;  2KDH A;  1JFJ A;  4FTG A;  2NZ0 A;  3BUM B;  1JUO A;  3OB1 B;  2PQL A;  3S0F A;  2HF5 A;  3RZS A;  3D74 A;  3DVK A;  2F8P A;  2I94 A;  2KPH A;  2KI4 C;  1AP4 A;  4GUK A;  5JJG A;  3D0Y B;  3CTN A;  2BL0 C;  3VRO A;  3BOW B;  1BR1 B;  1TN4 A;  4ORA B;  1F71 A;  1OOF A;  1WY9 A;  3NSL A;  1M39 A;  3RLZ A;  2F3Y A;  4HSZ A;  1E8A A;  2CTN A;  2Y5I A;  1B47 A;  4F7F A;  2M29 A;  1CMF A;  1TNX A;  1S6I A;  1C3Y A;  3I5H B;  5D3O A;  4M2Q A;  1OOG A;  1YX7 A;  1SSE B;  2WCM A;  5HKY A;  1GGZ A;  2Y1N A;  2WC5 A;  1F55 A;  2I18 A;  4XYN A;  3Q8I A;  1KCY A;  1XFW O;  3E3R A;  4WQ2 A;  4ZCU A;  5HYD A;  3DF0 B;  2JPO A;  4QJ3 B;  3NXA A;  3SJS A;  1S6C A;  1Y1U A;  1MQ1 A;  2BE4 A;  5DKQ A;  4GGN A;  2HPS A;  1PAL A;  3I5G C;  3AAK A;  4PHN A;  2D8N A;  2G2B A;  4M2P A;  2I2R E;  3B87 A;  2L98 A;  3L47 A;  4A4B A;  4QJ4 B;  2QDI A;  2COL B;  4PDZ A;  1DC1 A;  3PAT A;  3BFA A;  3OX5 A;  1C3Z A;  1IIO A;  1ZOT B;  1AJ5 A;  4YI8 A;  1H4B A;  2H61 A;  1S5G Z;  1S36 A;  3BXK A;  1J7Q A;  1EL4 A;  1TNP A;  3R1P A;  4YGE B;  1JBA A;  2E30 A;  3JTD C;  1NCY A;  4GFT A;  3O78 A;  1XFU O;  2NXQ A;  3CGA A;  3PFV A;  4PHM A;  2MBX A;  3OB2 B;  2K60 A;  4QJ5 B;  2M97 A;  5ER5 A;  3SG2 A;  4PHJ A;  3I5G B;  2L0P A;  1LIN A;  1NYA A;  2BKH B;  2K61 A;  1XFV O;  2OTG B;  3BYA A;  3TS5 C;  1RJV A;  2O60 A;  1K94 A;  1JFK A;  4E68 A;  1YUU A;  3C1V A;  1QLS A;  3OX6 A;  1OMR A;  4C0K A;  3WHT B;  4P5O E;  2KOT A;  2GV5 A;  3CAB A;  1QV0 A;  2MA2 A;  1XFY O;  2M3W A;  3FE9 A;  1OE9 B;  1B8R A;  1IJ5 A;  4DUQ A;  1YRU B;  3CLN A;  2AAO A;  1YVH A;  1QLK A;  1SRA A;  2JOJ A;  1CLM A;  1KQM C;  3PJI A;  1KFU S;  1QX7 A;  5I2O A;  1XA5 A;  5CSN A;  1N0Y A;  1BMO A;  2LLU A;  3FS7 A;  2WCH A;  3NHT A;  3IQQ A;  1S5G Y;  1EJ3 A;  1K8U A;  2LHL A;  1CFC A;  1CM4 A;  1TNW A;  4CFQ A;  2PRU A;  2JRF A;  1BOC A;  1DJW A;  1FBV A;  1CNP A;  1PVA A;  4MZL A;  4GAO A;  1RK9 A;  1UHN A;  2L50 A;  2MAZ A;  4YGB B;  1LXF C;  1DJY A;  2LVI A;  3AKB A;  1TUJ A;  1QIV A;  2MHH A;  3NSK A;  5FI6 A;  3BUW B;  1CM1 A;  2JZI A;  2BKI B;  1D1O A;  1A4P A;  2BNX A;  3I5H C;  2LC5 A;  1W9Z A;  3DY9 A;  2L4H A;  1GJY A;  3BJH A;  3JVT B;  4XJK B;  1YUT A;  1PVB A;  4JKT A;  2JC2 A;  4AQJ A;  4PE4 A;  1XYD A;  1OMV A;  2M7N A;  3EG5 B;  2JWW A;  1Y1A A;  4ICB A;  4INX A;  2FJU B;  3ZWH A;  3I5F C;  1Q80 A;  2BL0 B;  1SR6 B;  1DJH A;  2BCB A;  1MXE A;  4PE1 A;  1B8C A;  1T14 A;  2CNP A;  2ZRT A;  1FI5 A;  3EK4 A;  1YTZ C;  4AOM A;  1HT9 A;  1FI6 A;  3TZ1 A;  1A75 B;  2KFG A;  3OGN A;  2LE9 B;  1Z2C B;  5I94 A;  4M2O A;  2JPT A;  1NUB A;  1YR5 A;  4I5N B;  3KO0 A;  1QXP A;  1DT7 B;  1FPW A;  3CZ2 A;  4YBH B;  1SW8 A;  4U8D A;  3IF7 A;  2KI6 C;  1OOJ A;  1UHI A;  2PYQ A;  1WLM A;  2WOR A;  4TNC A;  5AAN A;  4DS7 A;  1YUS A;  2L5X B;  4N1G A;  1K90 D;  1UWO A;  1CDN A;  2LMU A;  4DIR A;  1OOH A;  3EK8 A;  2CT9 A;  1M46 A;  1XFZ O;  1DEK A;  1SCM B;  1F4O A;  4D1E A;  3LLE A;  4YGA A;  1SBJ A;  3I5F B;  1DJI A;  1SR6 C;  5BPJ A;  1NX1 A;  1QX5 B;  2M1U A;  1REC A;  2I7A A;  1J7P A;  2QAC A;  1L2O B;  2KBM A;  2P6B B;  1EXR A;  4OVN F;  5AXI A;  1SNL A;  2WCB A;  1KSO A;  2TN4 A;  5F6T A;  2PAS A;  3CDN A;  4HRE E;  3SG5 A;  4CLN A;  4MEW A;  2WCF A;  3K21 A;  5I2L A;  3BQ3 A;  1L7Z A;  1UHJ A;  2LUX A;  3DD4 A;  3ICB A;  1RRO A;  1B9A A;  1BU3 A;  1UUS A;  1QJT A;  2M7L A;  1KWO B;  1MR8 A;  3FIA A;  1XVJ A;  2K7O A;  2ZKM X;  2L51 A;  2Y1M A;  1IGV A;  1BJF A;  1KWO C;  1NX3 A;  4MZJ A;  1DMO A;  4MN0 A;  1A03 A;  2K2A A;  5KU1 A;  1C07 A;  2KYC A;  2MJW B;  5HKZ A;  1DJG A;  5JOL A;  3TS5 B;  4INW A;  4MBE A;  1SL9 A;  4CPV A;  1ORG A;  3DVE A;  1K96 A;  2CXJ A;  3D73 A;  3MSE B;  2QEV A;  1K9P A;  1K93 D;  3EVR A;  2K2F A;  1W7J B;  3FE8 A;  1ZAC A;  1TTX A;  1QV1 A;  2K8M B;  1KK7 Z;  2KHN A;  3I5I C;  3S0B A;  2KAY A;  3VB1 A;  3ZNI A;  1Y1X A;  1XFR A;  3CR4 X;  3I5I B;  2F2P A;  1KQV A;  2EC6 B;  1DGV A;  5CSF A;  3VRN A;  1NSH A;  1Y6W A;  5ER4 X;  2JU0 A;  1CDP A;  1SCM C;  3GOF A;  2LAN A;  1KK8 C;  1GM0 A;  4WQ3 A;  2PVB A;  1B8L A;  3CR2 A;  3D75 A;  1PUL A;  1KK7 Y;  2OTG C;  3KF9 A;  3EVV A;  2IS9 A;  3KPX A;  1F70 A;  1SPY A;  1JSA A;  4ORC B;  3VGO A;  4OKH A;  1DF0 A;  1WRL A;  1IWQ A;  2LLT A;  3SG3 A;  2F2O A;  1C7W A;  1J7R A;  3IVT A;  4CFR A;  4ETO A;  2K7B A;  2BE6 A;  2KQY A;  1WDC B;  2CCM A;  1SK6 D;  3BFH A;  4PHK A;  4I5K A;  1NWD A;  4IL1 A;  1U5I B;  1UHK A;  2KFF A; 
#chains in the Genus database with same CATH homology
 3NSO A;  3RM1 A;  1IQ3 A;  3VRP A;  2B1U A;  2H61 C;  5I8N A;  1CTR A;  4MZK A;  5D69 A;  1C7V A;  1PSR A;  2WND A;  2ZRS A;  1SYM A;  3QRX A;  1SL8 A;  4L9M A;  3PSR A;  2EHB A;  2M49 B;  5GQQ C;  1QTX A;  2JUL A;  2O5G A;  2BCX A;  1FF1 A;  2KI4 B;  1BR4 B;  1V1G A;  2WOS A;  1RFJ A;  1LA3 A;  3PAL A;  1IKU A;  5FYX A;  5DKN A;  2A4J A;  4BY4 A;  1OMD A;  5G08 A;  1MF8 B;  4PCW A;  1LA0 A;  1R6P A;  2KYF A;  2MRD A;  1RWY A;  2BBN A;  1K95 A;  3HX4 A;  1A2X A;  1MWN A;  3DVJ A;  4GBA A;  1JWD A;  3CZT X;  5K89 A;  1B7T Z;  3CWG A;  1K2H A;  1QAT A;  2H2K A;  2LVK A;  2GGM A;  2LVJ A;  1UP5 A;  3GK4 X;  4OR9 B;  2ISD A;  1B4C A;  1PSB A;  1N65 A;  3D0Y A;  5AER A;  3LK0 A;  2LHI A;  1XK4 A;  3BOW A;  3BUN B;  2PSR A;  2NCP A;  3A8R A;  1G33 A;  1CKK A;  1XK4 C;  1AHR A;  1AK8 A;  5TNC A;  1NCX A;  3EK7 A;  3NSI A;  4MRX A;  5HKW A;  2JXL A;  1MUX A;  1PRW A;  1RTP 1;  1TCF A;  2LUC A;  3SG6 A;  4GPL B;  1DJZ A;  3LK1 A;  1M31 A;  5AFP A;  1TNQ A;  2RGI A;  2F33 A;  2LMV A;  4OV2 A;  1XFX O;  1F54 A;  1IH0 A;  2HET A;  2LVV A;  1WRZ A;  2ZN8 A;  1LVC D;  3DF0 A;  4YI9 A;  5HLV A;  3BUO B;  1YRT B;  3TDZ A;  2LAP A;  3JTD B;  2PMY A;  1J1E A;  2NCO A;  2JT3 A;  2R2I A;  2WC8 A;  2M9G A;  1QX2 A;  2JQ6 A;  3M0W A;  4NDD A;  5DKR A;  1KQM B;  3H4S E;  4PE7 A;  2PAL A;  1B7T Y;  3PM8 A;  4WRI A;  2M1K B;  3SG4 A;  2Q91 A;  4C0J A;  1EG3 A;  3F45 A;  4YGC B;  1IJ6 A;  1NP8 A;  2KI6 D;  1TIZ A;  1Y0V H;  1YVL A;  3PLF B;  4GGF A;  4DCK A;  1UUR A;  1WDC C;  1IQ5 A;  1YX8 A;  4NDC A;  3TUY B;  2LM5 A;  3SG7 A;  1R2U A;  1S6J A;  4GNK B;  3FWB A;  4NDB A;  3PN7 B;  2OS8 C;  3TUY C;  1CB1 A;  1F4Q A;  4P2Y B;  2OS8 B;  4CID A;  1S3P A;  1NX2 A;  1SL7 A;  2EGD A;  4DRW A;  1JF2 A;  1A29 A;  2KGR A;  3GK2 A;  1LKJ A;  1XO5 A;  2K7C A;  5KSZ A;  5B8I B;  1IG5 A;  3EVU A;  5D7F A;  2KGB C;  1ZMZ A;  1DTL A;  1QVI Z;  2KSP A;  1CLL A;  1S1E A;  4JPZ B;  1CFP A;  3IQO A;  2JTZ A;  3A4U B;  2L4I A;  2JTT A;  2OPO A;  1CFF A;  4YGD B;  1K9U A;  1NX0 A;  4MRY A;  1A75 A;  1WLZ A;  1G8I A;  2K0J A;  1ALV A;  1H8B A;  3OP0 A;  2JT0 A;  2KBI A;  1JF0 A;  2G9B A;  1CDM A;  4Q04 A;  1UHH A;  4OCI A;  2NLN A;  5CSJ A;  2JNF A;  4MVF A;  2LP3 A;  3LCP C;  5IBW A;  4PAL A;  4PE0 A;  1BF5 A;  1EG4 A;  1AVS A;  2K7D A;  3KHE A;  1VRK A;  1BOD A;  1SMG A;  4JQ0 D;  2FCE A;  1QVI Y;  4HRG A;  1DGU A;  1M63 B;  3SIA A;  1J7O A;  4GGF C;  1QIW A;  1KFU L;  4R1E A;  1TRF A;  1YUR A;  4XJK A;  2SAS A;  2LV7 A;  2GGZ A;  3WXA A;  2ZFD A;  1OQP A;  4BY5 A;  2BEC A;  1CMG A;  2V53 A;  1GGW A;  1F8H A;  3EKH A;  3HCM A;  2KAV A;  2KAX A;  3JVT C;  1GQM A;  2BCA A;  1HQV A;  2LLS A;  2JT8 A;  1IRJ A;  1W7I B;  1CLB A;  2DOQ A;  3WHU B;  1DJX A;  1K9K A;  1TOP A;  3O2P A;  1QAS A;  1EH2 A;  2MLF C;  2CBL A;  3FWC A;  2JXC A;  1CDL A;  5CPV A;  1CFD A;  3AAJ A;  1JC2 A;  1BT6 A;  1S26 D;  3D10 A;  3GK1 A;  4N5X A;  3SIB A;  1KFX S;  5I2Q A;  1DVI A;  1OZS A;  3CS1 A;  4MLW A;  4I5L B;  1X02 A;  2JNX A;  4ORB B;  5CSI A;  1AJ4 A;  5KTY A;  1MXL C;  3TDU A;  2LP2 A;  1J1D A;  4A4C A;  2MLE C;  1ZFS A;  2VRG A;  5HLO A;  1TCO B;  3OHM B;  1N2D A;  5PAL A;  1KSM A;  3CR5 X;  1NCZ A;  1PK0 D;  1NIW A;  1FW4 A;  1KFX L;  4UPG A;  2FCD A;  2M8U A;  2KQ6 A;  4C0L A;  2Q4U A;  2ZND A;  4F0Z B;  3EKJ A;  1BLQ A;  5AEQ A;  2BBM A;  2F3Z A;  3O4Y A;  5J3X A;  1WRK A;  4NQG A;  4USL A;  4AQI A;  2LNK A;  1DF0 B;  4MSP A;  2HQW A;  1M45 A;  3O6B A;  2HQ8 A;  1OZO A;  3PN7 C;  2L2E A;  1SKT A;  2WCE A;  2Y4Q A;  4FQO A;  1KK8 B;  2EC6 C;  1U5I A;  1ODB A;  4JWQ A;  1SCV A;  2KFH A;  2ZN9 A;  3DVM A;  1NPQ A;  1J55 A;  2LMT A;  2LCP A;  3VRQ A;  4I5J A;  2AMI A;  4ZCV A;  4YRU A;  2SCP A;  3AKA A;  1ALW A;  2KNE A;  1L2O C;  1QS7 A;  4N1F A;  1MHO A;  2M0R A;  3BUX B;  3TDI A;  1SY9 A;  2FOT A;  1V1F A;  1G4Y R;  2AUC A;  2E6W A;  1BG1 A;  4HRH A;  1B1G A;  2QPT A;  3VRR A;  1OSA A;  1AUI B;  2ZNE A;  3LL8 B;  3WNX B;  1ZUZ A;  1JFJ A;  3KEV A;  2KDH A;  4FTG A;  2NZ0 A;  3BUM B;  1JUO A;  3OB1 B;  2HF5 A;  3DVK A;  2F8P A;  2I94 A;  2KI4 C;  1AP4 A;  4GUK A;  5JJG A;  3D0Y B;  3CTN A;  2BL0 C;  3VRO A;  3BOW B;  1BR1 B;  1TN4 A;  4ORA B;  1F71 A;  1WY9 A;  3NSL A;  1M39 A;  3RLZ A;  2F3Y A;  4HSZ A;  1E8A A;  2CTN A;  2Y5I A;  1B47 A;  1CMF A;  2M29 A;  1TNX A;  1S6I A;  3I5H B;  4M2Q A;  1YX7 A;  5HKY A;  1GGZ A;  2Y1N A;  1F55 A;  2I18 A;  4XYN A;  1KCY A;  1XFW O;  3E3R A;  4WQ2 A;  4ZCU A;  5HYD A;  3DF0 B;  4QJ3 B;  3NXA A;  3SJS A;  1S6C A;  1Y1U A;  1MQ1 A;  2BE4 A;  5DKQ A;  4GGN A;  2HPS A;  1PAL A;  3I5G C;  3AAK A;  4PHN A;  2D8N A;  2G2B A;  4M2P A;  2I2R E;  2L98 A;  4A4B A;  4QJ4 B;  2COL B;  4PDZ A;  3PAT A;  3OX5 A;  1ZOT B;  1AJ5 A;  4YI8 A;  1H4B A;  2H61 A;  1S5G Z;  1S36 A;  3BXK A;  1J7Q A;  1EL4 A;  1TNP A;  4YGE B;  1JBA A;  2E30 A;  3JTD C;  1NCY A;  4GFT A;  3O78 A;  1XFU O;  2NXQ A;  3CGA A;  3PFV A;  4PHM A;  2MBX A;  3OB2 B;  4QJ5 B;  2M97 A;  5ER5 A;  3SG2 A;  4PHJ A;  3I5G B;  2L0P A;  1LIN A;  1NYA A;  2BKH B;  2K61 A;  1XFV O;  2OTG B;  3BYA A;  3TS5 C;  1RJV A;  2O60 A;  1K94 A;  1JFK A;  4E68 A;  1YUU A;  3C1V A;  1QLS A;  3OX6 A;  1OMR A;  4C0K A;  3WHT B;  4P5O E;  2KOT A;  2GV5 A;  1QV0 A;  2MA2 A;  1XFY O;  2M3W A;  1OE9 B;  1B8R A;  1IJ5 A;  4DUQ A;  1YRU B;  3CLN A;  2AAO A;  1YVH A;  1QLK A;  1SRA A;  2JOJ A;  1CLM A;  1KQM C;  1KFU S;  1QX7 A;  5I2O A;  1XA5 A;  5CSN A;  1N0Y A;  1BMO A;  2LLU A;  3FS7 A;  3IQQ A;  1S5G Y;  1EJ3 A;  1K8U A;  2LHL A;  1CFC A;  1CM4 A;  1TNW A;  4CFQ A;  2PRU A;  2JRF A;  1BOC A;  1DJW A;  1FBV A;  1CNP A;  1PVA A;  4MZL A;  4GAO A;  1RK9 A;  1UHN A;  2L50 A;  2MAZ A;  4YGB B;  1LXF C;  1DJY A;  2LVI A;  3AKB A;  3NSK A;  1QIV A;  2MHH A;  3BUW B;  1CM1 A;  2JZI A;  2BKI B;  1D1O A;  1A4P A;  3I5H C;  2LC5 A;  3JVT B;  2L4H A;  1GJY A;  4XJK B;  1YUT A;  1PVB A;  2JC2 A;  4AQJ A;  4PE4 A;  1XYD A;  1OMV A;  2M7N A;  2JWW A;  1Y1A A;  4ICB A;  2FJU B;  3ZWH A;  3I5F C;  1Q80 A;  2BL0 B;  1SR6 B;  1DJH A;  2BCB A;  1MXE A;  4PE1 A;  1B8C A;  2ZRT A;  2CNP A;  1FI5 A;  3EK4 A;  1YTZ C;  4AOM A;  1HT9 A;  1FI6 A;  3TZ1 A;  1A75 B;  2KFG A;  2LE9 B;  4M2O A;  2JPT A;  1NUB A;  1YR5 A;  4I5N B;  3KO0 A;  1QXP A;  1DT7 B;  1FPW A;  4YBH B;  1SW8 A;  4U8D A;  3IF7 A;  2KI6 C;  1OOJ A;  1UHI A;  2WOR A;  1WLM A;  4DS7 A;  4TNC A;  5AAN A;  1YUS A;  2L5X B;  4N1G A;  1K90 D;  1UWO A;  1CDN A;  2LMU A;  4DIR A;  3EK8 A;  2CT9 A;  1M46 A;  1XFZ O;  1SCM B;  1F4O A;  4D1E A;  3LLE A;  4YGA A;  1SBJ A;  3I5F B;  1DJI A;  1SR6 C;  5BPJ A;  1NX1 A;  1QX5 B;  2M1U A;  1REC A;  2I7A A;  1J7P A;  2QAC A;  1L2O B;  2KBM A;  2P6B B;  1EXR A;  4OVN F;  5AXI A;  1SNL A;  2WCB A;  1KSO A;  2TN4 A;  5F6T A;  2PAS A;  4HRE E;  3SG5 A;  4CLN A;  4MEW A;  2WCF A;  3K21 A;  5I2L A;  3BQ3 A;  1L7Z A;  1UHJ A;  2LUX A;  3DD4 A;  3ICB A;  1RRO A;  1B9A A;  1BU3 A;  1UUS A;  1QJT A;  2M7L A;  1KWO B;  1MR8 A;  3FIA A;  1XVJ A;  2K7O A;  2ZKM X;  2L51 A;  2Y1M A;  1IGV A;  1BJF A;  1KWO C;  1NX3 A;  4MZJ A;  1DMO A;  4MN0 A;  1A03 A;  2K2A A;  5KU1 A;  1C07 A;  2KYC A;  2MJW B;  5HKZ A;  1DJG A;  5JOL A;  3TS5 B;  4MBE A;  1SL9 A;  4CPV A;  3DVE A;  1K96 A;  2CXJ A;  3MSE B;  1K9P A;  1K93 D;  3EVR A;  2K2F A;  1W7J B;  1ZAC A;  1TTX A;  1QV1 A;  2K8M B;  1KK7 Z;  2KHN A;  3I5I C;  2KAY A;  3ZNI A;  1Y1X A;  3CR4 X;  1KQV A;  3I5I B;  2F2P A;  2EC6 B;  1DGV A;  5CSF A;  3VRN A;  1NSH A;  1Y6W A;  5ER4 X;  2JU0 A;  1CDP A;  1SCM C;  3GOF A;  2LAN A;  1KK8 C;  4WQ3 A;  2PVB A;  1B8L A;  3CR2 A;  1PUL A;  1KK7 Y;  2OTG C;  3KF9 A;  3EVV A;  2IS9 A;  3KPX A;  1F70 A;  1SPY A;  1JSA A;  4ORC B;  3VGO A;  4OKH A;  1DF0 A;  1WRL A;  1IWQ A;  2LLT A;  3SG3 A;  2F2O A;  1C7W A;  1J7R A;  4CFR A;  4ETO A;  2K7B A;  2BE6 A;  2KQY A;  1WDC B;  2CCM A;  1SK6 D;  4PHK A;  4I5K A;  1NWD A;  4IL1 A;  1U5I B;  1UHK A;  2KFF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...