4XJKB

Crystal structure of mn(ii) ca(ii) na(i) bound calprotectin
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
108
structure length
108
Chain Sequence
KMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A8
publication title Manganese Binding Properties of Human Calprotectin under Conditions of High and Low Calcium: X-ray Crystallographic and Advanced Electron Paramagnetic Resonance Spectroscopic Analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 40
structure length 108
sequence length 108
chains with identical sequence D, F, H, J
ec nomenclature
pdb deposition date 2015-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4xjkB00
3FWBA 1IJ5A 5J3XA 2LHIA 4OCIA 1BJFA 2AAOA 2KGRA 4PCWA 1WRLA 1OZSA 4P5OE 1NX0A 2JWWA 1OSAA 5AANA 4MRXA 2DOQA 1A2XA 1ZOTB 4MZJA 1SPYA 2MHHA 3SG2A 4U8DA 1BR4B 1TNPA 1UURA 2MA2A 2R2IA 1XVJA 3WNXB 1F70A 2JT8A 4OVNF 4HRGA 1QVIZ 3PN7C 4M2QA 2LC5A 4NDCA 5DKQA 1M46A 1DJXA 4DRWA 1H4BA 1KQMC 1DJZA 3NSKA 1MWNA 1F4OA 4A4CA 1TNQA 2ZNDA 4L9MA 5GQQC 4HRHA 1QX5B 1EG4A 1WRZA 2BKHB 2JT0A 1KK7Y 5ER5A 2L4IA 2SCPA 5CPVA 3I5IC 3IQOA 1AP4A 3D0YB 1B4CA 3DVEA 2PVBA 1EH2A 1J1EA 2BCXA 1K96A 2M0RA 3AKAA 1V1GA 1CM1A 2M9GA 1B8RA 1FI5A 2Y1NA 3EVUA 2E6WA 2L50A 3ICBA 1A75A 1L2OB 1ZUZA 2LVVA 5IBWA 1A03A 1UHJA 1KK8C 2L5XB 1LINA 1F4QA 2BCBA 3CR2A 3CR4X 1CDMA 2EHBA 3I5FB 2JPTA 3WXAA 1DJWA 1DJIA 3FIAA 4MBEA 4AOMA 1W7JB 2LMUA 2ZFDA 2BBMA 3BUOB 1CM4A 4MN0A 4GGNA 1J55A 4FTGA 1WDCC 1LKJA 4NQGA 5BPJA 1SY9A 2GGZA 1JBAA 3D0YA 1HT9A 1NX1A 5PALA 4C0KA 1GGZA 3FS7A 1XO5A 4E68A 1TCFA 2JT3A 1W7IB 3TUYB 5KU1A 1J7PA 1RROA 1SCMB 2K61A 3O4YA 2MJWB 2I7AA 4MSPA 3K21A 1JF2A 2KYCA 2I94A 4N1FA 4DIRA 4QJ3B 1YTZC 4N1GA 2KSPA 2HQWA 2SASA 4GBAA 4HSZA 3TDUA 2OTGC 3LCPC 3GK1A 3I5IB 3LK0A 3DF0B 2I2RE 5HLOA 3SIBA 3OHMB 4CFRA 2BECA 2ZKMX 3A8RA 4GFTA 3OB2B 1ALVA 3PM8A 2KYFA 1KFUS 3TS5B 1F54A 3VRPA 2K7CA 1IH0A 5CSJA 5G08A 1DVIA 2JU0A 2LVKA 3SG5A 1XFWO 4CFQA 2KI4C 2M3WA 3PFVA 1S6CA 4M2PA 5HKWA 4CLNA 3JTDB 2A4JA 1DGVA 5CSIA 3M0WA 1XFYO 5JOLA 1QATA 1NCZA 3JVTC 3CS1A 4NDDA 4YGAA 1UHNA 5CSNA 1DJYA 4MEWA 2BL0C 4YGDB 1CFPA 1B7TZ 2KBMA 1NIWA 5D69A 4N5XA 4Q04A 4FQOA 1TNWA 1UP5A 1K9PA 1U5IA 1D1OA 1SL9A 2TN4A 1YX8A 2CTNA 1L7ZA 2H61C 1CMFA 3LK1A 2KQYA 2MAZA 1PSBA 4WQ3A 2P6BB 1SR6B 2KFGA 1QV1A 3MSEB 1TN4A 2D8NA 1MR8A 1UWOA 3OB1B 1MUXA 3H4SE 3VRNA 1SKTA 3HX4A 1OQPA 5DKRA 3BOWB 4QJ5B 1KWOB 4DS7A 1AHRA 1J7QA 2LLTA 1AVSA 1UUSA 4MVFA 2KFFA 3BXKA 3TDZA 3SG7A 1CDLA 1TTXA 1N2DA 1DJGA 1JFKA 1EJ3A 1QS7A 3I5GC 5KTYA 1QX2A 2GGMA 2K7BA 2NZ0A 1C7WA 3TDIA 3SG6A 2EC6C 2CNPA 2KHNA 1SMGA 4PE1A 1TIZA 1A75B 2JZIA 1DF0B 1B8CA 3BOWA 2M1UA 1KSOA 1FBVA 1SCVA 2NLNA 4MRYA 5AXIA 3NSLA 3SJSA 3IQQA 2LNKA 4MLWA 4WQ2A 4BY5A 1N65A 1XFXO 1FPWA 4YRUA 3NSIA 1IQ5A 3WHTB 1LVCD 3I5HB 3NXAA 1SW8A 1UHHA 1C07A 1S5GZ 1TCOB 1K94A 4I5NB 2BCAA 4PHMA 1QTXA 2ZN9A 2KI6C 1CLLA 1RWYA 2F2PA 2ISDA 1DF0A 3EK8A 1DJHA 3EK4A 1HQVA 2HF5A 2FCEA 2PRUA 3QRXA 1RECA 2F33A 2LLSA 2M7LA 1R6PA 2OS8C 2WCBA 1KFUL 2V53A 5I8NA 1MXEA 2LP3A 1OMVA 1S26D 2LVJA 1J7RA 1DGUA 2H61A 3O78A 1AJ5A 1ZACA 2E30A 2KGBC 1MF8B 5AEQA 1LXFC 2LV7A 3AKBA 1PVBA 1TNXA 3RM1A 1WLZA 2LUCA 2CCMA 1K95A 3PN7B 1KSMA 1J7OA 1CB1A 4AQJA 1F8HA 1K90D 4I5JA 1CKKA 4GGFA 1M45A 2BE4A 4AQIA 1KQMB 4DCKA 1JF0A 1C7VA 3D10A 1Y1AA 2M29A 4YGCB 3KO0A 4PE4A 5FYXA 2KAXA 1NUBA 1BT6A 2JC2A 1B8LA 1GJYA 3BYAA 3KEVA 2RGIA 1QX7A 1PSRA 1JFJA 4ZCUA 1WRKA 1EG3A 2EGDA 3DVJA 3EVRA 1ODBA 2PASA 4ORBB 4WRIA 3KF9A 2LMTA 2G2BA 1OE9B 5TNCA 1S6IA 3DVMA 1RTP1 2JQ6A 2WC8A 2HQ8A 2KAYA 2MRDA 2KI6D 1UHKA 2K2AA 1X02A 2F8PA 1ALWA 2QPTA 3E3RA 1KK8B 1U5IB 2KDHA 1JC2A 4CIDA 2M49B 1K9KA 1RFJA 1OMRA 2JTZA 2KOTA 2LCPA 2LM5A 1RJVA 2MBXA 2BBNA 4C0LA 1SL7A 1B1GA 3OP0A 1IWQA 1G33A 1KK7Z 2K2FA 4PE7A 5AFPA 2B1UA 2LVIA 3VRQA 1WDCB 2WORA 1CTRA 1DTLA 1QVIY 2FJUB 3O2PA 2COLB 4PALA 4MZLA 4CPVA 1Y1UA 3GK4X 5DKNA 1CFDA 2F2OA 2CBLA 2JXCA 2LAPA 2AUCA 4BY4A 3VGOA 4OKHA 1BMOA 4XYNA 3HCMA 1CFCA 4ZCVA 2HETA 1YR5A 2QACA 4OR9B 3C1VA 4GPLB 4YGEB 4JPZB 1NYAA 4DUQA 2OTGB 5I2LA 3IF7A 3CGAA 4USLA 4OV2A 1SNLA 4HREE 3EK7A 3AAKA 2Q91A 3OX5A 4YI9A 2WOSA 2O5GA 3LLEA 1S36A 2FOTA 1PULA 1YRTB 2L98A 2PSRA 5HLVA 1Y0VH 1QJTA 2VRGA 2KFHA 4PHKA 4XJKB 2KI4B 1S3PA 4PE0A 2M7NA 1OOJA 4R1EA 3WHUB 1EL4A 3CTNA 3EVVA 1Y6WA 1YUUA 1AJ4A 3A4UB 5I2QA 4ICBA 2AMIA 2PMYA 2Y5IA 2PALA 1YUTA 4MZKA 4GNKB 2WCEA 5B8IB 2LUXA 3JVTB 2F3YA 1CLMA 1OMDA 2O60A 2K0JA 1L2OC 2BL0B 1AK8A 4YI8A 1IG5A 1JUOA 1NSHA 1WLMA 1Q80A 3PSRA 1XFUO 3DVKA 1YRUB 1R2UA 1BODA 3I5FC 2KNEA 1IGVA 2JOJA 4P2YB 4XJKA 2MLFC 1KFXS 1CDPA 1QASA 3ZWHA 2LHLA 3AAJA 5K89A 1AUIB 2K7DA 1KCYA 3NSOA 1BF5A 3BUMB 1NCYA 1J1DA 4D1EA 2JXLA 1PRWA 1MXLC 1TRFA 4ETOA 1BOCA 2BKIB 2ZN8A 3TUYC 4I5LB 1SCMC 2GV5A 2KAVA 1QV0A 1SRAA 3F45A 3SG4A 2L0PA 1NX3A 3I5GB 1PK0D 1QLSA 1XA5A 2F3ZA 2HPSA 4A4BA 1PVAA 2K7OA 3O6BA 1K93D 2EC6B 1BR1B 1NPQA 1OZOA 3SG3A 4ORCB 2LMVA 4NDBA 1LA3A 1IQ3A 5F6TA 2BE6A 3ZNIA 4YBHB 3VRRA 1DT7B 2FCDA 2NXQA 3OX6A 2IS9A 1MQ1A 1B7TY 4QJ4B 1GGWA 1BU3A 3TS5C 1M63B 2H2KA 1B9AA 1G8IA 3DD4A 1FF1A 2LLUA 1K2HA 1PALA 2CT9A 1S6JA 1YURA 3GOFA 1SBJA 5I2OA 1CNPA 1FW4A 3JTDC 3PLFB 1XK4C 2WCFA 3PATA 1B47A 1A4PA 2Y4QA 4IL1A 3LL8B 1BLQA 3PALA 1S1EA 1UHIA 1M31A 1G4YR 1RK9A 1CFFA 1NWDA 5AERA 1EXRA 5ER4X 2OPOA 5HYDA 1QIVA 1IRJA 2MLEC 1A29A 1M39A 1SYMA 2OS8B 2JTTA 4ORAB 2M97A 2NCPA 1K8UA 1Y1XA 1TOPA 2L4HA 3BUXB 5HKYA 3CR5X 2JULA 3KHEA 2Y1MA 1SR6C 1ZMZA 3TZ1A 1IJ6A 4PHNA 1N0YA 2M8UA 2ZNEA 4GAOA 5JJGA 1IKUA 1MHOA 4YGBB 2NCOA 2CXJA 1QXPA 2K8MB 4TNCA 1KWOC 1CLBA 3EKHA 1KQVA 1FI6A 1K9UA 1XFVO 2KBIA 1H8BA 1ZFSA 4JWQA 3BUNB 3CLNA 4F0ZB 2WNDA 4GUKA 2JRFA 2LP2A 2LE9B 1NCXA 5KSZA 1CMGA 1SK6D 1S5GY 1VRKA 1LA0A 2Q4UA 1E8AA 1KFXL 1XFZO 2LANA 4C0JA 1JSAA 3DF0A 1NX2A 1BG1A 3BQ3A 3EKJA 3CZTX 1YX7A 2L2EA 2JNFA 1NP8A 3FWCA 1GQMA 1QIWA 1XYDA 5D7FA 1DMOA 1JWDA 5CSFA 2I18A 2KQ6A 5HKZA 1YVHA 2G9BA 4PDZA 4UPGA 4PHJA 3BUWB 3SIAA 3CWGA 3I5HC 3VROA 1CDNA 1QLKA 4I5KA 1XK4A 1WY9A 3GK2A 1YVLA 2JNXA 4M2OA 1YUSA 1F55A 4JQ0D 3RLZA 2ZRSA 2L51A 1F71A 4GGFC 1V1FA 2ZRTA 1SL8A 3KPXA 2M1KB
chains in the Genus database with same CATH superfamily
3S0AA 3FWBA 1IJ5A 5J3XA 2LHIA 4OCIA 1BJFA 2AAOA 2KGRA 3S0EA 4PCWA 1WRLA 1OZSA 4P5OE 1NX0A 2JWWA 4JD9A 1OSAA 1QWVA 5AANA 4MRXA 2DOQA 2WCMA 3R1PA 3R1OA 1A2XA 1ZOTB 4MZJA 1SPYA 2MHHA 3SG2A 4U8DA 1BR4B 1TNPA 1UURA 2MA2A 2R2IA 1XVJA 3WNXB 1F70A 2JT8A 4OVNF 4HRGA 1QVIZ 3PN7C 4M2QA 3SS5A 2LC5A 4NDCA 5DKQA 1M46A 1DJXA 1P28A 4DRWA 1H4BA 1KQMC 1DJZA 3NSKA 1MWNA 1F4OA 4A4CA 1TNQA 2ZNDA 4L9MA 3FE6A 4HRHA 5GQQC 1QX5B 1EG4A 4JKTA 1WRZA 2BKHB 2JT0A 1KK7Y 5ER5A 2L4IA 2SCPA 5CPVA 3I5IC 3IQOA 1AP4A 3D0YB 1B4CA 3DVEA 2PVBA 2PYQA 1EH2A 1J1EA 2BCXA 1K96A 2M0RA 3AKAA 1V1GA 1CM1A 2M9GA 1B8RA 3Q8IA 2Y1NA 3EVUA 2E6WA 2L50A 3ICBA 1FI5A 1A75A 3D77A 1L2OB 1ZUZA 2LVVA 5IBWA 1A03A 1UHJA 1KK8C 2L5XB 1LINA 1F4QA 2BCBA 3CR2A 3CR4X 1CDMA 2EHBA 3I5FB 2JPTA 3WXAA 1DJWA 1DJIA 2ERBA 3FIAA 4MBEA 4FQTA 3V2LA 1W7JB 4AOMA 2LMUA 2ZFDA 2BBMA 3BUOB 1CM4A 4MN0A 4GGNA 1J55A 1IIOA 4FTGA 1WDCC 3L47A 1LKJA 4NQGA 5BPJA 1SY9A 2GGZA 1JBAA 3D0YA 1HT9A 1NX1A 5PALA 4C0KA 1GGZA 2QEOA 3D74A 3FS7A 1XO5A 3K1EA 1TCFA 4E68A 2JT3A 1W7IB 3TUYB 5KU1A 1J7PA 1RROA 1SCMB 2K61A 3O4YA 2MJWB 2I7AA 4MSPA 3K21A 2QEVA 1JF2A 2KYCA 2I94A 4N1FA 4DIRA 4QJ3B 1YTZC 4N1GA 2KSPA 2HQWA 2SASA 4GBAA 4HSZA 3TDUA 2OTGC 3LCPC 3GK1A 3I5IB 3LK0A 3NHIA 3DF0B 2I2RE 5HLOA 3SIBA 3OHMB 3D73A 4CFRA 2BECA 3CZ0A 2ZKMX 3A8RA 4GFTA 3OB2B 1ALVA 3PM8A 2KYFA 1KFUS 3TS5B 1F54A 3VRPA 2K7CA 3OGNA 5CSJA 5G08A 1IH0A 1DVIA 2JU0A 2LVKA 3SG5A 1XFWO 4CFQA 2KI4C 2M3WA 3B6XA 3PFVA 1S6CA 4M2PA 5HKWA 4CLNA 3B7AA 3JTDB 2A4JA 2FJYA 3CZ2A 1DGVA 5CSIA 3M0WA 1XFYO 4INXA 5JOLA 1QATA 1NCZA 3JVTC 3CS1A 4NDDA 4YGAA 1UHNA 5CSNA 1DJYA 4MEWA 2BL0C 3QMEA 4YGDB 1C3YA 3BFBA 1B7TZ 1CFPA 2KBMA 1NIWA 5D69A 4N5XA 5FI6A 3L4AA 4Q04A 4FQOA 1TNWA 1UP5A 1K9PA 2KPHA 1U5IA 1D1OA 1SL9A 2TN4A 1YX8A 2CTNA 1L7ZA 2H61C 1CMFA 3LK1A 2KQYA 2MAZA 1PSBA 4WQ3A 2P6BB 1SR6B 2KFGA 1QV1A 3MSEB 1TN4A 2D8NA 1MR8A 1UWOA 3OB1B 3R72A 1MUXA 3H4SE 3VRNA 3S0DA 1SKTA 3HX4A 1OQPA 5DKRA 3BOWB 4QJ5B 1KWOB 4DS7A 1AHRA 1J7QA 2LLTA 1AVSA 1UUSA 4MVFA 2KFFA 3BXKA 3TDZA 3SG7A 3VB1A 1CDLA 1TTXA 3B86A 3S0GA 1N2DA 1DJGA 1JFKA 1EJ3A 1QS7A 3I5GC 5KTYA 1QX2A 3BFAA 2GGMA 2K7BA 2NZ0A 1C7WA 3TDIA 3B87A 3SG6A 2EC6C 2K60A 2CNPA 2KHNA 1SMGA 4PE1A 2WCLA 1TIZA 1A75B 2JZIA 1SSEB 1DF0B 3IVTA 1B8CA 3BOWA 2M1UA 1KSOA 1FBVA 1SCVA 2NLNA 4MRYA 5AXIA 3NSLA 3SJSA 3IQQA 2LNKA 4MLWA 4WQ2A 4BY5A 1N65A 1XFXO 1FPWA 4YRUA 3NSIA 1IQ5A 5FI7A 3WHTB 1LVCD 3I5HB 3NXAA 1SW8A 1ORGA 1UHHA 3CDNA 3N7HA 1C07A 1S5GZ 1TCOB 1K94A 4I5NB 2BCAA 3FE9A 4PHMA 1QTXA 2ZN9A 2KI6C 1CLLA 1RWYA 2F2PA 3DY9A 2ISDA 1DF0A 3EK8A 4INWA 1DJHA 3EK4A 3RZSA 1HQVA 2HF5A 2FCEA 2PRUA 3QRXA 1RECA 2F33A 2LLSA 2M7LA 1R6PA 2OS8C 2WCBA 1KFUL 3CYZA 2V53A 5I8NA 1MXEA 3CZ1A 2LP3A 1OMVA 1S26D 2LVJA 1J7RA 1DGUA 2H61A 3O78A 1AJ5A 1ZACA 2E30A 2KGBC 1MF8B 5AEQA 1TUJA 1XFRA 1LXFC 1Z4HA 2LV7A 3AKBA 1PVBA 1TNXA 3RM1A 1WLZA 2LUCA 2CCMA 1K95A 1LS8A 1KSMA 3PN7B 1J7OA 1CB1A 4AQJA 1F8HA 1K90D 4I5JA 1CKKA 4GGFA 1M45A 2BE4A 2P70A 4AQIA 1KQMB 4DCKA 1JF0A 1C7VA 3D10A 1Y1AA 2M29A 4YGCB 3KO0A 4PE4A 5FYXA 3CABA 2KAXA 1NUBA 1BT6A 2JC2A 1B8LA 1GJYA 3BYAA 3KEVA 2RGIA 1QX7A 1PSRA 1JFJA 2BNXA 4ZCUA 3SS4A 1WRKA 1EG3A 2EGDA 3DVJA 3EVRA 1ODBA 2PASA 4ORBB 4WRIA 3BFHA 3KF9A 2LMTA 2G2BA 2GTEA 2BAPA 1OE9B 5TNCA 1S6IA 3DVMA 1RTP1 2JQ6A 2KLDA 2WC8A 3DZTA 2HQ8A 2KAYA 2MRDA 2KI6D 1UHKA 2K2AA 1X02A 2F8PA 1ALWA 2QPTA 3E3RA 1KK8B 1U5IB 2KDHA 1JC2A 4CIDA 3SS3A 1OOGA 2M49B 5DICA 1K9KA 1RFJA 1OMRA 2JTZA 2KOTA 2LCPA 2LM5A 1RJVA 2MBXA 2BBNA 4C0LA 1SL7A 1B1GA 3OP0A 1IWQA 1G33A 1KK7Z 2K2FA 3R1VA 4PE7A 5AFPA 2B1UA 2LVIA 3VRQA 1WDCB 2WORA 1CTRA 1DTLA 1QVIY 2FJUB 3O2PA 2COLB 4PALA 4MZLA 4CPVA 1Y1UA 3GK4X 5DKNA 3UO9A 1CFDA 1DELA 2F2OA 2CBLA 2JXCA 2LAPA 2AUCA 2WCKA 4BY4A 3VGOA 4OKHA 1BMOA 4XYNA 3HCMA 1CFCA 4ZCVA 2HETA 1YR5A 2QACA 4OR9B 3C1VA 4GPLB 3O4XA 4YGEB 4JPZB 4F7FA 1NYAA 4DUQA 2OTGB 5I2LA 1DC1A 2H8VA 3IF7A 3CGAA 4USLA 4OV2A 1SNLA 4HREE 3EK7A 3AAKA 2Q91A 3OX5A 4YI9A 2WOSA 2O5GA 2YGUA 3LLEA 1S36A 2FOTA 1PULA 1YRTB 2L98A 2PSRA 5HLVA 1Y0VH 1QJTA 2JPOA 2KFHA 2VRGA 3NHTA 4PHKA 2KI4B 4XJKB 1S3PA 4PE0A 2M7NA 1OOJA 4R1EA 3WHUB 1EL4A 2WCHA 3CTNA 3EVVA 1Y6WA 1YUUA 1AJ4A 3A4UB 5I2QA 4ICBA 2AMIA 2PMYA 2Y5IA 2PALA 1YUTA 4MZKA 4GNKB 2WCEA 5B8IB 1GM0A 2LUXA 3JVTB 5I94A 2F3YA 1CLMA 1OMDA 2O60A 2K0JA 2L2CA 1L2OC 2BL0B 1AK8A 4YI8A 1IG5A 1JUOA 1NSHA 1WLMA 1Q80A 3PSRA 1XFUO 3DVKA 1YRUB 1R2UA 1DQEA 1BODA 3I5FC 2KNEA 1IGVA 2JOJA 4P2YB 4XJKA 2MLFC 1KFXS 1CDPA 1QASA 3ZWHA 2LHLA 3AAJA 5K89A 1AUIB 2K7DA 1KCYA 1OW4A 3NSOA 1BF5A 3BUMB 1NCYA 1J1DA 2KLEA 2JXLA 4D1EA 1PRWA 1MXLC 1TRFA 1TWOA 4ETOA 1BOCA 2BKIB 2ZN8A 3TUYC 4I5LB 1SCMC 3L4LA 2GV5A 2KAVA 1QV0A 1SRAA 3F45A 2L5YA 2L0PA 5EL2A 3SG4A 2WC5A 1NX3A 3I5GB 1PK0D 1QLSA 3PJIA 1XA5A 2F3ZA 2HPSA 4A4BA 1PVAA 2K7OA 3O6BA 1K93D 2EC6B 1BR1B 1NPQA 1OZOA 3SG3A 4ORCB 2LMVA 4NDBA 1LA3A 1IQ3A 5F6TA 2BE6A 3ZNIA 4YBHB 3VRRA 1DT7B 2FCDA 3DXLA 2NXQA 3OX6A 2IS9A 1MQ1A 1B7TY 4QJ4B 1GGWA 1BU3A 3TS5C 1M63B 2H2KA 1B9AA 1G8IA 3DD4A 1FF1A 2LLUA 1K2HA 1OOFA 1W9ZA 1PALA 2CT9A 1S6JA 3D76A 1YURA 5FI2A 3GOFA 1SBJA 5I2OA 1CNPA 3BJHA 1FW4A 3JTDC 3PLFB 1XK4C 2WCFA 3PATA 1DEKA 1B47A 1A4PA 1C3ZA 2Y4QA 1TUZA 4IL1A 3S0FA 3LL8B 1BLQA 3PALA 1S1EA 1UHIA 1M31A 3OBVA 1G4YR 1RK9A 1CFFA 2PQLA 1NWDA 5AERA 1EXRA 5ER4X 2OPOA 5HYDA 1QIVA 1IRJA 2MLEC 1A29A 5D3OA 1M39A 1SYMA 2OS8B 2JTTA 2QEBA 4ORAB 1Z2CB 2M97A 2NCPA 1K8UA 1Y1XA 1TOPA 4OZDA 2L4HA 3BUXB 5HKYA 3CR5X 2JULA 3KHEA 2Y1MA 1SR6C 1ZMZA 3TZ1A 1IJ6A 3FE8A 1N0YA 4PHNA 2M8UA 2ZNEA 4GAOA 5JJGA 1IKUA 1MHOA 4YGBB 2NCOA 2CXJA 1QXPA 2QDIA 2K8MB 4IJ7A 4TNCA 1KWOC 1CLBA 3D75A 3EKHA 4KYNA 1KQVA 1FI6A 1K9UA 1XFVO 2KBIA 1H8BA 1ZFSA 4JWQA 3BUNB 3CLNA 4F0ZB 1OOIX 2WNDA 3EG5B 4GUKA 2JRFA 2LP2A 2LE9B 1NCXA 5KSZA 1CMGA 1SK6D 1S5GY 1VRKA 1LA0A 2Q4UA 1E8AA 1KFXL 1XFZO 2LANA 4C0JA 1JSAA 3DF0A 1NX2A 2P71A 1BG1A 3NGVA 3B88A 3BQ3A 3CZTX 1YX7A 2L2EA 3EKJA 2JNFA 2WC6A 1NP8A 3PM2A 4PT1A 3FWCA 1GQMA 1QIWA 1XYDA 5D7FA 1DMOA 1JWDA 5CSFA 2I18A 2KQ6A 5HKZA 1YVHA 2QEHA 2WCJA 5HL1A 2G9BA 4PDZA 4UPGA 4PHJA 3BUWB 3SIAA 3UNWA 3CWGA 3I5HC 3VROA 3D78A 1CDNA 1QLKA 4I5KA 1XK4A 1WY9A 3GK2A 1YVLA 1T14A 2JNXA 4M2OA 1OOHA 1YUSA 4JQ0D 1F55A 3RLZA 3DYEA 3S0BA 2ZRSA 2L51A 1F71A 4GGFC 1V1FA 2ZRTA 1SL8A 3KPXA 2M1KB
chains in the Genus database with same CATH topology
3FWBA 1IJ5A 5J3XA 2LHIA 4OCIA 1BJFA 2AAOA 2KGRA 4PCWA 1WRLA 1OZSA 4P5OE 1NX0A 2JWWA 1OSAA 5AANA 4MRXA 2DOQA 1A2XA 1ZOTB 4MZJA 1SPYA 2MHHA 3SG2A 4U8DA 1BR4B 1TNPA 1UURA 2MA2A 2R2IA 1XVJA 3WNXB 1F70A 2JT8A 4OVNF 4HRGA 1QVIZ 3PN7C 4M2QA 2LC5A 4NDCA 5DKQA 1M46A 1DJXA 4DRWA 1H4BA 1KQMC 1DJZA 3NSKA 1MWNA 1F4OA 4A4CA 1TNQA 2ZNDA 4L9MA 5GQQC 4HRHA 1QX5B 1EG4A 1WRZA 2BKHB 2JT0A 1KK7Y 5ER5A 2L4IA 2SCPA 5CPVA 3I5IC 3IQOA 1AP4A 3D0YB 1B4CA 3DVEA 2PVBA 1EH2A 1J1EA 2BCXA 1K96A 2M0RA 3AKAA 1V1GA 1CM1A 2M9GA 1B8RA 1FI5A 2Y1NA 3EVUA 2E6WA 2L50A 3ICBA 1A75A 1L2OB 1ZUZA 2LVVA 5IBWA 1A03A 1UHJA 1KK8C 2L5XB 1LINA 1F4QA 2BCBA 3CR2A 3CR4X 1CDMA 2EHBA 3I5FB 2JPTA 3WXAA 1DJWA 1DJIA 3FIAA 4MBEA 4AOMA 1W7JB 2LMUA 2ZFDA 2BBMA 3BUOB 1CM4A 4MN0A 4GGNA 1J55A 4FTGA 1WDCC 1LKJA 4NQGA 5BPJA 1SY9A 2GGZA 1JBAA 3D0YA 1HT9A 1NX1A 5PALA 4C0KA 1GGZA 3FS7A 1XO5A 4E68A 1TCFA 2JT3A 1W7IB 3TUYB 5KU1A 1J7PA 1RROA 1SCMB 2K61A 3O4YA 2MJWB 2I7AA 4MSPA 3K21A 1JF2A 2KYCA 2I94A 4N1FA 4DIRA 4QJ3B 1YTZC 4N1GA 2KSPA 2HQWA 2SASA 4GBAA 4HSZA 3TDUA 2OTGC 3LCPC 3GK1A 3I5IB 3LK0A 3DF0B 2I2RE 5HLOA 3SIBA 3OHMB 4CFRA 2BECA 2ZKMX 3A8RA 4GFTA 3OB2B 1ALVA 3PM8A 2KYFA 1KFUS 3TS5B 1F54A 3VRPA 2K7CA 1IH0A 5CSJA 5G08A 1DVIA 2JU0A 2LVKA 3SG5A 1XFWO 4CFQA 2KI4C 2M3WA 3PFVA 1S6CA 4M2PA 5HKWA 4CLNA 3JTDB 2A4JA 1DGVA 5CSIA 3M0WA 1XFYO 5JOLA 1QATA 1NCZA 3JVTC 3CS1A 4NDDA 4YGAA 1UHNA 5CSNA 1DJYA 4MEWA 2BL0C 4YGDB 1CFPA 1B7TZ 2KBMA 1NIWA 5D69A 4N5XA 4Q04A 4FQOA 1TNWA 1UP5A 1K9PA 1U5IA 1D1OA 1SL9A 2TN4A 1YX8A 2CTNA 1L7ZA 2H61C 1CMFA 3LK1A 2KQYA 2MAZA 1PSBA 4WQ3A 2P6BB 1SR6B 2KFGA 1QV1A 3MSEB 1TN4A 2D8NA 1MR8A 1UWOA 3OB1B 1MUXA 3H4SE 3VRNA 1SKTA 3HX4A 1OQPA 5DKRA 3BOWB 4QJ5B 1KWOB 4DS7A 1AHRA 1J7QA 2LLTA 1AVSA 1UUSA 4MVFA 2KFFA 3BXKA 3TDZA 3SG7A 1CDLA 1TTXA 1N2DA 1DJGA 1JFKA 1EJ3A 1QS7A 3I5GC 5KTYA 1QX2A 2GGMA 2K7BA 2NZ0A 1C7WA 3TDIA 3SG6A 2EC6C 2CNPA 2KHNA 1SMGA 4PE1A 1TIZA 1A75B 2JZIA 1DF0B 1B8CA 3BOWA 2M1UA 1KSOA 1FBVA 1SCVA 2NLNA 4MRYA 5AXIA 3NSLA 3SJSA 3IQQA 2LNKA 4MLWA 4WQ2A 4BY5A 1N65A 1XFXO 1FPWA 4YRUA 3NSIA 1IQ5A 3WHTB 1LVCD 3I5HB 3NXAA 1SW8A 1UHHA 1C07A 1S5GZ 1TCOB 1K94A 4I5NB 2BCAA 4PHMA 1QTXA 2ZN9A 2KI6C 1CLLA 1RWYA 2F2PA 2ISDA 1DF0A 3EK8A 1DJHA 3EK4A 1HQVA 2HF5A 2FCEA 2PRUA 3QRXA 1RECA 2F33A 2LLSA 2M7LA 1R6PA 2OS8C 2WCBA 1KFUL 2V53A 5I8NA 1MXEA 2LP3A 1OMVA 1S26D 2LVJA 1J7RA 1DGUA 2H61A 3O78A 1AJ5A 1ZACA 2E30A 2KGBC 1MF8B 5AEQA 1LXFC 2LV7A 3AKBA 1PVBA 1TNXA 3RM1A 1WLZA 2LUCA 2CCMA 1K95A 3PN7B 1KSMA 1J7OA 1CB1A 4AQJA 1F8HA 1K90D 4I5JA 1CKKA 4GGFA 1M45A 2BE4A 4AQIA 1KQMB 4DCKA 1JF0A 1C7VA 3D10A 1Y1AA 2M29A 4YGCB 3KO0A 4PE4A 5FYXA 2KAXA 1NUBA 1BT6A 2JC2A 1B8LA 1GJYA 3BYAA 3KEVA 2RGIA 1QX7A 1PSRA 1JFJA 4ZCUA 1WRKA 1EG3A 2EGDA 3DVJA 3EVRA 1ODBA 2PASA 4ORBB 4WRIA 3KF9A 2LMTA 2G2BA 1OE9B 5TNCA 1S6IA 3DVMA 1RTP1 2JQ6A 2WC8A 2HQ8A 2KAYA 2MRDA 2KI6D 1UHKA 2K2AA 1X02A 2F8PA 1ALWA 2QPTA 3E3RA 1KK8B 1U5IB 2KDHA 1JC2A 4CIDA 2M49B 1K9KA 1RFJA 1OMRA 2JTZA 2KOTA 2LCPA 2LM5A 1RJVA 2MBXA 2BBNA 4C0LA 1SL7A 1B1GA 3OP0A 1IWQA 1G33A 1KK7Z 2K2FA 4PE7A 5AFPA 2B1UA 2LVIA 3VRQA 1WDCB 2WORA 1CTRA 1DTLA 1QVIY 2FJUB 3O2PA 2COLB 4PALA 4MZLA 4CPVA 1Y1UA 3GK4X 5DKNA 1CFDA 2F2OA 2CBLA 2JXCA 2LAPA 2AUCA 4BY4A 3VGOA 4OKHA 1BMOA 4XYNA 3HCMA 1CFCA 4ZCVA 2HETA 1YR5A 2QACA 4OR9B 3C1VA 4GPLB 4YGEB 4JPZB 1NYAA 4DUQA 2OTGB 5I2LA 3IF7A 3CGAA 4USLA 4OV2A 1SNLA 4HREE 3EK7A 3AAKA 2Q91A 3OX5A 4YI9A 2WOSA 2O5GA 3LLEA 1S36A 2FOTA 1PULA 1YRTB 2L98A 2PSRA 5HLVA 1Y0VH 1QJTA 2VRGA 2KFHA 4PHKA 4XJKB 2KI4B 1S3PA 4PE0A 2M7NA 1OOJA 4R1EA 3WHUB 1EL4A 3CTNA 3EVVA 1Y6WA 1YUUA 1AJ4A 3A4UB 5I2QA 4ICBA 2AMIA 2PMYA 2Y5IA 2PALA 1YUTA 4MZKA 4GNKB 2WCEA 5B8IB 2LUXA 3JVTB 2F3YA 1CLMA 1OMDA 2O60A 2K0JA 1L2OC 2BL0B 1AK8A 4YI8A 1IG5A 1JUOA 1NSHA 1WLMA 1Q80A 3PSRA 1XFUO 3DVKA 1YRUB 1R2UA 1BODA 3I5FC 2KNEA 1IGVA 2JOJA 4P2YB 4XJKA 2MLFC 1KFXS 1CDPA 1QASA 3ZWHA 2LHLA 3AAJA 5K89A 1AUIB 2K7DA 1KCYA 3NSOA 1BF5A 3BUMB 1NCYA 1J1DA 4D1EA 2JXLA 1PRWA 1MXLC 1TRFA 4ETOA 1BOCA 2BKIB 2ZN8A 3TUYC 4I5LB 1SCMC 2GV5A 2KAVA 1QV0A 1SRAA 3F45A 3SG4A 2L0PA 1NX3A 3I5GB 1PK0D 1QLSA 1XA5A 2F3ZA 2HPSA 4A4BA 1PVAA 2K7OA 3O6BA 1K93D 2EC6B 1BR1B 1NPQA 1OZOA 3SG3A 4ORCB 2LMVA 4NDBA 1LA3A 1IQ3A 5F6TA 2BE6A 3ZNIA 4YBHB 3VRRA 1DT7B 2FCDA 2NXQA 3OX6A 2IS9A 1MQ1A 1B7TY 4QJ4B 1GGWA 1BU3A 3TS5C 1M63B 2H2KA 1B9AA 1G8IA 3DD4A 1FF1A 2LLUA 1K2HA 1PALA 2CT9A 1S6JA 1YURA 3GOFA 1SBJA 5I2OA 1CNPA 1FW4A 3JTDC 3PLFB 1XK4C 2WCFA 3PATA 1B47A 1A4PA 2Y4QA 4IL1A 3LL8B 1BLQA 3PALA 1S1EA 1UHIA 1M31A 1G4YR 1RK9A 1CFFA 1NWDA 5AERA 1EXRA 5ER4X 2OPOA 5HYDA 1QIVA 1IRJA 2MLEC 1A29A 1M39A 1SYMA 2OS8B 2JTTA 4ORAB 2M97A 2NCPA 1K8UA 1Y1XA 1TOPA 2L4HA 3BUXB 5HKYA 3CR5X 2JULA 3KHEA 2Y1MA 1SR6C 1ZMZA 3TZ1A 1IJ6A 4PHNA 1N0YA 2M8UA 2ZNEA 4GAOA 5JJGA 1IKUA 1MHOA 4YGBB 2NCOA 2CXJA 1QXPA 2K8MB 4TNCA 1KWOC 1CLBA 3EKHA 1KQVA 1FI6A 1K9UA 1XFVO 2KBIA 1H8BA 1ZFSA 4JWQA 3BUNB 3CLNA 4F0ZB 2WNDA 4GUKA 2JRFA 2LP2A 2LE9B 1NCXA 5KSZA 1CMGA 1SK6D 1S5GY 1VRKA 1LA0A 2Q4UA 1E8AA 1KFXL 1XFZO 2LANA 4C0JA 1JSAA 3DF0A 1NX2A 1BG1A 3BQ3A 3EKJA 3CZTX 1YX7A 2L2EA 2JNFA 1NP8A 3FWCA 1GQMA 1QIWA 1XYDA 5D7FA 1DMOA 1JWDA 5CSFA 2I18A 2KQ6A 5HKZA 1YVHA 2G9BA 4PDZA 4UPGA 4PHJA 3BUWB 3SIAA 3CWGA 3I5HC 3VROA 1CDNA 1QLKA 4I5KA 1XK4A 1WY9A 3GK2A 1YVLA 2JNXA 4M2OA 1YUSA 1F55A 4JQ0D 3RLZA 2ZRSA 2L51A 1F71A 4GGFC 1V1FA 2ZRTA 1SL8A 3KPXA 2M1KB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FWB A;  1IJ5 A;  5J3X A;  2LHI A;  4OCI A;  1BJF A;  2AAO A;  2KGR A;  4PCW A;  1WRL A;  1OZS A;  4P5O E;  1NX0 A;  2JWW A;  1OSA A;  5AAN A;  4MRX A;  2DOQ A;  1A2X A;  1ZOT B;  4MZJ A;  1SPY A;  2MHH A;  3SG2 A;  4U8D A;  1BR4 B;  1TNP A;  1UUR A;  2MA2 A;  2R2I A;  1XVJ A;  3WNX B;  1F70 A;  2JT8 A;  4OVN F;  4HRG A;  1QVI Z;  3PN7 C;  4M2Q A;  2LC5 A;  4NDC A;  5DKQ A;  1M46 A;  1DJX A;  4DRW A;  1H4B A;  1KQM C;  1DJZ A;  3NSK A;  1MWN A;  1F4O A;  4A4C A;  1TNQ A;  2ZND A;  4L9M A;  5GQQ C;  4HRH A;  1QX5 B;  1EG4 A;  1WRZ A;  2BKH B;  2JT0 A;  1KK7 Y;  5ER5 A;  2L4I A;  2SCP A;  5CPV A;  3I5I C;  3IQO A;  1AP4 A;  3D0Y B;  1B4C A;  3DVE A;  2PVB A;  1EH2 A;  1J1E A;  2BCX A;  1K96 A;  2M0R A;  3AKA A;  1V1G A;  1CM1 A;  2M9G A;  1B8R A;  1FI5 A;  2Y1N A;  3EVU A;  2E6W A;  2L50 A;  3ICB A;  1A75 A;  1L2O B;  1ZUZ A;  2LVV A;  5IBW A;  1A03 A;  1UHJ A;  1KK8 C;  2L5X B;  1LIN A;  1F4Q A;  2BCB A;  3CR2 A;  3CR4 X;  1CDM A;  2EHB A;  3I5F B;  2JPT A;  3WXA A;  1DJW A;  1DJI A;  3FIA A;  4MBE A;  4AOM A;  1W7J B;  2LMU A;  2ZFD A;  2BBM A;  3BUO B;  1CM4 A;  4MN0 A;  4GGN A;  1J55 A;  4FTG A;  1WDC C;  1LKJ A;  4NQG A;  5BPJ A;  1SY9 A;  2GGZ A;  1JBA A;  3D0Y A;  1HT9 A;  1NX1 A;  5PAL A;  4C0K A;  1GGZ A;  3FS7 A;  1XO5 A;  4E68 A;  1TCF A;  2JT3 A;  1W7I B;  3TUY B;  5KU1 A;  1J7P A;  1RRO A;  1SCM B;  2K61 A;  3O4Y A;  2MJW B;  2I7A A;  4MSP A;  3K21 A;  1JF2 A;  2KYC A;  2I94 A;  4N1F A;  4DIR A;  4QJ3 B;  1YTZ C;  4N1G A;  2KSP A;  2HQW A;  2SAS A;  4GBA A;  4HSZ A;  3TDU A;  2OTG C;  3LCP C;  3GK1 A;  3I5I B;  3LK0 A;  3DF0 B;  2I2R E;  5HLO A;  3SIB A;  3OHM B;  4CFR A;  2BEC A;  2ZKM X;  3A8R A;  4GFT A;  3OB2 B;  1ALV A;  3PM8 A;  2KYF A;  1KFU S;  3TS5 B;  1F54 A;  3VRP A;  2K7C A;  1IH0 A;  5CSJ A;  5G08 A;  1DVI A;  2JU0 A;  2LVK A;  3SG5 A;  1XFW O;  4CFQ A;  2KI4 C;  2M3W A;  3PFV A;  1S6C A;  4M2P A;  5HKW A;  4CLN A;  3JTD B;  2A4J A;  1DGV A;  5CSI A;  3M0W A;  1XFY O;  5JOL A;  1QAT A;  1NCZ A;  3JVT C;  3CS1 A;  4NDD A;  4YGA A;  1UHN A;  5CSN A;  1DJY A;  4MEW A;  2BL0 C;  4YGD B;  1CFP A;  1B7T Z;  2KBM A;  1NIW A;  5D69 A;  4N5X A;  4Q04 A;  4FQO A;  1TNW A;  1UP5 A;  1K9P A;  1U5I A;  1D1O A;  1SL9 A;  2TN4 A;  1YX8 A;  2CTN A;  1L7Z A;  2H61 C;  1CMF A;  3LK1 A;  2KQY A;  2MAZ A;  1PSB A;  4WQ3 A;  2P6B B;  1SR6 B;  2KFG A;  1QV1 A;  3MSE B;  1TN4 A;  2D8N A;  1MR8 A;  1UWO A;  3OB1 B;  1MUX A;  3H4S E;  3VRN A;  1SKT A;  3HX4 A;  1OQP A;  5DKR A;  3BOW B;  4QJ5 B;  1KWO B;  4DS7 A;  1AHR A;  1J7Q A;  2LLT A;  1AVS A;  1UUS A;  4MVF A;  2KFF A;  3BXK A;  3TDZ A;  3SG7 A;  1CDL A;  1TTX A;  1N2D A;  1DJG A;  1JFK A;  1EJ3 A;  1QS7 A;  3I5G C;  5KTY A;  1QX2 A;  2GGM A;  2K7B A;  2NZ0 A;  1C7W A;  3TDI A;  3SG6 A;  2EC6 C;  2CNP A;  2KHN A;  1SMG A;  4PE1 A;  1TIZ A;  1A75 B;  2JZI A;  1DF0 B;  1B8C A;  3BOW A;  2M1U A;  1KSO A;  1FBV A;  1SCV A;  2NLN A;  4MRY A;  5AXI A;  3NSL A;  3SJS A;  3IQQ A;  2LNK A;  4MLW A;  4WQ2 A;  4BY5 A;  1N65 A;  1XFX O;  1FPW A;  4YRU A;  3NSI A;  1IQ5 A;  3WHT B;  1LVC D;  3I5H B;  3NXA A;  1SW8 A;  1UHH A;  1C07 A;  1S5G Z;  1TCO B;  1K94 A;  4I5N B;  2BCA A;  4PHM A;  1QTX A;  2ZN9 A;  2KI6 C;  1CLL A;  1RWY A;  2F2P A;  2ISD A;  1DF0 A;  3EK8 A;  1DJH A;  3EK4 A;  1HQV A;  2HF5 A;  2FCE A;  2PRU A;  3QRX A;  1REC A;  2F33 A;  2LLS A;  2M7L A;  1R6P A;  2OS8 C;  2WCB A;  1KFU L;  2V53 A;  5I8N A;  1MXE A;  2LP3 A;  1OMV A;  1S26 D;  2LVJ A;  1J7R A;  1DGU A;  2H61 A;  3O78 A;  1AJ5 A;  1ZAC A;  2E30 A;  2KGB C;  1MF8 B;  5AEQ A;  1LXF C;  2LV7 A;  3AKB A;  1PVB A;  1TNX A;  3RM1 A;  1WLZ A;  2LUC A;  2CCM A;  1K95 A;  3PN7 B;  1KSM A;  1J7O A;  1CB1 A;  4AQJ A;  1F8H A;  1K90 D;  4I5J A;  1CKK A;  4GGF A;  1M45 A;  2BE4 A;  4AQI A;  1KQM B;  4DCK A;  1JF0 A;  1C7V A;  3D10 A;  1Y1A A;  2M29 A;  4YGC B;  3KO0 A;  4PE4 A;  5FYX A;  2KAX A;  1NUB A;  1BT6 A;  2JC2 A;  1B8L A;  1GJY A;  3BYA A;  3KEV A;  2RGI A;  1QX7 A;  1PSR A;  1JFJ A;  4ZCU A;  1WRK A;  1EG3 A;  2EGD A;  3DVJ A;  3EVR A;  1ODB A;  2PAS A;  4ORB B;  4WRI A;  3KF9 A;  2LMT A;  2G2B A;  1OE9 B;  5TNC A;  1S6I A;  3DVM A;  1RTP 1;  2JQ6 A;  2WC8 A;  2HQ8 A;  2KAY A;  2MRD A;  2KI6 D;  1UHK A;  2K2A A;  1X02 A;  2F8P A;  1ALW A;  2QPT A;  3E3R A;  1KK8 B;  1U5I B;  2KDH A;  1JC2 A;  4CID A;  2M49 B;  1K9K A;  1RFJ A;  1OMR A;  2JTZ A;  2KOT A;  2LCP A;  2LM5 A;  1RJV A;  2MBX A;  2BBN A;  4C0L A;  1SL7 A;  1B1G A;  3OP0 A;  1IWQ A;  1G33 A;  1KK7 Z;  2K2F A;  4PE7 A;  5AFP A;  2B1U A;  2LVI A;  3VRQ A;  1WDC B;  2WOR A;  1CTR A;  1DTL A;  1QVI Y;  2FJU B;  3O2P A;  2COL B;  4PAL A;  4MZL A;  4CPV A;  1Y1U A;  3GK4 X;  5DKN A;  1CFD A;  2F2O A;  2CBL A;  2JXC A;  2LAP A;  2AUC A;  4BY4 A;  3VGO A;  4OKH A;  1BMO A;  4XYN A;  3HCM A;  1CFC A;  4ZCV A;  2HET A;  1YR5 A;  2QAC A;  4OR9 B;  3C1V A;  4GPL B;  4YGE B;  4JPZ B;  1NYA A;  4DUQ A;  2OTG B;  5I2L A;  3IF7 A;  3CGA A;  4USL A;  4OV2 A;  1SNL A;  4HRE E;  3EK7 A;  3AAK A;  2Q91 A;  3OX5 A;  4YI9 A;  2WOS A;  2O5G A;  3LLE A;  1S36 A;  2FOT A;  1PUL A;  1YRT B;  2L98 A;  2PSR A;  5HLV A;  1Y0V H;  1QJT A;  2VRG A;  2KFH A;  4PHK A;  4XJK B;  2KI4 B;  1S3P A;  4PE0 A;  2M7N A;  1OOJ A;  4R1E A;  3WHU B;  1EL4 A;  3CTN A;  3EVV A;  1Y6W A;  1YUU A;  1AJ4 A;  3A4U B;  5I2Q A;  4ICB A;  2AMI A;  2PMY A;  2Y5I A;  2PAL A;  1YUT A;  4MZK A;  4GNK B;  2WCE A;  5B8I B;  2LUX A;  3JVT B;  2F3Y A;  1CLM A;  1OMD A;  2O60 A;  2K0J A;  1L2O C;  2BL0 B;  1AK8 A;  4YI8 A;  1IG5 A;  1JUO A;  1NSH A;  1WLM A;  1Q80 A;  3PSR A;  1XFU O;  3DVK A;  1YRU B;  1R2U A;  1BOD A;  3I5F C;  2KNE A;  1IGV A;  2JOJ A;  4P2Y B;  4XJK A;  2MLF C;  1KFX S;  1CDP A;  1QAS A;  3ZWH A;  2LHL A;  3AAJ A;  5K89 A;  1AUI B;  2K7D A;  1KCY A;  3NSO A;  1BF5 A;  3BUM B;  1NCY A;  1J1D A;  4D1E A;  2JXL A;  1PRW A;  1MXL C;  1TRF A;  4ETO A;  1BOC A;  2BKI B;  2ZN8 A;  3TUY C;  4I5L B;  1SCM C;  2GV5 A;  2KAV A;  1QV0 A;  1SRA A;  3F45 A;  3SG4 A;  2L0P A;  1NX3 A;  3I5G B;  1PK0 D;  1QLS A;  1XA5 A;  2F3Z A;  2HPS A;  4A4B A;  1PVA A;  2K7O A;  3O6B A;  1K93 D;  2EC6 B;  1BR1 B;  1NPQ A;  1OZO A;  3SG3 A;  4ORC B;  2LMV A;  4NDB A;  1LA3 A;  1IQ3 A;  5F6T A;  2BE6 A;  3ZNI A;  4YBH B;  3VRR A;  1DT7 B;  2FCD A;  2NXQ A;  3OX6 A;  2IS9 A;  1MQ1 A;  1B7T Y;  4QJ4 B;  1GGW A;  1BU3 A;  3TS5 C;  1M63 B;  2H2K A;  1B9A A;  1G8I A;  3DD4 A;  1FF1 A;  2LLU A;  1K2H A;  1PAL A;  2CT9 A;  1S6J A;  1YUR A;  3GOF A;  1SBJ A;  5I2O A;  1CNP A;  1FW4 A;  3JTD C;  3PLF B;  1XK4 C;  2WCF A;  3PAT A;  1B47 A;  1A4P A;  2Y4Q A;  4IL1 A;  3LL8 B;  1BLQ A;  3PAL A;  1S1E A;  1UHI A;  1M31 A;  1G4Y R;  1RK9 A;  1CFF A;  1NWD A;  5AER A;  1EXR A;  5ER4 X;  2OPO A;  5HYD A;  1QIV A;  1IRJ A;  2MLE C;  1A29 A;  1M39 A;  1SYM A;  2OS8 B;  2JTT A;  4ORA B;  2M97 A;  2NCP A;  1K8U A;  1Y1X A;  1TOP A;  2L4H A;  3BUX B;  5HKY A;  3CR5 X;  2JUL A;  3KHE A;  2Y1M A;  1SR6 C;  1ZMZ A;  3TZ1 A;  1IJ6 A;  4PHN A;  1N0Y A;  2M8U A;  2ZNE A;  4GAO A;  5JJG A;  1IKU A;  1MHO A;  4YGB B;  2NCO A;  2CXJ A;  1QXP A;  2K8M B;  4TNC A;  1KWO C;  1CLB A;  3EKH A;  1KQV A;  1FI6 A;  1K9U A;  1XFV O;  2KBI A;  1H8B A;  1ZFS A;  4JWQ A;  3BUN B;  3CLN A;  4F0Z B;  2WND A;  4GUK A;  2JRF A;  2LP2 A;  2LE9 B;  1NCX A;  5KSZ A;  1CMG A;  1SK6 D;  1S5G Y;  1VRK A;  1LA0 A;  2Q4U A;  1E8A A;  1KFX L;  1XFZ O;  2LAN A;  4C0J A;  1JSA A;  3DF0 A;  1NX2 A;  1BG1 A;  3BQ3 A;  3EKJ A;  3CZT X;  1YX7 A;  2L2E A;  2JNF A;  1NP8 A;  3FWC A;  1GQM A;  1QIW A;  1XYD A;  5D7F A;  1DMO A;  1JWD A;  5CSF A;  2I18 A;  2KQ6 A;  5HKZ A;  1YVH A;  2G9B A;  4PDZ A;  4UPG A;  4PHJ A;  3BUW B;  3SIA A;  3CWG A;  3I5H C;  3VRO A;  1CDN A;  1QLK A;  4I5K A;  1XK4 A;  1WY9 A;  3GK2 A;  1YVL A;  2JNX A;  4M2O A;  1YUS A;  1F55 A;  4JQ0 D;  3RLZ A;  2ZRS A;  2L51 A;  1F71 A;  4GGF C;  1V1F A;  2ZRT A;  1SL8 A;  3KPX A;  2M1K B; 
#chains in the Genus database with same CATH topology
 3S0A A;  3FWB A;  1IJ5 A;  5J3X A;  2LHI A;  4OCI A;  1BJF A;  2AAO A;  2KGR A;  3S0E A;  4PCW A;  1WRL A;  1OZS A;  4P5O E;  1NX0 A;  2JWW A;  4JD9 A;  1OSA A;  1QWV A;  5AAN A;  4MRX A;  2DOQ A;  2WCM A;  3R1P A;  3R1O A;  1A2X A;  1ZOT B;  4MZJ A;  1SPY A;  2MHH A;  3SG2 A;  4U8D A;  1BR4 B;  1TNP A;  1UUR A;  2MA2 A;  2R2I A;  1XVJ A;  3WNX B;  1F70 A;  2JT8 A;  4OVN F;  4HRG A;  1QVI Z;  3PN7 C;  4M2Q A;  3SS5 A;  2LC5 A;  4NDC A;  5DKQ A;  1M46 A;  1DJX A;  1P28 A;  4DRW A;  1H4B A;  1KQM C;  1DJZ A;  3NSK A;  1MWN A;  1F4O A;  4A4C A;  1TNQ A;  2ZND A;  4L9M A;  3FE6 A;  4HRH A;  5GQQ C;  1QX5 B;  1EG4 A;  4JKT A;  1WRZ A;  2BKH B;  2JT0 A;  1KK7 Y;  5ER5 A;  2L4I A;  2SCP A;  5CPV A;  3I5I C;  3IQO A;  1AP4 A;  3D0Y B;  1B4C A;  3DVE A;  2PVB A;  2PYQ A;  1EH2 A;  1J1E A;  2BCX A;  1K96 A;  2M0R A;  3AKA A;  1V1G A;  1CM1 A;  2M9G A;  1B8R A;  3Q8I A;  2Y1N A;  3EVU A;  2E6W A;  2L50 A;  3ICB A;  1FI5 A;  1A75 A;  3D77 A;  1L2O B;  1ZUZ A;  2LVV A;  5IBW A;  1A03 A;  1UHJ A;  1KK8 C;  2L5X B;  1LIN A;  1F4Q A;  2BCB A;  3CR2 A;  3CR4 X;  1CDM A;  2EHB A;  3I5F B;  2JPT A;  3WXA A;  1DJW A;  1DJI A;  2ERB A;  3FIA A;  4MBE A;  4FQT A;  3V2L A;  1W7J B;  4AOM A;  2LMU A;  2ZFD A;  2BBM A;  3BUO B;  1CM4 A;  4MN0 A;  4GGN A;  1J55 A;  1IIO A;  4FTG A;  1WDC C;  3L47 A;  1LKJ A;  4NQG A;  5BPJ A;  1SY9 A;  2GGZ A;  1JBA A;  3D0Y A;  1HT9 A;  1NX1 A;  5PAL A;  4C0K A;  1GGZ A;  2QEO A;  3D74 A;  3FS7 A;  1XO5 A;  3K1E A;  1TCF A;  4E68 A;  2JT3 A;  1W7I B;  3TUY B;  5KU1 A;  1J7P A;  1RRO A;  1SCM B;  2K61 A;  3O4Y A;  2MJW B;  2I7A A;  4MSP A;  3K21 A;  2QEV A;  1JF2 A;  2KYC A;  2I94 A;  4N1F A;  4DIR A;  4QJ3 B;  1YTZ C;  4N1G A;  2KSP A;  2HQW A;  2SAS A;  4GBA A;  4HSZ A;  3TDU A;  2OTG C;  3LCP C;  3GK1 A;  3I5I B;  3LK0 A;  3NHI A;  3DF0 B;  2I2R E;  5HLO A;  3SIB A;  3OHM B;  3D73 A;  4CFR A;  2BEC A;  3CZ0 A;  2ZKM X;  3A8R A;  4GFT A;  3OB2 B;  1ALV A;  3PM8 A;  2KYF A;  1KFU S;  3TS5 B;  1F54 A;  3VRP A;  2K7C A;  3OGN A;  5CSJ A;  5G08 A;  1IH0 A;  1DVI A;  2JU0 A;  2LVK A;  3SG5 A;  1XFW O;  4CFQ A;  2KI4 C;  2M3W A;  3B6X A;  3PFV A;  1S6C A;  4M2P A;  5HKW A;  4CLN A;  3B7A A;  3JTD B;  2A4J A;  2FJY A;  3CZ2 A;  1DGV A;  5CSI A;  3M0W A;  1XFY O;  4INX A;  5JOL A;  1QAT A;  1NCZ A;  3JVT C;  3CS1 A;  4NDD A;  4YGA A;  1UHN A;  5CSN A;  1DJY A;  4MEW A;  2BL0 C;  3QME A;  4YGD B;  1C3Y A;  3BFB A;  1B7T Z;  1CFP A;  2KBM A;  1NIW A;  5D69 A;  4N5X A;  5FI6 A;  3L4A A;  4Q04 A;  4FQO A;  1TNW A;  1UP5 A;  1K9P A;  2KPH A;  1U5I A;  1D1O A;  1SL9 A;  2TN4 A;  1YX8 A;  2CTN A;  1L7Z A;  2H61 C;  1CMF A;  3LK1 A;  2KQY A;  2MAZ A;  1PSB A;  4WQ3 A;  2P6B B;  1SR6 B;  2KFG A;  1QV1 A;  3MSE B;  1TN4 A;  2D8N A;  1MR8 A;  1UWO A;  3OB1 B;  3R72 A;  1MUX A;  3H4S E;  3VRN A;  3S0D A;  1SKT A;  3HX4 A;  1OQP A;  5DKR A;  3BOW B;  4QJ5 B;  1KWO B;  4DS7 A;  1AHR A;  1J7Q A;  2LLT A;  1AVS A;  1UUS A;  4MVF A;  2KFF A;  3BXK A;  3TDZ A;  3SG7 A;  3VB1 A;  1CDL A;  1TTX A;  3B86 A;  3S0G A;  1N2D A;  1DJG A;  1JFK A;  1EJ3 A;  1QS7 A;  3I5G C;  5KTY A;  1QX2 A;  3BFA A;  2GGM A;  2K7B A;  2NZ0 A;  1C7W A;  3TDI A;  3B87 A;  3SG6 A;  2EC6 C;  2K60 A;  2CNP A;  2KHN A;  1SMG A;  4PE1 A;  2WCL A;  1TIZ A;  1A75 B;  2JZI A;  1SSE B;  1DF0 B;  3IVT A;  1B8C A;  3BOW A;  2M1U A;  1KSO A;  1FBV A;  1SCV A;  2NLN A;  4MRY A;  5AXI A;  3NSL A;  3SJS A;  3IQQ A;  2LNK A;  4MLW A;  4WQ2 A;  4BY5 A;  1N65 A;  1XFX O;  1FPW A;  4YRU A;  3NSI A;  1IQ5 A;  5FI7 A;  3WHT B;  1LVC D;  3I5H B;  3NXA A;  1SW8 A;  1ORG A;  1UHH A;  3CDN A;  3N7H A;  1C07 A;  1S5G Z;  1TCO B;  1K94 A;  4I5N B;  2BCA A;  3FE9 A;  4PHM A;  1QTX A;  2ZN9 A;  2KI6 C;  1CLL A;  1RWY A;  2F2P A;  3DY9 A;  2ISD A;  1DF0 A;  3EK8 A;  4INW A;  1DJH A;  3EK4 A;  3RZS A;  1HQV A;  2HF5 A;  2FCE A;  2PRU A;  3QRX A;  1REC A;  2F33 A;  2LLS A;  2M7L A;  1R6P A;  2OS8 C;  2WCB A;  1KFU L;  3CYZ A;  2V53 A;  5I8N A;  1MXE A;  3CZ1 A;  2LP3 A;  1OMV A;  1S26 D;  2LVJ A;  1J7R A;  1DGU A;  2H61 A;  3O78 A;  1AJ5 A;  1ZAC A;  2E30 A;  2KGB C;  1MF8 B;  5AEQ A;  1TUJ A;  1XFR A;  1LXF C;  1Z4H A;  2LV7 A;  3AKB A;  1PVB A;  1TNX A;  3RM1 A;  1WLZ A;  2LUC A;  2CCM A;  1K95 A;  1LS8 A;  1KSM A;  3PN7 B;  1J7O A;  1CB1 A;  4AQJ A;  1F8H A;  1K90 D;  4I5J A;  1CKK A;  4GGF A;  1M45 A;  2BE4 A;  2P70 A;  4AQI A;  1KQM B;  4DCK A;  1JF0 A;  1C7V A;  3D10 A;  1Y1A A;  2M29 A;  4YGC B;  3KO0 A;  4PE4 A;  5FYX A;  3CAB A;  2KAX A;  1NUB A;  1BT6 A;  2JC2 A;  1B8L A;  1GJY A;  3BYA A;  3KEV A;  2RGI A;  1QX7 A;  1PSR A;  1JFJ A;  2BNX A;  4ZCU A;  3SS4 A;  1WRK A;  1EG3 A;  2EGD A;  3DVJ A;  3EVR A;  1ODB A;  2PAS A;  4ORB B;  4WRI A;  3BFH A;  3KF9 A;  2LMT A;  2G2B A;  2GTE A;  2BAP A;  1OE9 B;  5TNC A;  1S6I A;  3DVM A;  1RTP 1;  2JQ6 A;  2KLD A;  2WC8 A;  3DZT A;  2HQ8 A;  2KAY A;  2MRD A;  2KI6 D;  1UHK A;  2K2A A;  1X02 A;  2F8P A;  1ALW A;  2QPT A;  3E3R A;  1KK8 B;  1U5I B;  2KDH A;  1JC2 A;  4CID A;  3SS3 A;  1OOG A;  2M49 B;  5DIC A;  1K9K A;  1RFJ A;  1OMR A;  2JTZ A;  2KOT A;  2LCP A;  2LM5 A;  1RJV A;  2MBX A;  2BBN A;  4C0L A;  1SL7 A;  1B1G A;  3OP0 A;  1IWQ A;  1G33 A;  1KK7 Z;  2K2F A;  3R1V A;  4PE7 A;  5AFP A;  2B1U A;  2LVI A;  3VRQ A;  1WDC B;  2WOR A;  1CTR A;  1DTL A;  1QVI Y;  2FJU B;  3O2P A;  2COL B;  4PAL A;  4MZL A;  4CPV A;  1Y1U A;  3GK4 X;  5DKN A;  3UO9 A;  1CFD A;  1DEL A;  2F2O A;  2CBL A;  2JXC A;  2LAP A;  2AUC A;  2WCK A;  4BY4 A;  3VGO A;  4OKH A;  1BMO A;  4XYN A;  3HCM A;  1CFC A;  4ZCV A;  2HET A;  1YR5 A;  2QAC A;  4OR9 B;  3C1V A;  4GPL B;  3O4X A;  4YGE B;  4JPZ B;  4F7F A;  1NYA A;  4DUQ A;  2OTG B;  5I2L A;  1DC1 A;  2H8V A;  3IF7 A;  3CGA A;  4USL A;  4OV2 A;  1SNL A;  4HRE E;  3EK7 A;  3AAK A;  2Q91 A;  3OX5 A;  4YI9 A;  2WOS A;  2O5G A;  2YGU A;  3LLE A;  1S36 A;  2FOT A;  1PUL A;  1YRT B;  2L98 A;  2PSR A;  5HLV A;  1Y0V H;  1QJT A;  2JPO A;  2KFH A;  2VRG A;  3NHT A;  4PHK A;  2KI4 B;  4XJK B;  1S3P A;  4PE0 A;  2M7N A;  1OOJ A;  4R1E A;  3WHU B;  1EL4 A;  2WCH A;  3CTN A;  3EVV A;  1Y6W A;  1YUU A;  1AJ4 A;  3A4U B;  5I2Q A;  4ICB A;  2AMI A;  2PMY A;  2Y5I A;  2PAL A;  1YUT A;  4MZK A;  4GNK B;  2WCE A;  5B8I B;  1GM0 A;  2LUX A;  3JVT B;  5I94 A;  2F3Y A;  1CLM A;  1OMD A;  2O60 A;  2K0J A;  2L2C A;  1L2O C;  2BL0 B;  1AK8 A;  4YI8 A;  1IG5 A;  1JUO A;  1NSH A;  1WLM A;  1Q80 A;  3PSR A;  1XFU O;  3DVK A;  1YRU B;  1R2U A;  1DQE A;  1BOD A;  3I5F C;  2KNE A;  1IGV A;  2JOJ A;  4P2Y B;  4XJK A;  2MLF C;  1KFX S;  1CDP A;  1QAS A;  3ZWH A;  2LHL A;  3AAJ A;  5K89 A;  1AUI B;  2K7D A;  1KCY A;  1OW4 A;  3NSO A;  1BF5 A;  3BUM B;  1NCY A;  1J1D A;  2KLE A;  2JXL A;  4D1E A;  1PRW A;  1MXL C;  1TRF A;  1TWO A;  4ETO A;  1BOC A;  2BKI B;  2ZN8 A;  3TUY C;  4I5L B;  1SCM C;  3L4L A;  2GV5 A;  2KAV A;  1QV0 A;  1SRA A;  3F45 A;  2L5Y A;  2L0P A;  5EL2 A;  3SG4 A;  2WC5 A;  1NX3 A;  3I5G B;  1PK0 D;  1QLS A;  3PJI A;  1XA5 A;  2F3Z A;  2HPS A;  4A4B A;  1PVA A;  2K7O A;  3O6B A;  1K93 D;  2EC6 B;  1BR1 B;  1NPQ A;  1OZO A;  3SG3 A;  4ORC B;  2LMV A;  4NDB A;  1LA3 A;  1IQ3 A;  5F6T A;  2BE6 A;  3ZNI A;  4YBH B;  3VRR A;  1DT7 B;  2FCD A;  3DXL A;  2NXQ A;  3OX6 A;  2IS9 A;  1MQ1 A;  1B7T Y;  4QJ4 B;  1GGW A;  1BU3 A;  3TS5 C;  1M63 B;  2H2K A;  1B9A A;  1G8I A;  3DD4 A;  1FF1 A;  2LLU A;  1K2H A;  1OOF A;  1W9Z A;  1PAL A;  2CT9 A;  1S6J A;  3D76 A;  1YUR A;  5FI2 A;  3GOF A;  1SBJ A;  5I2O A;  1CNP A;  3BJH A;  1FW4 A;  3JTD C;  3PLF B;  1XK4 C;  2WCF A;  3PAT A;  1DEK A;  1B47 A;  1A4P A;  1C3Z A;  2Y4Q A;  1TUZ A;  4IL1 A;  3S0F A;  3LL8 B;  1BLQ A;  3PAL A;  1S1E A;  1UHI A;  1M31 A;  3OBV A;  1G4Y R;  1RK9 A;  1CFF A;  2PQL A;  1NWD A;  5AER A;  1EXR A;  5ER4 X;  2OPO A;  5HYD A;  1QIV A;  1IRJ A;  2MLE C;  1A29 A;  5D3O A;  1M39 A;  1SYM A;  2OS8 B;  2JTT A;  2QEB A;  4ORA B;  1Z2C B;  2M97 A;  2NCP A;  1K8U A;  1Y1X A;  1TOP A;  4OZD A;  2L4H A;  3BUX B;  5HKY A;  3CR5 X;  2JUL A;  3KHE A;  2Y1M A;  1SR6 C;  1ZMZ A;  3TZ1 A;  1IJ6 A;  3FE8 A;  1N0Y A;  4PHN A;  2M8U A;  2ZNE A;  4GAO A;  5JJG A;  1IKU A;  1MHO A;  4YGB B;  2NCO A;  2CXJ A;  1QXP A;  2QDI A;  2K8M B;  4IJ7 A;  4TNC A;  1KWO C;  1CLB A;  3D75 A;  3EKH A;  4KYN A;  1KQV A;  1FI6 A;  1K9U A;  1XFV O;  2KBI A;  1H8B A;  1ZFS A;  4JWQ A;  3BUN B;  3CLN A;  4F0Z B;  1OOI X;  2WND A;  3EG5 B;  4GUK A;  2JRF A;  2LP2 A;  2LE9 B;  1NCX A;  5KSZ A;  1CMG A;  1SK6 D;  1S5G Y;  1VRK A;  1LA0 A;  2Q4U A;  1E8A A;  1KFX L;  1XFZ O;  2LAN A;  4C0J A;  1JSA A;  3DF0 A;  1NX2 A;  2P71 A;  1BG1 A;  3NGV A;  3B88 A;  3BQ3 A;  3CZT X;  1YX7 A;  2L2E A;  3EKJ A;  2JNF A;  2WC6 A;  1NP8 A;  3PM2 A;  4PT1 A;  3FWC A;  1GQM A;  1QIW A;  1XYD A;  5D7F A;  1DMO A;  1JWD A;  5CSF A;  2I18 A;  2KQ6 A;  5HKZ A;  1YVH A;  2QEH A;  2WCJ A;  5HL1 A;  2G9B A;  4PDZ A;  4UPG A;  4PHJ A;  3BUW B;  3SIA A;  3UNW A;  3CWG A;  3I5H C;  3VRO A;  3D78 A;  1CDN A;  1QLK A;  4I5K A;  1XK4 A;  1WY9 A;  3GK2 A;  1YVL A;  1T14 A;  2JNX A;  4M2O A;  1OOH A;  1YUS A;  4JQ0 D;  1F55 A;  3RLZ A;  3DYE A;  3S0B A;  2ZRS A;  2L51 A;  1F71 A;  4GGF C;  1V1F A;  2ZRT A;  1SL8 A;  3KPX A;  2M1K B; 
#chains in the Genus database with same CATH homology
 3FWB A;  1IJ5 A;  5J3X A;  2LHI A;  4OCI A;  1BJF A;  2AAO A;  2KGR A;  4PCW A;  1WRL A;  1OZS A;  4P5O E;  1NX0 A;  2JWW A;  1OSA A;  5AAN A;  4MRX A;  2DOQ A;  1A2X A;  1ZOT B;  4MZJ A;  1SPY A;  2MHH A;  3SG2 A;  4U8D A;  1BR4 B;  1TNP A;  1UUR A;  2MA2 A;  2R2I A;  1XVJ A;  3WNX B;  1F70 A;  2JT8 A;  4OVN F;  4HRG A;  1QVI Z;  3PN7 C;  4M2Q A;  2LC5 A;  4NDC A;  5DKQ A;  1M46 A;  1DJX A;  4DRW A;  1H4B A;  1KQM C;  1DJZ A;  3NSK A;  1MWN A;  1F4O A;  4A4C A;  1TNQ A;  2ZND A;  4L9M A;  5GQQ C;  4HRH A;  1QX5 B;  1EG4 A;  1WRZ A;  2BKH B;  2JT0 A;  1KK7 Y;  5ER5 A;  2L4I A;  2SCP A;  5CPV A;  3I5I C;  3IQO A;  1AP4 A;  3D0Y B;  1B4C A;  3DVE A;  2PVB A;  1EH2 A;  1J1E A;  2BCX A;  1K96 A;  2M0R A;  3AKA A;  1V1G A;  1CM1 A;  2M9G A;  1B8R A;  1FI5 A;  2Y1N A;  3EVU A;  2E6W A;  2L50 A;  3ICB A;  1A75 A;  1L2O B;  1ZUZ A;  2LVV A;  5IBW A;  1A03 A;  1UHJ A;  1KK8 C;  2L5X B;  1LIN A;  1F4Q A;  2BCB A;  3CR2 A;  3CR4 X;  1CDM A;  2EHB A;  3I5F B;  2JPT A;  3WXA A;  1DJW A;  1DJI A;  3FIA A;  4MBE A;  4AOM A;  1W7J B;  2LMU A;  2ZFD A;  2BBM A;  3BUO B;  1CM4 A;  4MN0 A;  4GGN A;  1J55 A;  4FTG A;  1WDC C;  1LKJ A;  4NQG A;  5BPJ A;  1SY9 A;  2GGZ A;  1JBA A;  3D0Y A;  1HT9 A;  1NX1 A;  5PAL A;  4C0K A;  1GGZ A;  3FS7 A;  1XO5 A;  4E68 A;  1TCF A;  2JT3 A;  1W7I B;  3TUY B;  5KU1 A;  1J7P A;  1RRO A;  1SCM B;  2K61 A;  3O4Y A;  2MJW B;  2I7A A;  4MSP A;  3K21 A;  1JF2 A;  2KYC A;  2I94 A;  4N1F A;  4DIR A;  4QJ3 B;  1YTZ C;  4N1G A;  2KSP A;  2HQW A;  2SAS A;  4GBA A;  4HSZ A;  3TDU A;  2OTG C;  3LCP C;  3GK1 A;  3I5I B;  3LK0 A;  3DF0 B;  2I2R E;  5HLO A;  3SIB A;  3OHM B;  4CFR A;  2BEC A;  2ZKM X;  3A8R A;  4GFT A;  3OB2 B;  1ALV A;  3PM8 A;  2KYF A;  1KFU S;  3TS5 B;  1F54 A;  3VRP A;  2K7C A;  1IH0 A;  5CSJ A;  5G08 A;  1DVI A;  2JU0 A;  2LVK A;  3SG5 A;  1XFW O;  4CFQ A;  2KI4 C;  2M3W A;  3PFV A;  1S6C A;  4M2P A;  5HKW A;  4CLN A;  3JTD B;  2A4J A;  1DGV A;  5CSI A;  3M0W A;  1XFY O;  5JOL A;  1QAT A;  1NCZ A;  3JVT C;  3CS1 A;  4NDD A;  4YGA A;  1UHN A;  5CSN A;  1DJY A;  4MEW A;  2BL0 C;  4YGD B;  1CFP A;  1B7T Z;  2KBM A;  1NIW A;  5D69 A;  4N5X A;  4Q04 A;  4FQO A;  1TNW A;  1UP5 A;  1K9P A;  1U5I A;  1D1O A;  1SL9 A;  2TN4 A;  1YX8 A;  2CTN A;  1L7Z A;  2H61 C;  1CMF A;  3LK1 A;  2KQY A;  2MAZ A;  1PSB A;  4WQ3 A;  2P6B B;  1SR6 B;  2KFG A;  1QV1 A;  3MSE B;  1TN4 A;  2D8N A;  1MR8 A;  1UWO A;  3OB1 B;  1MUX A;  3H4S E;  3VRN A;  1SKT A;  3HX4 A;  1OQP A;  5DKR A;  3BOW B;  4QJ5 B;  1KWO B;  4DS7 A;  1AHR A;  1J7Q A;  2LLT A;  1AVS A;  1UUS A;  4MVF A;  2KFF A;  3BXK A;  3TDZ A;  3SG7 A;  1CDL A;  1TTX A;  1N2D A;  1DJG A;  1JFK A;  1EJ3 A;  1QS7 A;  3I5G C;  5KTY A;  1QX2 A;  2GGM A;  2K7B A;  2NZ0 A;  1C7W A;  3TDI A;  3SG6 A;  2EC6 C;  2CNP A;  2KHN A;  1SMG A;  4PE1 A;  1TIZ A;  1A75 B;  2JZI A;  1DF0 B;  1B8C A;  3BOW A;  2M1U A;  1KSO A;  1FBV A;  1SCV A;  2NLN A;  4MRY A;  5AXI A;  3NSL A;  3SJS A;  3IQQ A;  2LNK A;  4MLW A;  4WQ2 A;  4BY5 A;  1N65 A;  1XFX O;  1FPW A;  4YRU A;  3NSI A;  1IQ5 A;  3WHT B;  1LVC D;  3I5H B;  3NXA A;  1SW8 A;  1UHH A;  1C07 A;  1S5G Z;  1TCO B;  1K94 A;  4I5N B;  2BCA A;  4PHM A;  1QTX A;  2ZN9 A;  2KI6 C;  1CLL A;  1RWY A;  2F2P A;  2ISD A;  1DF0 A;  3EK8 A;  1DJH A;  3EK4 A;  1HQV A;  2HF5 A;  2FCE A;  2PRU A;  3QRX A;  1REC A;  2F33 A;  2LLS A;  2M7L A;  1R6P A;  2OS8 C;  2WCB A;  1KFU L;  2V53 A;  5I8N A;  1MXE A;  2LP3 A;  1OMV A;  1S26 D;  2LVJ A;  1J7R A;  1DGU A;  2H61 A;  3O78 A;  1AJ5 A;  1ZAC A;  2E30 A;  2KGB C;  1MF8 B;  5AEQ A;  1LXF C;  2LV7 A;  3AKB A;  1PVB A;  1TNX A;  3RM1 A;  1WLZ A;  2LUC A;  2CCM A;  1K95 A;  3PN7 B;  1KSM A;  1J7O A;  1CB1 A;  4AQJ A;  1F8H A;  1K90 D;  4I5J A;  1CKK A;  4GGF A;  1M45 A;  2BE4 A;  4AQI A;  1KQM B;  4DCK A;  1JF0 A;  1C7V A;  3D10 A;  1Y1A A;  2M29 A;  4YGC B;  3KO0 A;  4PE4 A;  5FYX A;  2KAX A;  1NUB A;  1BT6 A;  2JC2 A;  1B8L A;  1GJY A;  3BYA A;  3KEV A;  2RGI A;  1QX7 A;  1PSR A;  1JFJ A;  4ZCU A;  1WRK A;  1EG3 A;  2EGD A;  3DVJ A;  3EVR A;  1ODB A;  2PAS A;  4ORB B;  4WRI A;  3KF9 A;  2LMT A;  2G2B A;  1OE9 B;  5TNC A;  1S6I A;  3DVM A;  1RTP 1;  2JQ6 A;  2WC8 A;  2HQ8 A;  2KAY A;  2MRD A;  2KI6 D;  1UHK A;  2K2A A;  1X02 A;  2F8P A;  1ALW A;  2QPT A;  3E3R A;  1KK8 B;  1U5I B;  2KDH A;  1JC2 A;  4CID A;  2M49 B;  1K9K A;  1RFJ A;  1OMR A;  2JTZ A;  2KOT A;  2LCP A;  2LM5 A;  1RJV A;  2MBX A;  2BBN A;  4C0L A;  1SL7 A;  1B1G A;  3OP0 A;  1IWQ A;  1G33 A;  1KK7 Z;  2K2F A;  4PE7 A;  5AFP A;  2B1U A;  2LVI A;  3VRQ A;  1WDC B;  2WOR A;  1CTR A;  1DTL A;  1QVI Y;  2FJU B;  3O2P A;  2COL B;  4PAL A;  4MZL A;  4CPV A;  1Y1U A;  3GK4 X;  5DKN A;  1CFD A;  2F2O A;  2CBL A;  2JXC A;  2LAP A;  2AUC A;  4BY4 A;  3VGO A;  4OKH A;  1BMO A;  4XYN A;  3HCM A;  1CFC A;  4ZCV A;  2HET A;  1YR5 A;  2QAC A;  4OR9 B;  3C1V A;  4GPL B;  4YGE B;  4JPZ B;  1NYA A;  4DUQ A;  2OTG B;  5I2L A;  3IF7 A;  3CGA A;  4USL A;  4OV2 A;  1SNL A;  4HRE E;  3EK7 A;  3AAK A;  2Q91 A;  3OX5 A;  4YI9 A;  2WOS A;  2O5G A;  3LLE A;  1S36 A;  2FOT A;  1PUL A;  1YRT B;  2L98 A;  2PSR A;  5HLV A;  1Y0V H;  1QJT A;  2VRG A;  2KFH A;  4PHK A;  4XJK B;  2KI4 B;  1S3P A;  4PE0 A;  2M7N A;  1OOJ A;  4R1E A;  3WHU B;  1EL4 A;  3CTN A;  3EVV A;  1Y6W A;  1YUU A;  1AJ4 A;  3A4U B;  5I2Q A;  4ICB A;  2AMI A;  2PMY A;  2Y5I A;  2PAL A;  1YUT A;  4MZK A;  4GNK B;  2WCE A;  5B8I B;  2LUX A;  3JVT B;  2F3Y A;  1CLM A;  1OMD A;  2O60 A;  2K0J A;  1L2O C;  2BL0 B;  1AK8 A;  4YI8 A;  1IG5 A;  1JUO A;  1NSH A;  1WLM A;  1Q80 A;  3PSR A;  1XFU O;  3DVK A;  1YRU B;  1R2U A;  1BOD A;  3I5F C;  2KNE A;  1IGV A;  2JOJ A;  4P2Y B;  4XJK A;  2MLF C;  1KFX S;  1CDP A;  1QAS A;  3ZWH A;  2LHL A;  3AAJ A;  5K89 A;  1AUI B;  2K7D A;  1KCY A;  3NSO A;  1BF5 A;  3BUM B;  1NCY A;  1J1D A;  4D1E A;  2JXL A;  1PRW A;  1MXL C;  1TRF A;  4ETO A;  1BOC A;  2BKI B;  2ZN8 A;  3TUY C;  4I5L B;  1SCM C;  2GV5 A;  2KAV A;  1QV0 A;  1SRA A;  3F45 A;  3SG4 A;  2L0P A;  1NX3 A;  3I5G B;  1PK0 D;  1QLS A;  1XA5 A;  2F3Z A;  2HPS A;  4A4B A;  1PVA A;  2K7O A;  3O6B A;  1K93 D;  2EC6 B;  1BR1 B;  1NPQ A;  1OZO A;  3SG3 A;  4ORC B;  2LMV A;  4NDB A;  1LA3 A;  1IQ3 A;  5F6T A;  2BE6 A;  3ZNI A;  4YBH B;  3VRR A;  1DT7 B;  2FCD A;  2NXQ A;  3OX6 A;  2IS9 A;  1MQ1 A;  1B7T Y;  4QJ4 B;  1GGW A;  1BU3 A;  3TS5 C;  1M63 B;  2H2K A;  1B9A A;  1G8I A;  3DD4 A;  1FF1 A;  2LLU A;  1K2H A;  1PAL A;  2CT9 A;  1S6J A;  1YUR A;  3GOF A;  1SBJ A;  5I2O A;  1CNP A;  1FW4 A;  3JTD C;  3PLF B;  1XK4 C;  2WCF A;  3PAT A;  1B47 A;  1A4P A;  2Y4Q A;  4IL1 A;  3LL8 B;  1BLQ A;  3PAL A;  1S1E A;  1UHI A;  1M31 A;  1G4Y R;  1RK9 A;  1CFF A;  1NWD A;  5AER A;  1EXR A;  5ER4 X;  2OPO A;  5HYD A;  1QIV A;  1IRJ A;  2MLE C;  1A29 A;  1M39 A;  1SYM A;  2OS8 B;  2JTT A;  4ORA B;  2M97 A;  2NCP A;  1K8U A;  1Y1X A;  1TOP A;  2L4H A;  3BUX B;  5HKY A;  3CR5 X;  2JUL A;  3KHE A;  2Y1M A;  1SR6 C;  1ZMZ A;  3TZ1 A;  1IJ6 A;  4PHN A;  1N0Y A;  2M8U A;  2ZNE A;  4GAO A;  5JJG A;  1IKU A;  1MHO A;  4YGB B;  2NCO A;  2CXJ A;  1QXP A;  2K8M B;  4TNC A;  1KWO C;  1CLB A;  3EKH A;  1KQV A;  1FI6 A;  1K9U A;  1XFV O;  2KBI A;  1H8B A;  1ZFS A;  4JWQ A;  3BUN B;  3CLN A;  4F0Z B;  2WND A;  4GUK A;  2JRF A;  2LP2 A;  2LE9 B;  1NCX A;  5KSZ A;  1CMG A;  1SK6 D;  1S5G Y;  1VRK A;  1LA0 A;  2Q4U A;  1E8A A;  1KFX L;  1XFZ O;  2LAN A;  4C0J A;  1JSA A;  3DF0 A;  1NX2 A;  1BG1 A;  3BQ3 A;  3EKJ A;  3CZT X;  1YX7 A;  2L2E A;  2JNF A;  1NP8 A;  3FWC A;  1GQM A;  1QIW A;  1XYD A;  5D7F A;  1DMO A;  1JWD A;  5CSF A;  2I18 A;  2KQ6 A;  5HKZ A;  1YVH A;  2G9B A;  4PDZ A;  4UPG A;  4PHJ A;  3BUW B;  3SIA A;  3CWG A;  3I5H C;  3VRO A;  1CDN A;  1QLK A;  4I5K A;  1XK4 A;  1WY9 A;  3GK2 A;  1YVL A;  2JNX A;  4M2O A;  1YUS A;  1F55 A;  4JQ0 D;  3RLZ A;  2ZRS A;  2L51 A;  1F71 A;  4GGF C;  1V1F A;  2ZRT A;  1SL8 A;  3KPX A;  2M1K B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...