2MRDA

Solution structure of human ca2+-loaded s100a4 cys-free mutant
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
101
structure length
101
Chain Sequence
MASPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYSVFLSSIAMMSNEFFEGFPDKQPRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A4
publication title The solution structure of human calcium-bound S100A4 mutated at four cysteine loci
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 37
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2mrdA00
2FOTA 3OP0A 1DTLA 2LHLA 1NCXA 1KSOA 1XVJA 2JTZA 1CNPA 1TRFA 1LVCD 2BCXA 1SNLA 2PSRA 4WRIA 3GK2A 5CSIA 3KPXA 1AUIB 2BCAA 1NSHA 1RK9A 1ODBA 4R1EA 4U8DA 1F4OA 2K7BA 5ER5A 2ZFDA 4NDDA 3O2PA 4GBAA 1EL4A 3PN7C 4FTGA 4M2PA 1SL9A 2O60A 1ALWA 1KQMC 3AKAA 1JFJA 2PMYA 1F8HA 1MR8A 1MF8B 1CDMA 2K2FA 1UHNA 1XK4C 2BBMA 1QV0A 3TDZA 4HSZA 2KSPA 3M0WA 1AVSA 5HKYA 5AXIA 5K89A 4Q04A 1S36A 1OMVA 3RM1A 1Y6WA 4E68A 1DJGA 3LLEA 4ZCVA 4MSPA 2KNEA 2KBIA 4ORCB 2M7LA 2LNKA 5B8IB 1DMOA 1WRLA 4MRXA 2JC2A 3PFVA 2KGRA 3FS7A 1S3PA 3JVTB 1CDPA 1QX7A 1DF0B 5BPJA 3LK0A 1QIWA 4PDZA 1DGVA 4N1GA 2NLNA 1WRZA 2JRFA 2BKHB 3OB2B 3GOFA 1EG3A 5KU1A 2WC8A 4GGFA 1CLMA 2G2BA 2EC6C 4ORBB 4BY4A 1J7PA 4JPZB 3DVMA 1UHJA 1XFUO 3WNXB 1ZACA 2I94A 1XFXO 1XFVO 4P2YB 1CLLA 3BUMB 1ZUZA 1CFDA 1QLSA 1QVIZ 2JU0A 1DJYA 4GFTA 1IGVA 2LCPA 1RECA 1DF0A 1NUBA 1QIVA 1CTRA 1UP5A 3D10A 2KOTA 1VRKA 4NDBA 5HKZA 5I2OA 1F70A 2BL0C 3PN7B 1KK7Y 1BT6A 1KQMB 3CTNA 4OV2A 1FI6A 5F6TA 4UPGA 1YX7A 5JOLA 1LKJA 1V1FA 1M46A 1EH2A 2HQWA 1B47A 1B8CA 2A4JA 1YRUB 1KK7Z 5G08A 3NSIA 1G8IA 2KI4C 2JULA 2OTGC 2LP2A 3AAKA 2NZ0A 1DJWA 1F54A 2EGDA 1IJ6A 1QASA 2LMTA 2V53A 2GGZA 1S6CA 1M45A 2KFFA 4NQGA 2JXCA 1RJVA 2MRDA 4PHNA 1TN4A 1A29A 1HQVA 4USLA 4XJKB 4BY5A 3IQQA 2VRGA 1SL7A 2EC6B 2L2EA 3ICBA 3CR2A 1M63B 1NWDA 3VRNA 3CS1A 1NCZA 3I5IC 1BOCA 2E6WA 1JC2A 5CPVA 3VRPA 4MZKA 1OQPA 1EG4A 2L51A 3F45A 5I8NA 2F8PA 1MWNA 3OB1B 2LANA 3SG6A 1K9KA 1BF5A 1J1DA 2HF5A 4XJKA 1S6IA 3LK1A 1M31A 1SPYA 4YI8A 1UURA 1R2UA 3EVUA 1JF2A 3C1VA 2KI6C 2LVIA 2M1UA 4MLWA 3EK8A 3EVVA 2PALA 2Y4QA 4N1FA 3VGOA 1TNQA 2WOSA 1EJ3A 1N65A 2AMIA 4HREE 1MQ1A 2KI4B 2OTGB 3BYAA 5DKRA 1K9PA 1YVHA 5AFPA 2MAZA 3EVRA 1CMGA 4GAOA 1CB1A 4FQOA 4PHKA 2LMUA 3EKJA 3FWBA 1FI5A 2M97A 1TNXA 4DRWA 4MRYA 2M1KB 4CIDA 2M7NA 2ZNEA 3OX6A 1C7VA 1MXEA 3I5IB 3K21A 4PE1A 2KFHA 2KQYA 2FJUB 1N0YA 2F2PA 1AJ4A 1B9AA 1EXRA 2L50A 3BOWB 1A75A 1BJFA 2M0RA 2M9GA 1K96A 1KK8C 1YUTA 3O78A 1BU3A 3BUNB 2L4HA 1DGUA 4OVNF 3BUOB 1B1GA 1B4CA 2COLB 2JWWA 2G9BA 2QPTA 1AK8A 1TNWA 1YUUA 1CM4A 4YGDB 2LE9B 2CCMA 1OZSA 4GNKB 2GGMA 5FYXA 2OS8C 2F3YA 1OOJA 1SK6D 1KFUS 3BOWA 3I5FC 2ZNDA 1YR5A 5GQQC 2F33A 4JQ0D 5AANA 2BKIB 1N2DA 1QLKA 1PK0D 3ZNIA 1K94A 2FCEA 2WORA 4PE0A 2MBXA 1GJYA 2LLSA 3TUYC 2FCDA 2TN4A 4GUKA 1CM1A 2MLFC 1CLBA 1J1EA 3VROA 3AKBA 1H8BA 2DOQA 1TIZA 5AERA 1QVIY 1RFJA 2NXQA 3VRQA 3CZTX 1LXFC 1QXPA 2I18A 2JT0A 2LHIA 2JTTA 2JZIA 1WY9A 2MA2A 1YURA 1X02A 3H4SE 2K7CA 1KK8B 1PSBA 1K95A 4CFRA 5KSZA 4M2OA 2M8UA 2SASA 3I5HC 1SRAA 3SJSA 4AQIA 3NXAA 4N5XA 2LVVA 1C07A 2P6BB 3OHMB 3FWCA 2CBLA 5IBWA 2BE4A 1YUSA 3I5FB 1A2XA 4ICBA 1IRJA 2Q91A 1RROA 1UUSA 4I5NB 1ALVA 4MVFA 5CSFA 3LCPC 2Y5IA 5KTYA 1Y1XA 1DJIA 1BMOA 1Q80A 1SY9A 3IQOA 2ZN9A 1J55A 4L9MA 5J3XA 3WXAA 1XK4A 2JQ6A 1OE9B 1C7WA 2L4IA 3PSRA 1SW8A 3TZ1A 2KBMA 3JTDC 4PCWA 3QRXA 3CLNA 1K93D 4MN0A 2HQ8A 2LUCA 3I5GC 4OR9B 4GPLB 1E8AA 1GQMA 1IG5A 2K7OA 2L0PA 1CFCA 3I5HB 4YRUA 2Y1NA 1HT9A 1OMDA 2B1UA 1GGZA 2BL0B 4YGCB 2KYCA 1B8RA 5JJGA 1TOPA 4AOMA 1FPWA 2K2AA 1Y1UA 4IL1A 1IQ5A 2K8MB 3GK1A 2AAOA 2PASA 1UHHA 1UWOA 1J7QA 2BE6A 2JT3A 2EHBA 3NSOA 1F55A 1RWYA 4A4CA 2LLTA 2PRUA 1PULA 1NX3A 2K0JA 2F3ZA 1W7JB 2JNFA 4DS7A 1A4PA 2KAVA 1L2OC 3DVJA 4YGEB 4OKHA 1JBAA 4YGAA 3PLFB 1F4QA 1KQVA 3TDUA 2KYFA 1BG1A 3JTDB 1B7TY 4PE4A 1J7OA 1J7RA 1SR6C 1NYAA 1SYMA 1FW4A 4D1EA 2LV7A 2H2KA 1KFXS 4NDCA 4I5KA 1CDLA 1QS7A 2BECA 2M49B 3VRRA 2CNPA 1IWQA 1AJ5A 4JWQA 2L5XB 1NX2A 1TCFA 3PALA 1PALA 1B7TZ 2M3WA 2LP3A 4CPVA 4C0KA 3EK7A 1K8UA 3GK4X 4HRHA 1KWOC 1LA0A 2JNXA 3HCMA 1S1EA 2Y1MA 3JVTC 5DKQA 3KHEA 1JWDA 3FIAA 2CXJA 1IJ5A 1MHOA 4WQ2A 2LLUA 2WNDA 1BR1B 3NSLA 1UHKA 2D8NA 1NX0A 4YGBB 2LC5A 2OPOA 1FF1A 3TS5C 4P5OE 1L2OB 3KF9A 1R6PA 4C0JA 3DVEA 1F71A 3MSEB 2JT8A 1SCMC 1XO5A 1K90D 4QJ3B 5AEQA 1PRWA 1QX5B 1XA5A 1XFYO 2KGBC 3A4UB 2H61C 2I2RE 1KFXL 1WDCC 3DF0B 2QACA 4DCKA 4F0ZB 2WCBA 1WLMA 2NCPA 3DVKA 1SR6B 1CFPA 3SG4A 1NIWA 4DUQA 3EK4A 5CSJA 5TNCA 1L7ZA 1ZMZA 3O4YA 4PE7A 2RGIA 3SG5A 1SMGA 1G33A 2LM5A 1CKKA 1MUXA 3D0YB 2ISDA 5ER4X 1QX2A 1JFKA 1TCOB 3SG3A 3DF0A 1KWOB 3WHUB 1LA3A 2Q4UA 3CR5X 1QV1A 3SG7A 5D7FA 1YTZC 3E3RA 2JOJA 1KFUL 3CGAA 3A8RA 2HETA 1YRTB 1Y0VH 4CLNA 2MJWB 2OS8B 2KDHA 3KO0A 3HX4A 1M39A 3D0YA 3LL8B 1S26D 2E30A 2JXLA 1DJHA 1U5IB 3RLZA 3TS5B 4QJ5B 3O6BA 1LINA 4I5JA 1JSAA 3TUYB 1PSRA 2CT9A 1CFFA 1SCMB 4M2QA 2WCEA 1XYDA 4MBEA 4XYNA 1OZOA 3SIBA 1W7IB 5HLOA 1WDCB 4ZCUA 4YBHB 1B8LA 3WHTB 4I5LB 4ETOA 1U5IA 1V1GA 3CR4X 4DIRA 1D1OA 1UHIA 3NSKA 3SIAA 2HPSA 5D69A 1CMFA 1YVLA 4OCIA 1KCYA 4TNCA 4A4BA 4MZJA 4AQJA 1NPQA 1NX1A 1XFWO 1S5GY 2BCBA 1PVAA 2LAPA 2H61A 2M29A 2MHHA 1S6JA 4ORAB 5I2LA 2IS9A 4GGNA 3BQ3A 1DT7B 1QATA 1PVBA 4PHJA 4PALA 3CWGA 2K7DA 1QTXA 2K61A 5HYDA 1JUOA 1WRKA 2I7AA 3IF7A 2PVBA 2ZRSA 3OX5A 1A03A 1MXLC 1S5GZ 2F2OA 3KEVA 1BODA 1DJXA 1CDNA 1YX8A 4MZLA 4C0LA 4QJ4B 1QJTA 2MLEC 1Y1AA 3BXKA 3PM8A 2KAXA 4MEWA 1H4BA 1DJZA 1IQ3A 2LMVA 2NCOA 2ZN8A 1SL8A 5DKNA 1OSAA 1SKTA 2LUXA 1AHRA 2ZKMX 1IKUA 2CTNA 1TNPA 1ZFSA 2KAYA 1IH0A 3ZWHA 2LVJA 5I2QA 1G4YR 1RTP1 3EKHA 2LVKA 2JPTA 1KSMA 2SCPA 1TTXA 1OMRA 2O5GA 2GV5A 2R2IA 3AAJA 1XFZO 1GGWA 1WLZA 1ZOTB 1NP8A 5PALA 3I5GB 3DD4A 4YI9A 2L98A 3PATA 2KFGA 4WQ3A 4GGFC 2KQ6A 1JF0A 1SCVA 1BLQA 1FBVA 1NCYA 2KHNA 1AP4A 1A75B 5HKWA 3BUWB 4HRGA 4PHMA 2AUCA 3SG2A 1K9UA 4CFQA 2BBNA 1SBJA 2WCFA 3BUXB 1DVIA 2ZRTA 5HLVA 5CSNA 2KI6D 1BR4B 1K2HA 3TDIA
chains in the Genus database with same CATH superfamily
2FOTA 3CZ0A 3OP0A 1DTLA 2LHLA 1NCXA 1KSOA 1XVJA 2JTZA 2ERBA 1CNPA 1TRFA 1LVCD 2BCXA 1SNLA 2PSRA 3R72A 4WRIA 3GK2A 5CSIA 1W9ZA 3KPXA 1AUIB 2BCAA 1NSHA 1RK9A 1ODBA 4R1EA 4U8DA 1F4OA 2P71A 2K7BA 3TUYC 5ER5A 2ZFDA 4NDDA 3O2PA 4PT1A 4GBAA 5D3OA 1EL4A 3PN7C 4FTGA 4M2PA 1SL9A 2O60A 1ALWA 1KQMC 3AKAA 1JFJA 3UO9A 3S0GA 2PMYA 1F8HA 1MR8A 3N7HA 1MF8B 1CDMA 2K2FA 1UHNA 1XK4C 2BBMA 1QV0A 3TDZA 4HSZA 2KSPA 3M0WA 1AVSA 5HKYA 5AXIA 5K89A 3D74A 4Q04A 3BFAA 1S36A 1OMVA 3RM1A 1Y6WA 4E68A 1DJGA 3LLEA 4ZCVA 3CABA 4MSPA 2KNEA 2KBIA 4ORCB 2M7LA 2LNKA 5B8IB 1A03A 1DMOA 1WRLA 4MRXA 2JC2A 3PFVA 2KGRA 3FS7A 1S3PA 3JVTB 1CDPA 1QX7A 2QEOA 1DF0B 5BPJA 3LK0A 1QIWA 4PDZA 1DGVA 4N1GA 2NLNA 1WRZA 2JRFA 2BKHB 3D77A 3OB2B 3GOFA 1EG3A 1Z2CB 5KU1A 2WC8A 4GGFA 1CLMA 2G2BA 2EC6C 4ORBB 4BY4A 1J7PA 4JPZB 3DVMA 1UHJA 1XFUO 3WNXB 1ZACA 1GM0A 2I94A 1XFXO 1XFVO 2WCKA 4P2YB 1CLLA 3BUMB 1ZUZA 1CFDA 1QLSA 1QVIZ 2JU0A 1DJYA 3DY9A 1IGVA 2LCPA 1RECA 1DF0A 1NUBA 3Q8IA 4GFTA 1QIVA 1CTRA 1UP5A 3D10A 2KOTA 1VRKA 2WCJA 4NDBA 5HKZA 5I2OA 1F70A 2BL0C 3PN7B 1KK7Y 1BT6A 1KQMB 3CTNA 4OV2A 1FI6A 5F6TA 4UPGA 1YX7A 5JOLA 1LKJA 1V1FA 1M46A 1EH2A 2HQWA 1B47A 1B8CA 2A4JA 1YRUB 3CYZA 3B88A 1KK7Z 5G08A 3NSIA 1G8IA 3S0EA 2KI4C 2JULA 2OTGC 2LP2A 4IJ7A 3AAKA 2NZ0A 3OBVA 1DJWA 1F54A 1DQEA 2EGDA 1IJ6A 1QASA 2LMTA 2V53A 2GGZA 1S6CA 1M45A 2KFFA 4NQGA 2JXCA 1RJVA 2MRDA 4PHNA 3R1PA 1TN4A 1A29A 1HQVA 4USLA 4XJKB 4BY5A 3IQQA 3NGVA 2VRGA 5HL1A 1SL7A 2EC6B 2L2EA 3ICBA 3CR2A 1M63B 1NWDA 3VRNA 3CS1A 1NCZA 3I5IC 5FI6A 1BOCA 2E6WA 1JC2A 5CPVA 3VRPA 3CZ1A 4MZKA 1OQPA 1EG4A 2L51A 2WCMA 3BFBA 3F45A 5I8NA 1ORGA 3S0AA 2F8PA 1MWNA 3OB1B 2LANA 3SG6A 1K9KA 1BF5A 1J1DA 2HF5A 4XJKA 1S6IA 3LK1A 1M31A 1SPYA 4YI8A 5FI7A 1UURA 1R2UA 3EVUA 1JF2A 3C1VA 2KI6C 2LVIA 2M1UA 3L47A 3EK8A 3EVVA 2PALA 2Y4QA 4MLWA 4N1FA 3VGOA 1TNQA 2WOSA 1EJ3A 1N65A 2AMIA 4HREE 1MQ1A 2KI4B 2OTGB 3BYAA 5DKRA 1K9PA 1YVHA 5AFPA 2MAZA 1SSEB 3EVRA 1CMGA 4GAOA 3V2LA 1CB1A 4FQOA 4PHKA 2LMUA 3EKJA 3R1VA 3FWBA 1FI5A 2M97A 1TNXA 4DRWA 4MRYA 2M1KB 4CIDA 2M7NA 2ZNEA 3EG5B 3OX6A 1C7VA 4JD9A 1MXEA 3I5IB 3K21A 4PE1A 2KFHA 1XFRA 2L2CA 1TUZA 2KQYA 2PYQA 3IVTA 3PM2A 2FJUB 1N0YA 2F2PA 1AJ4A 1B9AA 1EXRA 2L50A 2KLEA 3BOWB 1A75A 1BJFA 2M0RA 2M9GA 3OGNA 1K96A 1KK8C 1YUTA 3O78A 1BU3A 3BUNB 2L4HA 1DGUA 4OVNF 2BNXA 3BUOB 1B1GA 1B4CA 3NHTA 2COLB 2JWWA 2G9BA 2QPTA 1AK8A 1TNWA 1YUUA 1CM4A 4YGDB 2LE9B 2CCMA 1OZSA 4GNKB 1Z4HA 2GGMA 5FYXA 3O4XA 2OS8C 2F3YA 1OOJA 1SK6D 1KFUS 3BOWA 3B7AA 3I5FC 2ZNDA 1YR5A 5GQQC 2F33A 4JQ0D 5AANA 3SS4A 2BKIB 1N2DA 1QLKA 5I94A 1PK0D 3ZNIA 1LS8A 1K94A 2FCEA 2WC6A 2WORA 3L4LA 1GJYA 2LLSA 4PE0A 2FCDA 2TN4A 4GUKA 1CM1A 4INXA 2MBXA 3D73A 2MLFC 1CLBA 1J1EA 1T14A 3VROA 3AKBA 1H8BA 2DOQA 1TIZA 5AERA 1QVIY 1RFJA 2NXQA 3D78A 3VRQA 3CZTX 2QEHA 1LXFC 2H8VA 1QXPA 2QEBA 2WCLA 3SS5A 2I18A 2JT0A 2LHIA 2JTTA 2JZIA 3DZTA 1WY9A 2MA2A 1YURA 1X02A 3H4SE 2K7CA 1KK8B 1PSBA 1K95A 4CFRA 3R1OA 5KSZA 4M2OA 2M8UA 2SASA 3I5HC 1OOHA 1SRAA 3SJSA 4AQIA 2KLDA 3NXAA 4N5XA 2LVVA 1C07A 2P6BB 3OHMB 3FWCA 2CBLA 5IBWA 1DELA 2BE4A 1YUSA 3I5FB 3DYEA 1A2XA 4ICBA 1IRJA 2Q91A 3BJHA 1OOFA 1RROA 1UUSA 4I5NB 1ALVA 4MVFA 5CSFA 3LCPC 2Y5IA 5KTYA 1Y1XA 3D76A 2P70A 1DJIA 1BMOA 1Q80A 1SY9A 3IQOA 2ZN9A 3B6XA 1J55A 4L9MA 5J3XA 3WXAA 1XK4A 2JQ6A 1OE9B 1C7WA 2L4IA 3PSRA 1SW8A 3S0DA 3TZ1A 2KBMA 3JTDC 4PCWA 3QRXA 3CLNA 1K93D 1P28A 4MN0A 2HQ8A 2LUCA 1TWOA 3I5GC 4KYNA 4OR9B 5EL2A 4GPLB 2WCHA 1E8AA 1GQMA 1IG5A 2K7OA 2L0PA 1CFCA 3I5HB 4YRUA 2Y1NA 1HT9A 1OMDA 2B1UA 1GGZA 2BL0B 2WC5A 2KYCA 1B8RA 4YGCB 5JJGA 1TOPA 4AOMA 1FPWA 2K2AA 1Y1UA 4IL1A 1IQ5A 2K8MB 3GK1A 2AAOA 2PASA 1UHHA 1UWOA 3RZSA 1J7QA 2BE6A 2JT3A 2EHBA 3NSOA 1F55A 1RWYA 4A4CA 2LLTA 2PRUA 1PULA 1NX3A 4F7FA 2K0JA 2F3ZA 1OW4A 1W7JB 2JNFA 1C3ZA 4DS7A 1A4PA 2KAVA 1L2OC 2JPOA 3DVJA 4YGEB 4OKHA 1JBAA 4YGAA 3PLFB 3NHIA 1F4QA 1KQVA 3TDUA 2KYFA 1BG1A 5FI2A 3JTDB 1B7TY 3K1EA 4PE4A 1J7OA 1J7RA 1SR6C 1NYAA 1SYMA 1FW4A 4D1EA 2LV7A 2H2KA 1KFXS 4NDCA 4I5KA 1CDLA 1QS7A 2BECA 2M49B 3VRRA 2K60A 1IWQA 2CNPA 1AJ5A 4JKTA 2L5XB 1NX2A 1TCFA 3PALA 1PALA 4JWQA 3S0FA 1B7TZ 2M3WA 2LP3A 4CPVA 4C0KA 3EK7A 1K8UA 3GK4X 4HRHA 1KWOC 1LA0A 3D75A 2JNXA 3HCMA 1S1EA 2Y1MA 3JVTC 3QMEA 5DKQA 3KHEA 1DEKA 1JWDA 3FIAA 2CXJA 1IJ5A 1MHOA 4WQ2A 2LLUA 2WNDA 1BR1B 3NSLA 1UHKA 2L5YA 2D8NA 1NX0A 4YGBB 2LC5A 2OPOA 1FF1A 3TS5C 2PQLA 3FE8A 1L2OB 4P5OE 4FQTA 3KF9A 1R6PA 4C0JA 3DVEA 1F71A 3MSEB 2JT8A 1SCMC 1XO5A 1TUJA 1K90D 4QJ3B 5AEQA 1PRWA 1QX5B 1XA5A 1XFYO 1IIOA 2KGBC 3PJIA 3A4UB 2H61C 2I2RE 1KFXL 1WDCC 3DF0B 2QACA 4DCKA 4F0ZB 2WCBA 1WLMA 2NCPA 3DVKA 1SR6B 1CFPA 3SG4A 1NIWA 4DUQA 3EK4A 5CSJA 5TNCA 1L7ZA 1ZMZA 3O4YA 4PE7A 2RGIA 3SG5A 2QDIA 1SMGA 1G33A 2LM5A 1CKKA 1MUXA 3D0YB 2ISDA 5ER4X 1QX2A 1JFKA 1TCOB 3SG3A 3DF0A 1KWOB 3WHUB 1LA3A 2Q4UA 3CR5X 1QV1A 3SG7A 5D7FA 1YTZC 3E3RA 2JOJA 1KFUL 3CGAA 3A8RA 2HETA 1YRTB 1Y0VH 4CLNA 2MJWB 2OS8B 1OOIX 2KDHA 3FE6A 3HX4A 3KO0A 1M39A 3D0YA 3LL8B 1S26D 1QWVA 2E30A 2JXLA 1DJHA 2KPHA 1U5IB 3RLZA 3TS5B 4QJ5B 5DICA 3O6BA 1LINA 4I5JA 1JSAA 3TUYB 1PSRA 3BFHA 3DXLA 2CT9A 1CFFA 1SCMB 4M2QA 2WCEA 3CDNA 1XYDA 3S0BA 4MBEA 4XYNA 1OZOA 3SIBA 1W7IB 5HLOA 1WDCB 4ZCUA 4YBHB 1B8LA 3WHTB 4I5LB 4ETOA 1U5IA 1V1GA 3CR4X 4DIRA 1D1OA 1UHIA 3NSKA 3SIAA 2HPSA 5D69A 1CMFA 1YVLA 4OCIA 1KCYA 4TNCA 4A4BA 4MZJA 4AQJA 2QEVA 1NPQA 1NX1A 3VB1A 1XFWO 1C3YA 1S5GY 2BCBA 1PVAA 2LAPA 2H61A 2M29A 2MHHA 1S6JA 4ORAB 5I2LA 2IS9A 4GGNA 3BQ3A 1DT7B 1QATA 1PVBA 3B87A 4PHJA 4PALA 3CWGA 2K7DA 1QTXA 2K61A 5HYDA 1JUOA 1WRKA 2I7AA 2YGUA 2PVBA 2ZRSA 3IF7A 3OX5A 1MXLC 1S5GZ 2F2OA 3KEVA 1BODA 1DJXA 1CDNA 1YX8A 4MZLA 4C0LA 4QJ4B 2GTEA 1QJTA 2MLEC 1Y1AA 3BXKA 3L4AA 2FJYA 2KAXA 3PM8A 1DJZA 4MEWA 3UNWA 1H4BA 1IQ3A 2LMVA 2NCOA 1OOGA 2ZN8A 1SL8A 1DC1A 5DKNA 1OSAA 1SKTA 2LUXA 1AHRA 2ZKMX 3SS3A 1IKUA 2CTNA 1TNPA 1ZFSA 2KAYA 1IH0A 3ZWHA 2LVJA 5I2QA 1G4YR 1RTP1 3EKHA 2LVKA 2JPTA 1KSMA 2SCPA 3FE9A 1TTXA 1OMRA 2O5GA 2GV5A 2R2IA 3AAJA 1XFZO 1GGWA 1WLZA 1ZOTB 4INWA 1NP8A 4OZDA 5PALA 3I5GB 3DD4A 4YI9A 2L98A 3PATA 2KFGA 4WQ3A 4GGFC 3B86A 2KQ6A 1JF0A 3CZ2A 1SCVA 1BLQA 1FBVA 1NCYA 2KHNA 1AP4A 1A75B 5HKWA 3BUWB 4HRGA 4PHMA 2AUCA 3SG2A 1K9UA 4CFQA 2BAPA 2BBNA 1SBJA 2WCFA 3BUXB 1DVIA 2ZRTA 5HLVA 5CSNA 2KI6D 1BR4B 1K2HA 3TDIA
chains in the Genus database with same CATH topology
2FOTA 3OP0A 1DTLA 2LHLA 1NCXA 1KSOA 1XVJA 2JTZA 1CNPA 1TRFA 1LVCD 2BCXA 1SNLA 2PSRA 4WRIA 3GK2A 5CSIA 3KPXA 1AUIB 2BCAA 1NSHA 1RK9A 1ODBA 4R1EA 4U8DA 1F4OA 2K7BA 5ER5A 2ZFDA 4NDDA 3O2PA 4GBAA 1EL4A 3PN7C 4FTGA 4M2PA 1SL9A 2O60A 1ALWA 1KQMC 3AKAA 1JFJA 2PMYA 1F8HA 1MR8A 1MF8B 1CDMA 2K2FA 1UHNA 1XK4C 2BBMA 1QV0A 3TDZA 4HSZA 2KSPA 3M0WA 1AVSA 5HKYA 5AXIA 5K89A 4Q04A 1S36A 1OMVA 3RM1A 1Y6WA 4E68A 1DJGA 3LLEA 4ZCVA 4MSPA 2KNEA 2KBIA 4ORCB 2M7LA 2LNKA 5B8IB 1DMOA 1WRLA 4MRXA 2JC2A 3PFVA 2KGRA 3FS7A 1S3PA 3JVTB 1CDPA 1QX7A 1DF0B 5BPJA 3LK0A 1QIWA 4PDZA 1DGVA 4N1GA 2NLNA 1WRZA 2JRFA 2BKHB 3OB2B 3GOFA 1EG3A 5KU1A 2WC8A 4GGFA 1CLMA 2G2BA 2EC6C 4ORBB 4BY4A 1J7PA 4JPZB 3DVMA 1UHJA 1XFUO 3WNXB 1ZACA 2I94A 1XFXO 1XFVO 4P2YB 1CLLA 3BUMB 1ZUZA 1CFDA 1QLSA 1QVIZ 2JU0A 1DJYA 4GFTA 1IGVA 2LCPA 1RECA 1DF0A 1NUBA 1QIVA 1CTRA 1UP5A 3D10A 2KOTA 1VRKA 4NDBA 5HKZA 5I2OA 1F70A 2BL0C 3PN7B 1KK7Y 1BT6A 1KQMB 3CTNA 4OV2A 1FI6A 5F6TA 4UPGA 1YX7A 5JOLA 1LKJA 1V1FA 1M46A 1EH2A 2HQWA 1B47A 1B8CA 2A4JA 1YRUB 1KK7Z 5G08A 3NSIA 1G8IA 2KI4C 2JULA 2OTGC 2LP2A 3AAKA 2NZ0A 1DJWA 1F54A 2EGDA 1IJ6A 1QASA 2LMTA 2V53A 2GGZA 1S6CA 1M45A 2KFFA 4NQGA 2JXCA 1RJVA 2MRDA 4PHNA 1TN4A 1A29A 1HQVA 4USLA 4XJKB 4BY5A 3IQQA 2VRGA 1SL7A 2EC6B 2L2EA 3ICBA 3CR2A 1M63B 1NWDA 3VRNA 3CS1A 1NCZA 3I5IC 1BOCA 2E6WA 1JC2A 5CPVA 3VRPA 4MZKA 1OQPA 1EG4A 2L51A 3F45A 5I8NA 2F8PA 1MWNA 3OB1B 2LANA 3SG6A 1K9KA 1BF5A 1J1DA 2HF5A 4XJKA 1S6IA 3LK1A 1M31A 1SPYA 4YI8A 1UURA 1R2UA 3EVUA 1JF2A 3C1VA 2KI6C 2LVIA 2M1UA 4MLWA 3EK8A 3EVVA 2PALA 2Y4QA 4N1FA 3VGOA 1TNQA 2WOSA 1EJ3A 1N65A 2AMIA 4HREE 1MQ1A 2KI4B 2OTGB 3BYAA 5DKRA 1K9PA 1YVHA 5AFPA 2MAZA 3EVRA 1CMGA 4GAOA 1CB1A 4FQOA 4PHKA 2LMUA 3EKJA 3FWBA 1FI5A 2M97A 1TNXA 4DRWA 4MRYA 2M1KB 4CIDA 2M7NA 2ZNEA 3OX6A 1C7VA 1MXEA 3I5IB 3K21A 4PE1A 2KFHA 2KQYA 2FJUB 1N0YA 2F2PA 1AJ4A 1B9AA 1EXRA 2L50A 3BOWB 1A75A 1BJFA 2M0RA 2M9GA 1K96A 1KK8C 1YUTA 3O78A 1BU3A 3BUNB 2L4HA 1DGUA 4OVNF 3BUOB 1B1GA 1B4CA 2COLB 2JWWA 2G9BA 2QPTA 1AK8A 1TNWA 1YUUA 1CM4A 4YGDB 2LE9B 2CCMA 1OZSA 4GNKB 2GGMA 5FYXA 2OS8C 2F3YA 1OOJA 1SK6D 1KFUS 3BOWA 3I5FC 2ZNDA 1YR5A 5GQQC 2F33A 4JQ0D 5AANA 2BKIB 1N2DA 1QLKA 1PK0D 3ZNIA 1K94A 2FCEA 2WORA 4PE0A 2MBXA 1GJYA 2LLSA 3TUYC 2FCDA 2TN4A 4GUKA 1CM1A 2MLFC 1CLBA 1J1EA 3VROA 3AKBA 1H8BA 2DOQA 1TIZA 5AERA 1QVIY 1RFJA 2NXQA 3VRQA 3CZTX 1LXFC 1QXPA 2I18A 2JT0A 2LHIA 2JTTA 2JZIA 1WY9A 2MA2A 1YURA 1X02A 3H4SE 2K7CA 1KK8B 1PSBA 1K95A 4CFRA 5KSZA 4M2OA 2M8UA 2SASA 3I5HC 1SRAA 3SJSA 4AQIA 3NXAA 4N5XA 2LVVA 1C07A 2P6BB 3OHMB 3FWCA 2CBLA 5IBWA 2BE4A 1YUSA 3I5FB 1A2XA 4ICBA 1IRJA 2Q91A 1RROA 1UUSA 4I5NB 1ALVA 4MVFA 5CSFA 3LCPC 2Y5IA 5KTYA 1Y1XA 1DJIA 1BMOA 1Q80A 1SY9A 3IQOA 2ZN9A 1J55A 4L9MA 5J3XA 3WXAA 1XK4A 2JQ6A 1OE9B 1C7WA 2L4IA 3PSRA 1SW8A 3TZ1A 2KBMA 3JTDC 4PCWA 3QRXA 3CLNA 1K93D 4MN0A 2HQ8A 2LUCA 3I5GC 4OR9B 4GPLB 1E8AA 1GQMA 1IG5A 2K7OA 2L0PA 1CFCA 3I5HB 4YRUA 2Y1NA 1HT9A 1OMDA 2B1UA 1GGZA 2BL0B 4YGCB 2KYCA 1B8RA 5JJGA 1TOPA 4AOMA 1FPWA 2K2AA 1Y1UA 4IL1A 1IQ5A 2K8MB 3GK1A 2AAOA 2PASA 1UHHA 1UWOA 1J7QA 2BE6A 2JT3A 2EHBA 3NSOA 1F55A 1RWYA 4A4CA 2LLTA 2PRUA 1PULA 1NX3A 2K0JA 2F3ZA 1W7JB 2JNFA 4DS7A 1A4PA 2KAVA 1L2OC 3DVJA 4YGEB 4OKHA 1JBAA 4YGAA 3PLFB 1F4QA 1KQVA 3TDUA 2KYFA 1BG1A 3JTDB 1B7TY 4PE4A 1J7OA 1J7RA 1SR6C 1NYAA 1SYMA 1FW4A 4D1EA 2LV7A 2H2KA 1KFXS 4NDCA 4I5KA 1CDLA 1QS7A 2BECA 2M49B 3VRRA 2CNPA 1IWQA 1AJ5A 4JWQA 2L5XB 1NX2A 1TCFA 3PALA 1PALA 1B7TZ 2M3WA 2LP3A 4CPVA 4C0KA 3EK7A 1K8UA 3GK4X 4HRHA 1KWOC 1LA0A 2JNXA 3HCMA 1S1EA 2Y1MA 3JVTC 5DKQA 3KHEA 1JWDA 3FIAA 2CXJA 1IJ5A 1MHOA 4WQ2A 2LLUA 2WNDA 1BR1B 3NSLA 1UHKA 2D8NA 1NX0A 4YGBB 2LC5A 2OPOA 1FF1A 3TS5C 4P5OE 1L2OB 3KF9A 1R6PA 4C0JA 3DVEA 1F71A 3MSEB 2JT8A 1SCMC 1XO5A 1K90D 4QJ3B 5AEQA 1PRWA 1QX5B 1XA5A 1XFYO 2KGBC 3A4UB 2H61C 2I2RE 1KFXL 1WDCC 3DF0B 2QACA 4DCKA 4F0ZB 2WCBA 1WLMA 2NCPA 3DVKA 1SR6B 1CFPA 3SG4A 1NIWA 4DUQA 3EK4A 5CSJA 5TNCA 1L7ZA 1ZMZA 3O4YA 4PE7A 2RGIA 3SG5A 1SMGA 1G33A 2LM5A 1CKKA 1MUXA 3D0YB 2ISDA 5ER4X 1QX2A 1JFKA 1TCOB 3SG3A 3DF0A 1KWOB 3WHUB 1LA3A 2Q4UA 3CR5X 1QV1A 3SG7A 5D7FA 1YTZC 3E3RA 2JOJA 1KFUL 3CGAA 3A8RA 2HETA 1YRTB 1Y0VH 4CLNA 2MJWB 2OS8B 2KDHA 3KO0A 3HX4A 1M39A 3D0YA 3LL8B 1S26D 2E30A 2JXLA 1DJHA 1U5IB 3RLZA 3TS5B 4QJ5B 3O6BA 1LINA 4I5JA 1JSAA 3TUYB 1PSRA 2CT9A 1CFFA 1SCMB 4M2QA 2WCEA 1XYDA 4MBEA 4XYNA 1OZOA 3SIBA 1W7IB 5HLOA 1WDCB 4ZCUA 4YBHB 1B8LA 3WHTB 4I5LB 4ETOA 1U5IA 1V1GA 3CR4X 4DIRA 1D1OA 1UHIA 3NSKA 3SIAA 2HPSA 5D69A 1CMFA 1YVLA 4OCIA 1KCYA 4TNCA 4A4BA 4MZJA 4AQJA 1NPQA 1NX1A 1XFWO 1S5GY 2BCBA 1PVAA 2LAPA 2H61A 2M29A 2MHHA 1S6JA 4ORAB 5I2LA 2IS9A 4GGNA 3BQ3A 1DT7B 1QATA 1PVBA 4PHJA 4PALA 3CWGA 2K7DA 1QTXA 2K61A 5HYDA 1JUOA 1WRKA 2I7AA 3IF7A 2PVBA 2ZRSA 3OX5A 1A03A 1MXLC 1S5GZ 2F2OA 3KEVA 1BODA 1DJXA 1CDNA 1YX8A 4MZLA 4C0LA 4QJ4B 1QJTA 2MLEC 1Y1AA 3BXKA 3PM8A 2KAXA 4MEWA 1H4BA 1DJZA 1IQ3A 2LMVA 2NCOA 2ZN8A 1SL8A 5DKNA 1OSAA 1SKTA 2LUXA 1AHRA 2ZKMX 1IKUA 2CTNA 1TNPA 1ZFSA 2KAYA 1IH0A 3ZWHA 2LVJA 5I2QA 1G4YR 1RTP1 3EKHA 2LVKA 2JPTA 1KSMA 2SCPA 1TTXA 1OMRA 2O5GA 2GV5A 2R2IA 3AAJA 1XFZO 1GGWA 1WLZA 1ZOTB 1NP8A 5PALA 3I5GB 3DD4A 4YI9A 2L98A 3PATA 2KFGA 4WQ3A 4GGFC 2KQ6A 1JF0A 1SCVA 1BLQA 1FBVA 1NCYA 2KHNA 1AP4A 1A75B 5HKWA 3BUWB 4HRGA 4PHMA 2AUCA 3SG2A 1K9UA 4CFQA 2BBNA 1SBJA 2WCFA 3BUXB 1DVIA 2ZRTA 5HLVA 5CSNA 2KI6D 1BR4B 1K2HA 3TDIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FOT A;  3OP0 A;  1DTL A;  2LHL A;  1NCX A;  1KSO A;  1XVJ A;  2JTZ A;  1CNP A;  1TRF A;  1LVC D;  2BCX A;  1SNL A;  2PSR A;  4WRI A;  3GK2 A;  5CSI A;  3KPX A;  1AUI B;  2BCA A;  1NSH A;  1RK9 A;  1ODB A;  4R1E A;  4U8D A;  1F4O A;  2K7B A;  5ER5 A;  2ZFD A;  4NDD A;  3O2P A;  4GBA A;  1EL4 A;  3PN7 C;  4FTG A;  4M2P A;  1SL9 A;  2O60 A;  1ALW A;  1KQM C;  3AKA A;  1JFJ A;  2PMY A;  1F8H A;  1MR8 A;  1MF8 B;  1CDM A;  2K2F A;  1UHN A;  1XK4 C;  2BBM A;  1QV0 A;  3TDZ A;  4HSZ A;  2KSP A;  3M0W A;  1AVS A;  5HKY A;  5AXI A;  5K89 A;  4Q04 A;  1S36 A;  1OMV A;  3RM1 A;  1Y6W A;  4E68 A;  1DJG A;  3LLE A;  4ZCV A;  4MSP A;  2KNE A;  2KBI A;  4ORC B;  2M7L A;  2LNK A;  5B8I B;  1DMO A;  1WRL A;  4MRX A;  2JC2 A;  3PFV A;  2KGR A;  3FS7 A;  1S3P A;  3JVT B;  1CDP A;  1QX7 A;  1DF0 B;  5BPJ A;  3LK0 A;  1QIW A;  4PDZ A;  1DGV A;  4N1G A;  2NLN A;  1WRZ A;  2JRF A;  2BKH B;  3OB2 B;  3GOF A;  1EG3 A;  5KU1 A;  2WC8 A;  4GGF A;  1CLM A;  2G2B A;  2EC6 C;  4ORB B;  4BY4 A;  1J7P A;  4JPZ B;  3DVM A;  1UHJ A;  1XFU O;  3WNX B;  1ZAC A;  2I94 A;  1XFX O;  1XFV O;  4P2Y B;  1CLL A;  3BUM B;  1ZUZ A;  1CFD A;  1QLS A;  1QVI Z;  2JU0 A;  1DJY A;  4GFT A;  1IGV A;  2LCP A;  1REC A;  1DF0 A;  1NUB A;  1QIV A;  1CTR A;  1UP5 A;  3D10 A;  2KOT A;  1VRK A;  4NDB A;  5HKZ A;  5I2O A;  1F70 A;  2BL0 C;  3PN7 B;  1KK7 Y;  1BT6 A;  1KQM B;  3CTN A;  4OV2 A;  1FI6 A;  5F6T A;  4UPG A;  1YX7 A;  5JOL A;  1LKJ A;  1V1F A;  1M46 A;  1EH2 A;  2HQW A;  1B47 A;  1B8C A;  2A4J A;  1YRU B;  1KK7 Z;  5G08 A;  3NSI A;  1G8I A;  2KI4 C;  2JUL A;  2OTG C;  2LP2 A;  3AAK A;  2NZ0 A;  1DJW A;  1F54 A;  2EGD A;  1IJ6 A;  1QAS A;  2LMT A;  2V53 A;  2GGZ A;  1S6C A;  1M45 A;  2KFF A;  4NQG A;  2JXC A;  1RJV A;  2MRD A;  4PHN A;  1TN4 A;  1A29 A;  1HQV A;  4USL A;  4XJK B;  4BY5 A;  3IQQ A;  2VRG A;  1SL7 A;  2EC6 B;  2L2E A;  3ICB A;  3CR2 A;  1M63 B;  1NWD A;  3VRN A;  3CS1 A;  1NCZ A;  3I5I C;  1BOC A;  2E6W A;  1JC2 A;  5CPV A;  3VRP A;  4MZK A;  1OQP A;  1EG4 A;  2L51 A;  3F45 A;  5I8N A;  2F8P A;  1MWN A;  3OB1 B;  2LAN A;  3SG6 A;  1K9K A;  1BF5 A;  1J1D A;  2HF5 A;  4XJK A;  1S6I A;  3LK1 A;  1M31 A;  1SPY A;  4YI8 A;  1UUR A;  1R2U A;  3EVU A;  1JF2 A;  3C1V A;  2KI6 C;  2LVI A;  2M1U A;  4MLW A;  3EK8 A;  3EVV A;  2PAL A;  2Y4Q A;  4N1F A;  3VGO A;  1TNQ A;  2WOS A;  1EJ3 A;  1N65 A;  2AMI A;  4HRE E;  1MQ1 A;  2KI4 B;  2OTG B;  3BYA A;  5DKR A;  1K9P A;  1YVH A;  5AFP A;  2MAZ A;  3EVR A;  1CMG A;  4GAO A;  1CB1 A;  4FQO A;  4PHK A;  2LMU A;  3EKJ A;  3FWB A;  1FI5 A;  2M97 A;  1TNX A;  4DRW A;  4MRY A;  2M1K B;  4CID A;  2M7N A;  2ZNE A;  3OX6 A;  1C7V A;  1MXE A;  3I5I B;  3K21 A;  4PE1 A;  2KFH A;  2KQY A;  2FJU B;  1N0Y A;  2F2P A;  1AJ4 A;  1B9A A;  1EXR A;  2L50 A;  3BOW B;  1A75 A;  1BJF A;  2M0R A;  2M9G A;  1K96 A;  1KK8 C;  1YUT A;  3O78 A;  1BU3 A;  3BUN B;  2L4H A;  1DGU A;  4OVN F;  3BUO B;  1B1G A;  1B4C A;  2COL B;  2JWW A;  2G9B A;  2QPT A;  1AK8 A;  1TNW A;  1YUU A;  1CM4 A;  4YGD B;  2LE9 B;  2CCM A;  1OZS A;  4GNK B;  2GGM A;  5FYX A;  2OS8 C;  2F3Y A;  1OOJ A;  1SK6 D;  1KFU S;  3BOW A;  3I5F C;  2ZND A;  1YR5 A;  5GQQ C;  2F33 A;  4JQ0 D;  5AAN A;  2BKI B;  1N2D A;  1QLK A;  1PK0 D;  3ZNI A;  1K94 A;  2FCE A;  2WOR A;  4PE0 A;  2MBX A;  1GJY A;  2LLS A;  3TUY C;  2FCD A;  2TN4 A;  4GUK A;  1CM1 A;  2MLF C;  1CLB A;  1J1E A;  3VRO A;  3AKB A;  1H8B A;  2DOQ A;  1TIZ A;  5AER A;  1QVI Y;  1RFJ A;  2NXQ A;  3VRQ A;  3CZT X;  1LXF C;  1QXP A;  2I18 A;  2JT0 A;  2LHI A;  2JTT A;  2JZI A;  1WY9 A;  2MA2 A;  1YUR A;  1X02 A;  3H4S E;  2K7C A;  1KK8 B;  1PSB A;  1K95 A;  4CFR A;  5KSZ A;  4M2O A;  2M8U A;  2SAS A;  3I5H C;  1SRA A;  3SJS A;  4AQI A;  3NXA A;  4N5X A;  2LVV A;  1C07 A;  2P6B B;  3OHM B;  3FWC A;  2CBL A;  5IBW A;  2BE4 A;  1YUS A;  3I5F B;  1A2X A;  4ICB A;  1IRJ A;  2Q91 A;  1RRO A;  1UUS A;  4I5N B;  1ALV A;  4MVF A;  5CSF A;  3LCP C;  2Y5I A;  5KTY A;  1Y1X A;  1DJI A;  1BMO A;  1Q80 A;  1SY9 A;  3IQO A;  2ZN9 A;  1J55 A;  4L9M A;  5J3X A;  3WXA A;  1XK4 A;  2JQ6 A;  1OE9 B;  1C7W A;  2L4I A;  3PSR A;  1SW8 A;  3TZ1 A;  2KBM A;  3JTD C;  4PCW A;  3QRX A;  3CLN A;  1K93 D;  4MN0 A;  2HQ8 A;  2LUC A;  3I5G C;  4OR9 B;  4GPL B;  1E8A A;  1GQM A;  1IG5 A;  2K7O A;  2L0P A;  1CFC A;  3I5H B;  4YRU A;  2Y1N A;  1HT9 A;  1OMD A;  2B1U A;  1GGZ A;  2BL0 B;  4YGC B;  2KYC A;  1B8R A;  5JJG A;  1TOP A;  4AOM A;  1FPW A;  2K2A A;  1Y1U A;  4IL1 A;  1IQ5 A;  2K8M B;  3GK1 A;  2AAO A;  2PAS A;  1UHH A;  1UWO A;  1J7Q A;  2BE6 A;  2JT3 A;  2EHB A;  3NSO A;  1F55 A;  1RWY A;  4A4C A;  2LLT A;  2PRU A;  1PUL A;  1NX3 A;  2K0J A;  2F3Z A;  1W7J B;  2JNF A;  4DS7 A;  1A4P A;  2KAV A;  1L2O C;  3DVJ A;  4YGE B;  4OKH A;  1JBA A;  4YGA A;  3PLF B;  1F4Q A;  1KQV A;  3TDU A;  2KYF A;  1BG1 A;  3JTD B;  1B7T Y;  4PE4 A;  1J7O A;  1J7R A;  1SR6 C;  1NYA A;  1SYM A;  1FW4 A;  4D1E A;  2LV7 A;  2H2K A;  1KFX S;  4NDC A;  4I5K A;  1CDL A;  1QS7 A;  2BEC A;  2M49 B;  3VRR A;  2CNP A;  1IWQ A;  1AJ5 A;  4JWQ A;  2L5X B;  1NX2 A;  1TCF A;  3PAL A;  1PAL A;  1B7T Z;  2M3W A;  2LP3 A;  4CPV A;  4C0K A;  3EK7 A;  1K8U A;  3GK4 X;  4HRH A;  1KWO C;  1LA0 A;  2JNX A;  3HCM A;  1S1E A;  2Y1M A;  3JVT C;  5DKQ A;  3KHE A;  1JWD A;  3FIA A;  2CXJ A;  1IJ5 A;  1MHO A;  4WQ2 A;  2LLU A;  2WND A;  1BR1 B;  3NSL A;  1UHK A;  2D8N A;  1NX0 A;  4YGB B;  2LC5 A;  2OPO A;  1FF1 A;  3TS5 C;  4P5O E;  1L2O B;  3KF9 A;  1R6P A;  4C0J A;  3DVE A;  1F71 A;  3MSE B;  2JT8 A;  1SCM C;  1XO5 A;  1K90 D;  4QJ3 B;  5AEQ A;  1PRW A;  1QX5 B;  1XA5 A;  1XFY O;  2KGB C;  3A4U B;  2H61 C;  2I2R E;  1KFX L;  1WDC C;  3DF0 B;  2QAC A;  4DCK A;  4F0Z B;  2WCB A;  1WLM A;  2NCP A;  3DVK A;  1SR6 B;  1CFP A;  3SG4 A;  1NIW A;  4DUQ A;  3EK4 A;  5CSJ A;  5TNC A;  1L7Z A;  1ZMZ A;  3O4Y A;  4PE7 A;  2RGI A;  3SG5 A;  1SMG A;  1G33 A;  2LM5 A;  1CKK A;  1MUX A;  3D0Y B;  2ISD A;  5ER4 X;  1QX2 A;  1JFK A;  1TCO B;  3SG3 A;  3DF0 A;  1KWO B;  3WHU B;  1LA3 A;  2Q4U A;  3CR5 X;  1QV1 A;  3SG7 A;  5D7F A;  1YTZ C;  3E3R A;  2JOJ A;  1KFU L;  3CGA A;  3A8R A;  2HET A;  1YRT B;  1Y0V H;  4CLN A;  2MJW B;  2OS8 B;  2KDH A;  3KO0 A;  3HX4 A;  1M39 A;  3D0Y A;  3LL8 B;  1S26 D;  2E30 A;  2JXL A;  1DJH A;  1U5I B;  3RLZ A;  3TS5 B;  4QJ5 B;  3O6B A;  1LIN A;  4I5J A;  1JSA A;  3TUY B;  1PSR A;  2CT9 A;  1CFF A;  1SCM B;  4M2Q A;  2WCE A;  1XYD A;  4MBE A;  4XYN A;  1OZO A;  3SIB A;  1W7I B;  5HLO A;  1WDC B;  4ZCU A;  4YBH B;  1B8L A;  3WHT B;  4I5L B;  4ETO A;  1U5I A;  1V1G A;  3CR4 X;  4DIR A;  1D1O A;  1UHI A;  3NSK A;  3SIA A;  2HPS A;  5D69 A;  1CMF A;  1YVL A;  4OCI A;  1KCY A;  4TNC A;  4A4B A;  4MZJ A;  4AQJ A;  1NPQ A;  1NX1 A;  1XFW O;  1S5G Y;  2BCB A;  1PVA A;  2LAP A;  2H61 A;  2M29 A;  2MHH A;  1S6J A;  4ORA B;  5I2L A;  2IS9 A;  4GGN A;  3BQ3 A;  1DT7 B;  1QAT A;  1PVB A;  4PHJ A;  4PAL A;  3CWG A;  2K7D A;  1QTX A;  2K61 A;  5HYD A;  1JUO A;  1WRK A;  2I7A A;  3IF7 A;  2PVB A;  2ZRS A;  3OX5 A;  1A03 A;  1MXL C;  1S5G Z;  2F2O A;  3KEV A;  1BOD A;  1DJX A;  1CDN A;  1YX8 A;  4MZL A;  4C0L A;  4QJ4 B;  1QJT A;  2MLE C;  1Y1A A;  3BXK A;  3PM8 A;  2KAX A;  4MEW A;  1H4B A;  1DJZ A;  1IQ3 A;  2LMV A;  2NCO A;  2ZN8 A;  1SL8 A;  5DKN A;  1OSA A;  1SKT A;  2LUX A;  1AHR A;  2ZKM X;  1IKU A;  2CTN A;  1TNP A;  1ZFS A;  2KAY A;  1IH0 A;  3ZWH A;  2LVJ A;  5I2Q A;  1G4Y R;  1RTP 1;  3EKH A;  2LVK A;  2JPT A;  1KSM A;  2SCP A;  1TTX A;  1OMR A;  2O5G A;  2GV5 A;  2R2I A;  3AAJ A;  1XFZ O;  1GGW A;  1WLZ A;  1ZOT B;  1NP8 A;  5PAL A;  3I5G B;  3DD4 A;  4YI9 A;  2L98 A;  3PAT A;  2KFG A;  4WQ3 A;  4GGF C;  2KQ6 A;  1JF0 A;  1SCV A;  1BLQ A;  1FBV A;  1NCY A;  2KHN A;  1AP4 A;  1A75 B;  5HKW A;  3BUW B;  4HRG A;  4PHM A;  2AUC A;  3SG2 A;  1K9U A;  4CFQ A;  2BBN A;  1SBJ A;  2WCF A;  3BUX B;  1DVI A;  2ZRT A;  5HLV A;  5CSN A;  2KI6 D;  1BR4 B;  1K2H A;  3TDI A; 
#chains in the Genus database with same CATH topology
 2FOT A;  3CZ0 A;  3OP0 A;  1DTL A;  2LHL A;  1NCX A;  1KSO A;  1XVJ A;  2JTZ A;  2ERB A;  1CNP A;  1TRF A;  1LVC D;  2BCX A;  1SNL A;  2PSR A;  3R72 A;  4WRI A;  3GK2 A;  5CSI A;  1W9Z A;  3KPX A;  1AUI B;  2BCA A;  1NSH A;  1RK9 A;  1ODB A;  4R1E A;  4U8D A;  1F4O A;  2P71 A;  2K7B A;  3TUY C;  5ER5 A;  2ZFD A;  4NDD A;  3O2P A;  4PT1 A;  4GBA A;  5D3O A;  1EL4 A;  3PN7 C;  4FTG A;  4M2P A;  1SL9 A;  2O60 A;  1ALW A;  1KQM C;  3AKA A;  1JFJ A;  3UO9 A;  3S0G A;  2PMY A;  1F8H A;  1MR8 A;  3N7H A;  1MF8 B;  1CDM A;  2K2F A;  1UHN A;  1XK4 C;  2BBM A;  1QV0 A;  3TDZ A;  4HSZ A;  2KSP A;  3M0W A;  1AVS A;  5HKY A;  5AXI A;  5K89 A;  3D74 A;  4Q04 A;  3BFA A;  1S36 A;  1OMV A;  3RM1 A;  1Y6W A;  4E68 A;  1DJG A;  3LLE A;  4ZCV A;  3CAB A;  4MSP A;  2KNE A;  2KBI A;  4ORC B;  2M7L A;  2LNK A;  5B8I B;  1A03 A;  1DMO A;  1WRL A;  4MRX A;  2JC2 A;  3PFV A;  2KGR A;  3FS7 A;  1S3P A;  3JVT B;  1CDP A;  1QX7 A;  2QEO A;  1DF0 B;  5BPJ A;  3LK0 A;  1QIW A;  4PDZ A;  1DGV A;  4N1G A;  2NLN A;  1WRZ A;  2JRF A;  2BKH B;  3D77 A;  3OB2 B;  3GOF A;  1EG3 A;  1Z2C B;  5KU1 A;  2WC8 A;  4GGF A;  1CLM A;  2G2B A;  2EC6 C;  4ORB B;  4BY4 A;  1J7P A;  4JPZ B;  3DVM A;  1UHJ A;  1XFU O;  3WNX B;  1ZAC A;  1GM0 A;  2I94 A;  1XFX O;  1XFV O;  2WCK A;  4P2Y B;  1CLL A;  3BUM B;  1ZUZ A;  1CFD A;  1QLS A;  1QVI Z;  2JU0 A;  1DJY A;  3DY9 A;  1IGV A;  2LCP A;  1REC A;  1DF0 A;  1NUB A;  3Q8I A;  4GFT A;  1QIV A;  1CTR A;  1UP5 A;  3D10 A;  2KOT A;  1VRK A;  2WCJ A;  4NDB A;  5HKZ A;  5I2O A;  1F70 A;  2BL0 C;  3PN7 B;  1KK7 Y;  1BT6 A;  1KQM B;  3CTN A;  4OV2 A;  1FI6 A;  5F6T A;  4UPG A;  1YX7 A;  5JOL A;  1LKJ A;  1V1F A;  1M46 A;  1EH2 A;  2HQW A;  1B47 A;  1B8C A;  2A4J A;  1YRU B;  3CYZ A;  3B88 A;  1KK7 Z;  5G08 A;  3NSI A;  1G8I A;  3S0E A;  2KI4 C;  2JUL A;  2OTG C;  2LP2 A;  4IJ7 A;  3AAK A;  2NZ0 A;  3OBV A;  1DJW A;  1F54 A;  1DQE A;  2EGD A;  1IJ6 A;  1QAS A;  2LMT A;  2V53 A;  2GGZ A;  1S6C A;  1M45 A;  2KFF A;  4NQG A;  2JXC A;  1RJV A;  2MRD A;  4PHN A;  3R1P A;  1TN4 A;  1A29 A;  1HQV A;  4USL A;  4XJK B;  4BY5 A;  3IQQ A;  3NGV A;  2VRG A;  5HL1 A;  1SL7 A;  2EC6 B;  2L2E A;  3ICB A;  3CR2 A;  1M63 B;  1NWD A;  3VRN A;  3CS1 A;  1NCZ A;  3I5I C;  5FI6 A;  1BOC A;  2E6W A;  1JC2 A;  5CPV A;  3VRP A;  3CZ1 A;  4MZK A;  1OQP A;  1EG4 A;  2L51 A;  2WCM A;  3BFB A;  3F45 A;  5I8N A;  1ORG A;  3S0A A;  2F8P A;  1MWN A;  3OB1 B;  2LAN A;  3SG6 A;  1K9K A;  1BF5 A;  1J1D A;  2HF5 A;  4XJK A;  1S6I A;  3LK1 A;  1M31 A;  1SPY A;  4YI8 A;  5FI7 A;  1UUR A;  1R2U A;  3EVU A;  1JF2 A;  3C1V A;  2KI6 C;  2LVI A;  2M1U A;  3L47 A;  3EK8 A;  3EVV A;  2PAL A;  2Y4Q A;  4MLW A;  4N1F A;  3VGO A;  1TNQ A;  2WOS A;  1EJ3 A;  1N65 A;  2AMI A;  4HRE E;  1MQ1 A;  2KI4 B;  2OTG B;  3BYA A;  5DKR A;  1K9P A;  1YVH A;  5AFP A;  2MAZ A;  1SSE B;  3EVR A;  1CMG A;  4GAO A;  3V2L A;  1CB1 A;  4FQO A;  4PHK A;  2LMU A;  3EKJ A;  3R1V A;  3FWB A;  1FI5 A;  2M97 A;  1TNX A;  4DRW A;  4MRY A;  2M1K B;  4CID A;  2M7N A;  2ZNE A;  3EG5 B;  3OX6 A;  1C7V A;  4JD9 A;  1MXE A;  3I5I B;  3K21 A;  4PE1 A;  2KFH A;  1XFR A;  2L2C A;  1TUZ A;  2KQY A;  2PYQ A;  3IVT A;  3PM2 A;  2FJU B;  1N0Y A;  2F2P A;  1AJ4 A;  1B9A A;  1EXR A;  2L50 A;  2KLE A;  3BOW B;  1A75 A;  1BJF A;  2M0R A;  2M9G A;  3OGN A;  1K96 A;  1KK8 C;  1YUT A;  3O78 A;  1BU3 A;  3BUN B;  2L4H A;  1DGU A;  4OVN F;  2BNX A;  3BUO B;  1B1G A;  1B4C A;  3NHT A;  2COL B;  2JWW A;  2G9B A;  2QPT A;  1AK8 A;  1TNW A;  1YUU A;  1CM4 A;  4YGD B;  2LE9 B;  2CCM A;  1OZS A;  4GNK B;  1Z4H A;  2GGM A;  5FYX A;  3O4X A;  2OS8 C;  2F3Y A;  1OOJ A;  1SK6 D;  1KFU S;  3BOW A;  3B7A A;  3I5F C;  2ZND A;  1YR5 A;  5GQQ C;  2F33 A;  4JQ0 D;  5AAN A;  3SS4 A;  2BKI B;  1N2D A;  1QLK A;  5I94 A;  1PK0 D;  3ZNI A;  1LS8 A;  1K94 A;  2FCE A;  2WC6 A;  2WOR A;  3L4L A;  1GJY A;  2LLS A;  4PE0 A;  2FCD A;  2TN4 A;  4GUK A;  1CM1 A;  4INX A;  2MBX A;  3D73 A;  2MLF C;  1CLB A;  1J1E A;  1T14 A;  3VRO A;  3AKB A;  1H8B A;  2DOQ A;  1TIZ A;  5AER A;  1QVI Y;  1RFJ A;  2NXQ A;  3D78 A;  3VRQ A;  3CZT X;  2QEH A;  1LXF C;  2H8V A;  1QXP A;  2QEB A;  2WCL A;  3SS5 A;  2I18 A;  2JT0 A;  2LHI A;  2JTT A;  2JZI A;  3DZT A;  1WY9 A;  2MA2 A;  1YUR A;  1X02 A;  3H4S E;  2K7C A;  1KK8 B;  1PSB A;  1K95 A;  4CFR A;  3R1O A;  5KSZ A;  4M2O A;  2M8U A;  2SAS A;  3I5H C;  1OOH A;  1SRA A;  3SJS A;  4AQI A;  2KLD A;  3NXA A;  4N5X A;  2LVV A;  1C07 A;  2P6B B;  3OHM B;  3FWC A;  2CBL A;  5IBW A;  1DEL A;  2BE4 A;  1YUS A;  3I5F B;  3DYE A;  1A2X A;  4ICB A;  1IRJ A;  2Q91 A;  3BJH A;  1OOF A;  1RRO A;  1UUS A;  4I5N B;  1ALV A;  4MVF A;  5CSF A;  3LCP C;  2Y5I A;  5KTY A;  1Y1X A;  3D76 A;  2P70 A;  1DJI A;  1BMO A;  1Q80 A;  1SY9 A;  3IQO A;  2ZN9 A;  3B6X A;  1J55 A;  4L9M A;  5J3X A;  3WXA A;  1XK4 A;  2JQ6 A;  1OE9 B;  1C7W A;  2L4I A;  3PSR A;  1SW8 A;  3S0D A;  3TZ1 A;  2KBM A;  3JTD C;  4PCW A;  3QRX A;  3CLN A;  1K93 D;  1P28 A;  4MN0 A;  2HQ8 A;  2LUC A;  1TWO A;  3I5G C;  4KYN A;  4OR9 B;  5EL2 A;  4GPL B;  2WCH A;  1E8A A;  1GQM A;  1IG5 A;  2K7O A;  2L0P A;  1CFC A;  3I5H B;  4YRU A;  2Y1N A;  1HT9 A;  1OMD A;  2B1U A;  1GGZ A;  2BL0 B;  2WC5 A;  2KYC A;  1B8R A;  4YGC B;  5JJG A;  1TOP A;  4AOM A;  1FPW A;  2K2A A;  1Y1U A;  4IL1 A;  1IQ5 A;  2K8M B;  3GK1 A;  2AAO A;  2PAS A;  1UHH A;  1UWO A;  3RZS A;  1J7Q A;  2BE6 A;  2JT3 A;  2EHB A;  3NSO A;  1F55 A;  1RWY A;  4A4C A;  2LLT A;  2PRU A;  1PUL A;  1NX3 A;  4F7F A;  2K0J A;  2F3Z A;  1OW4 A;  1W7J B;  2JNF A;  1C3Z A;  4DS7 A;  1A4P A;  2KAV A;  1L2O C;  2JPO A;  3DVJ A;  4YGE B;  4OKH A;  1JBA A;  4YGA A;  3PLF B;  3NHI A;  1F4Q A;  1KQV A;  3TDU A;  2KYF A;  1BG1 A;  5FI2 A;  3JTD B;  1B7T Y;  3K1E A;  4PE4 A;  1J7O A;  1J7R A;  1SR6 C;  1NYA A;  1SYM A;  1FW4 A;  4D1E A;  2LV7 A;  2H2K A;  1KFX S;  4NDC A;  4I5K A;  1CDL A;  1QS7 A;  2BEC A;  2M49 B;  3VRR A;  2K60 A;  1IWQ A;  2CNP A;  1AJ5 A;  4JKT A;  2L5X B;  1NX2 A;  1TCF A;  3PAL A;  1PAL A;  4JWQ A;  3S0F A;  1B7T Z;  2M3W A;  2LP3 A;  4CPV A;  4C0K A;  3EK7 A;  1K8U A;  3GK4 X;  4HRH A;  1KWO C;  1LA0 A;  3D75 A;  2JNX A;  3HCM A;  1S1E A;  2Y1M A;  3JVT C;  3QME A;  5DKQ A;  3KHE A;  1DEK A;  1JWD A;  3FIA A;  2CXJ A;  1IJ5 A;  1MHO A;  4WQ2 A;  2LLU A;  2WND A;  1BR1 B;  3NSL A;  1UHK A;  2L5Y A;  2D8N A;  1NX0 A;  4YGB B;  2LC5 A;  2OPO A;  1FF1 A;  3TS5 C;  2PQL A;  3FE8 A;  1L2O B;  4P5O E;  4FQT A;  3KF9 A;  1R6P A;  4C0J A;  3DVE A;  1F71 A;  3MSE B;  2JT8 A;  1SCM C;  1XO5 A;  1TUJ A;  1K90 D;  4QJ3 B;  5AEQ A;  1PRW A;  1QX5 B;  1XA5 A;  1XFY O;  1IIO A;  2KGB C;  3PJI A;  3A4U B;  2H61 C;  2I2R E;  1KFX L;  1WDC C;  3DF0 B;  2QAC A;  4DCK A;  4F0Z B;  2WCB A;  1WLM A;  2NCP A;  3DVK A;  1SR6 B;  1CFP A;  3SG4 A;  1NIW A;  4DUQ A;  3EK4 A;  5CSJ A;  5TNC A;  1L7Z A;  1ZMZ A;  3O4Y A;  4PE7 A;  2RGI A;  3SG5 A;  2QDI A;  1SMG A;  1G33 A;  2LM5 A;  1CKK A;  1MUX A;  3D0Y B;  2ISD A;  5ER4 X;  1QX2 A;  1JFK A;  1TCO B;  3SG3 A;  3DF0 A;  1KWO B;  3WHU B;  1LA3 A;  2Q4U A;  3CR5 X;  1QV1 A;  3SG7 A;  5D7F A;  1YTZ C;  3E3R A;  2JOJ A;  1KFU L;  3CGA A;  3A8R A;  2HET A;  1YRT B;  1Y0V H;  4CLN A;  2MJW B;  2OS8 B;  1OOI X;  2KDH A;  3FE6 A;  3HX4 A;  3KO0 A;  1M39 A;  3D0Y A;  3LL8 B;  1S26 D;  1QWV A;  2E30 A;  2JXL A;  1DJH A;  2KPH A;  1U5I B;  3RLZ A;  3TS5 B;  4QJ5 B;  5DIC A;  3O6B A;  1LIN A;  4I5J A;  1JSA A;  3TUY B;  1PSR A;  3BFH A;  3DXL A;  2CT9 A;  1CFF A;  1SCM B;  4M2Q A;  2WCE A;  3CDN A;  1XYD A;  3S0B A;  4MBE A;  4XYN A;  1OZO A;  3SIB A;  1W7I B;  5HLO A;  1WDC B;  4ZCU A;  4YBH B;  1B8L A;  3WHT B;  4I5L B;  4ETO A;  1U5I A;  1V1G A;  3CR4 X;  4DIR A;  1D1O A;  1UHI A;  3NSK A;  3SIA A;  2HPS A;  5D69 A;  1CMF A;  1YVL A;  4OCI A;  1KCY A;  4TNC A;  4A4B A;  4MZJ A;  4AQJ A;  2QEV A;  1NPQ A;  1NX1 A;  3VB1 A;  1XFW O;  1C3Y A;  1S5G Y;  2BCB A;  1PVA A;  2LAP A;  2H61 A;  2M29 A;  2MHH A;  1S6J A;  4ORA B;  5I2L A;  2IS9 A;  4GGN A;  3BQ3 A;  1DT7 B;  1QAT A;  1PVB A;  3B87 A;  4PHJ A;  4PAL A;  3CWG A;  2K7D A;  1QTX A;  2K61 A;  5HYD A;  1JUO A;  1WRK A;  2I7A A;  2YGU A;  2PVB A;  2ZRS A;  3IF7 A;  3OX5 A;  1MXL C;  1S5G Z;  2F2O A;  3KEV A;  1BOD A;  1DJX A;  1CDN A;  1YX8 A;  4MZL A;  4C0L A;  4QJ4 B;  2GTE A;  1QJT A;  2MLE C;  1Y1A A;  3BXK A;  3L4A A;  2FJY A;  2KAX A;  3PM8 A;  1DJZ A;  4MEW A;  3UNW A;  1H4B A;  1IQ3 A;  2LMV A;  2NCO A;  1OOG A;  2ZN8 A;  1SL8 A;  1DC1 A;  5DKN A;  1OSA A;  1SKT A;  2LUX A;  1AHR A;  2ZKM X;  3SS3 A;  1IKU A;  2CTN A;  1TNP A;  1ZFS A;  2KAY A;  1IH0 A;  3ZWH A;  2LVJ A;  5I2Q A;  1G4Y R;  1RTP 1;  3EKH A;  2LVK A;  2JPT A;  1KSM A;  2SCP A;  3FE9 A;  1TTX A;  1OMR A;  2O5G A;  2GV5 A;  2R2I A;  3AAJ A;  1XFZ O;  1GGW A;  1WLZ A;  1ZOT B;  4INW A;  1NP8 A;  4OZD A;  5PAL A;  3I5G B;  3DD4 A;  4YI9 A;  2L98 A;  3PAT A;  2KFG A;  4WQ3 A;  4GGF C;  3B86 A;  2KQ6 A;  1JF0 A;  3CZ2 A;  1SCV A;  1BLQ A;  1FBV A;  1NCY A;  2KHN A;  1AP4 A;  1A75 B;  5HKW A;  3BUW B;  4HRG A;  4PHM A;  2AUC A;  3SG2 A;  1K9U A;  4CFQ A;  2BAP A;  2BBN A;  1SBJ A;  2WCF A;  3BUX B;  1DVI A;  2ZRT A;  5HLV A;  5CSN A;  2KI6 D;  1BR4 B;  1K2H A;  3TDI A; 
#chains in the Genus database with same CATH homology
 2FOT A;  3OP0 A;  1DTL A;  2LHL A;  1NCX A;  1KSO A;  1XVJ A;  2JTZ A;  1CNP A;  1TRF A;  1LVC D;  2BCX A;  1SNL A;  2PSR A;  4WRI A;  3GK2 A;  5CSI A;  3KPX A;  1AUI B;  2BCA A;  1NSH A;  1RK9 A;  1ODB A;  4R1E A;  4U8D A;  1F4O A;  2K7B A;  5ER5 A;  2ZFD A;  4NDD A;  3O2P A;  4GBA A;  1EL4 A;  3PN7 C;  4FTG A;  4M2P A;  1SL9 A;  2O60 A;  1ALW A;  1KQM C;  3AKA A;  1JFJ A;  2PMY A;  1F8H A;  1MR8 A;  1MF8 B;  1CDM A;  2K2F A;  1UHN A;  1XK4 C;  2BBM A;  1QV0 A;  3TDZ A;  4HSZ A;  2KSP A;  3M0W A;  1AVS A;  5HKY A;  5AXI A;  5K89 A;  4Q04 A;  1S36 A;  1OMV A;  3RM1 A;  1Y6W A;  4E68 A;  1DJG A;  3LLE A;  4ZCV A;  4MSP A;  2KNE A;  2KBI A;  4ORC B;  2M7L A;  2LNK A;  5B8I B;  1DMO A;  1WRL A;  4MRX A;  2JC2 A;  3PFV A;  2KGR A;  3FS7 A;  1S3P A;  3JVT B;  1CDP A;  1QX7 A;  1DF0 B;  5BPJ A;  3LK0 A;  1QIW A;  4PDZ A;  1DGV A;  4N1G A;  2NLN A;  1WRZ A;  2JRF A;  2BKH B;  3OB2 B;  3GOF A;  1EG3 A;  5KU1 A;  2WC8 A;  4GGF A;  1CLM A;  2G2B A;  2EC6 C;  4ORB B;  4BY4 A;  1J7P A;  4JPZ B;  3DVM A;  1UHJ A;  1XFU O;  3WNX B;  1ZAC A;  2I94 A;  1XFX O;  1XFV O;  4P2Y B;  1CLL A;  3BUM B;  1ZUZ A;  1CFD A;  1QLS A;  1QVI Z;  2JU0 A;  1DJY A;  4GFT A;  1IGV A;  2LCP A;  1REC A;  1DF0 A;  1NUB A;  1QIV A;  1CTR A;  1UP5 A;  3D10 A;  2KOT A;  1VRK A;  4NDB A;  5HKZ A;  5I2O A;  1F70 A;  2BL0 C;  3PN7 B;  1KK7 Y;  1BT6 A;  1KQM B;  3CTN A;  4OV2 A;  1FI6 A;  5F6T A;  4UPG A;  1YX7 A;  5JOL A;  1LKJ A;  1V1F A;  1M46 A;  1EH2 A;  2HQW A;  1B47 A;  1B8C A;  2A4J A;  1YRU B;  1KK7 Z;  5G08 A;  3NSI A;  1G8I A;  2KI4 C;  2JUL A;  2OTG C;  2LP2 A;  3AAK A;  2NZ0 A;  1DJW A;  1F54 A;  2EGD A;  1IJ6 A;  1QAS A;  2LMT A;  2V53 A;  2GGZ A;  1S6C A;  1M45 A;  2KFF A;  4NQG A;  2JXC A;  1RJV A;  2MRD A;  4PHN A;  1TN4 A;  1A29 A;  1HQV A;  4USL A;  4XJK B;  4BY5 A;  3IQQ A;  2VRG A;  1SL7 A;  2EC6 B;  2L2E A;  3ICB A;  3CR2 A;  1M63 B;  1NWD A;  3VRN A;  3CS1 A;  1NCZ A;  3I5I C;  1BOC A;  2E6W A;  1JC2 A;  5CPV A;  3VRP A;  4MZK A;  1OQP A;  1EG4 A;  2L51 A;  3F45 A;  5I8N A;  2F8P A;  1MWN A;  3OB1 B;  2LAN A;  3SG6 A;  1K9K A;  1BF5 A;  1J1D A;  2HF5 A;  4XJK A;  1S6I A;  3LK1 A;  1M31 A;  1SPY A;  4YI8 A;  1UUR A;  1R2U A;  3EVU A;  1JF2 A;  3C1V A;  2KI6 C;  2LVI A;  2M1U A;  4MLW A;  3EK8 A;  3EVV A;  2PAL A;  2Y4Q A;  4N1F A;  3VGO A;  1TNQ A;  2WOS A;  1EJ3 A;  1N65 A;  2AMI A;  4HRE E;  1MQ1 A;  2KI4 B;  2OTG B;  3BYA A;  5DKR A;  1K9P A;  1YVH A;  5AFP A;  2MAZ A;  3EVR A;  1CMG A;  4GAO A;  1CB1 A;  4FQO A;  4PHK A;  2LMU A;  3EKJ A;  3FWB A;  1FI5 A;  2M97 A;  1TNX A;  4DRW A;  4MRY A;  2M1K B;  4CID A;  2M7N A;  2ZNE A;  3OX6 A;  1C7V A;  1MXE A;  3I5I B;  3K21 A;  4PE1 A;  2KFH A;  2KQY A;  2FJU B;  1N0Y A;  2F2P A;  1AJ4 A;  1B9A A;  1EXR A;  2L50 A;  3BOW B;  1A75 A;  1BJF A;  2M0R A;  2M9G A;  1K96 A;  1KK8 C;  1YUT A;  3O78 A;  1BU3 A;  3BUN B;  2L4H A;  1DGU A;  4OVN F;  3BUO B;  1B1G A;  1B4C A;  2COL B;  2JWW A;  2G9B A;  2QPT A;  1AK8 A;  1TNW A;  1YUU A;  1CM4 A;  4YGD B;  2LE9 B;  2CCM A;  1OZS A;  4GNK B;  2GGM A;  5FYX A;  2OS8 C;  2F3Y A;  1OOJ A;  1SK6 D;  1KFU S;  3BOW A;  3I5F C;  2ZND A;  1YR5 A;  5GQQ C;  2F33 A;  4JQ0 D;  5AAN A;  2BKI B;  1N2D A;  1QLK A;  1PK0 D;  3ZNI A;  1K94 A;  2FCE A;  2WOR A;  4PE0 A;  2MBX A;  1GJY A;  2LLS A;  3TUY C;  2FCD A;  2TN4 A;  4GUK A;  1CM1 A;  2MLF C;  1CLB A;  1J1E A;  3VRO A;  3AKB A;  1H8B A;  2DOQ A;  1TIZ A;  5AER A;  1QVI Y;  1RFJ A;  2NXQ A;  3VRQ A;  3CZT X;  1LXF C;  1QXP A;  2I18 A;  2JT0 A;  2LHI A;  2JTT A;  2JZI A;  1WY9 A;  2MA2 A;  1YUR A;  1X02 A;  3H4S E;  2K7C A;  1KK8 B;  1PSB A;  1K95 A;  4CFR A;  5KSZ A;  4M2O A;  2M8U A;  2SAS A;  3I5H C;  1SRA A;  3SJS A;  4AQI A;  3NXA A;  4N5X A;  2LVV A;  1C07 A;  2P6B B;  3OHM B;  3FWC A;  2CBL A;  5IBW A;  2BE4 A;  1YUS A;  3I5F B;  1A2X A;  4ICB A;  1IRJ A;  2Q91 A;  1RRO A;  1UUS A;  4I5N B;  1ALV A;  4MVF A;  5CSF A;  3LCP C;  2Y5I A;  5KTY A;  1Y1X A;  1DJI A;  1BMO A;  1Q80 A;  1SY9 A;  3IQO A;  2ZN9 A;  1J55 A;  4L9M A;  5J3X A;  3WXA A;  1XK4 A;  2JQ6 A;  1OE9 B;  1C7W A;  2L4I A;  3PSR A;  1SW8 A;  3TZ1 A;  2KBM A;  3JTD C;  4PCW A;  3QRX A;  3CLN A;  1K93 D;  4MN0 A;  2HQ8 A;  2LUC A;  3I5G C;  4OR9 B;  4GPL B;  1E8A A;  1GQM A;  1IG5 A;  2K7O A;  2L0P A;  1CFC A;  3I5H B;  4YRU A;  2Y1N A;  1HT9 A;  1OMD A;  2B1U A;  1GGZ A;  2BL0 B;  4YGC B;  2KYC A;  1B8R A;  5JJG A;  1TOP A;  4AOM A;  1FPW A;  2K2A A;  1Y1U A;  4IL1 A;  1IQ5 A;  2K8M B;  3GK1 A;  2AAO A;  2PAS A;  1UHH A;  1UWO A;  1J7Q A;  2BE6 A;  2JT3 A;  2EHB A;  3NSO A;  1F55 A;  1RWY A;  4A4C A;  2LLT A;  2PRU A;  1PUL A;  1NX3 A;  2K0J A;  2F3Z A;  1W7J B;  2JNF A;  4DS7 A;  1A4P A;  2KAV A;  1L2O C;  3DVJ A;  4YGE B;  4OKH A;  1JBA A;  4YGA A;  3PLF B;  1F4Q A;  1KQV A;  3TDU A;  2KYF A;  1BG1 A;  3JTD B;  1B7T Y;  4PE4 A;  1J7O A;  1J7R A;  1SR6 C;  1NYA A;  1SYM A;  1FW4 A;  4D1E A;  2LV7 A;  2H2K A;  1KFX S;  4NDC A;  4I5K A;  1CDL A;  1QS7 A;  2BEC A;  2M49 B;  3VRR A;  2CNP A;  1IWQ A;  1AJ5 A;  4JWQ A;  2L5X B;  1NX2 A;  1TCF A;  3PAL A;  1PAL A;  1B7T Z;  2M3W A;  2LP3 A;  4CPV A;  4C0K A;  3EK7 A;  1K8U A;  3GK4 X;  4HRH A;  1KWO C;  1LA0 A;  2JNX A;  3HCM A;  1S1E A;  2Y1M A;  3JVT C;  5DKQ A;  3KHE A;  1JWD A;  3FIA A;  2CXJ A;  1IJ5 A;  1MHO A;  4WQ2 A;  2LLU A;  2WND A;  1BR1 B;  3NSL A;  1UHK A;  2D8N A;  1NX0 A;  4YGB B;  2LC5 A;  2OPO A;  1FF1 A;  3TS5 C;  4P5O E;  1L2O B;  3KF9 A;  1R6P A;  4C0J A;  3DVE A;  1F71 A;  3MSE B;  2JT8 A;  1SCM C;  1XO5 A;  1K90 D;  4QJ3 B;  5AEQ A;  1PRW A;  1QX5 B;  1XA5 A;  1XFY O;  2KGB C;  3A4U B;  2H61 C;  2I2R E;  1KFX L;  1WDC C;  3DF0 B;  2QAC A;  4DCK A;  4F0Z B;  2WCB A;  1WLM A;  2NCP A;  3DVK A;  1SR6 B;  1CFP A;  3SG4 A;  1NIW A;  4DUQ A;  3EK4 A;  5CSJ A;  5TNC A;  1L7Z A;  1ZMZ A;  3O4Y A;  4PE7 A;  2RGI A;  3SG5 A;  1SMG A;  1G33 A;  2LM5 A;  1CKK A;  1MUX A;  3D0Y B;  2ISD A;  5ER4 X;  1QX2 A;  1JFK A;  1TCO B;  3SG3 A;  3DF0 A;  1KWO B;  3WHU B;  1LA3 A;  2Q4U A;  3CR5 X;  1QV1 A;  3SG7 A;  5D7F A;  1YTZ C;  3E3R A;  2JOJ A;  1KFU L;  3CGA A;  3A8R A;  2HET A;  1YRT B;  1Y0V H;  4CLN A;  2MJW B;  2OS8 B;  2KDH A;  3KO0 A;  3HX4 A;  1M39 A;  3D0Y A;  3LL8 B;  1S26 D;  2E30 A;  2JXL A;  1DJH A;  1U5I B;  3RLZ A;  3TS5 B;  4QJ5 B;  3O6B A;  1LIN A;  4I5J A;  1JSA A;  3TUY B;  1PSR A;  2CT9 A;  1CFF A;  1SCM B;  4M2Q A;  2WCE A;  1XYD A;  4MBE A;  4XYN A;  1OZO A;  3SIB A;  1W7I B;  5HLO A;  1WDC B;  4ZCU A;  4YBH B;  1B8L A;  3WHT B;  4I5L B;  4ETO A;  1U5I A;  1V1G A;  3CR4 X;  4DIR A;  1D1O A;  1UHI A;  3NSK A;  3SIA A;  2HPS A;  5D69 A;  1CMF A;  1YVL A;  4OCI A;  1KCY A;  4TNC A;  4A4B A;  4MZJ A;  4AQJ A;  1NPQ A;  1NX1 A;  1XFW O;  1S5G Y;  2BCB A;  1PVA A;  2LAP A;  2H61 A;  2M29 A;  2MHH A;  1S6J A;  4ORA B;  5I2L A;  2IS9 A;  4GGN A;  3BQ3 A;  1DT7 B;  1QAT A;  1PVB A;  4PHJ A;  4PAL A;  3CWG A;  2K7D A;  1QTX A;  2K61 A;  5HYD A;  1JUO A;  1WRK A;  2I7A A;  3IF7 A;  2PVB A;  2ZRS A;  3OX5 A;  1A03 A;  1MXL C;  1S5G Z;  2F2O A;  3KEV A;  1BOD A;  1DJX A;  1CDN A;  1YX8 A;  4MZL A;  4C0L A;  4QJ4 B;  1QJT A;  2MLE C;  1Y1A A;  3BXK A;  3PM8 A;  2KAX A;  4MEW A;  1H4B A;  1DJZ A;  1IQ3 A;  2LMV A;  2NCO A;  2ZN8 A;  1SL8 A;  5DKN A;  1OSA A;  1SKT A;  2LUX A;  1AHR A;  2ZKM X;  1IKU A;  2CTN A;  1TNP A;  1ZFS A;  2KAY A;  1IH0 A;  3ZWH A;  2LVJ A;  5I2Q A;  1G4Y R;  1RTP 1;  3EKH A;  2LVK A;  2JPT A;  1KSM A;  2SCP A;  1TTX A;  1OMR A;  2O5G A;  2GV5 A;  2R2I A;  3AAJ A;  1XFZ O;  1GGW A;  1WLZ A;  1ZOT B;  1NP8 A;  5PAL A;  3I5G B;  3DD4 A;  4YI9 A;  2L98 A;  3PAT A;  2KFG A;  4WQ3 A;  4GGF C;  2KQ6 A;  1JF0 A;  1SCV A;  1BLQ A;  1FBV A;  1NCY A;  2KHN A;  1AP4 A;  1A75 B;  5HKW A;  3BUW B;  4HRG A;  4PHM A;  2AUC A;  3SG2 A;  1K9U A;  4CFQ A;  2BBN A;  1SBJ A;  2WCF A;  3BUX B;  1DVI A;  2ZRT A;  5HLV A;  5CSN A;  2KI6 D;  1BR4 B;  1K2H A;  3TDI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...