4Q04A

Crystal structure of ure3-bp from entomaeba histolytica without calcium
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
212
structure length
212
Chain Sequence
CLWNLQPIQGSWMGAACIYQMPPSVRNTWWFPLLNTIPLDQYTRIYQWFMGVDRDRSGTLEINELMMGQFPGGIRLSPQTALRMMRIFDTDFNGHISFYEFMAMYKFMELAYNLFVMNDRNRSGTLEPHEILPALQQLGFYINQRTSLLLHRLFARGMAFCDLNCWIAICAFAAQTRSAYQMIFMNPYYGPMKPFNPMEFGKFLDVVTSLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URE3-BP sequence specific DNA binding protein
publication title Crystal structure of URE3-BP from Entomaeba histolytica
rcsb
source organism Entamoeba histolytica
molecule tags Dna binding protein
total genus 72
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4q04A00
5ER4X 2BBMA 1YRTB 1QXPA 5G08A 4GFTA 2HQWA 1RJVA 3VRQA 4YI8A 1BT6A 2NCPA 1V1FA 1EL4A 1DJYA 2M1UA 2L98A 2HF5A 1CFPA 4CFRA 1MWNA 4MLWA 2LHIA 1CMFA 1CMGA 3SG6A 2JTTA 1BU3A 1B7TY 3TS5C 1RECA 1YUSA 2LLUA 2H2KA 2M8UA 3SG5A 3LLEA 4YGBB 1QIVA 1A03A 3VRRA 1G8IA 1IJ6A 1NYAA 1MHOA 3BUNB 1TOPA 2M29A 2ZRSA 4MRYA 1BODA 1XA5A 2JPTA 1CNPA 3KF9A 1XVJA 4Q04A 1K95A 1KWOB 1PSBA 5HLOA 1F8HA 2KI6C 1JUOA 3NSIA 2SASA 1SYMA 3PM8A 1DGUA 1Y1XA 3TDIA 5FYXA 1GQMA 4MBEA 1CFFA 1PVBA 2Y1MA 2KFHA 4GGFC 1EH2A 2H61A 2I2RE 3I5GB 1K9UA 2LUCA 2MA2A 1QJTA 3KO0A 2JTZA 2HPSA 3EKJA 3SJSA 4PHJA 2KFFA 2KBMA 1FW4A 1SCVA 4AOMA 2BCXA 3ICBA 4HRHA 2PRUA 3I5IC 1OZSA 2JT3A 1G33A 1XFYO 5CSNA 1JC2A 1SKTA 2WNDA 5DKRA 1SRAA 1QX5B 4MSPA 3HCMA 1YUTA 1R2UA 4N1FA 3RM1A 4WRIA 3O78A 3BOWA 1JFKA 1RROA 3SG2A 1MXLC 1IJ5A 2L0PA 3C1VA 1ZUZA 4I5LB 1CKKA 3A8RA 1FPWA 2ZRTA 1CDPA 1WDCC 4MZJA 1DJWA 4GBAA 1J7OA 3IF7A 1PSRA 2M7LA 3TDZA 1AHRA 1J7RA 2BECA 2NLNA 2KYCA 4YGCB 3WHUB 1IKUA 2MLEC 4C0LA 2LVKA 1B7TZ 3RLZA 1QV1A 1K2HA 1LA0A 4PE4A 3NSKA 2WCBA 1N2DA 2KHNA 2FOTA 1DJXA 1UHKA 1YVLA 1BOCA 2K2FA 1QIWA 5HYDA 3SIAA 3DVEA 2F2PA 4PE7A 2ISDA 1AK8A 2NCOA 3CWGA 4F0ZB 5KTYA 5ER5A 1DF0B 1YUUA 2LCPA 1TNQA 2PASA 1NCZA 1CDLA 4YRUA 1BG1A 2AMIA 1ZFSA 2JXLA 2LP2A 3CGAA 1M63B 2PVBA 2CXJA 2L4IA 1F54A 2M7NA 3LCPC 3DVJA 2EC6B 3VROA 1XO5A 3O6BA 1B9AA 3SG3A 5PALA 1M31A 1IG5A 1WLMA 2WOSA 1J7PA 4NQGA 1BF5A 2KNEA 2LM5A 1CB1A 2LMUA 1R6PA 1QX2A 4PHNA 1J55A 5D69A 1K9KA 2KI4B 2ZN9A 1JF0A 3GK4X 1AJ4A 3CR2A 2B1UA 3NSOA 4MEWA 4OVNF 4C0JA 1NX1A 1F4OA 1HQVA 1WRKA 1S1EA 2WORA 1J1EA 2P6BB 3AAJA 5HKYA 1QX7A 4CLNA 2OS8C 2JOJA 2CT9A 2L5XB 3PALA 3JVTC 1ZACA 1B8CA 3NSLA 1BR4B 5JJGA 1KFXL 4GUKA 4NDBA 2BKIB 2JNFA 1NX0A 5I2LA 1CLLA 1K93D 4MN0A 1U5IA 5F6TA 2BCAA 1ALVA 1YVHA 4BY5A 1CDMA 1OMRA 1DGVA 2Y4QA 2ZNDA 1WRLA 1Y1AA 1K96A 2JU0A 3OP0A 5HKZA 4HSZA 1SR6B 3M0WA 3KPXA 5AEQA 1B4CA 1S6CA 4XYNA 1M39A 3O2PA 1ZMZA 3I5FB 1UWOA 2KBIA 2JULA 1MUXA 3FS7A 1TN4A 4P5OE 1KQMC 3NXAA 1FF1A 3OX6A 3EVRA 2Y1NA 1EG3A 1UHHA 3GK1A 2OPOA 3BUWB 1DVIA 3LK1A 1L7ZA 1YX8A 2JRFA 5I2QA 2LANA 4OKHA 1TTXA 1NCYA 3DD4A 3ZNIA 2F3YA 3D10A 1CFDA 1C7WA 1DJGA 1K90D 2JT0A 2V53A 3TS5B 2BL0C 4BY4A 3DF0A 3D0YA 1XFZO 3OB1B 1NUBA 5BPJA 1RFJA 2OTGC 3HX4A 1FI5A 3BXKA 4I5NB 1FI6A 1NCXA 1PRWA 2G9BA 1A4PA 2GGZA 2WCFA 3F45A 4YI9A 4YGDB 2CCMA 4DUQA 1KFXS 1DMOA 1EXRA 3EK7A 5KU1A 5AFPA 1KK8C 4QJ5B 2LUXA 2CBLA 2MBXA 2MRDA 3I5HC 3JTDC 1RWYA 3OX5A 2I94A 2L50A 1B1GA 2EGDA 1YR5A 2BE6A 2NZ0A 1YURA 1U5IB 3VGOA 3TUYC 1DJHA 2MHHA 3PSRA 1UUSA 4DIRA 1PULA 1SL8A 1H8BA 5CSIA 4HRGA 2Y5IA 1NSHA 4WQ3A 3I5IB 1SMGA 1F70A 1S36A 1IQ5A 1IRJA 1PVAA 2O60A 4E68A 4XJKA 4IL1A 2LP3A 1F71A 3KHEA 1K8UA 3JTDB 2HETA 2M97A 2LVJA 3DVKA 3WXAA 4JPZB 3GK2A 3A4UB 3CR4X 1L2OC 2IS9A 2MAZA 1SK6D 2BCBA 3BUMB 1NX3A 1KCYA 1UURA 3PN7C 3DVMA 1TRFA 2I18A 2K61A 2M0RA 2KYFA 2L51A 1CLBA 1LINA 2F2OA 4MRXA 4R1EA 1JFJA 4MVFA 1GJYA 1OMDA 1WDCB 2LNKA 1PALA 4USLA 4AQJA 3LK0A 2M1KB 1YTZC 3PFVA 1QLKA 2LHLA 1GGWA 1KQVA 1BMOA 4NDDA 2ZFDA 1KSMA 1S6IA 1S26D 1LVCD 4M2QA 2FCDA 3AKAA 1GGZA 2QACA 2FCEA 1JWDA 1UHNA 1DJIA 3EK4A 2JC2A 3FWBA 4UPGA 3CS1A 4I5KA 5GQQC 3EVUA 1C07A 2SCPA 1TNPA 1SCMC 3PN7B 2Q91A 2JQ6A 4MZLA 5AXIA 3BUOB 1BR1B 1Y6WA 2K7CA 2JZIA 1C7VA 5JOLA 1F4QA 2LC5A 2L4HA 1NIWA 2NXQA 2D8NA 1QLSA 2PSRA 1RK9A 1SY9A 1KFUS 1OMVA 2F3ZA 2KFGA 3BOWB 2JXCA 1CFCA 2M9GA 1Q80A 1QASA 2JWWA 1Y0VH 4A4BA 3PATA 3BQ3A 1XYDA 4ORAB 1ALWA 2KQYA 2AUCA 4CPVA 1M46A 1ZOTB 4TNCA 4DS7A 2GV5A 2LMTA 1TNXA 3AAKA 4PHMA 3H4SE 1SL9A 1KK7Y 2WCEA 1EJ3A 1OSAA 1QVIZ 1UHIA 1EG4A 2OS8B 2RGIA 3SG7A 2QPTA 1AJ5A 2E30A 3KEVA 3JVTB 1ODBA 2ZKMX 5IBWA 4OV2A 5HLVA 1UHJA 1W7JB 1OE9B 4DRWA 2F8PA 1AP4A 1F55A 1Y1UA 4ORBB 1SNLA 2EHBA 3EVVA 1SL7A 4CFQA 1XK4A 2AAOA 1AVSA 2LMVA 3BYAA 3K21A 4GPLB 1NPQA 2LE9B 1KWOC 1XFWO 4JQ0D 5HKWA 3VRPA 4QJ4B 1H4BA 1MXEA 4QJ3B 1S5GY 2CTNA 3MSEB 1WY9A 4MZKA 2HQ8A 1DTLA 1TCOB 1XFUO 1N0YA 2K2AA 1W7IB 2KQ6A 3AKBA 4FTGA 2R2IA 5D7FA 5DKNA 4DCKA 5B8IB 1HT9A 3I5GC 1KQMB 1WLZA 4M2PA 4U8DA 4PDZA 4PALA 2LLTA 4D1EA 1RTP1 2FJUB 3CZTX 1VRKA 1DF0A 1NP8A 1D1OA 4ICBA 5J3XA 2KAVA 4PHKA 2KGRA 3VRNA 5DKQA 4OR9B 1K94A 3TDUA 3EKHA 2O5GA 1B47A 1SW8A 2CNPA 2G2BA 4GNKB 4PCWA 1MQ1A 3CLNA 2KDHA 4PE0A 2BL0B 3OHMB 2K7OA 3CR5X 4WQ2A 3IQQA 4ZCUA 2K7DA 4HREE 2OTGB 2F33A 1TIZA 3SIBA 5K89A 4L9MA 2K7BA 4CIDA 5CPVA 1A2XA 1XK4C 1YX7A 2COLB 1KFUL 1B8RA 5AANA 4A4CA 1LA3A 4N1GA 1CTRA 1KK7Z 1NWDA 2LAPA 2LV7A 3ZWHA 1A29A 1IQ3A 3BUXB 1QVIY 5KSZA 1KK8B 1M45A 2TN4A 3I5HB 1E8AA 4ZCVA 1K9PA 5I2OA 1N65A 1A75A 2MJWB 5I8NA 2LLSA 1TCFA 3PLFB 1QTXA 4OCIA 3TUYB 4YGEB 2MLFC 2WC8A 2KAXA 2ZN8A 1B8LA 1QS7A 2KSPA 1OQPA 3CTNA 5AERA 2Q4UA 2VRGA 2DOQA 1TNWA 1JBAA 1XFXO 1S5GZ 3FIAA 3O4YA 2L2EA 3WHTB 2JT8A 5CSFA 1NX2A 2E6WA 2PALA 1V1GA 2EC6C 1YRUB 3GOFA 4GGNA 2KI6D 4ETOA 2H61C 3DF0B 3WNXB 3D0YB 3LL8B 4FQOA 1L2OB 1XFVO 2BBNA 4C0KA 1MF8B 4I5JA 1CM4A 2KI4C 1S3PA 2KOTA 2BKHB 1CLMA 3QRXA 1FBVA 2K8MB 1DJZA 5TNCA 1J1DA 1OZOA 1JSAA 4P2YB 1LKJA 1LXFC 2BE4A 1IH0A 1DT7B 4N5XA 2GGMA 1BJFA 2ZNEA 2K0JA 1CM1A 2KAYA 1QATA 4YGAA 3EK8A 4JWQA 1SCMB 3OB2B 2M49B 1UP5A 1PK0D 4NDCA 1IWQA 2LVIA 1X02A 2LVVA 1BLQA 4YBHB 1JF2A 1KSOA 1WRZA 2I7AA 2JNXA 1CDNA 2M3WA 1MR8A 2A4JA 1S6JA 4M2OA 1SR6C 4PE1A 1OOJA 1QV0A 1AUIB 2KGBC 4XJKB 4GAOA 3IQOA 4GGFA 1G4YR 5CSJA 1IGVA 3TZ1A 1SBJA 4AQIA 2PMYA 3I5FC 1J7QA 1A75B 3E3RA 3SG4A 1SPYA 4ORCB 3FWCA
chains in the Genus database with same CATH superfamily
5ER4X 2BBMA 1YRTB 1QXPA 5G08A 2P71A 4GFTA 5FI6A 2HQWA 1RJVA 3VRQA 4YI8A 1BT6A 3NGVA 2NCPA 4OZDA 1V1FA 1EL4A 1DJYA 2M1UA 2L98A 2HF5A 1CFPA 4CFRA 1MWNA 4MLWA 2LHIA 1CMFA 1CMGA 2H8VA 3SG6A 2JTTA 2PQLA 3K1EA 1BU3A 1B7TY 3TS5C 1RECA 1YUSA 2LLUA 2H2KA 2M8UA 1P28A 3SG5A 3LLEA 4YGBB 1QIVA 1A03A 3VRRA 1G8IA 1IJ6A 1NYAA 1MHOA 3BUNB 1TOPA 2M29A 2ZRSA 4MRYA 1BODA 1XA5A 3BFHA 2JPTA 1CNPA 3KF9A 1XVJA 4Q04A 1K95A 1KWOB 1PSBA 5HLOA 1F8HA 2KI6C 3S0BA 1JUOA 1TUJA 3NSIA 1TUZA 1SYMA 2SASA 3PM8A 1DGUA 1Y1XA 3NHTA 3OBVA 3TDIA 5FYXA 1GQMA 4MBEA 1CFFA 1PVBA 2Y1MA 2KFHA 4GGFC 3DY9A 1EH2A 2H61A 2I2RE 3I5GB 1K9UA 2LUCA 2MA2A 1QJTA 3KO0A 2JTZA 2HPSA 3EKJA 3D74A 3SJSA 4PHJA 2KFFA 2KBMA 1FW4A 1SCVA 4AOMA 2BCXA 3ICBA 4F7FA 4HRHA 2PRUA 2GTEA 3I5IC 1OZSA 2JT3A 3V2LA 1G33A 1XFYO 5CSNA 1JC2A 1SKTA 1DQEA 3SS5A 2WNDA 5DKRA 5DICA 1SRAA 1QX5B 4MSPA 3HCMA 1YUTA 4JD9A 1R2UA 4N1FA 5FI7A 3RM1A 4WRIA 3O78A 3BOWA 1JFKA 1RROA 3SG2A 2YGUA 3CZ0A 1MXLC 3R1OA 1IJ5A 2L0PA 3C1VA 1ZUZA 4I5LB 1CKKA 3A8RA 1FPWA 2ZRTA 1CDPA 1WDCC 4MZJA 1DJWA 4GBAA 1J7OA 3IF7A 1PSRA 2M7LA 3TDZA 1AHRA 1J7RA 2BECA 2NLNA 2KYCA 4YGCB 3WHUB 1IKUA 2MLEC 4C0LA 2LVKA 1B7TZ 3RLZA 1QV1A 1K2HA 1LA0A 4PE4A 3NSKA 2WCBA 1N2DA 1OW4A 2FOTA 2KHNA 1DJXA 1UHKA 1YVLA 1BOCA 3B6XA 2K2FA 1QIWA 5HYDA 3SIAA 3CDNA 3DVEA 2F2PA 4PE7A 1ORGA 2ISDA 1AK8A 2NCOA 3CWGA 4F0ZB 5KTYA 5ER5A 1DF0B 1YUUA 2LCPA 1TNQA 2PASA 1NCZA 1CDLA 2WC6A 4YRUA 2AMIA 1ZFSA 2JXLA 1BG1A 2LP2A 3CGAA 1M63B 2PVBA 2CXJA 2L4IA 2QEBA 1F54A 2M7NA 3LCPC 1C3YA 3DVJA 2PYQA 2EC6B 3VROA 1XO5A 3O6BA 1B9AA 3SG3A 3D75A 5PALA 1M31A 1IG5A 1WLMA 2WOSA 1GM0A 1XFRA 3NHIA 1J7PA 4NQGA 1BF5A 2KNEA 2LM5A 3B86A 1CB1A 2LMUA 1R6PA 1QX2A 4PHNA 1J55A 5D69A 1K9KA 2KI4B 2ZN9A 1JF0A 3GK4X 3FWCA 1AJ4A 3CR2A 2B1UA 3NSOA 4MEWA 4OVNF 4C0JA 3FE8A 1NX1A 1F4OA 1HQVA 1WRKA 1S1EA 2WORA 1J1EA 2P6BB 3AAJA 5HKYA 1QX7A 4CLNA 2OS8C 2JOJA 2CT9A 3O4XA 2L5XB 3PALA 3JVTC 1ZACA 1B8CA 3NSLA 1BR4B 1IIOA 5JJGA 1KFXL 2WCHA 4GUKA 2BKIB 4NDBA 2JNFA 1NX0A 2L5YA 1CLLA 3DZTA 5I2LA 3L47A 1K93D 4MN0A 1U5IA 5F6TA 2BCAA 1ALVA 1YVHA 4KYNA 4BY5A 2ERBA 1CDMA 1OMRA 1DGVA 2Y4QA 2ZNDA 1WRLA 1Y1AA 1K96A 2JU0A 3OP0A 4FQTA 5HKZA 4HSZA 1SR6B 3BJHA 3M0WA 3KPXA 5AEQA 1B4CA 1Z2CB 1S6CA 4XYNA 1OOGA 1M39A 3O2PA 1ZMZA 3I5FB 1UWOA 2KBIA 1W9ZA 2JULA 1MUXA 3FS7A 3Q8IA 1TN4A 4P5OE 1KQMC 4IJ7A 3NXAA 1FF1A 3OX6A 3EVRA 2Y1NA 1EG3A 1UHHA 3GK1A 2OPOA 3BUWB 1DVIA 3LK1A 1L7ZA 1YX8A 2JRFA 3DXLA 2LANA 4OKHA 5I2QA 1DELA 1TTXA 3QMEA 3S0GA 1NCYA 3DD4A 3ZNIA 2F3YA 3D10A 1CFDA 1C7WA 1DJGA 1K90D 2JT0A 2V53A 3TS5B 5D3OA 2BL0C 4BY4A 3DF0A 3D0YA 1XFZO 1DEKA 3OB1B 1NUBA 5BPJA 1RFJA 2OTGC 3HX4A 1FI5A 3BXKA 4I5NB 1FI6A 1NCXA 1PRWA 2G9BA 4PT1A 1A4PA 2GGZA 1LS8A 2WCFA 3F45A 4YI9A 2BAPA 4YGDB 3UO9A 2CCMA 4DUQA 3L4AA 1KFXS 1DMOA 1EXRA 3EK7A 5KU1A 3B88A 1T14A 5AFPA 1KK8C 4QJ5B 2LUXA 2CBLA 3L4LA 2MBXA 2MRDA 3CABA 3I5HC 3JTDC 1RWYA 3OX5A 3R72A 2I94A 2L50A 1B1GA 2EGDA 1YR5A 2KLEA 2BE6A 2NZ0A 1YURA 1U5IB 3VGOA 3TUYC 1DJHA 2MHHA 3PSRA 1UUSA 4DIRA 1PULA 1SL8A 1H8BA 5CSIA 4HRGA 2Y5IA 1NSHA 4WQ3A 1OOFA 3I5IB 1SMGA 3CYZA 1F70A 1S36A 1IQ5A 1IRJA 1PVAA 2O60A 2KPHA 4E68A 4XJKA 4IL1A 2LP3A 1F71A 3KHEA 1K8UA 3JTDB 2HETA 3RZSA 2M97A 2LVJA 3DVKA 2P70A 3WXAA 4JPZB 3GK2A 3FE9A 3A4UB 3CR4X 1L2OC 3S0AA 2IS9A 2MAZA 1SK6D 2BCBA 3BUMB 1NX3A 1KCYA 1UURA 3PN7C 3DVMA 1TRFA 2L2CA 2I18A 2K61A 2M0RA 2KYFA 2L51A 1CLBA 1LINA 2F2OA 4MRXA 4R1EA 1JFJA 4MVFA 1GJYA 1OMDA 1WDCB 2LNKA 1PALA 4USLA 4AQJA 3LK0A 2M1KB 1YTZC 3PFVA 1QLKA 2LHLA 1GGWA 1KQVA 1BMOA 4NDDA 2ZFDA 1KSMA 1S6IA 1S26D 1LVCD 4M2QA 5FI2A 2FCDA 3AKAA 1GGZA 2QACA 2FCEA 1JWDA 1UHNA 1DJIA 3EK4A 2JC2A 3FWBA 4UPGA 3CS1A 4I5KA 5GQQC 3EVUA 1C07A 3UNWA 2SCPA 1OOHA 1TNPA 1SCMC 3PN7B 2Q91A 2JQ6A 4MZLA 5AXIA 3BUOB 1BR1B 1Y6WA 2K7CA 2JZIA 1C7VA 5JOLA 1F4QA 1QWVA 2LC5A 2L4HA 1NIWA 2NXQA 2D8NA 1QLSA 2PSRA 1RK9A 1SY9A 1KFUS 1OMVA 2F3ZA 2KFGA 3BOWB 2JXCA 1CFCA 2M9GA 2QDIA 1Q80A 1QASA 2JWWA 1Y0VH 4A4BA 3PATA 2WCKA 3BQ3A 1XYDA 4ORAB 1ALWA 3N7HA 2KQYA 2AUCA 4JKTA 4CPVA 1M46A 1DC1A 1ZOTB 4TNCA 4DS7A 2GV5A 2JPOA 2LMTA 1TNXA 3AAKA 4PHMA 3H4SE 1SL9A 1KK7Y 2WCEA 1EJ3A 1OSAA 1QVIZ 1UHIA 1EG4A 2OS8B 2RGIA 3SG7A 2QPTA 1AJ5A 2E30A 3BFAA 3KEVA 1TWOA 3JVTB 1ODBA 2ZKMX 5IBWA 4OV2A 5HLVA 1UHJA 1W7JB 1OE9B 4DRWA 2F8PA 1AP4A 1F55A 1Y1UA 4ORBB 1SNLA 2EHBA 3EVVA 1SL7A 5HL1A 4CFQA 1XK4A 2WCJA 2AAOA 1AVSA 2LMVA 3BYAA 3K21A 3OGNA 1NPQA 2LE9B 1KWOC 1XFWO 4GPLB 4JQ0D 5HKWA 3S0DA 3VRPA 4QJ4B 1MXEA 3DYEA 4QJ3B 1S5GY 1C3ZA 2CTNA 3MSEB 3PJIA 1WY9A 4MZKA 2HQ8A 1DTLA 1TCOB 1XFUO 1N0YA 2K2AA 1W7IB 2KQ6A 3AKBA 4FTGA 2R2IA 5D7FA 5DKNA 4DCKA 5B8IB 4INWA 1HT9A 3I5GC 1KQMB 1WLZA 4M2PA 4U8DA 1SSEB 4PDZA 4PALA 2LLTA 4D1EA 1RTP1 2FJUB 3CZTX 1VRKA 1DF0A 1NP8A 1D1OA 4ICBA 5J3XA 2KAVA 4PHKA 2KGRA 3VRNA 5DKQA 5I94A 4OR9B 1K94A 1Z4HA 3TDUA 3EKHA 2QEVA 2O5GA 4INXA 3PM2A 1B47A 1SW8A 2CNPA 2WCMA 2G2BA 4GNKB 3D73A 4PCWA 1MQ1A 3CLNA 2KDHA 4PE0A 2BL0B 3SS4A 3OHMB 2K7OA 3CR5X 4WQ2A 3IQQA 4ZCUA 2K7DA 4HREE 3D78A 2BNXA 2OTGB 2F33A 1TIZA 3SIBA 5K89A 4L9MA 2K7BA 2WC5A 3SS3A 4CIDA 5CPVA 1A2XA 1XK4C 1YX7A 2COLB 1KFUL 1B8RA 5AANA 4A4CA 1LA3A 4N1GA 1CTRA 1KK7Z 1NWDA 2LAPA 2LV7A 3FE6A 3ZWHA 1A29A 1IQ3A 3BUXB 3VB1A 1QVIY 3S0EA 1KK8B 5KSZA 1M45A 2TN4A 3I5HB 1E8AA 3B87A 4ZCVA 1K9PA 5I2OA 1N65A 1A75A 2MJWB 5I8NA 2LLSA 1TCFA 3PLFB 1QTXA 4OCIA 3TUYB 4YGEB 2MLFC 3BFBA 3R1PA 2WC8A 2KAXA 2ZN8A 1B8LA 1QS7A 2KSPA 1OQPA 3CTNA 5AERA 2Q4UA 2VRGA 2DOQA 1TNWA 1JBAA 1XFXO 3EG5B 1S5GZ 3FIAA 2KLDA 3O4YA 2L2EA 3WHTB 2FJYA 2JT8A 5CSFA 1NX2A 2E6WA 2K60A 1V1GA 2EC6C 1YRUB 2PALA 3GOFA 4GGNA 2KI6D 4ETOA 2H61C 1H4BA 3DF0B 3WNXB 3D0YB 3LL8B 3B7AA 4FQOA 1L2OB 1XFVO 2QEOA 3S0FA 2BBNA 3R1VA 4C0KA 1MF8B 4I5JA 1CM4A 2KI4C 1S3PA 2KOTA 2BKHB 1CLMA 3IVTA 3QRXA 1FBVA 2K8MB 1DJZA 5TNCA 1J1DA 1OZOA 1JSAA 4P2YB 1LKJA 1LXFC 2BE4A 1IH0A 1DT7B 4N5XA 2GGMA 1BJFA 2ZNEA 3CZ2A 2K0JA 1CM1A 2KAYA 1QATA 4YGAA 3EK8A 2WCLA 4JWQA 1SCMB 3OB2B 2M49B 1UP5A 1PK0D 4NDCA 1IWQA 2LVIA 1X02A 2LVVA 1BLQA 4YBHB 1JF2A 1KSOA 1WRZA 2I7AA 2JNXA 1CDNA 2M3WA 1MR8A 2A4JA 3D77A 3CZ1A 1S6JA 4M2OA 1SR6C 4PE1A 1OOJA 1QV0A 1AUIB 2KGBC 4XJKB 4GAOA 5EL2A 3IQOA 4GGFA 1G4YR 5CSJA 1IGVA 3TZ1A 1SBJA 2QEHA 4AQIA 2PMYA 3I5FC 1J7QA 1A75B 3E3RA 3SG4A 3D76A 1SPYA 4ORCB 1OOIX
chains in the Genus database with same CATH topology
5ER4X 2BBMA 1YRTB 1QXPA 5G08A 4GFTA 2HQWA 1RJVA 3VRQA 4YI8A 1BT6A 2NCPA 1V1FA 1EL4A 1DJYA 2M1UA 2L98A 2HF5A 1CFPA 4CFRA 1MWNA 4MLWA 2LHIA 1CMFA 1CMGA 3SG6A 2JTTA 1BU3A 1B7TY 3TS5C 1RECA 1YUSA 2LLUA 2H2KA 2M8UA 3SG5A 3LLEA 4YGBB 1QIVA 1A03A 3VRRA 1G8IA 1IJ6A 1NYAA 1MHOA 3BUNB 1TOPA 2M29A 2ZRSA 4MRYA 1BODA 1XA5A 2JPTA 1CNPA 3KF9A 1XVJA 4Q04A 1K95A 1KWOB 1PSBA 5HLOA 1F8HA 2KI6C 1JUOA 3NSIA 2SASA 1SYMA 3PM8A 1DGUA 1Y1XA 3TDIA 5FYXA 1GQMA 4MBEA 1CFFA 1PVBA 2Y1MA 2KFHA 4GGFC 1EH2A 2H61A 2I2RE 3I5GB 1K9UA 2LUCA 2MA2A 1QJTA 3KO0A 2JTZA 2HPSA 3EKJA 3SJSA 4PHJA 2KFFA 2KBMA 1FW4A 1SCVA 4AOMA 2BCXA 3ICBA 4HRHA 2PRUA 3I5IC 1OZSA 2JT3A 1G33A 1XFYO 5CSNA 1JC2A 1SKTA 2WNDA 5DKRA 1SRAA 1QX5B 4MSPA 3HCMA 1YUTA 1R2UA 4N1FA 3RM1A 4WRIA 3O78A 3BOWA 1JFKA 1RROA 3SG2A 1MXLC 1IJ5A 2L0PA 3C1VA 1ZUZA 4I5LB 1CKKA 3A8RA 1FPWA 2ZRTA 1CDPA 1WDCC 4MZJA 1DJWA 4GBAA 1J7OA 3IF7A 1PSRA 2M7LA 3TDZA 1AHRA 1J7RA 2BECA 2NLNA 2KYCA 4YGCB 3WHUB 1IKUA 2MLEC 4C0LA 2LVKA 1B7TZ 3RLZA 1QV1A 1K2HA 1LA0A 4PE4A 3NSKA 2WCBA 1N2DA 2KHNA 2FOTA 1DJXA 1UHKA 1YVLA 1BOCA 2K2FA 1QIWA 5HYDA 3SIAA 3DVEA 2F2PA 4PE7A 2ISDA 1AK8A 2NCOA 3CWGA 4F0ZB 5KTYA 5ER5A 1DF0B 1YUUA 2LCPA 1TNQA 2PASA 1NCZA 1CDLA 4YRUA 1BG1A 2AMIA 1ZFSA 2JXLA 2LP2A 3CGAA 1M63B 2PVBA 2CXJA 2L4IA 1F54A 2M7NA 3LCPC 3DVJA 2EC6B 3VROA 1XO5A 3O6BA 1B9AA 3SG3A 5PALA 1M31A 1IG5A 1WLMA 2WOSA 1J7PA 4NQGA 1BF5A 2KNEA 2LM5A 1CB1A 2LMUA 1R6PA 1QX2A 4PHNA 1J55A 5D69A 1K9KA 2KI4B 2ZN9A 1JF0A 3GK4X 1AJ4A 3CR2A 2B1UA 3NSOA 4MEWA 4OVNF 4C0JA 1NX1A 1F4OA 1HQVA 1WRKA 1S1EA 2WORA 1J1EA 2P6BB 3AAJA 5HKYA 1QX7A 4CLNA 2OS8C 2JOJA 2CT9A 2L5XB 3PALA 3JVTC 1ZACA 1B8CA 3NSLA 1BR4B 5JJGA 1KFXL 4GUKA 4NDBA 2BKIB 2JNFA 1NX0A 5I2LA 1CLLA 1K93D 4MN0A 1U5IA 5F6TA 2BCAA 1ALVA 1YVHA 4BY5A 1CDMA 1OMRA 1DGVA 2Y4QA 2ZNDA 1WRLA 1Y1AA 1K96A 2JU0A 3OP0A 5HKZA 4HSZA 1SR6B 3M0WA 3KPXA 5AEQA 1B4CA 1S6CA 4XYNA 1M39A 3O2PA 1ZMZA 3I5FB 1UWOA 2KBIA 2JULA 1MUXA 3FS7A 1TN4A 4P5OE 1KQMC 3NXAA 1FF1A 3OX6A 3EVRA 2Y1NA 1EG3A 1UHHA 3GK1A 2OPOA 3BUWB 1DVIA 3LK1A 1L7ZA 1YX8A 2JRFA 5I2QA 2LANA 4OKHA 1TTXA 1NCYA 3DD4A 3ZNIA 2F3YA 3D10A 1CFDA 1C7WA 1DJGA 1K90D 2JT0A 2V53A 3TS5B 2BL0C 4BY4A 3DF0A 3D0YA 1XFZO 3OB1B 1NUBA 5BPJA 1RFJA 2OTGC 3HX4A 1FI5A 3BXKA 4I5NB 1FI6A 1NCXA 1PRWA 2G9BA 1A4PA 2GGZA 2WCFA 3F45A 4YI9A 4YGDB 2CCMA 4DUQA 1KFXS 1DMOA 1EXRA 3EK7A 5KU1A 5AFPA 1KK8C 4QJ5B 2LUXA 2CBLA 2MBXA 2MRDA 3I5HC 3JTDC 1RWYA 3OX5A 2I94A 2L50A 1B1GA 2EGDA 1YR5A 2BE6A 2NZ0A 1YURA 1U5IB 3VGOA 3TUYC 1DJHA 2MHHA 3PSRA 1UUSA 4DIRA 1PULA 1SL8A 1H8BA 5CSIA 4HRGA 2Y5IA 1NSHA 4WQ3A 3I5IB 1SMGA 1F70A 1S36A 1IQ5A 1IRJA 1PVAA 2O60A 4E68A 4XJKA 4IL1A 2LP3A 1F71A 3KHEA 1K8UA 3JTDB 2HETA 2M97A 2LVJA 3DVKA 3WXAA 4JPZB 3GK2A 3A4UB 3CR4X 1L2OC 2IS9A 2MAZA 1SK6D 2BCBA 3BUMB 1NX3A 1KCYA 1UURA 3PN7C 3DVMA 1TRFA 2I18A 2K61A 2M0RA 2KYFA 2L51A 1CLBA 1LINA 2F2OA 4MRXA 4R1EA 1JFJA 4MVFA 1GJYA 1OMDA 1WDCB 2LNKA 1PALA 4USLA 4AQJA 3LK0A 2M1KB 1YTZC 3PFVA 1QLKA 2LHLA 1GGWA 1KQVA 1BMOA 4NDDA 2ZFDA 1KSMA 1S6IA 1S26D 1LVCD 4M2QA 2FCDA 3AKAA 1GGZA 2QACA 2FCEA 1JWDA 1UHNA 1DJIA 3EK4A 2JC2A 3FWBA 4UPGA 3CS1A 4I5KA 5GQQC 3EVUA 1C07A 2SCPA 1TNPA 1SCMC 3PN7B 2Q91A 2JQ6A 4MZLA 5AXIA 3BUOB 1BR1B 1Y6WA 2K7CA 2JZIA 1C7VA 5JOLA 1F4QA 2LC5A 2L4HA 1NIWA 2NXQA 2D8NA 1QLSA 2PSRA 1RK9A 1SY9A 1KFUS 1OMVA 2F3ZA 2KFGA 3BOWB 2JXCA 1CFCA 2M9GA 1Q80A 1QASA 2JWWA 1Y0VH 4A4BA 3PATA 3BQ3A 1XYDA 4ORAB 1ALWA 2KQYA 2AUCA 4CPVA 1M46A 1ZOTB 4TNCA 4DS7A 2GV5A 2LMTA 1TNXA 3AAKA 4PHMA 3H4SE 1SL9A 1KK7Y 2WCEA 1EJ3A 1OSAA 1QVIZ 1UHIA 1EG4A 2OS8B 2RGIA 3SG7A 2QPTA 1AJ5A 2E30A 3KEVA 3JVTB 1ODBA 2ZKMX 5IBWA 4OV2A 5HLVA 1UHJA 1W7JB 1OE9B 4DRWA 2F8PA 1AP4A 1F55A 1Y1UA 4ORBB 1SNLA 2EHBA 3EVVA 1SL7A 4CFQA 1XK4A 2AAOA 1AVSA 2LMVA 3BYAA 3K21A 4GPLB 1NPQA 2LE9B 1KWOC 1XFWO 4JQ0D 5HKWA 3VRPA 4QJ4B 1H4BA 1MXEA 4QJ3B 1S5GY 2CTNA 3MSEB 1WY9A 4MZKA 2HQ8A 1DTLA 1TCOB 1XFUO 1N0YA 2K2AA 1W7IB 2KQ6A 3AKBA 4FTGA 2R2IA 5D7FA 5DKNA 4DCKA 5B8IB 1HT9A 3I5GC 1KQMB 1WLZA 4M2PA 4U8DA 4PDZA 4PALA 2LLTA 4D1EA 1RTP1 2FJUB 3CZTX 1VRKA 1DF0A 1NP8A 1D1OA 4ICBA 5J3XA 2KAVA 4PHKA 2KGRA 3VRNA 5DKQA 4OR9B 1K94A 3TDUA 3EKHA 2O5GA 1B47A 1SW8A 2CNPA 2G2BA 4GNKB 4PCWA 1MQ1A 3CLNA 2KDHA 4PE0A 2BL0B 3OHMB 2K7OA 3CR5X 4WQ2A 3IQQA 4ZCUA 2K7DA 4HREE 2OTGB 2F33A 1TIZA 3SIBA 5K89A 4L9MA 2K7BA 4CIDA 5CPVA 1A2XA 1XK4C 1YX7A 2COLB 1KFUL 1B8RA 5AANA 4A4CA 1LA3A 4N1GA 1CTRA 1KK7Z 1NWDA 2LAPA 2LV7A 3ZWHA 1A29A 1IQ3A 3BUXB 1QVIY 5KSZA 1KK8B 1M45A 2TN4A 3I5HB 1E8AA 4ZCVA 1K9PA 5I2OA 1N65A 1A75A 2MJWB 5I8NA 2LLSA 1TCFA 3PLFB 1QTXA 4OCIA 3TUYB 4YGEB 2MLFC 2WC8A 2KAXA 2ZN8A 1B8LA 1QS7A 2KSPA 1OQPA 3CTNA 5AERA 2Q4UA 2VRGA 2DOQA 1TNWA 1JBAA 1XFXO 1S5GZ 3FIAA 3O4YA 2L2EA 3WHTB 2JT8A 5CSFA 1NX2A 2E6WA 2PALA 1V1GA 2EC6C 1YRUB 3GOFA 4GGNA 2KI6D 4ETOA 2H61C 3DF0B 3WNXB 3D0YB 3LL8B 4FQOA 1L2OB 1XFVO 2BBNA 4C0KA 1MF8B 4I5JA 1CM4A 2KI4C 1S3PA 2KOTA 2BKHB 1CLMA 3QRXA 1FBVA 2K8MB 1DJZA 5TNCA 1J1DA 1OZOA 1JSAA 4P2YB 1LKJA 1LXFC 2BE4A 1IH0A 1DT7B 4N5XA 2GGMA 1BJFA 2ZNEA 2K0JA 1CM1A 2KAYA 1QATA 4YGAA 3EK8A 4JWQA 1SCMB 3OB2B 2M49B 1UP5A 1PK0D 4NDCA 1IWQA 2LVIA 1X02A 2LVVA 1BLQA 4YBHB 1JF2A 1KSOA 1WRZA 2I7AA 2JNXA 1CDNA 2M3WA 1MR8A 2A4JA 1S6JA 4M2OA 1SR6C 4PE1A 1OOJA 1QV0A 1AUIB 2KGBC 4XJKB 4GAOA 3IQOA 4GGFA 1G4YR 5CSJA 1IGVA 3TZ1A 1SBJA 4AQIA 2PMYA 3I5FC 1J7QA 1A75B 3E3RA 3SG4A 1SPYA 4ORCB 3FWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ER4 X;  2BBM A;  1YRT B;  1QXP A;  5G08 A;  4GFT A;  2HQW A;  1RJV A;  3VRQ A;  4YI8 A;  1BT6 A;  2NCP A;  1V1F A;  1EL4 A;  1DJY A;  2M1U A;  2L98 A;  2HF5 A;  1CFP A;  4CFR A;  1MWN A;  4MLW A;  2LHI A;  1CMF A;  1CMG A;  3SG6 A;  2JTT A;  1BU3 A;  1B7T Y;  3TS5 C;  1REC A;  1YUS A;  2LLU A;  2H2K A;  2M8U A;  3SG5 A;  3LLE A;  4YGB B;  1QIV A;  1A03 A;  3VRR A;  1G8I A;  1IJ6 A;  1NYA A;  1MHO A;  3BUN B;  1TOP A;  2M29 A;  2ZRS A;  4MRY A;  1BOD A;  1XA5 A;  2JPT A;  1CNP A;  3KF9 A;  1XVJ A;  4Q04 A;  1K95 A;  1KWO B;  1PSB A;  5HLO A;  1F8H A;  2KI6 C;  1JUO A;  3NSI A;  2SAS A;  1SYM A;  3PM8 A;  1DGU A;  1Y1X A;  3TDI A;  5FYX A;  1GQM A;  4MBE A;  1CFF A;  1PVB A;  2Y1M A;  2KFH A;  4GGF C;  1EH2 A;  2H61 A;  2I2R E;  3I5G B;  1K9U A;  2LUC A;  2MA2 A;  1QJT A;  3KO0 A;  2JTZ A;  2HPS A;  3EKJ A;  3SJS A;  4PHJ A;  2KFF A;  2KBM A;  1FW4 A;  1SCV A;  4AOM A;  2BCX A;  3ICB A;  4HRH A;  2PRU A;  3I5I C;  1OZS A;  2JT3 A;  1G33 A;  1XFY O;  5CSN A;  1JC2 A;  1SKT A;  2WND A;  5DKR A;  1SRA A;  1QX5 B;  4MSP A;  3HCM A;  1YUT A;  1R2U A;  4N1F A;  3RM1 A;  4WRI A;  3O78 A;  3BOW A;  1JFK A;  1RRO A;  3SG2 A;  1MXL C;  1IJ5 A;  2L0P A;  3C1V A;  1ZUZ A;  4I5L B;  1CKK A;  3A8R A;  1FPW A;  2ZRT A;  1CDP A;  1WDC C;  4MZJ A;  1DJW A;  4GBA A;  1J7O A;  3IF7 A;  1PSR A;  2M7L A;  3TDZ A;  1AHR A;  1J7R A;  2BEC A;  2NLN A;  2KYC A;  4YGC B;  3WHU B;  1IKU A;  2MLE C;  4C0L A;  2LVK A;  1B7T Z;  3RLZ A;  1QV1 A;  1K2H A;  1LA0 A;  4PE4 A;  3NSK A;  2WCB A;  1N2D A;  2KHN A;  2FOT A;  1DJX A;  1UHK A;  1YVL A;  1BOC A;  2K2F A;  1QIW A;  5HYD A;  3SIA A;  3DVE A;  2F2P A;  4PE7 A;  2ISD A;  1AK8 A;  2NCO A;  3CWG A;  4F0Z B;  5KTY A;  5ER5 A;  1DF0 B;  1YUU A;  2LCP A;  1TNQ A;  2PAS A;  1NCZ A;  1CDL A;  4YRU A;  1BG1 A;  2AMI A;  1ZFS A;  2JXL A;  2LP2 A;  3CGA A;  1M63 B;  2PVB A;  2CXJ A;  2L4I A;  1F54 A;  2M7N A;  3LCP C;  3DVJ A;  2EC6 B;  3VRO A;  1XO5 A;  3O6B A;  1B9A A;  3SG3 A;  5PAL A;  1M31 A;  1IG5 A;  1WLM A;  2WOS A;  1J7P A;  4NQG A;  1BF5 A;  2KNE A;  2LM5 A;  1CB1 A;  2LMU A;  1R6P A;  1QX2 A;  4PHN A;  1J55 A;  5D69 A;  1K9K A;  2KI4 B;  2ZN9 A;  1JF0 A;  3GK4 X;  1AJ4 A;  3CR2 A;  2B1U A;  3NSO A;  4MEW A;  4OVN F;  4C0J A;  1NX1 A;  1F4O A;  1HQV A;  1WRK A;  1S1E A;  2WOR A;  1J1E A;  2P6B B;  3AAJ A;  5HKY A;  1QX7 A;  4CLN A;  2OS8 C;  2JOJ A;  2CT9 A;  2L5X B;  3PAL A;  3JVT C;  1ZAC A;  1B8C A;  3NSL A;  1BR4 B;  5JJG A;  1KFX L;  4GUK A;  4NDB A;  2BKI B;  2JNF A;  1NX0 A;  5I2L A;  1CLL A;  1K93 D;  4MN0 A;  1U5I A;  5F6T A;  2BCA A;  1ALV A;  1YVH A;  4BY5 A;  1CDM A;  1OMR A;  1DGV A;  2Y4Q A;  2ZND A;  1WRL A;  1Y1A A;  1K96 A;  2JU0 A;  3OP0 A;  5HKZ A;  4HSZ A;  1SR6 B;  3M0W A;  3KPX A;  5AEQ A;  1B4C A;  1S6C A;  4XYN A;  1M39 A;  3O2P A;  1ZMZ A;  3I5F B;  1UWO A;  2KBI A;  2JUL A;  1MUX A;  3FS7 A;  1TN4 A;  4P5O E;  1KQM C;  3NXA A;  1FF1 A;  3OX6 A;  3EVR A;  2Y1N A;  1EG3 A;  1UHH A;  3GK1 A;  2OPO A;  3BUW B;  1DVI A;  3LK1 A;  1L7Z A;  1YX8 A;  2JRF A;  5I2Q A;  2LAN A;  4OKH A;  1TTX A;  1NCY A;  3DD4 A;  3ZNI A;  2F3Y A;  3D10 A;  1CFD A;  1C7W A;  1DJG A;  1K90 D;  2JT0 A;  2V53 A;  3TS5 B;  2BL0 C;  4BY4 A;  3DF0 A;  3D0Y A;  1XFZ O;  3OB1 B;  1NUB A;  5BPJ A;  1RFJ A;  2OTG C;  3HX4 A;  1FI5 A;  3BXK A;  4I5N B;  1FI6 A;  1NCX A;  1PRW A;  2G9B A;  1A4P A;  2GGZ A;  2WCF A;  3F45 A;  4YI9 A;  4YGD B;  2CCM A;  4DUQ A;  1KFX S;  1DMO A;  1EXR A;  3EK7 A;  5KU1 A;  5AFP A;  1KK8 C;  4QJ5 B;  2LUX A;  2CBL A;  2MBX A;  2MRD A;  3I5H C;  3JTD C;  1RWY A;  3OX5 A;  2I94 A;  2L50 A;  1B1G A;  2EGD A;  1YR5 A;  2BE6 A;  2NZ0 A;  1YUR A;  1U5I B;  3VGO A;  3TUY C;  1DJH A;  2MHH A;  3PSR A;  1UUS A;  4DIR A;  1PUL A;  1SL8 A;  1H8B A;  5CSI A;  4HRG A;  2Y5I A;  1NSH A;  4WQ3 A;  3I5I B;  1SMG A;  1F70 A;  1S36 A;  1IQ5 A;  1IRJ A;  1PVA A;  2O60 A;  4E68 A;  4XJK A;  4IL1 A;  2LP3 A;  1F71 A;  3KHE A;  1K8U A;  3JTD B;  2HET A;  2M97 A;  2LVJ A;  3DVK A;  3WXA A;  4JPZ B;  3GK2 A;  3A4U B;  3CR4 X;  1L2O C;  2IS9 A;  2MAZ A;  1SK6 D;  2BCB A;  3BUM B;  1NX3 A;  1KCY A;  1UUR A;  3PN7 C;  3DVM A;  1TRF A;  2I18 A;  2K61 A;  2M0R A;  2KYF A;  2L51 A;  1CLB A;  1LIN A;  2F2O A;  4MRX A;  4R1E A;  1JFJ A;  4MVF A;  1GJY A;  1OMD A;  1WDC B;  2LNK A;  1PAL A;  4USL A;  4AQJ A;  3LK0 A;  2M1K B;  1YTZ C;  3PFV A;  1QLK A;  2LHL A;  1GGW A;  1KQV A;  1BMO A;  4NDD A;  2ZFD A;  1KSM A;  1S6I A;  1S26 D;  1LVC D;  4M2Q A;  2FCD A;  3AKA A;  1GGZ A;  2QAC A;  2FCE A;  1JWD A;  1UHN A;  1DJI A;  3EK4 A;  2JC2 A;  3FWB A;  4UPG A;  3CS1 A;  4I5K A;  5GQQ C;  3EVU A;  1C07 A;  2SCP A;  1TNP A;  1SCM C;  3PN7 B;  2Q91 A;  2JQ6 A;  4MZL A;  5AXI A;  3BUO B;  1BR1 B;  1Y6W A;  2K7C A;  2JZI A;  1C7V A;  5JOL A;  1F4Q A;  2LC5 A;  2L4H A;  1NIW A;  2NXQ A;  2D8N A;  1QLS A;  2PSR A;  1RK9 A;  1SY9 A;  1KFU S;  1OMV A;  2F3Z A;  2KFG A;  3BOW B;  2JXC A;  1CFC A;  2M9G A;  1Q80 A;  1QAS A;  2JWW A;  1Y0V H;  4A4B A;  3PAT A;  3BQ3 A;  1XYD A;  4ORA B;  1ALW A;  2KQY A;  2AUC A;  4CPV A;  1M46 A;  1ZOT B;  4TNC A;  4DS7 A;  2GV5 A;  2LMT A;  1TNX A;  3AAK A;  4PHM A;  3H4S E;  1SL9 A;  1KK7 Y;  2WCE A;  1EJ3 A;  1OSA A;  1QVI Z;  1UHI A;  1EG4 A;  2OS8 B;  2RGI A;  3SG7 A;  2QPT A;  1AJ5 A;  2E30 A;  3KEV A;  3JVT B;  1ODB A;  2ZKM X;  5IBW A;  4OV2 A;  5HLV A;  1UHJ A;  1W7J B;  1OE9 B;  4DRW A;  2F8P A;  1AP4 A;  1F55 A;  1Y1U A;  4ORB B;  1SNL A;  2EHB A;  3EVV A;  1SL7 A;  4CFQ A;  1XK4 A;  2AAO A;  1AVS A;  2LMV A;  3BYA A;  3K21 A;  4GPL B;  1NPQ A;  2LE9 B;  1KWO C;  1XFW O;  4JQ0 D;  5HKW A;  3VRP A;  4QJ4 B;  1H4B A;  1MXE A;  4QJ3 B;  1S5G Y;  2CTN A;  3MSE B;  1WY9 A;  4MZK A;  2HQ8 A;  1DTL A;  1TCO B;  1XFU O;  1N0Y A;  2K2A A;  1W7I B;  2KQ6 A;  3AKB A;  4FTG A;  2R2I A;  5D7F A;  5DKN A;  4DCK A;  5B8I B;  1HT9 A;  3I5G C;  1KQM B;  1WLZ A;  4M2P A;  4U8D A;  4PDZ A;  4PAL A;  2LLT A;  4D1E A;  1RTP 1;  2FJU B;  3CZT X;  1VRK A;  1DF0 A;  1NP8 A;  1D1O A;  4ICB A;  5J3X A;  2KAV A;  4PHK A;  2KGR A;  3VRN A;  5DKQ A;  4OR9 B;  1K94 A;  3TDU A;  3EKH A;  2O5G A;  1B47 A;  1SW8 A;  2CNP A;  2G2B A;  4GNK B;  4PCW A;  1MQ1 A;  3CLN A;  2KDH A;  4PE0 A;  2BL0 B;  3OHM B;  2K7O A;  3CR5 X;  4WQ2 A;  3IQQ A;  4ZCU A;  2K7D A;  4HRE E;  2OTG B;  2F33 A;  1TIZ A;  3SIB A;  5K89 A;  4L9M A;  2K7B A;  4CID A;  5CPV A;  1A2X A;  1XK4 C;  1YX7 A;  2COL B;  1KFU L;  1B8R A;  5AAN A;  4A4C A;  1LA3 A;  4N1G A;  1CTR A;  1KK7 Z;  1NWD A;  2LAP A;  2LV7 A;  3ZWH A;  1A29 A;  1IQ3 A;  3BUX B;  1QVI Y;  5KSZ A;  1KK8 B;  1M45 A;  2TN4 A;  3I5H B;  1E8A A;  4ZCV A;  1K9P A;  5I2O A;  1N65 A;  1A75 A;  2MJW B;  5I8N A;  2LLS A;  1TCF A;  3PLF B;  1QTX A;  4OCI A;  3TUY B;  4YGE B;  2MLF C;  2WC8 A;  2KAX A;  2ZN8 A;  1B8L A;  1QS7 A;  2KSP A;  1OQP A;  3CTN A;  5AER A;  2Q4U A;  2VRG A;  2DOQ A;  1TNW A;  1JBA A;  1XFX O;  1S5G Z;  3FIA A;  3O4Y A;  2L2E A;  3WHT B;  2JT8 A;  5CSF A;  1NX2 A;  2E6W A;  2PAL A;  1V1G A;  2EC6 C;  1YRU B;  3GOF A;  4GGN A;  2KI6 D;  4ETO A;  2H61 C;  3DF0 B;  3WNX B;  3D0Y B;  3LL8 B;  4FQO A;  1L2O B;  1XFV O;  2BBN A;  4C0K A;  1MF8 B;  4I5J A;  1CM4 A;  2KI4 C;  1S3P A;  2KOT A;  2BKH B;  1CLM A;  3QRX A;  1FBV A;  2K8M B;  1DJZ A;  5TNC A;  1J1D A;  1OZO A;  1JSA A;  4P2Y B;  1LKJ A;  1LXF C;  2BE4 A;  1IH0 A;  1DT7 B;  4N5X A;  2GGM A;  1BJF A;  2ZNE A;  2K0J A;  1CM1 A;  2KAY A;  1QAT A;  4YGA A;  3EK8 A;  4JWQ A;  1SCM B;  3OB2 B;  2M49 B;  1UP5 A;  1PK0 D;  4NDC A;  1IWQ A;  2LVI A;  1X02 A;  2LVV A;  1BLQ A;  4YBH B;  1JF2 A;  1KSO A;  1WRZ A;  2I7A A;  2JNX A;  1CDN A;  2M3W A;  1MR8 A;  2A4J A;  1S6J A;  4M2O A;  1SR6 C;  4PE1 A;  1OOJ A;  1QV0 A;  1AUI B;  2KGB C;  4XJK B;  4GAO A;  3IQO A;  4GGF A;  1G4Y R;  5CSJ A;  1IGV A;  3TZ1 A;  1SBJ A;  4AQI A;  2PMY A;  3I5F C;  1J7Q A;  1A75 B;  3E3R A;  3SG4 A;  1SPY A;  4ORC B;  3FWC A; 
#chains in the Genus database with same CATH topology
 5ER4 X;  2BBM A;  1YRT B;  1QXP A;  5G08 A;  2P71 A;  4GFT A;  5FI6 A;  2HQW A;  1RJV A;  3VRQ A;  4YI8 A;  1BT6 A;  3NGV A;  2NCP A;  4OZD A;  1V1F A;  1EL4 A;  1DJY A;  2M1U A;  2L98 A;  2HF5 A;  1CFP A;  4CFR A;  1MWN A;  4MLW A;  2LHI A;  1CMF A;  1CMG A;  2H8V A;  3SG6 A;  2JTT A;  2PQL A;  3K1E A;  1BU3 A;  1B7T Y;  3TS5 C;  1REC A;  1YUS A;  2LLU A;  2H2K A;  2M8U A;  1P28 A;  3SG5 A;  3LLE A;  4YGB B;  1QIV A;  1A03 A;  3VRR A;  1G8I A;  1IJ6 A;  1NYA A;  1MHO A;  3BUN B;  1TOP A;  2M29 A;  2ZRS A;  4MRY A;  1BOD A;  1XA5 A;  3BFH A;  2JPT A;  1CNP A;  3KF9 A;  1XVJ A;  4Q04 A;  1K95 A;  1KWO B;  1PSB A;  5HLO A;  1F8H A;  2KI6 C;  3S0B A;  1JUO A;  1TUJ A;  3NSI A;  1TUZ A;  1SYM A;  2SAS A;  3PM8 A;  1DGU A;  1Y1X A;  3NHT A;  3OBV A;  3TDI A;  5FYX A;  1GQM A;  4MBE A;  1CFF A;  1PVB A;  2Y1M A;  2KFH A;  4GGF C;  3DY9 A;  1EH2 A;  2H61 A;  2I2R E;  3I5G B;  1K9U A;  2LUC A;  2MA2 A;  1QJT A;  3KO0 A;  2JTZ A;  2HPS A;  3EKJ A;  3D74 A;  3SJS A;  4PHJ A;  2KFF A;  2KBM A;  1FW4 A;  1SCV A;  4AOM A;  2BCX A;  3ICB A;  4F7F A;  4HRH A;  2PRU A;  2GTE A;  3I5I C;  1OZS A;  2JT3 A;  3V2L A;  1G33 A;  1XFY O;  5CSN A;  1JC2 A;  1SKT A;  1DQE A;  3SS5 A;  2WND A;  5DKR A;  5DIC A;  1SRA A;  1QX5 B;  4MSP A;  3HCM A;  1YUT A;  4JD9 A;  1R2U A;  4N1F A;  5FI7 A;  3RM1 A;  4WRI A;  3O78 A;  3BOW A;  1JFK A;  1RRO A;  3SG2 A;  2YGU A;  3CZ0 A;  1MXL C;  3R1O A;  1IJ5 A;  2L0P A;  3C1V A;  1ZUZ A;  4I5L B;  1CKK A;  3A8R A;  1FPW A;  2ZRT A;  1CDP A;  1WDC C;  4MZJ A;  1DJW A;  4GBA A;  1J7O A;  3IF7 A;  1PSR A;  2M7L A;  3TDZ A;  1AHR A;  1J7R A;  2BEC A;  2NLN A;  2KYC A;  4YGC B;  3WHU B;  1IKU A;  2MLE C;  4C0L A;  2LVK A;  1B7T Z;  3RLZ A;  1QV1 A;  1K2H A;  1LA0 A;  4PE4 A;  3NSK A;  2WCB A;  1N2D A;  1OW4 A;  2FOT A;  2KHN A;  1DJX A;  1UHK A;  1YVL A;  1BOC A;  3B6X A;  2K2F A;  1QIW A;  5HYD A;  3SIA A;  3CDN A;  3DVE A;  2F2P A;  4PE7 A;  1ORG A;  2ISD A;  1AK8 A;  2NCO A;  3CWG A;  4F0Z B;  5KTY A;  5ER5 A;  1DF0 B;  1YUU A;  2LCP A;  1TNQ A;  2PAS A;  1NCZ A;  1CDL A;  2WC6 A;  4YRU A;  2AMI A;  1ZFS A;  2JXL A;  1BG1 A;  2LP2 A;  3CGA A;  1M63 B;  2PVB A;  2CXJ A;  2L4I A;  2QEB A;  1F54 A;  2M7N A;  3LCP C;  1C3Y A;  3DVJ A;  2PYQ A;  2EC6 B;  3VRO A;  1XO5 A;  3O6B A;  1B9A A;  3SG3 A;  3D75 A;  5PAL A;  1M31 A;  1IG5 A;  1WLM A;  2WOS A;  1GM0 A;  1XFR A;  3NHI A;  1J7P A;  4NQG A;  1BF5 A;  2KNE A;  2LM5 A;  3B86 A;  1CB1 A;  2LMU A;  1R6P A;  1QX2 A;  4PHN A;  1J55 A;  5D69 A;  1K9K A;  2KI4 B;  2ZN9 A;  1JF0 A;  3GK4 X;  3FWC A;  1AJ4 A;  3CR2 A;  2B1U A;  3NSO A;  4MEW A;  4OVN F;  4C0J A;  3FE8 A;  1NX1 A;  1F4O A;  1HQV A;  1WRK A;  1S1E A;  2WOR A;  1J1E A;  2P6B B;  3AAJ A;  5HKY A;  1QX7 A;  4CLN A;  2OS8 C;  2JOJ A;  2CT9 A;  3O4X A;  2L5X B;  3PAL A;  3JVT C;  1ZAC A;  1B8C A;  3NSL A;  1BR4 B;  1IIO A;  5JJG A;  1KFX L;  2WCH A;  4GUK A;  2BKI B;  4NDB A;  2JNF A;  1NX0 A;  2L5Y A;  1CLL A;  3DZT A;  5I2L A;  3L47 A;  1K93 D;  4MN0 A;  1U5I A;  5F6T A;  2BCA A;  1ALV A;  1YVH A;  4KYN A;  4BY5 A;  2ERB A;  1CDM A;  1OMR A;  1DGV A;  2Y4Q A;  2ZND A;  1WRL A;  1Y1A A;  1K96 A;  2JU0 A;  3OP0 A;  4FQT A;  5HKZ A;  4HSZ A;  1SR6 B;  3BJH A;  3M0W A;  3KPX A;  5AEQ A;  1B4C A;  1Z2C B;  1S6C A;  4XYN A;  1OOG A;  1M39 A;  3O2P A;  1ZMZ A;  3I5F B;  1UWO A;  2KBI A;  1W9Z A;  2JUL A;  1MUX A;  3FS7 A;  3Q8I A;  1TN4 A;  4P5O E;  1KQM C;  4IJ7 A;  3NXA A;  1FF1 A;  3OX6 A;  3EVR A;  2Y1N A;  1EG3 A;  1UHH A;  3GK1 A;  2OPO A;  3BUW B;  1DVI A;  3LK1 A;  1L7Z A;  1YX8 A;  2JRF A;  3DXL A;  2LAN A;  4OKH A;  5I2Q A;  1DEL A;  1TTX A;  3QME A;  3S0G A;  1NCY A;  3DD4 A;  3ZNI A;  2F3Y A;  3D10 A;  1CFD A;  1C7W A;  1DJG A;  1K90 D;  2JT0 A;  2V53 A;  3TS5 B;  5D3O A;  2BL0 C;  4BY4 A;  3DF0 A;  3D0Y A;  1XFZ O;  1DEK A;  3OB1 B;  1NUB A;  5BPJ A;  1RFJ A;  2OTG C;  3HX4 A;  1FI5 A;  3BXK A;  4I5N B;  1FI6 A;  1NCX A;  1PRW A;  2G9B A;  4PT1 A;  1A4P A;  2GGZ A;  1LS8 A;  2WCF A;  3F45 A;  4YI9 A;  2BAP A;  4YGD B;  3UO9 A;  2CCM A;  4DUQ A;  3L4A A;  1KFX S;  1DMO A;  1EXR A;  3EK7 A;  5KU1 A;  3B88 A;  1T14 A;  5AFP A;  1KK8 C;  4QJ5 B;  2LUX A;  2CBL A;  3L4L A;  2MBX A;  2MRD A;  3CAB A;  3I5H C;  3JTD C;  1RWY A;  3OX5 A;  3R72 A;  2I94 A;  2L50 A;  1B1G A;  2EGD A;  1YR5 A;  2KLE A;  2BE6 A;  2NZ0 A;  1YUR A;  1U5I B;  3VGO A;  3TUY C;  1DJH A;  2MHH A;  3PSR A;  1UUS A;  4DIR A;  1PUL A;  1SL8 A;  1H8B A;  5CSI A;  4HRG A;  2Y5I A;  1NSH A;  4WQ3 A;  1OOF A;  3I5I B;  1SMG A;  3CYZ A;  1F70 A;  1S36 A;  1IQ5 A;  1IRJ A;  1PVA A;  2O60 A;  2KPH A;  4E68 A;  4XJK A;  4IL1 A;  2LP3 A;  1F71 A;  3KHE A;  1K8U A;  3JTD B;  2HET A;  3RZS A;  2M97 A;  2LVJ A;  3DVK A;  2P70 A;  3WXA A;  4JPZ B;  3GK2 A;  3FE9 A;  3A4U B;  3CR4 X;  1L2O C;  3S0A A;  2IS9 A;  2MAZ A;  1SK6 D;  2BCB A;  3BUM B;  1NX3 A;  1KCY A;  1UUR A;  3PN7 C;  3DVM A;  1TRF A;  2L2C A;  2I18 A;  2K61 A;  2M0R A;  2KYF A;  2L51 A;  1CLB A;  1LIN A;  2F2O A;  4MRX A;  4R1E A;  1JFJ A;  4MVF A;  1GJY A;  1OMD A;  1WDC B;  2LNK A;  1PAL A;  4USL A;  4AQJ A;  3LK0 A;  2M1K B;  1YTZ C;  3PFV A;  1QLK A;  2LHL A;  1GGW A;  1KQV A;  1BMO A;  4NDD A;  2ZFD A;  1KSM A;  1S6I A;  1S26 D;  1LVC D;  4M2Q A;  5FI2 A;  2FCD A;  3AKA A;  1GGZ A;  2QAC A;  2FCE A;  1JWD A;  1UHN A;  1DJI A;  3EK4 A;  2JC2 A;  3FWB A;  4UPG A;  3CS1 A;  4I5K A;  5GQQ C;  3EVU A;  1C07 A;  3UNW A;  2SCP A;  1OOH A;  1TNP A;  1SCM C;  3PN7 B;  2Q91 A;  2JQ6 A;  4MZL A;  5AXI A;  3BUO B;  1BR1 B;  1Y6W A;  2K7C A;  2JZI A;  1C7V A;  5JOL A;  1F4Q A;  1QWV A;  2LC5 A;  2L4H A;  1NIW A;  2NXQ A;  2D8N A;  1QLS A;  2PSR A;  1RK9 A;  1SY9 A;  1KFU S;  1OMV A;  2F3Z A;  2KFG A;  3BOW B;  2JXC A;  1CFC A;  2M9G A;  2QDI A;  1Q80 A;  1QAS A;  2JWW A;  1Y0V H;  4A4B A;  3PAT A;  2WCK A;  3BQ3 A;  1XYD A;  4ORA B;  1ALW A;  3N7H A;  2KQY A;  2AUC A;  4JKT A;  4CPV A;  1M46 A;  1DC1 A;  1ZOT B;  4TNC A;  4DS7 A;  2GV5 A;  2JPO A;  2LMT A;  1TNX A;  3AAK A;  4PHM A;  3H4S E;  1SL9 A;  1KK7 Y;  2WCE A;  1EJ3 A;  1OSA A;  1QVI Z;  1UHI A;  1EG4 A;  2OS8 B;  2RGI A;  3SG7 A;  2QPT A;  1AJ5 A;  2E30 A;  3BFA A;  3KEV A;  1TWO A;  3JVT B;  1ODB A;  2ZKM X;  5IBW A;  4OV2 A;  5HLV A;  1UHJ A;  1W7J B;  1OE9 B;  4DRW A;  2F8P A;  1AP4 A;  1F55 A;  1Y1U A;  4ORB B;  1SNL A;  2EHB A;  3EVV A;  1SL7 A;  5HL1 A;  4CFQ A;  1XK4 A;  2WCJ A;  2AAO A;  1AVS A;  2LMV A;  3BYA A;  3K21 A;  3OGN A;  1NPQ A;  2LE9 B;  1KWO C;  1XFW O;  4GPL B;  4JQ0 D;  5HKW A;  3S0D A;  3VRP A;  4QJ4 B;  1MXE A;  3DYE A;  4QJ3 B;  1S5G Y;  1C3Z A;  2CTN A;  3MSE B;  3PJI A;  1WY9 A;  4MZK A;  2HQ8 A;  1DTL A;  1TCO B;  1XFU O;  1N0Y A;  2K2A A;  1W7I B;  2KQ6 A;  3AKB A;  4FTG A;  2R2I A;  5D7F A;  5DKN A;  4DCK A;  5B8I B;  4INW A;  1HT9 A;  3I5G C;  1KQM B;  1WLZ A;  4M2P A;  4U8D A;  1SSE B;  4PDZ A;  4PAL A;  2LLT A;  4D1E A;  1RTP 1;  2FJU B;  3CZT X;  1VRK A;  1DF0 A;  1NP8 A;  1D1O A;  4ICB A;  5J3X A;  2KAV A;  4PHK A;  2KGR A;  3VRN A;  5DKQ A;  5I94 A;  4OR9 B;  1K94 A;  1Z4H A;  3TDU A;  3EKH A;  2QEV A;  2O5G A;  4INX A;  3PM2 A;  1B47 A;  1SW8 A;  2CNP A;  2WCM A;  2G2B A;  4GNK B;  3D73 A;  4PCW A;  1MQ1 A;  3CLN A;  2KDH A;  4PE0 A;  2BL0 B;  3SS4 A;  3OHM B;  2K7O A;  3CR5 X;  4WQ2 A;  3IQQ A;  4ZCU A;  2K7D A;  4HRE E;  3D78 A;  2BNX A;  2OTG B;  2F33 A;  1TIZ A;  3SIB A;  5K89 A;  4L9M A;  2K7B A;  2WC5 A;  3SS3 A;  4CID A;  5CPV A;  1A2X A;  1XK4 C;  1YX7 A;  2COL B;  1KFU L;  1B8R A;  5AAN A;  4A4C A;  1LA3 A;  4N1G A;  1CTR A;  1KK7 Z;  1NWD A;  2LAP A;  2LV7 A;  3FE6 A;  3ZWH A;  1A29 A;  1IQ3 A;  3BUX B;  3VB1 A;  1QVI Y;  3S0E A;  1KK8 B;  5KSZ A;  1M45 A;  2TN4 A;  3I5H B;  1E8A A;  3B87 A;  4ZCV A;  1K9P A;  5I2O A;  1N65 A;  1A75 A;  2MJW B;  5I8N A;  2LLS A;  1TCF A;  3PLF B;  1QTX A;  4OCI A;  3TUY B;  4YGE B;  2MLF C;  3BFB A;  3R1P A;  2WC8 A;  2KAX A;  2ZN8 A;  1B8L A;  1QS7 A;  2KSP A;  1OQP A;  3CTN A;  5AER A;  2Q4U A;  2VRG A;  2DOQ A;  1TNW A;  1JBA A;  1XFX O;  3EG5 B;  1S5G Z;  3FIA A;  2KLD A;  3O4Y A;  2L2E A;  3WHT B;  2FJY A;  2JT8 A;  5CSF A;  1NX2 A;  2E6W A;  2K60 A;  1V1G A;  2EC6 C;  1YRU B;  2PAL A;  3GOF A;  4GGN A;  2KI6 D;  4ETO A;  2H61 C;  1H4B A;  3DF0 B;  3WNX B;  3D0Y B;  3LL8 B;  3B7A A;  4FQO A;  1L2O B;  1XFV O;  2QEO A;  3S0F A;  2BBN A;  3R1V A;  4C0K A;  1MF8 B;  4I5J A;  1CM4 A;  2KI4 C;  1S3P A;  2KOT A;  2BKH B;  1CLM A;  3IVT A;  3QRX A;  1FBV A;  2K8M B;  1DJZ A;  5TNC A;  1J1D A;  1OZO A;  1JSA A;  4P2Y B;  1LKJ A;  1LXF C;  2BE4 A;  1IH0 A;  1DT7 B;  4N5X A;  2GGM A;  1BJF A;  2ZNE A;  3CZ2 A;  2K0J A;  1CM1 A;  2KAY A;  1QAT A;  4YGA A;  3EK8 A;  2WCL A;  4JWQ A;  1SCM B;  3OB2 B;  2M49 B;  1UP5 A;  1PK0 D;  4NDC A;  1IWQ A;  2LVI A;  1X02 A;  2LVV A;  1BLQ A;  4YBH B;  1JF2 A;  1KSO A;  1WRZ A;  2I7A A;  2JNX A;  1CDN A;  2M3W A;  1MR8 A;  2A4J A;  3D77 A;  3CZ1 A;  1S6J A;  4M2O A;  1SR6 C;  4PE1 A;  1OOJ A;  1QV0 A;  1AUI B;  2KGB C;  4XJK B;  4GAO A;  5EL2 A;  3IQO A;  4GGF A;  1G4Y R;  5CSJ A;  1IGV A;  3TZ1 A;  1SBJ A;  2QEH A;  4AQI A;  2PMY A;  3I5F C;  1J7Q A;  1A75 B;  3E3R A;  3SG4 A;  3D76 A;  1SPY A;  4ORC B;  1OOI X; 
#chains in the Genus database with same CATH homology
 5ER4 X;  2BBM A;  1YRT B;  1QXP A;  5G08 A;  4GFT A;  2HQW A;  1RJV A;  3VRQ A;  4YI8 A;  1BT6 A;  2NCP A;  1V1F A;  1EL4 A;  1DJY A;  2M1U A;  2L98 A;  2HF5 A;  1CFP A;  4CFR A;  1MWN A;  4MLW A;  2LHI A;  1CMF A;  1CMG A;  3SG6 A;  2JTT A;  1BU3 A;  1B7T Y;  3TS5 C;  1REC A;  1YUS A;  2LLU A;  2H2K A;  2M8U A;  3SG5 A;  3LLE A;  4YGB B;  1QIV A;  1A03 A;  3VRR A;  1G8I A;  1IJ6 A;  1NYA A;  1MHO A;  3BUN B;  1TOP A;  2M29 A;  2ZRS A;  4MRY A;  1BOD A;  1XA5 A;  2JPT A;  1CNP A;  3KF9 A;  1XVJ A;  4Q04 A;  1K95 A;  1KWO B;  1PSB A;  5HLO A;  1F8H A;  2KI6 C;  1JUO A;  3NSI A;  2SAS A;  1SYM A;  3PM8 A;  1DGU A;  1Y1X A;  3TDI A;  5FYX A;  1GQM A;  4MBE A;  1CFF A;  1PVB A;  2Y1M A;  2KFH A;  4GGF C;  1EH2 A;  2H61 A;  2I2R E;  3I5G B;  1K9U A;  2LUC A;  2MA2 A;  1QJT A;  3KO0 A;  2JTZ A;  2HPS A;  3EKJ A;  3SJS A;  4PHJ A;  2KFF A;  2KBM A;  1FW4 A;  1SCV A;  4AOM A;  2BCX A;  3ICB A;  4HRH A;  2PRU A;  3I5I C;  1OZS A;  2JT3 A;  1G33 A;  1XFY O;  5CSN A;  1JC2 A;  1SKT A;  2WND A;  5DKR A;  1SRA A;  1QX5 B;  4MSP A;  3HCM A;  1YUT A;  1R2U A;  4N1F A;  3RM1 A;  4WRI A;  3O78 A;  3BOW A;  1JFK A;  1RRO A;  3SG2 A;  1MXL C;  1IJ5 A;  2L0P A;  3C1V A;  1ZUZ A;  4I5L B;  1CKK A;  3A8R A;  1FPW A;  2ZRT A;  1CDP A;  1WDC C;  4MZJ A;  1DJW A;  4GBA A;  1J7O A;  3IF7 A;  1PSR A;  2M7L A;  3TDZ A;  1AHR A;  1J7R A;  2BEC A;  2NLN A;  2KYC A;  4YGC B;  3WHU B;  1IKU A;  2MLE C;  4C0L A;  2LVK A;  1B7T Z;  3RLZ A;  1QV1 A;  1K2H A;  1LA0 A;  4PE4 A;  3NSK A;  2WCB A;  1N2D A;  2KHN A;  2FOT A;  1DJX A;  1UHK A;  1YVL A;  1BOC A;  2K2F A;  1QIW A;  5HYD A;  3SIA A;  3DVE A;  2F2P A;  4PE7 A;  2ISD A;  1AK8 A;  2NCO A;  3CWG A;  4F0Z B;  5KTY A;  5ER5 A;  1DF0 B;  1YUU A;  2LCP A;  1TNQ A;  2PAS A;  1NCZ A;  1CDL A;  4YRU A;  1BG1 A;  2AMI A;  1ZFS A;  2JXL A;  2LP2 A;  3CGA A;  1M63 B;  2PVB A;  2CXJ A;  2L4I A;  1F54 A;  2M7N A;  3LCP C;  3DVJ A;  2EC6 B;  3VRO A;  1XO5 A;  3O6B A;  1B9A A;  3SG3 A;  5PAL A;  1M31 A;  1IG5 A;  1WLM A;  2WOS A;  1J7P A;  4NQG A;  1BF5 A;  2KNE A;  2LM5 A;  1CB1 A;  2LMU A;  1R6P A;  1QX2 A;  4PHN A;  1J55 A;  5D69 A;  1K9K A;  2KI4 B;  2ZN9 A;  1JF0 A;  3GK4 X;  1AJ4 A;  3CR2 A;  2B1U A;  3NSO A;  4MEW A;  4OVN F;  4C0J A;  1NX1 A;  1F4O A;  1HQV A;  1WRK A;  1S1E A;  2WOR A;  1J1E A;  2P6B B;  3AAJ A;  5HKY A;  1QX7 A;  4CLN A;  2OS8 C;  2JOJ A;  2CT9 A;  2L5X B;  3PAL A;  3JVT C;  1ZAC A;  1B8C A;  3NSL A;  1BR4 B;  5JJG A;  1KFX L;  4GUK A;  4NDB A;  2BKI B;  2JNF A;  1NX0 A;  5I2L A;  1CLL A;  1K93 D;  4MN0 A;  1U5I A;  5F6T A;  2BCA A;  1ALV A;  1YVH A;  4BY5 A;  1CDM A;  1OMR A;  1DGV A;  2Y4Q A;  2ZND A;  1WRL A;  1Y1A A;  1K96 A;  2JU0 A;  3OP0 A;  5HKZ A;  4HSZ A;  1SR6 B;  3M0W A;  3KPX A;  5AEQ A;  1B4C A;  1S6C A;  4XYN A;  1M39 A;  3O2P A;  1ZMZ A;  3I5F B;  1UWO A;  2KBI A;  2JUL A;  1MUX A;  3FS7 A;  1TN4 A;  4P5O E;  1KQM C;  3NXA A;  1FF1 A;  3OX6 A;  3EVR A;  2Y1N A;  1EG3 A;  1UHH A;  3GK1 A;  2OPO A;  3BUW B;  1DVI A;  3LK1 A;  1L7Z A;  1YX8 A;  2JRF A;  5I2Q A;  2LAN A;  4OKH A;  1TTX A;  1NCY A;  3DD4 A;  3ZNI A;  2F3Y A;  3D10 A;  1CFD A;  1C7W A;  1DJG A;  1K90 D;  2JT0 A;  2V53 A;  3TS5 B;  2BL0 C;  4BY4 A;  3DF0 A;  3D0Y A;  1XFZ O;  3OB1 B;  1NUB A;  5BPJ A;  1RFJ A;  2OTG C;  3HX4 A;  1FI5 A;  3BXK A;  4I5N B;  1FI6 A;  1NCX A;  1PRW A;  2G9B A;  1A4P A;  2GGZ A;  2WCF A;  3F45 A;  4YI9 A;  4YGD B;  2CCM A;  4DUQ A;  1KFX S;  1DMO A;  1EXR A;  3EK7 A;  5KU1 A;  5AFP A;  1KK8 C;  4QJ5 B;  2LUX A;  2CBL A;  2MBX A;  2MRD A;  3I5H C;  3JTD C;  1RWY A;  3OX5 A;  2I94 A;  2L50 A;  1B1G A;  2EGD A;  1YR5 A;  2BE6 A;  2NZ0 A;  1YUR A;  1U5I B;  3VGO A;  3TUY C;  1DJH A;  2MHH A;  3PSR A;  1UUS A;  4DIR A;  1PUL A;  1SL8 A;  1H8B A;  5CSI A;  4HRG A;  2Y5I A;  1NSH A;  4WQ3 A;  3I5I B;  1SMG A;  1F70 A;  1S36 A;  1IQ5 A;  1IRJ A;  1PVA A;  2O60 A;  4E68 A;  4XJK A;  4IL1 A;  2LP3 A;  1F71 A;  3KHE A;  1K8U A;  3JTD B;  2HET A;  2M97 A;  2LVJ A;  3DVK A;  3WXA A;  4JPZ B;  3GK2 A;  3A4U B;  3CR4 X;  1L2O C;  2IS9 A;  2MAZ A;  1SK6 D;  2BCB A;  3BUM B;  1NX3 A;  1KCY A;  1UUR A;  3PN7 C;  3DVM A;  1TRF A;  2I18 A;  2K61 A;  2M0R A;  2KYF A;  2L51 A;  1CLB A;  1LIN A;  2F2O A;  4MRX A;  4R1E A;  1JFJ A;  4MVF A;  1GJY A;  1OMD A;  1WDC B;  2LNK A;  1PAL A;  4USL A;  4AQJ A;  3LK0 A;  2M1K B;  1YTZ C;  3PFV A;  1QLK A;  2LHL A;  1GGW A;  1KQV A;  1BMO A;  4NDD A;  2ZFD A;  1KSM A;  1S6I A;  1S26 D;  1LVC D;  4M2Q A;  2FCD A;  3AKA A;  1GGZ A;  2QAC A;  2FCE A;  1JWD A;  1UHN A;  1DJI A;  3EK4 A;  2JC2 A;  3FWB A;  4UPG A;  3CS1 A;  4I5K A;  5GQQ C;  3EVU A;  1C07 A;  2SCP A;  1TNP A;  1SCM C;  3PN7 B;  2Q91 A;  2JQ6 A;  4MZL A;  5AXI A;  3BUO B;  1BR1 B;  1Y6W A;  2K7C A;  2JZI A;  1C7V A;  5JOL A;  1F4Q A;  2LC5 A;  2L4H A;  1NIW A;  2NXQ A;  2D8N A;  1QLS A;  2PSR A;  1RK9 A;  1SY9 A;  1KFU S;  1OMV A;  2F3Z A;  2KFG A;  3BOW B;  2JXC A;  1CFC A;  2M9G A;  1Q80 A;  1QAS A;  2JWW A;  1Y0V H;  4A4B A;  3PAT A;  3BQ3 A;  1XYD A;  4ORA B;  1ALW A;  2KQY A;  2AUC A;  4CPV A;  1M46 A;  1ZOT B;  4TNC A;  4DS7 A;  2GV5 A;  2LMT A;  1TNX A;  3AAK A;  4PHM A;  3H4S E;  1SL9 A;  1KK7 Y;  2WCE A;  1EJ3 A;  1OSA A;  1QVI Z;  1UHI A;  1EG4 A;  2OS8 B;  2RGI A;  3SG7 A;  2QPT A;  1AJ5 A;  2E30 A;  3KEV A;  3JVT B;  1ODB A;  2ZKM X;  5IBW A;  4OV2 A;  5HLV A;  1UHJ A;  1W7J B;  1OE9 B;  4DRW A;  2F8P A;  1AP4 A;  1F55 A;  1Y1U A;  4ORB B;  1SNL A;  2EHB A;  3EVV A;  1SL7 A;  4CFQ A;  1XK4 A;  2AAO A;  1AVS A;  2LMV A;  3BYA A;  3K21 A;  4GPL B;  1NPQ A;  2LE9 B;  1KWO C;  1XFW O;  4JQ0 D;  5HKW A;  3VRP A;  4QJ4 B;  1H4B A;  1MXE A;  4QJ3 B;  1S5G Y;  2CTN A;  3MSE B;  1WY9 A;  4MZK A;  2HQ8 A;  1DTL A;  1TCO B;  1XFU O;  1N0Y A;  2K2A A;  1W7I B;  2KQ6 A;  3AKB A;  4FTG A;  2R2I A;  5D7F A;  5DKN A;  4DCK A;  5B8I B;  1HT9 A;  3I5G C;  1KQM B;  1WLZ A;  4M2P A;  4U8D A;  4PDZ A;  4PAL A;  2LLT A;  4D1E A;  1RTP 1;  2FJU B;  3CZT X;  1VRK A;  1DF0 A;  1NP8 A;  1D1O A;  4ICB A;  5J3X A;  2KAV A;  4PHK A;  2KGR A;  3VRN A;  5DKQ A;  4OR9 B;  1K94 A;  3TDU A;  3EKH A;  2O5G A;  1B47 A;  1SW8 A;  2CNP A;  2G2B A;  4GNK B;  4PCW A;  1MQ1 A;  3CLN A;  2KDH A;  4PE0 A;  2BL0 B;  3OHM B;  2K7O A;  3CR5 X;  4WQ2 A;  3IQQ A;  4ZCU A;  2K7D A;  4HRE E;  2OTG B;  2F33 A;  1TIZ A;  3SIB A;  5K89 A;  4L9M A;  2K7B A;  4CID A;  5CPV A;  1A2X A;  1XK4 C;  1YX7 A;  2COL B;  1KFU L;  1B8R A;  5AAN A;  4A4C A;  1LA3 A;  4N1G A;  1CTR A;  1KK7 Z;  1NWD A;  2LAP A;  2LV7 A;  3ZWH A;  1A29 A;  1IQ3 A;  3BUX B;  1QVI Y;  5KSZ A;  1KK8 B;  1M45 A;  2TN4 A;  3I5H B;  1E8A A;  4ZCV A;  1K9P A;  5I2O A;  1N65 A;  1A75 A;  2MJW B;  5I8N A;  2LLS A;  1TCF A;  3PLF B;  1QTX A;  4OCI A;  3TUY B;  4YGE B;  2MLF C;  2WC8 A;  2KAX A;  2ZN8 A;  1B8L A;  1QS7 A;  2KSP A;  1OQP A;  3CTN A;  5AER A;  2Q4U A;  2VRG A;  2DOQ A;  1TNW A;  1JBA A;  1XFX O;  1S5G Z;  3FIA A;  3O4Y A;  2L2E A;  3WHT B;  2JT8 A;  5CSF A;  1NX2 A;  2E6W A;  2PAL A;  1V1G A;  2EC6 C;  1YRU B;  3GOF A;  4GGN A;  2KI6 D;  4ETO A;  2H61 C;  3DF0 B;  3WNX B;  3D0Y B;  3LL8 B;  4FQO A;  1L2O B;  1XFV O;  2BBN A;  4C0K A;  1MF8 B;  4I5J A;  1CM4 A;  2KI4 C;  1S3P A;  2KOT A;  2BKH B;  1CLM A;  3QRX A;  1FBV A;  2K8M B;  1DJZ A;  5TNC A;  1J1D A;  1OZO A;  1JSA A;  4P2Y B;  1LKJ A;  1LXF C;  2BE4 A;  1IH0 A;  1DT7 B;  4N5X A;  2GGM A;  1BJF A;  2ZNE A;  2K0J A;  1CM1 A;  2KAY A;  1QAT A;  4YGA A;  3EK8 A;  4JWQ A;  1SCM B;  3OB2 B;  2M49 B;  1UP5 A;  1PK0 D;  4NDC A;  1IWQ A;  2LVI A;  1X02 A;  2LVV A;  1BLQ A;  4YBH B;  1JF2 A;  1KSO A;  1WRZ A;  2I7A A;  2JNX A;  1CDN A;  2M3W A;  1MR8 A;  2A4J A;  1S6J A;  4M2O A;  1SR6 C;  4PE1 A;  1OOJ A;  1QV0 A;  1AUI B;  2KGB C;  4XJK B;  4GAO A;  3IQO A;  4GGF A;  1G4Y R;  5CSJ A;  1IGV A;  3TZ1 A;  1SBJ A;  4AQI A;  2PMY A;  3I5F C;  1J7Q A;  1A75 B;  3E3R A;  3SG4 A;  1SPY A;  4ORC B;  3FWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...