4NDCA

X-ray structure of a mutant (t188d) of calexcitin - a neuronal calcium-signalling protein
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
187
structure length
187
Chain Sequence
QLSDFQRNKILRVFNTFYDCNHDGVIEWDDFELAIKKICNLHSWPTDGKKHNEARATLKLIWDGLRKYADENEDEQVTKEEWLKMWAECVKSVEKGESLPEWLTKYMNFMFDVNDTSGDNIIDKHEYSTVYMSYGIPKSDCDAAFDTLSDGGKTMVTREIFARLWTEYFVSNDRGAKGNHLFGDLKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Calexcitin
publication title X-ray, spectroscopic and normal-mode dynamics of calexcitin: structure-function studies of a neuronal calcium-signalling protein.
pubmed doi rcsb
source organism Doryteuthis pealeii
total genus 74
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ndcA00
2KNEA 1M45A 2LNKA 3WHTB 1CDMA 2LVVA 4MN0A 2Q4UA 4YGEB 1R6PA 1YVLA 2F33A 2P6BB 1F4OA 1QX2A 1JF2A 1KK8B 1KK7Y 1OQPA 1UP5A 4GUKA 4N1GA 4MVFA 5CSJA 1TRFA 4XJKA 1A29A 1K93D 3AKAA 2M49B 1QIWA 1WRLA 1NSHA 3GK2A 1QLKA 3EKJA 4NDCA 1M46A 5KSZA 2TN4A 5TNCA 1WDCC 1OZOA 1WY9A 1XK4A 5J3XA 4QJ3B 1MHOA 1Y6WA 2CTNA 3VRPA 4C0JA 1NYAA 3I5HC 3OB1B 3VGOA 4OCIA 2A4JA 2JXCA 2G2BA 3EK7A 1CFDA 2BBNA 2M7LA 1SR6B 1IG5A 4FTGA 2LAPA 2LVKA 1XFVO 2PASA 4P2YB 3M0WA 1B1GA 1TNWA 2LP3A 3WNXB 1FI6A 1PALA 1RTP1 1NX3A 3WXAA 3BXKA 4JQ0D 5B8IB 4I5LB 3CWGA 4NQGA 1KCYA 4XJKB 2H61A 1YRTB 2L4IA 1DF0A 1UHNA 3O4YA 1J1EA 1SCVA 1A2XA 1SYMA 1V1GA 2M29A 1MXEA 1OMDA 5ER5A 3SIAA 1YVHA 3WHUB 2JT3A 1N0YA 1G33A 1KK7Z 2OTGB 2WCFA 4HRGA 3RM1A 1MUXA 5CSFA 1OZSA 1KFUS 1NWDA 1ZOTB 2OS8B 2LLTA 2MJWB 2EC6B 3TZ1A 1E8AA 2KGRA 4PHJA 2KQ6A 2KYFA 1B9AA 5HLOA 1QV1A 2COLB 2KBIA 1UWOA 1N65A 3DD4A 2K2AA 3BOWA 1QX5B 4N1FA 1DJXA 4CIDA 4ZCVA 4QJ5B 4AQJA 5BPJA 1SY9A 1OMRA 2I2RE 3GK1A 1PRWA 4UPGA 2K8MB 3DF0A 1SCMB 2GV5A 3OB2B 4CLNA 1IJ5A 2M9GA 4ZCUA 5KTYA 1S3PA 2JRFA 3AKBA 1QJTA 2I94A 2OTGC 3TUYB 1KWOB 1B7TY 1JF0A 1K96A 1CM4A 3OX6A 1XA5A 1XYDA 4HRHA 1CFFA 1QASA 2KI6C 2M8UA 2OS8C 1FI5A 4MLWA 2EC6C 4YGAA 1F4QA 2FJUB 1QVIY 2ZRTA 1S36A 2HQWA 4ORAB 3SG5A 4GAOA 1K90D 2Q91A 1XO5A 1QXPA 1CLMA 1S5GY 1BJFA 1DTLA 2ZN9A 1DJYA 2LV7A 3ICBA 1J7QA 3NSOA 2M3WA 1L7ZA 1BLQA 1L2OB 3D0YB 3C1VA 4DCKA 2BCAA 4CFQA 1K9UA 5AANA 4PALA 1PSBA 4PE1A 4DUQA 1JFJA 1SKTA 2BCBA 2BBMA 1LA3A 4MRXA 1MWNA 4GGNA 1NIWA 1NCXA 2ZN8A 5CSNA 5I8NA 1IQ3A 3TUYC 1KWOC 1MR8A 3DF0B 3GOFA 1BODA 2F3YA 4JPZB 4YBHB 2K61A 2KI4B 2LANA 3BUOB 3I5HB 3SG3A 2K2FA 1CMGA 1H8BA 1J7PA 1J1DA 1V1FA 1ALVA 1YUTA 3CS1A 1QS7A 1CM1A 3BUMB 3EK4A 4U8DA 1XFYO 3K21A 1EG4A 2FCEA 4I5NB 1TCOB 1PULA 1PSRA 1CDPA 3FWCA 1RFJA 1TTXA 3I5IB 5DKQA 1B7TZ 1KSMA 2CT9A 1NUBA 2WCEA 1BOCA 3AAJA 5IBWA 2JTTA 5HYDA 1L2OC 2JT8A 3FWBA 1LVCD 5I2OA 1C7WA 2LLSA 2HETA 1EL4A 1M31A 1XFXO 1RJVA 3EK8A 3ZNIA 2O5GA 2O60A 1QVIZ 3OX5A 3O78A 1XFZO 2JXLA 1AP4A 2PALA 2NZ0A 3NSIA 1XFUO 3CR4X 2KBMA 1CDNA 1S6IA 2LHLA 1NX1A 1AJ5A 1S5GZ 2K7BA 4GFTA 1QX7A 2KGBC 1B47A 4D1EA 1J7OA 4PDZA 5AEQA 1MQ1A 1SBJA 2KI4C 3KO0A 1UHHA 2MHHA 4MSPA 1FF1A 2ZRSA 1F71A 2JC2A 1KFUL 2HPSA 1JC2A 1QTXA 2D8NA 2JQ6A 2L51A 2NCOA 2F2PA 2MLEC 1OMVA 3PN7B 3IF7A 3I5IC 1U5IB 2LM5A 1BR1B 3MSEB 3BUXB 5I2QA 2CXJA 2EHBA 2V53A 4CFRA 4MEWA 1NCZA 1Y1AA 1H4BA 1NX2A 1F55A 1FBVA 1G8IA 2G9BA 4PE4A 3SIBA 2LCPA 1YR5A 1YURA 1SL8A 2L5XB 3PFVA 2BE6A 2CNPA 1J7RA 3GK4X 1CKKA 3CR2A 3I5GB 1ZMZA 3PLFB 1SL9A 1Y1XA 2CCMA 5JOLA 1UHIA 2JWWA 1XVJA 2VRGA 3DVKA 1XFWO 1B8RA 4F0ZB 5CPVA 4YGCB 3LCPC 3NSLA 1CFPA 1S1EA 1CNPA 2NCPA 1EJ3A 5GQQC 1BG1A 1DVIA 4MZJA 1YTZC 3PN7C 3TDZA 1CMFA 3E3RA 4M2QA 2K7CA 3H4SE 1CLLA 3BUWB 3D0YA 3HX4A 4M2PA 3VRQA 1K2HA 3VRRA 3BUNB 1B8LA 2RGIA 2FOTA 2K7OA 2LLUA 3JTDB 5DKRA 3I5GC 2LHIA 3HCMA 1YX7A 4WQ2A 3A8RA 1SW8A 2KAVA 2JT0A 1AUIB 1LXFC 1B8CA 4DS7A 1K8UA 1SPYA 3OHMB 1NP8A 3TDUA 3DVJA 1QIVA 2ZFDA 4OR9B 2KI6D 1ZACA 2KHNA 1IGVA 1A75B 3I5FB 2M97A 1KSOA 2PVBA 1DJIA 1EH2A 1IJ6A 3D10A 1GGWA 5KU1A 3CTNA 1PVBA 1JWDA 1C7VA 2KFGA 2H2KA 2BKIB 3JTDC 2LUXA 4DIRA 1BU3A 1EXRA 1RK9A 3OP0A 2HQ8A 1G4YR 1RWYA 1OOJA 2NLNA 4PE0A 4TNCA 3VROA 2KQYA 4M2OA 4GGFC 1NCYA 1W7JB 1TNPA 2LE9B 3TDIA 1JSAA 2F3ZA 3KPXA 2AUCA 4HSZA 1YRUB 2SASA 1TOPA 1PK0D 1HQVA 2FCDA 3DVEA 3TS5B 2F2OA 2JULA 2KDHA 2EGDA 1HT9A 4A4BA 3LK1A 5AERA 1U5IA 2ZKMX 1UHKA 2Y1MA 3I5FC 1KFXS 1WRZA 3CR5X 3PATA 1TCFA 2AAOA 4OKHA 2NXQA 2L98A 5F6TA 1VRKA 1LINA 1X02A 2WOSA 2KAXA 3IQOA 4P5OE 3ZWHA 1K94A 4WRIA 2OPOA 3DVMA 1BT6A 1IWQA 4NDBA 1S6JA 4WQ3A 1IRJA 2BL0B 4YI9A 2MAZA 2MLFC 4A4CA 2B1UA 1BF5A 1MF8B 3VRNA 3CZTX 4MZLA 2K0JA 2Y5IA 3SJSA 4YGDB 5AFPA 4JWQA 1DMOA 1SK6D 3A4UB 1CB1A 2BE4A 1QATA 4PHKA 1KQMB 1YUUA 1RROA 3FS7A 1TN4A 2JZIA 2MBXA 1NX0A 3KEVA 2LMUA 4ORCB 4OVNF 4GNKB 3TS5C 1WRKA 2PRUA 1IQ5A 1AHRA 1DJGA 2L4HA 3AAKA 4C0LA 1K95A 5K89A 5HKWA 5G08A 1C07A 4OV2A 2L2EA 4I5KA 1Y0VH 4E68A 1TIZA 1QV0A 3CLNA 2BL0C 2R2IA 1DJZA 1MXLC 2LP2A 3O6BA 1M39A 4R1EA 1TNXA 4PE7A 3F45A 3EVVA 2KOTA 5FYXA 4GGFA 3EVUA 3KHEA 3FIAA 5HKZA 1AK8A 2ISDA 1JBAA 1DT7B 2WORA 1CLBA 3LL8B 1KQMC 2JNFA 2KFHA 1W7IB 4HREE 5D69A 3RLZA 3PALA 4GPLB 2KYCA 2L50A 3SG4A 4DRWA 1A03A 1KK8C 2LC5A 1WLMA 3EVRA 1A75A 4ICBA 4MRYA 1BR4B 2ZNEA 4ORBB 4L9MA 2K7DA 3SG6A 1GJYA 2LVIA 1BMOA 1S6CA 3EKHA 4USLA 4YGBB 2LMTA 1ZFSA 5CSIA 1PVAA 2GGMA 1IKUA 1ODBA 1Q80A 1SMGA 2F8PA 4XYNA 1LKJA 1UUSA 1Y1UA 2L0PA 1M63B 1GQMA 1F70A 1GGZA 4YI8A 2LUCA 2M0RA 2MRDA 1NPQA 1QLSA 4BY4A 4PHNA 1OE9B 3IQQA 2BECA 1OSAA 2E30A 3NSKA 4NDDA 2JOJA 4QJ4B 1LA0A 1CTRA 1JFKA 1SR6C 3LLEA 4MBEA 2KAYA 4YRUA 4AQIA 5ER4X 3SG2A 1FPWA 1KQVA 2M1UA 1EG3A 4ETOA 1DJHA 2SCPA 1RECA 2KFFA 4PHMA 2KSPA 2LVJA 1CFCA 1F54A 1ZUZA 3KF9A 2IS9A 2LMVA 2Y4QA 3CGAA 2JTZA 2PMYA 1KFXL 1WLZA 3QRXA 3SG7A 5D7FA 1IH0A 2WC8A 3JVTB 1SRAA 2MA2A 5PALA 1DGVA 1AVSA 2M1KB 1UHJA 2QACA 1DF0B 2Y1NA 1J55A 4Q04A 4AOMA 1SL7A 4FQOA 4CPVA 1XK4C 2M7NA 1A4PA 5DKNA 1D1OA 4BY5A 2AMIA 2BKHB 5I2LA 3PM8A 1N2DA 1YUSA 2HF5A 1DJWA 1UURA 5HLVA 1F8HA 2WNDA 2WCBA 1TNQA 1B4CA 4PCWA 3O2PA 2ZNDA 1AJ4A 2PSRA 3PSRA 1K9PA 1YX8A 2QPTA 2I18A 3BOWB 2CBLA 2JNXA 3NXAA 1SNLA 1CDLA 5HKYA 4IL1A 3JVTC 3LK0A 2JPTA 2BCXA 2GGZA 1SCMC 1R2UA 2H61C 3BQ3A 1DGUA 1ALWA 2JU0A 1WDCB 4MZKA 5AXIA 4GBAA 4I5JA 4C0KA 1S26D 1K9KA 4N5XA 1FW4A 2I7AA 1JUOA 3BYAA 2E6WA 2DOQA 5JJGA
chains in the Genus database with same CATH superfamily
2KNEA 1M45A 2LNKA 3WHTB 1CDMA 2LVVA 4MN0A 2Q4UA 4OZDA 4YGEB 1R6PA 5FI7A 1YVLA 2F33A 2P6BB 4INXA 1F4OA 1QX2A 1JF2A 2QEHA 1KK8B 1KK7Y 1OQPA 4KYNA 1Z4HA 1UP5A 3BFBA 4GUKA 3R1VA 4N1GA 4MVFA 5CSJA 1TRFA 4XJKA 1A29A 1K93D 3AKAA 2M49B 1QIWA 1WRLA 1NSHA 3GK2A 1QLKA 3EKJA 4NDCA 1M46A 5KSZA 2TN4A 5TNCA 1WDCC 1OZOA 1WY9A 1XK4A 3L4AA 4QJ3B 1MHOA 5J3XA 1Y6WA 2CTNA 3VRPA 3IVTA 4C0JA 1LS8A 1NYAA 3I5HC 3OB1B 3RZSA 3VGOA 2BNXA 4OCIA 2A4JA 2JXCA 2G2BA 3EK7A 1CFDA 2BBNA 2M7LA 1SR6B 1IG5A 4FTGA 2LAPA 2LVKA 5EL2A 1XFVO 2PASA 4P2YB 3M0WA 1B1GA 1TNWA 2LP3A 3WNXB 1FI6A 1PALA 1RTP1 1NX3A 2ERBA 3WXAA 3BXKA 4JQ0D 5B8IB 4I5LB 3CWGA 4NQGA 1KCYA 4XJKB 2FJYA 1YRTB 2H61A 2L4IA 1DELA 1DF0A 1UHNA 2L2CA 3B87A 3O4YA 1J1EA 1SCVA 1A2XA 1SYMA 1V1GA 2M29A 1MXEA 1OMDA 5ER5A 3SIAA 1YVHA 3WHUB 2JT3A 1N0YA 1G33A 1KK7Z 2OTGB 2WCFA 4HRGA 3RM1A 3FE6A 1MUXA 5CSFA 1OZSA 1KFUS 1NWDA 1ZOTB 2OS8B 2LLTA 2MJWB 2EC6B 3TZ1A 1E8AA 2KGRA 4PHJA 2KQ6A 2KYFA 1B9AA 5HLOA 1QV1A 3R1PA 2COLB 2KBIA 1UWOA 1N65A 3DD4A 2K2AA 3BOWA 1QX5B 4N1FA 1DJXA 4CIDA 4ZCVA 4QJ5B 2H8VA 4AQJA 5BPJA 1SY9A 3R72A 1OMRA 2I2RE 3GK1A 1PRWA 4UPGA 2K8MB 3DF0A 1SCMB 2GV5A 3OB2B 4CLNA 1IJ5A 2M9GA 2QEOA 4ZCUA 5KTYA 1S3PA 2JRFA 3AKBA 1QJTA 2I94A 2OTGC 3TUYB 1KWOB 4F7FA 1OOGA 1P28A 1B7TY 1JF0A 1K96A 3PM2A 1CM4A 3OX6A 1XA5A 1XYDA 4HRHA 1CFFA 1XFRA 1QASA 2KI6C 2M8UA 2OS8C 5FI2A 1FI5A 4MLWA 2EC6C 4YGAA 1F4QA 3S0BA 2FJUB 1QVIY 2ZRTA 1S36A 2HQWA 3D74A 4ORAB 3SG5A 3OGNA 4GAOA 1K90D 2Q91A 1XO5A 1QXPA 1CLMA 1OOHA 1BJFA 1DTLA 1S5GY 1DJYA 2LV7A 2ZN9A 3ICBA 3NSOA 2M3WA 1L7ZA 1J7QA 1BLQA 1L2OB 3D0YB 3C1VA 4DCKA 2BCAA 3FE9A 4CFQA 1K9UA 5AANA 4PALA 1PSBA 4PE1A 4DUQA 1JFJA 1SKTA 2BCBA 2BBMA 1LA3A 4MRXA 1MWNA 4GGNA 1NIWA 1NCXA 2ZN8A 5CSNA 5I8NA 1IQ3A 3TUYC 5D3OA 1KWOC 1MR8A 3DF0B 3GOFA 1BODA 2F3YA 5FI6A 4JPZB 4YBHB 3B7AA 2K61A 2KI4B 2LANA 3BUOB 3BFAA 3I5HB 3SG3A 2QEBA 2K2FA 1CMGA 1H8BA 1J7PA 1J1DA 3SS5A 1V1FA 1ALVA 1YUTA 3CS1A 1QS7A 1CM1A 3NHIA 3BUMB 3EK4A 4U8DA 3D73A 1XFYO 3K21A 1EG4A 2FCEA 4I5NB 1TCOB 1PULA 1PSRA 1CDPA 2K60A 1RFJA 1TTXA 3FWCA 3I5IB 1B7TZ 5DKQA 3S0AA 1KSMA 2CT9A 1NUBA 2WCEA 3CABA 1BOCA 3AAJA 5IBWA 2JTTA 5HYDA 3CZ1A 1L2OC 2JT8A 3FWBA 1LVCD 5I2OA 1C7WA 2LLSA 2HETA 1EL4A 1M31A 1XFXO 1RJVA 3EK8A 3ZNIA 2O5GA 2O60A 1QVIZ 3OX5A 3O78A 1XFZO 2JXLA 1AP4A 2PALA 2NZ0A 3NSIA 1XFUO 3CR4X 2KBMA 1CDNA 1S6IA 2LHLA 1NX1A 1AJ5A 1S5GZ 2K7BA 4GFTA 1QX7A 2KGBC 1B47A 4D1EA 2WCMA 1J7OA 4PDZA 5AEQA 1MQ1A 1SBJA 2KI4C 3KO0A 1UHHA 2MHHA 3CYZA 4MSPA 1FF1A 2ZRSA 1F71A 2JC2A 1KFUL 2HPSA 1JC2A 1QTXA 2D8NA 2GTEA 2JQ6A 2L51A 2NCOA 2F2PA 2MLEC 1OMVA 3PN7B 3IF7A 3I5IC 1U5IB 2LM5A 1BR1B 3MSEB 3BUXB 5I2QA 3QMEA 2CXJA 2EHBA 2V53A 2WCLA 3R1OA 4MEWA 5DICA 1NCZA 1OOFA 1OW4A 1Y1AA 1NX2A 4CFRA 1F55A 1FBVA 1G8IA 1H4BA 2G9BA 4PE4A 3SIBA 2LCPA 1YR5A 1YURA 1SL8A 2L5XB 4FQTA 3PFVA 2BE6A 2CNPA 1J7RA 3GK4X 1CKKA 3CR2A 3O4XA 3I5GB 2P71A 2KLDA 1ZMZA 3PLFB 1SL9A 1Y1XA 2CCMA 5JOLA 1UHIA 2JWWA 1XVJA 2VRGA 3DVKA 1XFWO 4INWA 1B8RA 4F0ZB 5CPVA 4YGCB 2WCKA 3LCPC 3NSLA 1CFPA 1S1EA 1CNPA 2NCPA 1EJ3A 4JD9A 3DYEA 5GQQC 1BG1A 1DVIA 4MZJA 1YTZC 5HL1A 3PN7C 3TDZA 1CMFA 3E3RA 4M2QA 3S0GA 3B86A 2QDIA 2K7CA 3H4SE 3DY9A 1CLLA 3BUWB 3D0YA 3HX4A 4M2PA 3VRQA 1K2HA 3VRRA 3BUNB 1B8LA 1SSEB 2RGIA 2FOTA 2K7OA 2LLUA 3JTDB 5DKRA 3I5GC 2LHIA 3HCMA 1YX7A 2WC5A 4WQ2A 2KPHA 1IIOA 3A8RA 1SW8A 2KAVA 2JT0A 3SS4A 1AUIB 3CZ0A 1LXFC 1B8CA 4DS7A 1K8UA 1SPYA 3OHMB 3K1EA 1NP8A 3TDUA 1TUZA 3L4LA 3DVJA 1QIVA 2ZFDA 4OR9B 1QWVA 2KI6D 1ZACA 2KHNA 1IGVA 1A75B 2PQLA 3I5FB 2M97A 1KSOA 2PVBA 1DJIA 1EH2A 1IJ6A 3D10A 1GGWA 1ORGA 3NGVA 5KU1A 2JPOA 2WCJA 3CTNA 1PVBA 1JWDA 1C7VA 2KFGA 2H2KA 2BKIB 3JTDC 2LUXA 4DIRA 1BU3A 1EXRA 1RK9A 3OP0A 2HQ8A 1G4YR 1RWYA 1OOJA 2NLNA 4PE0A 4TNCA 3VROA 2KQYA 4M2OA 1C3YA 3DXLA 4GGFC 1TWOA 1NCYA 1W7JB 3FE8A 1TNPA 2LE9B 3TDIA 1JSAA 1DC1A 2F3ZA 3KPXA 2AUCA 4HSZA 1Z2CB 1YRUB 2SASA 1TOPA 1PK0D 1HQVA 2FCDA 3DVEA 3TS5B 2F2OA 1C3ZA 2JULA 1T14A 2KDHA 2EGDA 1HT9A 4A4BA 3LK1A 3CDNA 5AERA 2P70A 2WCHA 1U5IA 2ZKMX 1UHKA 2Y1MA 3I5FC 1KFXS 1WRZA 3CR5X 3D78A 1TCFA 3PATA 2AAOA 4OKHA 2NXQA 2L98A 5F6TA 1VRKA 1LINA 1X02A 2WOSA 1OOIX 2KAXA 3IQOA 4P5OE 3ZWHA 1K94A 4WRIA 2OPOA 3DVMA 1BT6A 1IWQA 4NDBA 1S6JA 4WQ3A 3Q8IA 1IRJA 2BL0B 4YI9A 2MAZA 2MLFC 4A4CA 2B1UA 1BF5A 1MF8B 3VRNA 3CZTX 4MZLA 5I94A 2K0JA 2Y5IA 3SJSA 4YGDB 5AFPA 4JWQA 2L5YA 1DMOA 1SK6D 3A4UB 1CB1A 2BE4A 1QATA 4PHKA 1KQMB 1YUUA 1RROA 3FS7A 1TN4A 2JZIA 2MBXA 1NX0A 3KEVA 2LMUA 4ORCB 4OVNF 4GNKB 3TS5C 1WRKA 2PRUA 3UNWA 1IQ5A 1AHRA 1DJGA 2L4HA 3AAKA 4C0LA 3B6XA 1K95A 5K89A 5HKWA 5G08A 3B88A 1C07A 4OV2A 2L2EA 4I5KA 1W9ZA 1Y0VH 4E68A 1TIZA 1QV0A 3CLNA 2BL0C 3OBVA 2R2IA 1DJZA 1MXLC 2LP2A 3O6BA 1M39A 4R1EA 1TNXA 4PE7A 3DZTA 3F45A 3EVVA 2KOTA 5FYXA 4GGFA 2YGUA 3BJHA 3EVUA 3KHEA 3FIAA 5HKZA 4IJ7A 1AK8A 2ISDA 1JBAA 1DT7B 1DQEA 2WORA 1CLBA 3LL8B 1KQMC 2JNFA 2KFHA 1W7IB 4HREE 5D69A 3RLZA 3PALA 4GPLB 4PT1A 2KYCA 2L50A 3SG4A 4DRWA 1A03A 1KK8C 3NHTA 2LC5A 1WLMA 3N7HA 3EVRA 1A75A 4ICBA 4MRYA 1BR4B 3EG5B 2ZNEA 4ORBB 4L9MA 2K7DA 3D75A 3SG6A 1GJYA 2LVIA 1BMOA 1S6CA 3EKHA 4USLA 4YGBB 3V2LA 3UO9A 2LMTA 1ZFSA 5CSIA 1PVAA 2GGMA 1IKUA 1ODBA 1Q80A 1SMGA 2F8PA 2PYQA 4XYNA 1LKJA 1UUSA 1Y1UA 2L0PA 3D76A 1M63B 1GQMA 1F70A 1GGZA 4YI8A 2LUCA 2M0RA 2MRDA 1NPQA 1QLSA 4BY4A 4PHNA 1OE9B 3IQQA 2KLEA 2BECA 1OSAA 2E30A 3NSKA 4NDDA 2JOJA 4QJ4B 1LA0A 1CTRA 1JFKA 1SR6C 3LLEA 4MBEA 2KAYA 4YRUA 4AQIA 5ER4X 3SG2A 1FPWA 1KQVA 2M1UA 1EG3A 4ETOA 1DJHA 3D77A 2SCPA 1RECA 2KFFA 4PHMA 2KSPA 2LVJA 1CFCA 1F54A 1ZUZA 3KF9A 2IS9A 2LMVA 2Y4QA 3CGAA 2JTZA 2PMYA 1KFXL 1WLZA 3QRXA 3BFHA 5D7FA 3SG7A 1IH0A 2WC8A 3JVTB 1SRAA 2MA2A 5PALA 1DGVA 1AVSA 2M1KB 2WC6A 1UHJA 2QACA 1DF0B 2Y1NA 1J55A 4Q04A 4AOMA 1SL7A 4FQOA 4CPVA 1XK4C 2M7NA 1A4PA 5DKNA 3S0DA 1D1OA 4BY5A 2AMIA 3S0EA 2BKHB 5I2LA 3PM8A 1N2DA 1YUSA 2HF5A 1DJWA 1UURA 5HLVA 1F8HA 3CZ2A 2WNDA 2WCBA 1TNQA 3PJIA 1B4CA 4PCWA 3O2PA 2ZNDA 1AJ4A 2PSRA 3PSRA 1K9PA 1YX8A 1GM0A 2QPTA 3S0FA 2I18A 3BOWB 2CBLA 2JNXA 3NXAA 1SNLA 1CDLA 5HKYA 4IL1A 1TUJA 1DEKA 3JVTC 3LK0A 2JPTA 2BCXA 2GGZA 1SCMC 1R2UA 3SS3A 2QEVA 2H61C 3BQ3A 1DGUA 1ALWA 4JKTA 2JU0A 1WDCB 4MZKA 5AXIA 4GBAA 4I5JA 4C0KA 1S26D 1K9KA 4N5XA 1FW4A 2I7AA 1JUOA 3BYAA 2E6WA 3VB1A 2DOQA 3L47A 5JJGA 2BAPA
chains in the Genus database with same CATH topology
2KNEA 1M45A 2LNKA 3WHTB 1CDMA 2LVVA 4MN0A 2Q4UA 4YGEB 1R6PA 1YVLA 2F33A 2P6BB 1F4OA 1QX2A 1JF2A 1KK8B 1KK7Y 1OQPA 1UP5A 4GUKA 4N1GA 4MVFA 5CSJA 1TRFA 4XJKA 1A29A 1K93D 3AKAA 2M49B 1QIWA 1WRLA 1NSHA 3GK2A 1QLKA 3EKJA 4NDCA 1M46A 5KSZA 2TN4A 5TNCA 1WDCC 1OZOA 1WY9A 1XK4A 5J3XA 4QJ3B 1MHOA 1Y6WA 2CTNA 3VRPA 4C0JA 1NYAA 3I5HC 3OB1B 3VGOA 4OCIA 2A4JA 2JXCA 2G2BA 3EK7A 1CFDA 2BBNA 2M7LA 1SR6B 1IG5A 4FTGA 2LAPA 2LVKA 1XFVO 2PASA 4P2YB 3M0WA 1B1GA 1TNWA 2LP3A 3WNXB 1FI6A 1PALA 1RTP1 1NX3A 3WXAA 3BXKA 4JQ0D 5B8IB 4I5LB 3CWGA 4NQGA 1KCYA 4XJKB 2H61A 1YRTB 2L4IA 1DF0A 1UHNA 3O4YA 1J1EA 1SCVA 1A2XA 1SYMA 1V1GA 2M29A 1MXEA 1OMDA 5ER5A 3SIAA 1YVHA 3WHUB 2JT3A 1N0YA 1G33A 1KK7Z 2OTGB 2WCFA 4HRGA 3RM1A 1MUXA 5CSFA 1OZSA 1KFUS 1NWDA 1ZOTB 2OS8B 2LLTA 2MJWB 2EC6B 3TZ1A 1E8AA 2KGRA 4PHJA 2KQ6A 2KYFA 1B9AA 5HLOA 1QV1A 2COLB 2KBIA 1UWOA 1N65A 3DD4A 2K2AA 3BOWA 1QX5B 4N1FA 1DJXA 4CIDA 4ZCVA 4QJ5B 4AQJA 5BPJA 1SY9A 1OMRA 2I2RE 3GK1A 1PRWA 4UPGA 2K8MB 3DF0A 1SCMB 2GV5A 3OB2B 4CLNA 1IJ5A 2M9GA 4ZCUA 5KTYA 1S3PA 2JRFA 3AKBA 1QJTA 2I94A 2OTGC 3TUYB 1KWOB 1B7TY 1JF0A 1K96A 1CM4A 3OX6A 1XA5A 1XYDA 4HRHA 1CFFA 1QASA 2KI6C 2M8UA 2OS8C 1FI5A 4MLWA 2EC6C 4YGAA 1F4QA 2FJUB 1QVIY 2ZRTA 1S36A 2HQWA 4ORAB 3SG5A 4GAOA 1K90D 2Q91A 1XO5A 1QXPA 1CLMA 1S5GY 1BJFA 1DTLA 2ZN9A 1DJYA 2LV7A 3ICBA 1J7QA 3NSOA 2M3WA 1L7ZA 1BLQA 1L2OB 3D0YB 3C1VA 4DCKA 2BCAA 4CFQA 1K9UA 5AANA 4PALA 1PSBA 4PE1A 4DUQA 1JFJA 1SKTA 2BCBA 2BBMA 1LA3A 4MRXA 1MWNA 4GGNA 1NIWA 1NCXA 2ZN8A 5CSNA 5I8NA 1IQ3A 3TUYC 1KWOC 1MR8A 3DF0B 3GOFA 1BODA 2F3YA 4JPZB 4YBHB 2K61A 2KI4B 2LANA 3BUOB 3I5HB 3SG3A 2K2FA 1CMGA 1H8BA 1J7PA 1J1DA 1V1FA 1ALVA 1YUTA 3CS1A 1QS7A 1CM1A 3BUMB 3EK4A 4U8DA 1XFYO 3K21A 1EG4A 2FCEA 4I5NB 1TCOB 1PULA 1PSRA 1CDPA 3FWCA 1RFJA 1TTXA 3I5IB 5DKQA 1B7TZ 1KSMA 2CT9A 1NUBA 2WCEA 1BOCA 3AAJA 5IBWA 2JTTA 5HYDA 1L2OC 2JT8A 3FWBA 1LVCD 5I2OA 1C7WA 2LLSA 2HETA 1EL4A 1M31A 1XFXO 1RJVA 3EK8A 3ZNIA 2O5GA 2O60A 1QVIZ 3OX5A 3O78A 1XFZO 2JXLA 1AP4A 2PALA 2NZ0A 3NSIA 1XFUO 3CR4X 2KBMA 1CDNA 1S6IA 2LHLA 1NX1A 1AJ5A 1S5GZ 2K7BA 4GFTA 1QX7A 2KGBC 1B47A 4D1EA 1J7OA 4PDZA 5AEQA 1MQ1A 1SBJA 2KI4C 3KO0A 1UHHA 2MHHA 4MSPA 1FF1A 2ZRSA 1F71A 2JC2A 1KFUL 2HPSA 1JC2A 1QTXA 2D8NA 2JQ6A 2L51A 2NCOA 2F2PA 2MLEC 1OMVA 3PN7B 3IF7A 3I5IC 1U5IB 2LM5A 1BR1B 3MSEB 3BUXB 5I2QA 2CXJA 2EHBA 2V53A 4CFRA 4MEWA 1NCZA 1Y1AA 1H4BA 1NX2A 1F55A 1FBVA 1G8IA 2G9BA 4PE4A 3SIBA 2LCPA 1YR5A 1YURA 1SL8A 2L5XB 3PFVA 2BE6A 2CNPA 1J7RA 3GK4X 1CKKA 3CR2A 3I5GB 1ZMZA 3PLFB 1SL9A 1Y1XA 2CCMA 5JOLA 1UHIA 2JWWA 1XVJA 2VRGA 3DVKA 1XFWO 1B8RA 4F0ZB 5CPVA 4YGCB 3LCPC 3NSLA 1CFPA 1S1EA 1CNPA 2NCPA 1EJ3A 5GQQC 1BG1A 1DVIA 4MZJA 1YTZC 3PN7C 3TDZA 1CMFA 3E3RA 4M2QA 2K7CA 3H4SE 1CLLA 3BUWB 3D0YA 3HX4A 4M2PA 3VRQA 1K2HA 3VRRA 3BUNB 1B8LA 2RGIA 2FOTA 2K7OA 2LLUA 3JTDB 5DKRA 3I5GC 2LHIA 3HCMA 1YX7A 4WQ2A 3A8RA 1SW8A 2KAVA 2JT0A 1AUIB 1LXFC 1B8CA 4DS7A 1K8UA 1SPYA 3OHMB 1NP8A 3TDUA 3DVJA 1QIVA 2ZFDA 4OR9B 2KI6D 1ZACA 2KHNA 1IGVA 1A75B 3I5FB 2M97A 1KSOA 2PVBA 1DJIA 1EH2A 1IJ6A 3D10A 1GGWA 5KU1A 3CTNA 1PVBA 1JWDA 1C7VA 2KFGA 2H2KA 2BKIB 3JTDC 2LUXA 4DIRA 1BU3A 1EXRA 1RK9A 3OP0A 2HQ8A 1G4YR 1RWYA 1OOJA 2NLNA 4PE0A 4TNCA 3VROA 2KQYA 4M2OA 4GGFC 1NCYA 1W7JB 1TNPA 2LE9B 3TDIA 1JSAA 2F3ZA 3KPXA 2AUCA 4HSZA 1YRUB 2SASA 1TOPA 1PK0D 1HQVA 2FCDA 3DVEA 3TS5B 2F2OA 2JULA 2KDHA 2EGDA 1HT9A 4A4BA 3LK1A 5AERA 1U5IA 2ZKMX 1UHKA 2Y1MA 3I5FC 1KFXS 1WRZA 3CR5X 3PATA 1TCFA 2AAOA 4OKHA 2NXQA 2L98A 5F6TA 1VRKA 1LINA 1X02A 2WOSA 2KAXA 3IQOA 4P5OE 3ZWHA 1K94A 4WRIA 2OPOA 3DVMA 1BT6A 1IWQA 4NDBA 1S6JA 4WQ3A 1IRJA 2BL0B 4YI9A 2MAZA 2MLFC 4A4CA 2B1UA 1BF5A 1MF8B 3VRNA 3CZTX 4MZLA 2K0JA 2Y5IA 3SJSA 4YGDB 5AFPA 4JWQA 1DMOA 1SK6D 3A4UB 1CB1A 2BE4A 1QATA 4PHKA 1KQMB 1YUUA 1RROA 3FS7A 1TN4A 2JZIA 2MBXA 1NX0A 3KEVA 2LMUA 4ORCB 4OVNF 4GNKB 3TS5C 1WRKA 2PRUA 1IQ5A 1AHRA 1DJGA 2L4HA 3AAKA 4C0LA 1K95A 5K89A 5HKWA 5G08A 1C07A 4OV2A 2L2EA 4I5KA 1Y0VH 4E68A 1TIZA 1QV0A 3CLNA 2BL0C 2R2IA 1DJZA 1MXLC 2LP2A 3O6BA 1M39A 4R1EA 1TNXA 4PE7A 3F45A 3EVVA 2KOTA 5FYXA 4GGFA 3EVUA 3KHEA 3FIAA 5HKZA 1AK8A 2ISDA 1JBAA 1DT7B 2WORA 1CLBA 3LL8B 1KQMC 2JNFA 2KFHA 1W7IB 4HREE 5D69A 3RLZA 3PALA 4GPLB 2KYCA 2L50A 3SG4A 4DRWA 1A03A 1KK8C 2LC5A 1WLMA 3EVRA 1A75A 4ICBA 4MRYA 1BR4B 2ZNEA 4ORBB 4L9MA 2K7DA 3SG6A 1GJYA 2LVIA 1BMOA 1S6CA 3EKHA 4USLA 4YGBB 2LMTA 1ZFSA 5CSIA 1PVAA 2GGMA 1IKUA 1ODBA 1Q80A 1SMGA 2F8PA 4XYNA 1LKJA 1UUSA 1Y1UA 2L0PA 1M63B 1GQMA 1F70A 1GGZA 4YI8A 2LUCA 2M0RA 2MRDA 1NPQA 1QLSA 4BY4A 4PHNA 1OE9B 3IQQA 2BECA 1OSAA 2E30A 3NSKA 4NDDA 2JOJA 4QJ4B 1LA0A 1CTRA 1JFKA 1SR6C 3LLEA 4MBEA 2KAYA 4YRUA 4AQIA 5ER4X 3SG2A 1FPWA 1KQVA 2M1UA 1EG3A 4ETOA 1DJHA 2SCPA 1RECA 2KFFA 4PHMA 2KSPA 2LVJA 1CFCA 1F54A 1ZUZA 3KF9A 2IS9A 2LMVA 2Y4QA 3CGAA 2JTZA 2PMYA 1KFXL 1WLZA 3QRXA 3SG7A 5D7FA 1IH0A 2WC8A 3JVTB 1SRAA 2MA2A 5PALA 1DGVA 1AVSA 2M1KB 1UHJA 2QACA 1DF0B 2Y1NA 1J55A 4Q04A 4AOMA 1SL7A 4FQOA 4CPVA 1XK4C 2M7NA 1A4PA 5DKNA 1D1OA 4BY5A 2AMIA 2BKHB 5I2LA 3PM8A 1N2DA 1YUSA 2HF5A 1DJWA 1UURA 5HLVA 1F8HA 2WNDA 2WCBA 1TNQA 1B4CA 4PCWA 3O2PA 2ZNDA 1AJ4A 2PSRA 3PSRA 1K9PA 1YX8A 2QPTA 2I18A 3BOWB 2CBLA 2JNXA 3NXAA 1SNLA 1CDLA 5HKYA 4IL1A 3JVTC 3LK0A 2JPTA 2BCXA 2GGZA 1SCMC 1R2UA 2H61C 3BQ3A 1DGUA 1ALWA 2JU0A 1WDCB 4MZKA 5AXIA 4GBAA 4I5JA 4C0KA 1S26D 1K9KA 4N5XA 1FW4A 2I7AA 1JUOA 3BYAA 2E6WA 2DOQA 5JJGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KNE A;  1M45 A;  2LNK A;  3WHT B;  1CDM A;  2LVV A;  4MN0 A;  2Q4U A;  4YGE B;  1R6P A;  1YVL A;  2F33 A;  2P6B B;  1F4O A;  1QX2 A;  1JF2 A;  1KK8 B;  1KK7 Y;  1OQP A;  1UP5 A;  4GUK A;  4N1G A;  4MVF A;  5CSJ A;  1TRF A;  4XJK A;  1A29 A;  1K93 D;  3AKA A;  2M49 B;  1QIW A;  1WRL A;  1NSH A;  3GK2 A;  1QLK A;  3EKJ A;  4NDC A;  1M46 A;  5KSZ A;  2TN4 A;  5TNC A;  1WDC C;  1OZO A;  1WY9 A;  1XK4 A;  5J3X A;  4QJ3 B;  1MHO A;  1Y6W A;  2CTN A;  3VRP A;  4C0J A;  1NYA A;  3I5H C;  3OB1 B;  3VGO A;  4OCI A;  2A4J A;  2JXC A;  2G2B A;  3EK7 A;  1CFD A;  2BBN A;  2M7L A;  1SR6 B;  1IG5 A;  4FTG A;  2LAP A;  2LVK A;  1XFV O;  2PAS A;  4P2Y B;  3M0W A;  1B1G A;  1TNW A;  2LP3 A;  3WNX B;  1FI6 A;  1PAL A;  1RTP 1;  1NX3 A;  3WXA A;  3BXK A;  4JQ0 D;  5B8I B;  4I5L B;  3CWG A;  4NQG A;  1KCY A;  4XJK B;  2H61 A;  1YRT B;  2L4I A;  1DF0 A;  1UHN A;  3O4Y A;  1J1E A;  1SCV A;  1A2X A;  1SYM A;  1V1G A;  2M29 A;  1MXE A;  1OMD A;  5ER5 A;  3SIA A;  1YVH A;  3WHU B;  2JT3 A;  1N0Y A;  1G33 A;  1KK7 Z;  2OTG B;  2WCF A;  4HRG A;  3RM1 A;  1MUX A;  5CSF A;  1OZS A;  1KFU S;  1NWD A;  1ZOT B;  2OS8 B;  2LLT A;  2MJW B;  2EC6 B;  3TZ1 A;  1E8A A;  2KGR A;  4PHJ A;  2KQ6 A;  2KYF A;  1B9A A;  5HLO A;  1QV1 A;  2COL B;  2KBI A;  1UWO A;  1N65 A;  3DD4 A;  2K2A A;  3BOW A;  1QX5 B;  4N1F A;  1DJX A;  4CID A;  4ZCV A;  4QJ5 B;  4AQJ A;  5BPJ A;  1SY9 A;  1OMR A;  2I2R E;  3GK1 A;  1PRW A;  4UPG A;  2K8M B;  3DF0 A;  1SCM B;  2GV5 A;  3OB2 B;  4CLN A;  1IJ5 A;  2M9G A;  4ZCU A;  5KTY A;  1S3P A;  2JRF A;  3AKB A;  1QJT A;  2I94 A;  2OTG C;  3TUY B;  1KWO B;  1B7T Y;  1JF0 A;  1K96 A;  1CM4 A;  3OX6 A;  1XA5 A;  1XYD A;  4HRH A;  1CFF A;  1QAS A;  2KI6 C;  2M8U A;  2OS8 C;  1FI5 A;  4MLW A;  2EC6 C;  4YGA A;  1F4Q A;  2FJU B;  1QVI Y;  2ZRT A;  1S36 A;  2HQW A;  4ORA B;  3SG5 A;  4GAO A;  1K90 D;  2Q91 A;  1XO5 A;  1QXP A;  1CLM A;  1S5G Y;  1BJF A;  1DTL A;  2ZN9 A;  1DJY A;  2LV7 A;  3ICB A;  1J7Q A;  3NSO A;  2M3W A;  1L7Z A;  1BLQ A;  1L2O B;  3D0Y B;  3C1V A;  4DCK A;  2BCA A;  4CFQ A;  1K9U A;  5AAN A;  4PAL A;  1PSB A;  4PE1 A;  4DUQ A;  1JFJ A;  1SKT A;  2BCB A;  2BBM A;  1LA3 A;  4MRX A;  1MWN A;  4GGN A;  1NIW A;  1NCX A;  2ZN8 A;  5CSN A;  5I8N A;  1IQ3 A;  3TUY C;  1KWO C;  1MR8 A;  3DF0 B;  3GOF A;  1BOD A;  2F3Y A;  4JPZ B;  4YBH B;  2K61 A;  2KI4 B;  2LAN A;  3BUO B;  3I5H B;  3SG3 A;  2K2F A;  1CMG A;  1H8B A;  1J7P A;  1J1D A;  1V1F A;  1ALV A;  1YUT A;  3CS1 A;  1QS7 A;  1CM1 A;  3BUM B;  3EK4 A;  4U8D A;  1XFY O;  3K21 A;  1EG4 A;  2FCE A;  4I5N B;  1TCO B;  1PUL A;  1PSR A;  1CDP A;  3FWC A;  1RFJ A;  1TTX A;  3I5I B;  5DKQ A;  1B7T Z;  1KSM A;  2CT9 A;  1NUB A;  2WCE A;  1BOC A;  3AAJ A;  5IBW A;  2JTT A;  5HYD A;  1L2O C;  2JT8 A;  3FWB A;  1LVC D;  5I2O A;  1C7W A;  2LLS A;  2HET A;  1EL4 A;  1M31 A;  1XFX O;  1RJV A;  3EK8 A;  3ZNI A;  2O5G A;  2O60 A;  1QVI Z;  3OX5 A;  3O78 A;  1XFZ O;  2JXL A;  1AP4 A;  2PAL A;  2NZ0 A;  3NSI A;  1XFU O;  3CR4 X;  2KBM A;  1CDN A;  1S6I A;  2LHL A;  1NX1 A;  1AJ5 A;  1S5G Z;  2K7B A;  4GFT A;  1QX7 A;  2KGB C;  1B47 A;  4D1E A;  1J7O A;  4PDZ A;  5AEQ A;  1MQ1 A;  1SBJ A;  2KI4 C;  3KO0 A;  1UHH A;  2MHH A;  4MSP A;  1FF1 A;  2ZRS A;  1F71 A;  2JC2 A;  1KFU L;  2HPS A;  1JC2 A;  1QTX A;  2D8N A;  2JQ6 A;  2L51 A;  2NCO A;  2F2P A;  2MLE C;  1OMV A;  3PN7 B;  3IF7 A;  3I5I C;  1U5I B;  2LM5 A;  1BR1 B;  3MSE B;  3BUX B;  5I2Q A;  2CXJ A;  2EHB A;  2V53 A;  4CFR A;  4MEW A;  1NCZ A;  1Y1A A;  1H4B A;  1NX2 A;  1F55 A;  1FBV A;  1G8I A;  2G9B A;  4PE4 A;  3SIB A;  2LCP A;  1YR5 A;  1YUR A;  1SL8 A;  2L5X B;  3PFV A;  2BE6 A;  2CNP A;  1J7R A;  3GK4 X;  1CKK A;  3CR2 A;  3I5G B;  1ZMZ A;  3PLF B;  1SL9 A;  1Y1X A;  2CCM A;  5JOL A;  1UHI A;  2JWW A;  1XVJ A;  2VRG A;  3DVK A;  1XFW O;  1B8R A;  4F0Z B;  5CPV A;  4YGC B;  3LCP C;  3NSL A;  1CFP A;  1S1E A;  1CNP A;  2NCP A;  1EJ3 A;  5GQQ C;  1BG1 A;  1DVI A;  4MZJ A;  1YTZ C;  3PN7 C;  3TDZ A;  1CMF A;  3E3R A;  4M2Q A;  2K7C A;  3H4S E;  1CLL A;  3BUW B;  3D0Y A;  3HX4 A;  4M2P A;  3VRQ A;  1K2H A;  3VRR A;  3BUN B;  1B8L A;  2RGI A;  2FOT A;  2K7O A;  2LLU A;  3JTD B;  5DKR A;  3I5G C;  2LHI A;  3HCM A;  1YX7 A;  4WQ2 A;  3A8R A;  1SW8 A;  2KAV A;  2JT0 A;  1AUI B;  1LXF C;  1B8C A;  4DS7 A;  1K8U A;  1SPY A;  3OHM B;  1NP8 A;  3TDU A;  3DVJ A;  1QIV A;  2ZFD A;  4OR9 B;  2KI6 D;  1ZAC A;  2KHN A;  1IGV A;  1A75 B;  3I5F B;  2M97 A;  1KSO A;  2PVB A;  1DJI A;  1EH2 A;  1IJ6 A;  3D10 A;  1GGW A;  5KU1 A;  3CTN A;  1PVB A;  1JWD A;  1C7V A;  2KFG A;  2H2K A;  2BKI B;  3JTD C;  2LUX A;  4DIR A;  1BU3 A;  1EXR A;  1RK9 A;  3OP0 A;  2HQ8 A;  1G4Y R;  1RWY A;  1OOJ A;  2NLN A;  4PE0 A;  4TNC A;  3VRO A;  2KQY A;  4M2O A;  4GGF C;  1NCY A;  1W7J B;  1TNP A;  2LE9 B;  3TDI A;  1JSA A;  2F3Z A;  3KPX A;  2AUC A;  4HSZ A;  1YRU B;  2SAS A;  1TOP A;  1PK0 D;  1HQV A;  2FCD A;  3DVE A;  3TS5 B;  2F2O A;  2JUL A;  2KDH A;  2EGD A;  1HT9 A;  4A4B A;  3LK1 A;  5AER A;  1U5I A;  2ZKM X;  1UHK A;  2Y1M A;  3I5F C;  1KFX S;  1WRZ A;  3CR5 X;  3PAT A;  1TCF A;  2AAO A;  4OKH A;  2NXQ A;  2L98 A;  5F6T A;  1VRK A;  1LIN A;  1X02 A;  2WOS A;  2KAX A;  3IQO A;  4P5O E;  3ZWH A;  1K94 A;  4WRI A;  2OPO A;  3DVM A;  1BT6 A;  1IWQ A;  4NDB A;  1S6J A;  4WQ3 A;  1IRJ A;  2BL0 B;  4YI9 A;  2MAZ A;  2MLF C;  4A4C A;  2B1U A;  1BF5 A;  1MF8 B;  3VRN A;  3CZT X;  4MZL A;  2K0J A;  2Y5I A;  3SJS A;  4YGD B;  5AFP A;  4JWQ A;  1DMO A;  1SK6 D;  3A4U B;  1CB1 A;  2BE4 A;  1QAT A;  4PHK A;  1KQM B;  1YUU A;  1RRO A;  3FS7 A;  1TN4 A;  2JZI A;  2MBX A;  1NX0 A;  3KEV A;  2LMU A;  4ORC B;  4OVN F;  4GNK B;  3TS5 C;  1WRK A;  2PRU A;  1IQ5 A;  1AHR A;  1DJG A;  2L4H A;  3AAK A;  4C0L A;  1K95 A;  5K89 A;  5HKW A;  5G08 A;  1C07 A;  4OV2 A;  2L2E A;  4I5K A;  1Y0V H;  4E68 A;  1TIZ A;  1QV0 A;  3CLN A;  2BL0 C;  2R2I A;  1DJZ A;  1MXL C;  2LP2 A;  3O6B A;  1M39 A;  4R1E A;  1TNX A;  4PE7 A;  3F45 A;  3EVV A;  2KOT A;  5FYX A;  4GGF A;  3EVU A;  3KHE A;  3FIA A;  5HKZ A;  1AK8 A;  2ISD A;  1JBA A;  1DT7 B;  2WOR A;  1CLB A;  3LL8 B;  1KQM C;  2JNF A;  2KFH A;  1W7I B;  4HRE E;  5D69 A;  3RLZ A;  3PAL A;  4GPL B;  2KYC A;  2L50 A;  3SG4 A;  4DRW A;  1A03 A;  1KK8 C;  2LC5 A;  1WLM A;  3EVR A;  1A75 A;  4ICB A;  4MRY A;  1BR4 B;  2ZNE A;  4ORB B;  4L9M A;  2K7D A;  3SG6 A;  1GJY A;  2LVI A;  1BMO A;  1S6C A;  3EKH A;  4USL A;  4YGB B;  2LMT A;  1ZFS A;  5CSI A;  1PVA A;  2GGM A;  1IKU A;  1ODB A;  1Q80 A;  1SMG A;  2F8P A;  4XYN A;  1LKJ A;  1UUS A;  1Y1U A;  2L0P A;  1M63 B;  1GQM A;  1F70 A;  1GGZ A;  4YI8 A;  2LUC A;  2M0R A;  2MRD A;  1NPQ A;  1QLS A;  4BY4 A;  4PHN A;  1OE9 B;  3IQQ A;  2BEC A;  1OSA A;  2E30 A;  3NSK A;  4NDD A;  2JOJ A;  4QJ4 B;  1LA0 A;  1CTR A;  1JFK A;  1SR6 C;  3LLE A;  4MBE A;  2KAY A;  4YRU A;  4AQI A;  5ER4 X;  3SG2 A;  1FPW A;  1KQV A;  2M1U A;  1EG3 A;  4ETO A;  1DJH A;  2SCP A;  1REC A;  2KFF A;  4PHM A;  2KSP A;  2LVJ A;  1CFC A;  1F54 A;  1ZUZ A;  3KF9 A;  2IS9 A;  2LMV A;  2Y4Q A;  3CGA A;  2JTZ A;  2PMY A;  1KFX L;  1WLZ A;  3QRX A;  3SG7 A;  5D7F A;  1IH0 A;  2WC8 A;  3JVT B;  1SRA A;  2MA2 A;  5PAL A;  1DGV A;  1AVS A;  2M1K B;  1UHJ A;  2QAC A;  1DF0 B;  2Y1N A;  1J55 A;  4Q04 A;  4AOM A;  1SL7 A;  4FQO A;  4CPV A;  1XK4 C;  2M7N A;  1A4P A;  5DKN A;  1D1O A;  4BY5 A;  2AMI A;  2BKH B;  5I2L A;  3PM8 A;  1N2D A;  1YUS A;  2HF5 A;  1DJW A;  1UUR A;  5HLV A;  1F8H A;  2WND A;  2WCB A;  1TNQ A;  1B4C A;  4PCW A;  3O2P A;  2ZND A;  1AJ4 A;  2PSR A;  3PSR A;  1K9P A;  1YX8 A;  2QPT A;  2I18 A;  3BOW B;  2CBL A;  2JNX A;  3NXA A;  1SNL A;  1CDL A;  5HKY A;  4IL1 A;  3JVT C;  3LK0 A;  2JPT A;  2BCX A;  2GGZ A;  1SCM C;  1R2U A;  2H61 C;  3BQ3 A;  1DGU A;  1ALW A;  2JU0 A;  1WDC B;  4MZK A;  5AXI A;  4GBA A;  4I5J A;  4C0K A;  1S26 D;  1K9K A;  4N5X A;  1FW4 A;  2I7A A;  1JUO A;  3BYA A;  2E6W A;  2DOQ A;  5JJG A; 
#chains in the Genus database with same CATH topology
 2KNE A;  1M45 A;  2LNK A;  3WHT B;  1CDM A;  2LVV A;  4MN0 A;  2Q4U A;  4OZD A;  4YGE B;  1R6P A;  5FI7 A;  1YVL A;  2F33 A;  2P6B B;  4INX A;  1F4O A;  1QX2 A;  1JF2 A;  2QEH A;  1KK8 B;  1KK7 Y;  1OQP A;  4KYN A;  1Z4H A;  1UP5 A;  3BFB A;  4GUK A;  3R1V A;  4N1G A;  4MVF A;  5CSJ A;  1TRF A;  4XJK A;  1A29 A;  1K93 D;  3AKA A;  2M49 B;  1QIW A;  1WRL A;  1NSH A;  3GK2 A;  1QLK A;  3EKJ A;  4NDC A;  1M46 A;  5KSZ A;  2TN4 A;  5TNC A;  1WDC C;  1OZO A;  1WY9 A;  1XK4 A;  3L4A A;  4QJ3 B;  1MHO A;  5J3X A;  1Y6W A;  2CTN A;  3VRP A;  3IVT A;  4C0J A;  1LS8 A;  1NYA A;  3I5H C;  3OB1 B;  3RZS A;  3VGO A;  2BNX A;  4OCI A;  2A4J A;  2JXC A;  2G2B A;  3EK7 A;  1CFD A;  2BBN A;  2M7L A;  1SR6 B;  1IG5 A;  4FTG A;  2LAP A;  2LVK A;  5EL2 A;  1XFV O;  2PAS A;  4P2Y B;  3M0W A;  1B1G A;  1TNW A;  2LP3 A;  3WNX B;  1FI6 A;  1PAL A;  1RTP 1;  1NX3 A;  2ERB A;  3WXA A;  3BXK A;  4JQ0 D;  5B8I B;  4I5L B;  3CWG A;  4NQG A;  1KCY A;  4XJK B;  2FJY A;  1YRT B;  2H61 A;  2L4I A;  1DEL A;  1DF0 A;  1UHN A;  2L2C A;  3B87 A;  3O4Y A;  1J1E A;  1SCV A;  1A2X A;  1SYM A;  1V1G A;  2M29 A;  1MXE A;  1OMD A;  5ER5 A;  3SIA A;  1YVH A;  3WHU B;  2JT3 A;  1N0Y A;  1G33 A;  1KK7 Z;  2OTG B;  2WCF A;  4HRG A;  3RM1 A;  3FE6 A;  1MUX A;  5CSF A;  1OZS A;  1KFU S;  1NWD A;  1ZOT B;  2OS8 B;  2LLT A;  2MJW B;  2EC6 B;  3TZ1 A;  1E8A A;  2KGR A;  4PHJ A;  2KQ6 A;  2KYF A;  1B9A A;  5HLO A;  1QV1 A;  3R1P A;  2COL B;  2KBI A;  1UWO A;  1N65 A;  3DD4 A;  2K2A A;  3BOW A;  1QX5 B;  4N1F A;  1DJX A;  4CID A;  4ZCV A;  4QJ5 B;  2H8V A;  4AQJ A;  5BPJ A;  1SY9 A;  3R72 A;  1OMR A;  2I2R E;  3GK1 A;  1PRW A;  4UPG A;  2K8M B;  3DF0 A;  1SCM B;  2GV5 A;  3OB2 B;  4CLN A;  1IJ5 A;  2M9G A;  2QEO A;  4ZCU A;  5KTY A;  1S3P A;  2JRF A;  3AKB A;  1QJT A;  2I94 A;  2OTG C;  3TUY B;  1KWO B;  4F7F A;  1OOG A;  1P28 A;  1B7T Y;  1JF0 A;  1K96 A;  3PM2 A;  1CM4 A;  3OX6 A;  1XA5 A;  1XYD A;  4HRH A;  1CFF A;  1XFR A;  1QAS A;  2KI6 C;  2M8U A;  2OS8 C;  5FI2 A;  1FI5 A;  4MLW A;  2EC6 C;  4YGA A;  1F4Q A;  3S0B A;  2FJU B;  1QVI Y;  2ZRT A;  1S36 A;  2HQW A;  3D74 A;  4ORA B;  3SG5 A;  3OGN A;  4GAO A;  1K90 D;  2Q91 A;  1XO5 A;  1QXP A;  1CLM A;  1OOH A;  1BJF A;  1DTL A;  1S5G Y;  1DJY A;  2LV7 A;  2ZN9 A;  3ICB A;  3NSO A;  2M3W A;  1L7Z A;  1J7Q A;  1BLQ A;  1L2O B;  3D0Y B;  3C1V A;  4DCK A;  2BCA A;  3FE9 A;  4CFQ A;  1K9U A;  5AAN A;  4PAL A;  1PSB A;  4PE1 A;  4DUQ A;  1JFJ A;  1SKT A;  2BCB A;  2BBM A;  1LA3 A;  4MRX A;  1MWN A;  4GGN A;  1NIW A;  1NCX A;  2ZN8 A;  5CSN A;  5I8N A;  1IQ3 A;  3TUY C;  5D3O A;  1KWO C;  1MR8 A;  3DF0 B;  3GOF A;  1BOD A;  2F3Y A;  5FI6 A;  4JPZ B;  4YBH B;  3B7A A;  2K61 A;  2KI4 B;  2LAN A;  3BUO B;  3BFA A;  3I5H B;  3SG3 A;  2QEB A;  2K2F A;  1CMG A;  1H8B A;  1J7P A;  1J1D A;  3SS5 A;  1V1F A;  1ALV A;  1YUT A;  3CS1 A;  1QS7 A;  1CM1 A;  3NHI A;  3BUM B;  3EK4 A;  4U8D A;  3D73 A;  1XFY O;  3K21 A;  1EG4 A;  2FCE A;  4I5N B;  1TCO B;  1PUL A;  1PSR A;  1CDP A;  2K60 A;  1RFJ A;  1TTX A;  3FWC A;  3I5I B;  1B7T Z;  5DKQ A;  3S0A A;  1KSM A;  2CT9 A;  1NUB A;  2WCE A;  3CAB A;  1BOC A;  3AAJ A;  5IBW A;  2JTT A;  5HYD A;  3CZ1 A;  1L2O C;  2JT8 A;  3FWB A;  1LVC D;  5I2O A;  1C7W A;  2LLS A;  2HET A;  1EL4 A;  1M31 A;  1XFX O;  1RJV A;  3EK8 A;  3ZNI A;  2O5G A;  2O60 A;  1QVI Z;  3OX5 A;  3O78 A;  1XFZ O;  2JXL A;  1AP4 A;  2PAL A;  2NZ0 A;  3NSI A;  1XFU O;  3CR4 X;  2KBM A;  1CDN A;  1S6I A;  2LHL A;  1NX1 A;  1AJ5 A;  1S5G Z;  2K7B A;  4GFT A;  1QX7 A;  2KGB C;  1B47 A;  4D1E A;  2WCM A;  1J7O A;  4PDZ A;  5AEQ A;  1MQ1 A;  1SBJ A;  2KI4 C;  3KO0 A;  1UHH A;  2MHH A;  3CYZ A;  4MSP A;  1FF1 A;  2ZRS A;  1F71 A;  2JC2 A;  1KFU L;  2HPS A;  1JC2 A;  1QTX A;  2D8N A;  2GTE A;  2JQ6 A;  2L51 A;  2NCO A;  2F2P A;  2MLE C;  1OMV A;  3PN7 B;  3IF7 A;  3I5I C;  1U5I B;  2LM5 A;  1BR1 B;  3MSE B;  3BUX B;  5I2Q A;  3QME A;  2CXJ A;  2EHB A;  2V53 A;  2WCL A;  3R1O A;  4MEW A;  5DIC A;  1NCZ A;  1OOF A;  1OW4 A;  1Y1A A;  1NX2 A;  4CFR A;  1F55 A;  1FBV A;  1G8I A;  1H4B A;  2G9B A;  4PE4 A;  3SIB A;  2LCP A;  1YR5 A;  1YUR A;  1SL8 A;  2L5X B;  4FQT A;  3PFV A;  2BE6 A;  2CNP A;  1J7R A;  3GK4 X;  1CKK A;  3CR2 A;  3O4X A;  3I5G B;  2P71 A;  2KLD A;  1ZMZ A;  3PLF B;  1SL9 A;  1Y1X A;  2CCM A;  5JOL A;  1UHI A;  2JWW A;  1XVJ A;  2VRG A;  3DVK A;  1XFW O;  4INW A;  1B8R A;  4F0Z B;  5CPV A;  4YGC B;  2WCK A;  3LCP C;  3NSL A;  1CFP A;  1S1E A;  1CNP A;  2NCP A;  1EJ3 A;  4JD9 A;  3DYE A;  5GQQ C;  1BG1 A;  1DVI A;  4MZJ A;  1YTZ C;  5HL1 A;  3PN7 C;  3TDZ A;  1CMF A;  3E3R A;  4M2Q A;  3S0G A;  3B86 A;  2QDI A;  2K7C A;  3H4S E;  3DY9 A;  1CLL A;  3BUW B;  3D0Y A;  3HX4 A;  4M2P A;  3VRQ A;  1K2H A;  3VRR A;  3BUN B;  1B8L A;  1SSE B;  2RGI A;  2FOT A;  2K7O A;  2LLU A;  3JTD B;  5DKR A;  3I5G C;  2LHI A;  3HCM A;  1YX7 A;  2WC5 A;  4WQ2 A;  2KPH A;  1IIO A;  3A8R A;  1SW8 A;  2KAV A;  2JT0 A;  3SS4 A;  1AUI B;  3CZ0 A;  1LXF C;  1B8C A;  4DS7 A;  1K8U A;  1SPY A;  3OHM B;  3K1E A;  1NP8 A;  3TDU A;  1TUZ A;  3L4L A;  3DVJ A;  1QIV A;  2ZFD A;  4OR9 B;  1QWV A;  2KI6 D;  1ZAC A;  2KHN A;  1IGV A;  1A75 B;  2PQL A;  3I5F B;  2M97 A;  1KSO A;  2PVB A;  1DJI A;  1EH2 A;  1IJ6 A;  3D10 A;  1GGW A;  1ORG A;  3NGV A;  5KU1 A;  2JPO A;  2WCJ A;  3CTN A;  1PVB A;  1JWD A;  1C7V A;  2KFG A;  2H2K A;  2BKI B;  3JTD C;  2LUX A;  4DIR A;  1BU3 A;  1EXR A;  1RK9 A;  3OP0 A;  2HQ8 A;  1G4Y R;  1RWY A;  1OOJ A;  2NLN A;  4PE0 A;  4TNC A;  3VRO A;  2KQY A;  4M2O A;  1C3Y A;  3DXL A;  4GGF C;  1TWO A;  1NCY A;  1W7J B;  3FE8 A;  1TNP A;  2LE9 B;  3TDI A;  1JSA A;  1DC1 A;  2F3Z A;  3KPX A;  2AUC A;  4HSZ A;  1Z2C B;  1YRU B;  2SAS A;  1TOP A;  1PK0 D;  1HQV A;  2FCD A;  3DVE A;  3TS5 B;  2F2O A;  1C3Z A;  2JUL A;  1T14 A;  2KDH A;  2EGD A;  1HT9 A;  4A4B A;  3LK1 A;  3CDN A;  5AER A;  2P70 A;  2WCH A;  1U5I A;  2ZKM X;  1UHK A;  2Y1M A;  3I5F C;  1KFX S;  1WRZ A;  3CR5 X;  3D78 A;  1TCF A;  3PAT A;  2AAO A;  4OKH A;  2NXQ A;  2L98 A;  5F6T A;  1VRK A;  1LIN A;  1X02 A;  2WOS A;  1OOI X;  2KAX A;  3IQO A;  4P5O E;  3ZWH A;  1K94 A;  4WRI A;  2OPO A;  3DVM A;  1BT6 A;  1IWQ A;  4NDB A;  1S6J A;  4WQ3 A;  3Q8I A;  1IRJ A;  2BL0 B;  4YI9 A;  2MAZ A;  2MLF C;  4A4C A;  2B1U A;  1BF5 A;  1MF8 B;  3VRN A;  3CZT X;  4MZL A;  5I94 A;  2K0J A;  2Y5I A;  3SJS A;  4YGD B;  5AFP A;  4JWQ A;  2L5Y A;  1DMO A;  1SK6 D;  3A4U B;  1CB1 A;  2BE4 A;  1QAT A;  4PHK A;  1KQM B;  1YUU A;  1RRO A;  3FS7 A;  1TN4 A;  2JZI A;  2MBX A;  1NX0 A;  3KEV A;  2LMU A;  4ORC B;  4OVN F;  4GNK B;  3TS5 C;  1WRK A;  2PRU A;  3UNW A;  1IQ5 A;  1AHR A;  1DJG A;  2L4H A;  3AAK A;  4C0L A;  3B6X A;  1K95 A;  5K89 A;  5HKW A;  5G08 A;  3B88 A;  1C07 A;  4OV2 A;  2L2E A;  4I5K A;  1W9Z A;  1Y0V H;  4E68 A;  1TIZ A;  1QV0 A;  3CLN A;  2BL0 C;  3OBV A;  2R2I A;  1DJZ A;  1MXL C;  2LP2 A;  3O6B A;  1M39 A;  4R1E A;  1TNX A;  4PE7 A;  3DZT A;  3F45 A;  3EVV A;  2KOT A;  5FYX A;  4GGF A;  2YGU A;  3BJH A;  3EVU A;  3KHE A;  3FIA A;  5HKZ A;  4IJ7 A;  1AK8 A;  2ISD A;  1JBA A;  1DT7 B;  1DQE A;  2WOR A;  1CLB A;  3LL8 B;  1KQM C;  2JNF A;  2KFH A;  1W7I B;  4HRE E;  5D69 A;  3RLZ A;  3PAL A;  4GPL B;  4PT1 A;  2KYC A;  2L50 A;  3SG4 A;  4DRW A;  1A03 A;  1KK8 C;  3NHT A;  2LC5 A;  1WLM A;  3N7H A;  3EVR A;  1A75 A;  4ICB A;  4MRY A;  1BR4 B;  3EG5 B;  2ZNE A;  4ORB B;  4L9M A;  2K7D A;  3D75 A;  3SG6 A;  1GJY A;  2LVI A;  1BMO A;  1S6C A;  3EKH A;  4USL A;  4YGB B;  3V2L A;  3UO9 A;  2LMT A;  1ZFS A;  5CSI A;  1PVA A;  2GGM A;  1IKU A;  1ODB A;  1Q80 A;  1SMG A;  2F8P A;  2PYQ A;  4XYN A;  1LKJ A;  1UUS A;  1Y1U A;  2L0P A;  3D76 A;  1M63 B;  1GQM A;  1F70 A;  1GGZ A;  4YI8 A;  2LUC A;  2M0R A;  2MRD A;  1NPQ A;  1QLS A;  4BY4 A;  4PHN A;  1OE9 B;  3IQQ A;  2KLE A;  2BEC A;  1OSA A;  2E30 A;  3NSK A;  4NDD A;  2JOJ A;  4QJ4 B;  1LA0 A;  1CTR A;  1JFK A;  1SR6 C;  3LLE A;  4MBE A;  2KAY A;  4YRU A;  4AQI A;  5ER4 X;  3SG2 A;  1FPW A;  1KQV A;  2M1U A;  1EG3 A;  4ETO A;  1DJH A;  3D77 A;  2SCP A;  1REC A;  2KFF A;  4PHM A;  2KSP A;  2LVJ A;  1CFC A;  1F54 A;  1ZUZ A;  3KF9 A;  2IS9 A;  2LMV A;  2Y4Q A;  3CGA A;  2JTZ A;  2PMY A;  1KFX L;  1WLZ A;  3QRX A;  3BFH A;  5D7F A;  3SG7 A;  1IH0 A;  2WC8 A;  3JVT B;  1SRA A;  2MA2 A;  5PAL A;  1DGV A;  1AVS A;  2M1K B;  2WC6 A;  1UHJ A;  2QAC A;  1DF0 B;  2Y1N A;  1J55 A;  4Q04 A;  4AOM A;  1SL7 A;  4FQO A;  4CPV A;  1XK4 C;  2M7N A;  1A4P A;  5DKN A;  3S0D A;  1D1O A;  4BY5 A;  2AMI A;  3S0E A;  2BKH B;  5I2L A;  3PM8 A;  1N2D A;  1YUS A;  2HF5 A;  1DJW A;  1UUR A;  5HLV A;  1F8H A;  3CZ2 A;  2WND A;  2WCB A;  1TNQ A;  3PJI A;  1B4C A;  4PCW A;  3O2P A;  2ZND A;  1AJ4 A;  2PSR A;  3PSR A;  1K9P A;  1YX8 A;  1GM0 A;  2QPT A;  3S0F A;  2I18 A;  3BOW B;  2CBL A;  2JNX A;  3NXA A;  1SNL A;  1CDL A;  5HKY A;  4IL1 A;  1TUJ A;  1DEK A;  3JVT C;  3LK0 A;  2JPT A;  2BCX A;  2GGZ A;  1SCM C;  1R2U A;  3SS3 A;  2QEV A;  2H61 C;  3BQ3 A;  1DGU A;  1ALW A;  4JKT A;  2JU0 A;  1WDC B;  4MZK A;  5AXI A;  4GBA A;  4I5J A;  4C0K A;  1S26 D;  1K9K A;  4N5X A;  1FW4 A;  2I7A A;  1JUO A;  3BYA A;  2E6W A;  3VB1 A;  2DOQ A;  3L47 A;  5JJG A;  2BAP A; 
#chains in the Genus database with same CATH homology
 2KNE A;  1M45 A;  2LNK A;  3WHT B;  1CDM A;  2LVV A;  4MN0 A;  2Q4U A;  4YGE B;  1R6P A;  1YVL A;  2F33 A;  2P6B B;  1F4O A;  1QX2 A;  1JF2 A;  1KK8 B;  1KK7 Y;  1OQP A;  1UP5 A;  4GUK A;  4N1G A;  4MVF A;  5CSJ A;  1TRF A;  4XJK A;  1A29 A;  1K93 D;  3AKA A;  2M49 B;  1QIW A;  1WRL A;  1NSH A;  3GK2 A;  1QLK A;  3EKJ A;  4NDC A;  1M46 A;  5KSZ A;  2TN4 A;  5TNC A;  1WDC C;  1OZO A;  1WY9 A;  1XK4 A;  5J3X A;  4QJ3 B;  1MHO A;  1Y6W A;  2CTN A;  3VRP A;  4C0J A;  1NYA A;  3I5H C;  3OB1 B;  3VGO A;  4OCI A;  2A4J A;  2JXC A;  2G2B A;  3EK7 A;  1CFD A;  2BBN A;  2M7L A;  1SR6 B;  1IG5 A;  4FTG A;  2LAP A;  2LVK A;  1XFV O;  2PAS A;  4P2Y B;  3M0W A;  1B1G A;  1TNW A;  2LP3 A;  3WNX B;  1FI6 A;  1PAL A;  1RTP 1;  1NX3 A;  3WXA A;  3BXK A;  4JQ0 D;  5B8I B;  4I5L B;  3CWG A;  4NQG A;  1KCY A;  4XJK B;  2H61 A;  1YRT B;  2L4I A;  1DF0 A;  1UHN A;  3O4Y A;  1J1E A;  1SCV A;  1A2X A;  1SYM A;  1V1G A;  2M29 A;  1MXE A;  1OMD A;  5ER5 A;  3SIA A;  1YVH A;  3WHU B;  2JT3 A;  1N0Y A;  1G33 A;  1KK7 Z;  2OTG B;  2WCF A;  4HRG A;  3RM1 A;  1MUX A;  5CSF A;  1OZS A;  1KFU S;  1NWD A;  1ZOT B;  2OS8 B;  2LLT A;  2MJW B;  2EC6 B;  3TZ1 A;  1E8A A;  2KGR A;  4PHJ A;  2KQ6 A;  2KYF A;  1B9A A;  5HLO A;  1QV1 A;  2COL B;  2KBI A;  1UWO A;  1N65 A;  3DD4 A;  2K2A A;  3BOW A;  1QX5 B;  4N1F A;  1DJX A;  4CID A;  4ZCV A;  4QJ5 B;  4AQJ A;  5BPJ A;  1SY9 A;  1OMR A;  2I2R E;  3GK1 A;  1PRW A;  4UPG A;  2K8M B;  3DF0 A;  1SCM B;  2GV5 A;  3OB2 B;  4CLN A;  1IJ5 A;  2M9G A;  4ZCU A;  5KTY A;  1S3P A;  2JRF A;  3AKB A;  1QJT A;  2I94 A;  2OTG C;  3TUY B;  1KWO B;  1B7T Y;  1JF0 A;  1K96 A;  1CM4 A;  3OX6 A;  1XA5 A;  1XYD A;  4HRH A;  1CFF A;  1QAS A;  2KI6 C;  2M8U A;  2OS8 C;  1FI5 A;  4MLW A;  2EC6 C;  4YGA A;  1F4Q A;  2FJU B;  1QVI Y;  2ZRT A;  1S36 A;  2HQW A;  4ORA B;  3SG5 A;  4GAO A;  1K90 D;  2Q91 A;  1XO5 A;  1QXP A;  1CLM A;  1S5G Y;  1BJF A;  1DTL A;  2ZN9 A;  1DJY A;  2LV7 A;  3ICB A;  1J7Q A;  3NSO A;  2M3W A;  1L7Z A;  1BLQ A;  1L2O B;  3D0Y B;  3C1V A;  4DCK A;  2BCA A;  4CFQ A;  1K9U A;  5AAN A;  4PAL A;  1PSB A;  4PE1 A;  4DUQ A;  1JFJ A;  1SKT A;  2BCB A;  2BBM A;  1LA3 A;  4MRX A;  1MWN A;  4GGN A;  1NIW A;  1NCX A;  2ZN8 A;  5CSN A;  5I8N A;  1IQ3 A;  3TUY C;  1KWO C;  1MR8 A;  3DF0 B;  3GOF A;  1BOD A;  2F3Y A;  4JPZ B;  4YBH B;  2K61 A;  2KI4 B;  2LAN A;  3BUO B;  3I5H B;  3SG3 A;  2K2F A;  1CMG A;  1H8B A;  1J7P A;  1J1D A;  1V1F A;  1ALV A;  1YUT A;  3CS1 A;  1QS7 A;  1CM1 A;  3BUM B;  3EK4 A;  4U8D A;  1XFY O;  3K21 A;  1EG4 A;  2FCE A;  4I5N B;  1TCO B;  1PUL A;  1PSR A;  1CDP A;  3FWC A;  1RFJ A;  1TTX A;  3I5I B;  5DKQ A;  1B7T Z;  1KSM A;  2CT9 A;  1NUB A;  2WCE A;  1BOC A;  3AAJ A;  5IBW A;  2JTT A;  5HYD A;  1L2O C;  2JT8 A;  3FWB A;  1LVC D;  5I2O A;  1C7W A;  2LLS A;  2HET A;  1EL4 A;  1M31 A;  1XFX O;  1RJV A;  3EK8 A;  3ZNI A;  2O5G A;  2O60 A;  1QVI Z;  3OX5 A;  3O78 A;  1XFZ O;  2JXL A;  1AP4 A;  2PAL A;  2NZ0 A;  3NSI A;  1XFU O;  3CR4 X;  2KBM A;  1CDN A;  1S6I A;  2LHL A;  1NX1 A;  1AJ5 A;  1S5G Z;  2K7B A;  4GFT A;  1QX7 A;  2KGB C;  1B47 A;  4D1E A;  1J7O A;  4PDZ A;  5AEQ A;  1MQ1 A;  1SBJ A;  2KI4 C;  3KO0 A;  1UHH A;  2MHH A;  4MSP A;  1FF1 A;  2ZRS A;  1F71 A;  2JC2 A;  1KFU L;  2HPS A;  1JC2 A;  1QTX A;  2D8N A;  2JQ6 A;  2L51 A;  2NCO A;  2F2P A;  2MLE C;  1OMV A;  3PN7 B;  3IF7 A;  3I5I C;  1U5I B;  2LM5 A;  1BR1 B;  3MSE B;  3BUX B;  5I2Q A;  2CXJ A;  2EHB A;  2V53 A;  4CFR A;  4MEW A;  1NCZ A;  1Y1A A;  1H4B A;  1NX2 A;  1F55 A;  1FBV A;  1G8I A;  2G9B A;  4PE4 A;  3SIB A;  2LCP A;  1YR5 A;  1YUR A;  1SL8 A;  2L5X B;  3PFV A;  2BE6 A;  2CNP A;  1J7R A;  3GK4 X;  1CKK A;  3CR2 A;  3I5G B;  1ZMZ A;  3PLF B;  1SL9 A;  1Y1X A;  2CCM A;  5JOL A;  1UHI A;  2JWW A;  1XVJ A;  2VRG A;  3DVK A;  1XFW O;  1B8R A;  4F0Z B;  5CPV A;  4YGC B;  3LCP C;  3NSL A;  1CFP A;  1S1E A;  1CNP A;  2NCP A;  1EJ3 A;  5GQQ C;  1BG1 A;  1DVI A;  4MZJ A;  1YTZ C;  3PN7 C;  3TDZ A;  1CMF A;  3E3R A;  4M2Q A;  2K7C A;  3H4S E;  1CLL A;  3BUW B;  3D0Y A;  3HX4 A;  4M2P A;  3VRQ A;  1K2H A;  3VRR A;  3BUN B;  1B8L A;  2RGI A;  2FOT A;  2K7O A;  2LLU A;  3JTD B;  5DKR A;  3I5G C;  2LHI A;  3HCM A;  1YX7 A;  4WQ2 A;  3A8R A;  1SW8 A;  2KAV A;  2JT0 A;  1AUI B;  1LXF C;  1B8C A;  4DS7 A;  1K8U A;  1SPY A;  3OHM B;  1NP8 A;  3TDU A;  3DVJ A;  1QIV A;  2ZFD A;  4OR9 B;  2KI6 D;  1ZAC A;  2KHN A;  1IGV A;  1A75 B;  3I5F B;  2M97 A;  1KSO A;  2PVB A;  1DJI A;  1EH2 A;  1IJ6 A;  3D10 A;  1GGW A;  5KU1 A;  3CTN A;  1PVB A;  1JWD A;  1C7V A;  2KFG A;  2H2K A;  2BKI B;  3JTD C;  2LUX A;  4DIR A;  1BU3 A;  1EXR A;  1RK9 A;  3OP0 A;  2HQ8 A;  1G4Y R;  1RWY A;  1OOJ A;  2NLN A;  4PE0 A;  4TNC A;  3VRO A;  2KQY A;  4M2O A;  4GGF C;  1NCY A;  1W7J B;  1TNP A;  2LE9 B;  3TDI A;  1JSA A;  2F3Z A;  3KPX A;  2AUC A;  4HSZ A;  1YRU B;  2SAS A;  1TOP A;  1PK0 D;  1HQV A;  2FCD A;  3DVE A;  3TS5 B;  2F2O A;  2JUL A;  2KDH A;  2EGD A;  1HT9 A;  4A4B A;  3LK1 A;  5AER A;  1U5I A;  2ZKM X;  1UHK A;  2Y1M A;  3I5F C;  1KFX S;  1WRZ A;  3CR5 X;  3PAT A;  1TCF A;  2AAO A;  4OKH A;  2NXQ A;  2L98 A;  5F6T A;  1VRK A;  1LIN A;  1X02 A;  2WOS A;  2KAX A;  3IQO A;  4P5O E;  3ZWH A;  1K94 A;  4WRI A;  2OPO A;  3DVM A;  1BT6 A;  1IWQ A;  4NDB A;  1S6J A;  4WQ3 A;  1IRJ A;  2BL0 B;  4YI9 A;  2MAZ A;  2MLF C;  4A4C A;  2B1U A;  1BF5 A;  1MF8 B;  3VRN A;  3CZT X;  4MZL A;  2K0J A;  2Y5I A;  3SJS A;  4YGD B;  5AFP A;  4JWQ A;  1DMO A;  1SK6 D;  3A4U B;  1CB1 A;  2BE4 A;  1QAT A;  4PHK A;  1KQM B;  1YUU A;  1RRO A;  3FS7 A;  1TN4 A;  2JZI A;  2MBX A;  1NX0 A;  3KEV A;  2LMU A;  4ORC B;  4OVN F;  4GNK B;  3TS5 C;  1WRK A;  2PRU A;  1IQ5 A;  1AHR A;  1DJG A;  2L4H A;  3AAK A;  4C0L A;  1K95 A;  5K89 A;  5HKW A;  5G08 A;  1C07 A;  4OV2 A;  2L2E A;  4I5K A;  1Y0V H;  4E68 A;  1TIZ A;  1QV0 A;  3CLN A;  2BL0 C;  2R2I A;  1DJZ A;  1MXL C;  2LP2 A;  3O6B A;  1M39 A;  4R1E A;  1TNX A;  4PE7 A;  3F45 A;  3EVV A;  2KOT A;  5FYX A;  4GGF A;  3EVU A;  3KHE A;  3FIA A;  5HKZ A;  1AK8 A;  2ISD A;  1JBA A;  1DT7 B;  2WOR A;  1CLB A;  3LL8 B;  1KQM C;  2JNF A;  2KFH A;  1W7I B;  4HRE E;  5D69 A;  3RLZ A;  3PAL A;  4GPL B;  2KYC A;  2L50 A;  3SG4 A;  4DRW A;  1A03 A;  1KK8 C;  2LC5 A;  1WLM A;  3EVR A;  1A75 A;  4ICB A;  4MRY A;  1BR4 B;  2ZNE A;  4ORB B;  4L9M A;  2K7D A;  3SG6 A;  1GJY A;  2LVI A;  1BMO A;  1S6C A;  3EKH A;  4USL A;  4YGB B;  2LMT A;  1ZFS A;  5CSI A;  1PVA A;  2GGM A;  1IKU A;  1ODB A;  1Q80 A;  1SMG A;  2F8P A;  4XYN A;  1LKJ A;  1UUS A;  1Y1U A;  2L0P A;  1M63 B;  1GQM A;  1F70 A;  1GGZ A;  4YI8 A;  2LUC A;  2M0R A;  2MRD A;  1NPQ A;  1QLS A;  4BY4 A;  4PHN A;  1OE9 B;  3IQQ A;  2BEC A;  1OSA A;  2E30 A;  3NSK A;  4NDD A;  2JOJ A;  4QJ4 B;  1LA0 A;  1CTR A;  1JFK A;  1SR6 C;  3LLE A;  4MBE A;  2KAY A;  4YRU A;  4AQI A;  5ER4 X;  3SG2 A;  1FPW A;  1KQV A;  2M1U A;  1EG3 A;  4ETO A;  1DJH A;  2SCP A;  1REC A;  2KFF A;  4PHM A;  2KSP A;  2LVJ A;  1CFC A;  1F54 A;  1ZUZ A;  3KF9 A;  2IS9 A;  2LMV A;  2Y4Q A;  3CGA A;  2JTZ A;  2PMY A;  1KFX L;  1WLZ A;  3QRX A;  3SG7 A;  5D7F A;  1IH0 A;  2WC8 A;  3JVT B;  1SRA A;  2MA2 A;  5PAL A;  1DGV A;  1AVS A;  2M1K B;  1UHJ A;  2QAC A;  1DF0 B;  2Y1N A;  1J55 A;  4Q04 A;  4AOM A;  1SL7 A;  4FQO A;  4CPV A;  1XK4 C;  2M7N A;  1A4P A;  5DKN A;  1D1O A;  4BY5 A;  2AMI A;  2BKH B;  5I2L A;  3PM8 A;  1N2D A;  1YUS A;  2HF5 A;  1DJW A;  1UUR A;  5HLV A;  1F8H A;  2WND A;  2WCB A;  1TNQ A;  1B4C A;  4PCW A;  3O2P A;  2ZND A;  1AJ4 A;  2PSR A;  3PSR A;  1K9P A;  1YX8 A;  2QPT A;  2I18 A;  3BOW B;  2CBL A;  2JNX A;  3NXA A;  1SNL A;  1CDL A;  5HKY A;  4IL1 A;  3JVT C;  3LK0 A;  2JPT A;  2BCX A;  2GGZ A;  1SCM C;  1R2U A;  2H61 C;  3BQ3 A;  1DGU A;  1ALW A;  2JU0 A;  1WDC B;  4MZK A;  5AXI A;  4GBA A;  4I5J A;  4C0K A;  1S26 D;  1K9K A;  4N5X A;  1FW4 A;  2I7A A;  1JUO A;  3BYA A;  2E6W A;  2DOQ A;  5JJG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...