4XJKB

Crystal structure of mn(ii) ca(ii) na(i) bound calprotectin
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
108
structure length
108
Chain Sequence
KMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Protein S100-A8
publication title Manganese Binding Properties of Human Calprotectin under Conditions of High and Low Calcium: X-ray Crystallographic and Advanced Electron Paramagnetic Resonance Spectroscopic Analysis.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 108
sequence length 108
chains with identical sequence D, F, H, J
ec nomenclature
pdb deposition date 2015-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4xjkB00
1OE9B 2M3WA 2ZN9A 3TS5B 1IWQA 3I5FB 3TDIA 1JSAA 1ZACA 3CLNA 1KK7Z 1WRKA 3KF9A 1FF1A 4MLWA 3SIBA 3DF0B 5AERA 1F55A 1SCVA 4TNCA 2JQ6A 4MZLA 4YI9A 1FBVA 4R1EA 3OB1B 4MBEA 1XK4C 2M1UA 3SIAA 3WHTB 1F8HA 3I5IC 2JTZA 1UHKA 3FS7A 1CKKA 1CLMA 1JF0A 4GUKA 1AUIB 2M29A 1H8BA 1YUTA 1K2HA 2LVJA 2LLTA 4DIRA 2K7BA 4JQ0D 1QJTA 1IKUA 4PCWA 1SBJA 4WQ2A 2CCMA 2EC6B 2JT3A 1DF0B 4GGNA 4YGCB 2LCPA 2OPOA 1K9PA 2I7AA 2PRUA 1IQ5A 1C07A 4OV2A 4GGFC 2OS8C 5GQQC 1N2DA 1EL4A 1IJ5A 2BE6A 2NXQA 1QV0A 2CTNA 1DGUA 1S5GZ 2BCXA 1R2UA 2G9BA 5CSIA 4ETOA 3VGOA 1XK4A 4GNKB 1CFFA 3D10A 5I2OA 1SL9A 3QRXA 4DCKA 2M9GA 5HKZA 1WY9A 1H4BA 5I2QA 2Y5IA 5CSFA 1MF8B 4CPVA 1K9UA 1K95A 1EXRA 1BODA 1AVSA 1QX5B 3VRRA 3JVTB 3O78A 1CFPA 2JT0A 1CDNA 2TN4A 2L4HA 1SPYA 3O4YA 1B1GA 4MZKA 1M46A 1RJVA 4GGFA 1A75A 2FJUB 3SG3A 5ER4X 4UPGA 3SG4A 3I5GB 1RWYA 3K21A 4N5XA 4P5OE 1RROA 2KGBC 2KI4B 4CIDA 1OZSA 2I94A 1J7OA 2HETA 1S6JA 1PRWA 3AKAA 2NZ0A 3GK1A 3JTDC 1B8LA 4C0LA 1AK8A 1DJXA 1TNWA 1JF2A 1A29A 3RLZA 3DVEA 1OOJA 1QLSA 1SL8A 2HF5A 4HREE 1XFYO 4NDDA 2F2OA 1WDCB 1NYAA 4ORCB 2M7LA 2F33A 3EK8A 1YVHA 2ZRTA 1BF5A 1JUOA 1QX7A 4M2PA 1KFXL 1E8AA 1RFJA 1YTZC 1SCMC 4E68A 3TDUA 2LC5A 1QTXA 2KGRA 1FI6A 2LP3A 1UURA 2BKIB 2OTGB 3ICBA 1UWOA 5HLOA 2K2AA 3O2PA 1K96A 1YUSA 2BCAA 1KQMB 2PASA 1G8IA 2KNEA 4MRYA 3M0WA 4AQIA 1NWDA 1TN4A 2I2RE 4GAOA 5F6TA 1CDLA 1DGVA 1QVIY 2GGMA 3KHEA 4XJKA 1YR5A 3BQ3A 1XFZO 1NX3A 5PALA 1Y0VH 4OCIA 4OVNF 3ZWHA 2JZIA 5CSNA 4OKHA 2KOTA 2PSRA 4BY5A 3DVMA 1S36A 4I5KA 3AKBA 1NCYA 4MZJA 1G33A 3EK7A 2BBNA 2LANA 2E6WA 2AMIA 3OX6A 4YGAA 4M2OA 2CXJA 3AAJA 1UHHA 3EVVA 1FPWA 1MR8A 1L2OC 5DKRA 3BXKA 1BMOA 2EHBA 3D0YB 1GGWA 2K7CA 2LMTA 4CFRA 2MAZA 1M45A 1YX7A 2COLB 2R2IA 4PHJA 4DUQA 2BL0B 1TCOB 2JTTA 1VRKA 2M8UA 1IJ6A 4PHNA 2CBLA 4I5JA 4NDBA 1YRTB 2KFGA 4ZCUA 1F4QA 3O6BA 3TUYB 1YX8A 2Y1NA 1S6IA 1PVAA 1KK8B 2LVIA 1QV1A 3SG7A 1DJZA 1WRLA 1PSBA 1N65A 1OMDA 4PHKA 1JWDA 4AQJA 1SL7A 5JJGA 5HLVA 4A4BA 1M31A 1CDMA 1MXEA 1TNQA 1Y6WA 4YI8A 1CMGA 1AJ5A 3BUWB 1NP8A 2LNKA 5B8IB 1KWOB 5G08A 3CR5X 1MWNA 3SG5A 1B8RA 3FIAA 3CS1A 1Y1XA 4MVFA 4C0JA 5AXIA 4YGDB 2LUCA 1PULA 2K2FA 4XYNA 2VRGA 1K94A 4ORBB 2DOQA 1KSMA 1SR6C 1U5IA 4YGBB 3DVJA 4YGEB 1TTXA 1YUUA 1W7JB 4HRGA 1SK6D 2ZNDA 3AAKA 1BLQA 1XFXO 2ZNEA 1SW8A 1WLZA 3LK1A 2BKHB 1X02A 2AAOA 2O60A 2KQYA 1ODBA 2EGDA 2K7DA 1B7TY 2LM5A 3GK2A 2KYCA 3JTDB 2K7OA 2P6BB 3TS5C 2CNPA 2K8MB 4USLA 1BR1B 1XYDA 1TIZA 2L0PA 1ZOTB 3OHMB 1NX0A 2JU0A 5AEQA 1S1EA 2BBMA 1XO5A 3WNXB 2D8NA 3I5HC 3LLEA 1K8UA 2HQ8A 1DJIA 2LV7A 2K0JA 2SASA 3SG6A 4PE7A 3A4UB 5DKNA 1QATA 4PHMA 4C0KA 1CFDA 3NSKA 4MEWA 1JFJA 5DKQA 2LVVA 1EH2A 1LVCD 5BPJA 1A4PA 1ALWA 1QX2A 4NDCA 3OB2B 1JBAA 2WC8A 1UHNA 2L2EA 3CR4X 1SYMA 1BT6A 1BJFA 1AHRA 2O5GA 1F71A 1WLMA 5K89A 2G2BA 2L5XB 2A4JA 1BR4B 2KYFA 1DTLA 4MRXA 1KK7Y 4PALA 1SKTA 5AANA 5AFPA 3PALA 2KQ6A 1KFUL 2KAXA 1RK9A 2AUCA 2LVKA 3LCPC 2NLNA 4NQGA 5D7FA 1NUBA 2FOTA 1S6CA 2BECA 3PN7C 1YVLA 4GFTA 1DJHA 2NCOA 1A03A 1B47A 2GGZA 1NCZA 1KCYA 3PSRA 2M0RA 1LA0A 5HKYA 1SNLA 2ZFDA 2ZRSA 2IS9A 2LP2A 1ZMZA 1F54A 1MQ1A 4N1GA 2WCEA 2ISDA 2F2PA 1B9AA 1OMVA 2K61A 1B8CA 2LLSA 2PMYA 1U5IB 4MN0A 3RM1A 1KFXS 1S26D 1M39A 2KSPA 1NPQA 1BOCA 3CTNA 3OP0A 2F8PA 1K9KA 3I5GC 2Y4QA 1OZOA 1MXLC 2KI4C 4YBHB 3A8RA 4PE4A 1IH0A 2HQWA 3HX4A 4HRHA 4AOMA 1NIWA 1S5GY 1EJ3A 3I5IB 3IQOA 2E30A 2LHLA 2I18A 5HYDA 1TCFA 1HQVA 1PVBA 2PVBA 1CMFA 2LE9B 3CGAA 1BG1A 1CDPA 2JXLA 1SY9A 3EK4A 1S3PA 3BYAA 3NSLA 2JT8A 2WNDA 3SG2A 2M1KB 1IG5A 1RTP1 5I8NA 1TOPA 3CZTX 2MA2A 1DJGA 5TNCA 1JFKA 2OS8B 1A75B 1C7WA 2JNXA 2KFHA 3MSEB 1SR6B 2MHHA 3SJSA 4Q04A 1TNPA 2OTGC 1CM1A 3FWBA 3OX5A 2JXCA 4U8DA 2HPSA 4N1FA 2KFFA 1OMRA 2M7NA 4JWQA 1NX1A 3KEVA 3WHUB 1XA5A 2JULA 3PLFB 3VRPA 3EVRA 3LL8B 1YURA 4M2QA 1BU3A 1MUXA 2M97A 3C1VA 2JNFA 2L50A 1KSOA 4ZCVA 1GGZA 2V53A 1GJYA 2MLFC 2M49B 4I5LB 4ORAB 2CT9A 1UHJA 4HSZA 1EG4A 1J1EA 3I5HB 5KU1A 2KBIA 3BUXB 4FTGA 1J1DA 1DVIA 2JWWA 4JPZB 1QXPA 1PSRA 2B1UA 3CR2A 2KI6D 1N0YA 1YRUB 2H61C 2LHIA 2FCEA 3TDZA 2RGIA 2QACA 4CFQA 1IRJA 1ZFSA 1XFWO 2BL0C 1QVIZ 5I2LA 5JOLA 2KAVA 2LLUA 3EKHA 4XJKB 1PALA 3I5FC 4BY4A 3TZ1A 3NXAA 2LMUA 1LINA 2MBXA 3VROA 4D1EA 3H4SE 2F3YA 1AP4A 3TUYC 4WQ3A 1AJ4A 1Q80A 1F4OA 1KK8C 1L7ZA 2LAPA 3FWCA 4QJ4B 1JC2A 4A4CA 1K93D 1HT9A 3BOWA 5KTYA 3NSOA 1SCMB 1Y1UA 1KWOC 3PN7B 5KSZA 1G4YR 4DRWA 5J3XA 3ZNIA 4OR9B 2MJWB 1B4CA 2KI6C 2H61A 3VRNA 3D0YA 2EC6C 1FI5A 1SRAA 3DD4A 4PE1A 2H2KA 2KHNA 4L9MA 1J55A 3PM8A 1J7QA 4DS7A 3BUNB 5CPVA 4QJ5B 4ICBA 1C7VA 1SMGA 2JPTA 4QJ3B 1F70A 2LMVA 1CB1A 3DF0A 5FYXA 1QIVA 1DT7B 4CLNA 3CWGA 5IBWA 2PALA 3KO0A 2SCPA 1RECA 3PATA 1DJWA 1R6PA 1EG3A 2JOJA 1FW4A 3E3RA 1TRFA 1XFVO 1ZUZA 2WCFA 1XFUO 2WOSA 3LK0A 1NX2A 1OQPA 2KBMA 3GOFA 1K90D 1XVJA 1V1FA 5ER5A 1L2OB 1J7RA 1NCXA 2Q91A 5CSJA 2BCBA 1D1OA 2ZN8A 3JVTC 3WXAA 1J7PA 2WCBA 1DF0A 2L51A 2JRFA 1MHOA 2ZKMX 1KFUS 2L4IA 4IL1A 1UHIA 2KAYA 5D69A 3PFVA 1QASA 2BE4A 1UUSA 4MSPA 1IQ3A 1QIWA 1Y1AA 4FQOA 1B7TZ 4I5NB 3KPXA 3NSIA 4P2YB 5HKWA 2FCDA 3HCMA 3EKJA 2KDHA 1ALVA 3EVUA 2GV5A 1WRZA 2NCPA 1DMOA 1GQMA 1W7IB 1QLKA 4GBAA 1QS7A 1LA3A 3F45A 2MLEC 1WDCC 3BUOB 1KQVA 1CNPA 4GPLB 1A2XA 4WRIA 1IGVA 2MRDA 3BOWB 3GK4X 1NSHA 1UP5A 2LUXA 1CFCA 4YRUA 3IF7A 4PDZA 1V1GA 4F0ZB 2QPTA 1CLBA 1TNXA 1LXFC 1PK0D 3DVKA 2L98A 3IQQA 3BUMB 1CM4A 1CTRA 1M63B 2JC2A 2Y1MA 1KQMC 3VRQA 1DJYA 1LKJA 1OSAA 2WORA 1CLLA 2F3ZA 4PE0A 2Q4UA
chains in the Genus database with same CATH superfamily
1OE9B 2M3WA 2ZN9A 3TS5B 1IWQA 3I5FB 3TDIA 1JSAA 1ZACA 2QDIA 3CLNA 1KK7Z 1WRKA 3KF9A 1FF1A 4MLWA 3SIBA 3DF0B 5AERA 1F55A 1SCVA 4TNCA 2JQ6A 4MZLA 4YI9A 1FBVA 4R1EA 3VB1A 3D75A 3OB1B 4MBEA 1XK4C 2M1UA 3SIAA 3WHTB 3CZ1A 1F8HA 3I5IC 2JTZA 1UHKA 3FS7A 1CKKA 1CLMA 1JF0A 3R72A 1AUIB 2M29A 4GUKA 1YUTA 1H8BA 1K2HA 2LVJA 2LLTA 4DIRA 2K7BA 4JQ0D 1QJTA 1IKUA 3FE8A 4PCWA 1SBJA 4WQ2A 2CCMA 2EC6B 2JT3A 1DF0B 4GGNA 4YGCB 2LCPA 2OPOA 1K9PA 2I7AA 2PRUA 1IQ5A 1C07A 4OV2A 4GGFC 2OS8C 5GQQC 4PT1A 1N2DA 3CZ0A 1EL4A 1IJ5A 2BE6A 1XFRA 2NXQA 1QV0A 4JD9A 2CTNA 1DGUA 1S5GZ 2BCXA 1R2UA 2G9BA 5CSIA 4ETOA 3VGOA 3DXLA 1XK4A 4GNKB 1CFFA 3D10A 5I2OA 1SL9A 3QRXA 4DCKA 1TWOA 2M9GA 5HKZA 1WY9A 3B6XA 1H4BA 5I2QA 2Y5IA 5CSFA 1MF8B 2L5YA 4CPVA 1QWVA 1K9UA 1K95A 1EXRA 1BODA 1AVSA 1QX5B 3VRRA 3JVTB 3O78A 1CFPA 2JT0A 1CDNA 2TN4A 3D78A 2L4HA 1SPYA 3O4YA 1B1GA 4MZKA 1M46A 3BFHA 3UO9A 1RJVA 4GGFA 1A75A 2FJUB 3SG3A 5ER4X 2QEOA 4UPGA 3SG4A 3S0DA 3I5GB 1RWYA 3K21A 3R1PA 4N5XA 4P5OE 5HL1A 1RROA 2KGBC 2KI4B 4CIDA 1OZSA 2I94A 1J7OA 2HETA 1S6JA 1PRWA 1OW4A 3AKAA 2NZ0A 3DZTA 3GK1A 1B8LA 3JTDC 4C0LA 1AK8A 1TUZA 1DJXA 1TNWA 1JF2A 1A29A 3RLZA 3D76A 2FJYA 3DVEA 1OOJA 1QLSA 1SL8A 2HF5A 4HREE 1XFYO 4NDDA 2F2OA 3V2LA 1WDCB 1NYAA 4ORCB 2M7LA 1OOGA 2F33A 3EK8A 1YVHA 3S0AA 2ZRTA 1BF5A 1JUOA 1QX7A 4M2PA 1KFXL 1E8AA 1RFJA 1YTZC 1SCMC 4E68A 3TDUA 2LC5A 1QTXA 2KGRA 2K60A 1FI6A 2LP3A 1UURA 2BKIB 2QEVA 2OTGB 3O4XA 3ICBA 1UWOA 5HLOA 2K2AA 3O2PA 1K96A 1YUSA 2BCAA 1KQMB 2PASA 1G8IA 2KNEA 4MRYA 3M0WA 4AQIA 1NWDA 1TN4A 2I2RE 4GAOA 3UNWA 5F6TA 1CDLA 1DGVA 1QVIY 2GGMA 3KHEA 4XJKA 1YR5A 3BQ3A 1XFZO 1NX3A 5PALA 1Y0VH 4OCIA 4OVNF 4OZDA 2JZIA 5CSNA 3ZWHA 4OKHA 2KOTA 2PSRA 2YGUA 3DVMA 1S36A 4BY5A 4I5KA 3AKBA 1NCYA 3FE9A 4MZJA 1G33A 3EK7A 2BBNA 2LANA 2E6WA 2AMIA 3OX6A 4YGAA 4M2OA 2CXJA 3AAJA 1UHHA 3EVVA 4IJ7A 1FPWA 1MR8A 1L2OC 5DKRA 3BXKA 1BMOA 2EHBA 3D0YB 1GGWA 3EG5B 2K7CA 3N7HA 2LMTA 4CFRA 2MAZA 1M45A 1YX7A 2COLB 2R2IA 4PHJA 4DUQA 2BL0B 1C3YA 1TCOB 2JTTA 1VRKA 2M8UA 1IJ6A 4PHNA 2CBLA 5DICA 3SS3A 4I5JA 4NDBA 1YRTB 2KFGA 4ZCUA 1F4QA 3O6BA 3TUYB 1YX8A 2Y1NA 1S6IA 1LS8A 1PVAA 1KK8B 2LVIA 1QV1A 3SG7A 1DJZA 1DQEA 1WRLA 1PSBA 1N65A 1OMDA 4PHKA 1JWDA 4AQJA 1SL7A 5JJGA 5HLVA 4A4BA 1M31A 1CDMA 1MXEA 1TNQA 1Y6WA 4YI8A 1CMGA 1AJ5A 3BUWB 1NP8A 2LNKA 5B8IB 1KWOB 5G08A 3CR5X 1MWNA 3SG5A 3K1EA 1B8RA 3B88A 1ORGA 3CS1A 3FIAA 1Y1XA 2WCMA 4MVFA 4C0JA 5AXIA 4YGDB 2LUCA 1PULA 2H8VA 2K2FA 3D74A 4XYNA 5D3OA 2VRGA 1K94A 4ORBB 2DOQA 1KSMA 1SR6C 1U5IA 4YGBB 3DVJA 4YGEB 1TTXA 1YUUA 1W7JB 4HRGA 1SK6D 2ZNDA 3AAKA 1BLQA 1XFXO 2ZNEA 3OBVA 1SW8A 1WLZA 3LK1A 2BKHB 1X02A 2AAOA 3CYZA 2O60A 2KQYA 1ODBA 2EGDA 2K7DA 1B7TY 2LM5A 3GK2A 2KYCA 3S0GA 3JTDB 3BFAA 2K7OA 2P6BB 3TS5C 2CNPA 4KYNA 3L47A 2K8MB 4USLA 1BR1B 2PQLA 1XYDA 1TIZA 2L0PA 1ZOTB 3OHMB 1NX0A 2JU0A 3L4LA 1S1EA 5AEQA 2BBMA 1XO5A 3WNXB 2D8NA 3I5HC 2ERBA 3QMEA 3LLEA 1K8UA 2HQ8A 1DJIA 2LV7A 2K0JA 2SASA 3CZ2A 3SG6A 4PE7A 3A4UB 1GM0A 5DKNA 4F7FA 1QATA 4PHMA 4C0KA 1CFDA 3NSKA 3D73A 2PYQA 4MEWA 1JFJA 4INWA 5DKQA 2LVVA 3B87A 1EH2A 1LVCD 1Z4HA 1T14A 5BPJA 1A4PA 1ALWA 1QX2A 4NDCA 3OB2B 1JBAA 2WC8A 1UHNA 2L2EA 3CR4X 1SYMA 1BT6A 2QEHA 2WC5A 1BJFA 1AHRA 3NHIA 2O5GA 1F71A 1WLMA 5K89A 2G2BA 2L5XB 2A4JA 1BR4B 2KYFA 1DTLA 3RZSA 4MRXA 1KK7Y 4PALA 1SKTA 5AANA 5AFPA 3PALA 2KQ6A 1KFUL 2KAXA 1RK9A 2AUCA 2LVKA 3LCPC 2NLNA 4NQGA 5D7FA 1NUBA 2FOTA 1S6CA 2BECA 3PN7C 2BAPA 1YVLA 4GFTA 1DJHA 3S0BA 2NCOA 1A03A 1B47A 2GGZA 1NCZA 1KCYA 3PSRA 2M0RA 1LA0A 5HKYA 1SNLA 2ZFDA 3DY9A 2ZRSA 2IS9A 2LP2A 1ZMZA 1F54A 1MQ1A 4N1GA 2WCEA 2ISDA 2F2PA 2KLDA 1B9AA 1OMVA 2K61A 1B8CA 2LLSA 2PMYA 1U5IB 4MN0A 3Q8IA 3RM1A 3B86A 3PJIA 1KFXS 1S26D 1M39A 2KSPA 1NPQA 1BOCA 3CTNA 3OP0A 2F8PA 1K9KA 3I5GC 2Y4QA 1OZOA 1MXLC 2KI4C 4YBHB 3A8RA 4PE4A 1IH0A 2HQWA 3HX4A 5FI6A 4HRHA 4AOMA 1NIWA 1S5GY 1EJ3A 3I5IB 3IQOA 2E30A 2LHLA 2I18A 5HYDA 1TCFA 1HQVA 1PVBA 2PVBA 1CMFA 2LE9B 3S0EA 3CGAA 1BG1A 1CDPA 2JXLA 1SY9A 4FQTA 3EK4A 1S3PA 3BYAA 3NSLA 2JT8A 2WNDA 3SG2A 2M1KB 1IG5A 1RTP1 5I8NA 1TOPA 3FE6A 2GTEA 2JPOA 2MA2A 3CZTX 1DJGA 5TNCA 1JFKA 2OS8B 1A75B 1C7WA 2JNXA 5EL2A 2KFHA 3MSEB 1SR6B 2MHHA 3PM2A 3SJSA 4Q04A 1TNPA 2OTGC 1CM1A 3FWBA 3OX5A 2JXCA 4U8DA 2HPSA 3D77A 4N1FA 2KFFA 1OMRA 2M7NA 4JWQA 1NX1A 3KEVA 3NGVA 3WHUB 1XA5A 2JULA 3PLFB 3VRPA 3EVRA 3SS5A 2P70A 2KPHA 3LL8B 1YURA 4M2QA 1BU3A 1MUXA 2M97A 3C1VA 2JNFA 2L50A 1KSOA 4ZCVA 1GGZA 2V53A 3L4AA 1GJYA 2MLFC 2M49B 4I5LB 4ORAB 2CT9A 5FI7A 1UHJA 4HSZA 1EG4A 1J1EA 3I5HB 5KU1A 2KBIA 3BUXB 4FTGA 1OOHA 1J1DA 1DVIA 2JWWA 4JPZB 1QXPA 3BFBA 1PSRA 4INXA 2B1UA 3CR2A 2KI6D 1N0YA 1YRUB 2H61C 2LHIA 1Z2CB 3DYEA 2FCEA 3TDZA 2RGIA 1P28A 1OOIX 2QACA 4CFQA 1IRJA 1ZFSA 1XFWO 2BL0C 1QVIZ 5I2LA 5JOLA 2KAVA 2LLUA 3EKHA 4XJKB 2L2CA 1PALA 3I5FC 3NHTA 4BY4A 3TZ1A 3NXAA 2LMUA 1LINA 2MBXA 3VROA 4D1EA 3H4SE 2F3YA 1AP4A 3TUYC 4JKTA 1IIOA 2WCHA 4WQ3A 1AJ4A 1Q80A 1F4OA 1KK8C 1L7ZA 2LAPA 3FWCA 4QJ4B 1JC2A 3SS4A 4A4CA 1C3ZA 1K93D 1HT9A 3BOWA 5KTYA 3NSOA 1SCMB 1Y1UA 1KWOC 3PN7B 5KSZA 1G4YR 4DRWA 5J3XA 3ZNIA 4OR9B 2MJWB 1B4CA 2KI6C 2H61A 3VRNA 3D0YA 1OOFA 2EC6C 1SRAA 1FI5A 3DD4A 4PE1A 2H2KA 1SSEB 2KHNA 4L9MA 1J55A 3PM8A 1J7QA 4DS7A 3BUNB 5CPVA 4QJ5B 4ICBA 1C7VA 1SMGA 2P71A 2JPTA 4QJ3B 1F70A 2LMVA 1CB1A 3DF0A 5FYXA 1QIVA 1DT7B 4CLNA 3CWGA 5IBWA 2PALA 3KO0A 2SCPA 1RECA 3PATA 1DJWA 1R6PA 1EG3A 2JOJA 1FW4A 3E3RA 1TRFA 1XFVO 1ZUZA 2WCFA 1XFUO 2WOSA 3LK0A 1NX2A 1OQPA 2KBMA 3GOFA 1K90D 1XVJA 3S0FA 1V1FA 2QEBA 5ER5A 5FI2A 1L2OB 1J7RA 1NCXA 2Q91A 3CDNA 3BJHA 2WC6A 2BCBA 5CSJA 1D1OA 2ZN8A 3JVTC 1DC1A 3WXAA 1J7PA 2WCBA 1DF0A 2L51A 2JRFA 1MHOA 2ZKMX 1KFUS 2L4IA 4IL1A 3CABA 1UHIA 2KAYA 5D69A 3PFVA 1QASA 2BE4A 1UUSA 4MSPA 1IQ3A 1QIWA 1DEKA 2KLEA 1Y1AA 2WCKA 1DELA 2BNXA 4FQOA 1B7TZ 4I5NB 3KPXA 3NSIA 4P2YB 5HKWA 2FCDA 3HCMA 3EKJA 2KDHA 1ALVA 3EVUA 2GV5A 1WRZA 2NCPA 1DMOA 1GQMA 1W7IB 1QLKA 4GBAA 1QS7A 1LA3A 3F45A 2MLEC 1WDCC 3BUOB 1KQVA 1CNPA 4GPLB 2WCJA 1A2XA 4WRIA 1IGVA 3OGNA 2MRDA 3BOWB 1TUJA 3GK4X 1NSHA 1UP5A 2LUXA 1CFCA 4YRUA 3B7AA 3IF7A 1V1GA 4PDZA 2QPTA 4F0ZB 1CLBA 1TNXA 1LXFC 1PK0D 3R1VA 3DVKA 2L98A 1W9ZA 3IQQA 3BUMB 1CM4A 1CTRA 1M63B 3R1OA 3IVTA 2JC2A 2WCLA 2Y1MA 5I94A 1KQMC 3VRQA 1DJYA 1LKJA 1OSAA 2WORA 1CLLA 2F3ZA 4PE0A 2Q4UA
chains in the Genus database with same CATH topology
1OE9B 2M3WA 2ZN9A 3TS5B 1IWQA 3I5FB 3TDIA 1JSAA 1ZACA 3CLNA 1KK7Z 1WRKA 3KF9A 1FF1A 4MLWA 3SIBA 3DF0B 5AERA 1F55A 1SCVA 4TNCA 2JQ6A 4MZLA 4YI9A 1FBVA 4R1EA 3OB1B 4MBEA 1XK4C 2M1UA 3SIAA 3WHTB 1F8HA 3I5IC 2JTZA 1UHKA 3FS7A 1CKKA 1CLMA 1JF0A 4GUKA 1AUIB 2M29A 1H8BA 1YUTA 1K2HA 2LVJA 2LLTA 4DIRA 2K7BA 4JQ0D 1QJTA 1IKUA 4PCWA 1SBJA 4WQ2A 2CCMA 2EC6B 2JT3A 1DF0B 4GGNA 4YGCB 2LCPA 2OPOA 1K9PA 2I7AA 2PRUA 1IQ5A 1C07A 4OV2A 4GGFC 2OS8C 5GQQC 1N2DA 1EL4A 1IJ5A 2BE6A 2NXQA 1QV0A 2CTNA 1DGUA 1S5GZ 2BCXA 1R2UA 2G9BA 5CSIA 4ETOA 3VGOA 1XK4A 4GNKB 1CFFA 3D10A 5I2OA 1SL9A 3QRXA 4DCKA 2M9GA 5HKZA 1WY9A 1H4BA 5I2QA 2Y5IA 5CSFA 1MF8B 4CPVA 1K9UA 1K95A 1EXRA 1BODA 1AVSA 1QX5B 3VRRA 3JVTB 3O78A 1CFPA 2JT0A 1CDNA 2TN4A 2L4HA 1SPYA 3O4YA 1B1GA 4MZKA 1M46A 1RJVA 4GGFA 1A75A 2FJUB 3SG3A 5ER4X 4UPGA 3SG4A 3I5GB 1RWYA 3K21A 4N5XA 4P5OE 1RROA 2KGBC 2KI4B 4CIDA 1OZSA 2I94A 1J7OA 2HETA 1S6JA 1PRWA 3AKAA 2NZ0A 3GK1A 3JTDC 1B8LA 4C0LA 1AK8A 1DJXA 1TNWA 1JF2A 1A29A 3RLZA 3DVEA 1OOJA 1QLSA 1SL8A 2HF5A 4HREE 1XFYO 4NDDA 2F2OA 1WDCB 1NYAA 4ORCB 2M7LA 2F33A 3EK8A 1YVHA 2ZRTA 1BF5A 1JUOA 1QX7A 4M2PA 1KFXL 1E8AA 1RFJA 1YTZC 1SCMC 4E68A 3TDUA 2LC5A 1QTXA 2KGRA 1FI6A 2LP3A 1UURA 2BKIB 2OTGB 3ICBA 1UWOA 5HLOA 2K2AA 3O2PA 1K96A 1YUSA 2BCAA 1KQMB 2PASA 1G8IA 2KNEA 4MRYA 3M0WA 4AQIA 1NWDA 1TN4A 2I2RE 4GAOA 5F6TA 1CDLA 1DGVA 1QVIY 2GGMA 3KHEA 4XJKA 1YR5A 3BQ3A 1XFZO 1NX3A 5PALA 1Y0VH 4OCIA 4OVNF 3ZWHA 2JZIA 5CSNA 4OKHA 2KOTA 2PSRA 4BY5A 3DVMA 1S36A 4I5KA 3AKBA 1NCYA 4MZJA 1G33A 3EK7A 2BBNA 2LANA 2E6WA 2AMIA 3OX6A 4YGAA 4M2OA 2CXJA 3AAJA 1UHHA 3EVVA 1FPWA 1MR8A 1L2OC 5DKRA 3BXKA 1BMOA 2EHBA 3D0YB 1GGWA 2K7CA 2LMTA 4CFRA 2MAZA 1M45A 1YX7A 2COLB 2R2IA 4PHJA 4DUQA 2BL0B 1TCOB 2JTTA 1VRKA 2M8UA 1IJ6A 4PHNA 2CBLA 4I5JA 4NDBA 1YRTB 2KFGA 4ZCUA 1F4QA 3O6BA 3TUYB 1YX8A 2Y1NA 1S6IA 1PVAA 1KK8B 2LVIA 1QV1A 3SG7A 1DJZA 1WRLA 1PSBA 1N65A 1OMDA 4PHKA 1JWDA 4AQJA 1SL7A 5JJGA 5HLVA 4A4BA 1M31A 1CDMA 1MXEA 1TNQA 1Y6WA 4YI8A 1CMGA 1AJ5A 3BUWB 1NP8A 2LNKA 5B8IB 1KWOB 5G08A 3CR5X 1MWNA 3SG5A 1B8RA 3FIAA 3CS1A 1Y1XA 4MVFA 4C0JA 5AXIA 4YGDB 2LUCA 1PULA 2K2FA 4XYNA 2VRGA 1K94A 4ORBB 2DOQA 1KSMA 1SR6C 1U5IA 4YGBB 3DVJA 4YGEB 1TTXA 1YUUA 1W7JB 4HRGA 1SK6D 2ZNDA 3AAKA 1BLQA 1XFXO 2ZNEA 1SW8A 1WLZA 3LK1A 2BKHB 1X02A 2AAOA 2O60A 2KQYA 1ODBA 2EGDA 2K7DA 1B7TY 2LM5A 3GK2A 2KYCA 3JTDB 2K7OA 2P6BB 3TS5C 2CNPA 2K8MB 4USLA 1BR1B 1XYDA 1TIZA 2L0PA 1ZOTB 3OHMB 1NX0A 2JU0A 5AEQA 1S1EA 2BBMA 1XO5A 3WNXB 2D8NA 3I5HC 3LLEA 1K8UA 2HQ8A 1DJIA 2LV7A 2K0JA 2SASA 3SG6A 4PE7A 3A4UB 5DKNA 1QATA 4PHMA 4C0KA 1CFDA 3NSKA 4MEWA 1JFJA 5DKQA 2LVVA 1EH2A 1LVCD 5BPJA 1A4PA 1ALWA 1QX2A 4NDCA 3OB2B 1JBAA 2WC8A 1UHNA 2L2EA 3CR4X 1SYMA 1BT6A 1BJFA 1AHRA 2O5GA 1F71A 1WLMA 5K89A 2G2BA 2L5XB 2A4JA 1BR4B 2KYFA 1DTLA 4MRXA 1KK7Y 4PALA 1SKTA 5AANA 5AFPA 3PALA 2KQ6A 1KFUL 2KAXA 1RK9A 2AUCA 2LVKA 3LCPC 2NLNA 4NQGA 5D7FA 1NUBA 2FOTA 1S6CA 2BECA 3PN7C 1YVLA 4GFTA 1DJHA 2NCOA 1A03A 1B47A 2GGZA 1NCZA 1KCYA 3PSRA 2M0RA 1LA0A 5HKYA 1SNLA 2ZFDA 2ZRSA 2IS9A 2LP2A 1ZMZA 1F54A 1MQ1A 4N1GA 2WCEA 2ISDA 2F2PA 1B9AA 1OMVA 2K61A 1B8CA 2LLSA 2PMYA 1U5IB 4MN0A 3RM1A 1KFXS 1S26D 1M39A 2KSPA 1NPQA 1BOCA 3CTNA 3OP0A 2F8PA 1K9KA 3I5GC 2Y4QA 1OZOA 1MXLC 2KI4C 4YBHB 3A8RA 4PE4A 1IH0A 2HQWA 3HX4A 4HRHA 4AOMA 1NIWA 1S5GY 1EJ3A 3I5IB 3IQOA 2E30A 2LHLA 2I18A 5HYDA 1TCFA 1HQVA 1PVBA 2PVBA 1CMFA 2LE9B 3CGAA 1BG1A 1CDPA 2JXLA 1SY9A 3EK4A 1S3PA 3BYAA 3NSLA 2JT8A 2WNDA 3SG2A 2M1KB 1IG5A 1RTP1 5I8NA 1TOPA 3CZTX 2MA2A 1DJGA 5TNCA 1JFKA 2OS8B 1A75B 1C7WA 2JNXA 2KFHA 3MSEB 1SR6B 2MHHA 3SJSA 4Q04A 1TNPA 2OTGC 1CM1A 3FWBA 3OX5A 2JXCA 4U8DA 2HPSA 4N1FA 2KFFA 1OMRA 2M7NA 4JWQA 1NX1A 3KEVA 3WHUB 1XA5A 2JULA 3PLFB 3VRPA 3EVRA 3LL8B 1YURA 4M2QA 1BU3A 1MUXA 2M97A 3C1VA 2JNFA 2L50A 1KSOA 4ZCVA 1GGZA 2V53A 1GJYA 2MLFC 2M49B 4I5LB 4ORAB 2CT9A 1UHJA 4HSZA 1EG4A 1J1EA 3I5HB 5KU1A 2KBIA 3BUXB 4FTGA 1J1DA 1DVIA 2JWWA 4JPZB 1QXPA 1PSRA 2B1UA 3CR2A 2KI6D 1N0YA 1YRUB 2H61C 2LHIA 2FCEA 3TDZA 2RGIA 2QACA 4CFQA 1IRJA 1ZFSA 1XFWO 2BL0C 1QVIZ 5I2LA 5JOLA 2KAVA 2LLUA 3EKHA 4XJKB 1PALA 3I5FC 4BY4A 3TZ1A 3NXAA 2LMUA 1LINA 2MBXA 3VROA 4D1EA 3H4SE 2F3YA 1AP4A 3TUYC 4WQ3A 1AJ4A 1Q80A 1F4OA 1KK8C 1L7ZA 2LAPA 3FWCA 4QJ4B 1JC2A 4A4CA 1K93D 1HT9A 3BOWA 5KTYA 3NSOA 1SCMB 1Y1UA 1KWOC 3PN7B 5KSZA 1G4YR 4DRWA 5J3XA 3ZNIA 4OR9B 2MJWB 1B4CA 2KI6C 2H61A 3VRNA 3D0YA 2EC6C 1FI5A 1SRAA 3DD4A 4PE1A 2H2KA 2KHNA 4L9MA 1J55A 3PM8A 1J7QA 4DS7A 3BUNB 5CPVA 4QJ5B 4ICBA 1C7VA 1SMGA 2JPTA 4QJ3B 1F70A 2LMVA 1CB1A 3DF0A 5FYXA 1QIVA 1DT7B 4CLNA 3CWGA 5IBWA 2PALA 3KO0A 2SCPA 1RECA 3PATA 1DJWA 1R6PA 1EG3A 2JOJA 1FW4A 3E3RA 1TRFA 1XFVO 1ZUZA 2WCFA 1XFUO 2WOSA 3LK0A 1NX2A 1OQPA 2KBMA 3GOFA 1K90D 1XVJA 1V1FA 5ER5A 1L2OB 1J7RA 1NCXA 2Q91A 5CSJA 2BCBA 1D1OA 2ZN8A 3JVTC 3WXAA 1J7PA 2WCBA 1DF0A 2L51A 2JRFA 1MHOA 2ZKMX 1KFUS 2L4IA 4IL1A 1UHIA 2KAYA 5D69A 3PFVA 1QASA 2BE4A 1UUSA 4MSPA 1IQ3A 1QIWA 1Y1AA 4FQOA 1B7TZ 4I5NB 3KPXA 3NSIA 4P2YB 5HKWA 2FCDA 3HCMA 3EKJA 2KDHA 1ALVA 3EVUA 2GV5A 1WRZA 2NCPA 1DMOA 1GQMA 1W7IB 1QLKA 4GBAA 1QS7A 1LA3A 3F45A 2MLEC 1WDCC 3BUOB 1KQVA 1CNPA 4GPLB 1A2XA 4WRIA 1IGVA 2MRDA 3BOWB 3GK4X 1NSHA 1UP5A 2LUXA 1CFCA 4YRUA 3IF7A 4PDZA 1V1GA 4F0ZB 2QPTA 1CLBA 1TNXA 1LXFC 1PK0D 3DVKA 2L98A 3IQQA 3BUMB 1CM4A 1CTRA 1M63B 2JC2A 2Y1MA 1KQMC 3VRQA 1DJYA 1LKJA 1OSAA 2WORA 1CLLA 2F3ZA 4PE0A 2Q4UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OE9 B;  2M3W A;  2ZN9 A;  3TS5 B;  1IWQ A;  3I5F B;  3TDI A;  1JSA A;  1ZAC A;  3CLN A;  1KK7 Z;  1WRK A;  3KF9 A;  1FF1 A;  4MLW A;  3SIB A;  3DF0 B;  5AER A;  1F55 A;  1SCV A;  4TNC A;  2JQ6 A;  4MZL A;  4YI9 A;  1FBV A;  4R1E A;  3OB1 B;  4MBE A;  1XK4 C;  2M1U A;  3SIA A;  3WHT B;  1F8H A;  3I5I C;  2JTZ A;  1UHK A;  3FS7 A;  1CKK A;  1CLM A;  1JF0 A;  4GUK A;  1AUI B;  2M29 A;  1H8B A;  1YUT A;  1K2H A;  2LVJ A;  2LLT A;  4DIR A;  2K7B A;  4JQ0 D;  1QJT A;  1IKU A;  4PCW A;  1SBJ A;  4WQ2 A;  2CCM A;  2EC6 B;  2JT3 A;  1DF0 B;  4GGN A;  4YGC B;  2LCP A;  2OPO A;  1K9P A;  2I7A A;  2PRU A;  1IQ5 A;  1C07 A;  4OV2 A;  4GGF C;  2OS8 C;  5GQQ C;  1N2D A;  1EL4 A;  1IJ5 A;  2BE6 A;  2NXQ A;  1QV0 A;  2CTN A;  1DGU A;  1S5G Z;  2BCX A;  1R2U A;  2G9B A;  5CSI A;  4ETO A;  3VGO A;  1XK4 A;  4GNK B;  1CFF A;  3D10 A;  5I2O A;  1SL9 A;  3QRX A;  4DCK A;  2M9G A;  5HKZ A;  1WY9 A;  1H4B A;  5I2Q A;  2Y5I A;  5CSF A;  1MF8 B;  4CPV A;  1K9U A;  1K95 A;  1EXR A;  1BOD A;  1AVS A;  1QX5 B;  3VRR A;  3JVT B;  3O78 A;  1CFP A;  2JT0 A;  1CDN A;  2TN4 A;  2L4H A;  1SPY A;  3O4Y A;  1B1G A;  4MZK A;  1M46 A;  1RJV A;  4GGF A;  1A75 A;  2FJU B;  3SG3 A;  5ER4 X;  4UPG A;  3SG4 A;  3I5G B;  1RWY A;  3K21 A;  4N5X A;  4P5O E;  1RRO A;  2KGB C;  2KI4 B;  4CID A;  1OZS A;  2I94 A;  1J7O A;  2HET A;  1S6J A;  1PRW A;  3AKA A;  2NZ0 A;  3GK1 A;  3JTD C;  1B8L A;  4C0L A;  1AK8 A;  1DJX A;  1TNW A;  1JF2 A;  1A29 A;  3RLZ A;  3DVE A;  1OOJ A;  1QLS A;  1SL8 A;  2HF5 A;  4HRE E;  1XFY O;  4NDD A;  2F2O A;  1WDC B;  1NYA A;  4ORC B;  2M7L A;  2F33 A;  3EK8 A;  1YVH A;  2ZRT A;  1BF5 A;  1JUO A;  1QX7 A;  4M2P A;  1KFX L;  1E8A A;  1RFJ A;  1YTZ C;  1SCM C;  4E68 A;  3TDU A;  2LC5 A;  1QTX A;  2KGR A;  1FI6 A;  2LP3 A;  1UUR A;  2BKI B;  2OTG B;  3ICB A;  1UWO A;  5HLO A;  2K2A A;  3O2P A;  1K96 A;  1YUS A;  2BCA A;  1KQM B;  2PAS A;  1G8I A;  2KNE A;  4MRY A;  3M0W A;  4AQI A;  1NWD A;  1TN4 A;  2I2R E;  4GAO A;  5F6T A;  1CDL A;  1DGV A;  1QVI Y;  2GGM A;  3KHE A;  4XJK A;  1YR5 A;  3BQ3 A;  1XFZ O;  1NX3 A;  5PAL A;  1Y0V H;  4OCI A;  4OVN F;  3ZWH A;  2JZI A;  5CSN A;  4OKH A;  2KOT A;  2PSR A;  4BY5 A;  3DVM A;  1S36 A;  4I5K A;  3AKB A;  1NCY A;  4MZJ A;  1G33 A;  3EK7 A;  2BBN A;  2LAN A;  2E6W A;  2AMI A;  3OX6 A;  4YGA A;  4M2O A;  2CXJ A;  3AAJ A;  1UHH A;  3EVV A;  1FPW A;  1MR8 A;  1L2O C;  5DKR A;  3BXK A;  1BMO A;  2EHB A;  3D0Y B;  1GGW A;  2K7C A;  2LMT A;  4CFR A;  2MAZ A;  1M45 A;  1YX7 A;  2COL B;  2R2I A;  4PHJ A;  4DUQ A;  2BL0 B;  1TCO B;  2JTT A;  1VRK A;  2M8U A;  1IJ6 A;  4PHN A;  2CBL A;  4I5J A;  4NDB A;  1YRT B;  2KFG A;  4ZCU A;  1F4Q A;  3O6B A;  3TUY B;  1YX8 A;  2Y1N A;  1S6I A;  1PVA A;  1KK8 B;  2LVI A;  1QV1 A;  3SG7 A;  1DJZ A;  1WRL A;  1PSB A;  1N65 A;  1OMD A;  4PHK A;  1JWD A;  4AQJ A;  1SL7 A;  5JJG A;  5HLV A;  4A4B A;  1M31 A;  1CDM A;  1MXE A;  1TNQ A;  1Y6W A;  4YI8 A;  1CMG A;  1AJ5 A;  3BUW B;  1NP8 A;  2LNK A;  5B8I B;  1KWO B;  5G08 A;  3CR5 X;  1MWN A;  3SG5 A;  1B8R A;  3FIA A;  3CS1 A;  1Y1X A;  4MVF A;  4C0J A;  5AXI A;  4YGD B;  2LUC A;  1PUL A;  2K2F A;  4XYN A;  2VRG A;  1K94 A;  4ORB B;  2DOQ A;  1KSM A;  1SR6 C;  1U5I A;  4YGB B;  3DVJ A;  4YGE B;  1TTX A;  1YUU A;  1W7J B;  4HRG A;  1SK6 D;  2ZND A;  3AAK A;  1BLQ A;  1XFX O;  2ZNE A;  1SW8 A;  1WLZ A;  3LK1 A;  2BKH B;  1X02 A;  2AAO A;  2O60 A;  2KQY A;  1ODB A;  2EGD A;  2K7D A;  1B7T Y;  2LM5 A;  3GK2 A;  2KYC A;  3JTD B;  2K7O A;  2P6B B;  3TS5 C;  2CNP A;  2K8M B;  4USL A;  1BR1 B;  1XYD A;  1TIZ A;  2L0P A;  1ZOT B;  3OHM B;  1NX0 A;  2JU0 A;  5AEQ A;  1S1E A;  2BBM A;  1XO5 A;  3WNX B;  2D8N A;  3I5H C;  3LLE A;  1K8U A;  2HQ8 A;  1DJI A;  2LV7 A;  2K0J A;  2SAS A;  3SG6 A;  4PE7 A;  3A4U B;  5DKN A;  1QAT A;  4PHM A;  4C0K A;  1CFD A;  3NSK A;  4MEW A;  1JFJ A;  5DKQ A;  2LVV A;  1EH2 A;  1LVC D;  5BPJ A;  1A4P A;  1ALW A;  1QX2 A;  4NDC A;  3OB2 B;  1JBA A;  2WC8 A;  1UHN A;  2L2E A;  3CR4 X;  1SYM A;  1BT6 A;  1BJF A;  1AHR A;  2O5G A;  1F71 A;  1WLM A;  5K89 A;  2G2B A;  2L5X B;  2A4J A;  1BR4 B;  2KYF A;  1DTL A;  4MRX A;  1KK7 Y;  4PAL A;  1SKT A;  5AAN A;  5AFP A;  3PAL A;  2KQ6 A;  1KFU L;  2KAX A;  1RK9 A;  2AUC A;  2LVK A;  3LCP C;  2NLN A;  4NQG A;  5D7F A;  1NUB A;  2FOT A;  1S6C A;  2BEC A;  3PN7 C;  1YVL A;  4GFT A;  1DJH A;  2NCO A;  1A03 A;  1B47 A;  2GGZ A;  1NCZ A;  1KCY A;  3PSR A;  2M0R A;  1LA0 A;  5HKY A;  1SNL A;  2ZFD A;  2ZRS A;  2IS9 A;  2LP2 A;  1ZMZ A;  1F54 A;  1MQ1 A;  4N1G A;  2WCE A;  2ISD A;  2F2P A;  1B9A A;  1OMV A;  2K61 A;  1B8C A;  2LLS A;  2PMY A;  1U5I B;  4MN0 A;  3RM1 A;  1KFX S;  1S26 D;  1M39 A;  2KSP A;  1NPQ A;  1BOC A;  3CTN A;  3OP0 A;  2F8P A;  1K9K A;  3I5G C;  2Y4Q A;  1OZO A;  1MXL C;  2KI4 C;  4YBH B;  3A8R A;  4PE4 A;  1IH0 A;  2HQW A;  3HX4 A;  4HRH A;  4AOM A;  1NIW A;  1S5G Y;  1EJ3 A;  3I5I B;  3IQO A;  2E30 A;  2LHL A;  2I18 A;  5HYD A;  1TCF A;  1HQV A;  1PVB A;  2PVB A;  1CMF A;  2LE9 B;  3CGA A;  1BG1 A;  1CDP A;  2JXL A;  1SY9 A;  3EK4 A;  1S3P A;  3BYA A;  3NSL A;  2JT8 A;  2WND A;  3SG2 A;  2M1K B;  1IG5 A;  1RTP 1;  5I8N A;  1TOP A;  3CZT X;  2MA2 A;  1DJG A;  5TNC A;  1JFK A;  2OS8 B;  1A75 B;  1C7W A;  2JNX A;  2KFH A;  3MSE B;  1SR6 B;  2MHH A;  3SJS A;  4Q04 A;  1TNP A;  2OTG C;  1CM1 A;  3FWB A;  3OX5 A;  2JXC A;  4U8D A;  2HPS A;  4N1F A;  2KFF A;  1OMR A;  2M7N A;  4JWQ A;  1NX1 A;  3KEV A;  3WHU B;  1XA5 A;  2JUL A;  3PLF B;  3VRP A;  3EVR A;  3LL8 B;  1YUR A;  4M2Q A;  1BU3 A;  1MUX A;  2M97 A;  3C1V A;  2JNF A;  2L50 A;  1KSO A;  4ZCV A;  1GGZ A;  2V53 A;  1GJY A;  2MLF C;  2M49 B;  4I5L B;  4ORA B;  2CT9 A;  1UHJ A;  4HSZ A;  1EG4 A;  1J1E A;  3I5H B;  5KU1 A;  2KBI A;  3BUX B;  4FTG A;  1J1D A;  1DVI A;  2JWW A;  4JPZ B;  1QXP A;  1PSR A;  2B1U A;  3CR2 A;  2KI6 D;  1N0Y A;  1YRU B;  2H61 C;  2LHI A;  2FCE A;  3TDZ A;  2RGI A;  2QAC A;  4CFQ A;  1IRJ A;  1ZFS A;  1XFW O;  2BL0 C;  1QVI Z;  5I2L A;  5JOL A;  2KAV A;  2LLU A;  3EKH A;  4XJK B;  1PAL A;  3I5F C;  4BY4 A;  3TZ1 A;  3NXA A;  2LMU A;  1LIN A;  2MBX A;  3VRO A;  4D1E A;  3H4S E;  2F3Y A;  1AP4 A;  3TUY C;  4WQ3 A;  1AJ4 A;  1Q80 A;  1F4O A;  1KK8 C;  1L7Z A;  2LAP A;  3FWC A;  4QJ4 B;  1JC2 A;  4A4C A;  1K93 D;  1HT9 A;  3BOW A;  5KTY A;  3NSO A;  1SCM B;  1Y1U A;  1KWO C;  3PN7 B;  5KSZ A;  1G4Y R;  4DRW A;  5J3X A;  3ZNI A;  4OR9 B;  2MJW B;  1B4C A;  2KI6 C;  2H61 A;  3VRN A;  3D0Y A;  2EC6 C;  1FI5 A;  1SRA A;  3DD4 A;  4PE1 A;  2H2K A;  2KHN A;  4L9M A;  1J55 A;  3PM8 A;  1J7Q A;  4DS7 A;  3BUN B;  5CPV A;  4QJ5 B;  4ICB A;  1C7V A;  1SMG A;  2JPT A;  4QJ3 B;  1F70 A;  2LMV A;  1CB1 A;  3DF0 A;  5FYX A;  1QIV A;  1DT7 B;  4CLN A;  3CWG A;  5IBW A;  2PAL A;  3KO0 A;  2SCP A;  1REC A;  3PAT A;  1DJW A;  1R6P A;  1EG3 A;  2JOJ A;  1FW4 A;  3E3R A;  1TRF A;  1XFV O;  1ZUZ A;  2WCF A;  1XFU O;  2WOS A;  3LK0 A;  1NX2 A;  1OQP A;  2KBM A;  3GOF A;  1K90 D;  1XVJ A;  1V1F A;  5ER5 A;  1L2O B;  1J7R A;  1NCX A;  2Q91 A;  5CSJ A;  2BCB A;  1D1O A;  2ZN8 A;  3JVT C;  3WXA A;  1J7P A;  2WCB A;  1DF0 A;  2L51 A;  2JRF A;  1MHO A;  2ZKM X;  1KFU S;  2L4I A;  4IL1 A;  1UHI A;  2KAY A;  5D69 A;  3PFV A;  1QAS A;  2BE4 A;  1UUS A;  4MSP A;  1IQ3 A;  1QIW A;  1Y1A A;  4FQO A;  1B7T Z;  4I5N B;  3KPX A;  3NSI A;  4P2Y B;  5HKW A;  2FCD A;  3HCM A;  3EKJ A;  2KDH A;  1ALV A;  3EVU A;  2GV5 A;  1WRZ A;  2NCP A;  1DMO A;  1GQM A;  1W7I B;  1QLK A;  4GBA A;  1QS7 A;  1LA3 A;  3F45 A;  2MLE C;  1WDC C;  3BUO B;  1KQV A;  1CNP A;  4GPL B;  1A2X A;  4WRI A;  1IGV A;  2MRD A;  3BOW B;  3GK4 X;  1NSH A;  1UP5 A;  2LUX A;  1CFC A;  4YRU A;  3IF7 A;  4PDZ A;  1V1G A;  4F0Z B;  2QPT A;  1CLB A;  1TNX A;  1LXF C;  1PK0 D;  3DVK A;  2L98 A;  3IQQ A;  3BUM B;  1CM4 A;  1CTR A;  1M63 B;  2JC2 A;  2Y1M A;  1KQM C;  3VRQ A;  1DJY A;  1LKJ A;  1OSA A;  2WOR A;  1CLL A;  2F3Z A;  4PE0 A;  2Q4U A; 
#chains in the Genus database with same CATH topology
 1OE9 B;  2M3W A;  2ZN9 A;  3TS5 B;  1IWQ A;  3I5F B;  3TDI A;  1JSA A;  1ZAC A;  2QDI A;  3CLN A;  1KK7 Z;  1WRK A;  3KF9 A;  1FF1 A;  4MLW A;  3SIB A;  3DF0 B;  5AER A;  1F55 A;  1SCV A;  4TNC A;  2JQ6 A;  4MZL A;  4YI9 A;  1FBV A;  4R1E A;  3VB1 A;  3D75 A;  3OB1 B;  4MBE A;  1XK4 C;  2M1U A;  3SIA A;  3WHT B;  3CZ1 A;  1F8H A;  3I5I C;  2JTZ A;  1UHK A;  3FS7 A;  1CKK A;  1CLM A;  1JF0 A;  3R72 A;  1AUI B;  2M29 A;  4GUK A;  1YUT A;  1H8B A;  1K2H A;  2LVJ A;  2LLT A;  4DIR A;  2K7B A;  4JQ0 D;  1QJT A;  1IKU A;  3FE8 A;  4PCW A;  1SBJ A;  4WQ2 A;  2CCM A;  2EC6 B;  2JT3 A;  1DF0 B;  4GGN A;  4YGC B;  2LCP A;  2OPO A;  1K9P A;  2I7A A;  2PRU A;  1IQ5 A;  1C07 A;  4OV2 A;  4GGF C;  2OS8 C;  5GQQ C;  4PT1 A;  1N2D A;  3CZ0 A;  1EL4 A;  1IJ5 A;  2BE6 A;  1XFR A;  2NXQ A;  1QV0 A;  4JD9 A;  2CTN A;  1DGU A;  1S5G Z;  2BCX A;  1R2U A;  2G9B A;  5CSI A;  4ETO A;  3VGO A;  3DXL A;  1XK4 A;  4GNK B;  1CFF A;  3D10 A;  5I2O A;  1SL9 A;  3QRX A;  4DCK A;  1TWO A;  2M9G A;  5HKZ A;  1WY9 A;  3B6X A;  1H4B A;  5I2Q A;  2Y5I A;  5CSF A;  1MF8 B;  2L5Y A;  4CPV A;  1QWV A;  1K9U A;  1K95 A;  1EXR A;  1BOD A;  1AVS A;  1QX5 B;  3VRR A;  3JVT B;  3O78 A;  1CFP A;  2JT0 A;  1CDN A;  2TN4 A;  3D78 A;  2L4H A;  1SPY A;  3O4Y A;  1B1G A;  4MZK A;  1M46 A;  3BFH A;  3UO9 A;  1RJV A;  4GGF A;  1A75 A;  2FJU B;  3SG3 A;  5ER4 X;  2QEO A;  4UPG A;  3SG4 A;  3S0D A;  3I5G B;  1RWY A;  3K21 A;  3R1P A;  4N5X A;  4P5O E;  5HL1 A;  1RRO A;  2KGB C;  2KI4 B;  4CID A;  1OZS A;  2I94 A;  1J7O A;  2HET A;  1S6J A;  1PRW A;  1OW4 A;  3AKA A;  2NZ0 A;  3DZT A;  3GK1 A;  1B8L A;  3JTD C;  4C0L A;  1AK8 A;  1TUZ A;  1DJX A;  1TNW A;  1JF2 A;  1A29 A;  3RLZ A;  3D76 A;  2FJY A;  3DVE A;  1OOJ A;  1QLS A;  1SL8 A;  2HF5 A;  4HRE E;  1XFY O;  4NDD A;  2F2O A;  3V2L A;  1WDC B;  1NYA A;  4ORC B;  2M7L A;  1OOG A;  2F33 A;  3EK8 A;  1YVH A;  3S0A A;  2ZRT A;  1BF5 A;  1JUO A;  1QX7 A;  4M2P A;  1KFX L;  1E8A A;  1RFJ A;  1YTZ C;  1SCM C;  4E68 A;  3TDU A;  2LC5 A;  1QTX A;  2KGR A;  2K60 A;  1FI6 A;  2LP3 A;  1UUR A;  2BKI B;  2QEV A;  2OTG B;  3O4X A;  3ICB A;  1UWO A;  5HLO A;  2K2A A;  3O2P A;  1K96 A;  1YUS A;  2BCA A;  1KQM B;  2PAS A;  1G8I A;  2KNE A;  4MRY A;  3M0W A;  4AQI A;  1NWD A;  1TN4 A;  2I2R E;  4GAO A;  3UNW A;  5F6T A;  1CDL A;  1DGV A;  1QVI Y;  2GGM A;  3KHE A;  4XJK A;  1YR5 A;  3BQ3 A;  1XFZ O;  1NX3 A;  5PAL A;  1Y0V H;  4OCI A;  4OVN F;  4OZD A;  2JZI A;  5CSN A;  3ZWH A;  4OKH A;  2KOT A;  2PSR A;  2YGU A;  3DVM A;  1S36 A;  4BY5 A;  4I5K A;  3AKB A;  1NCY A;  3FE9 A;  4MZJ A;  1G33 A;  3EK7 A;  2BBN A;  2LAN A;  2E6W A;  2AMI A;  3OX6 A;  4YGA A;  4M2O A;  2CXJ A;  3AAJ A;  1UHH A;  3EVV A;  4IJ7 A;  1FPW A;  1MR8 A;  1L2O C;  5DKR A;  3BXK A;  1BMO A;  2EHB A;  3D0Y B;  1GGW A;  3EG5 B;  2K7C A;  3N7H A;  2LMT A;  4CFR A;  2MAZ A;  1M45 A;  1YX7 A;  2COL B;  2R2I A;  4PHJ A;  4DUQ A;  2BL0 B;  1C3Y A;  1TCO B;  2JTT A;  1VRK A;  2M8U A;  1IJ6 A;  4PHN A;  2CBL A;  5DIC A;  3SS3 A;  4I5J A;  4NDB A;  1YRT B;  2KFG A;  4ZCU A;  1F4Q A;  3O6B A;  3TUY B;  1YX8 A;  2Y1N A;  1S6I A;  1LS8 A;  1PVA A;  1KK8 B;  2LVI A;  1QV1 A;  3SG7 A;  1DJZ A;  1DQE A;  1WRL A;  1PSB A;  1N65 A;  1OMD A;  4PHK A;  1JWD A;  4AQJ A;  1SL7 A;  5JJG A;  5HLV A;  4A4B A;  1M31 A;  1CDM A;  1MXE A;  1TNQ A;  1Y6W A;  4YI8 A;  1CMG A;  1AJ5 A;  3BUW B;  1NP8 A;  2LNK A;  5B8I B;  1KWO B;  5G08 A;  3CR5 X;  1MWN A;  3SG5 A;  3K1E A;  1B8R A;  3B88 A;  1ORG A;  3CS1 A;  3FIA A;  1Y1X A;  2WCM A;  4MVF A;  4C0J A;  5AXI A;  4YGD B;  2LUC A;  1PUL A;  2H8V A;  2K2F A;  3D74 A;  4XYN A;  5D3O A;  2VRG A;  1K94 A;  4ORB B;  2DOQ A;  1KSM A;  1SR6 C;  1U5I A;  4YGB B;  3DVJ A;  4YGE B;  1TTX A;  1YUU A;  1W7J B;  4HRG A;  1SK6 D;  2ZND A;  3AAK A;  1BLQ A;  1XFX O;  2ZNE A;  3OBV A;  1SW8 A;  1WLZ A;  3LK1 A;  2BKH B;  1X02 A;  2AAO A;  3CYZ A;  2O60 A;  2KQY A;  1ODB A;  2EGD A;  2K7D A;  1B7T Y;  2LM5 A;  3GK2 A;  2KYC A;  3S0G A;  3JTD B;  3BFA A;  2K7O A;  2P6B B;  3TS5 C;  2CNP A;  4KYN A;  3L47 A;  2K8M B;  4USL A;  1BR1 B;  2PQL A;  1XYD A;  1TIZ A;  2L0P A;  1ZOT B;  3OHM B;  1NX0 A;  2JU0 A;  3L4L A;  1S1E A;  5AEQ A;  2BBM A;  1XO5 A;  3WNX B;  2D8N A;  3I5H C;  2ERB A;  3QME A;  3LLE A;  1K8U A;  2HQ8 A;  1DJI A;  2LV7 A;  2K0J A;  2SAS A;  3CZ2 A;  3SG6 A;  4PE7 A;  3A4U B;  1GM0 A;  5DKN A;  4F7F A;  1QAT A;  4PHM A;  4C0K A;  1CFD A;  3NSK A;  3D73 A;  2PYQ A;  4MEW A;  1JFJ A;  4INW A;  5DKQ A;  2LVV A;  3B87 A;  1EH2 A;  1LVC D;  1Z4H A;  1T14 A;  5BPJ A;  1A4P A;  1ALW A;  1QX2 A;  4NDC A;  3OB2 B;  1JBA A;  2WC8 A;  1UHN A;  2L2E A;  3CR4 X;  1SYM A;  1BT6 A;  2QEH A;  2WC5 A;  1BJF A;  1AHR A;  3NHI A;  2O5G A;  1F71 A;  1WLM A;  5K89 A;  2G2B A;  2L5X B;  2A4J A;  1BR4 B;  2KYF A;  1DTL A;  3RZS A;  4MRX A;  1KK7 Y;  4PAL A;  1SKT A;  5AAN A;  5AFP A;  3PAL A;  2KQ6 A;  1KFU L;  2KAX A;  1RK9 A;  2AUC A;  2LVK A;  3LCP C;  2NLN A;  4NQG A;  5D7F A;  1NUB A;  2FOT A;  1S6C A;  2BEC A;  3PN7 C;  2BAP A;  1YVL A;  4GFT A;  1DJH A;  3S0B A;  2NCO A;  1A03 A;  1B47 A;  2GGZ A;  1NCZ A;  1KCY A;  3PSR A;  2M0R A;  1LA0 A;  5HKY A;  1SNL A;  2ZFD A;  3DY9 A;  2ZRS A;  2IS9 A;  2LP2 A;  1ZMZ A;  1F54 A;  1MQ1 A;  4N1G A;  2WCE A;  2ISD A;  2F2P A;  2KLD A;  1B9A A;  1OMV A;  2K61 A;  1B8C A;  2LLS A;  2PMY A;  1U5I B;  4MN0 A;  3Q8I A;  3RM1 A;  3B86 A;  3PJI A;  1KFX S;  1S26 D;  1M39 A;  2KSP A;  1NPQ A;  1BOC A;  3CTN A;  3OP0 A;  2F8P A;  1K9K A;  3I5G C;  2Y4Q A;  1OZO A;  1MXL C;  2KI4 C;  4YBH B;  3A8R A;  4PE4 A;  1IH0 A;  2HQW A;  3HX4 A;  5FI6 A;  4HRH A;  4AOM A;  1NIW A;  1S5G Y;  1EJ3 A;  3I5I B;  3IQO A;  2E30 A;  2LHL A;  2I18 A;  5HYD A;  1TCF A;  1HQV A;  1PVB A;  2PVB A;  1CMF A;  2LE9 B;  3S0E A;  3CGA A;  1BG1 A;  1CDP A;  2JXL A;  1SY9 A;  4FQT A;  3EK4 A;  1S3P A;  3BYA A;  3NSL A;  2JT8 A;  2WND A;  3SG2 A;  2M1K B;  1IG5 A;  1RTP 1;  5I8N A;  1TOP A;  3FE6 A;  2GTE A;  2JPO A;  2MA2 A;  3CZT X;  1DJG A;  5TNC A;  1JFK A;  2OS8 B;  1A75 B;  1C7W A;  2JNX A;  5EL2 A;  2KFH A;  3MSE B;  1SR6 B;  2MHH A;  3PM2 A;  3SJS A;  4Q04 A;  1TNP A;  2OTG C;  1CM1 A;  3FWB A;  3OX5 A;  2JXC A;  4U8D A;  2HPS A;  3D77 A;  4N1F A;  2KFF A;  1OMR A;  2M7N A;  4JWQ A;  1NX1 A;  3KEV A;  3NGV A;  3WHU B;  1XA5 A;  2JUL A;  3PLF B;  3VRP A;  3EVR A;  3SS5 A;  2P70 A;  2KPH A;  3LL8 B;  1YUR A;  4M2Q A;  1BU3 A;  1MUX A;  2M97 A;  3C1V A;  2JNF A;  2L50 A;  1KSO A;  4ZCV A;  1GGZ A;  2V53 A;  3L4A A;  1GJY A;  2MLF C;  2M49 B;  4I5L B;  4ORA B;  2CT9 A;  5FI7 A;  1UHJ A;  4HSZ A;  1EG4 A;  1J1E A;  3I5H B;  5KU1 A;  2KBI A;  3BUX B;  4FTG A;  1OOH A;  1J1D A;  1DVI A;  2JWW A;  4JPZ B;  1QXP A;  3BFB A;  1PSR A;  4INX A;  2B1U A;  3CR2 A;  2KI6 D;  1N0Y A;  1YRU B;  2H61 C;  2LHI A;  1Z2C B;  3DYE A;  2FCE A;  3TDZ A;  2RGI A;  1P28 A;  1OOI X;  2QAC A;  4CFQ A;  1IRJ A;  1ZFS A;  1XFW O;  2BL0 C;  1QVI Z;  5I2L A;  5JOL A;  2KAV A;  2LLU A;  3EKH A;  4XJK B;  2L2C A;  1PAL A;  3I5F C;  3NHT A;  4BY4 A;  3TZ1 A;  3NXA A;  2LMU A;  1LIN A;  2MBX A;  3VRO A;  4D1E A;  3H4S E;  2F3Y A;  1AP4 A;  3TUY C;  4JKT A;  1IIO A;  2WCH A;  4WQ3 A;  1AJ4 A;  1Q80 A;  1F4O A;  1KK8 C;  1L7Z A;  2LAP A;  3FWC A;  4QJ4 B;  1JC2 A;  3SS4 A;  4A4C A;  1C3Z A;  1K93 D;  1HT9 A;  3BOW A;  5KTY A;  3NSO A;  1SCM B;  1Y1U A;  1KWO C;  3PN7 B;  5KSZ A;  1G4Y R;  4DRW A;  5J3X A;  3ZNI A;  4OR9 B;  2MJW B;  1B4C A;  2KI6 C;  2H61 A;  3VRN A;  3D0Y A;  1OOF A;  2EC6 C;  1SRA A;  1FI5 A;  3DD4 A;  4PE1 A;  2H2K A;  1SSE B;  2KHN A;  4L9M A;  1J55 A;  3PM8 A;  1J7Q A;  4DS7 A;  3BUN B;  5CPV A;  4QJ5 B;  4ICB A;  1C7V A;  1SMG A;  2P71 A;  2JPT A;  4QJ3 B;  1F70 A;  2LMV A;  1CB1 A;  3DF0 A;  5FYX A;  1QIV A;  1DT7 B;  4CLN A;  3CWG A;  5IBW A;  2PAL A;  3KO0 A;  2SCP A;  1REC A;  3PAT A;  1DJW A;  1R6P A;  1EG3 A;  2JOJ A;  1FW4 A;  3E3R A;  1TRF A;  1XFV O;  1ZUZ A;  2WCF A;  1XFU O;  2WOS A;  3LK0 A;  1NX2 A;  1OQP A;  2KBM A;  3GOF A;  1K90 D;  1XVJ A;  3S0F A;  1V1F A;  2QEB A;  5ER5 A;  5FI2 A;  1L2O B;  1J7R A;  1NCX A;  2Q91 A;  3CDN A;  3BJH A;  2WC6 A;  2BCB A;  5CSJ A;  1D1O A;  2ZN8 A;  3JVT C;  1DC1 A;  3WXA A;  1J7P A;  2WCB A;  1DF0 A;  2L51 A;  2JRF A;  1MHO A;  2ZKM X;  1KFU S;  2L4I A;  4IL1 A;  3CAB A;  1UHI A;  2KAY A;  5D69 A;  3PFV A;  1QAS A;  2BE4 A;  1UUS A;  4MSP A;  1IQ3 A;  1QIW A;  1DEK A;  2KLE A;  1Y1A A;  2WCK A;  1DEL A;  2BNX A;  4FQO A;  1B7T Z;  4I5N B;  3KPX A;  3NSI A;  4P2Y B;  5HKW A;  2FCD A;  3HCM A;  3EKJ A;  2KDH A;  1ALV A;  3EVU A;  2GV5 A;  1WRZ A;  2NCP A;  1DMO A;  1GQM A;  1W7I B;  1QLK A;  4GBA A;  1QS7 A;  1LA3 A;  3F45 A;  2MLE C;  1WDC C;  3BUO B;  1KQV A;  1CNP A;  4GPL B;  2WCJ A;  1A2X A;  4WRI A;  1IGV A;  3OGN A;  2MRD A;  3BOW B;  1TUJ A;  3GK4 X;  1NSH A;  1UP5 A;  2LUX A;  1CFC A;  4YRU A;  3B7A A;  3IF7 A;  1V1G A;  4PDZ A;  2QPT A;  4F0Z B;  1CLB A;  1TNX A;  1LXF C;  1PK0 D;  3R1V A;  3DVK A;  2L98 A;  1W9Z A;  3IQQ A;  3BUM B;  1CM4 A;  1CTR A;  1M63 B;  3R1O A;  3IVT A;  2JC2 A;  2WCL A;  2Y1M A;  5I94 A;  1KQM C;  3VRQ A;  1DJY A;  1LKJ A;  1OSA A;  2WOR A;  1CLL A;  2F3Z A;  4PE0 A;  2Q4U A; 
#chains in the Genus database with same CATH homology
 1OE9 B;  2M3W A;  2ZN9 A;  3TS5 B;  1IWQ A;  3I5F B;  3TDI A;  1JSA A;  1ZAC A;  3CLN A;  1KK7 Z;  1WRK A;  3KF9 A;  1FF1 A;  4MLW A;  3SIB A;  3DF0 B;  5AER A;  1F55 A;  1SCV A;  4TNC A;  2JQ6 A;  4MZL A;  4YI9 A;  1FBV A;  4R1E A;  3OB1 B;  4MBE A;  1XK4 C;  2M1U A;  3SIA A;  3WHT B;  1F8H A;  3I5I C;  2JTZ A;  1UHK A;  3FS7 A;  1CKK A;  1CLM A;  1JF0 A;  4GUK A;  1AUI B;  2M29 A;  1H8B A;  1YUT A;  1K2H A;  2LVJ A;  2LLT A;  4DIR A;  2K7B A;  4JQ0 D;  1QJT A;  1IKU A;  4PCW A;  1SBJ A;  4WQ2 A;  2CCM A;  2EC6 B;  2JT3 A;  1DF0 B;  4GGN A;  4YGC B;  2LCP A;  2OPO A;  1K9P A;  2I7A A;  2PRU A;  1IQ5 A;  1C07 A;  4OV2 A;  4GGF C;  2OS8 C;  5GQQ C;  1N2D A;  1EL4 A;  1IJ5 A;  2BE6 A;  2NXQ A;  1QV0 A;  2CTN A;  1DGU A;  1S5G Z;  2BCX A;  1R2U A;  2G9B A;  5CSI A;  4ETO A;  3VGO A;  1XK4 A;  4GNK B;  1CFF A;  3D10 A;  5I2O A;  1SL9 A;  3QRX A;  4DCK A;  2M9G A;  5HKZ A;  1WY9 A;  1H4B A;  5I2Q A;  2Y5I A;  5CSF A;  1MF8 B;  4CPV A;  1K9U A;  1K95 A;  1EXR A;  1BOD A;  1AVS A;  1QX5 B;  3VRR A;  3JVT B;  3O78 A;  1CFP A;  2JT0 A;  1CDN A;  2TN4 A;  2L4H A;  1SPY A;  3O4Y A;  1B1G A;  4MZK A;  1M46 A;  1RJV A;  4GGF A;  1A75 A;  2FJU B;  3SG3 A;  5ER4 X;  4UPG A;  3SG4 A;  3I5G B;  1RWY A;  3K21 A;  4N5X A;  4P5O E;  1RRO A;  2KGB C;  2KI4 B;  4CID A;  1OZS A;  2I94 A;  1J7O A;  2HET A;  1S6J A;  1PRW A;  3AKA A;  2NZ0 A;  3GK1 A;  3JTD C;  1B8L A;  4C0L A;  1AK8 A;  1DJX A;  1TNW A;  1JF2 A;  1A29 A;  3RLZ A;  3DVE A;  1OOJ A;  1QLS A;  1SL8 A;  2HF5 A;  4HRE E;  1XFY O;  4NDD A;  2F2O A;  1WDC B;  1NYA A;  4ORC B;  2M7L A;  2F33 A;  3EK8 A;  1YVH A;  2ZRT A;  1BF5 A;  1JUO A;  1QX7 A;  4M2P A;  1KFX L;  1E8A A;  1RFJ A;  1YTZ C;  1SCM C;  4E68 A;  3TDU A;  2LC5 A;  1QTX A;  2KGR A;  1FI6 A;  2LP3 A;  1UUR A;  2BKI B;  2OTG B;  3ICB A;  1UWO A;  5HLO A;  2K2A A;  3O2P A;  1K96 A;  1YUS A;  2BCA A;  1KQM B;  2PAS A;  1G8I A;  2KNE A;  4MRY A;  3M0W A;  4AQI A;  1NWD A;  1TN4 A;  2I2R E;  4GAO A;  5F6T A;  1CDL A;  1DGV A;  1QVI Y;  2GGM A;  3KHE A;  4XJK A;  1YR5 A;  3BQ3 A;  1XFZ O;  1NX3 A;  5PAL A;  1Y0V H;  4OCI A;  4OVN F;  3ZWH A;  2JZI A;  5CSN A;  4OKH A;  2KOT A;  2PSR A;  4BY5 A;  3DVM A;  1S36 A;  4I5K A;  3AKB A;  1NCY A;  4MZJ A;  1G33 A;  3EK7 A;  2BBN A;  2LAN A;  2E6W A;  2AMI A;  3OX6 A;  4YGA A;  4M2O A;  2CXJ A;  3AAJ A;  1UHH A;  3EVV A;  1FPW A;  1MR8 A;  1L2O C;  5DKR A;  3BXK A;  1BMO A;  2EHB A;  3D0Y B;  1GGW A;  2K7C A;  2LMT A;  4CFR A;  2MAZ A;  1M45 A;  1YX7 A;  2COL B;  2R2I A;  4PHJ A;  4DUQ A;  2BL0 B;  1TCO B;  2JTT A;  1VRK A;  2M8U A;  1IJ6 A;  4PHN A;  2CBL A;  4I5J A;  4NDB A;  1YRT B;  2KFG A;  4ZCU A;  1F4Q A;  3O6B A;  3TUY B;  1YX8 A;  2Y1N A;  1S6I A;  1PVA A;  1KK8 B;  2LVI A;  1QV1 A;  3SG7 A;  1DJZ A;  1WRL A;  1PSB A;  1N65 A;  1OMD A;  4PHK A;  1JWD A;  4AQJ A;  1SL7 A;  5JJG A;  5HLV A;  4A4B A;  1M31 A;  1CDM A;  1MXE A;  1TNQ A;  1Y6W A;  4YI8 A;  1CMG A;  1AJ5 A;  3BUW B;  1NP8 A;  2LNK A;  5B8I B;  1KWO B;  5G08 A;  3CR5 X;  1MWN A;  3SG5 A;  1B8R A;  3FIA A;  3CS1 A;  1Y1X A;  4MVF A;  4C0J A;  5AXI A;  4YGD B;  2LUC A;  1PUL A;  2K2F A;  4XYN A;  2VRG A;  1K94 A;  4ORB B;  2DOQ A;  1KSM A;  1SR6 C;  1U5I A;  4YGB B;  3DVJ A;  4YGE B;  1TTX A;  1YUU A;  1W7J B;  4HRG A;  1SK6 D;  2ZND A;  3AAK A;  1BLQ A;  1XFX O;  2ZNE A;  1SW8 A;  1WLZ A;  3LK1 A;  2BKH B;  1X02 A;  2AAO A;  2O60 A;  2KQY A;  1ODB A;  2EGD A;  2K7D A;  1B7T Y;  2LM5 A;  3GK2 A;  2KYC A;  3JTD B;  2K7O A;  2P6B B;  3TS5 C;  2CNP A;  2K8M B;  4USL A;  1BR1 B;  1XYD A;  1TIZ A;  2L0P A;  1ZOT B;  3OHM B;  1NX0 A;  2JU0 A;  5AEQ A;  1S1E A;  2BBM A;  1XO5 A;  3WNX B;  2D8N A;  3I5H C;  3LLE A;  1K8U A;  2HQ8 A;  1DJI A;  2LV7 A;  2K0J A;  2SAS A;  3SG6 A;  4PE7 A;  3A4U B;  5DKN A;  1QAT A;  4PHM A;  4C0K A;  1CFD A;  3NSK A;  4MEW A;  1JFJ A;  5DKQ A;  2LVV A;  1EH2 A;  1LVC D;  5BPJ A;  1A4P A;  1ALW A;  1QX2 A;  4NDC A;  3OB2 B;  1JBA A;  2WC8 A;  1UHN A;  2L2E A;  3CR4 X;  1SYM A;  1BT6 A;  1BJF A;  1AHR A;  2O5G A;  1F71 A;  1WLM A;  5K89 A;  2G2B A;  2L5X B;  2A4J A;  1BR4 B;  2KYF A;  1DTL A;  4MRX A;  1KK7 Y;  4PAL A;  1SKT A;  5AAN A;  5AFP A;  3PAL A;  2KQ6 A;  1KFU L;  2KAX A;  1RK9 A;  2AUC A;  2LVK A;  3LCP C;  2NLN A;  4NQG A;  5D7F A;  1NUB A;  2FOT A;  1S6C A;  2BEC A;  3PN7 C;  1YVL A;  4GFT A;  1DJH A;  2NCO A;  1A03 A;  1B47 A;  2GGZ A;  1NCZ A;  1KCY A;  3PSR A;  2M0R A;  1LA0 A;  5HKY A;  1SNL A;  2ZFD A;  2ZRS A;  2IS9 A;  2LP2 A;  1ZMZ A;  1F54 A;  1MQ1 A;  4N1G A;  2WCE A;  2ISD A;  2F2P A;  1B9A A;  1OMV A;  2K61 A;  1B8C A;  2LLS A;  2PMY A;  1U5I B;  4MN0 A;  3RM1 A;  1KFX S;  1S26 D;  1M39 A;  2KSP A;  1NPQ A;  1BOC A;  3CTN A;  3OP0 A;  2F8P A;  1K9K A;  3I5G C;  2Y4Q A;  1OZO A;  1MXL C;  2KI4 C;  4YBH B;  3A8R A;  4PE4 A;  1IH0 A;  2HQW A;  3HX4 A;  4HRH A;  4AOM A;  1NIW A;  1S5G Y;  1EJ3 A;  3I5I B;  3IQO A;  2E30 A;  2LHL A;  2I18 A;  5HYD A;  1TCF A;  1HQV A;  1PVB A;  2PVB A;  1CMF A;  2LE9 B;  3CGA A;  1BG1 A;  1CDP A;  2JXL A;  1SY9 A;  3EK4 A;  1S3P A;  3BYA A;  3NSL A;  2JT8 A;  2WND A;  3SG2 A;  2M1K B;  1IG5 A;  1RTP 1;  5I8N A;  1TOP A;  3CZT X;  2MA2 A;  1DJG A;  5TNC A;  1JFK A;  2OS8 B;  1A75 B;  1C7W A;  2JNX A;  2KFH A;  3MSE B;  1SR6 B;  2MHH A;  3SJS A;  4Q04 A;  1TNP A;  2OTG C;  1CM1 A;  3FWB A;  3OX5 A;  2JXC A;  4U8D A;  2HPS A;  4N1F A;  2KFF A;  1OMR A;  2M7N A;  4JWQ A;  1NX1 A;  3KEV A;  3WHU B;  1XA5 A;  2JUL A;  3PLF B;  3VRP A;  3EVR A;  3LL8 B;  1YUR A;  4M2Q A;  1BU3 A;  1MUX A;  2M97 A;  3C1V A;  2JNF A;  2L50 A;  1KSO A;  4ZCV A;  1GGZ A;  2V53 A;  1GJY A;  2MLF C;  2M49 B;  4I5L B;  4ORA B;  2CT9 A;  1UHJ A;  4HSZ A;  1EG4 A;  1J1E A;  3I5H B;  5KU1 A;  2KBI A;  3BUX B;  4FTG A;  1J1D A;  1DVI A;  2JWW A;  4JPZ B;  1QXP A;  1PSR A;  2B1U A;  3CR2 A;  2KI6 D;  1N0Y A;  1YRU B;  2H61 C;  2LHI A;  2FCE A;  3TDZ A;  2RGI A;  2QAC A;  4CFQ A;  1IRJ A;  1ZFS A;  1XFW O;  2BL0 C;  1QVI Z;  5I2L A;  5JOL A;  2KAV A;  2LLU A;  3EKH A;  4XJK B;  1PAL A;  3I5F C;  4BY4 A;  3TZ1 A;  3NXA A;  2LMU A;  1LIN A;  2MBX A;  3VRO A;  4D1E A;  3H4S E;  2F3Y A;  1AP4 A;  3TUY C;  4WQ3 A;  1AJ4 A;  1Q80 A;  1F4O A;  1KK8 C;  1L7Z A;  2LAP A;  3FWC A;  4QJ4 B;  1JC2 A;  4A4C A;  1K93 D;  1HT9 A;  3BOW A;  5KTY A;  3NSO A;  1SCM B;  1Y1U A;  1KWO C;  3PN7 B;  5KSZ A;  1G4Y R;  4DRW A;  5J3X A;  3ZNI A;  4OR9 B;  2MJW B;  1B4C A;  2KI6 C;  2H61 A;  3VRN A;  3D0Y A;  2EC6 C;  1FI5 A;  1SRA A;  3DD4 A;  4PE1 A;  2H2K A;  2KHN A;  4L9M A;  1J55 A;  3PM8 A;  1J7Q A;  4DS7 A;  3BUN B;  5CPV A;  4QJ5 B;  4ICB A;  1C7V A;  1SMG A;  2JPT A;  4QJ3 B;  1F70 A;  2LMV A;  1CB1 A;  3DF0 A;  5FYX A;  1QIV A;  1DT7 B;  4CLN A;  3CWG A;  5IBW A;  2PAL A;  3KO0 A;  2SCP A;  1REC A;  3PAT A;  1DJW A;  1R6P A;  1EG3 A;  2JOJ A;  1FW4 A;  3E3R A;  1TRF A;  1XFV O;  1ZUZ A;  2WCF A;  1XFU O;  2WOS A;  3LK0 A;  1NX2 A;  1OQP A;  2KBM A;  3GOF A;  1K90 D;  1XVJ A;  1V1F A;  5ER5 A;  1L2O B;  1J7R A;  1NCX A;  2Q91 A;  5CSJ A;  2BCB A;  1D1O A;  2ZN8 A;  3JVT C;  3WXA A;  1J7P A;  2WCB A;  1DF0 A;  2L51 A;  2JRF A;  1MHO A;  2ZKM X;  1KFU S;  2L4I A;  4IL1 A;  1UHI A;  2KAY A;  5D69 A;  3PFV A;  1QAS A;  2BE4 A;  1UUS A;  4MSP A;  1IQ3 A;  1QIW A;  1Y1A A;  4FQO A;  1B7T Z;  4I5N B;  3KPX A;  3NSI A;  4P2Y B;  5HKW A;  2FCD A;  3HCM A;  3EKJ A;  2KDH A;  1ALV A;  3EVU A;  2GV5 A;  1WRZ A;  2NCP A;  1DMO A;  1GQM A;  1W7I B;  1QLK A;  4GBA A;  1QS7 A;  1LA3 A;  3F45 A;  2MLE C;  1WDC C;  3BUO B;  1KQV A;  1CNP A;  4GPL B;  1A2X A;  4WRI A;  1IGV A;  2MRD A;  3BOW B;  3GK4 X;  1NSH A;  1UP5 A;  2LUX A;  1CFC A;  4YRU A;  3IF7 A;  4PDZ A;  1V1G A;  4F0Z B;  2QPT A;  1CLB A;  1TNX A;  1LXF C;  1PK0 D;  3DVK A;  2L98 A;  3IQQ A;  3BUM B;  1CM4 A;  1CTR A;  1M63 B;  2JC2 A;  2Y1M A;  1KQM C;  3VRQ A;  1DJY A;  1LKJ A;  1OSA A;  2WOR A;  1CLL A;  2F3Z A;  4PE0 A;  2Q4U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...