4NDCA

X-ray structure of a mutant (t188d) of calexcitin - a neuronal calcium-signalling protein
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
187
structure length
187
Chain Sequence
QLSDFQRNKILRVFNTFYDCNHDGVIEWDDFELAIKKICNLHSWPTDGKKHNEARATLKLIWDGLRKYADENEDEQVTKEEWLKMWAECVKSVEKGESLPEWLTKYMNFMFDVNDTSGDNIIDKHEYSTVYMSYGIPKSDCDAAFDTLSDGGKTMVTREIFARLWTEYFVSNDRGAKGNHLFGDLKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calexcitin
publication title X-ray, spectroscopic and normal-mode dynamics of calexcitin: structure-function studies of a neuronal calcium-signalling protein.
pubmed doi rcsb
source organism Doryteuthis pealeii
molecule tags Signaling protein
total genus 74
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ndcA00
2KQ6A 2KYFA 1FW4A 1FBVA 3C1VA 2M7NA 1ALWA 1TCOB 2JXLA 4PALA 5DKRA 2H61A 4CFQA 1SRAA 4CPVA 4QJ5B 4MRXA 1EG4A 2JU0A 2BE6A 2ZNDA 2GGZA 1NIWA 4ORBB 1ZFSA 1S36A 1JFJA 1DF0A 2JXCA 4NDBA 1PK0D 2M1UA 2L51A 3E3RA 1LINA 2BKHB 3WHTB 1BF5A 1B7TZ 3HX4A 3TS5B 1CFFA 1PALA 1N65A 5HYDA 4I5NB 4WRIA 2JQ6A 1G4YR 4GGFA 1AK8A 1KK8C 2Q4UA 1K90D 1XK4C 2L2EA 3CR4X 1IWQA 2JWWA 1QIWA 4PHMA 2K2AA 2L5XB 1L7ZA 1BLQA 2BCAA 1G8IA 3ICBA 1SMGA 1EG3A 1KQVA 1QTXA 5KTYA 3LCPC 5HKZA 1YX8A 3LK0A 4YI8A 3GK1A 4PE0A 3PN7B 2E30A 1SPYA 3WHUB 1A75A 1DJGA 3BXKA 1A2XA 2F3YA 3I5GB 2H2KA 4YGCB 4GUKA 1QX2A 1KK7Z 1DF0B 1Y6WA 1MR8A 3O4YA 1RJVA 4MEWA 1SNLA 1RFJA 1K93D 5CSJA 3TS5C 5HLVA 1J1EA 2K61A 2PASA 2WCFA 4CIDA 1BR4B 1CM4A 1W7IB 3RLZA 4MZJA 4BY5A 1YR5A 1KSMA 1PRWA 2KI6C 4PHJA 3OP0A 5KSZA 1XVJA 4DIRA 1K94A 3EVUA 4WQ2A 2JOJA 1AJ4A 1SCMC 3GK2A 2KGRA 1D1OA 4M2OA 4OKHA 1S1EA 2LP2A 1MHOA 1QATA 1KWOB 5HKWA 1L2OB 1SL7A 1V1FA 1SL9A 1NSHA 4ZCUA 1YTZC 3FIAA 1Y1AA 3PN7C 3VRQA 3BUNB 1NX2A 1C7WA 3OB1B 4PDZA 2R2IA 4GNKB 3I5GC 3H4SE 2PALA 2K7BA 1A75B 3CGAA 1MQ1A 1RROA 1QXPA 2LP3A 1CDMA 2M49B 3EVRA 3OB2B 5K89A 2PVBA 3I5HB 1NYAA 1X02A 2KYCA 1VRKA 2LMTA 1NPQA 1QVIZ 5AEQA 2D8NA 1GGZA 1TRFA 3AAJA 5ER5A 1BODA 2LAPA 1XK4A 3OHMB 1LXFC 2DOQA 2LMUA 1KFXS 4C0JA 1QV1A 1WRLA 2MAZA 1C7VA 1RTP1 2L4IA 4GPLB 3IQQA 1F54A 4C0LA 3NSIA 1WDCB 5DKQA 2BE4A 1TCFA 1NCXA 1V1GA 2LVVA 3CLNA 2K8MB 4YGDB 2KAVA 1KWOC 2BCBA 1L2OC 5CPVA 2MBXA 2L0PA 4MRYA 2BBNA 1CLMA 2FCEA 1DJYA 1BU3A 1S5GZ 3CWGA 5CSNA 2LLSA 5G08A 2JNFA 1B8LA 4PE4A 4D1EA 4MZLA 1BR1B 2LMVA 2KOTA 1GGWA 2KI6D 1NX3A 1BG1A 4AOMA 3I5HC 1XFUO 2M1KB 1G33A 1CDLA 5KU1A 4ORCB 4U8DA 2RGIA 1CLBA 4TNCA 3KF9A 4MLWA 4NQGA 1QX7A 2LCPA 1WDCC 3QRXA 3JVTB 2KQYA 1F70A 4DS7A 3AKBA 4HRGA 5AANA 1CLLA 1J7QA 2K7OA 2NZ0A 1IGVA 2CT9A 4WQ3A 3DVKA 1IKUA 4ZCVA 4A4BA 1PULA 1F8HA 1SR6B 3SG6A 5FYXA 1TNPA 1K9KA 2M29A 1MXLC 4XYNA 2HETA 4E68A 3O78A 4N1GA 1RK9A 1QX5B 1BJFA 1S6IA 1K9PA 2LLTA 1CMFA 3PSRA 4MBEA 4XJKA 2JTZA 2MRDA 3BUOB 1OZSA 1KQMB 3SIBA 3DD4A 2KFFA 1S6JA 3BUMB 3EKHA 1JF2A 1WLZA 2KBIA 1SY9A 3EK7A 2ISDA 2GV5A 2MLFC 1S6CA 2M7LA 3TZ1A 4OR9B 1DT7B 5AFPA 1C07A 4N5XA 1NX1A 2CBLA 4C0KA 3SG5A 2HQ8A 2PMYA 1SCMB 4I5LB 1K95A 3JVTC 3M0WA 1BOCA 5JJGA 1M45A 1ZUZA 2LVJA 3VRNA 1NWDA 2F2OA 3WXAA 4BY4A 1IJ5A 1SR6C 3NSOA 5I8NA 2A4JA 4DUQA 2I94A 3EVVA 5HLOA 1OOJA 1LA3A 2AAOA 2HPSA 2LHLA 4M2QA 4PHNA 2FCDA 1R6PA 1U5IA 4OCIA 1UHJA 2WCEA 1DJXA 2JZIA 3SJSA 2IS9A 1E8AA 2GGMA 4P2YB 1DGUA 1ALVA 2BECA 1KQMC 1MUXA 4XJKB 1HT9A 2OTGB 3SIAA 2BL0B 3F45A 3HCMA 1EXRA 5IBWA 1ZMZA 1S3PA 1NUBA 2KSPA 1DJHA 4CFRA 3D0YB 4JQ0D 1CTRA 3CS1A 1YURA 4PHKA 2JT0A 1SCVA 3VRRA 2F33A 1K8UA 2LV7A 2NLNA 2QACA 1LKJA 1GQMA 3O6BA 2MHHA 4PCWA 1ZOTB 1CFPA 3NSLA 1SK6D 4NDCA 2L98A 1UHHA 1U5IB 2LHIA 2NCOA 3DF0B 4IL1A 3SG4A 1JUOA 4YRUA 1ZACA 1Y1XA 4PE1A 5DKNA 1H4BA 2PSRA 3CTNA 1DJIA 4M2PA 2OTGC 1B47A 5PALA 2BL0C 1NP8A 4OVNF 4QJ3B 5JOLA 5B8IB 3ZNIA 1J1DA 3TUYB 4N1FA 3AKAA 3NXAA 4YGEB 1PVBA 2WCBA 1KFUL 1YRUB 3PALA 3PFVA 1EJ3A 4HRHA 2KI4C 3FWCA 1XYDA 5AERA 1TNWA 1A03A 2Y5IA 1WRKA 3OX5A 4NDDA 2LC5A 1OSAA 2KNEA 2KAXA 1J7PA 3EK8A 1CDNA 1MXEA 4P5OE 4A4CA 1B1GA 4GBAA 1W7JB 3LL8B 3CR5X 3DVJA 5ER4X 2LE9B 4F0ZB 2SCPA 2CTNA 4AQIA 2TN4A 3CR2A 1IRJA 2MA2A 1IQ3A 1S5GY 3AAKA 3TUYC 1QASA 3FS7A 1XFWO 4MN0A 1A4PA 2EC6C 2K7DA 3VRPA 3WNXB 1N0YA 3DVEA 2EHBA 1M31A 2F2PA 2I2RE 2K7CA 2LUXA 1PVAA 1F55A 2O60A 3CZTX 3GK4X 2ZNEA 4ORAB 1CMGA 4DCKA 4MZKA 4AQJA 2K0JA 2F3ZA 5I2QA 1F4QA 2I7AA 2KBMA 2Q91A 1B9AA 2O5GA 1MWNA 1DTLA 1Q80A 2BKIB 1SW8A 2NXQA 1IH0A 2OS8B 1FF1A 1AP4A 3SG2A 2PRUA 2Y1MA 1Y1UA 2M8UA 4Q04A 3SG7A 2L50A 1JFKA 1BT6A 2JULA 1S26D 2LVIA 3PM8A 5CSIA 4JPZB 3D0YA 1B8CA 2Y4QA 1QLSA 2P6BB 4R1EA 1RECA 1TIZA 4YBHB 1N2DA 3BUWB 2FOTA 1JSAA 1WRZA 1CB1A 3I5IB 2I18A 1JF0A 1OMRA 2HQWA 4GGNA 1B7TY 3BOWB 1IG5A 1OE9B 1UUSA 3A8RA 1B8RA 1WLMA 1LVCD 2JRFA 1K2HA 4I5JA 4YGBB 4CLNA 1SYMA 5D7FA 2LM5A 1SBJA 4FQOA 3DF0A 1GJYA 1ODBA 2QPTA 1OQPA 2CNPA 2M97A 1UURA 2OPOA 2B1UA 1XFZO 2KHNA 3TDUA 3VROA 3JTDB 2JT3A 1PSRA 1FI5A 1QV0A 3BQ3A 2OS8C 1XFYO 2JT8A 3D10A 3LLEA 1FI6A 3EKJA 2ZFDA 1M63B 2Y1NA 2ZRTA 1Y0VH 3EK4A 1LA0A 1JC2A 1IJ6A 1QJTA 1XO5A 1M46A 2M3WA 4FTGA 1SKTA 3FWBA 2CXJA 2ZRSA 1EL4A 2KI4B 2ZN9A 1KK7Y 2K2FA 3I5IC 2MLEC 3K21A 1AVSA 1CDPA 1QS7A 5BPJA 1JWDA 3RM1A 1F71A 1R2UA 4HSZA 1CKKA 2L4HA 1YUSA 3SG3A 3GOFA 1DMOA 1YRTB 2JTTA 4I5KA 1IQ5A 3TDIA 1YVHA 2LANA 2LNKA 1SL8A 1NCYA 3PLFB 3DVMA 2WORA 2LVKA 2M0RA 5I2LA 1CFCA 1DVIA 1UHNA 2MJWB 1TN4A 2KFHA 3JTDC 1TNXA 2EGDA 2LLUA 4L9MA 4QJ4B 3KPXA 4JWQA 1YUUA 1FPWA 3NSKA 3KHEA 2KAYA 1H8BA 4GAOA 1AJ5A 1AHRA 2LUCA 2H61C 2AUCA 1UP5A 1OZOA 1TNQA 3LK1A 3KEVA 1KSOA 3OX6A 1KCYA 2F8PA 2BBMA 2G2BA 2EC6B 4OV2A 5CSFA 1PSBA 3BUXB 4DRWA 2E6WA 4GFTA 4ICBA 1J7RA 4YGAA 1OMDA 3VGOA 1UHKA 1YVLA 5D69A 1KFUS 4MSPA 4UPGA 2V53A 4PE7A 1QVIY 3MSEB 1CM1A 3TDZA 1YX7A 2KGBC 1KFXL 1B4CA 2ZN8A 3I5FB 5J3XA 2AMIA 1YUTA 3A4UB 4USLA 2JNXA 1XFXO 2WC8A 5F6TA 4GGFC 2BCXA 2M9GA 2JC2A 1AUIB 2KDHA 1JBAA 2ZKMX 1CNPA 1A29A 2NCPA 1J7OA 1CFDA 1MF8B 1QLKA 1DJZA 1QIVA 5HKYA 5I2OA 1RWYA 4ETOA 1DJWA 2KFGA 1F4OA 1WY9A 4HREE 1K96A 1UWOA 3KO0A 2HF5A 1UHIA 2G9BA 2CCMA 3BOWA 5GQQC 1TTXA 1EH2A 2SASA 3O2PA 1DGVA 1HQVA 2WOSA 3BYAA 2JPTA 5AXIA 1BMOA 1K9UA 1J55A 3I5FC 1TOPA 2FJUB 3IQOA 3PATA 4YI9A 2WNDA 1NCZA 1M39A 1XA5A 5TNCA 1OMVA 3ZWHA 1KK8B 1NX0A 2COLB 2VRGA 4MVFA 1XFVO 3IF7A
chains in the Genus database with same CATH superfamily
2KQ6A 2KYFA 1FW4A 5DICA 1FBVA 3C1VA 2M7NA 1ALWA 1TCOB 2JXLA 3NHIA 4PALA 2H61A 5DKRA 4CFQA 2ERBA 1SRAA 4CPVA 4QJ5B 4MRXA 2H8VA 1EG4A 2JU0A 2BE6A 2ZNDA 2GGZA 1NIWA 3K1EA 4ORBB 1ZFSA 2P71A 1S36A 1JFJA 1DF0A 2JXCA 4NDBA 1PK0D 2M1UA 2L51A 3E3RA 1LINA 2BKHB 3D78A 3WHTB 3B86A 3CABA 2KPHA 1BF5A 1B7TZ 3HX4A 3TS5B 1CFFA 3Q8IA 1PALA 3CYZA 1N65A 5HYDA 4PT1A 4I5NB 4WRIA 2JQ6A 1G4YR 4GGFA 1AK8A 1KK8C 2Q4UA 1K90D 1XK4C 2L2EA 3CR4X 1IWQA 2JWWA 1QIWA 1ORGA 2K2AA 2L5XB 1L7ZA 4PHMA 1BLQA 2BCAA 3BFBA 1G8IA 3ICBA 1SMGA 1EG3A 1KQVA 1QTXA 5KTYA 3LCPC 5HKZA 1YX8A 3CZ1A 3LK0A 4YI8A 3GK1A 4PE0A 3PN7B 2E30A 1SPYA 3WHUB 1A75A 1DJGA 3BXKA 1A2XA 2F3YA 3I5GB 2H2KA 4YGCB 3PM2A 4GUKA 1QX2A 1KK7Z 3DY9A 1DF0B 1Y6WA 1MR8A 3O4YA 1RJVA 4MEWA 1SNLA 1RFJA 1K93D 5CSJA 1IIOA 3TS5C 5HLVA 1J1EA 2K61A 1SSEB 2PASA 2WCFA 1BR4B 4CIDA 3NHTA 1CM4A 1W7IB 3RLZA 4MZJA 4BY5A 1YR5A 1KSMA 1PRWA 2KI6C 4PHJA 3OP0A 5KSZA 1XVJA 4DIRA 1K94A 3EVUA 4WQ2A 2JOJA 1AJ4A 1SCMC 3GK2A 2KGRA 3O4XA 3CZ2A 4M2OA 4OKHA 1S1EA 2LP2A 1D1OA 1MHOA 1OW4A 1QATA 1KWOB 5HKWA 1L2OB 3OGNA 1SL7A 1V1FA 1SL9A 1NSHA 4ZCUA 1YTZC 3FIAA 1Y1AA 3PN7C 3VRQA 3BUNB 1NX2A 1C7WA 3OB1B 4PDZA 1T14A 1Z2CB 2R2IA 4GNKB 3CDNA 3I5GC 1DEKA 3H4SE 2PALA 2K7BA 1A75B 2BAPA 3CGAA 1MQ1A 1RROA 1QXPA 2LP3A 1CDMA 2M49B 3EVRA 3OB2B 5K89A 2PVBA 3N7HA 3I5HB 1NYAA 1X02A 2KYCA 1DC1A 1VRKA 2LMTA 1NPQA 1QVIZ 5AEQA 2D8NA 1GGZA 1TRFA 3AAJA 5ER5A 5FI6A 1BODA 2LAPA 1XK4A 3OHMB 1LXFC 2DOQA 2LMUA 1KFXS 4C0JA 1QV1A 1WRLA 2MAZA 1C7VA 1RTP1 2L4IA 1OOFA 4GPLB 3IQQA 1F54A 4C0LA 3B87A 3NSIA 1WDCB 5DKQA 2BE4A 1TCFA 1NCXA 1V1GA 2LVVA 3CLNA 2K8MB 4YGDB 2KAVA 1KWOC 2BCBA 1L2OC 5CPVA 2MBXA 2L0PA 4MRYA 2BBNA 1CLMA 2FCEA 1DJYA 1BU3A 1S5GZ 3CWGA 3IVTA 5CSNA 2LLSA 2JPOA 5G08A 2JNFA 1B8LA 4PE4A 4D1EA 4MZLA 1BR1B 2LMVA 2KOTA 3CZ0A 2KI6D 1GGWA 1NX3A 1BG1A 4AOMA 3BFAA 3I5HC 1XFUO 2M1KB 1G33A 1CDLA 3B7AA 2GTEA 3S0BA 5KU1A 1C3ZA 4ORCB 1OOHA 4U8DA 2RGIA 1CLBA 4TNCA 3KF9A 4MLWA 4NQGA 1QX7A 2LCPA 1WDCC 3DXLA 3QRXA 3JVTB 2KQYA 1F70A 4DS7A 3AKBA 4HRGA 5AANA 1CLLA 1J7QA 2K7OA 2NZ0A 1IGVA 2CT9A 4WQ3A 3DVKA 1IKUA 2QEOA 4ZCVA 1PULA 4A4BA 1SR6B 1F8HA 3SG6A 3FE8A 5FYXA 3V2LA 1TNPA 1K9KA 2M29A 1MXLC 3D77A 4XYNA 2HETA 2KLDA 3O78A 4N1GA 4E68A 1Z4HA 1RK9A 1QX5B 1BJFA 1S6IA 1K9PA 2LLTA 1CMFA 3PSRA 4MBEA 4XJKA 2JTZA 2MRDA 3BUOB 1OZSA 1KQMB 3SIBA 3DD4A 2KFFA 1S6JA 3BUMB 3EKHA 1JF2A 1WLZA 2KBIA 2L5YA 4IJ7A 1SY9A 3EK7A 2ISDA 2GV5A 2MLFC 1S6CA 2WCLA 2M7LA 3TZ1A 4OR9B 1DT7B 5AFPA 1C07A 4N5XA 1NX1A 2CBLA 4JD9A 3SG5A 4C0KA 2HQ8A 2PMYA 1SCMB 4I5LB 1K95A 3JVTC 3M0WA 1BOCA 5JJGA 1M45A 1ZUZA 2LVJA 3VRNA 1DQEA 2YGUA 2P70A 1NWDA 2F2OA 3WXAA 4BY4A 1IJ5A 1SR6C 3NSOA 5I8NA 2A4JA 4DUQA 2I94A 1TUJA 5FI7A 3EVVA 5HLOA 1OOJA 1LA3A 2AAOA 2HPSA 2LHLA 2QEVA 4M2QA 2FCDA 1R6PA 4PHNA 1OOGA 1U5IA 4OCIA 1UHJA 2WCEA 1DJXA 2JZIA 3SJSA 2IS9A 1E8AA 2GGMA 3BFHA 4P2YB 1DGUA 1ALVA 2BECA 1KQMC 1MUXA 4XJKB 1HT9A 2OTGB 3SIAA 2BL0B 3F45A 3HCMA 1EXRA 5IBWA 1ZMZA 1S3PA 1NUBA 3R1VA 2KSPA 1DJHA 4CFRA 3QMEA 3S0DA 3D0YB 4JQ0D 1CTRA 3S0GA 3CS1A 2BNXA 1YURA 4PHKA 2JT0A 1SCVA 3VRRA 2F33A 1K8UA 2LV7A 2NLNA 2QACA 1LKJA 1GQMA 3O6BA 2MHHA 4PCWA 3FE6A 1ZOTB 2QEBA 1CFPA 3NSLA 1OOIX 5FI2A 3PJIA 1SK6D 4NDCA 2L98A 1UHHA 1U5IB 2LHIA 2NCOA 3DF0B 4IL1A 3SG4A 1JUOA 1C3YA 4YRUA 1ZACA 1Y1XA 4PE1A 5DKNA 1H4BA 2PSRA 3DZTA 3CTNA 1DJIA 4M2PA 1GM0A 2OTGC 1B47A 5PALA 2BL0C 3R1PA 1NP8A 4OVNF 4QJ3B 5JOLA 5B8IB 3ZNIA 1J1DA 3TUYB 4N1FA 3AKAA 3NXAA 4YGEB 1PVBA 2WCBA 1KFUL 2L2CA 1YRUB 3PALA 3L4LA 3PFVA 1EJ3A 4HRHA 2KI4C 5D3OA 3FWCA 1XYDA 2K60A 5AERA 3R1OA 1TNWA 1A03A 2Y5IA 1WRKA 3OX5A 4NDDA 1TUZA 2LC5A 1OSAA 2KNEA 2KAXA 1J7PA 3EK8A 1CDNA 1MXEA 4P5OE 4A4CA 1B1GA 3D74A 1W7JB 3LL8B 3CR5X 3DVJA 4GBAA 2LE9B 2WCMA 2SCPA 5ER4X 4F0ZB 2CTNA 3S0EA 4AQIA 2TN4A 3CR2A 1IRJA 4KYNA 2MA2A 1IQ3A 2WCKA 1S5GY 2PQLA 3AAKA 3TUYC 1QASA 3FS7A 1XFWO 4MN0A 1A4PA 2EC6C 3SS3A 2K7DA 3VRPA 3WNXB 1N0YA 3DVEA 2EHBA 1M31A 2F2PA 2I2RE 2K7CA 2LUXA 1PVAA 1F55A 2WCJA 2O60A 3CZTX 3GK4X 2ZNEA 4ORAB 1CMGA 4DCKA 4MZKA 4INWA 4AQJA 2K0JA 2F3ZA 3D76A 5I2QA 1F4QA 2I7AA 2KBMA 2Q91A 1B9AA 5HL1A 3EG5B 2O5GA 1MWNA 1DTLA 3BJHA 1Q80A 2BKIB 1SW8A 2NXQA 2WC5A 3UO9A 1IH0A 2OS8B 1FF1A 1AP4A 3SG2A 3SS4A 2PRUA 2Y1MA 1Y1UA 2M8UA 4Q04A 3SG7A 2L50A 1JFKA 1BT6A 2JULA 1S26D 1P28A 2LVIA 3PM8A 5CSIA 4JPZB 3D0YA 1B8CA 2Y4QA 1QLSA 2P6BB 3L47A 1RECA 4R1EA 1TIZA 4YBHB 1N2DA 3BUWB 2FOTA 1JSAA 1WRZA 1CB1A 1DELA 3I5IB 2I18A 1JF0A 1OMRA 2HQWA 1QWVA 1B7TY 3BOWB 4GGNA 1IG5A 1OE9B 1UUSA 3OBVA 3A8RA 1B8RA 1WLMA 1LVCD 2JRFA 1K2HA 4I5JA 4YGBB 4CLNA 1SYMA 5D7FA 2LM5A 1SBJA 4FQOA 4INXA 3DF0A 1GJYA 1ODBA 2QPTA 1OQPA 2CNPA 2M97A 1UURA 2OPOA 2B1UA 1XFZO 2KHNA 3TDUA 3VROA 3JTDB 2JT3A 1PSRA 1FI5A 1QV0A 3BQ3A 2OS8C 1XFYO 2JT8A 3D10A 3LLEA 4JKTA 1FI6A 3EKJA 2ZFDA 1M63B 2Y1NA 2ZRTA 1Y0VH 3EK4A 3S0FA 1LA0A 1JC2A 1IJ6A 1QJTA 1XO5A 1M46A 2M3WA 4FTGA 1SKTA 3FWBA 2CXJA 5I94A 2ZRSA 3S0AA 1EL4A 2KI4B 2QEHA 1KK7Y 2K2FA 2ZN9A 3I5IC 2MLEC 3K21A 1AVSA 1CDPA 1QS7A 5BPJA 1JWDA 3RM1A 1F71A 4FQTA 1R2UA 4HSZA 1CKKA 2L4HA 1YUSA 3SG3A 3GOFA 1DMOA 1YRTB 2JTTA 4I5KA 3L4AA 1IQ5A 3TDIA 1YVHA 1LS8A 3DYEA 2LANA 2LNKA 1SL8A 1NCYA 3PLFB 4F7FA 3DVMA 2WORA 2FJYA 2LVKA 2M0RA 4OZDA 5I2LA 1CFCA 1DVIA 1UHNA 2MJWB 1TN4A 2KFHA 3JTDC 1TNXA 2EGDA 2LLUA 4L9MA 4QJ4B 3KPXA 4JWQA 1YUUA 1FPWA 3NSKA 3KHEA 2KAYA 1H8BA 4GAOA 1AJ5A 1AHRA 2LUCA 2H61C 2AUCA 1UP5A 1OZOA 1TNQA 3LK1A 3KEVA 1KSOA 3OX6A 1KCYA 3RZSA 2F8PA 2BBMA 2G2BA 2EC6B 4OV2A 5CSFA 1PSBA 3BUXB 5EL2A 4DRWA 2E6WA 4GFTA 4ICBA 1J7RA 4YGAA 3D75A 1OMDA 3VGOA 1UHKA 1W9ZA 1YVLA 5D69A 1KFUS 3SS5A 4MSPA 4UPGA 2V53A 4PE7A 1QVIY 3MSEB 2WC6A 1CM1A 3TDZA 1YX7A 2KGBC 1KFXL 1B4CA 2ZN8A 3I5FB 5J3XA 2PYQA 2AMIA 1YUTA 3A4UB 4USLA 2JNXA 1XFXO 2WC8A 5F6TA 4GGFC 2BCXA 2M9GA 3VB1A 2JC2A 1AUIB 2KDHA 1JBAA 2ZKMX 3UNWA 1CNPA 1A29A 2NCPA 1J7OA 3FE9A 1CFDA 1MF8B 1QLKA 1DJZA 1QIVA 3B6XA 5HKYA 5I2OA 2QDIA 3R72A 1RWYA 4ETOA 1DJWA 2KFGA 1F4OA 1WY9A 4HREE 1K96A 3NGVA 1UWOA 3KO0A 2HF5A 1UHIA 2G9BA 2CCMA 3BOWA 3B88A 5GQQC 1TTXA 1EH2A 2SASA 3O2PA 1DGVA 1HQVA 2WOSA 3BYAA 2JPTA 5AXIA 1BMOA 1XFRA 1K9UA 1J55A 1TOPA 2FJUB 3I5FC 3IQOA 3PATA 2WNDA 4YI9A 1NCZA 1M39A 1XA5A 5TNCA 2KLEA 1OMVA 3ZWHA 1KK8B 1NX0A 2COLB 2VRGA 3D73A 4MVFA 1XFVO 2WCHA 1TWOA 3IF7A
chains in the Genus database with same CATH topology
2KQ6A 2KYFA 1FW4A 1FBVA 3C1VA 2M7NA 1ALWA 1TCOB 2JXLA 4PALA 5DKRA 2H61A 4CFQA 1SRAA 4CPVA 4QJ5B 4MRXA 1EG4A 2JU0A 2BE6A 2ZNDA 2GGZA 1NIWA 4ORBB 1ZFSA 1S36A 1JFJA 1DF0A 2JXCA 4NDBA 1PK0D 2M1UA 2L51A 3E3RA 1LINA 2BKHB 3WHTB 1BF5A 1B7TZ 3HX4A 3TS5B 1CFFA 1PALA 1N65A 5HYDA 4I5NB 4WRIA 2JQ6A 1G4YR 4GGFA 1AK8A 1KK8C 2Q4UA 1K90D 1XK4C 2L2EA 3CR4X 1IWQA 2JWWA 1QIWA 4PHMA 2K2AA 2L5XB 1L7ZA 1BLQA 2BCAA 1G8IA 3ICBA 1SMGA 1EG3A 1KQVA 1QTXA 5KTYA 3LCPC 5HKZA 1YX8A 3LK0A 4YI8A 3GK1A 4PE0A 3PN7B 2E30A 1SPYA 3WHUB 1A75A 1DJGA 3BXKA 1A2XA 2F3YA 3I5GB 2H2KA 4YGCB 4GUKA 1QX2A 1KK7Z 1DF0B 1Y6WA 1MR8A 3O4YA 1RJVA 4MEWA 1SNLA 1RFJA 1K93D 5CSJA 3TS5C 5HLVA 1J1EA 2K61A 2PASA 2WCFA 4CIDA 1BR4B 1CM4A 1W7IB 3RLZA 4MZJA 4BY5A 1YR5A 1KSMA 1PRWA 2KI6C 4PHJA 3OP0A 5KSZA 1XVJA 4DIRA 1K94A 3EVUA 4WQ2A 2JOJA 1AJ4A 1SCMC 3GK2A 2KGRA 1D1OA 4M2OA 4OKHA 1S1EA 2LP2A 1MHOA 1QATA 1KWOB 5HKWA 1L2OB 1SL7A 1V1FA 1SL9A 1NSHA 4ZCUA 1YTZC 3FIAA 1Y1AA 3PN7C 3VRQA 3BUNB 1NX2A 1C7WA 3OB1B 4PDZA 2R2IA 4GNKB 3I5GC 3H4SE 2PALA 2K7BA 1A75B 3CGAA 1MQ1A 1RROA 1QXPA 2LP3A 1CDMA 2M49B 3EVRA 3OB2B 5K89A 2PVBA 3I5HB 1NYAA 1X02A 2KYCA 1VRKA 2LMTA 1NPQA 1QVIZ 5AEQA 2D8NA 1GGZA 1TRFA 3AAJA 5ER5A 1BODA 2LAPA 1XK4A 3OHMB 1LXFC 2DOQA 2LMUA 1KFXS 4C0JA 1QV1A 1WRLA 2MAZA 1C7VA 1RTP1 2L4IA 4GPLB 3IQQA 1F54A 4C0LA 3NSIA 1WDCB 5DKQA 2BE4A 1TCFA 1NCXA 1V1GA 2LVVA 3CLNA 2K8MB 4YGDB 2KAVA 1KWOC 2BCBA 1L2OC 5CPVA 2MBXA 2L0PA 4MRYA 2BBNA 1CLMA 2FCEA 1DJYA 1BU3A 1S5GZ 3CWGA 5CSNA 2LLSA 5G08A 2JNFA 1B8LA 4PE4A 4D1EA 4MZLA 1BR1B 2LMVA 2KOTA 1GGWA 2KI6D 1NX3A 1BG1A 4AOMA 3I5HC 1XFUO 2M1KB 1G33A 1CDLA 5KU1A 4ORCB 4U8DA 2RGIA 1CLBA 4TNCA 3KF9A 4MLWA 4NQGA 1QX7A 2LCPA 1WDCC 3QRXA 3JVTB 2KQYA 1F70A 4DS7A 3AKBA 4HRGA 5AANA 1CLLA 1J7QA 2K7OA 2NZ0A 1IGVA 2CT9A 4WQ3A 3DVKA 1IKUA 4ZCVA 4A4BA 1PULA 1F8HA 1SR6B 3SG6A 5FYXA 1TNPA 1K9KA 2M29A 1MXLC 4XYNA 2HETA 4E68A 3O78A 4N1GA 1RK9A 1QX5B 1BJFA 1S6IA 1K9PA 2LLTA 1CMFA 3PSRA 4MBEA 4XJKA 2JTZA 2MRDA 3BUOB 1OZSA 1KQMB 3SIBA 3DD4A 2KFFA 1S6JA 3BUMB 3EKHA 1JF2A 1WLZA 2KBIA 1SY9A 3EK7A 2ISDA 2GV5A 2MLFC 1S6CA 2M7LA 3TZ1A 4OR9B 1DT7B 5AFPA 1C07A 4N5XA 1NX1A 2CBLA 4C0KA 3SG5A 2HQ8A 2PMYA 1SCMB 4I5LB 1K95A 3JVTC 3M0WA 1BOCA 5JJGA 1M45A 1ZUZA 2LVJA 3VRNA 1NWDA 2F2OA 3WXAA 4BY4A 1IJ5A 1SR6C 3NSOA 5I8NA 2A4JA 4DUQA 2I94A 3EVVA 5HLOA 1OOJA 1LA3A 2AAOA 2HPSA 2LHLA 4M2QA 4PHNA 2FCDA 1R6PA 1U5IA 4OCIA 1UHJA 2WCEA 1DJXA 2JZIA 3SJSA 2IS9A 1E8AA 2GGMA 4P2YB 1DGUA 1ALVA 2BECA 1KQMC 1MUXA 4XJKB 1HT9A 2OTGB 3SIAA 2BL0B 3F45A 3HCMA 1EXRA 5IBWA 1ZMZA 1S3PA 1NUBA 2KSPA 1DJHA 4CFRA 3D0YB 4JQ0D 1CTRA 3CS1A 1YURA 4PHKA 2JT0A 1SCVA 3VRRA 2F33A 1K8UA 2LV7A 2NLNA 2QACA 1LKJA 1GQMA 3O6BA 2MHHA 4PCWA 1ZOTB 1CFPA 3NSLA 1SK6D 4NDCA 2L98A 1UHHA 1U5IB 2LHIA 2NCOA 3DF0B 4IL1A 3SG4A 1JUOA 4YRUA 1ZACA 1Y1XA 4PE1A 5DKNA 1H4BA 2PSRA 3CTNA 1DJIA 4M2PA 2OTGC 1B47A 5PALA 2BL0C 1NP8A 4OVNF 4QJ3B 5JOLA 5B8IB 3ZNIA 1J1DA 3TUYB 4N1FA 3AKAA 3NXAA 4YGEB 1PVBA 2WCBA 1KFUL 1YRUB 3PALA 3PFVA 1EJ3A 4HRHA 2KI4C 3FWCA 1XYDA 5AERA 1TNWA 1A03A 2Y5IA 1WRKA 3OX5A 4NDDA 2LC5A 1OSAA 2KNEA 2KAXA 1J7PA 3EK8A 1CDNA 1MXEA 4P5OE 4A4CA 1B1GA 4GBAA 1W7JB 3LL8B 3CR5X 3DVJA 5ER4X 2LE9B 4F0ZB 2SCPA 2CTNA 4AQIA 2TN4A 3CR2A 1IRJA 2MA2A 1IQ3A 1S5GY 3AAKA 3TUYC 1QASA 3FS7A 1XFWO 4MN0A 1A4PA 2EC6C 2K7DA 3VRPA 3WNXB 1N0YA 3DVEA 2EHBA 1M31A 2F2PA 2I2RE 2K7CA 2LUXA 1PVAA 1F55A 2O60A 3CZTX 3GK4X 2ZNEA 4ORAB 1CMGA 4DCKA 4MZKA 4AQJA 2K0JA 2F3ZA 5I2QA 1F4QA 2I7AA 2KBMA 2Q91A 1B9AA 2O5GA 1MWNA 1DTLA 1Q80A 2BKIB 1SW8A 2NXQA 1IH0A 2OS8B 1FF1A 1AP4A 3SG2A 2PRUA 2Y1MA 1Y1UA 2M8UA 4Q04A 3SG7A 2L50A 1JFKA 1BT6A 2JULA 1S26D 2LVIA 3PM8A 5CSIA 4JPZB 3D0YA 1B8CA 2Y4QA 1QLSA 2P6BB 4R1EA 1RECA 1TIZA 4YBHB 1N2DA 3BUWB 2FOTA 1JSAA 1WRZA 1CB1A 3I5IB 2I18A 1JF0A 1OMRA 2HQWA 4GGNA 1B7TY 3BOWB 1IG5A 1OE9B 1UUSA 3A8RA 1B8RA 1WLMA 1LVCD 2JRFA 1K2HA 4I5JA 4YGBB 4CLNA 1SYMA 5D7FA 2LM5A 1SBJA 4FQOA 3DF0A 1GJYA 1ODBA 2QPTA 1OQPA 2CNPA 2M97A 1UURA 2OPOA 2B1UA 1XFZO 2KHNA 3TDUA 3VROA 3JTDB 2JT3A 1PSRA 1FI5A 1QV0A 3BQ3A 2OS8C 1XFYO 2JT8A 3D10A 3LLEA 1FI6A 3EKJA 2ZFDA 1M63B 2Y1NA 2ZRTA 1Y0VH 3EK4A 1LA0A 1JC2A 1IJ6A 1QJTA 1XO5A 1M46A 2M3WA 4FTGA 1SKTA 3FWBA 2CXJA 2ZRSA 1EL4A 2KI4B 2ZN9A 1KK7Y 2K2FA 3I5IC 2MLEC 3K21A 1AVSA 1CDPA 1QS7A 5BPJA 1JWDA 3RM1A 1F71A 1R2UA 4HSZA 1CKKA 2L4HA 1YUSA 3SG3A 3GOFA 1DMOA 1YRTB 2JTTA 4I5KA 1IQ5A 3TDIA 1YVHA 2LANA 2LNKA 1SL8A 1NCYA 3PLFB 3DVMA 2WORA 2LVKA 2M0RA 5I2LA 1CFCA 1DVIA 1UHNA 2MJWB 1TN4A 2KFHA 3JTDC 1TNXA 2EGDA 2LLUA 4L9MA 4QJ4B 3KPXA 4JWQA 1YUUA 1FPWA 3NSKA 3KHEA 2KAYA 1H8BA 4GAOA 1AJ5A 1AHRA 2LUCA 2H61C 2AUCA 1UP5A 1OZOA 1TNQA 3LK1A 3KEVA 1KSOA 3OX6A 1KCYA 2F8PA 2BBMA 2G2BA 2EC6B 4OV2A 5CSFA 1PSBA 3BUXB 4DRWA 2E6WA 4GFTA 4ICBA 1J7RA 4YGAA 1OMDA 3VGOA 1UHKA 1YVLA 5D69A 1KFUS 4MSPA 4UPGA 2V53A 4PE7A 1QVIY 3MSEB 1CM1A 3TDZA 1YX7A 2KGBC 1KFXL 1B4CA 2ZN8A 3I5FB 5J3XA 2AMIA 1YUTA 3A4UB 4USLA 2JNXA 1XFXO 2WC8A 5F6TA 4GGFC 2BCXA 2M9GA 2JC2A 1AUIB 2KDHA 1JBAA 2ZKMX 1CNPA 1A29A 2NCPA 1J7OA 1CFDA 1MF8B 1QLKA 1DJZA 1QIVA 5HKYA 5I2OA 1RWYA 4ETOA 1DJWA 2KFGA 1F4OA 1WY9A 4HREE 1K96A 1UWOA 3KO0A 2HF5A 1UHIA 2G9BA 2CCMA 3BOWA 5GQQC 1TTXA 1EH2A 2SASA 3O2PA 1DGVA 1HQVA 2WOSA 3BYAA 2JPTA 5AXIA 1BMOA 1K9UA 1J55A 3I5FC 1TOPA 2FJUB 3IQOA 3PATA 4YI9A 2WNDA 1NCZA 1M39A 1XA5A 5TNCA 1OMVA 3ZWHA 1KK8B 1NX0A 2COLB 2VRGA 4MVFA 1XFVO 3IF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KQ6 A;  2KYF A;  1FW4 A;  1FBV A;  3C1V A;  2M7N A;  1ALW A;  1TCO B;  2JXL A;  4PAL A;  5DKR A;  2H61 A;  4CFQ A;  1SRA A;  4CPV A;  4QJ5 B;  4MRX A;  1EG4 A;  2JU0 A;  2BE6 A;  2ZND A;  2GGZ A;  1NIW A;  4ORB B;  1ZFS A;  1S36 A;  1JFJ A;  1DF0 A;  2JXC A;  4NDB A;  1PK0 D;  2M1U A;  2L51 A;  3E3R A;  1LIN A;  2BKH B;  3WHT B;  1BF5 A;  1B7T Z;  3HX4 A;  3TS5 B;  1CFF A;  1PAL A;  1N65 A;  5HYD A;  4I5N B;  4WRI A;  2JQ6 A;  1G4Y R;  4GGF A;  1AK8 A;  1KK8 C;  2Q4U A;  1K90 D;  1XK4 C;  2L2E A;  3CR4 X;  1IWQ A;  2JWW A;  1QIW A;  4PHM A;  2K2A A;  2L5X B;  1L7Z A;  1BLQ A;  2BCA A;  1G8I A;  3ICB A;  1SMG A;  1EG3 A;  1KQV A;  1QTX A;  5KTY A;  3LCP C;  5HKZ A;  1YX8 A;  3LK0 A;  4YI8 A;  3GK1 A;  4PE0 A;  3PN7 B;  2E30 A;  1SPY A;  3WHU B;  1A75 A;  1DJG A;  3BXK A;  1A2X A;  2F3Y A;  3I5G B;  2H2K A;  4YGC B;  4GUK A;  1QX2 A;  1KK7 Z;  1DF0 B;  1Y6W A;  1MR8 A;  3O4Y A;  1RJV A;  4MEW A;  1SNL A;  1RFJ A;  1K93 D;  5CSJ A;  3TS5 C;  5HLV A;  1J1E A;  2K61 A;  2PAS A;  2WCF A;  4CID A;  1BR4 B;  1CM4 A;  1W7I B;  3RLZ A;  4MZJ A;  4BY5 A;  1YR5 A;  1KSM A;  1PRW A;  2KI6 C;  4PHJ A;  3OP0 A;  5KSZ A;  1XVJ A;  4DIR A;  1K94 A;  3EVU A;  4WQ2 A;  2JOJ A;  1AJ4 A;  1SCM C;  3GK2 A;  2KGR A;  1D1O A;  4M2O A;  4OKH A;  1S1E A;  2LP2 A;  1MHO A;  1QAT A;  1KWO B;  5HKW A;  1L2O B;  1SL7 A;  1V1F A;  1SL9 A;  1NSH A;  4ZCU A;  1YTZ C;  3FIA A;  1Y1A A;  3PN7 C;  3VRQ A;  3BUN B;  1NX2 A;  1C7W A;  3OB1 B;  4PDZ A;  2R2I A;  4GNK B;  3I5G C;  3H4S E;  2PAL A;  2K7B A;  1A75 B;  3CGA A;  1MQ1 A;  1RRO A;  1QXP A;  2LP3 A;  1CDM A;  2M49 B;  3EVR A;  3OB2 B;  5K89 A;  2PVB A;  3I5H B;  1NYA A;  1X02 A;  2KYC A;  1VRK A;  2LMT A;  1NPQ A;  1QVI Z;  5AEQ A;  2D8N A;  1GGZ A;  1TRF A;  3AAJ A;  5ER5 A;  1BOD A;  2LAP A;  1XK4 A;  3OHM B;  1LXF C;  2DOQ A;  2LMU A;  1KFX S;  4C0J A;  1QV1 A;  1WRL A;  2MAZ A;  1C7V A;  1RTP 1;  2L4I A;  4GPL B;  3IQQ A;  1F54 A;  4C0L A;  3NSI A;  1WDC B;  5DKQ A;  2BE4 A;  1TCF A;  1NCX A;  1V1G A;  2LVV A;  3CLN A;  2K8M B;  4YGD B;  2KAV A;  1KWO C;  2BCB A;  1L2O C;  5CPV A;  2MBX A;  2L0P A;  4MRY A;  2BBN A;  1CLM A;  2FCE A;  1DJY A;  1BU3 A;  1S5G Z;  3CWG A;  5CSN A;  2LLS A;  5G08 A;  2JNF A;  1B8L A;  4PE4 A;  4D1E A;  4MZL A;  1BR1 B;  2LMV A;  2KOT A;  1GGW A;  2KI6 D;  1NX3 A;  1BG1 A;  4AOM A;  3I5H C;  1XFU O;  2M1K B;  1G33 A;  1CDL A;  5KU1 A;  4ORC B;  4U8D A;  2RGI A;  1CLB A;  4TNC A;  3KF9 A;  4MLW A;  4NQG A;  1QX7 A;  2LCP A;  1WDC C;  3QRX A;  3JVT B;  2KQY A;  1F70 A;  4DS7 A;  3AKB A;  4HRG A;  5AAN A;  1CLL A;  1J7Q A;  2K7O A;  2NZ0 A;  1IGV A;  2CT9 A;  4WQ3 A;  3DVK A;  1IKU A;  4ZCV A;  4A4B A;  1PUL A;  1F8H A;  1SR6 B;  3SG6 A;  5FYX A;  1TNP A;  1K9K A;  2M29 A;  1MXL C;  4XYN A;  2HET A;  4E68 A;  3O78 A;  4N1G A;  1RK9 A;  1QX5 B;  1BJF A;  1S6I A;  1K9P A;  2LLT A;  1CMF A;  3PSR A;  4MBE A;  4XJK A;  2JTZ A;  2MRD A;  3BUO B;  1OZS A;  1KQM B;  3SIB A;  3DD4 A;  2KFF A;  1S6J A;  3BUM B;  3EKH A;  1JF2 A;  1WLZ A;  2KBI A;  1SY9 A;  3EK7 A;  2ISD A;  2GV5 A;  2MLF C;  1S6C A;  2M7L A;  3TZ1 A;  4OR9 B;  1DT7 B;  5AFP A;  1C07 A;  4N5X A;  1NX1 A;  2CBL A;  4C0K A;  3SG5 A;  2HQ8 A;  2PMY A;  1SCM B;  4I5L B;  1K95 A;  3JVT C;  3M0W A;  1BOC A;  5JJG A;  1M45 A;  1ZUZ A;  2LVJ A;  3VRN A;  1NWD A;  2F2O A;  3WXA A;  4BY4 A;  1IJ5 A;  1SR6 C;  3NSO A;  5I8N A;  2A4J A;  4DUQ A;  2I94 A;  3EVV A;  5HLO A;  1OOJ A;  1LA3 A;  2AAO A;  2HPS A;  2LHL A;  4M2Q A;  4PHN A;  2FCD A;  1R6P A;  1U5I A;  4OCI A;  1UHJ A;  2WCE A;  1DJX A;  2JZI A;  3SJS A;  2IS9 A;  1E8A A;  2GGM A;  4P2Y B;  1DGU A;  1ALV A;  2BEC A;  1KQM C;  1MUX A;  4XJK B;  1HT9 A;  2OTG B;  3SIA A;  2BL0 B;  3F45 A;  3HCM A;  1EXR A;  5IBW A;  1ZMZ A;  1S3P A;  1NUB A;  2KSP A;  1DJH A;  4CFR A;  3D0Y B;  4JQ0 D;  1CTR A;  3CS1 A;  1YUR A;  4PHK A;  2JT0 A;  1SCV A;  3VRR A;  2F33 A;  1K8U A;  2LV7 A;  2NLN A;  2QAC A;  1LKJ A;  1GQM A;  3O6B A;  2MHH A;  4PCW A;  1ZOT B;  1CFP A;  3NSL A;  1SK6 D;  4NDC A;  2L98 A;  1UHH A;  1U5I B;  2LHI A;  2NCO A;  3DF0 B;  4IL1 A;  3SG4 A;  1JUO A;  4YRU A;  1ZAC A;  1Y1X A;  4PE1 A;  5DKN A;  1H4B A;  2PSR A;  3CTN A;  1DJI A;  4M2P A;  2OTG C;  1B47 A;  5PAL A;  2BL0 C;  1NP8 A;  4OVN F;  4QJ3 B;  5JOL A;  5B8I B;  3ZNI A;  1J1D A;  3TUY B;  4N1F A;  3AKA A;  3NXA A;  4YGE B;  1PVB A;  2WCB A;  1KFU L;  1YRU B;  3PAL A;  3PFV A;  1EJ3 A;  4HRH A;  2KI4 C;  3FWC A;  1XYD A;  5AER A;  1TNW A;  1A03 A;  2Y5I A;  1WRK A;  3OX5 A;  4NDD A;  2LC5 A;  1OSA A;  2KNE A;  2KAX A;  1J7P A;  3EK8 A;  1CDN A;  1MXE A;  4P5O E;  4A4C A;  1B1G A;  4GBA A;  1W7J B;  3LL8 B;  3CR5 X;  3DVJ A;  5ER4 X;  2LE9 B;  4F0Z B;  2SCP A;  2CTN A;  4AQI A;  2TN4 A;  3CR2 A;  1IRJ A;  2MA2 A;  1IQ3 A;  1S5G Y;  3AAK A;  3TUY C;  1QAS A;  3FS7 A;  1XFW O;  4MN0 A;  1A4P A;  2EC6 C;  2K7D A;  3VRP A;  3WNX B;  1N0Y A;  3DVE A;  2EHB A;  1M31 A;  2F2P A;  2I2R E;  2K7C A;  2LUX A;  1PVA A;  1F55 A;  2O60 A;  3CZT X;  3GK4 X;  2ZNE A;  4ORA B;  1CMG A;  4DCK A;  4MZK A;  4AQJ A;  2K0J A;  2F3Z A;  5I2Q A;  1F4Q A;  2I7A A;  2KBM A;  2Q91 A;  1B9A A;  2O5G A;  1MWN A;  1DTL A;  1Q80 A;  2BKI B;  1SW8 A;  2NXQ A;  1IH0 A;  2OS8 B;  1FF1 A;  1AP4 A;  3SG2 A;  2PRU A;  2Y1M A;  1Y1U A;  2M8U A;  4Q04 A;  3SG7 A;  2L50 A;  1JFK A;  1BT6 A;  2JUL A;  1S26 D;  2LVI A;  3PM8 A;  5CSI A;  4JPZ B;  3D0Y A;  1B8C A;  2Y4Q A;  1QLS A;  2P6B B;  4R1E A;  1REC A;  1TIZ A;  4YBH B;  1N2D A;  3BUW B;  2FOT A;  1JSA A;  1WRZ A;  1CB1 A;  3I5I B;  2I18 A;  1JF0 A;  1OMR A;  2HQW A;  4GGN A;  1B7T Y;  3BOW B;  1IG5 A;  1OE9 B;  1UUS A;  3A8R A;  1B8R A;  1WLM A;  1LVC D;  2JRF A;  1K2H A;  4I5J A;  4YGB B;  4CLN A;  1SYM A;  5D7F A;  2LM5 A;  1SBJ A;  4FQO A;  3DF0 A;  1GJY A;  1ODB A;  2QPT A;  1OQP A;  2CNP A;  2M97 A;  1UUR A;  2OPO A;  2B1U A;  1XFZ O;  2KHN A;  3TDU A;  3VRO A;  3JTD B;  2JT3 A;  1PSR A;  1FI5 A;  1QV0 A;  3BQ3 A;  2OS8 C;  1XFY O;  2JT8 A;  3D10 A;  3LLE A;  1FI6 A;  3EKJ A;  2ZFD A;  1M63 B;  2Y1N A;  2ZRT A;  1Y0V H;  3EK4 A;  1LA0 A;  1JC2 A;  1IJ6 A;  1QJT A;  1XO5 A;  1M46 A;  2M3W A;  4FTG A;  1SKT A;  3FWB A;  2CXJ A;  2ZRS A;  1EL4 A;  2KI4 B;  2ZN9 A;  1KK7 Y;  2K2F A;  3I5I C;  2MLE C;  3K21 A;  1AVS A;  1CDP A;  1QS7 A;  5BPJ A;  1JWD A;  3RM1 A;  1F71 A;  1R2U A;  4HSZ A;  1CKK A;  2L4H A;  1YUS A;  3SG3 A;  3GOF A;  1DMO A;  1YRT B;  2JTT A;  4I5K A;  1IQ5 A;  3TDI A;  1YVH A;  2LAN A;  2LNK A;  1SL8 A;  1NCY A;  3PLF B;  3DVM A;  2WOR A;  2LVK A;  2M0R A;  5I2L A;  1CFC A;  1DVI A;  1UHN A;  2MJW B;  1TN4 A;  2KFH A;  3JTD C;  1TNX A;  2EGD A;  2LLU A;  4L9M A;  4QJ4 B;  3KPX A;  4JWQ A;  1YUU A;  1FPW A;  3NSK A;  3KHE A;  2KAY A;  1H8B A;  4GAO A;  1AJ5 A;  1AHR A;  2LUC A;  2H61 C;  2AUC A;  1UP5 A;  1OZO A;  1TNQ A;  3LK1 A;  3KEV A;  1KSO A;  3OX6 A;  1KCY A;  2F8P A;  2BBM A;  2G2B A;  2EC6 B;  4OV2 A;  5CSF A;  1PSB A;  3BUX B;  4DRW A;  2E6W A;  4GFT A;  4ICB A;  1J7R A;  4YGA A;  1OMD A;  3VGO A;  1UHK A;  1YVL A;  5D69 A;  1KFU S;  4MSP A;  4UPG A;  2V53 A;  4PE7 A;  1QVI Y;  3MSE B;  1CM1 A;  3TDZ A;  1YX7 A;  2KGB C;  1KFX L;  1B4C A;  2ZN8 A;  3I5F B;  5J3X A;  2AMI A;  1YUT A;  3A4U B;  4USL A;  2JNX A;  1XFX O;  2WC8 A;  5F6T A;  4GGF C;  2BCX A;  2M9G A;  2JC2 A;  1AUI B;  2KDH A;  1JBA A;  2ZKM X;  1CNP A;  1A29 A;  2NCP A;  1J7O A;  1CFD A;  1MF8 B;  1QLK A;  1DJZ A;  1QIV A;  5HKY A;  5I2O A;  1RWY A;  4ETO A;  1DJW A;  2KFG A;  1F4O A;  1WY9 A;  4HRE E;  1K96 A;  1UWO A;  3KO0 A;  2HF5 A;  1UHI A;  2G9B A;  2CCM A;  3BOW A;  5GQQ C;  1TTX A;  1EH2 A;  2SAS A;  3O2P A;  1DGV A;  1HQV A;  2WOS A;  3BYA A;  2JPT A;  5AXI A;  1BMO A;  1K9U A;  1J55 A;  3I5F C;  1TOP A;  2FJU B;  3IQO A;  3PAT A;  4YI9 A;  2WND A;  1NCZ A;  1M39 A;  1XA5 A;  5TNC A;  1OMV A;  3ZWH A;  1KK8 B;  1NX0 A;  2COL B;  2VRG A;  4MVF A;  1XFV O;  3IF7 A; 
#chains in the Genus database with same CATH topology
 2KQ6 A;  2KYF A;  1FW4 A;  5DIC A;  1FBV A;  3C1V A;  2M7N A;  1ALW A;  1TCO B;  2JXL A;  3NHI A;  4PAL A;  2H61 A;  5DKR A;  4CFQ A;  2ERB A;  1SRA A;  4CPV A;  4QJ5 B;  4MRX A;  2H8V A;  1EG4 A;  2JU0 A;  2BE6 A;  2ZND A;  2GGZ A;  1NIW A;  3K1E A;  4ORB B;  1ZFS A;  2P71 A;  1S36 A;  1JFJ A;  1DF0 A;  2JXC A;  4NDB A;  1PK0 D;  2M1U A;  2L51 A;  3E3R A;  1LIN A;  2BKH B;  3D78 A;  3WHT B;  3B86 A;  3CAB A;  2KPH A;  1BF5 A;  1B7T Z;  3HX4 A;  3TS5 B;  1CFF A;  3Q8I A;  1PAL A;  3CYZ A;  1N65 A;  5HYD A;  4PT1 A;  4I5N B;  4WRI A;  2JQ6 A;  1G4Y R;  4GGF A;  1AK8 A;  1KK8 C;  2Q4U A;  1K90 D;  1XK4 C;  2L2E A;  3CR4 X;  1IWQ A;  2JWW A;  1QIW A;  1ORG A;  2K2A A;  2L5X B;  1L7Z A;  4PHM A;  1BLQ A;  2BCA A;  3BFB A;  1G8I A;  3ICB A;  1SMG A;  1EG3 A;  1KQV A;  1QTX A;  5KTY A;  3LCP C;  5HKZ A;  1YX8 A;  3CZ1 A;  3LK0 A;  4YI8 A;  3GK1 A;  4PE0 A;  3PN7 B;  2E30 A;  1SPY A;  3WHU B;  1A75 A;  1DJG A;  3BXK A;  1A2X A;  2F3Y A;  3I5G B;  2H2K A;  4YGC B;  3PM2 A;  4GUK A;  1QX2 A;  1KK7 Z;  3DY9 A;  1DF0 B;  1Y6W A;  1MR8 A;  3O4Y A;  1RJV A;  4MEW A;  1SNL A;  1RFJ A;  1K93 D;  5CSJ A;  1IIO A;  3TS5 C;  5HLV A;  1J1E A;  2K61 A;  1SSE B;  2PAS A;  2WCF A;  1BR4 B;  4CID A;  3NHT A;  1CM4 A;  1W7I B;  3RLZ A;  4MZJ A;  4BY5 A;  1YR5 A;  1KSM A;  1PRW A;  2KI6 C;  4PHJ A;  3OP0 A;  5KSZ A;  1XVJ A;  4DIR A;  1K94 A;  3EVU A;  4WQ2 A;  2JOJ A;  1AJ4 A;  1SCM C;  3GK2 A;  2KGR A;  3O4X A;  3CZ2 A;  4M2O A;  4OKH A;  1S1E A;  2LP2 A;  1D1O A;  1MHO A;  1OW4 A;  1QAT A;  1KWO B;  5HKW A;  1L2O B;  3OGN A;  1SL7 A;  1V1F A;  1SL9 A;  1NSH A;  4ZCU A;  1YTZ C;  3FIA A;  1Y1A A;  3PN7 C;  3VRQ A;  3BUN B;  1NX2 A;  1C7W A;  3OB1 B;  4PDZ A;  1T14 A;  1Z2C B;  2R2I A;  4GNK B;  3CDN A;  3I5G C;  1DEK A;  3H4S E;  2PAL A;  2K7B A;  1A75 B;  2BAP A;  3CGA A;  1MQ1 A;  1RRO A;  1QXP A;  2LP3 A;  1CDM A;  2M49 B;  3EVR A;  3OB2 B;  5K89 A;  2PVB A;  3N7H A;  3I5H B;  1NYA A;  1X02 A;  2KYC A;  1DC1 A;  1VRK A;  2LMT A;  1NPQ A;  1QVI Z;  5AEQ A;  2D8N A;  1GGZ A;  1TRF A;  3AAJ A;  5ER5 A;  5FI6 A;  1BOD A;  2LAP A;  1XK4 A;  3OHM B;  1LXF C;  2DOQ A;  2LMU A;  1KFX S;  4C0J A;  1QV1 A;  1WRL A;  2MAZ A;  1C7V A;  1RTP 1;  2L4I A;  1OOF A;  4GPL B;  3IQQ A;  1F54 A;  4C0L A;  3B87 A;  3NSI A;  1WDC B;  5DKQ A;  2BE4 A;  1TCF A;  1NCX A;  1V1G A;  2LVV A;  3CLN A;  2K8M B;  4YGD B;  2KAV A;  1KWO C;  2BCB A;  1L2O C;  5CPV A;  2MBX A;  2L0P A;  4MRY A;  2BBN A;  1CLM A;  2FCE A;  1DJY A;  1BU3 A;  1S5G Z;  3CWG A;  3IVT A;  5CSN A;  2LLS A;  2JPO A;  5G08 A;  2JNF A;  1B8L A;  4PE4 A;  4D1E A;  4MZL A;  1BR1 B;  2LMV A;  2KOT A;  3CZ0 A;  2KI6 D;  1GGW A;  1NX3 A;  1BG1 A;  4AOM A;  3BFA A;  3I5H C;  1XFU O;  2M1K B;  1G33 A;  1CDL A;  3B7A A;  2GTE A;  3S0B A;  5KU1 A;  1C3Z A;  4ORC B;  1OOH A;  4U8D A;  2RGI A;  1CLB A;  4TNC A;  3KF9 A;  4MLW A;  4NQG A;  1QX7 A;  2LCP A;  1WDC C;  3DXL A;  3QRX A;  3JVT B;  2KQY A;  1F70 A;  4DS7 A;  3AKB A;  4HRG A;  5AAN A;  1CLL A;  1J7Q A;  2K7O A;  2NZ0 A;  1IGV A;  2CT9 A;  4WQ3 A;  3DVK A;  1IKU A;  2QEO A;  4ZCV A;  1PUL A;  4A4B A;  1SR6 B;  1F8H A;  3SG6 A;  3FE8 A;  5FYX A;  3V2L A;  1TNP A;  1K9K A;  2M29 A;  1MXL C;  3D77 A;  4XYN A;  2HET A;  2KLD A;  3O78 A;  4N1G A;  4E68 A;  1Z4H A;  1RK9 A;  1QX5 B;  1BJF A;  1S6I A;  1K9P A;  2LLT A;  1CMF A;  3PSR A;  4MBE A;  4XJK A;  2JTZ A;  2MRD A;  3BUO B;  1OZS A;  1KQM B;  3SIB A;  3DD4 A;  2KFF A;  1S6J A;  3BUM B;  3EKH A;  1JF2 A;  1WLZ A;  2KBI A;  2L5Y A;  4IJ7 A;  1SY9 A;  3EK7 A;  2ISD A;  2GV5 A;  2MLF C;  1S6C A;  2WCL A;  2M7L A;  3TZ1 A;  4OR9 B;  1DT7 B;  5AFP A;  1C07 A;  4N5X A;  1NX1 A;  2CBL A;  4JD9 A;  3SG5 A;  4C0K A;  2HQ8 A;  2PMY A;  1SCM B;  4I5L B;  1K95 A;  3JVT C;  3M0W A;  1BOC A;  5JJG A;  1M45 A;  1ZUZ A;  2LVJ A;  3VRN A;  1DQE A;  2YGU A;  2P70 A;  1NWD A;  2F2O A;  3WXA A;  4BY4 A;  1IJ5 A;  1SR6 C;  3NSO A;  5I8N A;  2A4J A;  4DUQ A;  2I94 A;  1TUJ A;  5FI7 A;  3EVV A;  5HLO A;  1OOJ A;  1LA3 A;  2AAO A;  2HPS A;  2LHL A;  2QEV A;  4M2Q A;  2FCD A;  1R6P A;  4PHN A;  1OOG A;  1U5I A;  4OCI A;  1UHJ A;  2WCE A;  1DJX A;  2JZI A;  3SJS A;  2IS9 A;  1E8A A;  2GGM A;  3BFH A;  4P2Y B;  1DGU A;  1ALV A;  2BEC A;  1KQM C;  1MUX A;  4XJK B;  1HT9 A;  2OTG B;  3SIA A;  2BL0 B;  3F45 A;  3HCM A;  1EXR A;  5IBW A;  1ZMZ A;  1S3P A;  1NUB A;  3R1V A;  2KSP A;  1DJH A;  4CFR A;  3QME A;  3S0D A;  3D0Y B;  4JQ0 D;  1CTR A;  3S0G A;  3CS1 A;  2BNX A;  1YUR A;  4PHK A;  2JT0 A;  1SCV A;  3VRR A;  2F33 A;  1K8U A;  2LV7 A;  2NLN A;  2QAC A;  1LKJ A;  1GQM A;  3O6B A;  2MHH A;  4PCW A;  3FE6 A;  1ZOT B;  2QEB A;  1CFP A;  3NSL A;  1OOI X;  5FI2 A;  3PJI A;  1SK6 D;  4NDC A;  2L98 A;  1UHH A;  1U5I B;  2LHI A;  2NCO A;  3DF0 B;  4IL1 A;  3SG4 A;  1JUO A;  1C3Y A;  4YRU A;  1ZAC A;  1Y1X A;  4PE1 A;  5DKN A;  1H4B A;  2PSR A;  3DZT A;  3CTN A;  1DJI A;  4M2P A;  1GM0 A;  2OTG C;  1B47 A;  5PAL A;  2BL0 C;  3R1P A;  1NP8 A;  4OVN F;  4QJ3 B;  5JOL A;  5B8I B;  3ZNI A;  1J1D A;  3TUY B;  4N1F A;  3AKA A;  3NXA A;  4YGE B;  1PVB A;  2WCB A;  1KFU L;  2L2C A;  1YRU B;  3PAL A;  3L4L A;  3PFV A;  1EJ3 A;  4HRH A;  2KI4 C;  5D3O A;  3FWC A;  1XYD A;  2K60 A;  5AER A;  3R1O A;  1TNW A;  1A03 A;  2Y5I A;  1WRK A;  3OX5 A;  4NDD A;  1TUZ A;  2LC5 A;  1OSA A;  2KNE A;  2KAX A;  1J7P A;  3EK8 A;  1CDN A;  1MXE A;  4P5O E;  4A4C A;  1B1G A;  3D74 A;  1W7J B;  3LL8 B;  3CR5 X;  3DVJ A;  4GBA A;  2LE9 B;  2WCM A;  2SCP A;  5ER4 X;  4F0Z B;  2CTN A;  3S0E A;  4AQI A;  2TN4 A;  3CR2 A;  1IRJ A;  4KYN A;  2MA2 A;  1IQ3 A;  2WCK A;  1S5G Y;  2PQL A;  3AAK A;  3TUY C;  1QAS A;  3FS7 A;  1XFW O;  4MN0 A;  1A4P A;  2EC6 C;  3SS3 A;  2K7D A;  3VRP A;  3WNX B;  1N0Y A;  3DVE A;  2EHB A;  1M31 A;  2F2P A;  2I2R E;  2K7C A;  2LUX A;  1PVA A;  1F55 A;  2WCJ A;  2O60 A;  3CZT X;  3GK4 X;  2ZNE A;  4ORA B;  1CMG A;  4DCK A;  4MZK A;  4INW A;  4AQJ A;  2K0J A;  2F3Z A;  3D76 A;  5I2Q A;  1F4Q A;  2I7A A;  2KBM A;  2Q91 A;  1B9A A;  5HL1 A;  3EG5 B;  2O5G A;  1MWN A;  1DTL A;  3BJH A;  1Q80 A;  2BKI B;  1SW8 A;  2NXQ A;  2WC5 A;  3UO9 A;  1IH0 A;  2OS8 B;  1FF1 A;  1AP4 A;  3SG2 A;  3SS4 A;  2PRU A;  2Y1M A;  1Y1U A;  2M8U A;  4Q04 A;  3SG7 A;  2L50 A;  1JFK A;  1BT6 A;  2JUL A;  1S26 D;  1P28 A;  2LVI A;  3PM8 A;  5CSI A;  4JPZ B;  3D0Y A;  1B8C A;  2Y4Q A;  1QLS A;  2P6B B;  3L47 A;  1REC A;  4R1E A;  1TIZ A;  4YBH B;  1N2D A;  3BUW B;  2FOT A;  1JSA A;  1WRZ A;  1CB1 A;  1DEL A;  3I5I B;  2I18 A;  1JF0 A;  1OMR A;  2HQW A;  1QWV A;  1B7T Y;  3BOW B;  4GGN A;  1IG5 A;  1OE9 B;  1UUS A;  3OBV A;  3A8R A;  1B8R A;  1WLM A;  1LVC D;  2JRF A;  1K2H A;  4I5J A;  4YGB B;  4CLN A;  1SYM A;  5D7F A;  2LM5 A;  1SBJ A;  4FQO A;  4INX A;  3DF0 A;  1GJY A;  1ODB A;  2QPT A;  1OQP A;  2CNP A;  2M97 A;  1UUR A;  2OPO A;  2B1U A;  1XFZ O;  2KHN A;  3TDU A;  3VRO A;  3JTD B;  2JT3 A;  1PSR A;  1FI5 A;  1QV0 A;  3BQ3 A;  2OS8 C;  1XFY O;  2JT8 A;  3D10 A;  3LLE A;  4JKT A;  1FI6 A;  3EKJ A;  2ZFD A;  1M63 B;  2Y1N A;  2ZRT A;  1Y0V H;  3EK4 A;  3S0F A;  1LA0 A;  1JC2 A;  1IJ6 A;  1QJT A;  1XO5 A;  1M46 A;  2M3W A;  4FTG A;  1SKT A;  3FWB A;  2CXJ A;  5I94 A;  2ZRS A;  3S0A A;  1EL4 A;  2KI4 B;  2QEH A;  1KK7 Y;  2K2F A;  2ZN9 A;  3I5I C;  2MLE C;  3K21 A;  1AVS A;  1CDP A;  1QS7 A;  5BPJ A;  1JWD A;  3RM1 A;  1F71 A;  4FQT A;  1R2U A;  4HSZ A;  1CKK A;  2L4H A;  1YUS A;  3SG3 A;  3GOF A;  1DMO A;  1YRT B;  2JTT A;  4I5K A;  3L4A A;  1IQ5 A;  3TDI A;  1YVH A;  1LS8 A;  3DYE A;  2LAN A;  2LNK A;  1SL8 A;  1NCY A;  3PLF B;  4F7F A;  3DVM A;  2WOR A;  2FJY A;  2LVK A;  2M0R A;  4OZD A;  5I2L A;  1CFC A;  1DVI A;  1UHN A;  2MJW B;  1TN4 A;  2KFH A;  3JTD C;  1TNX A;  2EGD A;  2LLU A;  4L9M A;  4QJ4 B;  3KPX A;  4JWQ A;  1YUU A;  1FPW A;  3NSK A;  3KHE A;  2KAY A;  1H8B A;  4GAO A;  1AJ5 A;  1AHR A;  2LUC A;  2H61 C;  2AUC A;  1UP5 A;  1OZO A;  1TNQ A;  3LK1 A;  3KEV A;  1KSO A;  3OX6 A;  1KCY A;  3RZS A;  2F8P A;  2BBM A;  2G2B A;  2EC6 B;  4OV2 A;  5CSF A;  1PSB A;  3BUX B;  5EL2 A;  4DRW A;  2E6W A;  4GFT A;  4ICB A;  1J7R A;  4YGA A;  3D75 A;  1OMD A;  3VGO A;  1UHK A;  1W9Z A;  1YVL A;  5D69 A;  1KFU S;  3SS5 A;  4MSP A;  4UPG A;  2V53 A;  4PE7 A;  1QVI Y;  3MSE B;  2WC6 A;  1CM1 A;  3TDZ A;  1YX7 A;  2KGB C;  1KFX L;  1B4C A;  2ZN8 A;  3I5F B;  5J3X A;  2PYQ A;  2AMI A;  1YUT A;  3A4U B;  4USL A;  2JNX A;  1XFX O;  2WC8 A;  5F6T A;  4GGF C;  2BCX A;  2M9G A;  3VB1 A;  2JC2 A;  1AUI B;  2KDH A;  1JBA A;  2ZKM X;  3UNW A;  1CNP A;  1A29 A;  2NCP A;  1J7O A;  3FE9 A;  1CFD A;  1MF8 B;  1QLK A;  1DJZ A;  1QIV A;  3B6X A;  5HKY A;  5I2O A;  2QDI A;  3R72 A;  1RWY A;  4ETO A;  1DJW A;  2KFG A;  1F4O A;  1WY9 A;  4HRE E;  1K96 A;  3NGV A;  1UWO A;  3KO0 A;  2HF5 A;  1UHI A;  2G9B A;  2CCM A;  3BOW A;  3B88 A;  5GQQ C;  1TTX A;  1EH2 A;  2SAS A;  3O2P A;  1DGV A;  1HQV A;  2WOS A;  3BYA A;  2JPT A;  5AXI A;  1BMO A;  1XFR A;  1K9U A;  1J55 A;  1TOP A;  2FJU B;  3I5F C;  3IQO A;  3PAT A;  2WND A;  4YI9 A;  1NCZ A;  1M39 A;  1XA5 A;  5TNC A;  2KLE A;  1OMV A;  3ZWH A;  1KK8 B;  1NX0 A;  2COL B;  2VRG A;  3D73 A;  4MVF A;  1XFV O;  2WCH A;  1TWO A;  3IF7 A; 
#chains in the Genus database with same CATH homology
 2KQ6 A;  2KYF A;  1FW4 A;  1FBV A;  3C1V A;  2M7N A;  1ALW A;  1TCO B;  2JXL A;  4PAL A;  5DKR A;  2H61 A;  4CFQ A;  1SRA A;  4CPV A;  4QJ5 B;  4MRX A;  1EG4 A;  2JU0 A;  2BE6 A;  2ZND A;  2GGZ A;  1NIW A;  4ORB B;  1ZFS A;  1S36 A;  1JFJ A;  1DF0 A;  2JXC A;  4NDB A;  1PK0 D;  2M1U A;  2L51 A;  3E3R A;  1LIN A;  2BKH B;  3WHT B;  1BF5 A;  1B7T Z;  3HX4 A;  3TS5 B;  1CFF A;  1PAL A;  1N65 A;  5HYD A;  4I5N B;  4WRI A;  2JQ6 A;  1G4Y R;  4GGF A;  1AK8 A;  1KK8 C;  2Q4U A;  1K90 D;  1XK4 C;  2L2E A;  3CR4 X;  1IWQ A;  2JWW A;  1QIW A;  4PHM A;  2K2A A;  2L5X B;  1L7Z A;  1BLQ A;  2BCA A;  1G8I A;  3ICB A;  1SMG A;  1EG3 A;  1KQV A;  1QTX A;  5KTY A;  3LCP C;  5HKZ A;  1YX8 A;  3LK0 A;  4YI8 A;  3GK1 A;  4PE0 A;  3PN7 B;  2E30 A;  1SPY A;  3WHU B;  1A75 A;  1DJG A;  3BXK A;  1A2X A;  2F3Y A;  3I5G B;  2H2K A;  4YGC B;  4GUK A;  1QX2 A;  1KK7 Z;  1DF0 B;  1Y6W A;  1MR8 A;  3O4Y A;  1RJV A;  4MEW A;  1SNL A;  1RFJ A;  1K93 D;  5CSJ A;  3TS5 C;  5HLV A;  1J1E A;  2K61 A;  2PAS A;  2WCF A;  4CID A;  1BR4 B;  1CM4 A;  1W7I B;  3RLZ A;  4MZJ A;  4BY5 A;  1YR5 A;  1KSM A;  1PRW A;  2KI6 C;  4PHJ A;  3OP0 A;  5KSZ A;  1XVJ A;  4DIR A;  1K94 A;  3EVU A;  4WQ2 A;  2JOJ A;  1AJ4 A;  1SCM C;  3GK2 A;  2KGR A;  1D1O A;  4M2O A;  4OKH A;  1S1E A;  2LP2 A;  1MHO A;  1QAT A;  1KWO B;  5HKW A;  1L2O B;  1SL7 A;  1V1F A;  1SL9 A;  1NSH A;  4ZCU A;  1YTZ C;  3FIA A;  1Y1A A;  3PN7 C;  3VRQ A;  3BUN B;  1NX2 A;  1C7W A;  3OB1 B;  4PDZ A;  2R2I A;  4GNK B;  3I5G C;  3H4S E;  2PAL A;  2K7B A;  1A75 B;  3CGA A;  1MQ1 A;  1RRO A;  1QXP A;  2LP3 A;  1CDM A;  2M49 B;  3EVR A;  3OB2 B;  5K89 A;  2PVB A;  3I5H B;  1NYA A;  1X02 A;  2KYC A;  1VRK A;  2LMT A;  1NPQ A;  1QVI Z;  5AEQ A;  2D8N A;  1GGZ A;  1TRF A;  3AAJ A;  5ER5 A;  1BOD A;  2LAP A;  1XK4 A;  3OHM B;  1LXF C;  2DOQ A;  2LMU A;  1KFX S;  4C0J A;  1QV1 A;  1WRL A;  2MAZ A;  1C7V A;  1RTP 1;  2L4I A;  4GPL B;  3IQQ A;  1F54 A;  4C0L A;  3NSI A;  1WDC B;  5DKQ A;  2BE4 A;  1TCF A;  1NCX A;  1V1G A;  2LVV A;  3CLN A;  2K8M B;  4YGD B;  2KAV A;  1KWO C;  2BCB A;  1L2O C;  5CPV A;  2MBX A;  2L0P A;  4MRY A;  2BBN A;  1CLM A;  2FCE A;  1DJY A;  1BU3 A;  1S5G Z;  3CWG A;  5CSN A;  2LLS A;  5G08 A;  2JNF A;  1B8L A;  4PE4 A;  4D1E A;  4MZL A;  1BR1 B;  2LMV A;  2KOT A;  1GGW A;  2KI6 D;  1NX3 A;  1BG1 A;  4AOM A;  3I5H C;  1XFU O;  2M1K B;  1G33 A;  1CDL A;  5KU1 A;  4ORC B;  4U8D A;  2RGI A;  1CLB A;  4TNC A;  3KF9 A;  4MLW A;  4NQG A;  1QX7 A;  2LCP A;  1WDC C;  3QRX A;  3JVT B;  2KQY A;  1F70 A;  4DS7 A;  3AKB A;  4HRG A;  5AAN A;  1CLL A;  1J7Q A;  2K7O A;  2NZ0 A;  1IGV A;  2CT9 A;  4WQ3 A;  3DVK A;  1IKU A;  4ZCV A;  4A4B A;  1PUL A;  1F8H A;  1SR6 B;  3SG6 A;  5FYX A;  1TNP A;  1K9K A;  2M29 A;  1MXL C;  4XYN A;  2HET A;  4E68 A;  3O78 A;  4N1G A;  1RK9 A;  1QX5 B;  1BJF A;  1S6I A;  1K9P A;  2LLT A;  1CMF A;  3PSR A;  4MBE A;  4XJK A;  2JTZ A;  2MRD A;  3BUO B;  1OZS A;  1KQM B;  3SIB A;  3DD4 A;  2KFF A;  1S6J A;  3BUM B;  3EKH A;  1JF2 A;  1WLZ A;  2KBI A;  1SY9 A;  3EK7 A;  2ISD A;  2GV5 A;  2MLF C;  1S6C A;  2M7L A;  3TZ1 A;  4OR9 B;  1DT7 B;  5AFP A;  1C07 A;  4N5X A;  1NX1 A;  2CBL A;  4C0K A;  3SG5 A;  2HQ8 A;  2PMY A;  1SCM B;  4I5L B;  1K95 A;  3JVT C;  3M0W A;  1BOC A;  5JJG A;  1M45 A;  1ZUZ A;  2LVJ A;  3VRN A;  1NWD A;  2F2O A;  3WXA A;  4BY4 A;  1IJ5 A;  1SR6 C;  3NSO A;  5I8N A;  2A4J A;  4DUQ A;  2I94 A;  3EVV A;  5HLO A;  1OOJ A;  1LA3 A;  2AAO A;  2HPS A;  2LHL A;  4M2Q A;  4PHN A;  2FCD A;  1R6P A;  1U5I A;  4OCI A;  1UHJ A;  2WCE A;  1DJX A;  2JZI A;  3SJS A;  2IS9 A;  1E8A A;  2GGM A;  4P2Y B;  1DGU A;  1ALV A;  2BEC A;  1KQM C;  1MUX A;  4XJK B;  1HT9 A;  2OTG B;  3SIA A;  2BL0 B;  3F45 A;  3HCM A;  1EXR A;  5IBW A;  1ZMZ A;  1S3P A;  1NUB A;  2KSP A;  1DJH A;  4CFR A;  3D0Y B;  4JQ0 D;  1CTR A;  3CS1 A;  1YUR A;  4PHK A;  2JT0 A;  1SCV A;  3VRR A;  2F33 A;  1K8U A;  2LV7 A;  2NLN A;  2QAC A;  1LKJ A;  1GQM A;  3O6B A;  2MHH A;  4PCW A;  1ZOT B;  1CFP A;  3NSL A;  1SK6 D;  4NDC A;  2L98 A;  1UHH A;  1U5I B;  2LHI A;  2NCO A;  3DF0 B;  4IL1 A;  3SG4 A;  1JUO A;  4YRU A;  1ZAC A;  1Y1X A;  4PE1 A;  5DKN A;  1H4B A;  2PSR A;  3CTN A;  1DJI A;  4M2P A;  2OTG C;  1B47 A;  5PAL A;  2BL0 C;  1NP8 A;  4OVN F;  4QJ3 B;  5JOL A;  5B8I B;  3ZNI A;  1J1D A;  3TUY B;  4N1F A;  3AKA A;  3NXA A;  4YGE B;  1PVB A;  2WCB A;  1KFU L;  1YRU B;  3PAL A;  3PFV A;  1EJ3 A;  4HRH A;  2KI4 C;  3FWC A;  1XYD A;  5AER A;  1TNW A;  1A03 A;  2Y5I A;  1WRK A;  3OX5 A;  4NDD A;  2LC5 A;  1OSA A;  2KNE A;  2KAX A;  1J7P A;  3EK8 A;  1CDN A;  1MXE A;  4P5O E;  4A4C A;  1B1G A;  4GBA A;  1W7J B;  3LL8 B;  3CR5 X;  3DVJ A;  5ER4 X;  2LE9 B;  4F0Z B;  2SCP A;  2CTN A;  4AQI A;  2TN4 A;  3CR2 A;  1IRJ A;  2MA2 A;  1IQ3 A;  1S5G Y;  3AAK A;  3TUY C;  1QAS A;  3FS7 A;  1XFW O;  4MN0 A;  1A4P A;  2EC6 C;  2K7D A;  3VRP A;  3WNX B;  1N0Y A;  3DVE A;  2EHB A;  1M31 A;  2F2P A;  2I2R E;  2K7C A;  2LUX A;  1PVA A;  1F55 A;  2O60 A;  3CZT X;  3GK4 X;  2ZNE A;  4ORA B;  1CMG A;  4DCK A;  4MZK A;  4AQJ A;  2K0J A;  2F3Z A;  5I2Q A;  1F4Q A;  2I7A A;  2KBM A;  2Q91 A;  1B9A A;  2O5G A;  1MWN A;  1DTL A;  1Q80 A;  2BKI B;  1SW8 A;  2NXQ A;  1IH0 A;  2OS8 B;  1FF1 A;  1AP4 A;  3SG2 A;  2PRU A;  2Y1M A;  1Y1U A;  2M8U A;  4Q04 A;  3SG7 A;  2L50 A;  1JFK A;  1BT6 A;  2JUL A;  1S26 D;  2LVI A;  3PM8 A;  5CSI A;  4JPZ B;  3D0Y A;  1B8C A;  2Y4Q A;  1QLS A;  2P6B B;  4R1E A;  1REC A;  1TIZ A;  4YBH B;  1N2D A;  3BUW B;  2FOT A;  1JSA A;  1WRZ A;  1CB1 A;  3I5I B;  2I18 A;  1JF0 A;  1OMR A;  2HQW A;  4GGN A;  1B7T Y;  3BOW B;  1IG5 A;  1OE9 B;  1UUS A;  3A8R A;  1B8R A;  1WLM A;  1LVC D;  2JRF A;  1K2H A;  4I5J A;  4YGB B;  4CLN A;  1SYM A;  5D7F A;  2LM5 A;  1SBJ A;  4FQO A;  3DF0 A;  1GJY A;  1ODB A;  2QPT A;  1OQP A;  2CNP A;  2M97 A;  1UUR A;  2OPO A;  2B1U A;  1XFZ O;  2KHN A;  3TDU A;  3VRO A;  3JTD B;  2JT3 A;  1PSR A;  1FI5 A;  1QV0 A;  3BQ3 A;  2OS8 C;  1XFY O;  2JT8 A;  3D10 A;  3LLE A;  1FI6 A;  3EKJ A;  2ZFD A;  1M63 B;  2Y1N A;  2ZRT A;  1Y0V H;  3EK4 A;  1LA0 A;  1JC2 A;  1IJ6 A;  1QJT A;  1XO5 A;  1M46 A;  2M3W A;  4FTG A;  1SKT A;  3FWB A;  2CXJ A;  2ZRS A;  1EL4 A;  2KI4 B;  2ZN9 A;  1KK7 Y;  2K2F A;  3I5I C;  2MLE C;  3K21 A;  1AVS A;  1CDP A;  1QS7 A;  5BPJ A;  1JWD A;  3RM1 A;  1F71 A;  1R2U A;  4HSZ A;  1CKK A;  2L4H A;  1YUS A;  3SG3 A;  3GOF A;  1DMO A;  1YRT B;  2JTT A;  4I5K A;  1IQ5 A;  3TDI A;  1YVH A;  2LAN A;  2LNK A;  1SL8 A;  1NCY A;  3PLF B;  3DVM A;  2WOR A;  2LVK A;  2M0R A;  5I2L A;  1CFC A;  1DVI A;  1UHN A;  2MJW B;  1TN4 A;  2KFH A;  3JTD C;  1TNX A;  2EGD A;  2LLU A;  4L9M A;  4QJ4 B;  3KPX A;  4JWQ A;  1YUU A;  1FPW A;  3NSK A;  3KHE A;  2KAY A;  1H8B A;  4GAO A;  1AJ5 A;  1AHR A;  2LUC A;  2H61 C;  2AUC A;  1UP5 A;  1OZO A;  1TNQ A;  3LK1 A;  3KEV A;  1KSO A;  3OX6 A;  1KCY A;  2F8P A;  2BBM A;  2G2B A;  2EC6 B;  4OV2 A;  5CSF A;  1PSB A;  3BUX B;  4DRW A;  2E6W A;  4GFT A;  4ICB A;  1J7R A;  4YGA A;  1OMD A;  3VGO A;  1UHK A;  1YVL A;  5D69 A;  1KFU S;  4MSP A;  4UPG A;  2V53 A;  4PE7 A;  1QVI Y;  3MSE B;  1CM1 A;  3TDZ A;  1YX7 A;  2KGB C;  1KFX L;  1B4C A;  2ZN8 A;  3I5F B;  5J3X A;  2AMI A;  1YUT A;  3A4U B;  4USL A;  2JNX A;  1XFX O;  2WC8 A;  5F6T A;  4GGF C;  2BCX A;  2M9G A;  2JC2 A;  1AUI B;  2KDH A;  1JBA A;  2ZKM X;  1CNP A;  1A29 A;  2NCP A;  1J7O A;  1CFD A;  1MF8 B;  1QLK A;  1DJZ A;  1QIV A;  5HKY A;  5I2O A;  1RWY A;  4ETO A;  1DJW A;  2KFG A;  1F4O A;  1WY9 A;  4HRE E;  1K96 A;  1UWO A;  3KO0 A;  2HF5 A;  1UHI A;  2G9B A;  2CCM A;  3BOW A;  5GQQ C;  1TTX A;  1EH2 A;  2SAS A;  3O2P A;  1DGV A;  1HQV A;  2WOS A;  3BYA A;  2JPT A;  5AXI A;  1BMO A;  1K9U A;  1J55 A;  3I5F C;  1TOP A;  2FJU B;  3IQO A;  3PAT A;  4YI9 A;  2WND A;  1NCZ A;  1M39 A;  1XA5 A;  5TNC A;  1OMV A;  3ZWH A;  1KK8 B;  1NX0 A;  2COL B;  2VRG A;  4MVF A;  1XFV O;  3IF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...