4XJKB

Crystal structure of mn(ii) ca(ii) na(i) bound calprotectin
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
108
structure length
108
Chain Sequence
KMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A8
publication title Manganese Binding Properties of Human Calprotectin under Conditions of High and Low Calcium: X-ray Crystallographic and Advanced Electron Paramagnetic Resonance Spectroscopic Analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 40
structure length 108
sequence length 108
chains with identical sequence D, F, H, J
ec nomenclature
pdb deposition date 2015-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4xjkB00
5HKYA 1OMVA 4OCIA 1NSHA 1QIVA 3D0YB 2HETA 1DJXA 3VRNA 4GGNA 1BR1B 1FI6A 4ORAB 3AKBA 1VRKA 1K96A 3OB1B 1KFXL 2JWWA 2LMUA 4DCKA 1IGVA 4R1EA 2KGRA 1MQ1A 2F2OA 2KDHA 4PDZA 2F3YA 2O5GA 5CSFA 1DF0A 2F2PA 4CLNA 1S1EA 1QX7A 4P2YB 3MSEB 1UHHA 1CLMA 3EKHA 4E68A 2KAVA 2GGMA 3PM8A 4YI8A 4XJKB 2CBLA 3GK1A 1CFDA 2CXJA 3I5FB 3SG7A 2SCPA 3TS5C 1UHKA 3PALA 1V1FA 2CNPA 1G4YR 1CDPA 2JU0A 2L51A 3DF0A 5HLOA 1IJ6A 1M46A 1NYAA 1V1GA 1XA5A 2I7AA 2KI4C 1PULA 4PE0A 5CSJA 2K7CA 3PSRA 2KAXA 2FCDA 1SNLA 5HLVA 2BKIB 1A4PA 4GUKA 2KFGA 2LMTA 1E8AA 2I2RE 4UPGA 1EH2A 2AAOA 3LL8B 4N1FA 4OVNF 4YGBB 2NLNA 3IQOA 3VRRA 2IS9A 1DJYA 2K7BA 2BBNA 3KHEA 5DKRA 4PE4A 2LAPA 1UHIA 3BUXB 1AUIB 4M2PA 3TDZA 3JVTB 1FBVA 4DUQA 3I5FC 4OKHA 1QS7A 2BECA 1DF0B 2H61A 2L98A 5AFPA 1UHJA 2HPSA 3TZ1A 5I2QA 2LLTA 1QXPA 3ZWHA 2E6WA 5KSZA 1GGZA 2LVIA 1PRWA 1QJTA 4U8DA 1XVJA 2BCXA 4L9MA 5F6TA 1CNPA 1SMGA 2KBIA 4Q04A 1TCFA 2COLB 3DF0B 1MF8B 1OMDA 1BT6A 1B7TY 1QASA 1FF1A 3BXKA 3I5GB 2GV5A 2JC2A 3EVRA 2LCPA 1JSAA 4MZJA 3CR2A 3QRXA 2Y1NA 3A8RA 2VRGA 2M49B 1LA0A 5AERA 4OV2A 5D7FA 2LHLA 2MLFC 3HX4A 1S26D 4BY4A 2PASA 4MZKA 4PHJA 2CCMA 3BOWA 1KFUS 5JOLA 2L50A 2LVJA 1CLLA 3JVTC 5ER5A 1S36A 5CPVA 1QV1A 4N1GA 2OTGB 5KU1A 3O2PA 1RWYA 1IG5A 1SCMB 3NSOA 1F4QA 3LK0A 3KF9A 2P6BB 2LVVA 3ICBA 1UUSA 3LK1A 2LNKA 1R2UA 1DJIA 1HT9A 1KK7Y 1BODA 1J7PA 1QTXA 1TNQA 1NCZA 1SKTA 1IQ5A 2O60A 1WRLA 5G08A 4GFTA 5GQQC 1MUXA 4OR9B 3SIBA 2KI6C 2M9GA 1MHOA 1OMRA 1ZMZA 1BOCA 5I8NA 1C7WA 1S6IA 1B8RA 5DKNA 3I5GC 1KFUL 1SK6D 1H8BA 3IQQA 2HF5A 1GGWA 1KFXS 2MJWB 3SG4A 2M97A 1KQMB 1CKKA 1Y6WA 3M0WA 1WLMA 1U5IB 2G2BA 2ZNDA 2JRFA 4GBAA 1EG3A 3FWBA 4ETOA 1SBJA 1WRKA 3FIAA 1JF0A 2WC8A 2K2AA 4PHMA 3I5HB 2OTGC 1C07A 1SCMC 4ICBA 5AEQA 2F33A 2QPTA 1JC2A 4MN0A 1QVIZ 2LANA 2K0JA 2ZRSA 2DOQA 2BCAA 4YGEB 3SG5A 2JT0A 4USLA 5AANA 1N65A 1RTP1 2BE6A 3NSLA 2TN4A 5I2OA 2BE4A 1QV0A 2L4HA 1SYMA 1QLKA 2WNDA 2GGZA 3VRPA 4GAOA 1IKUA 3PLFB 1NP8A 1EG4A 4NDCA 2L2EA 3DD4A 3CTNA 1KQMC 1S6JA 1AHRA 1YUUA 2BKHB 2KI6D 2ZFDA 3HCMA 4C0LA 3VRQA 1N0YA 1LXFC 4D1EA 1X02A 4MEWA 3I5HC 1BF5A 3KEVA 1EJ3A 1DJWA 3WHTB 2BBMA 1UP5A 2HQ8A 2M7NA 1NX1A 1TCOB 5J3XA 1L2OB 2B1UA 3I5IB 2BCBA 1Q80A 1BJFA 1K9PA 1WY9A 4AQIA 1YX8A 1UURA 1PVAA 3PN7B 1EL4A 1XFUO 2JOJA 1W7IB 2LVKA 1J7OA 2Y1MA 1DJZA 1XFYO 5B8IB 2EHBA 1XFZO 4M2QA 3DVEA 1QLSA 1CMGA 2MRDA 2K7DA 3SG6A 2LLSA 2KSPA 3CS1A 3GK4X 4I5KA 5DKQA 5AXIA 1WRZA 1B4CA 2KNEA 5CSNA 4I5LB 4JPZB 4DS7A 2WCFA 2JT8A 3CR5X 4ORCB 1RJVA 1XFWO 2JT3A 1F71A 3OHMB 4ZCVA 1BLQA 3NSIA 4GGFC 1QIWA 4NDDA 1NIWA 2JZIA 2NCPA 1FW4A 4N5XA 5KTYA 1L2OC 1K8UA 2M29A 2LMVA 3I5IC 2SASA 1NX3A 1TTXA 1K93D 3SG3A 1K90D 1A03A 1C7VA 1NX0A 2JQ6A 1KSOA 5ER4X 4FTGA 1CDMA 1LVCD 2JXCA 1AK8A 3DVMA 2E30A 3KPXA 1J1EA 1TNPA 1M31A 1ZUZA 3OX6A 3CR4X 1WDCB 2KQYA 2KBMA 4QJ4B 1NPQA 1SPYA 4BY5A 1KWOB 3BYAA 1F55A 2K2FA 2WCBA 1YUTA 3ZNIA 5HKZA 1TIZA 4HRHA 1B1GA 1CFFA 1B9AA 1CFCA 1XO5A 5I2LA 1BMOA 3SIAA 1S5GY 1SRAA 2LV7A 3EK7A 2AMIA 1A75A 3K21A 3F45A 3BUNB 3PATA 1KK7Z 1RFJA 1YRTB 3O78A 1K2HA 1KK8B 2PALA 5IBWA 1AJ4A 1OZSA 2L4IA 4A4CA 2JPTA 1LKJA 1DTLA 1L7ZA 1YUSA 1OZOA 3OB2B 2MBXA 1BG1A 1NWDA 2JTTA 3RLZA 1JFJA 1A2XA 1S3PA 1IJ5A 2PSRA 1XFXO 4I5JA 1SY9A 2PVBA 2M1UA 4PE1A 2JNXA 4PHKA 3IF7A 1CMFA 4QJ3B 1KWOC 3TDUA 2JXLA 2M1KB 1CM4A 1Y1XA 2K8MB 3EVVA 2Y5IA 1A29A 1XK4A 1ALWA 2MAZA 4XJKA 3BOWB 1PK0D 2F3ZA 1TOPA 2ZN8A 3VGOA 2Q91A 1GQMA 2NXQA 2KYCA 3CWGA 2H61C 1MWNA 1W7JB 1PSBA 1KK8C 4CPVA 4YGDB 2LC5A 2K61A 3TUYB 2FCEA 1D1OA 4YGCB 2L5XB 3BUMB 2OPOA 1A75B 4MSPA 2V53A 2D8NA 1DJGA 4MRXA 1SW8A 1ZACA 1F70A 4PHNA 1YR5A 1DT7B 2ISDA 3DVKA 1QX5B 3DVJA 3E3RA 4TNCA 1B8LA 4MLWA 1OSAA 1QATA 5FYXA 1OQPA 2R2IA 2KYFA 1DGUA 1M63B 1TN4A 3KO0A 1SL9A 1NUBA 2CTNA 2LE9B 1TNWA 2LUXA 2Y4QA 3BUWB 2LUCA 2EC6B 3EK4A 1MR8A 1RECA 3SG2A 1JF2A 1YVHA 3WXAA 2PMYA 1G8IA 1MXEA 2I94A 1J7RA 1NCXA 1AVSA 1RROA 2CT9A 1B8CA 3C1VA 4WQ2A 2KQ6A 1PVBA 1KQVA 1MXLC 2JNFA 1CTRA 4GNKB 4ORBB 3TUYC 4JWQA 4PE7A 3AAKA 4QJ5B 2QACA 4C0KA 1XYDA 3AKAA 2RGIA 1DMOA 2PRUA 1JUOA 2OS8B 4YBHB 1PSRA 3JTDB 2MHHA 4WRIA 1CDNA 1BR4B 4HREE 1J7QA 3WHUB 1TRFA 4MRYA 3A4UB 1YRUB 4YRUA 1R6PA 1SCVA 4CIDA 1SL7A 4WQ3A 5K89A 1OE9B 5TNCA 4DRWA 4PALA 2KHNA 3VROA 3O6BA 2LM5A 2ZKMX 1JFKA 1GJYA 3BQ3A 2EC6C 2LLUA 1YX7A 2KAYA 2M7LA 2JTZA 1G33A 4AOMA 3EKJA 1IWQA 3EVUA 1OOJA 5D69A 1LINA 1UHNA 1XK4C 1SR6B 1J1DA 4DIRA 1CB1A 1B7TZ 2M3WA 1H4BA 3NSKA 3OX5A 3PN7C 2MA2A 4CFRA 4HRGA 2H2KA 1QX2A 2L0PA 2WCEA 1CM1A 3PFVA 2KFFA 1WLZA 1CLBA 4FQOA 1B47A 1XFVO 1UWOA 2WORA 5JJGA 3FWCA 2MLEC 3O4YA 2OS8C 4PCWA 1PALA 2G9BA 3JTDC 2BL0B 2LP3A 1F4OA 1SL8A 5PALA 1ALVA 2F8PA 2JULA 5BPJA 3GK2A 2NCOA 1U5IA 4ZCUA 3OP0A 1K94A 1TNXA 1M39A 2Q4UA 4GPLB 2FOTA 4YGAA 4M2OA 2K7OA 2I18A 3CLNA 2WOSA 3D10A 4P5OE 3GOFA 1CDLA 1NCYA 1S5GZ 2ZRTA 1YTZC 3H4SE 3LCPC 1RK9A 4I5NB 3SJSA 1F8HA 3AAJA 1CFPA 4HSZA 3TDIA 2EGDA 2A4JA 2M8UA 3NXAA 4JQ0D 1SR6C 1Y0VH 3D0YA 5HYDA 1NX2A 5HKWA 4NDBA 4MZLA 4AQJA 1DVIA 1YVLA 2LHIA 1FPWA 1WDCC 4MVFA 1IH0A 1JWDA 1AJ5A 2NZ0A 2FJUB 4NQGA 4YI9A 5CSIA 1EXRA 3FS7A 1K9UA 2ZNEA 1N2DA 2KOTA 2BL0C 1LA3A 1K9KA 1KSMA 1Y1UA 1Y1AA 1BU3A 3BUOB 1S6CA 3CZTX 1J55A 2M0RA 1KCYA 4MBEA 3WNXB 1DGVA 4A4BA 1IQ3A 1JBAA 1HQVA 1AP4A 1FI5A 2KFHA 3RM1A 3CGAA 1ODBA 4XYNA 1ZOTB 4CFQA 2AUCA 4F0ZB 1YURA 1ZFSA 3TS5B 1IRJA 4GGFA 2LP2A 2KGBC 1DJHA 1K95A 2HQWA 1F54A 1M45A 3LLEA 4C0JA 4IL1A 1QVIY 2ZN9A 3EK8A 2KI4B
chains in the Genus database with same CATH superfamily
5HKYA 1OMVA 4OCIA 1NSHA 1QIVA 3D0YB 1W9ZA 2BNXA 2HETA 1DJXA 3VRNA 4GGNA 1BR1B 1FI6A 4ORAB 3AKBA 1VRKA 1K96A 3OB1B 1KFXL 2JWWA 2LMUA 4DCKA 1IGVA 4R1EA 2KGRA 1MQ1A 2F2OA 2KDHA 4PDZA 2F3YA 2O5GA 5CSFA 1DF0A 2F2PA 4CLNA 1S1EA 1QX7A 4P2YB 3MSEB 1UHHA 1CLMA 3EKHA 4E68A 2P71A 2KAVA 2QEOA 2GGMA 3PM8A 4YI8A 4XJKB 2CBLA 3GK1A 2YGUA 1CFDA 2CXJA 3I5FB 3SG7A 2SCPA 3TS5C 1UHKA 3PALA 1V1FA 2FJYA 2CNPA 3CZ1A 1G4YR 1CDPA 2JU0A 3CZ0A 2L51A 3DF0A 5HLOA 1IJ6A 3BFHA 1M46A 1NYAA 1V1GA 1XA5A 2I7AA 2KI4C 1PULA 4PE0A 5CSJA 2K7CA 3PSRA 2KAXA 3S0EA 2FCDA 1C3YA 1SNLA 1Z4HA 5HLVA 3BFAA 2BKIB 1A4PA 4GUKA 2KFGA 2LMTA 1E8AA 2I2RE 4UPGA 1EH2A 2AAOA 3LL8B 4N1FA 4OVNF 4YGBB 2NLNA 3IQOA 1OW4A 4INXA 4INWA 2WC5A 3QMEA 2IS9A 1DJYA 2K7BA 2BBNA 4OZDA 1TUJA 3KHEA 3S0FA 5DKRA 4PE4A 2LAPA 1UHIA 3BUXB 1AUIB 4M2PA 3TDZA 3JVTB 1FBVA 4DUQA 3I5FC 4OKHA 1QS7A 2BECA 1DF0B 2H61A 2L98A 2KLEA 3NHIA 1DEKA 3V2LA 5AFPA 1UHJA 2HPSA 3TZ1A 5I2QA 2LLTA 1QXPA 3ZWHA 2E6WA 5KSZA 1OOFA 1GGZA 2LVIA 2WCKA 1PRWA 1QJTA 4U8DA 1XFRA 1XVJA 2BCXA 4L9MA 5F6TA 1CNPA 1SMGA 2KBIA 4Q04A 2P70A 1TCFA 2COLB 3DF0B 1MF8B 1OMDA 1BT6A 1B7TY 1QASA 1FF1A 3BXKA 3CDNA 3I5GB 2GV5A 2JC2A 3EVRA 2LCPA 5FI6A 4MZJA 3CR2A 1JSAA 2WCHA 3QRXA 2Y1NA 3A8RA 2VRGA 2M49B 1LA0A 3L4AA 5AERA 4OV2A 5D7FA 2LHLA 2MLFC 3HX4A 1S26D 4BY4A 2PASA 2BAPA 4MZKA 2CCMA 3BOWA 4PHJA 1KFUS 5JOLA 2L50A 2LVJA 2QDIA 1CLLA 3JVTC 5ER5A 1S36A 5CPVA 1QV1A 4N1GA 2OTGB 5KU1A 3O2PA 1RWYA 1IG5A 1SCMB 4FQTA 3NSOA 1F4QA 3D73A 3IVTA 3KF9A 2P6BB 3LK0A 2LVVA 3D76A 1UUSA 3ICBA 3LK1A 2LNKA 1R2UA 1DJIA 1HT9A 1KK7Y 1BODA 1J7PA 1QTXA 1TNQA 1NCZA 1SKTA 1IQ5A 2O60A 1WRLA 5G08A 4GFTA 5GQQC 1MUXA 4OR9B 3SIBA 2KI6C 2M9GA 3D78A 1MHOA 1OMRA 1ZMZA 1BOCA 5I8NA 1C7WA 1S6IA 1B8RA 5DKNA 3I5GC 1KFUL 1SK6D 1H8BA 3IQQA 2HF5A 1GGWA 2QEBA 1KFXS 2MJWB 3SG4A 2M97A 1KQMB 1CKKA 1Y6WA 3M0WA 1WLMA 1U5IB 2G2BA 2ZNDA 2JRFA 4GBAA 4JKTA 1EG3A 3FWBA 4ETOA 1SBJA 1WRKA 3FIAA 1C3ZA 1JF0A 2H8VA 2WC8A 2K2AA 4PHMA 3I5HB 2OTGC 1C07A 1DELA 1SCMC 4ICBA 5AEQA 2F33A 1SSEB 1T14A 2QPTA 1JC2A 4MN0A 1QVIZ 2LANA 5HL1A 2K0JA 2ZRSA 2DOQA 2BCAA 4YGEB 3SG5A 2JT0A 4USLA 3Q8IA 5AANA 1N65A 1RTP1 2BE6A 3NSLA 2TN4A 5I2OA 2BE4A 1QV0A 2L4HA 1SYMA 1QLKA 2WNDA 3BJHA 2GGZA 3VRPA 5EL2A 4GAOA 5FI7A 3PLFB 1IKUA 2KLDA 1NP8A 1EG4A 4NDCA 2L2EA 3DD4A 3CTNA 1KQMC 1S6JA 1AHRA 1YUUA 2BKHB 2KI6D 2ZFDA 3HCMA 4C0LA 3VRQA 1N0YA 1LXFC 4D1EA 1X02A 4MEWA 3I5HC 1BF5A 3KEVA 1EJ3A 1DJWA 3WHTB 2BBMA 1UP5A 2ERBA 2HQ8A 1NX1A 1TCOB 2M7NA 5J3XA 1L2OB 2B1UA 3R1PA 3I5IB 2BCBA 3UNWA 3FE9A 1Q80A 1BJFA 1K9PA 1WY9A 4AQIA 1YX8A 1UURA 1PVAA 3PN7B 1EL4A 1XFUO 2JOJA 1W7IB 2LVKA 3CABA 3RZSA 1J7OA 3R1OA 2Y1MA 1DJZA 1XFYO 3BFBA 5B8IB 2EHBA 2GTEA 1XFZO 4M2QA 3DVEA 1QLSA 1CMGA 2MRDA 2K7DA 3SG6A 2LLSA 2KSPA 3CS1A 3GK4X 4I5KA 5DKQA 5AXIA 1WRZA 1QWVA 1B4CA 2KNEA 5CSNA 4I5LB 4JPZB 2QEVA 2WCFA 2JT8A 3CR5X 4DS7A 4ORCB 1RJVA 1XFWO 2JT3A 1F71A 3OHMB 4ZCVA 1BLQA 3NSIA 4GGFC 1QIWA 4NDDA 1NIWA 2JZIA 2NCPA 1FW4A 3B86A 4N5XA 2WCMA 1L2OC 1K8UA 5KTYA 2M29A 2LMVA 3I5IC 2SASA 1NX3A 1TTXA 1K93D 3SG3A 1K90D 1A03A 1C7VA 1NX0A 2JQ6A 1KSOA 5ER4X 4FTGA 1CDMA 1LVCD 2JXCA 1AK8A 3DVMA 2E30A 1TUZA 3KPXA 1J1EA 1OOIX 1TNPA 1M31A 1OOHA 1ZUZA 3OX6A 3CR4X 3PJIA 1WDCB 2KQYA 2KBMA 4QJ4B 1NPQA 3SS3A 1GM0A 1SPYA 3UO9A 4BY5A 1KWOB 3BYAA 1F55A 2K2FA 2WCBA 1YUTA 2L2CA 5HKZA 1TIZA 4HRHA 3ZNIA 1B1GA 1CFFA 1B9AA 1CFCA 1XO5A 3OBVA 1P28A 5I2LA 1BMOA 3S0GA 3SIAA 1S5GY 1SRAA 2LV7A 3EK7A 2AMIA 1A75A 3K21A 3F45A 3BUNB 3PATA 1KK7Z 1RFJA 1YRTB 3O78A 1K2HA 1KK8B 1OOGA 2PALA 5IBWA 1AJ4A 1OZSA 2L4IA 4A4CA 2JPTA 1LKJA 2JPOA 1DTLA 1L7ZA 1YUSA 3S0BA 1OZOA 3OB2B 2MBXA 1BG1A 1NWDA 2JTTA 3RLZA 1JFJA 1A2XA 3S0DA 1S3PA 3SS5A 1IJ5A 2PSRA 1XFXO 4I5JA 1SY9A 2PVBA 2M1UA 4PE1A 2JNXA 3D75A 4PHKA 3IF7A 4IJ7A 4QJ3B 1CMFA 1KWOC 3TDUA 2JXLA 3B87A 2M1KB 1CM4A 2K60A 1Y1XA 2K8MB 3EVVA 2Y5IA 3R72A 1A29A 1XK4A 1ALWA 2MAZA 4XJKA 3BOWB 1PK0D 2F3ZA 1TOPA 2ZN8A 3B6XA 2Q91A 3VGOA 3S0AA 1GQMA 2NXQA 2KYCA 3D74A 3CWGA 2H61C 1MWNA 1W7JB 1PSBA 3CZ2A 1KK8C 4CPVA 3DXLA 2LC5A 2L5YA 4YGDB 2K61A 2WC6A 2FCEA 3TUYB 1D1OA 4YGCB 2L5XB 3BUMB 2OPOA 1A75B 3CYZA 4MSPA 2V53A 2D8NA 1DJGA 4MRXA 1SW8A 1ZACA 1F70A 4PHNA 1YR5A 2WCLA 1DT7B 2ISDA 3DVKA 1QX5B 3DVJA 3E3RA 4TNCA 1B8LA 1DQEA 3DY9A 4MLWA 1OSAA 1QATA 5FYXA 1OQPA 2R2IA 2KYFA 1DGUA 1M63B 4F7FA 1TN4A 3NHTA 3KO0A 3R1VA 1SL9A 1NUBA 2CTNA 2LE9B 1TNWA 2LUXA 2Y4QA 3BUWB 3FE6A 2LUCA 2EC6B 3EK4A 1MR8A 1RECA 3SG2A 3L4LA 1JF2A 1YVHA 3VB1A 2PMYA 3WXAA 1G8IA 1MXEA 2I94A 1J7RA 1NCXA 1AVSA 1RROA 3B7AA 2CT9A 1B8CA 2PYQA 3C1VA 4WQ2A 2KQ6A 1PVBA 1KQVA 1MXLC 2JNFA 1CTRA 4GNKB 4ORBB 3TUYC 4JWQA 2KPHA 4PE7A 3AAKA 2QEHA 2QACA 4C0KA 1XYDA 3AKAA 4QJ5B 2RGIA 1DMOA 1IIOA 2PRUA 1JUOA 2OS8B 4YBHB 1PSRA 3JTDB 2MHHA 4WRIA 1CDNA 1BR4B 4HREE 1J7QA 3WHUB 1TRFA 4MRYA 3A4UB 1YRUB 4YRUA 1R6PA 1SCVA 4CIDA 1SL7A 4WQ3A 5K89A 1OE9B 5TNCA 4DRWA 4PALA 2KHNA 3VROA 3O6BA 2LM5A 2ZKMX 1JFKA 1GJYA 3BQ3A 2EC6C 2LLUA 1YX7A 2KAYA 2M7LA 2JTZA 1G33A 4AOMA 3EKJA 1IWQA 3EVUA 1OOJA 5D69A 1LINA 4KYNA 1UHNA 1XK4C 1SR6B 1J1DA 4DIRA 1CB1A 1B7TZ 2M3WA 1H4BA 3NSKA 3OX5A 3PN7C 2MA2A 4CFRA 4HRGA 2H2KA 1QX2A 2L0PA 2WCEA 1CM1A 3K1EA 3PFVA 1LS8A 2KFFA 1WLZA 1CLBA 4FQOA 3NGVA 1B47A 1XFVO 1UWOA 2WORA 5JJGA 3FWCA 2MLEC 3O4YA 2OS8C 4PCWA 1PALA 2G9BA 3JTDC 2BL0B 2LP3A 1F4OA 1SL8A 5PALA 1ALVA 2F8PA 1TWOA 2JULA 5BPJA 3GK2A 2NCOA 1U5IA 4ZCUA 3OP0A 1K94A 1TNXA 1M39A 3OGNA 2Q4UA 2PQLA 4GPLB 2FOTA 4YGAA 4M2OA 2K7OA 3SS4A 2I18A 4JD9A 3CLNA 2WOSA 3D10A 4P5OE 3GOFA 1CDLA 1NCYA 1S5GZ 2ZRTA 1YTZC 3H4SE 3LCPC 1RK9A 4I5NB 3SJSA 3VRRA 3AAJA 3DZTA 1CFPA 1F8HA 4HSZA 3TDIA 2EGDA 2A4JA 2M8UA 3NXAA 4JQ0D 1SR6C 1Y0VH 3D0YA 5HYDA 1NX2A 3N7HA 1ORGA 5HKWA 3L47A 4NDBA 4MZLA 4AQJA 1DVIA 1YVLA 5I94A 2LHIA 1FPWA 1WDCC 4MVFA 1IH0A 1JWDA 1AJ5A 3DYEA 2NZ0A 2FJUB 4NQGA 4YI9A 5CSIA 1EXRA 3FS7A 3PM2A 1K9UA 2ZNEA 1N2DA 2KOTA 2BL0C 1LA3A 1K9KA 1KSMA 1Y1UA 2WCJA 1Y1AA 1BU3A 3BUOB 1S6CA 3CZTX 1J55A 2M0RA 1KCYA 4MBEA 3WNXB 1DC1A 1DGVA 1Z2CB 4A4BA 1IQ3A 1JBAA 1HQVA 1AP4A 1FI5A 3B88A 2KFHA 3RM1A 3CGAA 1ODBA 4XYNA 1ZOTB 3D77A 3EG5B 2AUCA 5DICA 4CFQA 4F0ZB 1YURA 1ZFSA 5D3OA 3TS5B 1IRJA 4GGFA 2LP2A 3FE8A 2KGBC 3O4XA 1DJHA 1K95A 2HQWA 1F54A 4PT1A 1M45A 3LLEA 4C0JA 4IL1A 1QVIY 2ZN9A 3EK8A 2KI4B 5FI2A
chains in the Genus database with same CATH topology
5HKYA 1OMVA 4OCIA 1NSHA 1QIVA 3D0YB 2HETA 1DJXA 3VRNA 4GGNA 1BR1B 1FI6A 4ORAB 3AKBA 1VRKA 1K96A 3OB1B 1KFXL 2JWWA 2LMUA 4DCKA 1IGVA 4R1EA 2KGRA 1MQ1A 2F2OA 2KDHA 4PDZA 2F3YA 2O5GA 5CSFA 1DF0A 2F2PA 4CLNA 1S1EA 1QX7A 4P2YB 3MSEB 1UHHA 1CLMA 3EKHA 4E68A 2KAVA 2GGMA 3PM8A 4YI8A 4XJKB 2CBLA 3GK1A 1CFDA 2CXJA 3I5FB 3SG7A 2SCPA 3TS5C 1UHKA 3PALA 1V1FA 2CNPA 1G4YR 1CDPA 2JU0A 2L51A 3DF0A 5HLOA 1IJ6A 1M46A 1NYAA 1V1GA 1XA5A 2I7AA 2KI4C 1PULA 4PE0A 5CSJA 2K7CA 3PSRA 2KAXA 2FCDA 1SNLA 5HLVA 2BKIB 1A4PA 4GUKA 2KFGA 2LMTA 1E8AA 2I2RE 4UPGA 1EH2A 2AAOA 3LL8B 4N1FA 4OVNF 4YGBB 2NLNA 3IQOA 3VRRA 2IS9A 1DJYA 2K7BA 2BBNA 3KHEA 5DKRA 4PE4A 2LAPA 1UHIA 3BUXB 1AUIB 4M2PA 3TDZA 3JVTB 1FBVA 4DUQA 3I5FC 4OKHA 1QS7A 2BECA 1DF0B 2H61A 2L98A 5AFPA 1UHJA 2HPSA 3TZ1A 5I2QA 2LLTA 1QXPA 3ZWHA 2E6WA 5KSZA 1GGZA 2LVIA 1PRWA 1QJTA 4U8DA 1XVJA 2BCXA 4L9MA 5F6TA 1CNPA 1SMGA 2KBIA 4Q04A 1TCFA 2COLB 3DF0B 1MF8B 1OMDA 1BT6A 1B7TY 1QASA 1FF1A 3BXKA 3I5GB 2GV5A 2JC2A 3EVRA 2LCPA 1JSAA 4MZJA 3CR2A 3QRXA 2Y1NA 3A8RA 2VRGA 2M49B 1LA0A 5AERA 4OV2A 5D7FA 2LHLA 2MLFC 3HX4A 1S26D 4BY4A 2PASA 4MZKA 4PHJA 2CCMA 3BOWA 1KFUS 5JOLA 2L50A 2LVJA 1CLLA 3JVTC 5ER5A 1S36A 5CPVA 1QV1A 4N1GA 2OTGB 5KU1A 3O2PA 1RWYA 1IG5A 1SCMB 3NSOA 1F4QA 3LK0A 3KF9A 2P6BB 2LVVA 3ICBA 1UUSA 3LK1A 2LNKA 1R2UA 1DJIA 1HT9A 1KK7Y 1BODA 1J7PA 1QTXA 1TNQA 1NCZA 1SKTA 1IQ5A 2O60A 1WRLA 5G08A 4GFTA 5GQQC 1MUXA 4OR9B 3SIBA 2KI6C 2M9GA 1MHOA 1OMRA 1ZMZA 1BOCA 5I8NA 1C7WA 1S6IA 1B8RA 5DKNA 3I5GC 1KFUL 1SK6D 1H8BA 3IQQA 2HF5A 1GGWA 1KFXS 2MJWB 3SG4A 2M97A 1KQMB 1CKKA 1Y6WA 3M0WA 1WLMA 1U5IB 2G2BA 2ZNDA 2JRFA 4GBAA 1EG3A 3FWBA 4ETOA 1SBJA 1WRKA 3FIAA 1JF0A 2WC8A 2K2AA 4PHMA 3I5HB 2OTGC 1C07A 1SCMC 4ICBA 5AEQA 2F33A 2QPTA 1JC2A 4MN0A 1QVIZ 2LANA 2K0JA 2ZRSA 2DOQA 2BCAA 4YGEB 3SG5A 2JT0A 4USLA 5AANA 1N65A 1RTP1 2BE6A 3NSLA 2TN4A 5I2OA 2BE4A 1QV0A 2L4HA 1SYMA 1QLKA 2WNDA 2GGZA 3VRPA 4GAOA 1IKUA 3PLFB 1NP8A 1EG4A 4NDCA 2L2EA 3DD4A 3CTNA 1KQMC 1S6JA 1AHRA 1YUUA 2BKHB 2KI6D 2ZFDA 3HCMA 4C0LA 3VRQA 1N0YA 1LXFC 4D1EA 1X02A 4MEWA 3I5HC 1BF5A 3KEVA 1EJ3A 1DJWA 3WHTB 2BBMA 1UP5A 2HQ8A 2M7NA 1NX1A 1TCOB 5J3XA 1L2OB 2B1UA 3I5IB 2BCBA 1Q80A 1BJFA 1K9PA 1WY9A 4AQIA 1YX8A 1UURA 1PVAA 3PN7B 1EL4A 1XFUO 2JOJA 1W7IB 2LVKA 1J7OA 2Y1MA 1DJZA 1XFYO 5B8IB 2EHBA 1XFZO 4M2QA 3DVEA 1QLSA 1CMGA 2MRDA 2K7DA 3SG6A 2LLSA 2KSPA 3CS1A 3GK4X 4I5KA 5DKQA 5AXIA 1WRZA 1B4CA 2KNEA 5CSNA 4I5LB 4JPZB 4DS7A 2WCFA 2JT8A 3CR5X 4ORCB 1RJVA 1XFWO 2JT3A 1F71A 3OHMB 4ZCVA 1BLQA 3NSIA 4GGFC 1QIWA 4NDDA 1NIWA 2JZIA 2NCPA 1FW4A 4N5XA 5KTYA 1L2OC 1K8UA 2M29A 2LMVA 3I5IC 2SASA 1NX3A 1TTXA 1K93D 3SG3A 1K90D 1A03A 1C7VA 1NX0A 2JQ6A 1KSOA 5ER4X 4FTGA 1CDMA 1LVCD 2JXCA 1AK8A 3DVMA 2E30A 3KPXA 1J1EA 1TNPA 1M31A 1ZUZA 3OX6A 3CR4X 1WDCB 2KQYA 2KBMA 4QJ4B 1NPQA 1SPYA 4BY5A 1KWOB 3BYAA 1F55A 2K2FA 2WCBA 1YUTA 3ZNIA 5HKZA 1TIZA 4HRHA 1B1GA 1CFFA 1B9AA 1CFCA 1XO5A 5I2LA 1BMOA 3SIAA 1S5GY 1SRAA 2LV7A 3EK7A 2AMIA 1A75A 3K21A 3F45A 3BUNB 3PATA 1KK7Z 1RFJA 1YRTB 3O78A 1K2HA 1KK8B 2PALA 5IBWA 1AJ4A 1OZSA 2L4IA 4A4CA 2JPTA 1LKJA 1DTLA 1L7ZA 1YUSA 1OZOA 3OB2B 2MBXA 1BG1A 1NWDA 2JTTA 3RLZA 1JFJA 1A2XA 1S3PA 1IJ5A 2PSRA 1XFXO 4I5JA 1SY9A 2PVBA 2M1UA 4PE1A 2JNXA 4PHKA 3IF7A 1CMFA 4QJ3B 1KWOC 3TDUA 2JXLA 2M1KB 1CM4A 1Y1XA 2K8MB 3EVVA 2Y5IA 1A29A 1XK4A 1ALWA 2MAZA 4XJKA 3BOWB 1PK0D 2F3ZA 1TOPA 2ZN8A 3VGOA 2Q91A 1GQMA 2NXQA 2KYCA 3CWGA 2H61C 1MWNA 1W7JB 1PSBA 1KK8C 4CPVA 4YGDB 2LC5A 2K61A 3TUYB 2FCEA 1D1OA 4YGCB 2L5XB 3BUMB 2OPOA 1A75B 4MSPA 2V53A 2D8NA 1DJGA 4MRXA 1SW8A 1ZACA 1F70A 4PHNA 1YR5A 1DT7B 2ISDA 3DVKA 1QX5B 3DVJA 3E3RA 4TNCA 1B8LA 4MLWA 1OSAA 1QATA 5FYXA 1OQPA 2R2IA 2KYFA 1DGUA 1M63B 1TN4A 3KO0A 1SL9A 1NUBA 2CTNA 2LE9B 1TNWA 2LUXA 2Y4QA 3BUWB 2LUCA 2EC6B 3EK4A 1MR8A 1RECA 3SG2A 1JF2A 1YVHA 3WXAA 2PMYA 1G8IA 1MXEA 2I94A 1J7RA 1NCXA 1AVSA 1RROA 2CT9A 1B8CA 3C1VA 4WQ2A 2KQ6A 1PVBA 1KQVA 1MXLC 2JNFA 1CTRA 4GNKB 4ORBB 3TUYC 4JWQA 4PE7A 3AAKA 4QJ5B 2QACA 4C0KA 1XYDA 3AKAA 2RGIA 1DMOA 2PRUA 1JUOA 2OS8B 4YBHB 1PSRA 3JTDB 2MHHA 4WRIA 1CDNA 1BR4B 4HREE 1J7QA 3WHUB 1TRFA 4MRYA 3A4UB 1YRUB 4YRUA 1R6PA 1SCVA 4CIDA 1SL7A 4WQ3A 5K89A 1OE9B 5TNCA 4DRWA 4PALA 2KHNA 3VROA 3O6BA 2LM5A 2ZKMX 1JFKA 1GJYA 3BQ3A 2EC6C 2LLUA 1YX7A 2KAYA 2M7LA 2JTZA 1G33A 4AOMA 3EKJA 1IWQA 3EVUA 1OOJA 5D69A 1LINA 1UHNA 1XK4C 1SR6B 1J1DA 4DIRA 1CB1A 1B7TZ 2M3WA 1H4BA 3NSKA 3OX5A 3PN7C 2MA2A 4CFRA 4HRGA 2H2KA 1QX2A 2L0PA 2WCEA 1CM1A 3PFVA 2KFFA 1WLZA 1CLBA 4FQOA 1B47A 1XFVO 1UWOA 2WORA 5JJGA 3FWCA 2MLEC 3O4YA 2OS8C 4PCWA 1PALA 2G9BA 3JTDC 2BL0B 2LP3A 1F4OA 1SL8A 5PALA 1ALVA 2F8PA 2JULA 5BPJA 3GK2A 2NCOA 1U5IA 4ZCUA 3OP0A 1K94A 1TNXA 1M39A 2Q4UA 4GPLB 2FOTA 4YGAA 4M2OA 2K7OA 2I18A 3CLNA 2WOSA 3D10A 4P5OE 3GOFA 1CDLA 1NCYA 1S5GZ 2ZRTA 1YTZC 3H4SE 3LCPC 1RK9A 4I5NB 3SJSA 1F8HA 3AAJA 1CFPA 4HSZA 3TDIA 2EGDA 2A4JA 2M8UA 3NXAA 4JQ0D 1SR6C 1Y0VH 3D0YA 5HYDA 1NX2A 5HKWA 4NDBA 4MZLA 4AQJA 1DVIA 1YVLA 2LHIA 1FPWA 1WDCC 4MVFA 1IH0A 1JWDA 1AJ5A 2NZ0A 2FJUB 4NQGA 4YI9A 5CSIA 1EXRA 3FS7A 1K9UA 2ZNEA 1N2DA 2KOTA 2BL0C 1LA3A 1K9KA 1KSMA 1Y1UA 1Y1AA 1BU3A 3BUOB 1S6CA 3CZTX 1J55A 2M0RA 1KCYA 4MBEA 3WNXB 1DGVA 4A4BA 1IQ3A 1JBAA 1HQVA 1AP4A 1FI5A 2KFHA 3RM1A 3CGAA 1ODBA 4XYNA 1ZOTB 4CFQA 2AUCA 4F0ZB 1YURA 1ZFSA 3TS5B 1IRJA 4GGFA 2LP2A 2KGBC 1DJHA 1K95A 2HQWA 1F54A 1M45A 3LLEA 4C0JA 4IL1A 1QVIY 2ZN9A 3EK8A 2KI4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HKY A;  1OMV A;  4OCI A;  1NSH A;  1QIV A;  3D0Y B;  2HET A;  1DJX A;  3VRN A;  4GGN A;  1BR1 B;  1FI6 A;  4ORA B;  3AKB A;  1VRK A;  1K96 A;  3OB1 B;  1KFX L;  2JWW A;  2LMU A;  4DCK A;  1IGV A;  4R1E A;  2KGR A;  1MQ1 A;  2F2O A;  2KDH A;  4PDZ A;  2F3Y A;  2O5G A;  5CSF A;  1DF0 A;  2F2P A;  4CLN A;  1S1E A;  1QX7 A;  4P2Y B;  3MSE B;  1UHH A;  1CLM A;  3EKH A;  4E68 A;  2KAV A;  2GGM A;  3PM8 A;  4YI8 A;  4XJK B;  2CBL A;  3GK1 A;  1CFD A;  2CXJ A;  3I5F B;  3SG7 A;  2SCP A;  3TS5 C;  1UHK A;  3PAL A;  1V1F A;  2CNP A;  1G4Y R;  1CDP A;  2JU0 A;  2L51 A;  3DF0 A;  5HLO A;  1IJ6 A;  1M46 A;  1NYA A;  1V1G A;  1XA5 A;  2I7A A;  2KI4 C;  1PUL A;  4PE0 A;  5CSJ A;  2K7C A;  3PSR A;  2KAX A;  2FCD A;  1SNL A;  5HLV A;  2BKI B;  1A4P A;  4GUK A;  2KFG A;  2LMT A;  1E8A A;  2I2R E;  4UPG A;  1EH2 A;  2AAO A;  3LL8 B;  4N1F A;  4OVN F;  4YGB B;  2NLN A;  3IQO A;  3VRR A;  2IS9 A;  1DJY A;  2K7B A;  2BBN A;  3KHE A;  5DKR A;  4PE4 A;  2LAP A;  1UHI A;  3BUX B;  1AUI B;  4M2P A;  3TDZ A;  3JVT B;  1FBV A;  4DUQ A;  3I5F C;  4OKH A;  1QS7 A;  2BEC A;  1DF0 B;  2H61 A;  2L98 A;  5AFP A;  1UHJ A;  2HPS A;  3TZ1 A;  5I2Q A;  2LLT A;  1QXP A;  3ZWH A;  2E6W A;  5KSZ A;  1GGZ A;  2LVI A;  1PRW A;  1QJT A;  4U8D A;  1XVJ A;  2BCX A;  4L9M A;  5F6T A;  1CNP A;  1SMG A;  2KBI A;  4Q04 A;  1TCF A;  2COL B;  3DF0 B;  1MF8 B;  1OMD A;  1BT6 A;  1B7T Y;  1QAS A;  1FF1 A;  3BXK A;  3I5G B;  2GV5 A;  2JC2 A;  3EVR A;  2LCP A;  1JSA A;  4MZJ A;  3CR2 A;  3QRX A;  2Y1N A;  3A8R A;  2VRG A;  2M49 B;  1LA0 A;  5AER A;  4OV2 A;  5D7F A;  2LHL A;  2MLF C;  3HX4 A;  1S26 D;  4BY4 A;  2PAS A;  4MZK A;  4PHJ A;  2CCM A;  3BOW A;  1KFU S;  5JOL A;  2L50 A;  2LVJ A;  1CLL A;  3JVT C;  5ER5 A;  1S36 A;  5CPV A;  1QV1 A;  4N1G A;  2OTG B;  5KU1 A;  3O2P A;  1RWY A;  1IG5 A;  1SCM B;  3NSO A;  1F4Q A;  3LK0 A;  3KF9 A;  2P6B B;  2LVV A;  3ICB A;  1UUS A;  3LK1 A;  2LNK A;  1R2U A;  1DJI A;  1HT9 A;  1KK7 Y;  1BOD A;  1J7P A;  1QTX A;  1TNQ A;  1NCZ A;  1SKT A;  1IQ5 A;  2O60 A;  1WRL A;  5G08 A;  4GFT A;  5GQQ C;  1MUX A;  4OR9 B;  3SIB A;  2KI6 C;  2M9G A;  1MHO A;  1OMR A;  1ZMZ A;  1BOC A;  5I8N A;  1C7W A;  1S6I A;  1B8R A;  5DKN A;  3I5G C;  1KFU L;  1SK6 D;  1H8B A;  3IQQ A;  2HF5 A;  1GGW A;  1KFX S;  2MJW B;  3SG4 A;  2M97 A;  1KQM B;  1CKK A;  1Y6W A;  3M0W A;  1WLM A;  1U5I B;  2G2B A;  2ZND A;  2JRF A;  4GBA A;  1EG3 A;  3FWB A;  4ETO A;  1SBJ A;  1WRK A;  3FIA A;  1JF0 A;  2WC8 A;  2K2A A;  4PHM A;  3I5H B;  2OTG C;  1C07 A;  1SCM C;  4ICB A;  5AEQ A;  2F33 A;  2QPT A;  1JC2 A;  4MN0 A;  1QVI Z;  2LAN A;  2K0J A;  2ZRS A;  2DOQ A;  2BCA A;  4YGE B;  3SG5 A;  2JT0 A;  4USL A;  5AAN A;  1N65 A;  1RTP 1;  2BE6 A;  3NSL A;  2TN4 A;  5I2O A;  2BE4 A;  1QV0 A;  2L4H A;  1SYM A;  1QLK A;  2WND A;  2GGZ A;  3VRP A;  4GAO A;  1IKU A;  3PLF B;  1NP8 A;  1EG4 A;  4NDC A;  2L2E A;  3DD4 A;  3CTN A;  1KQM C;  1S6J A;  1AHR A;  1YUU A;  2BKH B;  2KI6 D;  2ZFD A;  3HCM A;  4C0L A;  3VRQ A;  1N0Y A;  1LXF C;  4D1E A;  1X02 A;  4MEW A;  3I5H C;  1BF5 A;  3KEV A;  1EJ3 A;  1DJW A;  3WHT B;  2BBM A;  1UP5 A;  2HQ8 A;  2M7N A;  1NX1 A;  1TCO B;  5J3X A;  1L2O B;  2B1U A;  3I5I B;  2BCB A;  1Q80 A;  1BJF A;  1K9P A;  1WY9 A;  4AQI A;  1YX8 A;  1UUR A;  1PVA A;  3PN7 B;  1EL4 A;  1XFU O;  2JOJ A;  1W7I B;  2LVK A;  1J7O A;  2Y1M A;  1DJZ A;  1XFY O;  5B8I B;  2EHB A;  1XFZ O;  4M2Q A;  3DVE A;  1QLS A;  1CMG A;  2MRD A;  2K7D A;  3SG6 A;  2LLS A;  2KSP A;  3CS1 A;  3GK4 X;  4I5K A;  5DKQ A;  5AXI A;  1WRZ A;  1B4C A;  2KNE A;  5CSN A;  4I5L B;  4JPZ B;  4DS7 A;  2WCF A;  2JT8 A;  3CR5 X;  4ORC B;  1RJV A;  1XFW O;  2JT3 A;  1F71 A;  3OHM B;  4ZCV A;  1BLQ A;  3NSI A;  4GGF C;  1QIW A;  4NDD A;  1NIW A;  2JZI A;  2NCP A;  1FW4 A;  4N5X A;  5KTY A;  1L2O C;  1K8U A;  2M29 A;  2LMV A;  3I5I C;  2SAS A;  1NX3 A;  1TTX A;  1K93 D;  3SG3 A;  1K90 D;  1A03 A;  1C7V A;  1NX0 A;  2JQ6 A;  1KSO A;  5ER4 X;  4FTG A;  1CDM A;  1LVC D;  2JXC A;  1AK8 A;  3DVM A;  2E30 A;  3KPX A;  1J1E A;  1TNP A;  1M31 A;  1ZUZ A;  3OX6 A;  3CR4 X;  1WDC B;  2KQY A;  2KBM A;  4QJ4 B;  1NPQ A;  1SPY A;  4BY5 A;  1KWO B;  3BYA A;  1F55 A;  2K2F A;  2WCB A;  1YUT A;  3ZNI A;  5HKZ A;  1TIZ A;  4HRH A;  1B1G A;  1CFF A;  1B9A A;  1CFC A;  1XO5 A;  5I2L A;  1BMO A;  3SIA A;  1S5G Y;  1SRA A;  2LV7 A;  3EK7 A;  2AMI A;  1A75 A;  3K21 A;  3F45 A;  3BUN B;  3PAT A;  1KK7 Z;  1RFJ A;  1YRT B;  3O78 A;  1K2H A;  1KK8 B;  2PAL A;  5IBW A;  1AJ4 A;  1OZS A;  2L4I A;  4A4C A;  2JPT A;  1LKJ A;  1DTL A;  1L7Z A;  1YUS A;  1OZO A;  3OB2 B;  2MBX A;  1BG1 A;  1NWD A;  2JTT A;  3RLZ A;  1JFJ A;  1A2X A;  1S3P A;  1IJ5 A;  2PSR A;  1XFX O;  4I5J A;  1SY9 A;  2PVB A;  2M1U A;  4PE1 A;  2JNX A;  4PHK A;  3IF7 A;  1CMF A;  4QJ3 B;  1KWO C;  3TDU A;  2JXL A;  2M1K B;  1CM4 A;  1Y1X A;  2K8M B;  3EVV A;  2Y5I A;  1A29 A;  1XK4 A;  1ALW A;  2MAZ A;  4XJK A;  3BOW B;  1PK0 D;  2F3Z A;  1TOP A;  2ZN8 A;  3VGO A;  2Q91 A;  1GQM A;  2NXQ A;  2KYC A;  3CWG A;  2H61 C;  1MWN A;  1W7J B;  1PSB A;  1KK8 C;  4CPV A;  4YGD B;  2LC5 A;  2K61 A;  3TUY B;  2FCE A;  1D1O A;  4YGC B;  2L5X B;  3BUM B;  2OPO A;  1A75 B;  4MSP A;  2V53 A;  2D8N A;  1DJG A;  4MRX A;  1SW8 A;  1ZAC A;  1F70 A;  4PHN A;  1YR5 A;  1DT7 B;  2ISD A;  3DVK A;  1QX5 B;  3DVJ A;  3E3R A;  4TNC A;  1B8L A;  4MLW A;  1OSA A;  1QAT A;  5FYX A;  1OQP A;  2R2I A;  2KYF A;  1DGU A;  1M63 B;  1TN4 A;  3KO0 A;  1SL9 A;  1NUB A;  2CTN A;  2LE9 B;  1TNW A;  2LUX A;  2Y4Q A;  3BUW B;  2LUC A;  2EC6 B;  3EK4 A;  1MR8 A;  1REC A;  3SG2 A;  1JF2 A;  1YVH A;  3WXA A;  2PMY A;  1G8I A;  1MXE A;  2I94 A;  1J7R A;  1NCX A;  1AVS A;  1RRO A;  2CT9 A;  1B8C A;  3C1V A;  4WQ2 A;  2KQ6 A;  1PVB A;  1KQV A;  1MXL C;  2JNF A;  1CTR A;  4GNK B;  4ORB B;  3TUY C;  4JWQ A;  4PE7 A;  3AAK A;  4QJ5 B;  2QAC A;  4C0K A;  1XYD A;  3AKA A;  2RGI A;  1DMO A;  2PRU A;  1JUO A;  2OS8 B;  4YBH B;  1PSR A;  3JTD B;  2MHH A;  4WRI A;  1CDN A;  1BR4 B;  4HRE E;  1J7Q A;  3WHU B;  1TRF A;  4MRY A;  3A4U B;  1YRU B;  4YRU A;  1R6P A;  1SCV A;  4CID A;  1SL7 A;  4WQ3 A;  5K89 A;  1OE9 B;  5TNC A;  4DRW A;  4PAL A;  2KHN A;  3VRO A;  3O6B A;  2LM5 A;  2ZKM X;  1JFK A;  1GJY A;  3BQ3 A;  2EC6 C;  2LLU A;  1YX7 A;  2KAY A;  2M7L A;  2JTZ A;  1G33 A;  4AOM A;  3EKJ A;  1IWQ A;  3EVU A;  1OOJ A;  5D69 A;  1LIN A;  1UHN A;  1XK4 C;  1SR6 B;  1J1D A;  4DIR A;  1CB1 A;  1B7T Z;  2M3W A;  1H4B A;  3NSK A;  3OX5 A;  3PN7 C;  2MA2 A;  4CFR A;  4HRG A;  2H2K A;  1QX2 A;  2L0P A;  2WCE A;  1CM1 A;  3PFV A;  2KFF A;  1WLZ A;  1CLB A;  4FQO A;  1B47 A;  1XFV O;  1UWO A;  2WOR A;  5JJG A;  3FWC A;  2MLE C;  3O4Y A;  2OS8 C;  4PCW A;  1PAL A;  2G9B A;  3JTD C;  2BL0 B;  2LP3 A;  1F4O A;  1SL8 A;  5PAL A;  1ALV A;  2F8P A;  2JUL A;  5BPJ A;  3GK2 A;  2NCO A;  1U5I A;  4ZCU A;  3OP0 A;  1K94 A;  1TNX A;  1M39 A;  2Q4U A;  4GPL B;  2FOT A;  4YGA A;  4M2O A;  2K7O A;  2I18 A;  3CLN A;  2WOS A;  3D10 A;  4P5O E;  3GOF A;  1CDL A;  1NCY A;  1S5G Z;  2ZRT A;  1YTZ C;  3H4S E;  3LCP C;  1RK9 A;  4I5N B;  3SJS A;  1F8H A;  3AAJ A;  1CFP A;  4HSZ A;  3TDI A;  2EGD A;  2A4J A;  2M8U A;  3NXA A;  4JQ0 D;  1SR6 C;  1Y0V H;  3D0Y A;  5HYD A;  1NX2 A;  5HKW A;  4NDB A;  4MZL A;  4AQJ A;  1DVI A;  1YVL A;  2LHI A;  1FPW A;  1WDC C;  4MVF A;  1IH0 A;  1JWD A;  1AJ5 A;  2NZ0 A;  2FJU B;  4NQG A;  4YI9 A;  5CSI A;  1EXR A;  3FS7 A;  1K9U A;  2ZNE A;  1N2D A;  2KOT A;  2BL0 C;  1LA3 A;  1K9K A;  1KSM A;  1Y1U A;  1Y1A A;  1BU3 A;  3BUO B;  1S6C A;  3CZT X;  1J55 A;  2M0R A;  1KCY A;  4MBE A;  3WNX B;  1DGV A;  4A4B A;  1IQ3 A;  1JBA A;  1HQV A;  1AP4 A;  1FI5 A;  2KFH A;  3RM1 A;  3CGA A;  1ODB A;  4XYN A;  1ZOT B;  4CFQ A;  2AUC A;  4F0Z B;  1YUR A;  1ZFS A;  3TS5 B;  1IRJ A;  4GGF A;  2LP2 A;  2KGB C;  1DJH A;  1K95 A;  2HQW A;  1F54 A;  1M45 A;  3LLE A;  4C0J A;  4IL1 A;  1QVI Y;  2ZN9 A;  3EK8 A;  2KI4 B; 
#chains in the Genus database with same CATH topology
 5HKY A;  1OMV A;  4OCI A;  1NSH A;  1QIV A;  3D0Y B;  1W9Z A;  2BNX A;  2HET A;  1DJX A;  3VRN A;  4GGN A;  1BR1 B;  1FI6 A;  4ORA B;  3AKB A;  1VRK A;  1K96 A;  3OB1 B;  1KFX L;  2JWW A;  2LMU A;  4DCK A;  1IGV A;  4R1E A;  2KGR A;  1MQ1 A;  2F2O A;  2KDH A;  4PDZ A;  2F3Y A;  2O5G A;  5CSF A;  1DF0 A;  2F2P A;  4CLN A;  1S1E A;  1QX7 A;  4P2Y B;  3MSE B;  1UHH A;  1CLM A;  3EKH A;  4E68 A;  2P71 A;  2KAV A;  2QEO A;  2GGM A;  3PM8 A;  4YI8 A;  4XJK B;  2CBL A;  3GK1 A;  2YGU A;  1CFD A;  2CXJ A;  3I5F B;  3SG7 A;  2SCP A;  3TS5 C;  1UHK A;  3PAL A;  1V1F A;  2FJY A;  2CNP A;  3CZ1 A;  1G4Y R;  1CDP A;  2JU0 A;  3CZ0 A;  2L51 A;  3DF0 A;  5HLO A;  1IJ6 A;  3BFH A;  1M46 A;  1NYA A;  1V1G A;  1XA5 A;  2I7A A;  2KI4 C;  1PUL A;  4PE0 A;  5CSJ A;  2K7C A;  3PSR A;  2KAX A;  3S0E A;  2FCD A;  1C3Y A;  1SNL A;  1Z4H A;  5HLV A;  3BFA A;  2BKI B;  1A4P A;  4GUK A;  2KFG A;  2LMT A;  1E8A A;  2I2R E;  4UPG A;  1EH2 A;  2AAO A;  3LL8 B;  4N1F A;  4OVN F;  4YGB B;  2NLN A;  3IQO A;  1OW4 A;  4INX A;  4INW A;  2WC5 A;  3QME A;  2IS9 A;  1DJY A;  2K7B A;  2BBN A;  4OZD A;  1TUJ A;  3KHE A;  3S0F A;  5DKR A;  4PE4 A;  2LAP A;  1UHI A;  3BUX B;  1AUI B;  4M2P A;  3TDZ A;  3JVT B;  1FBV A;  4DUQ A;  3I5F C;  4OKH A;  1QS7 A;  2BEC A;  1DF0 B;  2H61 A;  2L98 A;  2KLE A;  3NHI A;  1DEK A;  3V2L A;  5AFP A;  1UHJ A;  2HPS A;  3TZ1 A;  5I2Q A;  2LLT A;  1QXP A;  3ZWH A;  2E6W A;  5KSZ A;  1OOF A;  1GGZ A;  2LVI A;  2WCK A;  1PRW A;  1QJT A;  4U8D A;  1XFR A;  1XVJ A;  2BCX A;  4L9M A;  5F6T A;  1CNP A;  1SMG A;  2KBI A;  4Q04 A;  2P70 A;  1TCF A;  2COL B;  3DF0 B;  1MF8 B;  1OMD A;  1BT6 A;  1B7T Y;  1QAS A;  1FF1 A;  3BXK A;  3CDN A;  3I5G B;  2GV5 A;  2JC2 A;  3EVR A;  2LCP A;  5FI6 A;  4MZJ A;  3CR2 A;  1JSA A;  2WCH A;  3QRX A;  2Y1N A;  3A8R A;  2VRG A;  2M49 B;  1LA0 A;  3L4A A;  5AER A;  4OV2 A;  5D7F A;  2LHL A;  2MLF C;  3HX4 A;  1S26 D;  4BY4 A;  2PAS A;  2BAP A;  4MZK A;  2CCM A;  3BOW A;  4PHJ A;  1KFU S;  5JOL A;  2L50 A;  2LVJ A;  2QDI A;  1CLL A;  3JVT C;  5ER5 A;  1S36 A;  5CPV A;  1QV1 A;  4N1G A;  2OTG B;  5KU1 A;  3O2P A;  1RWY A;  1IG5 A;  1SCM B;  4FQT A;  3NSO A;  1F4Q A;  3D73 A;  3IVT A;  3KF9 A;  2P6B B;  3LK0 A;  2LVV A;  3D76 A;  1UUS A;  3ICB A;  3LK1 A;  2LNK A;  1R2U A;  1DJI A;  1HT9 A;  1KK7 Y;  1BOD A;  1J7P A;  1QTX A;  1TNQ A;  1NCZ A;  1SKT A;  1IQ5 A;  2O60 A;  1WRL A;  5G08 A;  4GFT A;  5GQQ C;  1MUX A;  4OR9 B;  3SIB A;  2KI6 C;  2M9G A;  3D78 A;  1MHO A;  1OMR A;  1ZMZ A;  1BOC A;  5I8N A;  1C7W A;  1S6I A;  1B8R A;  5DKN A;  3I5G C;  1KFU L;  1SK6 D;  1H8B A;  3IQQ A;  2HF5 A;  1GGW A;  2QEB A;  1KFX S;  2MJW B;  3SG4 A;  2M97 A;  1KQM B;  1CKK A;  1Y6W A;  3M0W A;  1WLM A;  1U5I B;  2G2B A;  2ZND A;  2JRF A;  4GBA A;  4JKT A;  1EG3 A;  3FWB A;  4ETO A;  1SBJ A;  1WRK A;  3FIA A;  1C3Z A;  1JF0 A;  2H8V A;  2WC8 A;  2K2A A;  4PHM A;  3I5H B;  2OTG C;  1C07 A;  1DEL A;  1SCM C;  4ICB A;  5AEQ A;  2F33 A;  1SSE B;  1T14 A;  2QPT A;  1JC2 A;  4MN0 A;  1QVI Z;  2LAN A;  5HL1 A;  2K0J A;  2ZRS A;  2DOQ A;  2BCA A;  4YGE B;  3SG5 A;  2JT0 A;  4USL A;  3Q8I A;  5AAN A;  1N65 A;  1RTP 1;  2BE6 A;  3NSL A;  2TN4 A;  5I2O A;  2BE4 A;  1QV0 A;  2L4H A;  1SYM A;  1QLK A;  2WND A;  3BJH A;  2GGZ A;  3VRP A;  5EL2 A;  4GAO A;  5FI7 A;  3PLF B;  1IKU A;  2KLD A;  1NP8 A;  1EG4 A;  4NDC A;  2L2E A;  3DD4 A;  3CTN A;  1KQM C;  1S6J A;  1AHR A;  1YUU A;  2BKH B;  2KI6 D;  2ZFD A;  3HCM A;  4C0L A;  3VRQ A;  1N0Y A;  1LXF C;  4D1E A;  1X02 A;  4MEW A;  3I5H C;  1BF5 A;  3KEV A;  1EJ3 A;  1DJW A;  3WHT B;  2BBM A;  1UP5 A;  2ERB A;  2HQ8 A;  1NX1 A;  1TCO B;  2M7N A;  5J3X A;  1L2O B;  2B1U A;  3R1P A;  3I5I B;  2BCB A;  3UNW A;  3FE9 A;  1Q80 A;  1BJF A;  1K9P A;  1WY9 A;  4AQI A;  1YX8 A;  1UUR A;  1PVA A;  3PN7 B;  1EL4 A;  1XFU O;  2JOJ A;  1W7I B;  2LVK A;  3CAB A;  3RZS A;  1J7O A;  3R1O A;  2Y1M A;  1DJZ A;  1XFY O;  3BFB A;  5B8I B;  2EHB A;  2GTE A;  1XFZ O;  4M2Q A;  3DVE A;  1QLS A;  1CMG A;  2MRD A;  2K7D A;  3SG6 A;  2LLS A;  2KSP A;  3CS1 A;  3GK4 X;  4I5K A;  5DKQ A;  5AXI A;  1WRZ A;  1QWV A;  1B4C A;  2KNE A;  5CSN A;  4I5L B;  4JPZ B;  2QEV A;  2WCF A;  2JT8 A;  3CR5 X;  4DS7 A;  4ORC B;  1RJV A;  1XFW O;  2JT3 A;  1F71 A;  3OHM B;  4ZCV A;  1BLQ A;  3NSI A;  4GGF C;  1QIW A;  4NDD A;  1NIW A;  2JZI A;  2NCP A;  1FW4 A;  3B86 A;  4N5X A;  2WCM A;  1L2O C;  1K8U A;  5KTY A;  2M29 A;  2LMV A;  3I5I C;  2SAS A;  1NX3 A;  1TTX A;  1K93 D;  3SG3 A;  1K90 D;  1A03 A;  1C7V A;  1NX0 A;  2JQ6 A;  1KSO A;  5ER4 X;  4FTG A;  1CDM A;  1LVC D;  2JXC A;  1AK8 A;  3DVM A;  2E30 A;  1TUZ A;  3KPX A;  1J1E A;  1OOI X;  1TNP A;  1M31 A;  1OOH A;  1ZUZ A;  3OX6 A;  3CR4 X;  3PJI A;  1WDC B;  2KQY A;  2KBM A;  4QJ4 B;  1NPQ A;  3SS3 A;  1GM0 A;  1SPY A;  3UO9 A;  4BY5 A;  1KWO B;  3BYA A;  1F55 A;  2K2F A;  2WCB A;  1YUT A;  2L2C A;  5HKZ A;  1TIZ A;  4HRH A;  3ZNI A;  1B1G A;  1CFF A;  1B9A A;  1CFC A;  1XO5 A;  3OBV A;  1P28 A;  5I2L A;  1BMO A;  3S0G A;  3SIA A;  1S5G Y;  1SRA A;  2LV7 A;  3EK7 A;  2AMI A;  1A75 A;  3K21 A;  3F45 A;  3BUN B;  3PAT A;  1KK7 Z;  1RFJ A;  1YRT B;  3O78 A;  1K2H A;  1KK8 B;  1OOG A;  2PAL A;  5IBW A;  1AJ4 A;  1OZS A;  2L4I A;  4A4C A;  2JPT A;  1LKJ A;  2JPO A;  1DTL A;  1L7Z A;  1YUS A;  3S0B A;  1OZO A;  3OB2 B;  2MBX A;  1BG1 A;  1NWD A;  2JTT A;  3RLZ A;  1JFJ A;  1A2X A;  3S0D A;  1S3P A;  3SS5 A;  1IJ5 A;  2PSR A;  1XFX O;  4I5J A;  1SY9 A;  2PVB A;  2M1U A;  4PE1 A;  2JNX A;  3D75 A;  4PHK A;  3IF7 A;  4IJ7 A;  4QJ3 B;  1CMF A;  1KWO C;  3TDU A;  2JXL A;  3B87 A;  2M1K B;  1CM4 A;  2K60 A;  1Y1X A;  2K8M B;  3EVV A;  2Y5I A;  3R72 A;  1A29 A;  1XK4 A;  1ALW A;  2MAZ A;  4XJK A;  3BOW B;  1PK0 D;  2F3Z A;  1TOP A;  2ZN8 A;  3B6X A;  2Q91 A;  3VGO A;  3S0A A;  1GQM A;  2NXQ A;  2KYC A;  3D74 A;  3CWG A;  2H61 C;  1MWN A;  1W7J B;  1PSB A;  3CZ2 A;  1KK8 C;  4CPV A;  3DXL A;  2LC5 A;  2L5Y A;  4YGD B;  2K61 A;  2WC6 A;  2FCE A;  3TUY B;  1D1O A;  4YGC B;  2L5X B;  3BUM B;  2OPO A;  1A75 B;  3CYZ A;  4MSP A;  2V53 A;  2D8N A;  1DJG A;  4MRX A;  1SW8 A;  1ZAC A;  1F70 A;  4PHN A;  1YR5 A;  2WCL A;  1DT7 B;  2ISD A;  3DVK A;  1QX5 B;  3DVJ A;  3E3R A;  4TNC A;  1B8L A;  1DQE A;  3DY9 A;  4MLW A;  1OSA A;  1QAT A;  5FYX A;  1OQP A;  2R2I A;  2KYF A;  1DGU A;  1M63 B;  4F7F A;  1TN4 A;  3NHT A;  3KO0 A;  3R1V A;  1SL9 A;  1NUB A;  2CTN A;  2LE9 B;  1TNW A;  2LUX A;  2Y4Q A;  3BUW B;  3FE6 A;  2LUC A;  2EC6 B;  3EK4 A;  1MR8 A;  1REC A;  3SG2 A;  3L4L A;  1JF2 A;  1YVH A;  3VB1 A;  2PMY A;  3WXA A;  1G8I A;  1MXE A;  2I94 A;  1J7R A;  1NCX A;  1AVS A;  1RRO A;  3B7A A;  2CT9 A;  1B8C A;  2PYQ A;  3C1V A;  4WQ2 A;  2KQ6 A;  1PVB A;  1KQV A;  1MXL C;  2JNF A;  1CTR A;  4GNK B;  4ORB B;  3TUY C;  4JWQ A;  2KPH A;  4PE7 A;  3AAK A;  2QEH A;  2QAC A;  4C0K A;  1XYD A;  3AKA A;  4QJ5 B;  2RGI A;  1DMO A;  1IIO A;  2PRU A;  1JUO A;  2OS8 B;  4YBH B;  1PSR A;  3JTD B;  2MHH A;  4WRI A;  1CDN A;  1BR4 B;  4HRE E;  1J7Q A;  3WHU B;  1TRF A;  4MRY A;  3A4U B;  1YRU B;  4YRU A;  1R6P A;  1SCV A;  4CID A;  1SL7 A;  4WQ3 A;  5K89 A;  1OE9 B;  5TNC A;  4DRW A;  4PAL A;  2KHN A;  3VRO A;  3O6B A;  2LM5 A;  2ZKM X;  1JFK A;  1GJY A;  3BQ3 A;  2EC6 C;  2LLU A;  1YX7 A;  2KAY A;  2M7L A;  2JTZ A;  1G33 A;  4AOM A;  3EKJ A;  1IWQ A;  3EVU A;  1OOJ A;  5D69 A;  1LIN A;  4KYN A;  1UHN A;  1XK4 C;  1SR6 B;  1J1D A;  4DIR A;  1CB1 A;  1B7T Z;  2M3W A;  1H4B A;  3NSK A;  3OX5 A;  3PN7 C;  2MA2 A;  4CFR A;  4HRG A;  2H2K A;  1QX2 A;  2L0P A;  2WCE A;  1CM1 A;  3K1E A;  3PFV A;  1LS8 A;  2KFF A;  1WLZ A;  1CLB A;  4FQO A;  3NGV A;  1B47 A;  1XFV O;  1UWO A;  2WOR A;  5JJG A;  3FWC A;  2MLE C;  3O4Y A;  2OS8 C;  4PCW A;  1PAL A;  2G9B A;  3JTD C;  2BL0 B;  2LP3 A;  1F4O A;  1SL8 A;  5PAL A;  1ALV A;  2F8P A;  1TWO A;  2JUL A;  5BPJ A;  3GK2 A;  2NCO A;  1U5I A;  4ZCU A;  3OP0 A;  1K94 A;  1TNX A;  1M39 A;  3OGN A;  2Q4U A;  2PQL A;  4GPL B;  2FOT A;  4YGA A;  4M2O A;  2K7O A;  3SS4 A;  2I18 A;  4JD9 A;  3CLN A;  2WOS A;  3D10 A;  4P5O E;  3GOF A;  1CDL A;  1NCY A;  1S5G Z;  2ZRT A;  1YTZ C;  3H4S E;  3LCP C;  1RK9 A;  4I5N B;  3SJS A;  3VRR A;  3AAJ A;  3DZT A;  1CFP A;  1F8H A;  4HSZ A;  3TDI A;  2EGD A;  2A4J A;  2M8U A;  3NXA A;  4JQ0 D;  1SR6 C;  1Y0V H;  3D0Y A;  5HYD A;  1NX2 A;  3N7H A;  1ORG A;  5HKW A;  3L47 A;  4NDB A;  4MZL A;  4AQJ A;  1DVI A;  1YVL A;  5I94 A;  2LHI A;  1FPW A;  1WDC C;  4MVF A;  1IH0 A;  1JWD A;  1AJ5 A;  3DYE A;  2NZ0 A;  2FJU B;  4NQG A;  4YI9 A;  5CSI A;  1EXR A;  3FS7 A;  3PM2 A;  1K9U A;  2ZNE A;  1N2D A;  2KOT A;  2BL0 C;  1LA3 A;  1K9K A;  1KSM A;  1Y1U A;  2WCJ A;  1Y1A A;  1BU3 A;  3BUO B;  1S6C A;  3CZT X;  1J55 A;  2M0R A;  1KCY A;  4MBE A;  3WNX B;  1DC1 A;  1DGV A;  1Z2C B;  4A4B A;  1IQ3 A;  1JBA A;  1HQV A;  1AP4 A;  1FI5 A;  3B88 A;  2KFH A;  3RM1 A;  3CGA A;  1ODB A;  4XYN A;  1ZOT B;  3D77 A;  3EG5 B;  2AUC A;  5DIC A;  4CFQ A;  4F0Z B;  1YUR A;  1ZFS A;  5D3O A;  3TS5 B;  1IRJ A;  4GGF A;  2LP2 A;  3FE8 A;  2KGB C;  3O4X A;  1DJH A;  1K95 A;  2HQW A;  1F54 A;  4PT1 A;  1M45 A;  3LLE A;  4C0J A;  4IL1 A;  1QVI Y;  2ZN9 A;  3EK8 A;  2KI4 B;  5FI2 A; 
#chains in the Genus database with same CATH homology
 5HKY A;  1OMV A;  4OCI A;  1NSH A;  1QIV A;  3D0Y B;  2HET A;  1DJX A;  3VRN A;  4GGN A;  1BR1 B;  1FI6 A;  4ORA B;  3AKB A;  1VRK A;  1K96 A;  3OB1 B;  1KFX L;  2JWW A;  2LMU A;  4DCK A;  1IGV A;  4R1E A;  2KGR A;  1MQ1 A;  2F2O A;  2KDH A;  4PDZ A;  2F3Y A;  2O5G A;  5CSF A;  1DF0 A;  2F2P A;  4CLN A;  1S1E A;  1QX7 A;  4P2Y B;  3MSE B;  1UHH A;  1CLM A;  3EKH A;  4E68 A;  2KAV A;  2GGM A;  3PM8 A;  4YI8 A;  4XJK B;  2CBL A;  3GK1 A;  1CFD A;  2CXJ A;  3I5F B;  3SG7 A;  2SCP A;  3TS5 C;  1UHK A;  3PAL A;  1V1F A;  2CNP A;  1G4Y R;  1CDP A;  2JU0 A;  2L51 A;  3DF0 A;  5HLO A;  1IJ6 A;  1M46 A;  1NYA A;  1V1G A;  1XA5 A;  2I7A A;  2KI4 C;  1PUL A;  4PE0 A;  5CSJ A;  2K7C A;  3PSR A;  2KAX A;  2FCD A;  1SNL A;  5HLV A;  2BKI B;  1A4P A;  4GUK A;  2KFG A;  2LMT A;  1E8A A;  2I2R E;  4UPG A;  1EH2 A;  2AAO A;  3LL8 B;  4N1F A;  4OVN F;  4YGB B;  2NLN A;  3IQO A;  3VRR A;  2IS9 A;  1DJY A;  2K7B A;  2BBN A;  3KHE A;  5DKR A;  4PE4 A;  2LAP A;  1UHI A;  3BUX B;  1AUI B;  4M2P A;  3TDZ A;  3JVT B;  1FBV A;  4DUQ A;  3I5F C;  4OKH A;  1QS7 A;  2BEC A;  1DF0 B;  2H61 A;  2L98 A;  5AFP A;  1UHJ A;  2HPS A;  3TZ1 A;  5I2Q A;  2LLT A;  1QXP A;  3ZWH A;  2E6W A;  5KSZ A;  1GGZ A;  2LVI A;  1PRW A;  1QJT A;  4U8D A;  1XVJ A;  2BCX A;  4L9M A;  5F6T A;  1CNP A;  1SMG A;  2KBI A;  4Q04 A;  1TCF A;  2COL B;  3DF0 B;  1MF8 B;  1OMD A;  1BT6 A;  1B7T Y;  1QAS A;  1FF1 A;  3BXK A;  3I5G B;  2GV5 A;  2JC2 A;  3EVR A;  2LCP A;  1JSA A;  4MZJ A;  3CR2 A;  3QRX A;  2Y1N A;  3A8R A;  2VRG A;  2M49 B;  1LA0 A;  5AER A;  4OV2 A;  5D7F A;  2LHL A;  2MLF C;  3HX4 A;  1S26 D;  4BY4 A;  2PAS A;  4MZK A;  4PHJ A;  2CCM A;  3BOW A;  1KFU S;  5JOL A;  2L50 A;  2LVJ A;  1CLL A;  3JVT C;  5ER5 A;  1S36 A;  5CPV A;  1QV1 A;  4N1G A;  2OTG B;  5KU1 A;  3O2P A;  1RWY A;  1IG5 A;  1SCM B;  3NSO A;  1F4Q A;  3LK0 A;  3KF9 A;  2P6B B;  2LVV A;  3ICB A;  1UUS A;  3LK1 A;  2LNK A;  1R2U A;  1DJI A;  1HT9 A;  1KK7 Y;  1BOD A;  1J7P A;  1QTX A;  1TNQ A;  1NCZ A;  1SKT A;  1IQ5 A;  2O60 A;  1WRL A;  5G08 A;  4GFT A;  5GQQ C;  1MUX A;  4OR9 B;  3SIB A;  2KI6 C;  2M9G A;  1MHO A;  1OMR A;  1ZMZ A;  1BOC A;  5I8N A;  1C7W A;  1S6I A;  1B8R A;  5DKN A;  3I5G C;  1KFU L;  1SK6 D;  1H8B A;  3IQQ A;  2HF5 A;  1GGW A;  1KFX S;  2MJW B;  3SG4 A;  2M97 A;  1KQM B;  1CKK A;  1Y6W A;  3M0W A;  1WLM A;  1U5I B;  2G2B A;  2ZND A;  2JRF A;  4GBA A;  1EG3 A;  3FWB A;  4ETO A;  1SBJ A;  1WRK A;  3FIA A;  1JF0 A;  2WC8 A;  2K2A A;  4PHM A;  3I5H B;  2OTG C;  1C07 A;  1SCM C;  4ICB A;  5AEQ A;  2F33 A;  2QPT A;  1JC2 A;  4MN0 A;  1QVI Z;  2LAN A;  2K0J A;  2ZRS A;  2DOQ A;  2BCA A;  4YGE B;  3SG5 A;  2JT0 A;  4USL A;  5AAN A;  1N65 A;  1RTP 1;  2BE6 A;  3NSL A;  2TN4 A;  5I2O A;  2BE4 A;  1QV0 A;  2L4H A;  1SYM A;  1QLK A;  2WND A;  2GGZ A;  3VRP A;  4GAO A;  1IKU A;  3PLF B;  1NP8 A;  1EG4 A;  4NDC A;  2L2E A;  3DD4 A;  3CTN A;  1KQM C;  1S6J A;  1AHR A;  1YUU A;  2BKH B;  2KI6 D;  2ZFD A;  3HCM A;  4C0L A;  3VRQ A;  1N0Y A;  1LXF C;  4D1E A;  1X02 A;  4MEW A;  3I5H C;  1BF5 A;  3KEV A;  1EJ3 A;  1DJW A;  3WHT B;  2BBM A;  1UP5 A;  2HQ8 A;  2M7N A;  1NX1 A;  1TCO B;  5J3X A;  1L2O B;  2B1U A;  3I5I B;  2BCB A;  1Q80 A;  1BJF A;  1K9P A;  1WY9 A;  4AQI A;  1YX8 A;  1UUR A;  1PVA A;  3PN7 B;  1EL4 A;  1XFU O;  2JOJ A;  1W7I B;  2LVK A;  1J7O A;  2Y1M A;  1DJZ A;  1XFY O;  5B8I B;  2EHB A;  1XFZ O;  4M2Q A;  3DVE A;  1QLS A;  1CMG A;  2MRD A;  2K7D A;  3SG6 A;  2LLS A;  2KSP A;  3CS1 A;  3GK4 X;  4I5K A;  5DKQ A;  5AXI A;  1WRZ A;  1B4C A;  2KNE A;  5CSN A;  4I5L B;  4JPZ B;  4DS7 A;  2WCF A;  2JT8 A;  3CR5 X;  4ORC B;  1RJV A;  1XFW O;  2JT3 A;  1F71 A;  3OHM B;  4ZCV A;  1BLQ A;  3NSI A;  4GGF C;  1QIW A;  4NDD A;  1NIW A;  2JZI A;  2NCP A;  1FW4 A;  4N5X A;  5KTY A;  1L2O C;  1K8U A;  2M29 A;  2LMV A;  3I5I C;  2SAS A;  1NX3 A;  1TTX A;  1K93 D;  3SG3 A;  1K90 D;  1A03 A;  1C7V A;  1NX0 A;  2JQ6 A;  1KSO A;  5ER4 X;  4FTG A;  1CDM A;  1LVC D;  2JXC A;  1AK8 A;  3DVM A;  2E30 A;  3KPX A;  1J1E A;  1TNP A;  1M31 A;  1ZUZ A;  3OX6 A;  3CR4 X;  1WDC B;  2KQY A;  2KBM A;  4QJ4 B;  1NPQ A;  1SPY A;  4BY5 A;  1KWO B;  3BYA A;  1F55 A;  2K2F A;  2WCB A;  1YUT A;  3ZNI A;  5HKZ A;  1TIZ A;  4HRH A;  1B1G A;  1CFF A;  1B9A A;  1CFC A;  1XO5 A;  5I2L A;  1BMO A;  3SIA A;  1S5G Y;  1SRA A;  2LV7 A;  3EK7 A;  2AMI A;  1A75 A;  3K21 A;  3F45 A;  3BUN B;  3PAT A;  1KK7 Z;  1RFJ A;  1YRT B;  3O78 A;  1K2H A;  1KK8 B;  2PAL A;  5IBW A;  1AJ4 A;  1OZS A;  2L4I A;  4A4C A;  2JPT A;  1LKJ A;  1DTL A;  1L7Z A;  1YUS A;  1OZO A;  3OB2 B;  2MBX A;  1BG1 A;  1NWD A;  2JTT A;  3RLZ A;  1JFJ A;  1A2X A;  1S3P A;  1IJ5 A;  2PSR A;  1XFX O;  4I5J A;  1SY9 A;  2PVB A;  2M1U A;  4PE1 A;  2JNX A;  4PHK A;  3IF7 A;  1CMF A;  4QJ3 B;  1KWO C;  3TDU A;  2JXL A;  2M1K B;  1CM4 A;  1Y1X A;  2K8M B;  3EVV A;  2Y5I A;  1A29 A;  1XK4 A;  1ALW A;  2MAZ A;  4XJK A;  3BOW B;  1PK0 D;  2F3Z A;  1TOP A;  2ZN8 A;  3VGO A;  2Q91 A;  1GQM A;  2NXQ A;  2KYC A;  3CWG A;  2H61 C;  1MWN A;  1W7J B;  1PSB A;  1KK8 C;  4CPV A;  4YGD B;  2LC5 A;  2K61 A;  3TUY B;  2FCE A;  1D1O A;  4YGC B;  2L5X B;  3BUM B;  2OPO A;  1A75 B;  4MSP A;  2V53 A;  2D8N A;  1DJG A;  4MRX A;  1SW8 A;  1ZAC A;  1F70 A;  4PHN A;  1YR5 A;  1DT7 B;  2ISD A;  3DVK A;  1QX5 B;  3DVJ A;  3E3R A;  4TNC A;  1B8L A;  4MLW A;  1OSA A;  1QAT A;  5FYX A;  1OQP A;  2R2I A;  2KYF A;  1DGU A;  1M63 B;  1TN4 A;  3KO0 A;  1SL9 A;  1NUB A;  2CTN A;  2LE9 B;  1TNW A;  2LUX A;  2Y4Q A;  3BUW B;  2LUC A;  2EC6 B;  3EK4 A;  1MR8 A;  1REC A;  3SG2 A;  1JF2 A;  1YVH A;  3WXA A;  2PMY A;  1G8I A;  1MXE A;  2I94 A;  1J7R A;  1NCX A;  1AVS A;  1RRO A;  2CT9 A;  1B8C A;  3C1V A;  4WQ2 A;  2KQ6 A;  1PVB A;  1KQV A;  1MXL C;  2JNF A;  1CTR A;  4GNK B;  4ORB B;  3TUY C;  4JWQ A;  4PE7 A;  3AAK A;  4QJ5 B;  2QAC A;  4C0K A;  1XYD A;  3AKA A;  2RGI A;  1DMO A;  2PRU A;  1JUO A;  2OS8 B;  4YBH B;  1PSR A;  3JTD B;  2MHH A;  4WRI A;  1CDN A;  1BR4 B;  4HRE E;  1J7Q A;  3WHU B;  1TRF A;  4MRY A;  3A4U B;  1YRU B;  4YRU A;  1R6P A;  1SCV A;  4CID A;  1SL7 A;  4WQ3 A;  5K89 A;  1OE9 B;  5TNC A;  4DRW A;  4PAL A;  2KHN A;  3VRO A;  3O6B A;  2LM5 A;  2ZKM X;  1JFK A;  1GJY A;  3BQ3 A;  2EC6 C;  2LLU A;  1YX7 A;  2KAY A;  2M7L A;  2JTZ A;  1G33 A;  4AOM A;  3EKJ A;  1IWQ A;  3EVU A;  1OOJ A;  5D69 A;  1LIN A;  1UHN A;  1XK4 C;  1SR6 B;  1J1D A;  4DIR A;  1CB1 A;  1B7T Z;  2M3W A;  1H4B A;  3NSK A;  3OX5 A;  3PN7 C;  2MA2 A;  4CFR A;  4HRG A;  2H2K A;  1QX2 A;  2L0P A;  2WCE A;  1CM1 A;  3PFV A;  2KFF A;  1WLZ A;  1CLB A;  4FQO A;  1B47 A;  1XFV O;  1UWO A;  2WOR A;  5JJG A;  3FWC A;  2MLE C;  3O4Y A;  2OS8 C;  4PCW A;  1PAL A;  2G9B A;  3JTD C;  2BL0 B;  2LP3 A;  1F4O A;  1SL8 A;  5PAL A;  1ALV A;  2F8P A;  2JUL A;  5BPJ A;  3GK2 A;  2NCO A;  1U5I A;  4ZCU A;  3OP0 A;  1K94 A;  1TNX A;  1M39 A;  2Q4U A;  4GPL B;  2FOT A;  4YGA A;  4M2O A;  2K7O A;  2I18 A;  3CLN A;  2WOS A;  3D10 A;  4P5O E;  3GOF A;  1CDL A;  1NCY A;  1S5G Z;  2ZRT A;  1YTZ C;  3H4S E;  3LCP C;  1RK9 A;  4I5N B;  3SJS A;  1F8H A;  3AAJ A;  1CFP A;  4HSZ A;  3TDI A;  2EGD A;  2A4J A;  2M8U A;  3NXA A;  4JQ0 D;  1SR6 C;  1Y0V H;  3D0Y A;  5HYD A;  1NX2 A;  5HKW A;  4NDB A;  4MZL A;  4AQJ A;  1DVI A;  1YVL A;  2LHI A;  1FPW A;  1WDC C;  4MVF A;  1IH0 A;  1JWD A;  1AJ5 A;  2NZ0 A;  2FJU B;  4NQG A;  4YI9 A;  5CSI A;  1EXR A;  3FS7 A;  1K9U A;  2ZNE A;  1N2D A;  2KOT A;  2BL0 C;  1LA3 A;  1K9K A;  1KSM A;  1Y1U A;  1Y1A A;  1BU3 A;  3BUO B;  1S6C A;  3CZT X;  1J55 A;  2M0R A;  1KCY A;  4MBE A;  3WNX B;  1DGV A;  4A4B A;  1IQ3 A;  1JBA A;  1HQV A;  1AP4 A;  1FI5 A;  2KFH A;  3RM1 A;  3CGA A;  1ODB A;  4XYN A;  1ZOT B;  4CFQ A;  2AUC A;  4F0Z B;  1YUR A;  1ZFS A;  3TS5 B;  1IRJ A;  4GGF A;  2LP2 A;  2KGB C;  1DJH A;  1K95 A;  2HQW A;  1F54 A;  1M45 A;  3LLE A;  4C0J A;  4IL1 A;  1QVI Y;  2ZN9 A;  3EK8 A;  2KI4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...