4Q04A

Crystal structure of ure3-bp from entomaeba histolytica without calcium
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
212
structure length
212
Chain Sequence
CLWNLQPIQGSWMGAACIYQMPPSVRNTWWFPLLNTIPLDQYTRIYQWFMGVDRDRSGTLEINELMMGQFPGGIRLSPQTALRMMRIFDTDFNGHISFYEFMAMYKFMELAYNLFVMNDRNRSGTLEPHEILPALQQLGFYINQRTSLLLHRLFARGMAFCDLNCWIAICAFAAQTRSAYQMIFMNPYYGPMKPFNPMEFGKFLDVVTSLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords URE3-BP sequence specific DNA binding protein
publication title Crystal structure of URE3-BP from Entomaeba histolytica
rcsb
source organism Entamoeba histolytica
total genus 72
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4q04A00
3JVTB 1QX5B 2BCBA 1MR8A 1Y0VH 3TUYB 1SRAA 5ER4X 1TNWA 1IQ5A 4XJKA 3VROA 2RGIA 1DT7B 1LINA 4MVFA 4YI9A 4GAOA 1C07A 1QIVA 2JULA 2LMVA 1QVIY 3SG2A 2ISDA 1C7WA 3JTDB 2JC2A 1MXLC 1DMOA 3CLNA 2K7DA 2GV5A 1KCYA 1J7QA 1S1EA 2LV7A 1SCVA 3BUNB 4E68A 2LVVA 3CR4X 1DGUA 3I5GC 2KBMA 3LK0A 2JNFA 1QX2A 1IKUA 1JF0A 2K8MB 4GGFA 2KDHA 1GGZA 1SYMA 2A4JA 2KAVA 3RLZA 2AUCA 1XK4A 4P2YB 1K95A 1MUXA 2EC6B 2JRFA 3O6BA 2LCPA 4OVNF 1CKKA 1L7ZA 3AAKA 2O5GA 2FCEA 3SG6A 1QATA 3BUOB 3TDIA 2M1KB 4GGFC 3BXKA 3H4SE 1G4YR 4HSZA 1CFFA 4CLNA 1CDMA 1PALA 1GGWA 4PCWA 1AHRA 2FJUB 2KGBC 4IL1A 1EG3A 1TNXA 1HT9A 4DCKA 2COLB 4BY4A 3TS5C 5HKWA 1LKJA 2PMYA 4FQOA 2BBNA 4QJ3B 1JBAA 1OMVA 1TCFA 3LLEA 3PSRA 3WNXB 1CDNA 2MRDA 2LP3A 4OR9B 1KFUL 2L50A 2E6WA 2JWWA 4YRUA 1ZMZA 2Y5IA 4JQ0D 1XFVO 4MZKA 1QLSA 2H2KA 2KI4C 5DKNA 4CFQA 2KYFA 4M2PA 2EHBA 1ODBA 1F4QA 1AUIB 1VRKA 1KQVA 2P6BB 1RTP1 2KFHA 3OB1B 2JT3A 1CMGA 1SK6D 2KYCA 1CM4A 1AJ5A 1YUUA 1YRUB 2K0JA 1M46A 2GGMA 1CDPA 2M7NA 3FIAA 3VRNA 3BUMB 3WXAA 2OS8B 1ZACA 3KF9A 5I2LA 1DGVA 2CCMA 1RECA 1BJFA 2PASA 3IQQA 1B8CA 4OV2A 1KSOA 3BUWB 1SCMC 2CTNA 3DVKA 1IG5A 3BOWA 1TIZA 2BCAA 4BY5A 2NLNA 1UUSA 1YRTB 3SIAA 1K2HA 2I18A 1TRFA 3EVRA 1QJTA 1TN4A 4XJKB 1CDLA 4I5JA 1J1DA 4NDCA 4C0KA 1A75A 3FWCA 5F6TA 4Q04A 1J55A 1KWOB 1RROA 5HLVA 1GJYA 1F70A 1W7IB 4MN0A 3D10A 1DF0A 4GUKA 1PSRA 2QACA 1B9AA 5DKRA 2ZNEA 2LAPA 1IH0A 2ZFDA 2ZNDA 1QTXA 2L2EA 2M3WA 1FBVA 1J7OA 2BL0C 1MF8B 4PE0A 2F3ZA 2LMUA 3SIBA 1JC2A 1BT6A 4ORAB 1PULA 1LA3A 1WRLA 2MAZA 2F33A 3DF0A 4QJ4B 1WDCC 1BR4B 1UURA 1DJIA 2CT9A 2JXCA 1QV0A 1XO5A 2SCPA 1AK8A 4I5KA 4N1GA 4AQIA 1B7TZ 3EVUA 1QLKA 4QJ5B 1S5GZ 4AOMA 1S6JA 1NX2A 5B8IB 3HCMA 1DJGA 1S6IA 2KI4B 2JTZA 3I5HB 1IJ5A 3PFVA 4DIRA 3A4UB 3TDUA 3FWBA 2HF5A 3E3RA 4ETOA 2HQWA 4HRHA 5BPJA 2L51A 4MRYA 2LVKA 2MLFC 2PRUA 1CLMA 1B8RA 1JFJA 3BUXB 4TNCA 2LHIA 5JOLA 1A29A 1GQMA 5I2QA 4GNKB 2PVBA 3EK7A 1K9PA 4PE1A 4NDBA 4WQ2A 3SJSA 1KWOC 1RWYA 2JPTA 3QRXA 1SL8A 4A4BA 1SCMB 2KFGA 1TOPA 1A4PA 3KHEA 1CTRA 5AANA 1BOCA 4OKHA 4PHMA 4U8DA 5FYXA 2K61A 1DJWA 2Y1NA 4A4CA 2NXQA 3SG4A 3IF7A 2LLUA 1AJ4A 1YVLA 2KNEA 1QXPA 1Y1XA 1SL7A 1HQVA 2MJWB 1FI5A 2ZN8A 1G8IA 2ZN9A 1UHHA 1DVIA 2LC5A 1G33A 1KFXS 2CXJA 2NCPA 2KFFA 2QPTA 2WOSA 2I7AA 1U5IB 1XK4C 4CFRA 1TNPA 1LXFC 3NSIA 3PALA 1EH2A 1A75B 2NCOA 1XVJA 1K93D 3CTNA 1JFKA 3PATA 5HYDA 1Q80A 2BL0B 3GK4X 2F2OA 1WRZA 1DF0B 1OSAA 3WHUB 3VRPA 4ORBB 1QV1A 4P5OE 4MRXA 1FW4A 2I2RE 3FS7A 1E8AA 1ALWA 1DJYA 1WDCB 2CBLA 1V1GA 2F3YA 5K89A 4JPZB 2PSRA 2KAYA 1SY9A 4ICBA 3I5HC 5TNCA 2FCDA 2KHNA 3PM8A 4ORCB 1F71A 3K21A 1LVCD 3NSKA 4WQ3A 1YTZC 3CR5X 5CSNA 1L2OB 1QX7A 2AAOA 3A8RA 4PHNA 1IRJA 3GK1A 5I8NA 1F8HA 2GGZA 4GFTA 1OE9B 1OMRA 3CR2A 4PHJA 2LP2A 4MEWA 1QVIZ 5HKZA 2SASA 1MWNA 1MQ1A 1KK7Y 5ER5A 1DTLA 2O60A 1WRKA 1AVSA 3SG5A 1KFXL 3DVJA 1XFWO 1NYAA 2LVIA 5GQQC 1SL9A 3WHTB 2ZRTA 1H8BA 1OOJA 3EK4A 2JQ6A 4GBAA 4YGAA 1OZOA 3O4YA 5KU1A 4MSPA 1UHJA 2BKIB 2MHHA 3GOFA 1K94A 1DJZA 2KAXA 1PVBA 1EXRA 5CSIA 2JXLA 2JT8A 1YR5A 2K2FA 4YGBB 1KSMA 3OB2B 5AEQA 2KOTA 4NDDA 1UHKA 5D7FA 2WCEA 3AAJA 1RJVA 5I2OA 1XYDA 3D0YA 3CGAA 3I5FC 1XFUO 3LL8B 4CPVA 1SW8A 1PK0D 2L5XB 1NSHA 4HRGA 3OX5A 2MBXA 1B4CA 3PN7C 1RFJA 2JNXA 4DS7A 1SMGA 1RK9A 2LVJA 3EVVA 4YGDB 4JWQA 2OPOA 3RM1A 1FPWA 1BG1A 3KEVA 2JZIA 1KK8C 1L2OC 1V1FA 4CIDA 2M1UA 1NCZA 1QASA 3I5IC 3O2PA 1CFPA 1XFYO 1TTXA 5CSFA 2M7LA 4FTGA 2JT0A 1CLBA 1W7JB 2M29A 1Y1AA 3CWGA 3NSLA 2KBIA 3OHMB 1H4BA 3M0WA 2H61A 1YURA 1WLMA 4R1EA 1BF5A 1OQPA 1WY9A 2LMTA 1IGVA 1ZOTB 2WC8A 2BBMA 1JUOA 2VRGA 4ZCUA 1ALVA 1F55A 2R2IA 4HREE 3VRQA 2K7BA 1X02A 1JWDA 2LLSA 3GK2A 1J7PA 3BQ3A 1TCOB 1K9KA 3NSOA 4L9MA 2WCBA 1KFUS 3O78A 1IQ3A 2M97A 4PALA 1SPYA 1XFZO 5DKQA 2G2BA 4GPLB 1CLLA 3BOWB 1NWDA 1A2XA 5AERA 1EG4A 3TZ1A 1UHNA 1WLZA 4YI8A 5AFPA 4I5LB 2JU0A 1NCYA 1MXEA 2B1UA 4DUQA 1BLQA 4DRWA 5KSZA 4MZLA 1SR6C 1IJ6A 1QS7A 2I94A 1NX1A 2F2PA 1BMOA 1CB1A 2KQYA 1LA0A 2G9BA 4M2OA 2EGDA 1Y1UA 3SG3A 2JOJA 1QIWA 3OX6A 2V53A 1MHOA 1PVAA 1YUTA 1YX8A 3I5FB 4XYNA 2CNPA 5D69A 2LNKA 4PDZA 4GGNA 2M0RA 1J1EA 4ZCVA 2LE9B 1UP5A 2M8UA 3KPXA 1UWOA 5IBWA 1F4OA 3OP0A 1K96A 3DD4A 5CSJA 3PN7B 3D0YB 1K90D 2MA2A 2Y1MA 2ZRSA 3DVEA 3DF0B 1SKTA 2WCFA 2BECA 4N5XA 1KK8B 2ZKMX 1FI6A 2IS9A 2MLEC 3EKHA 2D8NA 1CM1A 1JSAA 1BU3A 1S36A 1CMFA 1CNPA 1YVHA 2KQ6A 3I5IB 1B7TY 4AQJA 2OTGC 5KTYA 1S5GY 2PALA 5AXIA 1KQMC 4NQGA 2HPSA 3JVTC 1M63B 1NIWA 2KSPA 3TUYC 1N2DA 5HKYA 4YBHB 2BCXA 2Q4UA 1OZSA 2E30A 3CZTX 1J7RA 1NPQA 1R6PA 4D1EA 2K7OA 1EL4A 1N0YA 3HX4A 1K8UA 2M49B 2WNDA 1FF1A 1ZUZA 4I5NB 3JTDC 4OCIA 4USLA 1UHIA 2BE6A 2LUCA 4WRIA 3VGOA 3CS1A 1M45A 1YX7A 1YUSA 2K7CA 5PALA 1NX0A 2FOTA 5G08A 5JJGA 1BODA 1M31A 3AKAA 1R2UA 1XA5A 3KO0A 1M39A 4MLWA 4YGEB 3VRRA 1U5IA 1F54A 3ZNIA 4F0ZB 2F8PA 2EC6C 3PLFB 1DJXA 1B8LA 2LM5A 3F45A 4MZJA 2Y4QA 1NCXA 1SR6B 2BE4A 3DVMA 3TDZA 1BR1B 1S26D 3ICBA 3I5GB 2AMIA 1XFXO 1K9UA 2L4IA 3IQOA 4UPGA 1OMDA 2L0PA 4M2QA 3BYAA 4MBEA 2Q91A 1S6CA 2KGRA 2LANA 4PE4A 2KI6D 1C7VA 1PSBA 1CFCA 1AP4A 2LUXA 1PRWA 3LK1A 1JF2A 2HETA 4C0LA 4N1FA 1SNLA 2K2AA 5CPVA 5HLOA 2JTTA 4C0JA 2TN4A 1TNQA 3EKJA 4PHKA 1B47A 1A03A 1KQMB 2DOQA 4YGCB 2LLTA 1SBJA 1NX3A 1Y6WA 3TS5B 4PE7A 1S3PA 2LHLA 1D1OA 1KK7Z 3ZWHA 2M9GA 3NXAA 1NP8A 1IWQA 3C1VA 1ZFSA 3EK8A 3MSEB 1B1GA 3AKBA 3SG7A 5J3XA 2L98A 2L4HA 2WORA 2HQ8A 1EJ3A 2OTGB 3LCPC 1CFDA 2KI6C 2NZ0A 1DJHA 2OS8C 2BKHB 1NUBA 1N65A 2H61C
chains in the Genus database with same CATH superfamily
3JVTB 1QX5B 2BCBA 1MR8A 1Y0VH 3TUYB 1OOFA 1SRAA 5ER4X 1TNWA 1IQ5A 4XJKA 3VROA 2RGIA 1DT7B 1LINA 4MVFA 3R72A 4YI9A 4GAOA 1C07A 3D78A 1QIVA 2JULA 2LMVA 1QVIY 3SG2A 2ISDA 1C7WA 3JTDB 2JC2A 1MXLC 1TWOA 1DMOA 3CLNA 2K7DA 2QEHA 2GV5A 1KCYA 1J7QA 1S1EA 2LV7A 1SCVA 3BUNB 3CZ2A 4E68A 2LVVA 3CR4X 1DGUA 3I5GC 2KBMA 3LK0A 4PT1A 2JNFA 1QX2A 1IKUA 1JF0A 2K8MB 4GGFA 2KDHA 2P70A 1GGZA 1SYMA 2A4JA 2KAVA 5EL2A 2AUCA 1XK4A 4P2YB 3RLZA 1K95A 1MUXA 2EC6B 1DEKA 2JRFA 2LCPA 3O6BA 4OVNF 1CKKA 1L7ZA 3AAKA 2O5GA 2FCEA 3SG6A 1QATA 3R1VA 3BUOB 3TDIA 2M1KB 4GGFC 3BXKA 3H4SE 1G4YR 4HSZA 2JPOA 1CFFA 4CLNA 1CDMA 1PALA 1GGWA 4PCWA 1AHRA 2FJUB 2KGBC 4IL1A 1EG3A 1TNXA 1HT9A 4DCKA 2COLB 4BY4A 3TS5C 5HKWA 1LKJA 2PMYA 4FQOA 2BBNA 4QJ3B 1JBAA 1OMVA 1TCFA 3LLEA 3PSRA 3WNXB 1CDNA 2MRDA 2LP3A 4OR9B 1KFUL 2L50A 2E6WA 2JWWA 4YRUA 3SS5A 1ZMZA 2Y5IA 4JQ0D 1XFVO 4MZKA 2K60A 1QLSA 2H2KA 1SSEB 2KI4C 5DKNA 2KYFA 4M2PA 4CFQA 2EHBA 1ODBA 1F4QA 3L4AA 1C3YA 1AUIB 1VRKA 1KQVA 2P6BB 1RTP1 2KFHA 3OB1B 2JT3A 1CMGA 1SK6D 2KYCA 1CM4A 1AJ5A 1YUUA 1YRUB 2K0JA 1M46A 2GGMA 1CDPA 2M7NA 3FIAA 3VRNA 2ERBA 3BUMB 3WXAA 3S0DA 2OS8B 1ZACA 3KF9A 5I2LA 1DGVA 2CCMA 1RECA 1BJFA 2PASA 3IQQA 1B8CA 1QWVA 4OV2A 3S0AA 1KSOA 3BUWB 1SCMC 2CTNA 3DVKA 1IG5A 3BOWA 1TIZA 2BCAA 4BY5A 2NLNA 1UUSA 1YRTB 3SIAA 1K2HA 2I18A 1TRFA 3EVRA 1QJTA 1TN4A 4XJKB 1CDLA 4I5JA 1J1DA 4NDCA 4C0KA 1A75A 3FWCA 5F6TA 4Q04A 1J55A 1KWOB 3PM2A 1RROA 5HLVA 1GJYA 1F70A 1W7IB 3S0GA 4MN0A 3D10A 1DF0A 1OW4A 4GUKA 1PSRA 2QACA 1B9AA 5DKRA 2ZNEA 2LAPA 1IH0A 3NHIA 2ZFDA 2ZNDA 1QTXA 1C3ZA 2L2EA 2M3WA 1FBVA 1W9ZA 1J7OA 2BL0C 1MF8B 4PE0A 2F3ZA 2LMUA 3SIBA 1JC2A 1BT6A 3OBVA 1PULA 4ORAB 5I94A 1LA3A 1WRLA 2MAZA 2F33A 3DF0A 4QJ4B 1WDCC 1BR4B 1UURA 1DJIA 2CT9A 2JXCA 1QV0A 1XO5A 2SCPA 1AK8A 4I5KA 2P71A 4N1GA 4AQIA 3RZSA 1B7TZ 3EVUA 1OOHA 1QLKA 3O4XA 4QJ5B 1S5GZ 3NHTA 4AOMA 1S6JA 1NX2A 5B8IB 3HCMA 1DJGA 4JKTA 1S6IA 2KI4B 2JTZA 3D76A 3D75A 1IJ5A 3I5HB 3PFVA 4DIRA 3A4UB 3TDUA 3FWBA 2HF5A 3E3RA 4ETOA 2HQWA 4HRHA 3S0EA 5BPJA 2L51A 2BAPA 2LVKA 2MLFC 2PRUA 4MRYA 1CLMA 1B8RA 1JFJA 4IJ7A 3B6XA 3BUXB 4TNCA 2LHIA 5JOLA 1A29A 1GQMA 5I2QA 3D73A 4GNKB 2PVBA 3EK7A 1K9PA 4PE1A 4NDBA 4WQ2A 3EG5B 3SJSA 1KWOC 1RWYA 2JPTA 3QRXA 1SL8A 2WCMA 4A4BA 1SCMB 2KFGA 1TOPA 1A4PA 3KHEA 1CTRA 5AANA 1BOCA 4OKHA 4PHMA 1T14A 4U8DA 5FYXA 2K61A 1DJWA 2Y1NA 3DZTA 5FI6A 4A4CA 2NXQA 3SG4A 3IF7A 2LLUA 1AJ4A 5D3OA 1YVLA 3NGVA 2KNEA 1QXPA 1Y1XA 3CABA 1SL7A 1HQVA 2MJWB 5DICA 1FI5A 2ZN8A 1G8IA 2ZN9A 1UHHA 1DVIA 2LC5A 3B88A 1G33A 1KFXS 2CXJA 2NCPA 2KFFA 2QPTA 2WOSA 3V2LA 2I7AA 1U5IB 1XK4C 4CFRA 1TNPA 3B87A 1LXFC 3NSIA 3PALA 1EH2A 1A75B 2NCOA 2PQLA 1XVJA 1K93D 3S0BA 3CTNA 2L2CA 1JFKA 3PATA 5HYDA 1Q80A 2BL0B 3GK4X 2F2OA 3K1EA 1WRZA 1DF0B 1OSAA 3WHUB 3VRPA 4ORBB 1QV1A 4OZDA 4P5OE 4MRXA 1FW4A 2WCLA 2I2RE 3FS7A 1E8AA 1ALWA 1DJYA 1WDCB 2CBLA 1V1GA 2F3YA 5K89A 1DELA 4JPZB 2PSRA 2KAYA 1SY9A 4ICBA 2BNXA 3I5HC 5TNCA 2FCDA 2KHNA 3PM8A 4ORCB 1F71A 3K21A 1LVCD 3NSKA 4WQ3A 1YTZC 1Z2CB 4JD9A 3CR5X 5CSNA 1L2OB 1QX7A 2AAOA 3A8RA 4PHNA 1IRJA 3GK1A 5I8NA 1F8HA 2GGZA 4GFTA 1OE9B 1OMRA 3CR2A 4PHJA 3UNWA 2LP2A 4MEWA 1QVIZ 5HKZA 2SASA 1MWNA 3FE6A 1MQ1A 1KK7Y 5ER5A 5FI7A 1DTLA 2O60A 1WRKA 1AVSA 3SG5A 2PYQA 1KFXL 3DVJA 1XFWO 1NYAA 2LVIA 5GQQC 1SL9A 3WHTB 2ZRTA 1H8BA 1OOJA 3EK4A 2JQ6A 4GBAA 4YGAA 1OZOA 1OOIX 3O4YA 4INXA 5KU1A 4MSPA 1UHJA 2BKIB 2MHHA 3GOFA 1K94A 1DJZA 2KAXA 1PVBA 1TUZA 1EXRA 5CSIA 2JXLA 2JT8A 1YR5A 2K2FA 1GM0A 4YGBB 1KSMA 3OB2B 5AEQA 2KOTA 4NDDA 1UHKA 1OOGA 3L4LA 5D7FA 2WCEA 3AAJA 1RJVA 5I2OA 1DC1A 1XYDA 3Q8IA 3D0YA 3L47A 3CGAA 3I5FC 1XFUO 3LL8B 4CPVA 1SW8A 1PK0D 2L5XB 1NSHA 4HRGA 3OX5A 2MBXA 1B4CA 1IIOA 3PN7C 1RFJA 2JNXA 4DS7A 1SMGA 1RK9A 2LVJA 3EVVA 4YGDB 4JWQA 2OPOA 3RM1A 1FPWA 1BG1A 3KEVA 2JZIA 1KK8C 1L2OC 1V1FA 3B86A 3QMEA 4CIDA 2M1UA 1NCZA 3D74A 1QASA 3I5IC 3O2PA 1CFPA 1XFYO 1TTXA 5CSFA 3PJIA 2M7LA 4FTGA 2JT0A 1CLBA 3CZ0A 2WC5A 1W7JB 2M29A 1Y1AA 3CWGA 3NSLA 2KBIA 3DXLA 3OHMB 1H4BA 3M0WA 2H61A 1YURA 1WLMA 4R1EA 3SS3A 1BF5A 1OQPA 1WY9A 2LMTA 1IGVA 1ZOTB 2WC8A 2BBMA 1JUOA 2VRGA 4ZCUA 1ALVA 1F55A 2R2IA 4HREE 3VRQA 2K7BA 1X02A 1JWDA 2LLSA 3GK2A 1J7PA 3BQ3A 1TCOB 1K9KA 3NSOA 4L9MA 2WCBA 2QDIA 3FE9A 1KFUS 3O78A 1IQ3A 2M97A 4PALA 1SPYA 1XFZO 5DKQA 2G2BA 4GPLB 3BFBA 1CLLA 3BOWB 1NWDA 1A2XA 5AERA 1EG4A 3TZ1A 1UHNA 1WLZA 4YI8A 5AFPA 4I5LB 2JU0A 1DQEA 1MXEA 1NCYA 2B1UA 2GTEA 4DUQA 4DRWA 5KSZA 1BLQA 2KLEA 4MZLA 1SR6C 1IJ6A 1QS7A 2I94A 1NX1A 5HL1A 2F2PA 1BMOA 2WCKA 1CB1A 2KQYA 3OGNA 1LA0A 2G9BA 4M2OA 2EGDA 1Y1UA 3CZ1A 3SG3A 2JOJA 1QIWA 3OX6A 2V53A 1MHOA 1PVAA 1YUTA 1YX8A 3I5FB 4XYNA 2CNPA 5D69A 2LNKA 3N7HA 4PDZA 4GGNA 2M0RA 1J1EA 3CYZA 4ZCVA 2LE9B 1UP5A 2M8UA 3KPXA 1UWOA 5IBWA 1F4OA 2BKHB 1K96A 3OP0A 3DD4A 1Z4HA 3PN7B 5CSJA 1XFRA 3D0YB 1K90D 2MA2A 2Y1MA 2ZRSA 3DVEA 3DF0B 1SKTA 2WCFA 2BECA 4N5XA 1KK8B 2ZKMX 1FI6A 2IS9A 2MLEC 3S0FA 3EKHA 2D8NA 1CM1A 1JSAA 1BU3A 1S36A 1CMFA 1CNPA 1YVHA 2KQ6A 3I5IB 4KYNA 2QEOA 3B7AA 1B7TY 4AQJA 2OTGC 1TUJA 5KTYA 3FE8A 1S5GY 2PALA 5AXIA 1KQMC 4NQGA 3DYEA 2HPSA 3JVTC 1M63B 1NIWA 2KSPA 3TUYC 2YGUA 1N2DA 3BJHA 5HKYA 4YBHB 2BCXA 2Q4UA 1OZSA 2E30A 3CZTX 1J7RA 1NPQA 1R6PA 3BFHA 2QEVA 3DY9A 4D1EA 2K7OA 1EL4A 1N0YA 2QEBA 3HX4A 1K8UA 2M49B 2WNDA 1FF1A 1ZUZA 3R1PA 4I5NB 3JTDC 4OCIA 4USLA 1UHIA 2BE6A 2LUCA 4WRIA 3VGOA 3CS1A 1M45A 1YX7A 2L5YA 1LS8A 1P28A 1YUSA 2K7CA 3D77A 5PALA 1NX0A 2FOTA 5G08A 5JJGA 1BODA 1M31A 2FJYA 3AKAA 1R2UA 2WC6A 1XA5A 3KO0A 1M39A 4MLWA 4YGEB 3VRRA 1U5IA 1F54A 3ZNIA 4F0ZB 2F8PA 2EC6C 4F7FA 3PLFB 1DJXA 1B8LA 2LM5A 3F45A 4MZJA 2Y4QA 1NCXA 1ORGA 1SR6B 2BE4A 2WCHA 3DVMA 3TDZA 1BR1B 1S26D 3ICBA 3I5GB 2AMIA 1XFXO 1K9UA 2L4IA 3IQOA 4UPGA 1OMDA 2L0PA 4M2QA 3BYAA 4MBEA 2Q91A 1S6CA 3CDNA 2KGRA 3BFAA 2LANA 4INWA 2KI6D 4PE4A 1PSBA 2H8VA 3VB1A 1AP4A 1C7VA 1CFCA 2LUXA 1PRWA 3LK1A 1JF2A 2HETA 3SS4A 4C0LA 4N1FA 3R1OA 1SNLA 2K2AA 5CPVA 3IVTA 5FI2A 5HLOA 2JTTA 4C0JA 2TN4A 1TNQA 2WCJA 3EKJA 1B47A 4PHKA 1A03A 2DOQA 2KLDA 4YGCB 3UO9A 2LLTA 1SBJA 1NX3A 1Y6WA 3TS5B 4PE7A 1S3PA 2KPHA 2LHLA 4FQTA 1D1OA 1KK7Z 3ZWHA 2M9GA 3NXAA 1NP8A 1IWQA 3C1VA 1ZFSA 3EK8A 3MSEB 1B1GA 3AKBA 3SG7A 5J3XA 2L98A 2L4HA 2WORA 2HQ8A 1EJ3A 2OTGB 3LCPC 1CFDA 2KI6C 2NZ0A 1DJHA 2OS8C 1KQMB 1NUBA 1N65A 2H61C
chains in the Genus database with same CATH topology
3JVTB 1QX5B 2BCBA 1MR8A 1Y0VH 3TUYB 1SRAA 5ER4X 1TNWA 1IQ5A 4XJKA 3VROA 2RGIA 1DT7B 1LINA 4MVFA 4YI9A 4GAOA 1C07A 1QIVA 2JULA 2LMVA 1QVIY 3SG2A 2ISDA 1C7WA 3JTDB 2JC2A 1MXLC 1DMOA 3CLNA 2K7DA 2GV5A 1KCYA 1J7QA 1S1EA 2LV7A 1SCVA 3BUNB 4E68A 2LVVA 3CR4X 1DGUA 3I5GC 2KBMA 3LK0A 2JNFA 1QX2A 1IKUA 1JF0A 2K8MB 4GGFA 2KDHA 1GGZA 1SYMA 2A4JA 2KAVA 3RLZA 2AUCA 1XK4A 4P2YB 1K95A 1MUXA 2EC6B 2JRFA 3O6BA 2LCPA 4OVNF 1CKKA 1L7ZA 3AAKA 2O5GA 2FCEA 3SG6A 1QATA 3BUOB 3TDIA 2M1KB 4GGFC 3BXKA 3H4SE 1G4YR 4HSZA 1CFFA 4CLNA 1CDMA 1PALA 1GGWA 4PCWA 1AHRA 2FJUB 2KGBC 4IL1A 1EG3A 1TNXA 1HT9A 4DCKA 2COLB 4BY4A 3TS5C 5HKWA 1LKJA 2PMYA 4FQOA 2BBNA 4QJ3B 1JBAA 1OMVA 1TCFA 3LLEA 3PSRA 3WNXB 1CDNA 2MRDA 2LP3A 4OR9B 1KFUL 2L50A 2E6WA 2JWWA 4YRUA 1ZMZA 2Y5IA 4JQ0D 1XFVO 4MZKA 1QLSA 2H2KA 2KI4C 5DKNA 4CFQA 2KYFA 4M2PA 2EHBA 1ODBA 1F4QA 1AUIB 1VRKA 1KQVA 2P6BB 1RTP1 2KFHA 3OB1B 2JT3A 1CMGA 1SK6D 2KYCA 1CM4A 1AJ5A 1YUUA 1YRUB 2K0JA 1M46A 2GGMA 1CDPA 2M7NA 3FIAA 3VRNA 3BUMB 3WXAA 2OS8B 1ZACA 3KF9A 5I2LA 1DGVA 2CCMA 1RECA 1BJFA 2PASA 3IQQA 1B8CA 4OV2A 1KSOA 3BUWB 1SCMC 2CTNA 3DVKA 1IG5A 3BOWA 1TIZA 2BCAA 4BY5A 2NLNA 1UUSA 1YRTB 3SIAA 1K2HA 2I18A 1TRFA 3EVRA 1QJTA 1TN4A 4XJKB 1CDLA 4I5JA 1J1DA 4NDCA 4C0KA 1A75A 3FWCA 5F6TA 4Q04A 1J55A 1KWOB 1RROA 5HLVA 1GJYA 1F70A 1W7IB 4MN0A 3D10A 1DF0A 4GUKA 1PSRA 2QACA 1B9AA 5DKRA 2ZNEA 2LAPA 1IH0A 2ZFDA 2ZNDA 1QTXA 2L2EA 2M3WA 1FBVA 1J7OA 2BL0C 1MF8B 4PE0A 2F3ZA 2LMUA 3SIBA 1JC2A 1BT6A 4ORAB 1PULA 1LA3A 1WRLA 2MAZA 2F33A 3DF0A 4QJ4B 1WDCC 1BR4B 1UURA 1DJIA 2CT9A 2JXCA 1QV0A 1XO5A 2SCPA 1AK8A 4I5KA 4N1GA 4AQIA 1B7TZ 3EVUA 1QLKA 4QJ5B 1S5GZ 4AOMA 1S6JA 1NX2A 5B8IB 3HCMA 1DJGA 1S6IA 2KI4B 2JTZA 3I5HB 1IJ5A 3PFVA 4DIRA 3A4UB 3TDUA 3FWBA 2HF5A 3E3RA 4ETOA 2HQWA 4HRHA 5BPJA 2L51A 4MRYA 2LVKA 2MLFC 2PRUA 1CLMA 1B8RA 1JFJA 3BUXB 4TNCA 2LHIA 5JOLA 1A29A 1GQMA 5I2QA 4GNKB 2PVBA 3EK7A 1K9PA 4PE1A 4NDBA 4WQ2A 3SJSA 1KWOC 1RWYA 2JPTA 3QRXA 1SL8A 4A4BA 1SCMB 2KFGA 1TOPA 1A4PA 3KHEA 1CTRA 5AANA 1BOCA 4OKHA 4PHMA 4U8DA 5FYXA 2K61A 1DJWA 2Y1NA 4A4CA 2NXQA 3SG4A 3IF7A 2LLUA 1AJ4A 1YVLA 2KNEA 1QXPA 1Y1XA 1SL7A 1HQVA 2MJWB 1FI5A 2ZN8A 1G8IA 2ZN9A 1UHHA 1DVIA 2LC5A 1G33A 1KFXS 2CXJA 2NCPA 2KFFA 2QPTA 2WOSA 2I7AA 1U5IB 1XK4C 4CFRA 1TNPA 1LXFC 3NSIA 3PALA 1EH2A 1A75B 2NCOA 1XVJA 1K93D 3CTNA 1JFKA 3PATA 5HYDA 1Q80A 2BL0B 3GK4X 2F2OA 1WRZA 1DF0B 1OSAA 3WHUB 3VRPA 4ORBB 1QV1A 4P5OE 4MRXA 1FW4A 2I2RE 3FS7A 1E8AA 1ALWA 1DJYA 1WDCB 2CBLA 1V1GA 2F3YA 5K89A 4JPZB 2PSRA 2KAYA 1SY9A 4ICBA 3I5HC 5TNCA 2FCDA 2KHNA 3PM8A 4ORCB 1F71A 3K21A 1LVCD 3NSKA 4WQ3A 1YTZC 3CR5X 5CSNA 1L2OB 1QX7A 2AAOA 3A8RA 4PHNA 1IRJA 3GK1A 5I8NA 1F8HA 2GGZA 4GFTA 1OE9B 1OMRA 3CR2A 4PHJA 2LP2A 4MEWA 1QVIZ 5HKZA 2SASA 1MWNA 1MQ1A 1KK7Y 5ER5A 1DTLA 2O60A 1WRKA 1AVSA 3SG5A 1KFXL 3DVJA 1XFWO 1NYAA 2LVIA 5GQQC 1SL9A 3WHTB 2ZRTA 1H8BA 1OOJA 3EK4A 2JQ6A 4GBAA 4YGAA 1OZOA 3O4YA 5KU1A 4MSPA 1UHJA 2BKIB 2MHHA 3GOFA 1K94A 1DJZA 2KAXA 1PVBA 1EXRA 5CSIA 2JXLA 2JT8A 1YR5A 2K2FA 4YGBB 1KSMA 3OB2B 5AEQA 2KOTA 4NDDA 1UHKA 5D7FA 2WCEA 3AAJA 1RJVA 5I2OA 1XYDA 3D0YA 3CGAA 3I5FC 1XFUO 3LL8B 4CPVA 1SW8A 1PK0D 2L5XB 1NSHA 4HRGA 3OX5A 2MBXA 1B4CA 3PN7C 1RFJA 2JNXA 4DS7A 1SMGA 1RK9A 2LVJA 3EVVA 4YGDB 4JWQA 2OPOA 3RM1A 1FPWA 1BG1A 3KEVA 2JZIA 1KK8C 1L2OC 1V1FA 4CIDA 2M1UA 1NCZA 1QASA 3I5IC 3O2PA 1CFPA 1XFYO 1TTXA 5CSFA 2M7LA 4FTGA 2JT0A 1CLBA 1W7JB 2M29A 1Y1AA 3CWGA 3NSLA 2KBIA 3OHMB 1H4BA 3M0WA 2H61A 1YURA 1WLMA 4R1EA 1BF5A 1OQPA 1WY9A 2LMTA 1IGVA 1ZOTB 2WC8A 2BBMA 1JUOA 2VRGA 4ZCUA 1ALVA 1F55A 2R2IA 4HREE 3VRQA 2K7BA 1X02A 1JWDA 2LLSA 3GK2A 1J7PA 3BQ3A 1TCOB 1K9KA 3NSOA 4L9MA 2WCBA 1KFUS 3O78A 1IQ3A 2M97A 4PALA 1SPYA 1XFZO 5DKQA 2G2BA 4GPLB 1CLLA 3BOWB 1NWDA 1A2XA 5AERA 1EG4A 3TZ1A 1UHNA 1WLZA 4YI8A 5AFPA 4I5LB 2JU0A 1NCYA 1MXEA 2B1UA 4DUQA 1BLQA 4DRWA 5KSZA 4MZLA 1SR6C 1IJ6A 1QS7A 2I94A 1NX1A 2F2PA 1BMOA 1CB1A 2KQYA 1LA0A 2G9BA 4M2OA 2EGDA 1Y1UA 3SG3A 2JOJA 1QIWA 3OX6A 2V53A 1MHOA 1PVAA 1YUTA 1YX8A 3I5FB 4XYNA 2CNPA 5D69A 2LNKA 4PDZA 4GGNA 2M0RA 1J1EA 4ZCVA 2LE9B 1UP5A 2M8UA 3KPXA 1UWOA 5IBWA 1F4OA 3OP0A 1K96A 3DD4A 5CSJA 3PN7B 3D0YB 1K90D 2MA2A 2Y1MA 2ZRSA 3DVEA 3DF0B 1SKTA 2WCFA 2BECA 4N5XA 1KK8B 2ZKMX 1FI6A 2IS9A 2MLEC 3EKHA 2D8NA 1CM1A 1JSAA 1BU3A 1S36A 1CMFA 1CNPA 1YVHA 2KQ6A 3I5IB 1B7TY 4AQJA 2OTGC 5KTYA 1S5GY 2PALA 5AXIA 1KQMC 4NQGA 2HPSA 3JVTC 1M63B 1NIWA 2KSPA 3TUYC 1N2DA 5HKYA 4YBHB 2BCXA 2Q4UA 1OZSA 2E30A 3CZTX 1J7RA 1NPQA 1R6PA 4D1EA 2K7OA 1EL4A 1N0YA 3HX4A 1K8UA 2M49B 2WNDA 1FF1A 1ZUZA 4I5NB 3JTDC 4OCIA 4USLA 1UHIA 2BE6A 2LUCA 4WRIA 3VGOA 3CS1A 1M45A 1YX7A 1YUSA 2K7CA 5PALA 1NX0A 2FOTA 5G08A 5JJGA 1BODA 1M31A 3AKAA 1R2UA 1XA5A 3KO0A 1M39A 4MLWA 4YGEB 3VRRA 1U5IA 1F54A 3ZNIA 4F0ZB 2F8PA 2EC6C 3PLFB 1DJXA 1B8LA 2LM5A 3F45A 4MZJA 2Y4QA 1NCXA 1SR6B 2BE4A 3DVMA 3TDZA 1BR1B 1S26D 3ICBA 3I5GB 2AMIA 1XFXO 1K9UA 2L4IA 3IQOA 4UPGA 1OMDA 2L0PA 4M2QA 3BYAA 4MBEA 2Q91A 1S6CA 2KGRA 2LANA 4PE4A 2KI6D 1C7VA 1PSBA 1CFCA 1AP4A 2LUXA 1PRWA 3LK1A 1JF2A 2HETA 4C0LA 4N1FA 1SNLA 2K2AA 5CPVA 5HLOA 2JTTA 4C0JA 2TN4A 1TNQA 3EKJA 4PHKA 1B47A 1A03A 1KQMB 2DOQA 4YGCB 2LLTA 1SBJA 1NX3A 1Y6WA 3TS5B 4PE7A 1S3PA 2LHLA 1D1OA 1KK7Z 3ZWHA 2M9GA 3NXAA 1NP8A 1IWQA 3C1VA 1ZFSA 3EK8A 3MSEB 1B1GA 3AKBA 3SG7A 5J3XA 2L98A 2L4HA 2WORA 2HQ8A 1EJ3A 2OTGB 3LCPC 1CFDA 2KI6C 2NZ0A 1DJHA 2OS8C 2BKHB 1NUBA 1N65A 2H61C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JVT B;  1QX5 B;  2BCB A;  1MR8 A;  1Y0V H;  3TUY B;  1SRA A;  5ER4 X;  1TNW A;  1IQ5 A;  4XJK A;  3VRO A;  2RGI A;  1DT7 B;  1LIN A;  4MVF A;  4YI9 A;  4GAO A;  1C07 A;  1QIV A;  2JUL A;  2LMV A;  1QVI Y;  3SG2 A;  2ISD A;  1C7W A;  3JTD B;  2JC2 A;  1MXL C;  1DMO A;  3CLN A;  2K7D A;  2GV5 A;  1KCY A;  1J7Q A;  1S1E A;  2LV7 A;  1SCV A;  3BUN B;  4E68 A;  2LVV A;  3CR4 X;  1DGU A;  3I5G C;  2KBM A;  3LK0 A;  2JNF A;  1QX2 A;  1IKU A;  1JF0 A;  2K8M B;  4GGF A;  2KDH A;  1GGZ A;  1SYM A;  2A4J A;  2KAV A;  3RLZ A;  2AUC A;  1XK4 A;  4P2Y B;  1K95 A;  1MUX A;  2EC6 B;  2JRF A;  3O6B A;  2LCP A;  4OVN F;  1CKK A;  1L7Z A;  3AAK A;  2O5G A;  2FCE A;  3SG6 A;  1QAT A;  3BUO B;  3TDI A;  2M1K B;  4GGF C;  3BXK A;  3H4S E;  1G4Y R;  4HSZ A;  1CFF A;  4CLN A;  1CDM A;  1PAL A;  1GGW A;  4PCW A;  1AHR A;  2FJU B;  2KGB C;  4IL1 A;  1EG3 A;  1TNX A;  1HT9 A;  4DCK A;  2COL B;  4BY4 A;  3TS5 C;  5HKW A;  1LKJ A;  2PMY A;  4FQO A;  2BBN A;  4QJ3 B;  1JBA A;  1OMV A;  1TCF A;  3LLE A;  3PSR A;  3WNX B;  1CDN A;  2MRD A;  2LP3 A;  4OR9 B;  1KFU L;  2L50 A;  2E6W A;  2JWW A;  4YRU A;  1ZMZ A;  2Y5I A;  4JQ0 D;  1XFV O;  4MZK A;  1QLS A;  2H2K A;  2KI4 C;  5DKN A;  4CFQ A;  2KYF A;  4M2P A;  2EHB A;  1ODB A;  1F4Q A;  1AUI B;  1VRK A;  1KQV A;  2P6B B;  1RTP 1;  2KFH A;  3OB1 B;  2JT3 A;  1CMG A;  1SK6 D;  2KYC A;  1CM4 A;  1AJ5 A;  1YUU A;  1YRU B;  2K0J A;  1M46 A;  2GGM A;  1CDP A;  2M7N A;  3FIA A;  3VRN A;  3BUM B;  3WXA A;  2OS8 B;  1ZAC A;  3KF9 A;  5I2L A;  1DGV A;  2CCM A;  1REC A;  1BJF A;  2PAS A;  3IQQ A;  1B8C A;  4OV2 A;  1KSO A;  3BUW B;  1SCM C;  2CTN A;  3DVK A;  1IG5 A;  3BOW A;  1TIZ A;  2BCA A;  4BY5 A;  2NLN A;  1UUS A;  1YRT B;  3SIA A;  1K2H A;  2I18 A;  1TRF A;  3EVR A;  1QJT A;  1TN4 A;  4XJK B;  1CDL A;  4I5J A;  1J1D A;  4NDC A;  4C0K A;  1A75 A;  3FWC A;  5F6T A;  4Q04 A;  1J55 A;  1KWO B;  1RRO A;  5HLV A;  1GJY A;  1F70 A;  1W7I B;  4MN0 A;  3D10 A;  1DF0 A;  4GUK A;  1PSR A;  2QAC A;  1B9A A;  5DKR A;  2ZNE A;  2LAP A;  1IH0 A;  2ZFD A;  2ZND A;  1QTX A;  2L2E A;  2M3W A;  1FBV A;  1J7O A;  2BL0 C;  1MF8 B;  4PE0 A;  2F3Z A;  2LMU A;  3SIB A;  1JC2 A;  1BT6 A;  4ORA B;  1PUL A;  1LA3 A;  1WRL A;  2MAZ A;  2F33 A;  3DF0 A;  4QJ4 B;  1WDC C;  1BR4 B;  1UUR A;  1DJI A;  2CT9 A;  2JXC A;  1QV0 A;  1XO5 A;  2SCP A;  1AK8 A;  4I5K A;  4N1G A;  4AQI A;  1B7T Z;  3EVU A;  1QLK A;  4QJ5 B;  1S5G Z;  4AOM A;  1S6J A;  1NX2 A;  5B8I B;  3HCM A;  1DJG A;  1S6I A;  2KI4 B;  2JTZ A;  3I5H B;  1IJ5 A;  3PFV A;  4DIR A;  3A4U B;  3TDU A;  3FWB A;  2HF5 A;  3E3R A;  4ETO A;  2HQW A;  4HRH A;  5BPJ A;  2L51 A;  4MRY A;  2LVK A;  2MLF C;  2PRU A;  1CLM A;  1B8R A;  1JFJ A;  3BUX B;  4TNC A;  2LHI A;  5JOL A;  1A29 A;  1GQM A;  5I2Q A;  4GNK B;  2PVB A;  3EK7 A;  1K9P A;  4PE1 A;  4NDB A;  4WQ2 A;  3SJS A;  1KWO C;  1RWY A;  2JPT A;  3QRX A;  1SL8 A;  4A4B A;  1SCM B;  2KFG A;  1TOP A;  1A4P A;  3KHE A;  1CTR A;  5AAN A;  1BOC A;  4OKH A;  4PHM A;  4U8D A;  5FYX A;  2K61 A;  1DJW A;  2Y1N A;  4A4C A;  2NXQ A;  3SG4 A;  3IF7 A;  2LLU A;  1AJ4 A;  1YVL A;  2KNE A;  1QXP A;  1Y1X A;  1SL7 A;  1HQV A;  2MJW B;  1FI5 A;  2ZN8 A;  1G8I A;  2ZN9 A;  1UHH A;  1DVI A;  2LC5 A;  1G33 A;  1KFX S;  2CXJ A;  2NCP A;  2KFF A;  2QPT A;  2WOS A;  2I7A A;  1U5I B;  1XK4 C;  4CFR A;  1TNP A;  1LXF C;  3NSI A;  3PAL A;  1EH2 A;  1A75 B;  2NCO A;  1XVJ A;  1K93 D;  3CTN A;  1JFK A;  3PAT A;  5HYD A;  1Q80 A;  2BL0 B;  3GK4 X;  2F2O A;  1WRZ A;  1DF0 B;  1OSA A;  3WHU B;  3VRP A;  4ORB B;  1QV1 A;  4P5O E;  4MRX A;  1FW4 A;  2I2R E;  3FS7 A;  1E8A A;  1ALW A;  1DJY A;  1WDC B;  2CBL A;  1V1G A;  2F3Y A;  5K89 A;  4JPZ B;  2PSR A;  2KAY A;  1SY9 A;  4ICB A;  3I5H C;  5TNC A;  2FCD A;  2KHN A;  3PM8 A;  4ORC B;  1F71 A;  3K21 A;  1LVC D;  3NSK A;  4WQ3 A;  1YTZ C;  3CR5 X;  5CSN A;  1L2O B;  1QX7 A;  2AAO A;  3A8R A;  4PHN A;  1IRJ A;  3GK1 A;  5I8N A;  1F8H A;  2GGZ A;  4GFT A;  1OE9 B;  1OMR A;  3CR2 A;  4PHJ A;  2LP2 A;  4MEW A;  1QVI Z;  5HKZ A;  2SAS A;  1MWN A;  1MQ1 A;  1KK7 Y;  5ER5 A;  1DTL A;  2O60 A;  1WRK A;  1AVS A;  3SG5 A;  1KFX L;  3DVJ A;  1XFW O;  1NYA A;  2LVI A;  5GQQ C;  1SL9 A;  3WHT B;  2ZRT A;  1H8B A;  1OOJ A;  3EK4 A;  2JQ6 A;  4GBA A;  4YGA A;  1OZO A;  3O4Y A;  5KU1 A;  4MSP A;  1UHJ A;  2BKI B;  2MHH A;  3GOF A;  1K94 A;  1DJZ A;  2KAX A;  1PVB A;  1EXR A;  5CSI A;  2JXL A;  2JT8 A;  1YR5 A;  2K2F A;  4YGB B;  1KSM A;  3OB2 B;  5AEQ A;  2KOT A;  4NDD A;  1UHK A;  5D7F A;  2WCE A;  3AAJ A;  1RJV A;  5I2O A;  1XYD A;  3D0Y A;  3CGA A;  3I5F C;  1XFU O;  3LL8 B;  4CPV A;  1SW8 A;  1PK0 D;  2L5X B;  1NSH A;  4HRG A;  3OX5 A;  2MBX A;  1B4C A;  3PN7 C;  1RFJ A;  2JNX A;  4DS7 A;  1SMG A;  1RK9 A;  2LVJ A;  3EVV A;  4YGD B;  4JWQ A;  2OPO A;  3RM1 A;  1FPW A;  1BG1 A;  3KEV A;  2JZI A;  1KK8 C;  1L2O C;  1V1F A;  4CID A;  2M1U A;  1NCZ A;  1QAS A;  3I5I C;  3O2P A;  1CFP A;  1XFY O;  1TTX A;  5CSF A;  2M7L A;  4FTG A;  2JT0 A;  1CLB A;  1W7J B;  2M29 A;  1Y1A A;  3CWG A;  3NSL A;  2KBI A;  3OHM B;  1H4B A;  3M0W A;  2H61 A;  1YUR A;  1WLM A;  4R1E A;  1BF5 A;  1OQP A;  1WY9 A;  2LMT A;  1IGV A;  1ZOT B;  2WC8 A;  2BBM A;  1JUO A;  2VRG A;  4ZCU A;  1ALV A;  1F55 A;  2R2I A;  4HRE E;  3VRQ A;  2K7B A;  1X02 A;  1JWD A;  2LLS A;  3GK2 A;  1J7P A;  3BQ3 A;  1TCO B;  1K9K A;  3NSO A;  4L9M A;  2WCB A;  1KFU S;  3O78 A;  1IQ3 A;  2M97 A;  4PAL A;  1SPY A;  1XFZ O;  5DKQ A;  2G2B A;  4GPL B;  1CLL A;  3BOW B;  1NWD A;  1A2X A;  5AER A;  1EG4 A;  3TZ1 A;  1UHN A;  1WLZ A;  4YI8 A;  5AFP A;  4I5L B;  2JU0 A;  1NCY A;  1MXE A;  2B1U A;  4DUQ A;  1BLQ A;  4DRW A;  5KSZ A;  4MZL A;  1SR6 C;  1IJ6 A;  1QS7 A;  2I94 A;  1NX1 A;  2F2P A;  1BMO A;  1CB1 A;  2KQY A;  1LA0 A;  2G9B A;  4M2O A;  2EGD A;  1Y1U A;  3SG3 A;  2JOJ A;  1QIW A;  3OX6 A;  2V53 A;  1MHO A;  1PVA A;  1YUT A;  1YX8 A;  3I5F B;  4XYN A;  2CNP A;  5D69 A;  2LNK A;  4PDZ A;  4GGN A;  2M0R A;  1J1E A;  4ZCV A;  2LE9 B;  1UP5 A;  2M8U A;  3KPX A;  1UWO A;  5IBW A;  1F4O A;  3OP0 A;  1K96 A;  3DD4 A;  5CSJ A;  3PN7 B;  3D0Y B;  1K90 D;  2MA2 A;  2Y1M A;  2ZRS A;  3DVE A;  3DF0 B;  1SKT A;  2WCF A;  2BEC A;  4N5X A;  1KK8 B;  2ZKM X;  1FI6 A;  2IS9 A;  2MLE C;  3EKH A;  2D8N A;  1CM1 A;  1JSA A;  1BU3 A;  1S36 A;  1CMF A;  1CNP A;  1YVH A;  2KQ6 A;  3I5I B;  1B7T Y;  4AQJ A;  2OTG C;  5KTY A;  1S5G Y;  2PAL A;  5AXI A;  1KQM C;  4NQG A;  2HPS A;  3JVT C;  1M63 B;  1NIW A;  2KSP A;  3TUY C;  1N2D A;  5HKY A;  4YBH B;  2BCX A;  2Q4U A;  1OZS A;  2E30 A;  3CZT X;  1J7R A;  1NPQ A;  1R6P A;  4D1E A;  2K7O A;  1EL4 A;  1N0Y A;  3HX4 A;  1K8U A;  2M49 B;  2WND A;  1FF1 A;  1ZUZ A;  4I5N B;  3JTD C;  4OCI A;  4USL A;  1UHI A;  2BE6 A;  2LUC A;  4WRI A;  3VGO A;  3CS1 A;  1M45 A;  1YX7 A;  1YUS A;  2K7C A;  5PAL A;  1NX0 A;  2FOT A;  5G08 A;  5JJG A;  1BOD A;  1M31 A;  3AKA A;  1R2U A;  1XA5 A;  3KO0 A;  1M39 A;  4MLW A;  4YGE B;  3VRR A;  1U5I A;  1F54 A;  3ZNI A;  4F0Z B;  2F8P A;  2EC6 C;  3PLF B;  1DJX A;  1B8L A;  2LM5 A;  3F45 A;  4MZJ A;  2Y4Q A;  1NCX A;  1SR6 B;  2BE4 A;  3DVM A;  3TDZ A;  1BR1 B;  1S26 D;  3ICB A;  3I5G B;  2AMI A;  1XFX O;  1K9U A;  2L4I A;  3IQO A;  4UPG A;  1OMD A;  2L0P A;  4M2Q A;  3BYA A;  4MBE A;  2Q91 A;  1S6C A;  2KGR A;  2LAN A;  4PE4 A;  2KI6 D;  1C7V A;  1PSB A;  1CFC A;  1AP4 A;  2LUX A;  1PRW A;  3LK1 A;  1JF2 A;  2HET A;  4C0L A;  4N1F A;  1SNL A;  2K2A A;  5CPV A;  5HLO A;  2JTT A;  4C0J A;  2TN4 A;  1TNQ A;  3EKJ A;  4PHK A;  1B47 A;  1A03 A;  1KQM B;  2DOQ A;  4YGC B;  2LLT A;  1SBJ A;  1NX3 A;  1Y6W A;  3TS5 B;  4PE7 A;  1S3P A;  2LHL A;  1D1O A;  1KK7 Z;  3ZWH A;  2M9G A;  3NXA A;  1NP8 A;  1IWQ A;  3C1V A;  1ZFS A;  3EK8 A;  3MSE B;  1B1G A;  3AKB A;  3SG7 A;  5J3X A;  2L98 A;  2L4H A;  2WOR A;  2HQ8 A;  1EJ3 A;  2OTG B;  3LCP C;  1CFD A;  2KI6 C;  2NZ0 A;  1DJH A;  2OS8 C;  2BKH B;  1NUB A;  1N65 A;  2H61 C; 
#chains in the Genus database with same CATH topology
 3JVT B;  1QX5 B;  2BCB A;  1MR8 A;  1Y0V H;  3TUY B;  1OOF A;  1SRA A;  5ER4 X;  1TNW A;  1IQ5 A;  4XJK A;  3VRO A;  2RGI A;  1DT7 B;  1LIN A;  4MVF A;  3R72 A;  4YI9 A;  4GAO A;  1C07 A;  3D78 A;  1QIV A;  2JUL A;  2LMV A;  1QVI Y;  3SG2 A;  2ISD A;  1C7W A;  3JTD B;  2JC2 A;  1MXL C;  1TWO A;  1DMO A;  3CLN A;  2K7D A;  2QEH A;  2GV5 A;  1KCY A;  1J7Q A;  1S1E A;  2LV7 A;  1SCV A;  3BUN B;  3CZ2 A;  4E68 A;  2LVV A;  3CR4 X;  1DGU A;  3I5G C;  2KBM A;  3LK0 A;  4PT1 A;  2JNF A;  1QX2 A;  1IKU A;  1JF0 A;  2K8M B;  4GGF A;  2KDH A;  2P70 A;  1GGZ A;  1SYM A;  2A4J A;  2KAV A;  5EL2 A;  2AUC A;  1XK4 A;  4P2Y B;  3RLZ A;  1K95 A;  1MUX A;  2EC6 B;  1DEK A;  2JRF A;  2LCP A;  3O6B A;  4OVN F;  1CKK A;  1L7Z A;  3AAK A;  2O5G A;  2FCE A;  3SG6 A;  1QAT A;  3R1V A;  3BUO B;  3TDI A;  2M1K B;  4GGF C;  3BXK A;  3H4S E;  1G4Y R;  4HSZ A;  2JPO A;  1CFF A;  4CLN A;  1CDM A;  1PAL A;  1GGW A;  4PCW A;  1AHR A;  2FJU B;  2KGB C;  4IL1 A;  1EG3 A;  1TNX A;  1HT9 A;  4DCK A;  2COL B;  4BY4 A;  3TS5 C;  5HKW A;  1LKJ A;  2PMY A;  4FQO A;  2BBN A;  4QJ3 B;  1JBA A;  1OMV A;  1TCF A;  3LLE A;  3PSR A;  3WNX B;  1CDN A;  2MRD A;  2LP3 A;  4OR9 B;  1KFU L;  2L50 A;  2E6W A;  2JWW A;  4YRU A;  3SS5 A;  1ZMZ A;  2Y5I A;  4JQ0 D;  1XFV O;  4MZK A;  2K60 A;  1QLS A;  2H2K A;  1SSE B;  2KI4 C;  5DKN A;  2KYF A;  4M2P A;  4CFQ A;  2EHB A;  1ODB A;  1F4Q A;  3L4A A;  1C3Y A;  1AUI B;  1VRK A;  1KQV A;  2P6B B;  1RTP 1;  2KFH A;  3OB1 B;  2JT3 A;  1CMG A;  1SK6 D;  2KYC A;  1CM4 A;  1AJ5 A;  1YUU A;  1YRU B;  2K0J A;  1M46 A;  2GGM A;  1CDP A;  2M7N A;  3FIA A;  3VRN A;  2ERB A;  3BUM B;  3WXA A;  3S0D A;  2OS8 B;  1ZAC A;  3KF9 A;  5I2L A;  1DGV A;  2CCM A;  1REC A;  1BJF A;  2PAS A;  3IQQ A;  1B8C A;  1QWV A;  4OV2 A;  3S0A A;  1KSO A;  3BUW B;  1SCM C;  2CTN A;  3DVK A;  1IG5 A;  3BOW A;  1TIZ A;  2BCA A;  4BY5 A;  2NLN A;  1UUS A;  1YRT B;  3SIA A;  1K2H A;  2I18 A;  1TRF A;  3EVR A;  1QJT A;  1TN4 A;  4XJK B;  1CDL A;  4I5J A;  1J1D A;  4NDC A;  4C0K A;  1A75 A;  3FWC A;  5F6T A;  4Q04 A;  1J55 A;  1KWO B;  3PM2 A;  1RRO A;  5HLV A;  1GJY A;  1F70 A;  1W7I B;  3S0G A;  4MN0 A;  3D10 A;  1DF0 A;  1OW4 A;  4GUK A;  1PSR A;  2QAC A;  1B9A A;  5DKR A;  2ZNE A;  2LAP A;  1IH0 A;  3NHI A;  2ZFD A;  2ZND A;  1QTX A;  1C3Z A;  2L2E A;  2M3W A;  1FBV A;  1W9Z A;  1J7O A;  2BL0 C;  1MF8 B;  4PE0 A;  2F3Z A;  2LMU A;  3SIB A;  1JC2 A;  1BT6 A;  3OBV A;  1PUL A;  4ORA B;  5I94 A;  1LA3 A;  1WRL A;  2MAZ A;  2F33 A;  3DF0 A;  4QJ4 B;  1WDC C;  1BR4 B;  1UUR A;  1DJI A;  2CT9 A;  2JXC A;  1QV0 A;  1XO5 A;  2SCP A;  1AK8 A;  4I5K A;  2P71 A;  4N1G A;  4AQI A;  3RZS A;  1B7T Z;  3EVU A;  1OOH A;  1QLK A;  3O4X A;  4QJ5 B;  1S5G Z;  3NHT A;  4AOM A;  1S6J A;  1NX2 A;  5B8I B;  3HCM A;  1DJG A;  4JKT A;  1S6I A;  2KI4 B;  2JTZ A;  3D76 A;  3D75 A;  1IJ5 A;  3I5H B;  3PFV A;  4DIR A;  3A4U B;  3TDU A;  3FWB A;  2HF5 A;  3E3R A;  4ETO A;  2HQW A;  4HRH A;  3S0E A;  5BPJ A;  2L51 A;  2BAP A;  2LVK A;  2MLF C;  2PRU A;  4MRY A;  1CLM A;  1B8R A;  1JFJ A;  4IJ7 A;  3B6X A;  3BUX B;  4TNC A;  2LHI A;  5JOL A;  1A29 A;  1GQM A;  5I2Q A;  3D73 A;  4GNK B;  2PVB A;  3EK7 A;  1K9P A;  4PE1 A;  4NDB A;  4WQ2 A;  3EG5 B;  3SJS A;  1KWO C;  1RWY A;  2JPT A;  3QRX A;  1SL8 A;  2WCM A;  4A4B A;  1SCM B;  2KFG A;  1TOP A;  1A4P A;  3KHE A;  1CTR A;  5AAN A;  1BOC A;  4OKH A;  4PHM A;  1T14 A;  4U8D A;  5FYX A;  2K61 A;  1DJW A;  2Y1N A;  3DZT A;  5FI6 A;  4A4C A;  2NXQ A;  3SG4 A;  3IF7 A;  2LLU A;  1AJ4 A;  5D3O A;  1YVL A;  3NGV A;  2KNE A;  1QXP A;  1Y1X A;  3CAB A;  1SL7 A;  1HQV A;  2MJW B;  5DIC A;  1FI5 A;  2ZN8 A;  1G8I A;  2ZN9 A;  1UHH A;  1DVI A;  2LC5 A;  3B88 A;  1G33 A;  1KFX S;  2CXJ A;  2NCP A;  2KFF A;  2QPT A;  2WOS A;  3V2L A;  2I7A A;  1U5I B;  1XK4 C;  4CFR A;  1TNP A;  3B87 A;  1LXF C;  3NSI A;  3PAL A;  1EH2 A;  1A75 B;  2NCO A;  2PQL A;  1XVJ A;  1K93 D;  3S0B A;  3CTN A;  2L2C A;  1JFK A;  3PAT A;  5HYD A;  1Q80 A;  2BL0 B;  3GK4 X;  2F2O A;  3K1E A;  1WRZ A;  1DF0 B;  1OSA A;  3WHU B;  3VRP A;  4ORB B;  1QV1 A;  4OZD A;  4P5O E;  4MRX A;  1FW4 A;  2WCL A;  2I2R E;  3FS7 A;  1E8A A;  1ALW A;  1DJY A;  1WDC B;  2CBL A;  1V1G A;  2F3Y A;  5K89 A;  1DEL A;  4JPZ B;  2PSR A;  2KAY A;  1SY9 A;  4ICB A;  2BNX A;  3I5H C;  5TNC A;  2FCD A;  2KHN A;  3PM8 A;  4ORC B;  1F71 A;  3K21 A;  1LVC D;  3NSK A;  4WQ3 A;  1YTZ C;  1Z2C B;  4JD9 A;  3CR5 X;  5CSN A;  1L2O B;  1QX7 A;  2AAO A;  3A8R A;  4PHN A;  1IRJ A;  3GK1 A;  5I8N A;  1F8H A;  2GGZ A;  4GFT A;  1OE9 B;  1OMR A;  3CR2 A;  4PHJ A;  3UNW A;  2LP2 A;  4MEW A;  1QVI Z;  5HKZ A;  2SAS A;  1MWN A;  3FE6 A;  1MQ1 A;  1KK7 Y;  5ER5 A;  5FI7 A;  1DTL A;  2O60 A;  1WRK A;  1AVS A;  3SG5 A;  2PYQ A;  1KFX L;  3DVJ A;  1XFW O;  1NYA A;  2LVI A;  5GQQ C;  1SL9 A;  3WHT B;  2ZRT A;  1H8B A;  1OOJ A;  3EK4 A;  2JQ6 A;  4GBA A;  4YGA A;  1OZO A;  1OOI X;  3O4Y A;  4INX A;  5KU1 A;  4MSP A;  1UHJ A;  2BKI B;  2MHH A;  3GOF A;  1K94 A;  1DJZ A;  2KAX A;  1PVB A;  1TUZ A;  1EXR A;  5CSI A;  2JXL A;  2JT8 A;  1YR5 A;  2K2F A;  1GM0 A;  4YGB B;  1KSM A;  3OB2 B;  5AEQ A;  2KOT A;  4NDD A;  1UHK A;  1OOG A;  3L4L A;  5D7F A;  2WCE A;  3AAJ A;  1RJV A;  5I2O A;  1DC1 A;  1XYD A;  3Q8I A;  3D0Y A;  3L47 A;  3CGA A;  3I5F C;  1XFU O;  3LL8 B;  4CPV A;  1SW8 A;  1PK0 D;  2L5X B;  1NSH A;  4HRG A;  3OX5 A;  2MBX A;  1B4C A;  1IIO A;  3PN7 C;  1RFJ A;  2JNX A;  4DS7 A;  1SMG A;  1RK9 A;  2LVJ A;  3EVV A;  4YGD B;  4JWQ A;  2OPO A;  3RM1 A;  1FPW A;  1BG1 A;  3KEV A;  2JZI A;  1KK8 C;  1L2O C;  1V1F A;  3B86 A;  3QME A;  4CID A;  2M1U A;  1NCZ A;  3D74 A;  1QAS A;  3I5I C;  3O2P A;  1CFP A;  1XFY O;  1TTX A;  5CSF A;  3PJI A;  2M7L A;  4FTG A;  2JT0 A;  1CLB A;  3CZ0 A;  2WC5 A;  1W7J B;  2M29 A;  1Y1A A;  3CWG A;  3NSL A;  2KBI A;  3DXL A;  3OHM B;  1H4B A;  3M0W A;  2H61 A;  1YUR A;  1WLM A;  4R1E A;  3SS3 A;  1BF5 A;  1OQP A;  1WY9 A;  2LMT A;  1IGV A;  1ZOT B;  2WC8 A;  2BBM A;  1JUO A;  2VRG A;  4ZCU A;  1ALV A;  1F55 A;  2R2I A;  4HRE E;  3VRQ A;  2K7B A;  1X02 A;  1JWD A;  2LLS A;  3GK2 A;  1J7P A;  3BQ3 A;  1TCO B;  1K9K A;  3NSO A;  4L9M A;  2WCB A;  2QDI A;  3FE9 A;  1KFU S;  3O78 A;  1IQ3 A;  2M97 A;  4PAL A;  1SPY A;  1XFZ O;  5DKQ A;  2G2B A;  4GPL B;  3BFB A;  1CLL A;  3BOW B;  1NWD A;  1A2X A;  5AER A;  1EG4 A;  3TZ1 A;  1UHN A;  1WLZ A;  4YI8 A;  5AFP A;  4I5L B;  2JU0 A;  1DQE A;  1MXE A;  1NCY A;  2B1U A;  2GTE A;  4DUQ A;  4DRW A;  5KSZ A;  1BLQ A;  2KLE A;  4MZL A;  1SR6 C;  1IJ6 A;  1QS7 A;  2I94 A;  1NX1 A;  5HL1 A;  2F2P A;  1BMO A;  2WCK A;  1CB1 A;  2KQY A;  3OGN A;  1LA0 A;  2G9B A;  4M2O A;  2EGD A;  1Y1U A;  3CZ1 A;  3SG3 A;  2JOJ A;  1QIW A;  3OX6 A;  2V53 A;  1MHO A;  1PVA A;  1YUT A;  1YX8 A;  3I5F B;  4XYN A;  2CNP A;  5D69 A;  2LNK A;  3N7H A;  4PDZ A;  4GGN A;  2M0R A;  1J1E A;  3CYZ A;  4ZCV A;  2LE9 B;  1UP5 A;  2M8U A;  3KPX A;  1UWO A;  5IBW A;  1F4O A;  2BKH B;  1K96 A;  3OP0 A;  3DD4 A;  1Z4H A;  3PN7 B;  5CSJ A;  1XFR A;  3D0Y B;  1K90 D;  2MA2 A;  2Y1M A;  2ZRS A;  3DVE A;  3DF0 B;  1SKT A;  2WCF A;  2BEC A;  4N5X A;  1KK8 B;  2ZKM X;  1FI6 A;  2IS9 A;  2MLE C;  3S0F A;  3EKH A;  2D8N A;  1CM1 A;  1JSA A;  1BU3 A;  1S36 A;  1CMF A;  1CNP A;  1YVH A;  2KQ6 A;  3I5I B;  4KYN A;  2QEO A;  3B7A A;  1B7T Y;  4AQJ A;  2OTG C;  1TUJ A;  5KTY A;  3FE8 A;  1S5G Y;  2PAL A;  5AXI A;  1KQM C;  4NQG A;  3DYE A;  2HPS A;  3JVT C;  1M63 B;  1NIW A;  2KSP A;  3TUY C;  2YGU A;  1N2D A;  3BJH A;  5HKY A;  4YBH B;  2BCX A;  2Q4U A;  1OZS A;  2E30 A;  3CZT X;  1J7R A;  1NPQ A;  1R6P A;  3BFH A;  2QEV A;  3DY9 A;  4D1E A;  2K7O A;  1EL4 A;  1N0Y A;  2QEB A;  3HX4 A;  1K8U A;  2M49 B;  2WND A;  1FF1 A;  1ZUZ A;  3R1P A;  4I5N B;  3JTD C;  4OCI A;  4USL A;  1UHI A;  2BE6 A;  2LUC A;  4WRI A;  3VGO A;  3CS1 A;  1M45 A;  1YX7 A;  2L5Y A;  1LS8 A;  1P28 A;  1YUS A;  2K7C A;  3D77 A;  5PAL A;  1NX0 A;  2FOT A;  5G08 A;  5JJG A;  1BOD A;  1M31 A;  2FJY A;  3AKA A;  1R2U A;  2WC6 A;  1XA5 A;  3KO0 A;  1M39 A;  4MLW A;  4YGE B;  3VRR A;  1U5I A;  1F54 A;  3ZNI A;  4F0Z B;  2F8P A;  2EC6 C;  4F7F A;  3PLF B;  1DJX A;  1B8L A;  2LM5 A;  3F45 A;  4MZJ A;  2Y4Q A;  1NCX A;  1ORG A;  1SR6 B;  2BE4 A;  2WCH A;  3DVM A;  3TDZ A;  1BR1 B;  1S26 D;  3ICB A;  3I5G B;  2AMI A;  1XFX O;  1K9U A;  2L4I A;  3IQO A;  4UPG A;  1OMD A;  2L0P A;  4M2Q A;  3BYA A;  4MBE A;  2Q91 A;  1S6C A;  3CDN A;  2KGR A;  3BFA A;  2LAN A;  4INW A;  2KI6 D;  4PE4 A;  1PSB A;  2H8V A;  3VB1 A;  1AP4 A;  1C7V A;  1CFC A;  2LUX A;  1PRW A;  3LK1 A;  1JF2 A;  2HET A;  3SS4 A;  4C0L A;  4N1F A;  3R1O A;  1SNL A;  2K2A A;  5CPV A;  3IVT A;  5FI2 A;  5HLO A;  2JTT A;  4C0J A;  2TN4 A;  1TNQ A;  2WCJ A;  3EKJ A;  1B47 A;  4PHK A;  1A03 A;  2DOQ A;  2KLD A;  4YGC B;  3UO9 A;  2LLT A;  1SBJ A;  1NX3 A;  1Y6W A;  3TS5 B;  4PE7 A;  1S3P A;  2KPH A;  2LHL A;  4FQT A;  1D1O A;  1KK7 Z;  3ZWH A;  2M9G A;  3NXA A;  1NP8 A;  1IWQ A;  3C1V A;  1ZFS A;  3EK8 A;  3MSE B;  1B1G A;  3AKB A;  3SG7 A;  5J3X A;  2L98 A;  2L4H A;  2WOR A;  2HQ8 A;  1EJ3 A;  2OTG B;  3LCP C;  1CFD A;  2KI6 C;  2NZ0 A;  1DJH A;  2OS8 C;  1KQM B;  1NUB A;  1N65 A;  2H61 C; 
#chains in the Genus database with same CATH homology
 3JVT B;  1QX5 B;  2BCB A;  1MR8 A;  1Y0V H;  3TUY B;  1SRA A;  5ER4 X;  1TNW A;  1IQ5 A;  4XJK A;  3VRO A;  2RGI A;  1DT7 B;  1LIN A;  4MVF A;  4YI9 A;  4GAO A;  1C07 A;  1QIV A;  2JUL A;  2LMV A;  1QVI Y;  3SG2 A;  2ISD A;  1C7W A;  3JTD B;  2JC2 A;  1MXL C;  1DMO A;  3CLN A;  2K7D A;  2GV5 A;  1KCY A;  1J7Q A;  1S1E A;  2LV7 A;  1SCV A;  3BUN B;  4E68 A;  2LVV A;  3CR4 X;  1DGU A;  3I5G C;  2KBM A;  3LK0 A;  2JNF A;  1QX2 A;  1IKU A;  1JF0 A;  2K8M B;  4GGF A;  2KDH A;  1GGZ A;  1SYM A;  2A4J A;  2KAV A;  3RLZ A;  2AUC A;  1XK4 A;  4P2Y B;  1K95 A;  1MUX A;  2EC6 B;  2JRF A;  3O6B A;  2LCP A;  4OVN F;  1CKK A;  1L7Z A;  3AAK A;  2O5G A;  2FCE A;  3SG6 A;  1QAT A;  3BUO B;  3TDI A;  2M1K B;  4GGF C;  3BXK A;  3H4S E;  1G4Y R;  4HSZ A;  1CFF A;  4CLN A;  1CDM A;  1PAL A;  1GGW A;  4PCW A;  1AHR A;  2FJU B;  2KGB C;  4IL1 A;  1EG3 A;  1TNX A;  1HT9 A;  4DCK A;  2COL B;  4BY4 A;  3TS5 C;  5HKW A;  1LKJ A;  2PMY A;  4FQO A;  2BBN A;  4QJ3 B;  1JBA A;  1OMV A;  1TCF A;  3LLE A;  3PSR A;  3WNX B;  1CDN A;  2MRD A;  2LP3 A;  4OR9 B;  1KFU L;  2L50 A;  2E6W A;  2JWW A;  4YRU A;  1ZMZ A;  2Y5I A;  4JQ0 D;  1XFV O;  4MZK A;  1QLS A;  2H2K A;  2KI4 C;  5DKN A;  4CFQ A;  2KYF A;  4M2P A;  2EHB A;  1ODB A;  1F4Q A;  1AUI B;  1VRK A;  1KQV A;  2P6B B;  1RTP 1;  2KFH A;  3OB1 B;  2JT3 A;  1CMG A;  1SK6 D;  2KYC A;  1CM4 A;  1AJ5 A;  1YUU A;  1YRU B;  2K0J A;  1M46 A;  2GGM A;  1CDP A;  2M7N A;  3FIA A;  3VRN A;  3BUM B;  3WXA A;  2OS8 B;  1ZAC A;  3KF9 A;  5I2L A;  1DGV A;  2CCM A;  1REC A;  1BJF A;  2PAS A;  3IQQ A;  1B8C A;  4OV2 A;  1KSO A;  3BUW B;  1SCM C;  2CTN A;  3DVK A;  1IG5 A;  3BOW A;  1TIZ A;  2BCA A;  4BY5 A;  2NLN A;  1UUS A;  1YRT B;  3SIA A;  1K2H A;  2I18 A;  1TRF A;  3EVR A;  1QJT A;  1TN4 A;  4XJK B;  1CDL A;  4I5J A;  1J1D A;  4NDC A;  4C0K A;  1A75 A;  3FWC A;  5F6T A;  4Q04 A;  1J55 A;  1KWO B;  1RRO A;  5HLV A;  1GJY A;  1F70 A;  1W7I B;  4MN0 A;  3D10 A;  1DF0 A;  4GUK A;  1PSR A;  2QAC A;  1B9A A;  5DKR A;  2ZNE A;  2LAP A;  1IH0 A;  2ZFD A;  2ZND A;  1QTX A;  2L2E A;  2M3W A;  1FBV A;  1J7O A;  2BL0 C;  1MF8 B;  4PE0 A;  2F3Z A;  2LMU A;  3SIB A;  1JC2 A;  1BT6 A;  4ORA B;  1PUL A;  1LA3 A;  1WRL A;  2MAZ A;  2F33 A;  3DF0 A;  4QJ4 B;  1WDC C;  1BR4 B;  1UUR A;  1DJI A;  2CT9 A;  2JXC A;  1QV0 A;  1XO5 A;  2SCP A;  1AK8 A;  4I5K A;  4N1G A;  4AQI A;  1B7T Z;  3EVU A;  1QLK A;  4QJ5 B;  1S5G Z;  4AOM A;  1S6J A;  1NX2 A;  5B8I B;  3HCM A;  1DJG A;  1S6I A;  2KI4 B;  2JTZ A;  3I5H B;  1IJ5 A;  3PFV A;  4DIR A;  3A4U B;  3TDU A;  3FWB A;  2HF5 A;  3E3R A;  4ETO A;  2HQW A;  4HRH A;  5BPJ A;  2L51 A;  4MRY A;  2LVK A;  2MLF C;  2PRU A;  1CLM A;  1B8R A;  1JFJ A;  3BUX B;  4TNC A;  2LHI A;  5JOL A;  1A29 A;  1GQM A;  5I2Q A;  4GNK B;  2PVB A;  3EK7 A;  1K9P A;  4PE1 A;  4NDB A;  4WQ2 A;  3SJS A;  1KWO C;  1RWY A;  2JPT A;  3QRX A;  1SL8 A;  4A4B A;  1SCM B;  2KFG A;  1TOP A;  1A4P A;  3KHE A;  1CTR A;  5AAN A;  1BOC A;  4OKH A;  4PHM A;  4U8D A;  5FYX A;  2K61 A;  1DJW A;  2Y1N A;  4A4C A;  2NXQ A;  3SG4 A;  3IF7 A;  2LLU A;  1AJ4 A;  1YVL A;  2KNE A;  1QXP A;  1Y1X A;  1SL7 A;  1HQV A;  2MJW B;  1FI5 A;  2ZN8 A;  1G8I A;  2ZN9 A;  1UHH A;  1DVI A;  2LC5 A;  1G33 A;  1KFX S;  2CXJ A;  2NCP A;  2KFF A;  2QPT A;  2WOS A;  2I7A A;  1U5I B;  1XK4 C;  4CFR A;  1TNP A;  1LXF C;  3NSI A;  3PAL A;  1EH2 A;  1A75 B;  2NCO A;  1XVJ A;  1K93 D;  3CTN A;  1JFK A;  3PAT A;  5HYD A;  1Q80 A;  2BL0 B;  3GK4 X;  2F2O A;  1WRZ A;  1DF0 B;  1OSA A;  3WHU B;  3VRP A;  4ORB B;  1QV1 A;  4P5O E;  4MRX A;  1FW4 A;  2I2R E;  3FS7 A;  1E8A A;  1ALW A;  1DJY A;  1WDC B;  2CBL A;  1V1G A;  2F3Y A;  5K89 A;  4JPZ B;  2PSR A;  2KAY A;  1SY9 A;  4ICB A;  3I5H C;  5TNC A;  2FCD A;  2KHN A;  3PM8 A;  4ORC B;  1F71 A;  3K21 A;  1LVC D;  3NSK A;  4WQ3 A;  1YTZ C;  3CR5 X;  5CSN A;  1L2O B;  1QX7 A;  2AAO A;  3A8R A;  4PHN A;  1IRJ A;  3GK1 A;  5I8N A;  1F8H A;  2GGZ A;  4GFT A;  1OE9 B;  1OMR A;  3CR2 A;  4PHJ A;  2LP2 A;  4MEW A;  1QVI Z;  5HKZ A;  2SAS A;  1MWN A;  1MQ1 A;  1KK7 Y;  5ER5 A;  1DTL A;  2O60 A;  1WRK A;  1AVS A;  3SG5 A;  1KFX L;  3DVJ A;  1XFW O;  1NYA A;  2LVI A;  5GQQ C;  1SL9 A;  3WHT B;  2ZRT A;  1H8B A;  1OOJ A;  3EK4 A;  2JQ6 A;  4GBA A;  4YGA A;  1OZO A;  3O4Y A;  5KU1 A;  4MSP A;  1UHJ A;  2BKI B;  2MHH A;  3GOF A;  1K94 A;  1DJZ A;  2KAX A;  1PVB A;  1EXR A;  5CSI A;  2JXL A;  2JT8 A;  1YR5 A;  2K2F A;  4YGB B;  1KSM A;  3OB2 B;  5AEQ A;  2KOT A;  4NDD A;  1UHK A;  5D7F A;  2WCE A;  3AAJ A;  1RJV A;  5I2O A;  1XYD A;  3D0Y A;  3CGA A;  3I5F C;  1XFU O;  3LL8 B;  4CPV A;  1SW8 A;  1PK0 D;  2L5X B;  1NSH A;  4HRG A;  3OX5 A;  2MBX A;  1B4C A;  3PN7 C;  1RFJ A;  2JNX A;  4DS7 A;  1SMG A;  1RK9 A;  2LVJ A;  3EVV A;  4YGD B;  4JWQ A;  2OPO A;  3RM1 A;  1FPW A;  1BG1 A;  3KEV A;  2JZI A;  1KK8 C;  1L2O C;  1V1F A;  4CID A;  2M1U A;  1NCZ A;  1QAS A;  3I5I C;  3O2P A;  1CFP A;  1XFY O;  1TTX A;  5CSF A;  2M7L A;  4FTG A;  2JT0 A;  1CLB A;  1W7J B;  2M29 A;  1Y1A A;  3CWG A;  3NSL A;  2KBI A;  3OHM B;  1H4B A;  3M0W A;  2H61 A;  1YUR A;  1WLM A;  4R1E A;  1BF5 A;  1OQP A;  1WY9 A;  2LMT A;  1IGV A;  1ZOT B;  2WC8 A;  2BBM A;  1JUO A;  2VRG A;  4ZCU A;  1ALV A;  1F55 A;  2R2I A;  4HRE E;  3VRQ A;  2K7B A;  1X02 A;  1JWD A;  2LLS A;  3GK2 A;  1J7P A;  3BQ3 A;  1TCO B;  1K9K A;  3NSO A;  4L9M A;  2WCB A;  1KFU S;  3O78 A;  1IQ3 A;  2M97 A;  4PAL A;  1SPY A;  1XFZ O;  5DKQ A;  2G2B A;  4GPL B;  1CLL A;  3BOW B;  1NWD A;  1A2X A;  5AER A;  1EG4 A;  3TZ1 A;  1UHN A;  1WLZ A;  4YI8 A;  5AFP A;  4I5L B;  2JU0 A;  1NCY A;  1MXE A;  2B1U A;  4DUQ A;  1BLQ A;  4DRW A;  5KSZ A;  4MZL A;  1SR6 C;  1IJ6 A;  1QS7 A;  2I94 A;  1NX1 A;  2F2P A;  1BMO A;  1CB1 A;  2KQY A;  1LA0 A;  2G9B A;  4M2O A;  2EGD A;  1Y1U A;  3SG3 A;  2JOJ A;  1QIW A;  3OX6 A;  2V53 A;  1MHO A;  1PVA A;  1YUT A;  1YX8 A;  3I5F B;  4XYN A;  2CNP A;  5D69 A;  2LNK A;  4PDZ A;  4GGN A;  2M0R A;  1J1E A;  4ZCV A;  2LE9 B;  1UP5 A;  2M8U A;  3KPX A;  1UWO A;  5IBW A;  1F4O A;  3OP0 A;  1K96 A;  3DD4 A;  5CSJ A;  3PN7 B;  3D0Y B;  1K90 D;  2MA2 A;  2Y1M A;  2ZRS A;  3DVE A;  3DF0 B;  1SKT A;  2WCF A;  2BEC A;  4N5X A;  1KK8 B;  2ZKM X;  1FI6 A;  2IS9 A;  2MLE C;  3EKH A;  2D8N A;  1CM1 A;  1JSA A;  1BU3 A;  1S36 A;  1CMF A;  1CNP A;  1YVH A;  2KQ6 A;  3I5I B;  1B7T Y;  4AQJ A;  2OTG C;  5KTY A;  1S5G Y;  2PAL A;  5AXI A;  1KQM C;  4NQG A;  2HPS A;  3JVT C;  1M63 B;  1NIW A;  2KSP A;  3TUY C;  1N2D A;  5HKY A;  4YBH B;  2BCX A;  2Q4U A;  1OZS A;  2E30 A;  3CZT X;  1J7R A;  1NPQ A;  1R6P A;  4D1E A;  2K7O A;  1EL4 A;  1N0Y A;  3HX4 A;  1K8U A;  2M49 B;  2WND A;  1FF1 A;  1ZUZ A;  4I5N B;  3JTD C;  4OCI A;  4USL A;  1UHI A;  2BE6 A;  2LUC A;  4WRI A;  3VGO A;  3CS1 A;  1M45 A;  1YX7 A;  1YUS A;  2K7C A;  5PAL A;  1NX0 A;  2FOT A;  5G08 A;  5JJG A;  1BOD A;  1M31 A;  3AKA A;  1R2U A;  1XA5 A;  3KO0 A;  1M39 A;  4MLW A;  4YGE B;  3VRR A;  1U5I A;  1F54 A;  3ZNI A;  4F0Z B;  2F8P A;  2EC6 C;  3PLF B;  1DJX A;  1B8L A;  2LM5 A;  3F45 A;  4MZJ A;  2Y4Q A;  1NCX A;  1SR6 B;  2BE4 A;  3DVM A;  3TDZ A;  1BR1 B;  1S26 D;  3ICB A;  3I5G B;  2AMI A;  1XFX O;  1K9U A;  2L4I A;  3IQO A;  4UPG A;  1OMD A;  2L0P A;  4M2Q A;  3BYA A;  4MBE A;  2Q91 A;  1S6C A;  2KGR A;  2LAN A;  4PE4 A;  2KI6 D;  1C7V A;  1PSB A;  1CFC A;  1AP4 A;  2LUX A;  1PRW A;  3LK1 A;  1JF2 A;  2HET A;  4C0L A;  4N1F A;  1SNL A;  2K2A A;  5CPV A;  5HLO A;  2JTT A;  4C0J A;  2TN4 A;  1TNQ A;  3EKJ A;  4PHK A;  1B47 A;  1A03 A;  1KQM B;  2DOQ A;  4YGC B;  2LLT A;  1SBJ A;  1NX3 A;  1Y6W A;  3TS5 B;  4PE7 A;  1S3P A;  2LHL A;  1D1O A;  1KK7 Z;  3ZWH A;  2M9G A;  3NXA A;  1NP8 A;  1IWQ A;  3C1V A;  1ZFS A;  3EK8 A;  3MSE B;  1B1G A;  3AKB A;  3SG7 A;  5J3X A;  2L98 A;  2L4H A;  2WOR A;  2HQ8 A;  1EJ3 A;  2OTG B;  3LCP C;  1CFD A;  2KI6 C;  2NZ0 A;  1DJH A;  2OS8 C;  2BKH B;  1NUB A;  1N65 A;  2H61 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...