4XJKB

Crystal structure of mn(ii) ca(ii) na(i) bound calprotectin
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
108
structure length
108
Chain Sequence
b'KMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A8
publication title Manganese Binding Properties of Human Calprotectin under Conditions of High and Low Calcium: X-ray Crystallographic and Advanced Electron Paramagnetic Resonance Spectroscopic Analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 40
structure length 108
sequence length 108
chains with identical sequence D, F, H, J
ec nomenclature
pdb deposition date 2015-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4xjkB00
2BCXA 2JNFA 2JZIA 5HKZA 4YRUA 5KU1A 4PDZA 1DT7B 1UHJA 3FWBA 4NDBA 1SL7A 2K7DA 3JVTC 4U8DA 1KSOA 2FOTA 2LAPA 2NCPA 3JVTB 4YGCB 2GGMA 1BG1A 3CR4X 1FI6A 2BCBA 2F8PA 3C1VA 2I18A 2L0PA 3VRNA 5DKQA 4YGAA 3LK1A 2JTZA 1S36A 1WRLA 2KI6C 1JBAA 4CFRA 2OS8B 5AEQA 1J7OA 4MVFA 1LVCD 1RFJA 1PVAA 5KTYA 5G08A 1KQMC 1IGVA 3BUOB 4YI8A 2PALA 1W7JB 2IS9A 2KI6D 5JJGA 3O4YA 4P2YB 4ICBA 2WNDA 1NYAA 3HX4A 4USLA 1FBVA 1QX2A 1S3PA 2KBMA 2LANA 2LC5A 4DS7A 1FPWA 4CPVA 1IJ6A 1CDPA 1F54A 1KK7Y 4N1FA 1WRZA 5HLVA 1YX8A 2KDHA 2P6BB 1CDLA 1KK8C 2M1KB 1SBJA 2V53A 4OVNF 2G9BA 3KEVA 1JSAA 1N65A 2OTGC 1QV1A 2EHBA 3WHUB 3LLEA 2HPSA 1DGVA 2WCEA 1YUSA 4HREE 1G4YR 1IWQA 5AANA 1YUUA 4UPGA 1ODBA 2LCPA 1CLBA 2CCMA 1CFCA 1SK6D 1S5GZ 1KFUS 1B47A 3DF0B 3EVVA 1NX0A 3CR2A 2BBNA 2AMIA 2WCFA 5K89A 4OR9B 1NSHA 3DVEA 3LCPC 3GOFA 2K8MB 3PFVA 1KQVA 1YVHA 3I5GC 2L5XB 2F2PA 2LP2A 2NXQA 4MSPA 5CSNA 3KO0A 3NSKA 4YGBB 2HQWA 3AAJA 2BE4A 5D7FA 5HLOA 3TDUA 1OOJA 2K7BA 1K2HA 4ORCB 3OB2B 3DD4A 1CLMA 2KAXA 5DKNA 1IKUA 1XFVO 1C7VA 1EJ3A 1RJVA 1KFXL 4C0JA 1SR6B 2F2OA 2M0RA 4GGFA 4XJKA 3BUWB 3BXKA 3PN7C 1CFDA 3TDIA 2ZRTA 1CM1A 4PE0A 1LINA 2LNKA 4GGNA 1OZOA 2Q91A 1UWOA 2MA2A 1S6CA 5IBWA 3PALA 2I94A 4M2QA 1TNQA 1NX3A 2JXLA 4PALA 1XYDA 1DJYA 1BR4B 2KFHA 3QRXA 1AJ5A 2NCOA 1QLSA 1RTP1 1EL4A 1M63B 4OCIA 5DKRA 1L7ZA 1CLLA 1M45A 5I8NA 1PULA 1JFKA 1M39A 2MHHA 1Y1XA 2NZ0A 2M29A 4JPZB 4R1EA 1YTZC 1UHKA 1A75A 1OQPA 1F8HA 3AKBA 5FYXA 1UHHA 4YI9A 3KF9A 1B1GA 2KI4C 3RM1A 1MR8A 4M2OA 4AQIA 3NSIA 1L2OC 1WRKA 1IG5A 1ZMZA 1CKKA 1NPQA 1Y1AA 1BLQA 4F0ZB 1ZFSA 3CR5X 1L2OB 2K61A 2MLFC 3DVKA 1J7PA 3D0YB 2K2AA 4GFTA 3FIAA 4GGFC 1BJFA 2H2KA 2O5GA 3TDZA 4XYNA 4ETOA 2KFGA 2LUXA 1GGWA 1KSMA 1SCVA 1SW8A 2JT3A 4CFQA 3WHTB 1AJ4A 5HKYA 1J55A 4OKHA 3IQOA 1DJIA 1ALVA 1SMGA 1NCYA 3ICBA 1KFXS 1R2UA 1WLMA 2KQ6A 4GBAA 1A4PA 4PHNA 1J7RA 1DVIA 3WNXB 4CIDA 2R2IA 2KNEA 1F71A 2RGIA 1AHRA 1D1OA 1KWOB 1NUBA 3K21A 3EKJA 2KFFA 2EC6C 2KHNA 2OS8C 2BCAA 2LVVA 1K8UA 3JTDB 4I5JA 2LVJA 2EC6B 1B7TY 3NXAA 1G33A 2DOQA 1IH0A 2L4HA 1AVSA 3EK8A 5I2LA 3SIAA 3H4SE 1UUSA 2COLB 2FCDA 3D10A 2O60A 1KCYA 1XVJA 1RECA 3LL8B 2M8UA 2HQ8A 2WOSA 1VRKA 3I5HC 2LLUA 2SASA 3MSEB 2M3WA 1OSAA 3KHEA 1GQMA 2MBXA 1LXFC 1RROA 1OZSA 1PSBA 3I5HB 1NP8A 1XFWO 1XO5A 2F33A 1QATA 1BODA 3PM8A 5I2OA 4D1EA 1QTXA 1BF5A 4WQ3A 5CSFA 2CNPA 1S6JA 3VRRA 1DJGA 1QXPA 1QV0A 1NCXA 4I5LB 1C07A 2M1UA 2ZN8A 1K9KA 1QASA 1PVBA 3I5FB 1K9PA 1EG3A 3PLFB 4DRWA 3KPXA 2AAOA 1BMOA 1YURA 2LLSA 1B8LA 1JF0A 3CZTX 1KK7Z 3FS7A 1XFUO 2K0JA 4NQGA 2LUCA 1QX5B 3DVJA 4PE4A 5ER5A 4AQJA 2LMTA 1A03A 3BUNB 1S1EA 4QJ4B 2BKHB 1B8CA 2SCPA 5F6TA 2M49B 1LA3A 2PVBA 3BOWB 3TZ1A 3SIBA 4NDCA 3SG5A 4AOMA 2B1UA 3NSLA 4HRGA 5B8IB 2LMUA 1ZUZA 1JF2A 4GPLB 3BQ3A 1C7WA 1K9UA 2FJUB 2KQYA 1SR6C 3D0YA 1JUOA 2MLEC 1DGUA 3BUMB 2JOJA 2OPOA 3WXAA 2H61C 1YX7A 1TCOB 1EXRA 1WDCB 4OV2A 5D69A 1CB1A 3A8RA 3AKAA 1IQ3A 3RLZA 2Y5IA 1UHNA 1OE9B 2M97A 3ZNIA 1PALA 4YGDB 3I5IB 2NLNA 1UHIA 2JU0A 2LVIA 2M7NA 1HQVA 2KYFA 3OP0A 1K93D 2PASA 4MN0A 3TS5B 1YUTA 3BUXB 1UP5A 2JPTA 2AUCA 1U5IB 2Y1NA 1BR1B 2JQ6A 3EK7A 4I5KA 2A4JA 1QVIY 4M2PA 1YR5A 4BY4A 1NX2A 3SJSA 2JNXA 1DF0B 4FTGA 3FWCA 3ZWHA 2L51A 2CT9A 1TNWA 4MRYA 1Q80A 2KOTA 2KYCA 2PMYA 1M31A 1EG4A 1EH2A 1V1GA 3O2PA 3CS1A 2BL0C 2LVKA 2PSRA 2WCBA 4PHMA 5GQQC 1BU3A 3EVRA 1SL8A 1S26D 2GV5A 2BL0B 2KGBC 1CM4A 3NSOA 1W7IB 1MHOA 2ZKMX 4ORAB 1PSRA 5I2QA 2E30A 2F3YA 1K90D 4IL1A 4TNCA 5ER4X 4A4BA 4CLNA 2LP3A 3VRPA 2L2EA 5CSIA 2JTTA 1QIWA 1DJZA 1OMDA 3VROA 3PATA 2BE6A 4ZCVA 4MBEA 3SG7A 1XFZO 1E8AA 2ISDA 5HKWA 1KWOC 2ZNEA 2F3ZA 1OMRA 2CBLA 3IQQA 1YVLA 2I7AA 3DF0A 3JTDC 1TNPA 1IRJA 1J1EA 4I5NB 4GAOA 2LLTA 2LV7A 1OMVA 1SRAA 1IJ5A 3TUYB 2JC2A 3BOWA 2HF5A 1CMGA 1TCFA 4Q04A 1BT6A 1H8BA 3EKHA 1WLZA 3E3RA 2JXCA 2TN4A 1DMOA 3CTNA 4N5XA 1NWDA 1SYMA 4ORBB 1H4BA 2L98A 2KAYA 2D8NA 1UURA 1B7TZ 3SG3A 1YRTB 5JOLA 3CGAA 4P5OE 2JT8A 4DIRA 2PRUA 2VRGA 1SCMC 3A4UB 2H61A 3I5FC 1DJXA 1SNLA 1MF8B 2Q4UA 1RK9A 2JRFA 1A75B 5J3XA 2CXJA 1SCMB 1X02A 4HSZA 1CDMA 4ZCUA 1CTRA 1AK8A 3GK2A 3AAKA 1KQMB 1J1DA 1QIVA 2LE9B 1U5IA 1SL9A 2ZRSA 1B9AA 4PHKA 1JFJA 3EVUA 3GK4X 1BOCA 4FQOA 2L4IA 2M9GA 4DUQA 3OHMB 1G8IA 1QLKA 3O78A 1DF0A 1TN4A 1MWNA 1XK4C 2K7CA 1S5GY 2FCEA 2KGRA 2L50A 1CFFA 1F70A 3O6BA 1TOPA 1LKJA 1SY9A 2LHLA 1B4CA 4YGEB 4BY5A 1AP4A 4GNKB 1KK8B 2BKIB 3OX6A 2KAVA 3PSRA 1MXEA 1RWYA 2Y1MA 1TRFA 2OTGB 3IF7A 1M46A 1K94A 2JWWA 1TIZA 3CWGA 1DJWA 1QS7A 3CLNA 1ZACA 3SG4A 1J7QA 4C0LA 3F45A 1JWDA 1WDCC 3M0WA 4JWQA 4PE1A 3HCMA 1WY9A 2M7LA 2MJWB 4N1GA 5CPVA 1YRUB 3EK4A 3OB1B 3VRQA 5BPJA 1IQ5A 1FI5A 3I5IC 1XFXO 1TTXA 2JT0A 3SG6A 5AFPA 4WRIA 4L9MA 4QJ3B 2WC8A 1K96A 1LA0A 5AXIA 3I5GB 3TS5C 2Y4QA 2I2RE 2MRDA 1MQ1A 4JQ0D 1S6IA 2K2FA 1F4QA 2K7OA 2QACA 3BYAA 4NDDA 1K95A 5TNCA 1CDNA 2ZN9A 1FF1A 2LM5A 1SKTA 4DCKA 5AERA 1AUIB 1MUXA 1F4OA 3VGOA 1QJTA 1QX7A 1F55A 5PALA 1ZOTB 4MZLA 4E68A 1FW4A 2BBMA 1A29A 2JULA 2KSPA 1HT9A 3SG2A 1JC2A 3PN7B 1V1FA 4HRHA 1B8RA 1Y0VH 1NIWA 2MAZA 5KSZA 2CTNA 4PCWA 3GK1A 5CSJA 1GGZA 1QVIZ 1A2XA 4MZJA 2WORA 1NCZA 2E6WA 4MEWA 2EGDA 2HETA 5HYDA 1Y1UA 4PHJA 3OX5A 1N0YA 2LMVA 4PE7A 2ZFDA 1CNPA 1Y6WA 1XA5A 2KBIA 1NX1A 1CFPA 4A4CA 4YBHB 4QJ5B 4MRXA 1MXLC 1ALWA 2KI4B 1XFYO 4GUKA 2QPTA 1R6PA 3TUYC 4MLWA 2LHIA 4MZKA 4C0KA 4WQ2A 1DTLA 2BECA 1N2DA 2ZNDA 4XJKB 2G2BA 1DJHA 1GJYA 2GGZA 1PK0D 1CMFA 1SPYA 3DVMA 1XK4A 1KFUL 3LK0A 1PRWA 1TNXA
chains in the Genus database with same CATH superfamily
2BCXA 2JNFA 2JZIA 5HKZA 4YRUA 5KU1A 3B6XA 4PDZA 1UHJA 1DT7B 3FWBA 4NDBA 1SL7A 2K7DA 3JVTC 4U8DA 1KSOA 2FOTA 2LAPA 1TUZA 1XFRA 2FJYA 2NCPA 3JVTB 4YGCB 2GGMA 1BG1A 3CR4X 1FI6A 2BCBA 3D74A 2F8PA 3C1VA 2H8VA 2I18A 2L0PA 1ORGA 3VRNA 5DKQA 4YGAA 3LK1A 2JTZA 1S36A 1WRLA 2KI6C 1JBAA 3FE8A 4CFRA 2OS8B 5AEQA 1J7OA 1T14A 4MVFA 1LVCD 1RFJA 1PVAA 5KTYA 5G08A 1KQMC 1IGVA 3BUOB 4YI8A 2PALA 4PT1A 1W7JB 2IS9A 2KI6D 5JJGA 3O4YA 4P2YB 4ICBA 2WNDA 1NYAA 3HX4A 4USLA 1FBVA 1QX2A 1S3PA 2KBMA 2LANA 2LC5A 4DS7A 1FPWA 4CPVA 1IJ6A 1CDPA 1F54A 1OOHA 3R1OA 1KK7Y 4N1FA 1WRZA 5HLVA 1DEKA 1YX8A 2L2CA 2KDHA 2P6BB 1CDLA 1C3ZA 1KK8C 2M1KB 1SBJA 2V53A 4JD9A 4OVNF 2G9BA 3KEVA 1JSAA 1N65A 2OTGC 1QV1A 2EHBA 3OBVA 3WHUB 3LLEA 2HPSA 1DGVA 3NHTA 3PJIA 2WCEA 1YUSA 4HREE 1G4YR 1IWQA 5AANA 1YUUA 4UPGA 1ODBA 2LCPA 1CLBA 2CCMA 1CFCA 1SK6D 1S5GZ 1KFUS 1B47A 3BJHA 3DF0B 1NX0A 3EVVA 3CR2A 2BBNA 2AMIA 2WCFA 5K89A 4OR9B 1NSHA 3DVEA 3LCPC 3GOFA 2K8MB 3PFVA 1KQVA 3NGVA 1YVHA 3I5GC 3D73A 2L5XB 2F2PA 2LP2A 2NXQA 4MSPA 5CSNA 3KO0A 3NSKA 4YGBB 2HQWA 3AAJA 2BE4A 5D7FA 5HLOA 3TDUA 1OOJA 2K7BA 1K2HA 2WCJA 4ORCB 3OB2B 3DD4A 1CLMA 2KAXA 5DKNA 1IKUA 1XFVO 1C7VA 1EJ3A 1RJVA 1KFXL 4C0JA 1SR6B 2F2OA 2M0RA 4GGFA 4XJKA 3BUWB 3FE6A 3BXKA 3PN7C 1CFDA 3SS5A 3TDIA 2ZRTA 1CM1A 4KYNA 4PE0A 1LINA 2LNKA 4GGNA 3S0GA 3D78A 1OZOA 2ERBA 2BNXA 2Q91A 3NHIA 1UWOA 2MA2A 1S6CA 5IBWA 3PALA 2I94A 4M2QA 1TNQA 1NX3A 2JXLA 4PALA 1XYDA 1DJYA 1BR4B 1TWOA 2KFHA 3QRXA 5EL2A 1AJ5A 2NCOA 5HL1A 1QLSA 1RTP1 1EL4A 1M63B 4OCIA 5DKRA 1L7ZA 1CLLA 1M45A 5DICA 5I8NA 1PULA 1JFKA 1M39A 2MHHA 1Y1XA 2NZ0A 2M29A 4JPZB 4R1EA 1YTZC 1UHKA 1A75A 1OOGA 1OQPA 1F8HA 3AKBA 2K60A 1UHHA 4YI9A 5FYXA 3KF9A 1B1GA 2KI4C 2WCHA 3RM1A 1MR8A 4M2OA 4AQIA 3CZ0A 3NSIA 1L2OC 1WRKA 1IG5A 1ZMZA 1CKKA 1NPQA 1Y1AA 1BLQA 4F0ZB 1ZFSA 3CR5X 1L2OB 2K61A 2MLFC 3DVKA 1DC1A 1J7PA 1GM0A 3D0YB 2K2AA 4GFTA 3FIAA 4GGFC 1BJFA 2H2KA 2O5GA 3TDZA 4XYNA 4ETOA 2KFGA 2LUXA 3B7AA 1OOIX 3DY9A 1GGWA 1DQEA 1KSMA 1SCVA 1SW8A 2JT3A 2QEHA 4CFQA 3WHTB 3QMEA 1AJ4A 5HKYA 1J55A 4OKHA 1SSEB 3IQOA 1DJIA 1ALVA 1SMGA 1NCYA 3ICBA 1KFXS 1R2UA 1WLMA 2KQ6A 4GBAA 1A4PA 2QEVA 1J7RA 1DVIA 4PHNA 3WNXB 2R2IA 4CIDA 2KNEA 1F71A 2RGIA 1AHRA 1D1OA 1KWOB 3UO9A 1NUBA 3K21A 3EKJA 2KFFA 2EC6C 2KHNA 3DZTA 2OS8C 2BCAA 2LVVA 1K8UA 3JTDB 4I5JA 2LVJA 2EC6B 1B7TY 3NXAA 1G33A 3RZSA 3L4AA 2DOQA 1IH0A 2L4HA 1AVSA 3EK8A 5I2LA 3SIAA 3H4SE 1UUSA 2COLB 2JPOA 2FCDA 3D10A 2O60A 3D75A 1KCYA 1XVJA 1RECA 3LL8B 2M8UA 2HQ8A 2WOSA 1VRKA 3I5HC 2LLUA 2SASA 3MSEB 2M3WA 1OSAA 3KHEA 1W9ZA 2QEOA 1GQMA 2MBXA 1LXFC 1RROA 1OZSA 1PSBA 3I5HB 1NP8A 1XFWO 1XO5A 2F33A 1QATA 3CABA 1BODA 3PM8A 5I2OA 4D1EA 1QTXA 1BF5A 3S0BA 4WQ3A 5CSFA 2CNPA 1S6JA 3VRRA 1DJGA 1QXPA 1QV0A 1NCXA 4I5LB 1C07A 2M1UA 2ZN8A 1K9KA 1QASA 3SS4A 1PVBA 3I5FB 1K9PA 1EG3A 3PLFB 4DRWA 3KPXA 2AAOA 1BMOA 1YURA 2LLSA 1B8LA 1JF0A 3CZTX 1KK7Z 3FS7A 1XFUO 2K0JA 4NQGA 2LUCA 1QX5B 3DVJA 4PE4A 5ER5A 2PQLA 2QEBA 4AQJA 2LMTA 1A03A 3BUNB 1S1EA 4QJ4B 2BKHB 1B8CA 2SCPA 5F6TA 2M49B 1LA3A 2PVBA 3BOWB 3TZ1A 3SIBA 4NDCA 3SG5A 2QDIA 4AOMA 2B1UA 2WCMA 3NSLA 3CZ2A 4HRGA 3IVTA 5B8IB 2LMUA 1ZUZA 1JF2A 4GPLB 3BQ3A 1C7WA 1K9UA 2FJUB 2KQYA 4FQTA 1SR6C 3D0YA 1JUOA 2MLEC 3DXLA 1DGUA 3BUMB 2JOJA 2OPOA 3WXAA 2H61C 1YX7A 1TCOB 1EXRA 1WDCB 4OV2A 5D69A 1CB1A 3A8RA 3AKAA 1IQ3A 3RLZA 2Y5IA 3R1PA 1UHNA 1OE9B 2M97A 3ZNIA 1PALA 3CDNA 4YGDB 3D77A 2NLNA 3I5IB 1UHIA 2JU0A 2LVIA 2M7NA 1HQVA 2KYFA 2WCKA 3OP0A 4I5NB 4INWA 1K93D 2PASA 4MN0A 3L4LA 1YUTA 3BUXB 1UP5A 2JPTA 3TS5B 2AUCA 1U5IB 2Y1NA 1BR1B 2JQ6A 3CYZA 3EK7A 4I5KA 2A4JA 1QVIY 3PM2A 4M2PA 1YR5A 4BY4A 1NX2A 3VB1A 3D76A 3SJSA 2JNXA 1DF0B 4FTGA 3FWCA 3ZWHA 2L51A 2CT9A 1TNWA 4MRYA 1Q80A 2KOTA 2KYCA 2PMYA 1M31A 2KLDA 1EG4A 1EH2A 3DYEA 1V1GA 3O2PA 3CS1A 2BL0C 2LVKA 2PSRA 2WCBA 4PHMA 5GQQC 1BU3A 3EVRA 1SL8A 3B86A 1S26D 2KPHA 2GV5A 2BL0B 2KGBC 1CM4A 3NSOA 1W7IB 1MHOA 2ZKMX 4ORAB 1PSRA 5I2QA 2E30A 2F3YA 1K90D 3EG5B 4IL1A 4TNCA 3BFBA 5ER4X 4A4BA 4CLNA 2LP3A 3VRPA 2L2EA 5CSIA 2JTTA 1QIWA 1DJZA 1OMDA 3VROA 3PATA 2BE6A 4ZCVA 4MBEA 3SG7A 1XFZO 1E8AA 2ISDA 5HKWA 1KWOC 2ZNEA 2F3ZA 1OMRA 2CBLA 3IQQA 1YVLA 2I7AA 3DF0A 3JTDC 1TNPA 1IRJA 1J1EA 2P70A 3N7HA 2LLTA 2LV7A 1OMVA 1SRAA 4GAOA 5FI6A 3S0FA 1IJ5A 3TUYB 3SS3A 2JC2A 3BOWA 2HF5A 1CMGA 1TCFA 4Q04A 1BT6A 1H8BA 3EKHA 1WLZA 3E3RA 3V2LA 2JXCA 2TN4A 1P28A 1OW4A 1DMOA 3CTNA 5D3OA 4N5XA 1NWDA 3S0DA 1SYMA 4ORBB 1H4BA 2L98A 2KAYA 2D8NA 4OZDA 1UURA 1B7TZ 3SG3A 1YRTB 2GTEA 5JOLA 3CGAA 4P5OE 2JT8A 4DIRA 2PRUA 2VRGA 1SCMC 3A4UB 2H61A 2WC6A 3I5FC 2PYQA 1DJXA 1SNLA 1MF8B 2Q4UA 1RK9A 2JRFA 4IJ7A 1A75B 5J3XA 2CXJA 1SCMB 1X02A 4HSZA 1CDMA 4ZCUA 1CTRA 1AK8A 3GK2A 3AAKA 1KQMB 1J1DA 1QIVA 2LE9B 1U5IA 1SL9A 2ZRSA 1B9AA 4PHKA 1JFJA 3EVUA 3GK4X 3BFHA 1BOCA 4FQOA 2L4IA 2M9GA 4DUQA 3OHMB 1G8IA 1C3YA 1QLKA 3O78A 1DF0A 3FE9A 1TN4A 1MWNA 1XK4C 2YGUA 3B87A 2K7CA 1S5GY 2FCEA 2KGRA 2L50A 4F7FA 1IIOA 1Z4HA 2KLEA 1CFFA 1F70A 3O6BA 1TOPA 5I94A 1LKJA 1SY9A 2LHLA 3CZ1A 1B4CA 4YGEB 2WC5A 3UNWA 4BY5A 1AP4A 4GNKB 1KK8B 2BKIB 3OX6A 1Z2CB 2KAVA 1MXEA 3O4XA 3PSRA 1RWYA 1TUJA 2BAPA 1TRFA 2OTGB 2Y1MA 3IF7A 1M46A 1K94A 2JWWA 1TIZA 3CWGA 1DJWA 1QS7A 3CLNA 1ZACA 3SG4A 1J7QA 4C0LA 3F45A 3S0AA 1JWDA 1WDCC 3M0WA 4JWQA 4PE1A 3HCMA 1WY9A 2M7LA 2MJWB 4N1GA 5CPVA 1YRUB 3EK4A 3OB1B 3VRQA 5BPJA 1IQ5A 1DELA 5FI7A 1FI5A 5FI2A 3I5IC 1XFXO 1TTXA 2JT0A 3SG6A 5AFPA 4WRIA 4L9MA 3S0EA 4QJ3B 2WC8A 1K96A 1LA0A 5AXIA 3I5GB 4JKTA 3TS5C 2P71A 2Y4QA 2I2RE 2MRDA 1MQ1A 4JQ0D 1S6IA 2K2FA 1F4QA 2K7OA 2QACA 3BYAA 4NDDA 1K95A 5TNCA 1CDNA 2ZN9A 3OGNA 2LM5A 1FF1A 1SKTA 4DCKA 1LS8A 5AERA 1AUIB 1MUXA 1F4OA 3VGOA 1QJTA 1QX7A 1F55A 5PALA 1ZOTB 3B88A 4MZLA 4E68A 1FW4A 2BBMA 3L47A 1A29A 2JULA 2KSPA 1HT9A 3SG2A 1JC2A 3PN7B 1V1FA 2WCLA 4HRHA 1B8RA 1Y0VH 1NIWA 2MAZA 5KSZA 2CTNA 4PCWA 3GK1A 5CSJA 2L5YA 1GGZA 1QVIZ 3R72A 1A2XA 4MZJA 2WORA 1NCZA 2E6WA 4MEWA 2EGDA 2HETA 5HYDA 3Q8IA 1Y1UA 4PHJA 3OX5A 1N0YA 2LMVA 4INXA 4PE7A 2ZFDA 1OOFA 1CNPA 1Y6WA 1XA5A 2KBIA 1NX1A 1CFPA 4A4CA 4YBHB 4QJ5B 4MRXA 1MXLC 1ALWA 2KI4B 1XFYO 4GUKA 1QWVA 1R6PA 2QPTA 4MLWA 3TUYC 2LHIA 3BFAA 4MZKA 4C0KA 4WQ2A 1DTLA 3K1EA 2BECA 1N2DA 2ZNDA 4XJKB 2G2BA 1DJHA 1GJYA 2GGZA 1PK0D 1CMFA 1SPYA 3DVMA 1XK4A 1KFUL 3LK0A 3R1VA 1PRWA 1TNXA
chains in the Genus database with same CATH topology
2BCXA 2JNFA 2JZIA 5HKZA 4YRUA 5KU1A 4PDZA 1DT7B 1UHJA 3FWBA 4NDBA 1SL7A 2K7DA 3JVTC 4U8DA 1KSOA 2FOTA 2LAPA 2NCPA 3JVTB 4YGCB 2GGMA 1BG1A 3CR4X 1FI6A 2BCBA 2F8PA 3C1VA 2I18A 2L0PA 3VRNA 5DKQA 4YGAA 3LK1A 2JTZA 1S36A 1WRLA 2KI6C 1JBAA 4CFRA 2OS8B 5AEQA 1J7OA 4MVFA 1LVCD 1RFJA 1PVAA 5KTYA 5G08A 1KQMC 1IGVA 3BUOB 4YI8A 2PALA 1W7JB 2IS9A 2KI6D 5JJGA 3O4YA 4P2YB 4ICBA 2WNDA 1NYAA 3HX4A 4USLA 1FBVA 1QX2A 1S3PA 2KBMA 2LANA 2LC5A 4DS7A 1FPWA 4CPVA 1IJ6A 1CDPA 1F54A 1KK7Y 4N1FA 1WRZA 5HLVA 1YX8A 2KDHA 2P6BB 1CDLA 1KK8C 2M1KB 1SBJA 2V53A 4OVNF 2G9BA 3KEVA 1JSAA 1N65A 2OTGC 1QV1A 2EHBA 3WHUB 3LLEA 2HPSA 1DGVA 2WCEA 1YUSA 4HREE 1G4YR 1IWQA 5AANA 1YUUA 4UPGA 1ODBA 2LCPA 1CLBA 2CCMA 1CFCA 1SK6D 1S5GZ 1KFUS 1B47A 3DF0B 3EVVA 1NX0A 3CR2A 2BBNA 2AMIA 2WCFA 5K89A 4OR9B 1NSHA 3DVEA 3LCPC 3GOFA 2K8MB 3PFVA 1KQVA 1YVHA 3I5GC 2L5XB 2F2PA 2LP2A 2NXQA 4MSPA 5CSNA 3KO0A 3NSKA 4YGBB 2HQWA 3AAJA 2BE4A 5D7FA 5HLOA 3TDUA 1OOJA 2K7BA 1K2HA 4ORCB 3OB2B 3DD4A 1CLMA 2KAXA 5DKNA 1IKUA 1XFVO 1C7VA 1EJ3A 1RJVA 1KFXL 4C0JA 1SR6B 2F2OA 2M0RA 4GGFA 4XJKA 3BUWB 3BXKA 3PN7C 1CFDA 3TDIA 2ZRTA 1CM1A 4PE0A 1LINA 2LNKA 4GGNA 1OZOA 2Q91A 1UWOA 2MA2A 1S6CA 5IBWA 3PALA 2I94A 4M2QA 1TNQA 1NX3A 2JXLA 4PALA 1XYDA 1DJYA 1BR4B 2KFHA 3QRXA 1AJ5A 2NCOA 1QLSA 1RTP1 1EL4A 1M63B 4OCIA 5DKRA 1L7ZA 1CLLA 1M45A 5I8NA 1PULA 1JFKA 1M39A 2MHHA 1Y1XA 2NZ0A 2M29A 4JPZB 4R1EA 1YTZC 1UHKA 1A75A 1OQPA 1F8HA 3AKBA 5FYXA 1UHHA 4YI9A 3KF9A 1B1GA 2KI4C 3RM1A 1MR8A 4M2OA 4AQIA 3NSIA 1L2OC 1WRKA 1IG5A 1ZMZA 1CKKA 1NPQA 1Y1AA 1BLQA 4F0ZB 1ZFSA 3CR5X 1L2OB 2K61A 2MLFC 3DVKA 1J7PA 3D0YB 2K2AA 4GFTA 3FIAA 4GGFC 1BJFA 2H2KA 2O5GA 3TDZA 4XYNA 4ETOA 2KFGA 2LUXA 1GGWA 1KSMA 1SCVA 1SW8A 2JT3A 4CFQA 3WHTB 1AJ4A 5HKYA 1J55A 4OKHA 3IQOA 1DJIA 1ALVA 1SMGA 1NCYA 3ICBA 1KFXS 1R2UA 1WLMA 2KQ6A 4GBAA 1A4PA 4PHNA 1J7RA 1DVIA 3WNXB 4CIDA 2R2IA 2KNEA 1F71A 2RGIA 1AHRA 1D1OA 1KWOB 1NUBA 3K21A 3EKJA 2KFFA 2EC6C 2KHNA 2OS8C 2BCAA 2LVVA 1K8UA 3JTDB 4I5JA 2LVJA 2EC6B 1B7TY 3NXAA 1G33A 2DOQA 1IH0A 2L4HA 1AVSA 3EK8A 5I2LA 3SIAA 3H4SE 1UUSA 2COLB 2FCDA 3D10A 2O60A 1KCYA 1XVJA 1RECA 3LL8B 2M8UA 2HQ8A 2WOSA 1VRKA 3I5HC 2LLUA 2SASA 3MSEB 2M3WA 1OSAA 3KHEA 1GQMA 2MBXA 1LXFC 1RROA 1OZSA 1PSBA 3I5HB 1NP8A 1XFWO 1XO5A 2F33A 1QATA 1BODA 3PM8A 5I2OA 4D1EA 1QTXA 1BF5A 4WQ3A 5CSFA 2CNPA 1S6JA 3VRRA 1DJGA 1QXPA 1QV0A 1NCXA 4I5LB 1C07A 2M1UA 2ZN8A 1K9KA 1QASA 1PVBA 3I5FB 1K9PA 1EG3A 3PLFB 4DRWA 3KPXA 2AAOA 1BMOA 1YURA 2LLSA 1B8LA 1JF0A 3CZTX 1KK7Z 3FS7A 1XFUO 2K0JA 4NQGA 2LUCA 1QX5B 3DVJA 4PE4A 5ER5A 4AQJA 2LMTA 1A03A 3BUNB 1S1EA 4QJ4B 2BKHB 1B8CA 2SCPA 5F6TA 2M49B 1LA3A 2PVBA 3BOWB 3TZ1A 3SIBA 4NDCA 3SG5A 4AOMA 2B1UA 3NSLA 4HRGA 5B8IB 2LMUA 1ZUZA 1JF2A 4GPLB 3BQ3A 1C7WA 1K9UA 2FJUB 2KQYA 1SR6C 3D0YA 1JUOA 2MLEC 1DGUA 3BUMB 2JOJA 2OPOA 3WXAA 2H61C 1YX7A 1TCOB 1EXRA 1WDCB 4OV2A 5D69A 1CB1A 3A8RA 3AKAA 1IQ3A 3RLZA 2Y5IA 1UHNA 1OE9B 2M97A 3ZNIA 1PALA 4YGDB 3I5IB 2NLNA 1UHIA 2JU0A 2LVIA 2M7NA 1HQVA 2KYFA 3OP0A 1K93D 2PASA 4MN0A 3TS5B 1YUTA 3BUXB 1UP5A 2JPTA 2AUCA 1U5IB 2Y1NA 1BR1B 2JQ6A 3EK7A 4I5KA 2A4JA 1QVIY 4M2PA 1YR5A 4BY4A 1NX2A 3SJSA 2JNXA 1DF0B 4FTGA 3FWCA 3ZWHA 2L51A 2CT9A 1TNWA 4MRYA 1Q80A 2KOTA 2KYCA 2PMYA 1M31A 1EG4A 1EH2A 1V1GA 3O2PA 3CS1A 2BL0C 2LVKA 2PSRA 2WCBA 4PHMA 5GQQC 1BU3A 3EVRA 1SL8A 1S26D 2GV5A 2BL0B 2KGBC 1CM4A 3NSOA 1W7IB 1MHOA 2ZKMX 4ORAB 1PSRA 5I2QA 2E30A 2F3YA 1K90D 4IL1A 4TNCA 5ER4X 4A4BA 4CLNA 2LP3A 3VRPA 2L2EA 5CSIA 2JTTA 1QIWA 1DJZA 1OMDA 3VROA 3PATA 2BE6A 4ZCVA 4MBEA 3SG7A 1XFZO 1E8AA 2ISDA 5HKWA 1KWOC 2ZNEA 2F3ZA 1OMRA 2CBLA 3IQQA 1YVLA 2I7AA 3DF0A 3JTDC 1TNPA 1IRJA 1J1EA 4I5NB 4GAOA 2LLTA 2LV7A 1OMVA 1SRAA 1IJ5A 3TUYB 2JC2A 3BOWA 2HF5A 1CMGA 1TCFA 4Q04A 1BT6A 1H8BA 3EKHA 1WLZA 3E3RA 2JXCA 2TN4A 1DMOA 3CTNA 4N5XA 1NWDA 1SYMA 4ORBB 1H4BA 2L98A 2KAYA 2D8NA 1UURA 1B7TZ 3SG3A 1YRTB 5JOLA 3CGAA 4P5OE 2JT8A 4DIRA 2PRUA 2VRGA 1SCMC 3A4UB 2H61A 3I5FC 1DJXA 1SNLA 1MF8B 2Q4UA 1RK9A 2JRFA 1A75B 5J3XA 2CXJA 1SCMB 1X02A 4HSZA 1CDMA 4ZCUA 1CTRA 1AK8A 3GK2A 3AAKA 1KQMB 1J1DA 1QIVA 2LE9B 1U5IA 1SL9A 2ZRSA 1B9AA 4PHKA 1JFJA 3EVUA 3GK4X 1BOCA 4FQOA 2L4IA 2M9GA 4DUQA 3OHMB 1G8IA 1QLKA 3O78A 1DF0A 1TN4A 1MWNA 1XK4C 2K7CA 1S5GY 2FCEA 2KGRA 2L50A 1CFFA 1F70A 3O6BA 1TOPA 1LKJA 1SY9A 2LHLA 1B4CA 4YGEB 4BY5A 1AP4A 4GNKB 1KK8B 2BKIB 3OX6A 2KAVA 3PSRA 1MXEA 1RWYA 2Y1MA 1TRFA 2OTGB 3IF7A 1M46A 1K94A 2JWWA 1TIZA 3CWGA 1DJWA 1QS7A 3CLNA 1ZACA 3SG4A 1J7QA 4C0LA 3F45A 1JWDA 1WDCC 3M0WA 4JWQA 4PE1A 3HCMA 1WY9A 2M7LA 2MJWB 4N1GA 5CPVA 1YRUB 3EK4A 3OB1B 3VRQA 5BPJA 1IQ5A 1FI5A 3I5IC 1XFXO 1TTXA 2JT0A 3SG6A 5AFPA 4WRIA 4L9MA 4QJ3B 2WC8A 1K96A 1LA0A 5AXIA 3I5GB 3TS5C 2Y4QA 2I2RE 2MRDA 1MQ1A 4JQ0D 1S6IA 2K2FA 1F4QA 2K7OA 2QACA 3BYAA 4NDDA 1K95A 5TNCA 1CDNA 2ZN9A 1FF1A 2LM5A 1SKTA 4DCKA 5AERA 1AUIB 1MUXA 1F4OA 3VGOA 1QJTA 1QX7A 1F55A 5PALA 1ZOTB 4MZLA 4E68A 1FW4A 2BBMA 1A29A 2JULA 2KSPA 1HT9A 3SG2A 1JC2A 3PN7B 1V1FA 4HRHA 1B8RA 1Y0VH 1NIWA 2MAZA 5KSZA 2CTNA 4PCWA 3GK1A 5CSJA 1GGZA 1QVIZ 1A2XA 4MZJA 2WORA 1NCZA 2E6WA 4MEWA 2EGDA 2HETA 5HYDA 1Y1UA 4PHJA 3OX5A 1N0YA 2LMVA 4PE7A 2ZFDA 1CNPA 1Y6WA 1XA5A 2KBIA 1NX1A 1CFPA 4A4CA 4YBHB 4QJ5B 4MRXA 1MXLC 1ALWA 2KI4B 1XFYO 4GUKA 2QPTA 1R6PA 3TUYC 4MLWA 2LHIA 4MZKA 4C0KA 4WQ2A 1DTLA 2BECA 1N2DA 2ZNDA 4XJKB 2G2BA 1DJHA 1GJYA 2GGZA 1PK0D 1CMFA 1SPYA 3DVMA 1XK4A 1KFUL 3LK0A 1PRWA 1TNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BCX A;  2JNF A;  2JZI A;  5HKZ A;  4YRU A;  5KU1 A;  4PDZ A;  1DT7 B;  1UHJ A;  3FWB A;  4NDB A;  1SL7 A;  2K7D A;  3JVT C;  4U8D A;  1KSO A;  2FOT A;  2LAP A;  2NCP A;  3JVT B;  4YGC B;  2GGM A;  1BG1 A;  3CR4 X;  1FI6 A;  2BCB A;  2F8P A;  3C1V A;  2I18 A;  2L0P A;  3VRN A;  5DKQ A;  4YGA A;  3LK1 A;  2JTZ A;  1S36 A;  1WRL A;  2KI6 C;  1JBA A;  4CFR A;  2OS8 B;  5AEQ A;  1J7O A;  4MVF A;  1LVC D;  1RFJ A;  1PVA A;  5KTY A;  5G08 A;  1KQM C;  1IGV A;  3BUO B;  4YI8 A;  2PAL A;  1W7J B;  2IS9 A;  2KI6 D;  5JJG A;  3O4Y A;  4P2Y B;  4ICB A;  2WND A;  1NYA A;  3HX4 A;  4USL A;  1FBV A;  1QX2 A;  1S3P A;  2KBM A;  2LAN A;  2LC5 A;  4DS7 A;  1FPW A;  4CPV A;  1IJ6 A;  1CDP A;  1F54 A;  1KK7 Y;  4N1F A;  1WRZ A;  5HLV A;  1YX8 A;  2KDH A;  2P6B B;  1CDL A;  1KK8 C;  2M1K B;  1SBJ A;  2V53 A;  4OVN F;  2G9B A;  3KEV A;  1JSA A;  1N65 A;  2OTG C;  1QV1 A;  2EHB A;  3WHU B;  3LLE A;  2HPS A;  1DGV A;  2WCE A;  1YUS A;  4HRE E;  1G4Y R;  1IWQ A;  5AAN A;  1YUU A;  4UPG A;  1ODB A;  2LCP A;  1CLB A;  2CCM A;  1CFC A;  1SK6 D;  1S5G Z;  1KFU S;  1B47 A;  3DF0 B;  3EVV A;  1NX0 A;  3CR2 A;  2BBN A;  2AMI A;  2WCF A;  5K89 A;  4OR9 B;  1NSH A;  3DVE A;  3LCP C;  3GOF A;  2K8M B;  3PFV A;  1KQV A;  1YVH A;  3I5G C;  2L5X B;  2F2P A;  2LP2 A;  2NXQ A;  4MSP A;  5CSN A;  3KO0 A;  3NSK A;  4YGB B;  2HQW A;  3AAJ A;  2BE4 A;  5D7F A;  5HLO A;  3TDU A;  1OOJ A;  2K7B A;  1K2H A;  4ORC B;  3OB2 B;  3DD4 A;  1CLM A;  2KAX A;  5DKN A;  1IKU A;  1XFV O;  1C7V A;  1EJ3 A;  1RJV A;  1KFX L;  4C0J A;  1SR6 B;  2F2O A;  2M0R A;  4GGF A;  4XJK A;  3BUW B;  3BXK A;  3PN7 C;  1CFD A;  3TDI A;  2ZRT A;  1CM1 A;  4PE0 A;  1LIN A;  2LNK A;  4GGN A;  1OZO A;  2Q91 A;  1UWO A;  2MA2 A;  1S6C A;  5IBW A;  3PAL A;  2I94 A;  4M2Q A;  1TNQ A;  1NX3 A;  2JXL A;  4PAL A;  1XYD A;  1DJY A;  1BR4 B;  2KFH A;  3QRX A;  1AJ5 A;  2NCO A;  1QLS A;  1RTP 1;  1EL4 A;  1M63 B;  4OCI A;  5DKR A;  1L7Z A;  1CLL A;  1M45 A;  5I8N A;  1PUL A;  1JFK A;  1M39 A;  2MHH A;  1Y1X A;  2NZ0 A;  2M29 A;  4JPZ B;  4R1E A;  1YTZ C;  1UHK A;  1A75 A;  1OQP A;  1F8H A;  3AKB A;  5FYX A;  1UHH A;  4YI9 A;  3KF9 A;  1B1G A;  2KI4 C;  3RM1 A;  1MR8 A;  4M2O A;  4AQI A;  3NSI A;  1L2O C;  1WRK A;  1IG5 A;  1ZMZ A;  1CKK A;  1NPQ A;  1Y1A A;  1BLQ A;  4F0Z B;  1ZFS A;  3CR5 X;  1L2O B;  2K61 A;  2MLF C;  3DVK A;  1J7P A;  3D0Y B;  2K2A A;  4GFT A;  3FIA A;  4GGF C;  1BJF A;  2H2K A;  2O5G A;  3TDZ A;  4XYN A;  4ETO A;  2KFG A;  2LUX A;  1GGW A;  1KSM A;  1SCV A;  1SW8 A;  2JT3 A;  4CFQ A;  3WHT B;  1AJ4 A;  5HKY A;  1J55 A;  4OKH A;  3IQO A;  1DJI A;  1ALV A;  1SMG A;  1NCY A;  3ICB A;  1KFX S;  1R2U A;  1WLM A;  2KQ6 A;  4GBA A;  1A4P A;  4PHN A;  1J7R A;  1DVI A;  3WNX B;  4CID A;  2R2I A;  2KNE A;  1F71 A;  2RGI A;  1AHR A;  1D1O A;  1KWO B;  1NUB A;  3K21 A;  3EKJ A;  2KFF A;  2EC6 C;  2KHN A;  2OS8 C;  2BCA A;  2LVV A;  1K8U A;  3JTD B;  4I5J A;  2LVJ A;  2EC6 B;  1B7T Y;  3NXA A;  1G33 A;  2DOQ A;  1IH0 A;  2L4H A;  1AVS A;  3EK8 A;  5I2L A;  3SIA A;  3H4S E;  1UUS A;  2COL B;  2FCD A;  3D10 A;  2O60 A;  1KCY A;  1XVJ A;  1REC A;  3LL8 B;  2M8U A;  2HQ8 A;  2WOS A;  1VRK A;  3I5H C;  2LLU A;  2SAS A;  3MSE B;  2M3W A;  1OSA A;  3KHE A;  1GQM A;  2MBX A;  1LXF C;  1RRO A;  1OZS A;  1PSB A;  3I5H B;  1NP8 A;  1XFW O;  1XO5 A;  2F33 A;  1QAT A;  1BOD A;  3PM8 A;  5I2O A;  4D1E A;  1QTX A;  1BF5 A;  4WQ3 A;  5CSF A;  2CNP A;  1S6J A;  3VRR A;  1DJG A;  1QXP A;  1QV0 A;  1NCX A;  4I5L B;  1C07 A;  2M1U A;  2ZN8 A;  1K9K A;  1QAS A;  1PVB A;  3I5F B;  1K9P A;  1EG3 A;  3PLF B;  4DRW A;  3KPX A;  2AAO A;  1BMO A;  1YUR A;  2LLS A;  1B8L A;  1JF0 A;  3CZT X;  1KK7 Z;  3FS7 A;  1XFU O;  2K0J A;  4NQG A;  2LUC A;  1QX5 B;  3DVJ A;  4PE4 A;  5ER5 A;  4AQJ A;  2LMT A;  1A03 A;  3BUN B;  1S1E A;  4QJ4 B;  2BKH B;  1B8C A;  2SCP A;  5F6T A;  2M49 B;  1LA3 A;  2PVB A;  3BOW B;  3TZ1 A;  3SIB A;  4NDC A;  3SG5 A;  4AOM A;  2B1U A;  3NSL A;  4HRG A;  5B8I B;  2LMU A;  1ZUZ A;  1JF2 A;  4GPL B;  3BQ3 A;  1C7W A;  1K9U A;  2FJU B;  2KQY A;  1SR6 C;  3D0Y A;  1JUO A;  2MLE C;  1DGU A;  3BUM B;  2JOJ A;  2OPO A;  3WXA A;  2H61 C;  1YX7 A;  1TCO B;  1EXR A;  1WDC B;  4OV2 A;  5D69 A;  1CB1 A;  3A8R A;  3AKA A;  1IQ3 A;  3RLZ A;  2Y5I A;  1UHN A;  1OE9 B;  2M97 A;  3ZNI A;  1PAL A;  4YGD B;  3I5I B;  2NLN A;  1UHI A;  2JU0 A;  2LVI A;  2M7N A;  1HQV A;  2KYF A;  3OP0 A;  1K93 D;  2PAS A;  4MN0 A;  3TS5 B;  1YUT A;  3BUX B;  1UP5 A;  2JPT A;  2AUC A;  1U5I B;  2Y1N A;  1BR1 B;  2JQ6 A;  3EK7 A;  4I5K A;  2A4J A;  1QVI Y;  4M2P A;  1YR5 A;  4BY4 A;  1NX2 A;  3SJS A;  2JNX A;  1DF0 B;  4FTG A;  3FWC A;  3ZWH A;  2L51 A;  2CT9 A;  1TNW A;  4MRY A;  1Q80 A;  2KOT A;  2KYC A;  2PMY A;  1M31 A;  1EG4 A;  1EH2 A;  1V1G A;  3O2P A;  3CS1 A;  2BL0 C;  2LVK A;  2PSR A;  2WCB A;  4PHM A;  5GQQ C;  1BU3 A;  3EVR A;  1SL8 A;  1S26 D;  2GV5 A;  2BL0 B;  2KGB C;  1CM4 A;  3NSO A;  1W7I B;  1MHO A;  2ZKM X;  4ORA B;  1PSR A;  5I2Q A;  2E30 A;  2F3Y A;  1K90 D;  4IL1 A;  4TNC A;  5ER4 X;  4A4B A;  4CLN A;  2LP3 A;  3VRP A;  2L2E A;  5CSI A;  2JTT A;  1QIW A;  1DJZ A;  1OMD A;  3VRO A;  3PAT A;  2BE6 A;  4ZCV A;  4MBE A;  3SG7 A;  1XFZ O;  1E8A A;  2ISD A;  5HKW A;  1KWO C;  2ZNE A;  2F3Z A;  1OMR A;  2CBL A;  3IQQ A;  1YVL A;  2I7A A;  3DF0 A;  3JTD C;  1TNP A;  1IRJ A;  1J1E A;  4I5N B;  4GAO A;  2LLT A;  2LV7 A;  1OMV A;  1SRA A;  1IJ5 A;  3TUY B;  2JC2 A;  3BOW A;  2HF5 A;  1CMG A;  1TCF A;  4Q04 A;  1BT6 A;  1H8B A;  3EKH A;  1WLZ A;  3E3R A;  2JXC A;  2TN4 A;  1DMO A;  3CTN A;  4N5X A;  1NWD A;  1SYM A;  4ORB B;  1H4B A;  2L98 A;  2KAY A;  2D8N A;  1UUR A;  1B7T Z;  3SG3 A;  1YRT B;  5JOL A;  3CGA A;  4P5O E;  2JT8 A;  4DIR A;  2PRU A;  2VRG A;  1SCM C;  3A4U B;  2H61 A;  3I5F C;  1DJX A;  1SNL A;  1MF8 B;  2Q4U A;  1RK9 A;  2JRF A;  1A75 B;  5J3X A;  2CXJ A;  1SCM B;  1X02 A;  4HSZ A;  1CDM A;  4ZCU A;  1CTR A;  1AK8 A;  3GK2 A;  3AAK A;  1KQM B;  1J1D A;  1QIV A;  2LE9 B;  1U5I A;  1SL9 A;  2ZRS A;  1B9A A;  4PHK A;  1JFJ A;  3EVU A;  3GK4 X;  1BOC A;  4FQO A;  2L4I A;  2M9G A;  4DUQ A;  3OHM B;  1G8I A;  1QLK A;  3O78 A;  1DF0 A;  1TN4 A;  1MWN A;  1XK4 C;  2K7C A;  1S5G Y;  2FCE A;  2KGR A;  2L50 A;  1CFF A;  1F70 A;  3O6B A;  1TOP A;  1LKJ A;  1SY9 A;  2LHL A;  1B4C A;  4YGE B;  4BY5 A;  1AP4 A;  4GNK B;  1KK8 B;  2BKI B;  3OX6 A;  2KAV A;  3PSR A;  1MXE A;  1RWY A;  2Y1M A;  1TRF A;  2OTG B;  3IF7 A;  1M46 A;  1K94 A;  2JWW A;  1TIZ A;  3CWG A;  1DJW A;  1QS7 A;  3CLN A;  1ZAC A;  3SG4 A;  1J7Q A;  4C0L A;  3F45 A;  1JWD A;  1WDC C;  3M0W A;  4JWQ A;  4PE1 A;  3HCM A;  1WY9 A;  2M7L A;  2MJW B;  4N1G A;  5CPV A;  1YRU B;  3EK4 A;  3OB1 B;  3VRQ A;  5BPJ A;  1IQ5 A;  1FI5 A;  3I5I C;  1XFX O;  1TTX A;  2JT0 A;  3SG6 A;  5AFP A;  4WRI A;  4L9M A;  4QJ3 B;  2WC8 A;  1K96 A;  1LA0 A;  5AXI A;  3I5G B;  3TS5 C;  2Y4Q A;  2I2R E;  2MRD A;  1MQ1 A;  4JQ0 D;  1S6I A;  2K2F A;  1F4Q A;  2K7O A;  2QAC A;  3BYA A;  4NDD A;  1K95 A;  5TNC A;  1CDN A;  2ZN9 A;  1FF1 A;  2LM5 A;  1SKT A;  4DCK A;  5AER A;  1AUI B;  1MUX A;  1F4O A;  3VGO A;  1QJT A;  1QX7 A;  1F55 A;  5PAL A;  1ZOT B;  4MZL A;  4E68 A;  1FW4 A;  2BBM A;  1A29 A;  2JUL A;  2KSP A;  1HT9 A;  3SG2 A;  1JC2 A;  3PN7 B;  1V1F A;  4HRH A;  1B8R A;  1Y0V H;  1NIW A;  2MAZ A;  5KSZ A;  2CTN A;  4PCW A;  3GK1 A;  5CSJ A;  1GGZ A;  1QVI Z;  1A2X A;  4MZJ A;  2WOR A;  1NCZ A;  2E6W A;  4MEW A;  2EGD A;  2HET A;  5HYD A;  1Y1U A;  4PHJ A;  3OX5 A;  1N0Y A;  2LMV A;  4PE7 A;  2ZFD A;  1CNP A;  1Y6W A;  1XA5 A;  2KBI A;  1NX1 A;  1CFP A;  4A4C A;  4YBH B;  4QJ5 B;  4MRX A;  1MXL C;  1ALW A;  2KI4 B;  1XFY O;  4GUK A;  2QPT A;  1R6P A;  3TUY C;  4MLW A;  2LHI A;  4MZK A;  4C0K A;  4WQ2 A;  1DTL A;  2BEC A;  1N2D A;  2ZND A;  4XJK B;  2G2B A;  1DJH A;  1GJY A;  2GGZ A;  1PK0 D;  1CMF A;  1SPY A;  3DVM A;  1XK4 A;  1KFU L;  3LK0 A;  1PRW A;  1TNX A; 
#chains in the Genus database with same CATH topology
 2BCX A;  2JNF A;  2JZI A;  5HKZ A;  4YRU A;  5KU1 A;  3B6X A;  4PDZ A;  1UHJ A;  1DT7 B;  3FWB A;  4NDB A;  1SL7 A;  2K7D A;  3JVT C;  4U8D A;  1KSO A;  2FOT A;  2LAP A;  1TUZ A;  1XFR A;  2FJY A;  2NCP A;  3JVT B;  4YGC B;  2GGM A;  1BG1 A;  3CR4 X;  1FI6 A;  2BCB A;  3D74 A;  2F8P A;  3C1V A;  2H8V A;  2I18 A;  2L0P A;  1ORG A;  3VRN A;  5DKQ A;  4YGA A;  3LK1 A;  2JTZ A;  1S36 A;  1WRL A;  2KI6 C;  1JBA A;  3FE8 A;  4CFR A;  2OS8 B;  5AEQ A;  1J7O A;  1T14 A;  4MVF A;  1LVC D;  1RFJ A;  1PVA A;  5KTY A;  5G08 A;  1KQM C;  1IGV A;  3BUO B;  4YI8 A;  2PAL A;  4PT1 A;  1W7J B;  2IS9 A;  2KI6 D;  5JJG A;  3O4Y A;  4P2Y B;  4ICB A;  2WND A;  1NYA A;  3HX4 A;  4USL A;  1FBV A;  1QX2 A;  1S3P A;  2KBM A;  2LAN A;  2LC5 A;  4DS7 A;  1FPW A;  4CPV A;  1IJ6 A;  1CDP A;  1F54 A;  1OOH A;  3R1O A;  1KK7 Y;  4N1F A;  1WRZ A;  5HLV A;  1DEK A;  1YX8 A;  2L2C A;  2KDH A;  2P6B B;  1CDL A;  1C3Z A;  1KK8 C;  2M1K B;  1SBJ A;  2V53 A;  4JD9 A;  4OVN F;  2G9B A;  3KEV A;  1JSA A;  1N65 A;  2OTG C;  1QV1 A;  2EHB A;  3OBV A;  3WHU B;  3LLE A;  2HPS A;  1DGV A;  3NHT A;  3PJI A;  2WCE A;  1YUS A;  4HRE E;  1G4Y R;  1IWQ A;  5AAN A;  1YUU A;  4UPG A;  1ODB A;  2LCP A;  1CLB A;  2CCM A;  1CFC A;  1SK6 D;  1S5G Z;  1KFU S;  1B47 A;  3BJH A;  3DF0 B;  1NX0 A;  3EVV A;  3CR2 A;  2BBN A;  2AMI A;  2WCF A;  5K89 A;  4OR9 B;  1NSH A;  3DVE A;  3LCP C;  3GOF A;  2K8M B;  3PFV A;  1KQV A;  3NGV A;  1YVH A;  3I5G C;  3D73 A;  2L5X B;  2F2P A;  2LP2 A;  2NXQ A;  4MSP A;  5CSN A;  3KO0 A;  3NSK A;  4YGB B;  2HQW A;  3AAJ A;  2BE4 A;  5D7F A;  5HLO A;  3TDU A;  1OOJ A;  2K7B A;  1K2H A;  2WCJ A;  4ORC B;  3OB2 B;  3DD4 A;  1CLM A;  2KAX A;  5DKN A;  1IKU A;  1XFV O;  1C7V A;  1EJ3 A;  1RJV A;  1KFX L;  4C0J A;  1SR6 B;  2F2O A;  2M0R A;  4GGF A;  4XJK A;  3BUW B;  3FE6 A;  3BXK A;  3PN7 C;  1CFD A;  3SS5 A;  3TDI A;  2ZRT A;  1CM1 A;  4KYN A;  4PE0 A;  1LIN A;  2LNK A;  4GGN A;  3S0G A;  3D78 A;  1OZO A;  2ERB A;  2BNX A;  2Q91 A;  3NHI A;  1UWO A;  2MA2 A;  1S6C A;  5IBW A;  3PAL A;  2I94 A;  4M2Q A;  1TNQ A;  1NX3 A;  2JXL A;  4PAL A;  1XYD A;  1DJY A;  1BR4 B;  1TWO A;  2KFH A;  3QRX A;  5EL2 A;  1AJ5 A;  2NCO A;  5HL1 A;  1QLS A;  1RTP 1;  1EL4 A;  1M63 B;  4OCI A;  5DKR A;  1L7Z A;  1CLL A;  1M45 A;  5DIC A;  5I8N A;  1PUL A;  1JFK A;  1M39 A;  2MHH A;  1Y1X A;  2NZ0 A;  2M29 A;  4JPZ B;  4R1E A;  1YTZ C;  1UHK A;  1A75 A;  1OOG A;  1OQP A;  1F8H A;  3AKB A;  2K60 A;  1UHH A;  4YI9 A;  5FYX A;  3KF9 A;  1B1G A;  2KI4 C;  2WCH A;  3RM1 A;  1MR8 A;  4M2O A;  4AQI A;  3CZ0 A;  3NSI A;  1L2O C;  1WRK A;  1IG5 A;  1ZMZ A;  1CKK A;  1NPQ A;  1Y1A A;  1BLQ A;  4F0Z B;  1ZFS A;  3CR5 X;  1L2O B;  2K61 A;  2MLF C;  3DVK A;  1DC1 A;  1J7P A;  1GM0 A;  3D0Y B;  2K2A A;  4GFT A;  3FIA A;  4GGF C;  1BJF A;  2H2K A;  2O5G A;  3TDZ A;  4XYN A;  4ETO A;  2KFG A;  2LUX A;  3B7A A;  1OOI X;  3DY9 A;  1GGW A;  1DQE A;  1KSM A;  1SCV A;  1SW8 A;  2JT3 A;  2QEH A;  4CFQ A;  3WHT B;  3QME A;  1AJ4 A;  5HKY A;  1J55 A;  4OKH A;  1SSE B;  3IQO A;  1DJI A;  1ALV A;  1SMG A;  1NCY A;  3ICB A;  1KFX S;  1R2U A;  1WLM A;  2KQ6 A;  4GBA A;  1A4P A;  2QEV A;  1J7R A;  1DVI A;  4PHN A;  3WNX B;  2R2I A;  4CID A;  2KNE A;  1F71 A;  2RGI A;  1AHR A;  1D1O A;  1KWO B;  3UO9 A;  1NUB A;  3K21 A;  3EKJ A;  2KFF A;  2EC6 C;  2KHN A;  3DZT A;  2OS8 C;  2BCA A;  2LVV A;  1K8U A;  3JTD B;  4I5J A;  2LVJ A;  2EC6 B;  1B7T Y;  3NXA A;  1G33 A;  3RZS A;  3L4A A;  2DOQ A;  1IH0 A;  2L4H A;  1AVS A;  3EK8 A;  5I2L A;  3SIA A;  3H4S E;  1UUS A;  2COL B;  2JPO A;  2FCD A;  3D10 A;  2O60 A;  3D75 A;  1KCY A;  1XVJ A;  1REC A;  3LL8 B;  2M8U A;  2HQ8 A;  2WOS A;  1VRK A;  3I5H C;  2LLU A;  2SAS A;  3MSE B;  2M3W A;  1OSA A;  3KHE A;  1W9Z A;  2QEO A;  1GQM A;  2MBX A;  1LXF C;  1RRO A;  1OZS A;  1PSB A;  3I5H B;  1NP8 A;  1XFW O;  1XO5 A;  2F33 A;  1QAT A;  3CAB A;  1BOD A;  3PM8 A;  5I2O A;  4D1E A;  1QTX A;  1BF5 A;  3S0B A;  4WQ3 A;  5CSF A;  2CNP A;  1S6J A;  3VRR A;  1DJG A;  1QXP A;  1QV0 A;  1NCX A;  4I5L B;  1C07 A;  2M1U A;  2ZN8 A;  1K9K A;  1QAS A;  3SS4 A;  1PVB A;  3I5F B;  1K9P A;  1EG3 A;  3PLF B;  4DRW A;  3KPX A;  2AAO A;  1BMO A;  1YUR A;  2LLS A;  1B8L A;  1JF0 A;  3CZT X;  1KK7 Z;  3FS7 A;  1XFU O;  2K0J A;  4NQG A;  2LUC A;  1QX5 B;  3DVJ A;  4PE4 A;  5ER5 A;  2PQL A;  2QEB A;  4AQJ A;  2LMT A;  1A03 A;  3BUN B;  1S1E A;  4QJ4 B;  2BKH B;  1B8C A;  2SCP A;  5F6T A;  2M49 B;  1LA3 A;  2PVB A;  3BOW B;  3TZ1 A;  3SIB A;  4NDC A;  3SG5 A;  2QDI A;  4AOM A;  2B1U A;  2WCM A;  3NSL A;  3CZ2 A;  4HRG A;  3IVT A;  5B8I B;  2LMU A;  1ZUZ A;  1JF2 A;  4GPL B;  3BQ3 A;  1C7W A;  1K9U A;  2FJU B;  2KQY A;  4FQT A;  1SR6 C;  3D0Y A;  1JUO A;  2MLE C;  3DXL A;  1DGU A;  3BUM B;  2JOJ A;  2OPO A;  3WXA A;  2H61 C;  1YX7 A;  1TCO B;  1EXR A;  1WDC B;  4OV2 A;  5D69 A;  1CB1 A;  3A8R A;  3AKA A;  1IQ3 A;  3RLZ A;  2Y5I A;  3R1P A;  1UHN A;  1OE9 B;  2M97 A;  3ZNI A;  1PAL A;  3CDN A;  4YGD B;  3D77 A;  2NLN A;  3I5I B;  1UHI A;  2JU0 A;  2LVI A;  2M7N A;  1HQV A;  2KYF A;  2WCK A;  3OP0 A;  4I5N B;  4INW A;  1K93 D;  2PAS A;  4MN0 A;  3L4L A;  1YUT A;  3BUX B;  1UP5 A;  2JPT A;  3TS5 B;  2AUC A;  1U5I B;  2Y1N A;  1BR1 B;  2JQ6 A;  3CYZ A;  3EK7 A;  4I5K A;  2A4J A;  1QVI Y;  3PM2 A;  4M2P A;  1YR5 A;  4BY4 A;  1NX2 A;  3VB1 A;  3D76 A;  3SJS A;  2JNX A;  1DF0 B;  4FTG A;  3FWC A;  3ZWH A;  2L51 A;  2CT9 A;  1TNW A;  4MRY A;  1Q80 A;  2KOT A;  2KYC A;  2PMY A;  1M31 A;  2KLD A;  1EG4 A;  1EH2 A;  3DYE A;  1V1G A;  3O2P A;  3CS1 A;  2BL0 C;  2LVK A;  2PSR A;  2WCB A;  4PHM A;  5GQQ C;  1BU3 A;  3EVR A;  1SL8 A;  3B86 A;  1S26 D;  2KPH A;  2GV5 A;  2BL0 B;  2KGB C;  1CM4 A;  3NSO A;  1W7I B;  1MHO A;  2ZKM X;  4ORA B;  1PSR A;  5I2Q A;  2E30 A;  2F3Y A;  1K90 D;  3EG5 B;  4IL1 A;  4TNC A;  3BFB A;  5ER4 X;  4A4B A;  4CLN A;  2LP3 A;  3VRP A;  2L2E A;  5CSI A;  2JTT A;  1QIW A;  1DJZ A;  1OMD A;  3VRO A;  3PAT A;  2BE6 A;  4ZCV A;  4MBE A;  3SG7 A;  1XFZ O;  1E8A A;  2ISD A;  5HKW A;  1KWO C;  2ZNE A;  2F3Z A;  1OMR A;  2CBL A;  3IQQ A;  1YVL A;  2I7A A;  3DF0 A;  3JTD C;  1TNP A;  1IRJ A;  1J1E A;  2P70 A;  3N7H A;  2LLT A;  2LV7 A;  1OMV A;  1SRA A;  4GAO A;  5FI6 A;  3S0F A;  1IJ5 A;  3TUY B;  3SS3 A;  2JC2 A;  3BOW A;  2HF5 A;  1CMG A;  1TCF A;  4Q04 A;  1BT6 A;  1H8B A;  3EKH A;  1WLZ A;  3E3R A;  3V2L A;  2JXC A;  2TN4 A;  1P28 A;  1OW4 A;  1DMO A;  3CTN A;  5D3O A;  4N5X A;  1NWD A;  3S0D A;  1SYM A;  4ORB B;  1H4B A;  2L98 A;  2KAY A;  2D8N A;  4OZD A;  1UUR A;  1B7T Z;  3SG3 A;  1YRT B;  2GTE A;  5JOL A;  3CGA A;  4P5O E;  2JT8 A;  4DIR A;  2PRU A;  2VRG A;  1SCM C;  3A4U B;  2H61 A;  2WC6 A;  3I5F C;  2PYQ A;  1DJX A;  1SNL A;  1MF8 B;  2Q4U A;  1RK9 A;  2JRF A;  4IJ7 A;  1A75 B;  5J3X A;  2CXJ A;  1SCM B;  1X02 A;  4HSZ A;  1CDM A;  4ZCU A;  1CTR A;  1AK8 A;  3GK2 A;  3AAK A;  1KQM B;  1J1D A;  1QIV A;  2LE9 B;  1U5I A;  1SL9 A;  2ZRS A;  1B9A A;  4PHK A;  1JFJ A;  3EVU A;  3GK4 X;  3BFH A;  1BOC A;  4FQO A;  2L4I A;  2M9G A;  4DUQ A;  3OHM B;  1G8I A;  1C3Y A;  1QLK A;  3O78 A;  1DF0 A;  3FE9 A;  1TN4 A;  1MWN A;  1XK4 C;  2YGU A;  3B87 A;  2K7C A;  1S5G Y;  2FCE A;  2KGR A;  2L50 A;  4F7F A;  1IIO A;  1Z4H A;  2KLE A;  1CFF A;  1F70 A;  3O6B A;  1TOP A;  5I94 A;  1LKJ A;  1SY9 A;  2LHL A;  3CZ1 A;  1B4C A;  4YGE B;  2WC5 A;  3UNW A;  4BY5 A;  1AP4 A;  4GNK B;  1KK8 B;  2BKI B;  3OX6 A;  1Z2C B;  2KAV A;  1MXE A;  3O4X A;  3PSR A;  1RWY A;  1TUJ A;  2BAP A;  1TRF A;  2OTG B;  2Y1M A;  3IF7 A;  1M46 A;  1K94 A;  2JWW A;  1TIZ A;  3CWG A;  1DJW A;  1QS7 A;  3CLN A;  1ZAC A;  3SG4 A;  1J7Q A;  4C0L A;  3F45 A;  3S0A A;  1JWD A;  1WDC C;  3M0W A;  4JWQ A;  4PE1 A;  3HCM A;  1WY9 A;  2M7L A;  2MJW B;  4N1G A;  5CPV A;  1YRU B;  3EK4 A;  3OB1 B;  3VRQ A;  5BPJ A;  1IQ5 A;  1DEL A;  5FI7 A;  1FI5 A;  5FI2 A;  3I5I C;  1XFX O;  1TTX A;  2JT0 A;  3SG6 A;  5AFP A;  4WRI A;  4L9M A;  3S0E A;  4QJ3 B;  2WC8 A;  1K96 A;  1LA0 A;  5AXI A;  3I5G B;  4JKT A;  3TS5 C;  2P71 A;  2Y4Q A;  2I2R E;  2MRD A;  1MQ1 A;  4JQ0 D;  1S6I A;  2K2F A;  1F4Q A;  2K7O A;  2QAC A;  3BYA A;  4NDD A;  1K95 A;  5TNC A;  1CDN A;  2ZN9 A;  3OGN A;  2LM5 A;  1FF1 A;  1SKT A;  4DCK A;  1LS8 A;  5AER A;  1AUI B;  1MUX A;  1F4O A;  3VGO A;  1QJT A;  1QX7 A;  1F55 A;  5PAL A;  1ZOT B;  3B88 A;  4MZL A;  4E68 A;  1FW4 A;  2BBM A;  3L47 A;  1A29 A;  2JUL A;  2KSP A;  1HT9 A;  3SG2 A;  1JC2 A;  3PN7 B;  1V1F A;  2WCL A;  4HRH A;  1B8R A;  1Y0V H;  1NIW A;  2MAZ A;  5KSZ A;  2CTN A;  4PCW A;  3GK1 A;  5CSJ A;  2L5Y A;  1GGZ A;  1QVI Z;  3R72 A;  1A2X A;  4MZJ A;  2WOR A;  1NCZ A;  2E6W A;  4MEW A;  2EGD A;  2HET A;  5HYD A;  3Q8I A;  1Y1U A;  4PHJ A;  3OX5 A;  1N0Y A;  2LMV A;  4INX A;  4PE7 A;  2ZFD A;  1OOF A;  1CNP A;  1Y6W A;  1XA5 A;  2KBI A;  1NX1 A;  1CFP A;  4A4C A;  4YBH B;  4QJ5 B;  4MRX A;  1MXL C;  1ALW A;  2KI4 B;  1XFY O;  4GUK A;  1QWV A;  1R6P A;  2QPT A;  4MLW A;  3TUY C;  2LHI A;  3BFA A;  4MZK A;  4C0K A;  4WQ2 A;  1DTL A;  3K1E A;  2BEC A;  1N2D A;  2ZND A;  4XJK B;  2G2B A;  1DJH A;  1GJY A;  2GGZ A;  1PK0 D;  1CMF A;  1SPY A;  3DVM A;  1XK4 A;  1KFU L;  3LK0 A;  3R1V A;  1PRW A;  1TNX A; 
#chains in the Genus database with same CATH homology
 2BCX A;  2JNF A;  2JZI A;  5HKZ A;  4YRU A;  5KU1 A;  4PDZ A;  1DT7 B;  1UHJ A;  3FWB A;  4NDB A;  1SL7 A;  2K7D A;  3JVT C;  4U8D A;  1KSO A;  2FOT A;  2LAP A;  2NCP A;  3JVT B;  4YGC B;  2GGM A;  1BG1 A;  3CR4 X;  1FI6 A;  2BCB A;  2F8P A;  3C1V A;  2I18 A;  2L0P A;  3VRN A;  5DKQ A;  4YGA A;  3LK1 A;  2JTZ A;  1S36 A;  1WRL A;  2KI6 C;  1JBA A;  4CFR A;  2OS8 B;  5AEQ A;  1J7O A;  4MVF A;  1LVC D;  1RFJ A;  1PVA A;  5KTY A;  5G08 A;  1KQM C;  1IGV A;  3BUO B;  4YI8 A;  2PAL A;  1W7J B;  2IS9 A;  2KI6 D;  5JJG A;  3O4Y A;  4P2Y B;  4ICB A;  2WND A;  1NYA A;  3HX4 A;  4USL A;  1FBV A;  1QX2 A;  1S3P A;  2KBM A;  2LAN A;  2LC5 A;  4DS7 A;  1FPW A;  4CPV A;  1IJ6 A;  1CDP A;  1F54 A;  1KK7 Y;  4N1F A;  1WRZ A;  5HLV A;  1YX8 A;  2KDH A;  2P6B B;  1CDL A;  1KK8 C;  2M1K B;  1SBJ A;  2V53 A;  4OVN F;  2G9B A;  3KEV A;  1JSA A;  1N65 A;  2OTG C;  1QV1 A;  2EHB A;  3WHU B;  3LLE A;  2HPS A;  1DGV A;  2WCE A;  1YUS A;  4HRE E;  1G4Y R;  1IWQ A;  5AAN A;  1YUU A;  4UPG A;  1ODB A;  2LCP A;  1CLB A;  2CCM A;  1CFC A;  1SK6 D;  1S5G Z;  1KFU S;  1B47 A;  3DF0 B;  3EVV A;  1NX0 A;  3CR2 A;  2BBN A;  2AMI A;  2WCF A;  5K89 A;  4OR9 B;  1NSH A;  3DVE A;  3LCP C;  3GOF A;  2K8M B;  3PFV A;  1KQV A;  1YVH A;  3I5G C;  2L5X B;  2F2P A;  2LP2 A;  2NXQ A;  4MSP A;  5CSN A;  3KO0 A;  3NSK A;  4YGB B;  2HQW A;  3AAJ A;  2BE4 A;  5D7F A;  5HLO A;  3TDU A;  1OOJ A;  2K7B A;  1K2H A;  4ORC B;  3OB2 B;  3DD4 A;  1CLM A;  2KAX A;  5DKN A;  1IKU A;  1XFV O;  1C7V A;  1EJ3 A;  1RJV A;  1KFX L;  4C0J A;  1SR6 B;  2F2O A;  2M0R A;  4GGF A;  4XJK A;  3BUW B;  3BXK A;  3PN7 C;  1CFD A;  3TDI A;  2ZRT A;  1CM1 A;  4PE0 A;  1LIN A;  2LNK A;  4GGN A;  1OZO A;  2Q91 A;  1UWO A;  2MA2 A;  1S6C A;  5IBW A;  3PAL A;  2I94 A;  4M2Q A;  1TNQ A;  1NX3 A;  2JXL A;  4PAL A;  1XYD A;  1DJY A;  1BR4 B;  2KFH A;  3QRX A;  1AJ5 A;  2NCO A;  1QLS A;  1RTP 1;  1EL4 A;  1M63 B;  4OCI A;  5DKR A;  1L7Z A;  1CLL A;  1M45 A;  5I8N A;  1PUL A;  1JFK A;  1M39 A;  2MHH A;  1Y1X A;  2NZ0 A;  2M29 A;  4JPZ B;  4R1E A;  1YTZ C;  1UHK A;  1A75 A;  1OQP A;  1F8H A;  3AKB A;  5FYX A;  1UHH A;  4YI9 A;  3KF9 A;  1B1G A;  2KI4 C;  3RM1 A;  1MR8 A;  4M2O A;  4AQI A;  3NSI A;  1L2O C;  1WRK A;  1IG5 A;  1ZMZ A;  1CKK A;  1NPQ A;  1Y1A A;  1BLQ A;  4F0Z B;  1ZFS A;  3CR5 X;  1L2O B;  2K61 A;  2MLF C;  3DVK A;  1J7P A;  3D0Y B;  2K2A A;  4GFT A;  3FIA A;  4GGF C;  1BJF A;  2H2K A;  2O5G A;  3TDZ A;  4XYN A;  4ETO A;  2KFG A;  2LUX A;  1GGW A;  1KSM A;  1SCV A;  1SW8 A;  2JT3 A;  4CFQ A;  3WHT B;  1AJ4 A;  5HKY A;  1J55 A;  4OKH A;  3IQO A;  1DJI A;  1ALV A;  1SMG A;  1NCY A;  3ICB A;  1KFX S;  1R2U A;  1WLM A;  2KQ6 A;  4GBA A;  1A4P A;  4PHN A;  1J7R A;  1DVI A;  3WNX B;  4CID A;  2R2I A;  2KNE A;  1F71 A;  2RGI A;  1AHR A;  1D1O A;  1KWO B;  1NUB A;  3K21 A;  3EKJ A;  2KFF A;  2EC6 C;  2KHN A;  2OS8 C;  2BCA A;  2LVV A;  1K8U A;  3JTD B;  4I5J A;  2LVJ A;  2EC6 B;  1B7T Y;  3NXA A;  1G33 A;  2DOQ A;  1IH0 A;  2L4H A;  1AVS A;  3EK8 A;  5I2L A;  3SIA A;  3H4S E;  1UUS A;  2COL B;  2FCD A;  3D10 A;  2O60 A;  1KCY A;  1XVJ A;  1REC A;  3LL8 B;  2M8U A;  2HQ8 A;  2WOS A;  1VRK A;  3I5H C;  2LLU A;  2SAS A;  3MSE B;  2M3W A;  1OSA A;  3KHE A;  1GQM A;  2MBX A;  1LXF C;  1RRO A;  1OZS A;  1PSB A;  3I5H B;  1NP8 A;  1XFW O;  1XO5 A;  2F33 A;  1QAT A;  1BOD A;  3PM8 A;  5I2O A;  4D1E A;  1QTX A;  1BF5 A;  4WQ3 A;  5CSF A;  2CNP A;  1S6J A;  3VRR A;  1DJG A;  1QXP A;  1QV0 A;  1NCX A;  4I5L B;  1C07 A;  2M1U A;  2ZN8 A;  1K9K A;  1QAS A;  1PVB A;  3I5F B;  1K9P A;  1EG3 A;  3PLF B;  4DRW A;  3KPX A;  2AAO A;  1BMO A;  1YUR A;  2LLS A;  1B8L A;  1JF0 A;  3CZT X;  1KK7 Z;  3FS7 A;  1XFU O;  2K0J A;  4NQG A;  2LUC A;  1QX5 B;  3DVJ A;  4PE4 A;  5ER5 A;  4AQJ A;  2LMT A;  1A03 A;  3BUN B;  1S1E A;  4QJ4 B;  2BKH B;  1B8C A;  2SCP A;  5F6T A;  2M49 B;  1LA3 A;  2PVB A;  3BOW B;  3TZ1 A;  3SIB A;  4NDC A;  3SG5 A;  4AOM A;  2B1U A;  3NSL A;  4HRG A;  5B8I B;  2LMU A;  1ZUZ A;  1JF2 A;  4GPL B;  3BQ3 A;  1C7W A;  1K9U A;  2FJU B;  2KQY A;  1SR6 C;  3D0Y A;  1JUO A;  2MLE C;  1DGU A;  3BUM B;  2JOJ A;  2OPO A;  3WXA A;  2H61 C;  1YX7 A;  1TCO B;  1EXR A;  1WDC B;  4OV2 A;  5D69 A;  1CB1 A;  3A8R A;  3AKA A;  1IQ3 A;  3RLZ A;  2Y5I A;  1UHN A;  1OE9 B;  2M97 A;  3ZNI A;  1PAL A;  4YGD B;  3I5I B;  2NLN A;  1UHI A;  2JU0 A;  2LVI A;  2M7N A;  1HQV A;  2KYF A;  3OP0 A;  1K93 D;  2PAS A;  4MN0 A;  3TS5 B;  1YUT A;  3BUX B;  1UP5 A;  2JPT A;  2AUC A;  1U5I B;  2Y1N A;  1BR1 B;  2JQ6 A;  3EK7 A;  4I5K A;  2A4J A;  1QVI Y;  4M2P A;  1YR5 A;  4BY4 A;  1NX2 A;  3SJS A;  2JNX A;  1DF0 B;  4FTG A;  3FWC A;  3ZWH A;  2L51 A;  2CT9 A;  1TNW A;  4MRY A;  1Q80 A;  2KOT A;  2KYC A;  2PMY A;  1M31 A;  1EG4 A;  1EH2 A;  1V1G A;  3O2P A;  3CS1 A;  2BL0 C;  2LVK A;  2PSR A;  2WCB A;  4PHM A;  5GQQ C;  1BU3 A;  3EVR A;  1SL8 A;  1S26 D;  2GV5 A;  2BL0 B;  2KGB C;  1CM4 A;  3NSO A;  1W7I B;  1MHO A;  2ZKM X;  4ORA B;  1PSR A;  5I2Q A;  2E30 A;  2F3Y A;  1K90 D;  4IL1 A;  4TNC A;  5ER4 X;  4A4B A;  4CLN A;  2LP3 A;  3VRP A;  2L2E A;  5CSI A;  2JTT A;  1QIW A;  1DJZ A;  1OMD A;  3VRO A;  3PAT A;  2BE6 A;  4ZCV A;  4MBE A;  3SG7 A;  1XFZ O;  1E8A A;  2ISD A;  5HKW A;  1KWO C;  2ZNE A;  2F3Z A;  1OMR A;  2CBL A;  3IQQ A;  1YVL A;  2I7A A;  3DF0 A;  3JTD C;  1TNP A;  1IRJ A;  1J1E A;  4I5N B;  4GAO A;  2LLT A;  2LV7 A;  1OMV A;  1SRA A;  1IJ5 A;  3TUY B;  2JC2 A;  3BOW A;  2HF5 A;  1CMG A;  1TCF A;  4Q04 A;  1BT6 A;  1H8B A;  3EKH A;  1WLZ A;  3E3R A;  2JXC A;  2TN4 A;  1DMO A;  3CTN A;  4N5X A;  1NWD A;  1SYM A;  4ORB B;  1H4B A;  2L98 A;  2KAY A;  2D8N A;  1UUR A;  1B7T Z;  3SG3 A;  1YRT B;  5JOL A;  3CGA A;  4P5O E;  2JT8 A;  4DIR A;  2PRU A;  2VRG A;  1SCM C;  3A4U B;  2H61 A;  3I5F C;  1DJX A;  1SNL A;  1MF8 B;  2Q4U A;  1RK9 A;  2JRF A;  1A75 B;  5J3X A;  2CXJ A;  1SCM B;  1X02 A;  4HSZ A;  1CDM A;  4ZCU A;  1CTR A;  1AK8 A;  3GK2 A;  3AAK A;  1KQM B;  1J1D A;  1QIV A;  2LE9 B;  1U5I A;  1SL9 A;  2ZRS A;  1B9A A;  4PHK A;  1JFJ A;  3EVU A;  3GK4 X;  1BOC A;  4FQO A;  2L4I A;  2M9G A;  4DUQ A;  3OHM B;  1G8I A;  1QLK A;  3O78 A;  1DF0 A;  1TN4 A;  1MWN A;  1XK4 C;  2K7C A;  1S5G Y;  2FCE A;  2KGR A;  2L50 A;  1CFF A;  1F70 A;  3O6B A;  1TOP A;  1LKJ A;  1SY9 A;  2LHL A;  1B4C A;  4YGE B;  4BY5 A;  1AP4 A;  4GNK B;  1KK8 B;  2BKI B;  3OX6 A;  2KAV A;  3PSR A;  1MXE A;  1RWY A;  2Y1M A;  1TRF A;  2OTG B;  3IF7 A;  1M46 A;  1K94 A;  2JWW A;  1TIZ A;  3CWG A;  1DJW A;  1QS7 A;  3CLN A;  1ZAC A;  3SG4 A;  1J7Q A;  4C0L A;  3F45 A;  1JWD A;  1WDC C;  3M0W A;  4JWQ A;  4PE1 A;  3HCM A;  1WY9 A;  2M7L A;  2MJW B;  4N1G A;  5CPV A;  1YRU B;  3EK4 A;  3OB1 B;  3VRQ A;  5BPJ A;  1IQ5 A;  1FI5 A;  3I5I C;  1XFX O;  1TTX A;  2JT0 A;  3SG6 A;  5AFP A;  4WRI A;  4L9M A;  4QJ3 B;  2WC8 A;  1K96 A;  1LA0 A;  5AXI A;  3I5G B;  3TS5 C;  2Y4Q A;  2I2R E;  2MRD A;  1MQ1 A;  4JQ0 D;  1S6I A;  2K2F A;  1F4Q A;  2K7O A;  2QAC A;  3BYA A;  4NDD A;  1K95 A;  5TNC A;  1CDN A;  2ZN9 A;  1FF1 A;  2LM5 A;  1SKT A;  4DCK A;  5AER A;  1AUI B;  1MUX A;  1F4O A;  3VGO A;  1QJT A;  1QX7 A;  1F55 A;  5PAL A;  1ZOT B;  4MZL A;  4E68 A;  1FW4 A;  2BBM A;  1A29 A;  2JUL A;  2KSP A;  1HT9 A;  3SG2 A;  1JC2 A;  3PN7 B;  1V1F A;  4HRH A;  1B8R A;  1Y0V H;  1NIW A;  2MAZ A;  5KSZ A;  2CTN A;  4PCW A;  3GK1 A;  5CSJ A;  1GGZ A;  1QVI Z;  1A2X A;  4MZJ A;  2WOR A;  1NCZ A;  2E6W A;  4MEW A;  2EGD A;  2HET A;  5HYD A;  1Y1U A;  4PHJ A;  3OX5 A;  1N0Y A;  2LMV A;  4PE7 A;  2ZFD A;  1CNP A;  1Y6W A;  1XA5 A;  2KBI A;  1NX1 A;  1CFP A;  4A4C A;  4YBH B;  4QJ5 B;  4MRX A;  1MXL C;  1ALW A;  2KI4 B;  1XFY O;  4GUK A;  2QPT A;  1R6P A;  3TUY C;  4MLW A;  2LHI A;  4MZK A;  4C0K A;  4WQ2 A;  1DTL A;  2BEC A;  1N2D A;  2ZND A;  4XJK B;  2G2B A;  1DJH A;  1GJY A;  2GGZ A;  1PK0 D;  1CMF A;  1SPY A;  3DVM A;  1XK4 A;  1KFU L;  3LK0 A;  1PRW A;  1TNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...