4NDCA

X-ray structure of a mutant (t188d) of calexcitin - a neuronal calcium-signalling protein
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
187
structure length
187
Chain Sequence
QLSDFQRNKILRVFNTFYDCNHDGVIEWDDFELAIKKICNLHSWPTDGKKHNEARATLKLIWDGLRKYADENEDEQVTKEEWLKMWAECVKSVEKGESLPEWLTKYMNFMFDVNDTSGDNIIDKHEYSTVYMSYGIPKSDCDAAFDTLSDGGKTMVTREIFARLWTEYFVSNDRGAKGNHLFGDLKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calexcitin
publication title X-ray, spectroscopic and normal-mode dynamics of calexcitin: structure-function studies of a neuronal calcium-signalling protein.
pubmed doi rcsb
source organism Doryteuthis pealeii
molecule tags Signaling protein
total genus 74
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ndcA00
1UURA 1OZSA 3TS5B 3CTNA 3FWBA 1YURA 2JXCA 2ZNEA 1JSAA 2KGRA 3RM1A 3PALA 3PN7B 4A4CA 1KFXS 3PLFB 3CR4X 2LLUA 4PDZA 3NSLA 1PVBA 2LM5A 1SYMA 3TZ1A 1JUOA 5DKNA 5AXIA 2E6WA 5GQQC 2HETA 2Q91A 2JQ6A 2LMVA 1IJ6A 2PALA 1K9UA 2A4JA 4BY4A 4PE7A 1ZMZA 3EVUA 2K8MB 1K95A 3D10A 3JVTC 1TRFA 1MHOA 3VRNA 2OPOA 2NCPA 1CDLA 2LVJA 4OR9B 1S6IA 4DRWA 1SL7A 4R1EA 4YI8A 1CM4A 1K96A 1LA0A 1S5GY 2KSPA 3HX4A 4DIRA 4QJ5B 2PASA 1R6PA 1NSHA 1MF8B 3EK8A 4MN0A 4CLNA 3KF9A 2LCPA 2QPTA 4YGCB 4DUQA 5DKQA 1CDPA 3NXAA 2LVVA 2M9GA 3TDUA 1EG3A 4NDCA 1IKUA 2BKIB 2OTGB 4ZCUA 1CLMA 1U5IA 1DF0B 2F8PA 1N0YA 2FJUB 1KWOC 3BUWB 3HCMA 2JPTA 4JQ0D 1IRJA 1DJWA 1IG5A 1S36A 1W7JB 4GPLB 2AAOA 4PE4A 2GGMA 2LMTA 2ZNDA 4AOMA 1J7OA 3PM8A 2FCEA 1N2DA 1A75A 1OMVA 2H61C 4NDBA 3OB2B 1UWOA 1QJTA 1KSMA 1YR5A 2LUCA 3VROA 1AP4A 2LAPA 3BUXB 2WCEA 1TNPA 1CLLA 3EVVA 3TS5C 1H8BA 1ZUZA 2KI6D 2K7BA 2JU0A 1QASA 1LVCD 2JT3A 4ICBA 1ALVA 1EL4A 3PN7C 3MSEB 1AJ5A 3WXAA 3OP0A 1Y0VH 3ICBA 1ZACA 5DKRA 1F4QA 2JOJA 4BY5A 4YGDB 2K2FA 5F6TA 2KAXA 4GAOA 2L0PA 4MZKA 3BXKA 1N65A 2EHBA 3IF7A 3SG5A 4DS7A 1DMOA 2MAZA 4QJ3B 1OMDA 2LP2A 1SRAA 3A4UB 2BCBA 5JJGA 1G33A 1SCMB 2I94A 1TNQA 1Y1AA 3CLNA 3GOFA 2MBXA 3D0YA 1LA3A 1M31A 1UP5A 3SIAA 1WRLA 1AK8A 1CB1A 4IL1A 1NWDA 4YBHB 4YRUA 1HT9A 3K21A 1A29A 2BBNA 1F54A 2MA2A 2BKHB 1YUUA 1QV1A 3BUMB 4MBEA 1MQ1A 1S3PA 1JC2A 2Y1NA 5BPJA 1UUSA 3DVJA 1CDNA 4UPGA 1QTXA 3AKAA 1SNLA 4QJ4B 2OTGC 1G8IA 1CNPA 3IQQA 1C7VA 1DJGA 1WDCC 2LV7A 1MWNA 2BECA 2WORA 1QX7A 4PHNA 2JT0A 2M0RA 2BCXA 1PSBA 4U8DA 1KFUS 1UHNA 2M7LA 1YUSA 1U5IB 3SG4A 1K8UA 2IS9A 3PSRA 4XJKA 1K90D 3TUYB 1YVLA 3O2PA 4E68A 1D1OA 4GGFC 4XYNA 2BL0B 4FTGA 3I5IB 2F3ZA 4MSPA 3DF0A 2KBMA 2F2OA 3GK1A 3OX5A 3SG3A 3CZTX 2KAYA 3EKHA 5G08A 1K9KA 1F4OA 2JULA 2L4IA 3QRXA 2MLFC 3BOWA 1QATA 1WLZA 2EGDA 1YRUB 4I5JA 4JWQA 1LKJA 1BF5A 3SG6A 1C7WA 1CFDA 1LXFC 1J7PA 2O60A 5B8IB 1WY9A 1AUIB 1Y6WA 2NZ0A 4MLWA 1OZOA 2M1UA 1NX1A 1RFJA 1NX2A 4USLA 2L4HA 2HQ8A 2K7OA 2AMIA 2I2RE 1QXPA 4CFQA 4GNKB 1CFFA 1CLBA 1F71A 1SCMC 3E3RA 1NCZA 1MR8A 1R2UA 1SCVA 2L5XB 2LMUA 4MZJA 1EG4A 1NYAA 1SMGA 1PRWA 1NIWA 2BE6A 4PE0A 3A8RA 5KTYA 4M2PA 2JC2A 1TN4A 2LNKA 4YI9A 1XK4C 4C0KA 1K94A 1VRKA 1XFVO 1BR4B 1NX0A 2BBMA 1BJFA 4WRIA 1KK8B 1AVSA 1JFJA 1YVHA 2M97A 3VRPA 5IBWA 1RJVA 5KU1A 2M8UA 1TTXA 4FQOA 4N1FA 2P6BB 3IQOA 1CTRA 4CPVA 1J1EA 2WC8A 4ETOA 1QS7A 2L51A 4HREE 1J1DA 1TIZA 1MXEA 1G4YR 2RGIA 4F0ZB 2KNEA 1AHRA 1WLMA 1RROA 3TUYC 2ISDA 3DD4A 1M46A 1UHHA 4AQJA 1RECA 4WQ2A 2PRUA 2PVBA 2KFGA 2BL0C 1TNWA 3I5IC 4HRHA 1WRZA 2L98A 3CWGA 1XFXO 1AJ4A 1YX7A 2KAVA 2NLNA 2O5GA 3OB1B 3OX6A 2WCBA 1F8HA 3KPXA 1CM1A 2AUCA 4C0LA 1CFPA 2H61A 4C0JA 2K61A 5K89A 1XFWO 2SCPA 2KHNA 1KQMB 1FI6A 5AERA 1K2HA 1RTP1 2GV5A 4MVFA 1A03A 2HF5A 5PALA 2TN4A 5HLOA 4CIDA 2OS8B 2COLB 1KCYA 1JBAA 1B8CA 1B8RA 1OE9B 2CTNA 2LLSA 2BE4A 2CXJA 5CSFA 4P5OE 2K0JA 4AQIA 4OCIA 2LVKA 3WNXB 1SL9A 2NCOA 1BU3A 1YTZC 5I2QA 4MRYA 2CBLA 2JRFA 1BMOA 1M63B 2KYFA 3CR5X 1SY9A 1K9PA 5ER4X 3M0WA 1CKKA 5AEQA 3FS7A 1KFXL 1OQPA 3LK1A 1OSAA 1SK6D 3I5FB 2K2AA 3NSOA 2SASA 2KI6C 3AAJA 5HKYA 1ODBA 1WRKA 1A4PA 1B47A 3BQ3A 2MRDA 3LL8B 1B7TZ 4I5NB 1DT7B 1XFUO 5FYXA 4OKHA 1DGVA 1UHJA 4P2YB 3NSKA 5HKWA 1EH2A 4PHMA 1QIVA 1S26D 3ZNIA 2E30A 1SW8A 1V1GA 3O4YA 4PCWA 1MXLC 1DF0A 1IQ3A 4HRGA 1MUXA 4I5KA 3F45A 3FWCA 2ZN9A 5I2LA 1CDMA 4GGNA 3LLEA 1B1GA 1BT6A 1DJZA 5HKZA 1A75B 5CPVA 2MLEC 2CCMA 3I5GB 3JTDB 5I2OA 4GGFA 1SR6B 3FIAA 2JNXA 1S1EA 2KYCA 1EXRA 3VRRA 1HQVA 4JPZB 1KQMC 5HLVA 1B4CA 1QV0A 2G9BA 1QVIY 2M49B 2Y4QA 2WCFA 1XYDA 1FPWA 1J7QA 1B7TY 2FOTA 3BYAA 2OS8C 1QX5B 1YX8A 2KDHA 4ZCVA 4DCKA 1OMRA 1GQMA 2JZIA 2K7DA 4PE1A 1E8AA 1LINA 1UHKA 1KK7Z 3I5HB 3LK0A 5JOLA 3PATA 1IQ5A 1CFCA 1V1FA 1SBJA 2JTZA 5D69A 2ZN8A 5I8NA 3BUOB 3AKBA 4MEWA 1S6CA 3D0YB 3EKJA 5HYDA 3NSIA 2LE9B 3LCPC 1GGWA 1KQVA 1DVIA 1DJXA 1C07A 1BOCA 3VRQA 3VGOA 2KI4B 5ER5A 2Y1MA 1ZFSA 2ZFDA 2KGBC 4PALA 1TCOB 1KSOA 1YRTB 3SG2A 1BODA 1Y1XA 3I5FC 5CSIA 1FF1A 3TDZA 1F70A 3EK7A 1PSRA 1TNXA 4PHJA 1XK4A 1L2OB 3KO0A 2LC5A 4PHKA 2LANA 2M1KB 3EK4A 1NCYA 2WOSA 3O6BA 4Q04A 3H4SE 1QX2A 2G2BA 2I7AA 2R2IA 4WQ3A 3RLZA 1DJIA 1KK7Y 4N1GA 1OOJA 1F55A 2GGZA 3WHTB 2I18A 4ORBB 2LP3A 3SG7A 1YUTA 2KBIA 4XJKB 4NDDA 2NXQA 4YGBB 3EVRA 2M7NA 1WDCB 2JWWA 3KHEA 1TCFA 4ORAB 1BG1A 3I5GC 1DTLA 2EC6B 3JTDC 1X02A 1S6JA 1ALWA 2JNFA 1SR6C 3CGAA 3DF0B 4N5XA 1XFYO 4GFTA 2LHIA 5AFPA 1IWQA 1IH0A 4CFRA 3BOWB 1EJ3A 4OV2A 5TNCA 1M39A 3WHUB 2KOTA 2K7CA 1KFUL 1B8LA 4M2OA 3SIBA 2H2KA 2L2EA 2VRGA 2ZRTA 3PFVA 1NCXA 4L9MA 1GJYA 1SKTA 1J7RA 1JF2A 3OHMB 3I5HC 4M2QA 4YGEB 4D1EA 2HPSA 2B1UA 2MHHA 5AANA 2WNDA 1K93D 1M45A 2Q4UA 1Q80A 1TOPA 2HQWA 3GK4X 3TDIA 4HSZA 1PALA 1FW4A 1IGVA 1DJHA 2KI4C 3JVTB 4GBAA 1B9AA 4MZLA 2BCAA 1XVJA 2PMYA 1PK0D 2PSRA 1KK8C 3CR2A 1ZOTB 2KFFA 1DJYA 1XO5A 4OVNF 1QVIZ 3GK2A 4I5LB 1FBVA 2KQYA 2V53A 1L2OC 1NP8A 1CMFA 1JFKA 1PVAA 2F2PA 3DVEA 1BR1B 1QLSA 2KQ6A 4GUKA 1NX3A 1GGZA 3ZWHA 3BUNB 1A2XA 1SPYA 3O78A 1NPQA 1RK9A 2L50A 2F3YA 1L7ZA 1QLKA 3SJSA 2JXLA 1JF0A 3AAKA 4YGAA 2DOQA 2M29A 2D8NA 1JWDA 2KFHA 2LHLA 1BLQA 1UHIA 1FI5A 2CT9A 1RWYA 2QACA 2LUXA 2F33A 1H4BA 2Y5IA 4TNCA 5J3XA 1KWOB 1PULA 2FCDA 1DGUA 3KEVA 2M3WA 3C1VA 4MRXA 1NUBA 2EC6C 2JTTA 2ZKMX 5D7FA 2CNPA 5CSJA 5KSZA 1CMGA 2LLTA 3CS1A 5CSNA 4NQGA 1IJ5A 1J55A 1W7IB 2ZRSA 1XFZO 2JT8A 2LVIA 1Y1UA 1S5GZ 1SL8A 1QIWA 2MJWB 3DVKA 4A4BA 4ORCB 1XA5A 3DVMA
chains in the Genus database with same CATH superfamily
1UURA 2WC5A 1OZSA 3TS5B 1TUJA 3CTNA 3FWBA 4JD9A 3NHIA 1YURA 2JXCA 2ZNEA 1JSAA 2KGRA 3RM1A 3PALA 3PN7B 4A4CA 1KFXS 3PLFB 1Z2CB 2WCHA 3CR4X 2LLUA 4PDZA 3NSLA 1PVBA 2LM5A 1SYMA 3TZ1A 1JUOA 3SS5A 5DKNA 5AXIA 2E6WA 5GQQC 2HETA 2Q91A 2JQ6A 2LMVA 1IJ6A 2PALA 3OGNA 1K9UA 2A4JA 4BY4A 5D3OA 4PE7A 1ZMZA 3EVUA 2K8MB 1K95A 1OW4A 3D10A 3JVTC 1TRFA 1MHOA 3VRNA 2OPOA 4PT1A 2NCPA 1CDLA 2LVJA 4OR9B 3S0EA 1S6IA 4DRWA 1SL7A 4R1EA 4YI8A 1CM4A 1K96A 1LA0A 1S5GY 2KSPA 3HX4A 4DIRA 4QJ5B 2PASA 1R6PA 1DEKA 2KLDA 1NSHA 1MF8B 3EK8A 4MN0A 4CLNA 3KF9A 2LCPA 2QPTA 4YGCB 1W9ZA 4DUQA 5DKQA 3B87A 1CDPA 1OOFA 3NXAA 2LVVA 2M9GA 3TDUA 1EG3A 4NDCA 3D76A 1IKUA 2BKIB 2OTGB 4ZCUA 1CLMA 1U5IA 1DF0B 2F8PA 1N0YA 2KPHA 2FJUB 1KWOC 3BUWB 3HCMA 2JPTA 4JQ0D 1IRJA 1DJWA 1IG5A 1S36A 1W7JB 4GPLB 2AAOA 4PE4A 2GGMA 2LMTA 2ZNDA 4AOMA 1J7OA 3PM8A 2FCEA 1N2DA 1A75A 1OMVA 2H61C 4NDBA 3OB2B 1UWOA 4FQTA 1QJTA 3B7AA 3R1OA 1KSMA 1YR5A 2LUCA 3VROA 2WC6A 1AP4A 2LAPA 3BUXB 2WCEA 1TNPA 1CLLA 3EVVA 3L4AA 3TS5C 1H8BA 1ZUZA 2KI6D 2K7BA 2ERBA 5I94A 2JU0A 2YGUA 1QASA 1LVCD 2JT3A 4ICBA 1ALVA 1EL4A 3PN7C 3BFBA 1AJ5A 3MSEB 2P71A 3WXAA 3OP0A 1Y0VH 3L4LA 3ICBA 1ZACA 5DKRA 1F4QA 2JOJA 4BY5A 4YGDB 2K2FA 5F6TA 2KAXA 4GAOA 2L0PA 4MZKA 3BXKA 1N65A 2EHBA 3IF7A 3SG5A 4DS7A 1DMOA 2MAZA 4QJ3B 1OMDA 2LP2A 1SRAA 3A4UB 2BCBA 2QDIA 1G33A 1SCMB 2I94A 1TNQA 1Y1AA 3CLNA 3DZTA 2L5YA 3D0YA 3GOFA 1LA3A 1M31A 1UP5A 3SIAA 1TWOA 1WRLA 3CZ1A 1AK8A 1CB1A 4IL1A 1NWDA 4YBHB 4YRUA 1C3YA 1HT9A 1TUZA 3K21A 1A29A 2BBNA 1F54A 3DY9A 2MA2A 1YUUA 2BKHB 1QV1A 3BUMB 4MBEA 1MQ1A 3S0DA 1S3PA 1JC2A 2Y1NA 5BPJA 1UUSA 3DVJA 1CDNA 4UPGA 1QTXA 3AKAA 1SNLA 4QJ4B 1DC1A 2OTGC 3L47A 3SS3A 1G8IA 1CNPA 3IQQA 1C7VA 1DJGA 1WDCC 2LV7A 1MWNA 2BECA 2WORA 1QX7A 4PHNA 2JT0A 2M0RA 2BCXA 1PSBA 4U8DA 1KFUS 1UHNA 2M7LA 1YUSA 1U5IB 3SG4A 1K8UA 2IS9A 3S0FA 3PSRA 4XJKA 4KYNA 1K90D 3TUYB 1YVLA 3O2PA 4E68A 1D1OA 5HL1A 4GGFC 3BFHA 4XYNA 2BL0B 4FTGA 3I5IB 2F3ZA 4MSPA 3DF0A 2KBMA 2F2OA 3GK1A 3OX5A 3SG3A 3CZTX 2KAYA 3EKHA 5G08A 1K9KA 1F4OA 2JULA 2L4IA 3QRXA 2MLFC 3DVEA 3BOWA 1QATA 1WLZA 2EGDA 1YRUB 4I5JA 3NGVA 5FI2A 4JWQA 1LKJA 1BF5A 3SG6A 1C7WA 1CFDA 1LXFC 1J7PA 2O60A 5B8IB 1WY9A 1AUIB 1Y6WA 2NZ0A 4MLWA 5JJGA 1OZOA 2M1UA 1NX1A 1RFJA 2L2CA 1NX2A 4USLA 2L4HA 2HQ8A 2K7OA 2AMIA 2I2RE 1QXPA 4CFQA 4GNKB 5FI7A 1CFFA 1CLBA 1F71A 1SCMC 3E3RA 1NCZA 1MR8A 1R2UA 1SCVA 2L5XB 2LMUA 4MZJA 1EG4A 1NYAA 1SMGA 1PRWA 1NIWA 2BE6A 4PE0A 3A8RA 5KTYA 4M2PA 2JC2A 1TN4A 1ORGA 2LNKA 4YI9A 3QMEA 1XK4C 4C0KA 1K94A 1VRKA 1XFVO 1BR4B 1NX0A 1BJFA 2BBMA 4WRIA 3R72A 1KK8B 1AVSA 1JFJA 1YVHA 2M97A 3VRPA 5IBWA 1RJVA 5KU1A 2M8UA 1TTXA 4FQOA 4INXA 4N1FA 2P6BB 3IQOA 1CTRA 4OZDA 4CPVA 3FE9A 1J1EA 2WC8A 4ETOA 4IJ7A 1QS7A 2L51A 2GTEA 4HREE 1J1DA 1TIZA 3CDNA 1MXEA 1G4YR 2RGIA 4F0ZB 1OOIX 2KNEA 1AHRA 1WLMA 1RROA 3TUYC 3K1EA 3DD4A 1M46A 1UHHA 3IVTA 2ISDA 1RECA 3NHTA 2PRUA 4WQ2A 4AQJA 2PVBA 2KFGA 2BL0C 3DXLA 1DQEA 1TNWA 3I5IC 4HRHA 1WRZA 2L98A 3CWGA 1XFXO 1AJ4A 1YX7A 2KAVA 2NLNA 2O5GA 3OB1B 3OX6A 2WCBA 1F8HA 3KPXA 1CM1A 2AUCA 4C0LA 1CFPA 2H61A 4C0JA 2K61A 1C3ZA 5K89A 1XFWO 4F7FA 2SCPA 2KHNA 1KQMB 1FI6A 5AERA 3VB1A 2BNXA 1K2HA 1RTP1 2GV5A 4MVFA 3UNWA 2HF5A 5PALA 2TN4A 1A03A 1GM0A 2BAPA 5HLOA 4CIDA 2OS8B 3EG5B 2COLB 3Q8IA 1JBAA 1KCYA 1B8CA 1B8RA 1OE9B 2CTNA 2LLSA 2BE4A 2CXJA 5CSFA 4P5OE 2K0JA 4AQIA 4OCIA 2LVKA 3WNXB 1SL9A 2NCOA 1BU3A 1YTZC 5I2QA 4MRYA 2CBLA 2JRFA 1BMOA 1M63B 2KYFA 3CR5X 3D74A 2P70A 1SY9A 1K9PA 5ER4X 3M0WA 1CKKA 3PJIA 5AEQA 3FS7A 1KFXL 1OQPA 1T14A 3B88A 3LK1A 1OSAA 1SK6D 3I5FB 2K2AA 2QEHA 3NSOA 2SASA 2KI6C 3AAJA 1QWVA 5HKYA 1ODBA 1WRKA 1A4PA 1B47A 3BQ3A 2MRDA 3LL8B 1B7TZ 4I5NB 3SS4A 1XFUO 5FYXA 1DT7B 4OKHA 1DGVA 1UHJA 4P2YB 3NSKA 5HKWA 1EH2A 4PHMA 2WCJA 1QIVA 1S26D 3ZNIA 2E30A 1SW8A 1V1GA 3O4YA 4PCWA 3FE8A 1MXLC 1DF0A 2K60A 1IQ3A 4HRGA 1MUXA 4I5KA 3F45A 3FWCA 2ZN9A 5I2LA 1CDMA 4GGNA 2H8VA 3LLEA 1B1GA 1BT6A 1DJZA 5HKZA 1A75B 5CPVA 3R1VA 2MLEC 2CCMA 3I5GB 3JTDB 5I2OA 3D75A 4GGFA 1SR6B 3FIAA 2JNXA 1S1EA 2KYCA 1EXRA 3VRRA 1HQVA 4JPZB 1KQMC 5HLVA 1Z4HA 1B4CA 1QV0A 2G9BA 5DICA 1QVIY 5EL2A 2M49B 2Y4QA 2WCFA 1XYDA 1FPWA 2QEVA 1J7QA 1IIOA 1B7TY 2FOTA 3BYAA 2OS8C 1OOGA 1QX5B 1YX8A 2KDHA 4ZCVA 2PQLA 1OMRA 1GQMA 2JZIA 2K7DA 4PE1A 3S0GA 4DCKA 1E8AA 1LINA 1UHKA 1KK7Z 3I5HB 3LK0A 5JOLA 3PATA 1IQ5A 1CFCA 1V1FA 1SBJA 2JTZA 5D69A 2ZN8A 5I8NA 3BUOB 3AKBA 3RZSA 4MEWA 1S6CA 3D0YB 3EKJA 3N7HA 5HYDA 3NSIA 2LE9B 3LCPC 1GGWA 1KQVA 1DVIA 1DJXA 1C07A 1BOCA 3VRQA 3VGOA 2QEOA 2KI4B 5ER5A 2Y1MA 3D78A 1ZFSA 2ZFDA 2KGBC 4PALA 1TCOB 1KSOA 1YRTB 3B86A 3SG2A 1BODA 1Y1XA 3I5FC 5CSIA 1FF1A 3TDZA 1F70A 3EK7A 1PSRA 1TNXA 2WCLA 4PHJA 1XK4A 1L2OB 3KO0A 2LC5A 4PHKA 2LANA 2FJYA 2M1KB 3EK4A 1NCYA 2WOSA 3O6BA 4Q04A 3H4SE 1QX2A 2G2BA 2I7AA 2R2IA 4WQ3A 3S0BA 3RLZA 1DJIA 1KK7Y 4N1GA 3BJHA 1OOJA 1F55A 2GGZA 3WHTB 2I18A 4ORBB 2LP3A 3SG7A 1YUTA 1SSEB 3R1PA 2QEBA 2KBIA 4XJKB 4NDDA 2NXQA 3DYEA 3EVRA 4YGBB 2M7NA 1WDCB 2JWWA 3KHEA 1TCFA 4ORAB 1BG1A 3I5GC 1DTLA 2EC6B 3JTDC 1X02A 1S6JA 3CZ2A 1ALWA 2JNFA 1SR6C 3CGAA 3D77A 3DF0B 1XFYO 4GFTA 2LHIA 4N5XA 1DELA 5AFPA 1IWQA 3V2LA 1IH0A 4CFRA 3BOWB 1EJ3A 4OV2A 5TNCA 1LS8A 1M39A 2MBXA 3WHUB 2KOTA 2K7CA 1KFUL 1B8LA 4M2OA 3SIBA 2H2KA 2L2EA 2VRGA 2ZRTA 1XFRA 1NCXA 3PFVA 4L9MA 1GJYA 3CZ0A 1SKTA 1J7RA 1JF2A 3OBVA 3OHMB 4JKTA 3I5HC 4M2QA 4YGEB 4D1EA 2HPSA 2B1UA 2MHHA 5AANA 2WNDA 1K93D 1M45A 2Q4UA 1Q80A 1TOPA 2HQWA 3GK4X 3TDIA 4HSZA 3UO9A 1PALA 2WCKA 1FW4A 1IGVA 1DJHA 2KI4C 3JVTB 4GBAA 1B9AA 4MZLA 2BCAA 1XVJA 2PMYA 1PK0D 2PSRA 2WCMA 1KK8C 3CR2A 1ZOTB 2KFFA 1DJYA 1XO5A 4OVNF 1QVIZ 3GK2A 4I5LB 1FBVA 2KQYA 2V53A 1L2OC 1NP8A 1CMFA 1JFKA 1PVAA 2F2PA 3D73A 1BR1B 1OOHA 1QLSA 2KQ6A 1NX3A 1GGZA 3B6XA 4GUKA 5FI6A 3BUNB 1A2XA 3CYZA 3ZWHA 3BFAA 1SPYA 3O78A 1NPQA 1RK9A 2L50A 2KLEA 2F3YA 1L7ZA 1QLKA 3SJSA 2JXLA 1JF0A 3AAKA 4YGAA 2DOQA 2M29A 2D8NA 2PYQA 1JWDA 2KFHA 2LHLA 1BLQA 1UHIA 1FI5A 2CT9A 1RWYA 2QACA 2LUXA 2F33A 3CABA 1H4BA 2Y5IA 4TNCA 3PM2A 5J3XA 1KWOB 1PULA 2FCDA 1P28A 1DGUA 3KEVA 2M3WA 3C1VA 4MRXA 1NUBA 2EC6C 2JTTA 2ZKMX 5D7FA 2CNPA 5CSJA 4INWA 5KSZA 1CMGA 2LLTA 3CS1A 3FE6A 4NQGA 1IJ5A 1J55A 1W7IB 5CSNA 2ZRSA 1XFZO 2JPOA 2JT8A 2LVIA 3O4XA 1Y1UA 1S5GZ 1SL8A 1QIWA 2MJWB 3DVKA 4A4BA 4ORCB 1XA5A 3S0AA 3DVMA
chains in the Genus database with same CATH topology
1UURA 1OZSA 3TS5B 3CTNA 3FWBA 1YURA 2JXCA 2ZNEA 1JSAA 2KGRA 3RM1A 3PALA 3PN7B 4A4CA 1KFXS 3PLFB 3CR4X 2LLUA 4PDZA 3NSLA 1PVBA 2LM5A 1SYMA 3TZ1A 1JUOA 5DKNA 5AXIA 2E6WA 5GQQC 2HETA 2Q91A 2JQ6A 2LMVA 1IJ6A 2PALA 1K9UA 2A4JA 4BY4A 4PE7A 1ZMZA 3EVUA 2K8MB 1K95A 3D10A 3JVTC 1TRFA 1MHOA 3VRNA 2OPOA 2NCPA 1CDLA 2LVJA 4OR9B 1S6IA 4DRWA 1SL7A 4R1EA 4YI8A 1CM4A 1K96A 1LA0A 1S5GY 2KSPA 3HX4A 4DIRA 4QJ5B 2PASA 1R6PA 1NSHA 1MF8B 3EK8A 4MN0A 4CLNA 3KF9A 2LCPA 2QPTA 4YGCB 4DUQA 5DKQA 1CDPA 3NXAA 2LVVA 2M9GA 3TDUA 1EG3A 4NDCA 1IKUA 2BKIB 2OTGB 4ZCUA 1CLMA 1U5IA 1DF0B 2F8PA 1N0YA 2FJUB 1KWOC 3BUWB 3HCMA 2JPTA 4JQ0D 1IRJA 1DJWA 1IG5A 1S36A 1W7JB 4GPLB 2AAOA 4PE4A 2GGMA 2LMTA 2ZNDA 4AOMA 1J7OA 3PM8A 2FCEA 1N2DA 1A75A 1OMVA 2H61C 4NDBA 3OB2B 1UWOA 1QJTA 1KSMA 1YR5A 2LUCA 3VROA 1AP4A 2LAPA 3BUXB 2WCEA 1TNPA 1CLLA 3EVVA 3TS5C 1H8BA 1ZUZA 2KI6D 2K7BA 2JU0A 1QASA 1LVCD 2JT3A 4ICBA 1ALVA 1EL4A 3PN7C 3MSEB 1AJ5A 3WXAA 3OP0A 1Y0VH 3ICBA 1ZACA 5DKRA 1F4QA 2JOJA 4BY5A 4YGDB 2K2FA 5F6TA 2KAXA 4GAOA 2L0PA 4MZKA 3BXKA 1N65A 2EHBA 3IF7A 3SG5A 4DS7A 1DMOA 2MAZA 4QJ3B 1OMDA 2LP2A 1SRAA 3A4UB 2BCBA 5JJGA 1G33A 1SCMB 2I94A 1TNQA 1Y1AA 3CLNA 3GOFA 2MBXA 3D0YA 1LA3A 1M31A 1UP5A 3SIAA 1WRLA 1AK8A 1CB1A 4IL1A 1NWDA 4YBHB 4YRUA 1HT9A 3K21A 1A29A 2BBNA 1F54A 2MA2A 2BKHB 1YUUA 1QV1A 3BUMB 4MBEA 1MQ1A 1S3PA 1JC2A 2Y1NA 5BPJA 1UUSA 3DVJA 1CDNA 4UPGA 1QTXA 3AKAA 1SNLA 4QJ4B 2OTGC 1G8IA 1CNPA 3IQQA 1C7VA 1DJGA 1WDCC 2LV7A 1MWNA 2BECA 2WORA 1QX7A 4PHNA 2JT0A 2M0RA 2BCXA 1PSBA 4U8DA 1KFUS 1UHNA 2M7LA 1YUSA 1U5IB 3SG4A 1K8UA 2IS9A 3PSRA 4XJKA 1K90D 3TUYB 1YVLA 3O2PA 4E68A 1D1OA 4GGFC 4XYNA 2BL0B 4FTGA 3I5IB 2F3ZA 4MSPA 3DF0A 2KBMA 2F2OA 3GK1A 3OX5A 3SG3A 3CZTX 2KAYA 3EKHA 5G08A 1K9KA 1F4OA 2JULA 2L4IA 3QRXA 2MLFC 3BOWA 1QATA 1WLZA 2EGDA 1YRUB 4I5JA 4JWQA 1LKJA 1BF5A 3SG6A 1C7WA 1CFDA 1LXFC 1J7PA 2O60A 5B8IB 1WY9A 1AUIB 1Y6WA 2NZ0A 4MLWA 1OZOA 2M1UA 1NX1A 1RFJA 1NX2A 4USLA 2L4HA 2HQ8A 2K7OA 2AMIA 2I2RE 1QXPA 4CFQA 4GNKB 1CFFA 1CLBA 1F71A 1SCMC 3E3RA 1NCZA 1MR8A 1R2UA 1SCVA 2L5XB 2LMUA 4MZJA 1EG4A 1NYAA 1SMGA 1PRWA 1NIWA 2BE6A 4PE0A 3A8RA 5KTYA 4M2PA 2JC2A 1TN4A 2LNKA 4YI9A 1XK4C 4C0KA 1K94A 1VRKA 1XFVO 1BR4B 1NX0A 2BBMA 1BJFA 4WRIA 1KK8B 1AVSA 1JFJA 1YVHA 2M97A 3VRPA 5IBWA 1RJVA 5KU1A 2M8UA 1TTXA 4FQOA 4N1FA 2P6BB 3IQOA 1CTRA 4CPVA 1J1EA 2WC8A 4ETOA 1QS7A 2L51A 4HREE 1J1DA 1TIZA 1MXEA 1G4YR 2RGIA 4F0ZB 2KNEA 1AHRA 1WLMA 1RROA 3TUYC 2ISDA 3DD4A 1M46A 1UHHA 4AQJA 1RECA 4WQ2A 2PRUA 2PVBA 2KFGA 2BL0C 1TNWA 3I5IC 4HRHA 1WRZA 2L98A 3CWGA 1XFXO 1AJ4A 1YX7A 2KAVA 2NLNA 2O5GA 3OB1B 3OX6A 2WCBA 1F8HA 3KPXA 1CM1A 2AUCA 4C0LA 1CFPA 2H61A 4C0JA 2K61A 5K89A 1XFWO 2SCPA 2KHNA 1KQMB 1FI6A 5AERA 1K2HA 1RTP1 2GV5A 4MVFA 1A03A 2HF5A 5PALA 2TN4A 5HLOA 4CIDA 2OS8B 2COLB 1KCYA 1JBAA 1B8CA 1B8RA 1OE9B 2CTNA 2LLSA 2BE4A 2CXJA 5CSFA 4P5OE 2K0JA 4AQIA 4OCIA 2LVKA 3WNXB 1SL9A 2NCOA 1BU3A 1YTZC 5I2QA 4MRYA 2CBLA 2JRFA 1BMOA 1M63B 2KYFA 3CR5X 1SY9A 1K9PA 5ER4X 3M0WA 1CKKA 5AEQA 3FS7A 1KFXL 1OQPA 3LK1A 1OSAA 1SK6D 3I5FB 2K2AA 3NSOA 2SASA 2KI6C 3AAJA 5HKYA 1ODBA 1WRKA 1A4PA 1B47A 3BQ3A 2MRDA 3LL8B 1B7TZ 4I5NB 1DT7B 1XFUO 5FYXA 4OKHA 1DGVA 1UHJA 4P2YB 3NSKA 5HKWA 1EH2A 4PHMA 1QIVA 1S26D 3ZNIA 2E30A 1SW8A 1V1GA 3O4YA 4PCWA 1MXLC 1DF0A 1IQ3A 4HRGA 1MUXA 4I5KA 3F45A 3FWCA 2ZN9A 5I2LA 1CDMA 4GGNA 3LLEA 1B1GA 1BT6A 1DJZA 5HKZA 1A75B 5CPVA 2MLEC 2CCMA 3I5GB 3JTDB 5I2OA 4GGFA 1SR6B 3FIAA 2JNXA 1S1EA 2KYCA 1EXRA 3VRRA 1HQVA 4JPZB 1KQMC 5HLVA 1B4CA 1QV0A 2G9BA 1QVIY 2M49B 2Y4QA 2WCFA 1XYDA 1FPWA 1J7QA 1B7TY 2FOTA 3BYAA 2OS8C 1QX5B 1YX8A 2KDHA 4ZCVA 4DCKA 1OMRA 1GQMA 2JZIA 2K7DA 4PE1A 1E8AA 1LINA 1UHKA 1KK7Z 3I5HB 3LK0A 5JOLA 3PATA 1IQ5A 1CFCA 1V1FA 1SBJA 2JTZA 5D69A 2ZN8A 5I8NA 3BUOB 3AKBA 4MEWA 1S6CA 3D0YB 3EKJA 5HYDA 3NSIA 2LE9B 3LCPC 1GGWA 1KQVA 1DVIA 1DJXA 1C07A 1BOCA 3VRQA 3VGOA 2KI4B 5ER5A 2Y1MA 1ZFSA 2ZFDA 2KGBC 4PALA 1TCOB 1KSOA 1YRTB 3SG2A 1BODA 1Y1XA 3I5FC 5CSIA 1FF1A 3TDZA 1F70A 3EK7A 1PSRA 1TNXA 4PHJA 1XK4A 1L2OB 3KO0A 2LC5A 4PHKA 2LANA 2M1KB 3EK4A 1NCYA 2WOSA 3O6BA 4Q04A 3H4SE 1QX2A 2G2BA 2I7AA 2R2IA 4WQ3A 3RLZA 1DJIA 1KK7Y 4N1GA 1OOJA 1F55A 2GGZA 3WHTB 2I18A 4ORBB 2LP3A 3SG7A 1YUTA 2KBIA 4XJKB 4NDDA 2NXQA 4YGBB 3EVRA 2M7NA 1WDCB 2JWWA 3KHEA 1TCFA 4ORAB 1BG1A 3I5GC 1DTLA 2EC6B 3JTDC 1X02A 1S6JA 1ALWA 2JNFA 1SR6C 3CGAA 3DF0B 4N5XA 1XFYO 4GFTA 2LHIA 5AFPA 1IWQA 1IH0A 4CFRA 3BOWB 1EJ3A 4OV2A 5TNCA 1M39A 3WHUB 2KOTA 2K7CA 1KFUL 1B8LA 4M2OA 3SIBA 2H2KA 2L2EA 2VRGA 2ZRTA 3PFVA 1NCXA 4L9MA 1GJYA 1SKTA 1J7RA 1JF2A 3OHMB 3I5HC 4M2QA 4YGEB 4D1EA 2HPSA 2B1UA 2MHHA 5AANA 2WNDA 1K93D 1M45A 2Q4UA 1Q80A 1TOPA 2HQWA 3GK4X 3TDIA 4HSZA 1PALA 1FW4A 1IGVA 1DJHA 2KI4C 3JVTB 4GBAA 1B9AA 4MZLA 2BCAA 1XVJA 2PMYA 1PK0D 2PSRA 1KK8C 3CR2A 1ZOTB 2KFFA 1DJYA 1XO5A 4OVNF 1QVIZ 3GK2A 4I5LB 1FBVA 2KQYA 2V53A 1L2OC 1NP8A 1CMFA 1JFKA 1PVAA 2F2PA 3DVEA 1BR1B 1QLSA 2KQ6A 4GUKA 1NX3A 1GGZA 3ZWHA 3BUNB 1A2XA 1SPYA 3O78A 1NPQA 1RK9A 2L50A 2F3YA 1L7ZA 1QLKA 3SJSA 2JXLA 1JF0A 3AAKA 4YGAA 2DOQA 2M29A 2D8NA 1JWDA 2KFHA 2LHLA 1BLQA 1UHIA 1FI5A 2CT9A 1RWYA 2QACA 2LUXA 2F33A 1H4BA 2Y5IA 4TNCA 5J3XA 1KWOB 1PULA 2FCDA 1DGUA 3KEVA 2M3WA 3C1VA 4MRXA 1NUBA 2EC6C 2JTTA 2ZKMX 5D7FA 2CNPA 5CSJA 5KSZA 1CMGA 2LLTA 3CS1A 5CSNA 4NQGA 1IJ5A 1J55A 1W7IB 2ZRSA 1XFZO 2JT8A 2LVIA 1Y1UA 1S5GZ 1SL8A 1QIWA 2MJWB 3DVKA 4A4BA 4ORCB 1XA5A 3DVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UUR A;  1OZS A;  3TS5 B;  3CTN A;  3FWB A;  1YUR A;  2JXC A;  2ZNE A;  1JSA A;  2KGR A;  3RM1 A;  3PAL A;  3PN7 B;  4A4C A;  1KFX S;  3PLF B;  3CR4 X;  2LLU A;  4PDZ A;  3NSL A;  1PVB A;  2LM5 A;  1SYM A;  3TZ1 A;  1JUO A;  5DKN A;  5AXI A;  2E6W A;  5GQQ C;  2HET A;  2Q91 A;  2JQ6 A;  2LMV A;  1IJ6 A;  2PAL A;  1K9U A;  2A4J A;  4BY4 A;  4PE7 A;  1ZMZ A;  3EVU A;  2K8M B;  1K95 A;  3D10 A;  3JVT C;  1TRF A;  1MHO A;  3VRN A;  2OPO A;  2NCP A;  1CDL A;  2LVJ A;  4OR9 B;  1S6I A;  4DRW A;  1SL7 A;  4R1E A;  4YI8 A;  1CM4 A;  1K96 A;  1LA0 A;  1S5G Y;  2KSP A;  3HX4 A;  4DIR A;  4QJ5 B;  2PAS A;  1R6P A;  1NSH A;  1MF8 B;  3EK8 A;  4MN0 A;  4CLN A;  3KF9 A;  2LCP A;  2QPT A;  4YGC B;  4DUQ A;  5DKQ A;  1CDP A;  3NXA A;  2LVV A;  2M9G A;  3TDU A;  1EG3 A;  4NDC A;  1IKU A;  2BKI B;  2OTG B;  4ZCU A;  1CLM A;  1U5I A;  1DF0 B;  2F8P A;  1N0Y A;  2FJU B;  1KWO C;  3BUW B;  3HCM A;  2JPT A;  4JQ0 D;  1IRJ A;  1DJW A;  1IG5 A;  1S36 A;  1W7J B;  4GPL B;  2AAO A;  4PE4 A;  2GGM A;  2LMT A;  2ZND A;  4AOM A;  1J7O A;  3PM8 A;  2FCE A;  1N2D A;  1A75 A;  1OMV A;  2H61 C;  4NDB A;  3OB2 B;  1UWO A;  1QJT A;  1KSM A;  1YR5 A;  2LUC A;  3VRO A;  1AP4 A;  2LAP A;  3BUX B;  2WCE A;  1TNP A;  1CLL A;  3EVV A;  3TS5 C;  1H8B A;  1ZUZ A;  2KI6 D;  2K7B A;  2JU0 A;  1QAS A;  1LVC D;  2JT3 A;  4ICB A;  1ALV A;  1EL4 A;  3PN7 C;  3MSE B;  1AJ5 A;  3WXA A;  3OP0 A;  1Y0V H;  3ICB A;  1ZAC A;  5DKR A;  1F4Q A;  2JOJ A;  4BY5 A;  4YGD B;  2K2F A;  5F6T A;  2KAX A;  4GAO A;  2L0P A;  4MZK A;  3BXK A;  1N65 A;  2EHB A;  3IF7 A;  3SG5 A;  4DS7 A;  1DMO A;  2MAZ A;  4QJ3 B;  1OMD A;  2LP2 A;  1SRA A;  3A4U B;  2BCB A;  5JJG A;  1G33 A;  1SCM B;  2I94 A;  1TNQ A;  1Y1A A;  3CLN A;  3GOF A;  2MBX A;  3D0Y A;  1LA3 A;  1M31 A;  1UP5 A;  3SIA A;  1WRL A;  1AK8 A;  1CB1 A;  4IL1 A;  1NWD A;  4YBH B;  4YRU A;  1HT9 A;  3K21 A;  1A29 A;  2BBN A;  1F54 A;  2MA2 A;  2BKH B;  1YUU A;  1QV1 A;  3BUM B;  4MBE A;  1MQ1 A;  1S3P A;  1JC2 A;  2Y1N A;  5BPJ A;  1UUS A;  3DVJ A;  1CDN A;  4UPG A;  1QTX A;  3AKA A;  1SNL A;  4QJ4 B;  2OTG C;  1G8I A;  1CNP A;  3IQQ A;  1C7V A;  1DJG A;  1WDC C;  2LV7 A;  1MWN A;  2BEC A;  2WOR A;  1QX7 A;  4PHN A;  2JT0 A;  2M0R A;  2BCX A;  1PSB A;  4U8D A;  1KFU S;  1UHN A;  2M7L A;  1YUS A;  1U5I B;  3SG4 A;  1K8U A;  2IS9 A;  3PSR A;  4XJK A;  1K90 D;  3TUY B;  1YVL A;  3O2P A;  4E68 A;  1D1O A;  4GGF C;  4XYN A;  2BL0 B;  4FTG A;  3I5I B;  2F3Z A;  4MSP A;  3DF0 A;  2KBM A;  2F2O A;  3GK1 A;  3OX5 A;  3SG3 A;  3CZT X;  2KAY A;  3EKH A;  5G08 A;  1K9K A;  1F4O A;  2JUL A;  2L4I A;  3QRX A;  2MLF C;  3BOW A;  1QAT A;  1WLZ A;  2EGD A;  1YRU B;  4I5J A;  4JWQ A;  1LKJ A;  1BF5 A;  3SG6 A;  1C7W A;  1CFD A;  1LXF C;  1J7P A;  2O60 A;  5B8I B;  1WY9 A;  1AUI B;  1Y6W A;  2NZ0 A;  4MLW A;  1OZO A;  2M1U A;  1NX1 A;  1RFJ A;  1NX2 A;  4USL A;  2L4H A;  2HQ8 A;  2K7O A;  2AMI A;  2I2R E;  1QXP A;  4CFQ A;  4GNK B;  1CFF A;  1CLB A;  1F71 A;  1SCM C;  3E3R A;  1NCZ A;  1MR8 A;  1R2U A;  1SCV A;  2L5X B;  2LMU A;  4MZJ A;  1EG4 A;  1NYA A;  1SMG A;  1PRW A;  1NIW A;  2BE6 A;  4PE0 A;  3A8R A;  5KTY A;  4M2P A;  2JC2 A;  1TN4 A;  2LNK A;  4YI9 A;  1XK4 C;  4C0K A;  1K94 A;  1VRK A;  1XFV O;  1BR4 B;  1NX0 A;  2BBM A;  1BJF A;  4WRI A;  1KK8 B;  1AVS A;  1JFJ A;  1YVH A;  2M97 A;  3VRP A;  5IBW A;  1RJV A;  5KU1 A;  2M8U A;  1TTX A;  4FQO A;  4N1F A;  2P6B B;  3IQO A;  1CTR A;  4CPV A;  1J1E A;  2WC8 A;  4ETO A;  1QS7 A;  2L51 A;  4HRE E;  1J1D A;  1TIZ A;  1MXE A;  1G4Y R;  2RGI A;  4F0Z B;  2KNE A;  1AHR A;  1WLM A;  1RRO A;  3TUY C;  2ISD A;  3DD4 A;  1M46 A;  1UHH A;  4AQJ A;  1REC A;  4WQ2 A;  2PRU A;  2PVB A;  2KFG A;  2BL0 C;  1TNW A;  3I5I C;  4HRH A;  1WRZ A;  2L98 A;  3CWG A;  1XFX O;  1AJ4 A;  1YX7 A;  2KAV A;  2NLN A;  2O5G A;  3OB1 B;  3OX6 A;  2WCB A;  1F8H A;  3KPX A;  1CM1 A;  2AUC A;  4C0L A;  1CFP A;  2H61 A;  4C0J A;  2K61 A;  5K89 A;  1XFW O;  2SCP A;  2KHN A;  1KQM B;  1FI6 A;  5AER A;  1K2H A;  1RTP 1;  2GV5 A;  4MVF A;  1A03 A;  2HF5 A;  5PAL A;  2TN4 A;  5HLO A;  4CID A;  2OS8 B;  2COL B;  1KCY A;  1JBA A;  1B8C A;  1B8R A;  1OE9 B;  2CTN A;  2LLS A;  2BE4 A;  2CXJ A;  5CSF A;  4P5O E;  2K0J A;  4AQI A;  4OCI A;  2LVK A;  3WNX B;  1SL9 A;  2NCO A;  1BU3 A;  1YTZ C;  5I2Q A;  4MRY A;  2CBL A;  2JRF A;  1BMO A;  1M63 B;  2KYF A;  3CR5 X;  1SY9 A;  1K9P A;  5ER4 X;  3M0W A;  1CKK A;  5AEQ A;  3FS7 A;  1KFX L;  1OQP A;  3LK1 A;  1OSA A;  1SK6 D;  3I5F B;  2K2A A;  3NSO A;  2SAS A;  2KI6 C;  3AAJ A;  5HKY A;  1ODB A;  1WRK A;  1A4P A;  1B47 A;  3BQ3 A;  2MRD A;  3LL8 B;  1B7T Z;  4I5N B;  1DT7 B;  1XFU O;  5FYX A;  4OKH A;  1DGV A;  1UHJ A;  4P2Y B;  3NSK A;  5HKW A;  1EH2 A;  4PHM A;  1QIV A;  1S26 D;  3ZNI A;  2E30 A;  1SW8 A;  1V1G A;  3O4Y A;  4PCW A;  1MXL C;  1DF0 A;  1IQ3 A;  4HRG A;  1MUX A;  4I5K A;  3F45 A;  3FWC A;  2ZN9 A;  5I2L A;  1CDM A;  4GGN A;  3LLE A;  1B1G A;  1BT6 A;  1DJZ A;  5HKZ A;  1A75 B;  5CPV A;  2MLE C;  2CCM A;  3I5G B;  3JTD B;  5I2O A;  4GGF A;  1SR6 B;  3FIA A;  2JNX A;  1S1E A;  2KYC A;  1EXR A;  3VRR A;  1HQV A;  4JPZ B;  1KQM C;  5HLV A;  1B4C A;  1QV0 A;  2G9B A;  1QVI Y;  2M49 B;  2Y4Q A;  2WCF A;  1XYD A;  1FPW A;  1J7Q A;  1B7T Y;  2FOT A;  3BYA A;  2OS8 C;  1QX5 B;  1YX8 A;  2KDH A;  4ZCV A;  4DCK A;  1OMR A;  1GQM A;  2JZI A;  2K7D A;  4PE1 A;  1E8A A;  1LIN A;  1UHK A;  1KK7 Z;  3I5H B;  3LK0 A;  5JOL A;  3PAT A;  1IQ5 A;  1CFC A;  1V1F A;  1SBJ A;  2JTZ A;  5D69 A;  2ZN8 A;  5I8N A;  3BUO B;  3AKB A;  4MEW A;  1S6C A;  3D0Y B;  3EKJ A;  5HYD A;  3NSI A;  2LE9 B;  3LCP C;  1GGW A;  1KQV A;  1DVI A;  1DJX A;  1C07 A;  1BOC A;  3VRQ A;  3VGO A;  2KI4 B;  5ER5 A;  2Y1M A;  1ZFS A;  2ZFD A;  2KGB C;  4PAL A;  1TCO B;  1KSO A;  1YRT B;  3SG2 A;  1BOD A;  1Y1X A;  3I5F C;  5CSI A;  1FF1 A;  3TDZ A;  1F70 A;  3EK7 A;  1PSR A;  1TNX A;  4PHJ A;  1XK4 A;  1L2O B;  3KO0 A;  2LC5 A;  4PHK A;  2LAN A;  2M1K B;  3EK4 A;  1NCY A;  2WOS A;  3O6B A;  4Q04 A;  3H4S E;  1QX2 A;  2G2B A;  2I7A A;  2R2I A;  4WQ3 A;  3RLZ A;  1DJI A;  1KK7 Y;  4N1G A;  1OOJ A;  1F55 A;  2GGZ A;  3WHT B;  2I18 A;  4ORB B;  2LP3 A;  3SG7 A;  1YUT A;  2KBI A;  4XJK B;  4NDD A;  2NXQ A;  4YGB B;  3EVR A;  2M7N A;  1WDC B;  2JWW A;  3KHE A;  1TCF A;  4ORA B;  1BG1 A;  3I5G C;  1DTL A;  2EC6 B;  3JTD C;  1X02 A;  1S6J A;  1ALW A;  2JNF A;  1SR6 C;  3CGA A;  3DF0 B;  4N5X A;  1XFY O;  4GFT A;  2LHI A;  5AFP A;  1IWQ A;  1IH0 A;  4CFR A;  3BOW B;  1EJ3 A;  4OV2 A;  5TNC A;  1M39 A;  3WHU B;  2KOT A;  2K7C A;  1KFU L;  1B8L A;  4M2O A;  3SIB A;  2H2K A;  2L2E A;  2VRG A;  2ZRT A;  3PFV A;  1NCX A;  4L9M A;  1GJY A;  1SKT A;  1J7R A;  1JF2 A;  3OHM B;  3I5H C;  4M2Q A;  4YGE B;  4D1E A;  2HPS A;  2B1U A;  2MHH A;  5AAN A;  2WND A;  1K93 D;  1M45 A;  2Q4U A;  1Q80 A;  1TOP A;  2HQW A;  3GK4 X;  3TDI A;  4HSZ A;  1PAL A;  1FW4 A;  1IGV A;  1DJH A;  2KI4 C;  3JVT B;  4GBA A;  1B9A A;  4MZL A;  2BCA A;  1XVJ A;  2PMY A;  1PK0 D;  2PSR A;  1KK8 C;  3CR2 A;  1ZOT B;  2KFF A;  1DJY A;  1XO5 A;  4OVN F;  1QVI Z;  3GK2 A;  4I5L B;  1FBV A;  2KQY A;  2V53 A;  1L2O C;  1NP8 A;  1CMF A;  1JFK A;  1PVA A;  2F2P A;  3DVE A;  1BR1 B;  1QLS A;  2KQ6 A;  4GUK A;  1NX3 A;  1GGZ A;  3ZWH A;  3BUN B;  1A2X A;  1SPY A;  3O78 A;  1NPQ A;  1RK9 A;  2L50 A;  2F3Y A;  1L7Z A;  1QLK A;  3SJS A;  2JXL A;  1JF0 A;  3AAK A;  4YGA A;  2DOQ A;  2M29 A;  2D8N A;  1JWD A;  2KFH A;  2LHL A;  1BLQ A;  1UHI A;  1FI5 A;  2CT9 A;  1RWY A;  2QAC A;  2LUX A;  2F33 A;  1H4B A;  2Y5I A;  4TNC A;  5J3X A;  1KWO B;  1PUL A;  2FCD A;  1DGU A;  3KEV A;  2M3W A;  3C1V A;  4MRX A;  1NUB A;  2EC6 C;  2JTT A;  2ZKM X;  5D7F A;  2CNP A;  5CSJ A;  5KSZ A;  1CMG A;  2LLT A;  3CS1 A;  5CSN A;  4NQG A;  1IJ5 A;  1J55 A;  1W7I B;  2ZRS A;  1XFZ O;  2JT8 A;  2LVI A;  1Y1U A;  1S5G Z;  1SL8 A;  1QIW A;  2MJW B;  3DVK A;  4A4B A;  4ORC B;  1XA5 A;  3DVM A; 
#chains in the Genus database with same CATH topology
 1UUR A;  2WC5 A;  1OZS A;  3TS5 B;  1TUJ A;  3CTN A;  3FWB A;  4JD9 A;  3NHI A;  1YUR A;  2JXC A;  2ZNE A;  1JSA A;  2KGR A;  3RM1 A;  3PAL A;  3PN7 B;  4A4C A;  1KFX S;  3PLF B;  1Z2C B;  2WCH A;  3CR4 X;  2LLU A;  4PDZ A;  3NSL A;  1PVB A;  2LM5 A;  1SYM A;  3TZ1 A;  1JUO A;  3SS5 A;  5DKN A;  5AXI A;  2E6W A;  5GQQ C;  2HET A;  2Q91 A;  2JQ6 A;  2LMV A;  1IJ6 A;  2PAL A;  3OGN A;  1K9U A;  2A4J A;  4BY4 A;  5D3O A;  4PE7 A;  1ZMZ A;  3EVU A;  2K8M B;  1K95 A;  1OW4 A;  3D10 A;  3JVT C;  1TRF A;  1MHO A;  3VRN A;  2OPO A;  4PT1 A;  2NCP A;  1CDL A;  2LVJ A;  4OR9 B;  3S0E A;  1S6I A;  4DRW A;  1SL7 A;  4R1E A;  4YI8 A;  1CM4 A;  1K96 A;  1LA0 A;  1S5G Y;  2KSP A;  3HX4 A;  4DIR A;  4QJ5 B;  2PAS A;  1R6P A;  1DEK A;  2KLD A;  1NSH A;  1MF8 B;  3EK8 A;  4MN0 A;  4CLN A;  3KF9 A;  2LCP A;  2QPT A;  4YGC B;  1W9Z A;  4DUQ A;  5DKQ A;  3B87 A;  1CDP A;  1OOF A;  3NXA A;  2LVV A;  2M9G A;  3TDU A;  1EG3 A;  4NDC A;  3D76 A;  1IKU A;  2BKI B;  2OTG B;  4ZCU A;  1CLM A;  1U5I A;  1DF0 B;  2F8P A;  1N0Y A;  2KPH A;  2FJU B;  1KWO C;  3BUW B;  3HCM A;  2JPT A;  4JQ0 D;  1IRJ A;  1DJW A;  1IG5 A;  1S36 A;  1W7J B;  4GPL B;  2AAO A;  4PE4 A;  2GGM A;  2LMT A;  2ZND A;  4AOM A;  1J7O A;  3PM8 A;  2FCE A;  1N2D A;  1A75 A;  1OMV A;  2H61 C;  4NDB A;  3OB2 B;  1UWO A;  4FQT A;  1QJT A;  3B7A A;  3R1O A;  1KSM A;  1YR5 A;  2LUC A;  3VRO A;  2WC6 A;  1AP4 A;  2LAP A;  3BUX B;  2WCE A;  1TNP A;  1CLL A;  3EVV A;  3L4A A;  3TS5 C;  1H8B A;  1ZUZ A;  2KI6 D;  2K7B A;  2ERB A;  5I94 A;  2JU0 A;  2YGU A;  1QAS A;  1LVC D;  2JT3 A;  4ICB A;  1ALV A;  1EL4 A;  3PN7 C;  3BFB A;  1AJ5 A;  3MSE B;  2P71 A;  3WXA A;  3OP0 A;  1Y0V H;  3L4L A;  3ICB A;  1ZAC A;  5DKR A;  1F4Q A;  2JOJ A;  4BY5 A;  4YGD B;  2K2F A;  5F6T A;  2KAX A;  4GAO A;  2L0P A;  4MZK A;  3BXK A;  1N65 A;  2EHB A;  3IF7 A;  3SG5 A;  4DS7 A;  1DMO A;  2MAZ A;  4QJ3 B;  1OMD A;  2LP2 A;  1SRA A;  3A4U B;  2BCB A;  2QDI A;  1G33 A;  1SCM B;  2I94 A;  1TNQ A;  1Y1A A;  3CLN A;  3DZT A;  2L5Y A;  3D0Y A;  3GOF A;  1LA3 A;  1M31 A;  1UP5 A;  3SIA A;  1TWO A;  1WRL A;  3CZ1 A;  1AK8 A;  1CB1 A;  4IL1 A;  1NWD A;  4YBH B;  4YRU A;  1C3Y A;  1HT9 A;  1TUZ A;  3K21 A;  1A29 A;  2BBN A;  1F54 A;  3DY9 A;  2MA2 A;  1YUU A;  2BKH B;  1QV1 A;  3BUM B;  4MBE A;  1MQ1 A;  3S0D A;  1S3P A;  1JC2 A;  2Y1N A;  5BPJ A;  1UUS A;  3DVJ A;  1CDN A;  4UPG A;  1QTX A;  3AKA A;  1SNL A;  4QJ4 B;  1DC1 A;  2OTG C;  3L47 A;  3SS3 A;  1G8I A;  1CNP A;  3IQQ A;  1C7V A;  1DJG A;  1WDC C;  2LV7 A;  1MWN A;  2BEC A;  2WOR A;  1QX7 A;  4PHN A;  2JT0 A;  2M0R A;  2BCX A;  1PSB A;  4U8D A;  1KFU S;  1UHN A;  2M7L A;  1YUS A;  1U5I B;  3SG4 A;  1K8U A;  2IS9 A;  3S0F A;  3PSR A;  4XJK A;  4KYN A;  1K90 D;  3TUY B;  1YVL A;  3O2P A;  4E68 A;  1D1O A;  5HL1 A;  4GGF C;  3BFH A;  4XYN A;  2BL0 B;  4FTG A;  3I5I B;  2F3Z A;  4MSP A;  3DF0 A;  2KBM A;  2F2O A;  3GK1 A;  3OX5 A;  3SG3 A;  3CZT X;  2KAY A;  3EKH A;  5G08 A;  1K9K A;  1F4O A;  2JUL A;  2L4I A;  3QRX A;  2MLF C;  3DVE A;  3BOW A;  1QAT A;  1WLZ A;  2EGD A;  1YRU B;  4I5J A;  3NGV A;  5FI2 A;  4JWQ A;  1LKJ A;  1BF5 A;  3SG6 A;  1C7W A;  1CFD A;  1LXF C;  1J7P A;  2O60 A;  5B8I B;  1WY9 A;  1AUI B;  1Y6W A;  2NZ0 A;  4MLW A;  5JJG A;  1OZO A;  2M1U A;  1NX1 A;  1RFJ A;  2L2C A;  1NX2 A;  4USL A;  2L4H A;  2HQ8 A;  2K7O A;  2AMI A;  2I2R E;  1QXP A;  4CFQ A;  4GNK B;  5FI7 A;  1CFF A;  1CLB A;  1F71 A;  1SCM C;  3E3R A;  1NCZ A;  1MR8 A;  1R2U A;  1SCV A;  2L5X B;  2LMU A;  4MZJ A;  1EG4 A;  1NYA A;  1SMG A;  1PRW A;  1NIW A;  2BE6 A;  4PE0 A;  3A8R A;  5KTY A;  4M2P A;  2JC2 A;  1TN4 A;  1ORG A;  2LNK A;  4YI9 A;  3QME A;  1XK4 C;  4C0K A;  1K94 A;  1VRK A;  1XFV O;  1BR4 B;  1NX0 A;  1BJF A;  2BBM A;  4WRI A;  3R72 A;  1KK8 B;  1AVS A;  1JFJ A;  1YVH A;  2M97 A;  3VRP A;  5IBW A;  1RJV A;  5KU1 A;  2M8U A;  1TTX A;  4FQO A;  4INX A;  4N1F A;  2P6B B;  3IQO A;  1CTR A;  4OZD A;  4CPV A;  3FE9 A;  1J1E A;  2WC8 A;  4ETO A;  4IJ7 A;  1QS7 A;  2L51 A;  2GTE A;  4HRE E;  1J1D A;  1TIZ A;  3CDN A;  1MXE A;  1G4Y R;  2RGI A;  4F0Z B;  1OOI X;  2KNE A;  1AHR A;  1WLM A;  1RRO A;  3TUY C;  3K1E A;  3DD4 A;  1M46 A;  1UHH A;  3IVT A;  2ISD A;  1REC A;  3NHT A;  2PRU A;  4WQ2 A;  4AQJ A;  2PVB A;  2KFG A;  2BL0 C;  3DXL A;  1DQE A;  1TNW A;  3I5I C;  4HRH A;  1WRZ A;  2L98 A;  3CWG A;  1XFX O;  1AJ4 A;  1YX7 A;  2KAV A;  2NLN A;  2O5G A;  3OB1 B;  3OX6 A;  2WCB A;  1F8H A;  3KPX A;  1CM1 A;  2AUC A;  4C0L A;  1CFP A;  2H61 A;  4C0J A;  2K61 A;  1C3Z A;  5K89 A;  1XFW O;  4F7F A;  2SCP A;  2KHN A;  1KQM B;  1FI6 A;  5AER A;  3VB1 A;  2BNX A;  1K2H A;  1RTP 1;  2GV5 A;  4MVF A;  3UNW A;  2HF5 A;  5PAL A;  2TN4 A;  1A03 A;  1GM0 A;  2BAP A;  5HLO A;  4CID A;  2OS8 B;  3EG5 B;  2COL B;  3Q8I A;  1JBA A;  1KCY A;  1B8C A;  1B8R A;  1OE9 B;  2CTN A;  2LLS A;  2BE4 A;  2CXJ A;  5CSF A;  4P5O E;  2K0J A;  4AQI A;  4OCI A;  2LVK A;  3WNX B;  1SL9 A;  2NCO A;  1BU3 A;  1YTZ C;  5I2Q A;  4MRY A;  2CBL A;  2JRF A;  1BMO A;  1M63 B;  2KYF A;  3CR5 X;  3D74 A;  2P70 A;  1SY9 A;  1K9P A;  5ER4 X;  3M0W A;  1CKK A;  3PJI A;  5AEQ A;  3FS7 A;  1KFX L;  1OQP A;  1T14 A;  3B88 A;  3LK1 A;  1OSA A;  1SK6 D;  3I5F B;  2K2A A;  2QEH A;  3NSO A;  2SAS A;  2KI6 C;  3AAJ A;  1QWV A;  5HKY A;  1ODB A;  1WRK A;  1A4P A;  1B47 A;  3BQ3 A;  2MRD A;  3LL8 B;  1B7T Z;  4I5N B;  3SS4 A;  1XFU O;  5FYX A;  1DT7 B;  4OKH A;  1DGV A;  1UHJ A;  4P2Y B;  3NSK A;  5HKW A;  1EH2 A;  4PHM A;  2WCJ A;  1QIV A;  1S26 D;  3ZNI A;  2E30 A;  1SW8 A;  1V1G A;  3O4Y A;  4PCW A;  3FE8 A;  1MXL C;  1DF0 A;  2K60 A;  1IQ3 A;  4HRG A;  1MUX A;  4I5K A;  3F45 A;  3FWC A;  2ZN9 A;  5I2L A;  1CDM A;  4GGN A;  2H8V A;  3LLE A;  1B1G A;  1BT6 A;  1DJZ A;  5HKZ A;  1A75 B;  5CPV A;  3R1V A;  2MLE C;  2CCM A;  3I5G B;  3JTD B;  5I2O A;  3D75 A;  4GGF A;  1SR6 B;  3FIA A;  2JNX A;  1S1E A;  2KYC A;  1EXR A;  3VRR A;  1HQV A;  4JPZ B;  1KQM C;  5HLV A;  1Z4H A;  1B4C A;  1QV0 A;  2G9B A;  5DIC A;  1QVI Y;  5EL2 A;  2M49 B;  2Y4Q A;  2WCF A;  1XYD A;  1FPW A;  2QEV A;  1J7Q A;  1IIO A;  1B7T Y;  2FOT A;  3BYA A;  2OS8 C;  1OOG A;  1QX5 B;  1YX8 A;  2KDH A;  4ZCV A;  2PQL A;  1OMR A;  1GQM A;  2JZI A;  2K7D A;  4PE1 A;  3S0G A;  4DCK A;  1E8A A;  1LIN A;  1UHK A;  1KK7 Z;  3I5H B;  3LK0 A;  5JOL A;  3PAT A;  1IQ5 A;  1CFC A;  1V1F A;  1SBJ A;  2JTZ A;  5D69 A;  2ZN8 A;  5I8N A;  3BUO B;  3AKB A;  3RZS A;  4MEW A;  1S6C A;  3D0Y B;  3EKJ A;  3N7H A;  5HYD A;  3NSI A;  2LE9 B;  3LCP C;  1GGW A;  1KQV A;  1DVI A;  1DJX A;  1C07 A;  1BOC A;  3VRQ A;  3VGO A;  2QEO A;  2KI4 B;  5ER5 A;  2Y1M A;  3D78 A;  1ZFS A;  2ZFD A;  2KGB C;  4PAL A;  1TCO B;  1KSO A;  1YRT B;  3B86 A;  3SG2 A;  1BOD A;  1Y1X A;  3I5F C;  5CSI A;  1FF1 A;  3TDZ A;  1F70 A;  3EK7 A;  1PSR A;  1TNX A;  2WCL A;  4PHJ A;  1XK4 A;  1L2O B;  3KO0 A;  2LC5 A;  4PHK A;  2LAN A;  2FJY A;  2M1K B;  3EK4 A;  1NCY A;  2WOS A;  3O6B A;  4Q04 A;  3H4S E;  1QX2 A;  2G2B A;  2I7A A;  2R2I A;  4WQ3 A;  3S0B A;  3RLZ A;  1DJI A;  1KK7 Y;  4N1G A;  3BJH A;  1OOJ A;  1F55 A;  2GGZ A;  3WHT B;  2I18 A;  4ORB B;  2LP3 A;  3SG7 A;  1YUT A;  1SSE B;  3R1P A;  2QEB A;  2KBI A;  4XJK B;  4NDD A;  2NXQ A;  3DYE A;  3EVR A;  4YGB B;  2M7N A;  1WDC B;  2JWW A;  3KHE A;  1TCF A;  4ORA B;  1BG1 A;  3I5G C;  1DTL A;  2EC6 B;  3JTD C;  1X02 A;  1S6J A;  3CZ2 A;  1ALW A;  2JNF A;  1SR6 C;  3CGA A;  3D77 A;  3DF0 B;  1XFY O;  4GFT A;  2LHI A;  4N5X A;  1DEL A;  5AFP A;  1IWQ A;  3V2L A;  1IH0 A;  4CFR A;  3BOW B;  1EJ3 A;  4OV2 A;  5TNC A;  1LS8 A;  1M39 A;  2MBX A;  3WHU B;  2KOT A;  2K7C A;  1KFU L;  1B8L A;  4M2O A;  3SIB A;  2H2K A;  2L2E A;  2VRG A;  2ZRT A;  1XFR A;  1NCX A;  3PFV A;  4L9M A;  1GJY A;  3CZ0 A;  1SKT A;  1J7R A;  1JF2 A;  3OBV A;  3OHM B;  4JKT A;  3I5H C;  4M2Q A;  4YGE B;  4D1E A;  2HPS A;  2B1U A;  2MHH A;  5AAN A;  2WND A;  1K93 D;  1M45 A;  2Q4U A;  1Q80 A;  1TOP A;  2HQW A;  3GK4 X;  3TDI A;  4HSZ A;  3UO9 A;  1PAL A;  2WCK A;  1FW4 A;  1IGV A;  1DJH A;  2KI4 C;  3JVT B;  4GBA A;  1B9A A;  4MZL A;  2BCA A;  1XVJ A;  2PMY A;  1PK0 D;  2PSR A;  2WCM A;  1KK8 C;  3CR2 A;  1ZOT B;  2KFF A;  1DJY A;  1XO5 A;  4OVN F;  1QVI Z;  3GK2 A;  4I5L B;  1FBV A;  2KQY A;  2V53 A;  1L2O C;  1NP8 A;  1CMF A;  1JFK A;  1PVA A;  2F2P A;  3D73 A;  1BR1 B;  1OOH A;  1QLS A;  2KQ6 A;  1NX3 A;  1GGZ A;  3B6X A;  4GUK A;  5FI6 A;  3BUN B;  1A2X A;  3CYZ A;  3ZWH A;  3BFA A;  1SPY A;  3O78 A;  1NPQ A;  1RK9 A;  2L50 A;  2KLE A;  2F3Y A;  1L7Z A;  1QLK A;  3SJS A;  2JXL A;  1JF0 A;  3AAK A;  4YGA A;  2DOQ A;  2M29 A;  2D8N A;  2PYQ A;  1JWD A;  2KFH A;  2LHL A;  1BLQ A;  1UHI A;  1FI5 A;  2CT9 A;  1RWY A;  2QAC A;  2LUX A;  2F33 A;  3CAB A;  1H4B A;  2Y5I A;  4TNC A;  3PM2 A;  5J3X A;  1KWO B;  1PUL A;  2FCD A;  1P28 A;  1DGU A;  3KEV A;  2M3W A;  3C1V A;  4MRX A;  1NUB A;  2EC6 C;  2JTT A;  2ZKM X;  5D7F A;  2CNP A;  5CSJ A;  4INW A;  5KSZ A;  1CMG A;  2LLT A;  3CS1 A;  3FE6 A;  4NQG A;  1IJ5 A;  1J55 A;  1W7I B;  5CSN A;  2ZRS A;  1XFZ O;  2JPO A;  2JT8 A;  2LVI A;  3O4X A;  1Y1U A;  1S5G Z;  1SL8 A;  1QIW A;  2MJW B;  3DVK A;  4A4B A;  4ORC B;  1XA5 A;  3S0A A;  3DVM A; 
#chains in the Genus database with same CATH homology
 1UUR A;  1OZS A;  3TS5 B;  3CTN A;  3FWB A;  1YUR A;  2JXC A;  2ZNE A;  1JSA A;  2KGR A;  3RM1 A;  3PAL A;  3PN7 B;  4A4C A;  1KFX S;  3PLF B;  3CR4 X;  2LLU A;  4PDZ A;  3NSL A;  1PVB A;  2LM5 A;  1SYM A;  3TZ1 A;  1JUO A;  5DKN A;  5AXI A;  2E6W A;  5GQQ C;  2HET A;  2Q91 A;  2JQ6 A;  2LMV A;  1IJ6 A;  2PAL A;  1K9U A;  2A4J A;  4BY4 A;  4PE7 A;  1ZMZ A;  3EVU A;  2K8M B;  1K95 A;  3D10 A;  3JVT C;  1TRF A;  1MHO A;  3VRN A;  2OPO A;  2NCP A;  1CDL A;  2LVJ A;  4OR9 B;  1S6I A;  4DRW A;  1SL7 A;  4R1E A;  4YI8 A;  1CM4 A;  1K96 A;  1LA0 A;  1S5G Y;  2KSP A;  3HX4 A;  4DIR A;  4QJ5 B;  2PAS A;  1R6P A;  1NSH A;  1MF8 B;  3EK8 A;  4MN0 A;  4CLN A;  3KF9 A;  2LCP A;  2QPT A;  4YGC B;  4DUQ A;  5DKQ A;  1CDP A;  3NXA A;  2LVV A;  2M9G A;  3TDU A;  1EG3 A;  4NDC A;  1IKU A;  2BKI B;  2OTG B;  4ZCU A;  1CLM A;  1U5I A;  1DF0 B;  2F8P A;  1N0Y A;  2FJU B;  1KWO C;  3BUW B;  3HCM A;  2JPT A;  4JQ0 D;  1IRJ A;  1DJW A;  1IG5 A;  1S36 A;  1W7J B;  4GPL B;  2AAO A;  4PE4 A;  2GGM A;  2LMT A;  2ZND A;  4AOM A;  1J7O A;  3PM8 A;  2FCE A;  1N2D A;  1A75 A;  1OMV A;  2H61 C;  4NDB A;  3OB2 B;  1UWO A;  1QJT A;  1KSM A;  1YR5 A;  2LUC A;  3VRO A;  1AP4 A;  2LAP A;  3BUX B;  2WCE A;  1TNP A;  1CLL A;  3EVV A;  3TS5 C;  1H8B A;  1ZUZ A;  2KI6 D;  2K7B A;  2JU0 A;  1QAS A;  1LVC D;  2JT3 A;  4ICB A;  1ALV A;  1EL4 A;  3PN7 C;  3MSE B;  1AJ5 A;  3WXA A;  3OP0 A;  1Y0V H;  3ICB A;  1ZAC A;  5DKR A;  1F4Q A;  2JOJ A;  4BY5 A;  4YGD B;  2K2F A;  5F6T A;  2KAX A;  4GAO A;  2L0P A;  4MZK A;  3BXK A;  1N65 A;  2EHB A;  3IF7 A;  3SG5 A;  4DS7 A;  1DMO A;  2MAZ A;  4QJ3 B;  1OMD A;  2LP2 A;  1SRA A;  3A4U B;  2BCB A;  5JJG A;  1G33 A;  1SCM B;  2I94 A;  1TNQ A;  1Y1A A;  3CLN A;  3GOF A;  2MBX A;  3D0Y A;  1LA3 A;  1M31 A;  1UP5 A;  3SIA A;  1WRL A;  1AK8 A;  1CB1 A;  4IL1 A;  1NWD A;  4YBH B;  4YRU A;  1HT9 A;  3K21 A;  1A29 A;  2BBN A;  1F54 A;  2MA2 A;  2BKH B;  1YUU A;  1QV1 A;  3BUM B;  4MBE A;  1MQ1 A;  1S3P A;  1JC2 A;  2Y1N A;  5BPJ A;  1UUS A;  3DVJ A;  1CDN A;  4UPG A;  1QTX A;  3AKA A;  1SNL A;  4QJ4 B;  2OTG C;  1G8I A;  1CNP A;  3IQQ A;  1C7V A;  1DJG A;  1WDC C;  2LV7 A;  1MWN A;  2BEC A;  2WOR A;  1QX7 A;  4PHN A;  2JT0 A;  2M0R A;  2BCX A;  1PSB A;  4U8D A;  1KFU S;  1UHN A;  2M7L A;  1YUS A;  1U5I B;  3SG4 A;  1K8U A;  2IS9 A;  3PSR A;  4XJK A;  1K90 D;  3TUY B;  1YVL A;  3O2P A;  4E68 A;  1D1O A;  4GGF C;  4XYN A;  2BL0 B;  4FTG A;  3I5I B;  2F3Z A;  4MSP A;  3DF0 A;  2KBM A;  2F2O A;  3GK1 A;  3OX5 A;  3SG3 A;  3CZT X;  2KAY A;  3EKH A;  5G08 A;  1K9K A;  1F4O A;  2JUL A;  2L4I A;  3QRX A;  2MLF C;  3BOW A;  1QAT A;  1WLZ A;  2EGD A;  1YRU B;  4I5J A;  4JWQ A;  1LKJ A;  1BF5 A;  3SG6 A;  1C7W A;  1CFD A;  1LXF C;  1J7P A;  2O60 A;  5B8I B;  1WY9 A;  1AUI B;  1Y6W A;  2NZ0 A;  4MLW A;  1OZO A;  2M1U A;  1NX1 A;  1RFJ A;  1NX2 A;  4USL A;  2L4H A;  2HQ8 A;  2K7O A;  2AMI A;  2I2R E;  1QXP A;  4CFQ A;  4GNK B;  1CFF A;  1CLB A;  1F71 A;  1SCM C;  3E3R A;  1NCZ A;  1MR8 A;  1R2U A;  1SCV A;  2L5X B;  2LMU A;  4MZJ A;  1EG4 A;  1NYA A;  1SMG A;  1PRW A;  1NIW A;  2BE6 A;  4PE0 A;  3A8R A;  5KTY A;  4M2P A;  2JC2 A;  1TN4 A;  2LNK A;  4YI9 A;  1XK4 C;  4C0K A;  1K94 A;  1VRK A;  1XFV O;  1BR4 B;  1NX0 A;  2BBM A;  1BJF A;  4WRI A;  1KK8 B;  1AVS A;  1JFJ A;  1YVH A;  2M97 A;  3VRP A;  5IBW A;  1RJV A;  5KU1 A;  2M8U A;  1TTX A;  4FQO A;  4N1F A;  2P6B B;  3IQO A;  1CTR A;  4CPV A;  1J1E A;  2WC8 A;  4ETO A;  1QS7 A;  2L51 A;  4HRE E;  1J1D A;  1TIZ A;  1MXE A;  1G4Y R;  2RGI A;  4F0Z B;  2KNE A;  1AHR A;  1WLM A;  1RRO A;  3TUY C;  2ISD A;  3DD4 A;  1M46 A;  1UHH A;  4AQJ A;  1REC A;  4WQ2 A;  2PRU A;  2PVB A;  2KFG A;  2BL0 C;  1TNW A;  3I5I C;  4HRH A;  1WRZ A;  2L98 A;  3CWG A;  1XFX O;  1AJ4 A;  1YX7 A;  2KAV A;  2NLN A;  2O5G A;  3OB1 B;  3OX6 A;  2WCB A;  1F8H A;  3KPX A;  1CM1 A;  2AUC A;  4C0L A;  1CFP A;  2H61 A;  4C0J A;  2K61 A;  5K89 A;  1XFW O;  2SCP A;  2KHN A;  1KQM B;  1FI6 A;  5AER A;  1K2H A;  1RTP 1;  2GV5 A;  4MVF A;  1A03 A;  2HF5 A;  5PAL A;  2TN4 A;  5HLO A;  4CID A;  2OS8 B;  2COL B;  1KCY A;  1JBA A;  1B8C A;  1B8R A;  1OE9 B;  2CTN A;  2LLS A;  2BE4 A;  2CXJ A;  5CSF A;  4P5O E;  2K0J A;  4AQI A;  4OCI A;  2LVK A;  3WNX B;  1SL9 A;  2NCO A;  1BU3 A;  1YTZ C;  5I2Q A;  4MRY A;  2CBL A;  2JRF A;  1BMO A;  1M63 B;  2KYF A;  3CR5 X;  1SY9 A;  1K9P A;  5ER4 X;  3M0W A;  1CKK A;  5AEQ A;  3FS7 A;  1KFX L;  1OQP A;  3LK1 A;  1OSA A;  1SK6 D;  3I5F B;  2K2A A;  3NSO A;  2SAS A;  2KI6 C;  3AAJ A;  5HKY A;  1ODB A;  1WRK A;  1A4P A;  1B47 A;  3BQ3 A;  2MRD A;  3LL8 B;  1B7T Z;  4I5N B;  1DT7 B;  1XFU O;  5FYX A;  4OKH A;  1DGV A;  1UHJ A;  4P2Y B;  3NSK A;  5HKW A;  1EH2 A;  4PHM A;  1QIV A;  1S26 D;  3ZNI A;  2E30 A;  1SW8 A;  1V1G A;  3O4Y A;  4PCW A;  1MXL C;  1DF0 A;  1IQ3 A;  4HRG A;  1MUX A;  4I5K A;  3F45 A;  3FWC A;  2ZN9 A;  5I2L A;  1CDM A;  4GGN A;  3LLE A;  1B1G A;  1BT6 A;  1DJZ A;  5HKZ A;  1A75 B;  5CPV A;  2MLE C;  2CCM A;  3I5G B;  3JTD B;  5I2O A;  4GGF A;  1SR6 B;  3FIA A;  2JNX A;  1S1E A;  2KYC A;  1EXR A;  3VRR A;  1HQV A;  4JPZ B;  1KQM C;  5HLV A;  1B4C A;  1QV0 A;  2G9B A;  1QVI Y;  2M49 B;  2Y4Q A;  2WCF A;  1XYD A;  1FPW A;  1J7Q A;  1B7T Y;  2FOT A;  3BYA A;  2OS8 C;  1QX5 B;  1YX8 A;  2KDH A;  4ZCV A;  4DCK A;  1OMR A;  1GQM A;  2JZI A;  2K7D A;  4PE1 A;  1E8A A;  1LIN A;  1UHK A;  1KK7 Z;  3I5H B;  3LK0 A;  5JOL A;  3PAT A;  1IQ5 A;  1CFC A;  1V1F A;  1SBJ A;  2JTZ A;  5D69 A;  2ZN8 A;  5I8N A;  3BUO B;  3AKB A;  4MEW A;  1S6C A;  3D0Y B;  3EKJ A;  5HYD A;  3NSI A;  2LE9 B;  3LCP C;  1GGW A;  1KQV A;  1DVI A;  1DJX A;  1C07 A;  1BOC A;  3VRQ A;  3VGO A;  2KI4 B;  5ER5 A;  2Y1M A;  1ZFS A;  2ZFD A;  2KGB C;  4PAL A;  1TCO B;  1KSO A;  1YRT B;  3SG2 A;  1BOD A;  1Y1X A;  3I5F C;  5CSI A;  1FF1 A;  3TDZ A;  1F70 A;  3EK7 A;  1PSR A;  1TNX A;  4PHJ A;  1XK4 A;  1L2O B;  3KO0 A;  2LC5 A;  4PHK A;  2LAN A;  2M1K B;  3EK4 A;  1NCY A;  2WOS A;  3O6B A;  4Q04 A;  3H4S E;  1QX2 A;  2G2B A;  2I7A A;  2R2I A;  4WQ3 A;  3RLZ A;  1DJI A;  1KK7 Y;  4N1G A;  1OOJ A;  1F55 A;  2GGZ A;  3WHT B;  2I18 A;  4ORB B;  2LP3 A;  3SG7 A;  1YUT A;  2KBI A;  4XJK B;  4NDD A;  2NXQ A;  4YGB B;  3EVR A;  2M7N A;  1WDC B;  2JWW A;  3KHE A;  1TCF A;  4ORA B;  1BG1 A;  3I5G C;  1DTL A;  2EC6 B;  3JTD C;  1X02 A;  1S6J A;  1ALW A;  2JNF A;  1SR6 C;  3CGA A;  3DF0 B;  4N5X A;  1XFY O;  4GFT A;  2LHI A;  5AFP A;  1IWQ A;  1IH0 A;  4CFR A;  3BOW B;  1EJ3 A;  4OV2 A;  5TNC A;  1M39 A;  3WHU B;  2KOT A;  2K7C A;  1KFU L;  1B8L A;  4M2O A;  3SIB A;  2H2K A;  2L2E A;  2VRG A;  2ZRT A;  3PFV A;  1NCX A;  4L9M A;  1GJY A;  1SKT A;  1J7R A;  1JF2 A;  3OHM B;  3I5H C;  4M2Q A;  4YGE B;  4D1E A;  2HPS A;  2B1U A;  2MHH A;  5AAN A;  2WND A;  1K93 D;  1M45 A;  2Q4U A;  1Q80 A;  1TOP A;  2HQW A;  3GK4 X;  3TDI A;  4HSZ A;  1PAL A;  1FW4 A;  1IGV A;  1DJH A;  2KI4 C;  3JVT B;  4GBA A;  1B9A A;  4MZL A;  2BCA A;  1XVJ A;  2PMY A;  1PK0 D;  2PSR A;  1KK8 C;  3CR2 A;  1ZOT B;  2KFF A;  1DJY A;  1XO5 A;  4OVN F;  1QVI Z;  3GK2 A;  4I5L B;  1FBV A;  2KQY A;  2V53 A;  1L2O C;  1NP8 A;  1CMF A;  1JFK A;  1PVA A;  2F2P A;  3DVE A;  1BR1 B;  1QLS A;  2KQ6 A;  4GUK A;  1NX3 A;  1GGZ A;  3ZWH A;  3BUN B;  1A2X A;  1SPY A;  3O78 A;  1NPQ A;  1RK9 A;  2L50 A;  2F3Y A;  1L7Z A;  1QLK A;  3SJS A;  2JXL A;  1JF0 A;  3AAK A;  4YGA A;  2DOQ A;  2M29 A;  2D8N A;  1JWD A;  2KFH A;  2LHL A;  1BLQ A;  1UHI A;  1FI5 A;  2CT9 A;  1RWY A;  2QAC A;  2LUX A;  2F33 A;  1H4B A;  2Y5I A;  4TNC A;  5J3X A;  1KWO B;  1PUL A;  2FCD A;  1DGU A;  3KEV A;  2M3W A;  3C1V A;  4MRX A;  1NUB A;  2EC6 C;  2JTT A;  2ZKM X;  5D7F A;  2CNP A;  5CSJ A;  5KSZ A;  1CMG A;  2LLT A;  3CS1 A;  5CSN A;  4NQG A;  1IJ5 A;  1J55 A;  1W7I B;  2ZRS A;  1XFZ O;  2JT8 A;  2LVI A;  1Y1U A;  1S5G Z;  1SL8 A;  1QIW A;  2MJW B;  3DVK A;  4A4B A;  4ORC B;  1XA5 A;  3DVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...