2OS8B

Rigor-like structures of muscle myosins reveal key mechanical elements in the transduction pathways of this allosteric motor
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
135
structure length
135
Chain Sequence
IQEMKEAFTMIDQNRDGFIDINDLKEMFSSLGRTPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFGMFDELDTKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVRFVAMIKGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rigor-like Structures from Muscle Myosins Reveal Key Mechanical Elements in the Transduction Pathways of This Allosteric Motor.
pubmed doi rcsb
molecule tags Contractile protein
molecule keywords Myosin heavy chain
total genus 24
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2007-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2os8B01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2os8B02
1TNQA 1FF1A 4MZJA 1DJHA 1LVCD 2L4HA 5AEQA 1GGWA 2ZNDA 1V1FA 2KYFA 2ZN8A 5HKWA 4MBEA 3GOFA 1LA3A 1G4YR 1DJZA 2SCPA 3CTNA 3PALA 5D69A 1QVIZ 5AFPA 2ZKMX 1XFWO 1AHRA 3LK0A 4U8DA 1EL4A 1UHJA 1QLKA 1N0YA 1NX3A 2KFFA 5CSNA 2MJWB 3EKHA 2Q4UA 4QJ3B 4PE1A 1SW8A 3EVVA 3VRRA 1YURA 1KFXS 2ZRTA 1YX8A 1DGUA 1L7ZA 3AKAA 3TDZA 4PE0A 1A29A 2HQWA 2NCOA 4A4BA 1GQMA 4NDBA 1NCYA 1AUIB 2LE9B 3TS5C 3IQQA 4FTGA 1K9UA 3SIBA 2KI6C 2NZ0A 2FOTA 1KWOB 1OMDA 2Y4QA 3SG2A 1XFZO 1K90D 1S6JA 2H2KA 3DD4A 1UP5A 3DVMA 3I5HB 3PM8A 4M2PA 4D1EA 1OE9B 1NUBA 3CS1A 3JTDB 1G8IA 4R1EA 1QX2A 3KO0A 1NPQA 3D0YA 1F8HA 5J3XA 3TUYB 2OS8B 1LXFC 2HQ8A 3PN7B 1QATA 1SR6B 1NSHA 4DRWA 2GV5A 4DUQA 2MA2A 1IKUA 1CFDA 1XK4C 2M7NA 4IL1A 4XJKB 2CCMA 2NLNA 4GFTA 3I5IC 4NQGA 1OMVA 2JTTA 3FS7A 1KQVA 1YX7A 3IF7A 1YTZC 4PHMA 2LLUA 1ZACA 2F3ZA 3CWGA 1HT9A 1JWDA 1WDCC 2LLSA 2KFHA 3BQ3A 3TS5B 3SG4A 1NYAA 1B47A 3PFVA 2KSPA 1S36A 1QXPA 3PN7C 5GQQC 3TUYC 1FBVA 2LV7A 2JNFA 2L51A 2LP2A 3TDIA 2M7LA 1SNLA 3AAKA 1W7JB 1KK7Z 2LVKA 2PALA 1N65A 1QV1A 4HRGA 4NDDA 4ZCUA 4BY5A 2JPTA 4AQJA 1YR5A 1KWOC 5F6TA 1E8AA 2LANA 2LVVA 1TCOB 3AKBA 1WRZA 1AJ5A 3LCPC 1A03A 1JUOA 3C1VA 2QPTA 1N2DA 5HLOA 2PRUA 2JOJA 3E3RA 2QACA 1TOPA 2KOTA 2LUCA 2L5XB 2OS8C 3MSEB 1RFJA 4CPVA 2ISDA 3CGAA 1H8BA 2MBXA 1UHIA 1XFYO 1IG5A 3SJSA 1V1GA 1TNWA 2HF5A 4YI9A 1EH2A 4TNCA 2TN4A 2WCBA 4L9MA 1NIWA 1WDCB 4ETOA 1S5GZ 1CDNA 4WQ2A 4QJ4B 4JWQA 1U5IB 1J1DA 5HYDA 1QV0A 2F8PA 3BUNB 5B8IB 3I5IB 1YRUB 2JT0A 1ZUZA 2BKHB 5HKYA 4MN0A 4P5OE 1K95A 1K8UA 4A4CA 2BKIB 1CDLA 2I18A 1MUXA 1PSRA 1WLMA 2BE4A 2F3YA 4N1GA 2I7AA 1FW4A 1DTLA 3CR4X 1DVIA 3CZTX 1UURA 1BOCA 3CR5X 3O2PA 4MRXA 2CT9A 1F55A 1C7WA 1OMRA 2WCFA 2DOQA 1KFUS 3HCMA 3PSRA 3EK7A 1OQPA 2M3WA 2G2BA 4I5LB 2JQ6A 2V53A 4PE4A 3EVRA 1WLZA 1HQVA 2AMIA 2K2FA 2KNEA 3DF0B 3RLZA 4M2QA 4CIDA 2LMVA 3FWCA 3SG6A 3WNXB 4YGAA 1DJXA 1DJWA 1QTXA 1CM1A 1YVHA 3I5GB 3OHMB 3O6BA 4GGFC 4GNKB 3AAJA 3LL8B 5DKQA 5I8NA 1JF2A 4GGNA 3ZWHA 2FCDA 5KSZA 4OR9B 4HSZA 3O4YA 2KHNA 4GPLB 1IJ5A 3IQOA 1BG1A 1JBAA 1PRWA 1SPYA 3VRPA 1DJGA 1UHHA 1B4CA 1YRTB 2I94A 1XA5A 1OZSA 2K7OA 1DT7B 2D8NA 1B1GA 1IGVA 3BUXB 2K7DA 2M1UA 4PE7A 1MWNA 1YUSA 2JULA 1S26D 1NWDA 1TN4A 3NXAA 5TNCA 1M31A 4YGEB 1BJFA 3NSKA 2H61A 1NX2A 2NXQA 3OP0A 3TDUA 1L2OC 1BF5A 2PVBA 1DJIA 4HRHA 1MF8B 3K21A 3M0WA 3NSIA 4NDCA 3KHEA 5IBWA 1C7VA 2M1KB 3D10A 2OPOA 1YUTA 4FQOA 1ZMZA 3A8RA 3GK4X 3NSOA 2M29A 2ZN9A 5PALA 4MLWA 1SL8A 1SCVA 2F2OA 5KTYA 2KI4C 1B8RA 2LNKA 1RJVA 1MXEA 4PHKA 1QJTA 1WRLA 2F2PA 1FI6A 1QS7A 2BCAA 1J55A 2KAVA 1AJ4A 3KEVA 5D7FA 2FJUB 1DGVA 1F70A 1BLQA 4N1FA 3BUWB 1BR1B 3EK8A 2OTGC 3VROA 2JNXA 1QASA 4C0LA 4ORCB 3JVTC 2HETA 1GJYA 3PLFB 3ZNIA 3JTDC 1IQ5A 1MXLC 3VRQA 3I5FC 1CDPA 2KBMA 3BOWB 1QVIY 4WQ3A 1CMFA 2CNPA 1NCXA 2HPSA 3KPXA 2LMTA 1ALVA 4YGCB 1W7IB 1XO5A 2H61C 2M8UA 2CTNA 1EJ3A 5ER4X 4MEWA 3SG3A 1AVSA 2M49B 3LK1A 4ICBA 1S5GY 3SIAA 1IH0A 2JZIA 4PHNA 2CXJA 1CLLA 1OSAA 1TTXA 1Y1AA 1SMGA 2LCPA 1F4OA 3LLEA 4CLNA 5I2QA 4YI8A 2KI6D 1UWOA 3QRXA 4E68A 2A4JA 1QX7A 1L2OB 2K61A 3DVJA 2LC5A 1CNPA 1KQMB 1VRKA 2K0JA 3RM1A 4OVNF 4XJKA 1J7RA 4MZLA 1LINA 1C07A 1Y1XA 1QIWA 1RK9A 4JQ0D 2BCXA 1R2UA 2P6BB 1WY9A 1PK0D 5CSJA 1LKJA 2M97A 1AK8A 2I2RE 1JSAA 1JF0A 5ER5A 1BT6A 2O60A 2G9BA 4GGFA 3OB2B 1K93D 1SY9A 2B1UA 1MR8A 4Q04A 2KGBC 2LHIA 1A2XA 2ZNEA 1XVJA 2JT3A 3ICBA 1TCFA 2O5GA 1F54A 1PVAA 4F0ZB 3CR2A 4PHJA 2PMYA 2JRFA 1F71A 2MRDA 1J7QA 2AAOA 4HREE 4DIRA 2L50A 1SK6D 5I2OA 1M46A 1QX5B 4P2YB 5G08A 2BBNA 2L2EA 2IS9A 1SBJA 2Y1NA 1XK4A 3DVKA 1DF0A 1UUSA 1OOJA 1CTRA 1K96A 1NCZA 2E6WA 3I5HC 2CBLA 2KI4B 2R2IA 1WRKA 2MAZA 2JC2A 3OX5A 5I2LA 1KK8B 3OB1B 1K9KA 1UHNA 2JTZA 1B9AA 1RECA 2L0PA 2L98A 1JFJA 2WC8A 4PCWA 1KFXL 2L4IA 1BR4B 2F33A 3O78A 1K94A 2KFGA 4PALA 4AQIA 3D0YB 4QJ5B 1RTP1 3GK2A 4M2OA 2KAYA 4DCKA 2LAPA 1JFKA 1CFFA 2RGIA 3KF9A 2KGRA 2LLTA 3CLNA 1H4BA 1TNPA 4OKHA 2KAXA 3GK1A 1G33A 2AUCA 2JT8A 3A4UB 3WXAA 1FI5A 1D1OA 2MLFC 1PVBA 3WHUB 1OZOA 2K8MB 1M63B 2BL0B 5AXIA 2WORA 1BU3A 3BYAA 1CDMA 4YRUA 2VRGA 2MLEC 3TZ1A 1XFUO 1IQ3A 1ZOTB 3FWBA 1CLBA 4OCIA 5K89A 1AP4A 1DF0B 2COLB 1SL7A 3PATA 1M39A 1K2HA 3VGOA 4GBAA 1KFUL 1S3PA 1R6PA 2JXCA 1YVLA 4MVFA 2EGDA 2JXLA 2BECA 2PSRA 3EK4A 1KSMA 1S1EA 1BODA 2JWWA 3F45A 2ZFDA 1PSBA 3EKJA 1A75A 1NX0A 2GGZA 4OV2A 1KK7Y 4CFRA 1CLMA 1RROA 1X02A 1Y0VH 1GGZA 1DJYA 2Y1MA 1NP8A 3BUOB 1SRAA 3EVUA 4MZKA 2BL0C 1CMGA 2Y5IA 1FPWA 1EXRA 1Y6WA 4GAOA 4DS7A 2KQYA 1JC2A 1S6CA 1NX1A 1QLSA 5JOLA 4BY4A 1XYDA 5HLVA 1F4QA 4I5JA 5AANA 5KU1A 3WHTB 4YGBB 1M45A 4I5NB 2WNDA 2E30A 1A4PA 4ZCVA 4AOMA 1U5IA 2SASA 2KQ6A 1SYMA 5CSFA 1IWQA 4UPGA 1B7TY 3FIAA 3BUMB 3I5FB 2EHBA 1B8CA 1CFPA 2PASA 1MHOA 4PDZA 1S6IA 1SR6C 3JVTB 5HKZA 3DVEA 3SG7A 4CFQA 2K7CA 5JJGA 2KBIA 1Y1UA 2LVIA 5CPVA 2K7BA 4WRIA 2LVJA 4C0KA 4I5KA 2MHHA 1IRJA 1B7TZ 1CM4A 2WOSA 4N5XA 2KYCA 5CSIA 2LHLA 2FCEA 1A75B 1KCYA 1ODBA 2BE6A 2ZRSA 1Q80A 1PULA 2EC6C 3DF0A 1RWYA 2LUXA 1QIVA 2NCPA 4ORBB 1SKTA 2LM5A 4XYNA 4YBHB 4MSPA 5BPJA 1PALA 3OX6A 1KSOA 2EC6B 2M0RA 3BOWA 3NSLA 1J7OA 1KK8C 1SCMB 3H4SE 1B8LA 2K2AA 2OTGB 3BXKA 1CB1A 1ZFSA 1CFCA 2KDHA 5AERA 3HX4A 1LA0A 4GUKA 1K9PA 3I5GC 1CKKA 1J1EA 5DKNA 2LP3A 5FYXA 4C0JA 1XFVO 2JU0A 2M9GA 1BMOA 2LMUA 1XFXO 1SL9A 1KQMC 1MQ1A 1TRFA 1TIZA 1ALWA 3SG5A 1TNXA 1J7PA 2GGMA 1EG3A 2BBMA 3VRNA 1EG4A 1UHKA 2Q91A 1YUUA 4JPZB 2BCBA 1SCMC 4USLA 4YGDB 1DMOA 1IJ6A 4ORAB 5DKRA 2WCEA 4MRYA
chains in the Genus database with same CATH superfamily
1TNQA 1FF1A 3PM2A 1DJHA 1LVCD 2L4HA 4MZJA 5AEQA 1GGWA 2ZNDA 1V1FA 2KYFA 2ZN8A 5HKWA 4MBEA 3GOFA 1LA3A 1G4YR 1DJZA 2SCPA 3CTNA 3PALA 5D69A 1QVIZ 5AFPA 2ZKMX 1XFWO 1AHRA 3LK0A 4U8DA 1EL4A 1TUJA 1UHJA 1QLKA 1N0YA 1NX3A 2KFFA 5CSNA 2MJWB 3EKHA 2Q4UA 3FE8A 4PE1A 1SW8A 3EVVA 4QJ3B 2KPHA 3VRRA 3DY9A 1YURA 1KFXS 2ZRTA 1YX8A 1DGUA 1LS8A 1L7ZA 3AKAA 3TDZA 4PE0A 1A29A 2HQWA 2NCOA 4A4BA 1GQMA 4NDBA 1NCYA 1AUIB 2LE9B 3S0DA 3TS5C 3IQQA 4FTGA 5FI6A 1K9UA 3SIBA 2KI6C 2NZ0A 2FOTA 2L5YA 1KWOB 1OMDA 2Y4QA 2WC5A 3SG2A 1XFZO 1K90D 1S6JA 2H2KA 3CYZA 1UP5A 3DD4A 3DVMA 3I5HB 3PM8A 4M2PA 1OE9B 4D1EA 1NUBA 3CS1A 3JTDB 1G8IA 4R1EA 1DELA 1QX2A 3KO0A 1NPQA 3D0YA 1F8HA 5J3XA 5DICA 3TUYB 2OS8B 1LXFC 2HQ8A 3PN7B 1QATA 1SR6B 1NSHA 2PYQA 4DRWA 2GV5A 4DUQA 2MA2A 1IKUA 1CFDA 1XK4C 2M7NA 4IL1A 4XJKB 2CCMA 2NLNA 1OOGA 4GFTA 3I5IC 4NQGA 1OMVA 2JTTA 3FS7A 1KQVA 1YX7A 3IF7A 1YTZC 2P71A 4PHMA 2LLUA 1ZACA 2F3ZA 3CWGA 1HT9A 1JWDA 1WDCC 2LLSA 2KFHA 3BQ3A 3TS5B 3SG4A 1NYAA 1B47A 3PFVA 2KSPA 1S36A 1QXPA 3PN7C 5GQQC 2FJYA 3TUYC 1FBVA 2LV7A 2JNFA 2L51A 2LP2A 2BNXA 1T14A 2M7LA 3TDIA 1SNLA 3AAKA 1W7JB 2K60A 1KK7Z 2LVKA 2PALA 1N65A 1QV1A 4HRGA 4NDDA 4ZCUA 4BY5A 2JPTA 4AQJA 1YR5A 1DQEA 1KWOC 5F6TA 1E8AA 2LANA 2LVVA 2ERBA 1TCOB 3O4XA 3AKBA 1WRZA 1AJ5A 3LCPC 1A03A 3EG5B 1JUOA 2WCKA 2WCMA 3C1VA 2QPTA 1N2DA 5HLOA 2PRUA 2JOJA 3CABA 3E3RA 2QACA 1SSEB 1TOPA 2KOTA 2LUCA 2L5XB 3DYEA 2OS8C 3MSEB 1RFJA 4CPVA 2ISDA 3CGAA 1H8BA 2MBXA 1UHIA 1XFYO 1IG5A 3SJSA 1QWVA 1V1GA 1TNWA 2HF5A 1DC1A 4YI9A 1EH2A 4TNCA 2TN4A 2WCBA 4L9MA 1NIWA 1WDCB 4ETOA 1S5GZ 1CDNA 4WQ2A 4QJ4B 4JWQA 1U5IB 1J1DA 5HYDA 1QV0A 2F8PA 3BUNB 5B8IB 3R1VA 3I5IB 1YRUB 2JT0A 1ZUZA 2BKHB 5HKYA 4MN0A 4P5OE 2YGUA 1K95A 1K8UA 4A4CA 2BKIB 4F7FA 1CDLA 2I18A 1MUXA 1PSRA 1WLMA 3D76A 2BE4A 2F3YA 4N1GA 2I7AA 1FW4A 2WCJA 1DTLA 3CR4X 1DVIA 3CZTX 1UURA 1BOCA 3CR5X 3O2PA 4MRXA 2CT9A 3L4AA 1F55A 2QEVA 1C7WA 1OMRA 2WCFA 2DOQA 1KFUS 3HCMA 3PSRA 3S0BA 3EK7A 1OQPA 2M3WA 2G2BA 4I5LB 1W9ZA 2JQ6A 2V53A 4PE4A 3EVRA 1WLZA 1GM0A 1HQVA 2AMIA 2K2FA 2KNEA 3DF0B 3RLZA 4M2QA 4CIDA 2LMVA 3FWCA 3SG6A 5EL2A 4YGAA 3WNXB 1DJXA 1DJWA 1QTXA 1CM1A 3R1PA 1YVHA 3I5GB 3OHMB 3O6BA 4GGFC 4GNKB 3AAJA 3LL8B 5DKQA 5I8NA 1JF2A 4GGNA 3ZWHA 5I94A 3S0FA 2FCDA 5KSZA 4OR9B 4HSZA 3O4YA 2KHNA 4GPLB 1IJ5A 3IQOA 1BG1A 1JBAA 1PRWA 1SPYA 3VRPA 1DJGA 1UHHA 2JPOA 1B4CA 1YRTB 2I94A 2QEBA 1XA5A 1C3YA 1OZSA 2K7OA 1DT7B 3R72A 2D8NA 1B1GA 1IGVA 3BUXB 2K7DA 2M1UA 4PE7A 1MWNA 1YUSA 2JULA 5HL1A 1S26D 1NWDA 1TN4A 3NXAA 5TNCA 1M31A 4YGEB 1BJFA 3NSKA 2H61A 1NX2A 2NXQA 1TWOA 3OP0A 3TDUA 1L2OC 1BF5A 2PVBA 1DJIA 4HRHA 4JKTA 1MF8B 3K21A 3M0WA 3NGVA 3NSIA 4NDCA 3KHEA 5IBWA 1C7VA 2M1KB 3D10A 2OPOA 1YUTA 4FQOA 1ZMZA 3A8RA 3GK4X 3NSOA 2M29A 4IJ7A 3S0EA 2ZN9A 5PALA 4MLWA 1SL8A 1SCVA 5FI7A 2F2OA 5KTYA 2KI4C 4INXA 1B8RA 1TUZA 1RJVA 1MXEA 2LNKA 4PHKA 1QJTA 1WRLA 2F2PA 3BJHA 1FI6A 1QS7A 2BCAA 1J55A 2KAVA 1AJ4A 1XFRA 3KEVA 5D7FA 2FJUB 1DGVA 1F70A 1BLQA 4N1FA 3BUWB 1BR1B 3L47A 2BAPA 2OTGC 3EK8A 2JNXA 1QASA 3VROA 4C0LA 4ORCB 3JVTC 2HETA 1GJYA 3BFAA 3PLFB 3ZNIA 3JTDC 1IQ5A 1MXLC 1Z2CB 3VRQA 3I5FC 1CDPA 2KBMA 3BOWB 1QVIY 4WQ3A 1CMFA 2CNPA 1NCXA 2HPSA 3KPXA 2LMTA 1ALVA 4YGCB 1W7IB 1XO5A 2H61C 2M8UA 2CTNA 3CZ2A 1EJ3A 5ER4X 4MEWA 3SG3A 1AVSA 2M49B 3LK1A 1Z4HA 4ICBA 1S5GY 2P70A 3SIAA 1IH0A 2JZIA 4PHNA 2CXJA 1CLLA 1OSAA 1TTXA 1Y1AA 1SMGA 2LCPA 1F4OA 2QEHA 3LLEA 3V2LA 4CLNA 5I2QA 4YI8A 2KI6D 3S0AA 1UWOA 3QRXA 4E68A 2A4JA 1QX7A 1L2OB 2K61A 3DVJA 2LC5A 1CNPA 1KQMB 1VRKA 2K0JA 3CZ0A 3RM1A 4OVNF 4XJKA 1J7RA 4MZLA 1LINA 1C07A 1Y1XA 1QIWA 1RK9A 4JQ0D 4OZDA 1DEKA 2BCXA 1R2UA 2P6BB 1WY9A 1PK0D 5CSJA 1LKJA 2M97A 1AK8A 2I2RE 1JSAA 1JF0A 5ER5A 1BT6A 2O60A 2G9BA 4GGFA 3OB2B 1K93D 1SY9A 2B1UA 2H8VA 1MR8A 4Q04A 2KGBC 2LHIA 1A2XA 3D77A 3FE9A 2ZNEA 1XVJA 2JT3A 3ICBA 2WCLA 1TCFA 2O5GA 3OGNA 1F54A 1PVAA 1IIOA 3Q8IA 3CR2A 4PHJA 4F0ZB 2PMYA 2JRFA 1F71A 2MRDA 1J7QA 3B87A 2AAOA 4HREE 4DIRA 2L50A 1SK6D 5I2OA 1M46A 3BFBA 1QX5B 4P2YB 2L2CA 1P28A 2BBNA 2KLDA 2L2EA 3B86A 2IS9A 3CDNA 1SBJA 2Y1NA 3B7AA 1XK4A 3SS4A 3DVKA 1DF0A 1UUSA 1OOJA 1CTRA 1K96A 1NCZA 2E6WA 3I5HC 2CBLA 2KI4B 2R2IA 1WRKA 2MAZA 2JC2A 3OX5A 5I2LA 1KK8B 3OB1B 1K9KA 1UHNA 2JTZA 1B9AA 1RECA 2L0PA 2L98A 1JFJA 2WC8A 4PCWA 1KFXL 2L4IA 1BR4B 2F33A 3O78A 1K94A 2KFGA 4PALA 4AQIA 3UNWA 3D0YB 4QJ5B 1RTP1 3GK2A 4M2OA 2KAYA 4DCKA 2LAPA 1JFKA 3PJIA 2RGIA 3KF9A 2KGRA 2LLTA 3CLNA 4INWA 1CFFA 1H4BA 1TNPA 4OKHA 2KAXA 3GK1A 1G33A 2AUCA 2JT8A 3A4UB 3WXAA 1FI5A 1D1OA 2MLFC 1PVBA 3WHUB 1OZOA 2K8MB 3NHTA 3B6XA 1M63B 5G08A 2BL0B 5AXIA 2WORA 1BU3A 3BYAA 1CDMA 3BFHA 4YRUA 2VRGA 3DXLA 2MLEC 3TZ1A 1XFUO 1IQ3A 1ZOTB 3FWBA 1CLBA 4OCIA 5K89A 3CZ1A 3OBVA 1DF0B 3N7HA 1AP4A 2COLB 1SL7A 3PATA 1M39A 1K2HA 3VGOA 4GBAA 1KFUL 1S3PA 1R6PA 2JXCA 1YVLA 4MVFA 2EGDA 2JXLA 2BECA 2PSRA 3EK4A 1KSMA 1S1EA 3VB1A 1BODA 2JWWA 3F45A 2ZFDA 3IVTA 1PSBA 3EKJA 4JD9A 1A75A 1NX0A 2GGZA 4OV2A 1KK7Y 4CFRA 1CLMA 1RROA 1X02A 1Y0VH 1GGZA 1DJYA 2Y1MA 1NP8A 3BUOB 1SRAA 3EVUA 4MZKA 2BL0C 1CMGA 2Y5IA 1FPWA 3D75A 1EXRA 1Y6WA 4GAOA 4DS7A 2KQYA 1JC2A 1S6CA 1NX1A 1QLSA 5JOLA 4BY4A 1XYDA 2PQLA 1ORGA 5HLVA 1F4QA 4I5JA 5AANA 5KU1A 3WHTB 4YGBB 1M45A 4I5NB 3R1OA 2WNDA 2E30A 1A4PA 4ZCVA 4AOMA 1U5IA 2SASA 3D73A 1OOFA 2KQ6A 1SYMA 4PT1A 1IWQA 5CSFA 4UPGA 4FQTA 1B7TY 2WCHA 3FIAA 3BUMB 3I5FB 2EHBA 1B8CA 1CFPA 2PASA 1MHOA 4PDZA 1S6IA 1SR6C 3JVTB 5HKZA 3DVEA 3B88A 1OOHA 3SG7A 4KYNA 4CFQA 2K7CA 5JJGA 2KBIA 1Y1UA 2LVIA 5CPVA 2QDIA 2K7BA 3D74A 4WRIA 3S0GA 2LVJA 3RZSA 4C0KA 3D78A 4I5KA 2KLEA 2MHHA 1IRJA 1B7TZ 1CM4A 2WOSA 4N5XA 2KYCA 5CSIA 2LHLA 2FCEA 1A75B 1KCYA 1ODBA 2BE6A 2ZRSA 1Q80A 1PULA 2EC6C 3DF0A 1RWYA 2LUXA 1QIVA 3DZTA 2NCPA 4ORBB 3SS3A 1SKTA 2LM5A 4XYNA 4YBHB 4MSPA 5BPJA 1PALA 3OX6A 1KSOA 2EC6B 2M0RA 3BOWA 3NSLA 3UO9A 1J7OA 5FI2A 1KK8C 3L4LA 1SCMB 3H4SE 1B8LA 2K2AA 2OTGB 3BXKA 1CB1A 1ZFSA 3K1EA 1CFCA 2KDHA 3NHIA 5AERA 3HX4A 1LA0A 3FE6A 1K9PA 4GUKA 1OW4A 3I5GC 1CKKA 3SS5A 1J1EA 1C3ZA 5DKNA 2LP3A 5FYXA 2GTEA 4C0JA 1XFVO 2JU0A 2M9GA 1BMOA 2LMUA 1XFXO 1SL9A 1KQMC 1MQ1A 1TRFA 3QMEA 1TIZA 1ALWA 3SG5A 1OOIX 5D3OA 1TNXA 1J7PA 2GGMA 1EG3A 2BBMA 3VRNA 2QEOA 2WC6A 1EG4A 1UHKA 2Q91A 1YUUA 4JPZB 2BCBA 1SCMC 4USLA 4YGDB 1DMOA 1IJ6A 4ORAB 5DKRA 2WCEA 4MRYA
chains in the Genus database with same CATH topology
1TNQA 1FF1A 4MZJA 1DJHA 1LVCD 2L4HA 5AEQA 1GGWA 2ZNDA 1V1FA 2KYFA 2ZN8A 5HKWA 4MBEA 3GOFA 1LA3A 1G4YR 1DJZA 2SCPA 3CTNA 3PALA 5D69A 1QVIZ 5AFPA 2ZKMX 1XFWO 1AHRA 3LK0A 4U8DA 1EL4A 1UHJA 1QLKA 1N0YA 1NX3A 2KFFA 5CSNA 2MJWB 3EKHA 2Q4UA 4QJ3B 4PE1A 1SW8A 3EVVA 3VRRA 1YURA 1KFXS 2ZRTA 1YX8A 1DGUA 1L7ZA 3AKAA 3TDZA 4PE0A 1A29A 2HQWA 2NCOA 4A4BA 1GQMA 4NDBA 1NCYA 1AUIB 2LE9B 3TS5C 3IQQA 4FTGA 1K9UA 3SIBA 2KI6C 2NZ0A 2FOTA 1KWOB 1OMDA 2Y4QA 3SG2A 1XFZO 1K90D 1S6JA 2H2KA 3DD4A 1UP5A 3DVMA 3I5HB 3PM8A 4M2PA 4D1EA 1OE9B 1NUBA 3CS1A 3JTDB 1G8IA 4R1EA 1QX2A 3KO0A 1NPQA 3D0YA 1F8HA 5J3XA 3TUYB 2OS8B 1LXFC 2HQ8A 3PN7B 1QATA 1SR6B 1NSHA 4DRWA 2GV5A 4DUQA 2MA2A 1IKUA 1CFDA 1XK4C 2M7NA 4IL1A 4XJKB 2CCMA 2NLNA 4GFTA 3I5IC 4NQGA 1OMVA 2JTTA 3FS7A 1KQVA 1YX7A 3IF7A 1YTZC 4PHMA 2LLUA 1ZACA 2F3ZA 3CWGA 1HT9A 1JWDA 1WDCC 2LLSA 2KFHA 3BQ3A 3TS5B 3SG4A 1NYAA 1B47A 3PFVA 2KSPA 1S36A 1QXPA 3PN7C 5GQQC 3TUYC 1FBVA 2LV7A 2JNFA 2L51A 2LP2A 3TDIA 2M7LA 1SNLA 3AAKA 1W7JB 1KK7Z 2LVKA 2PALA 1N65A 1QV1A 4HRGA 4NDDA 4ZCUA 4BY5A 2JPTA 4AQJA 1YR5A 1KWOC 5F6TA 1E8AA 2LANA 2LVVA 1TCOB 3AKBA 1WRZA 1AJ5A 3LCPC 1A03A 1JUOA 3C1VA 2QPTA 1N2DA 5HLOA 2PRUA 2JOJA 3E3RA 2QACA 1TOPA 2KOTA 2LUCA 2L5XB 2OS8C 3MSEB 1RFJA 4CPVA 2ISDA 3CGAA 1H8BA 2MBXA 1UHIA 1XFYO 1IG5A 3SJSA 1V1GA 1TNWA 2HF5A 4YI9A 1EH2A 4TNCA 2TN4A 2WCBA 4L9MA 1NIWA 1WDCB 4ETOA 1S5GZ 1CDNA 4WQ2A 4QJ4B 4JWQA 1U5IB 1J1DA 5HYDA 1QV0A 2F8PA 3BUNB 5B8IB 3I5IB 1YRUB 2JT0A 1ZUZA 2BKHB 5HKYA 4MN0A 4P5OE 1K95A 1K8UA 4A4CA 2BKIB 1CDLA 2I18A 1MUXA 1PSRA 1WLMA 2BE4A 2F3YA 4N1GA 2I7AA 1FW4A 1DTLA 3CR4X 1DVIA 3CZTX 1UURA 1BOCA 3CR5X 3O2PA 4MRXA 2CT9A 1F55A 1C7WA 1OMRA 2WCFA 2DOQA 1KFUS 3HCMA 3PSRA 3EK7A 1OQPA 2M3WA 2G2BA 4I5LB 2JQ6A 2V53A 4PE4A 3EVRA 1WLZA 1HQVA 2AMIA 2K2FA 2KNEA 3DF0B 3RLZA 4M2QA 4CIDA 2LMVA 3FWCA 3SG6A 3WNXB 4YGAA 1DJXA 1DJWA 1QTXA 1CM1A 1YVHA 3I5GB 3OHMB 3O6BA 4GGFC 4GNKB 3AAJA 3LL8B 5DKQA 5I8NA 1JF2A 4GGNA 3ZWHA 2FCDA 5KSZA 4OR9B 4HSZA 3O4YA 2KHNA 4GPLB 1IJ5A 3IQOA 1BG1A 1JBAA 1PRWA 1SPYA 3VRPA 1DJGA 1UHHA 1B4CA 1YRTB 2I94A 1XA5A 1OZSA 2K7OA 1DT7B 2D8NA 1B1GA 1IGVA 3BUXB 2K7DA 2M1UA 4PE7A 1MWNA 1YUSA 2JULA 1S26D 1NWDA 1TN4A 3NXAA 5TNCA 1M31A 4YGEB 1BJFA 3NSKA 2H61A 1NX2A 2NXQA 3OP0A 3TDUA 1L2OC 1BF5A 2PVBA 1DJIA 4HRHA 1MF8B 3K21A 3M0WA 3NSIA 4NDCA 3KHEA 5IBWA 1C7VA 2M1KB 3D10A 2OPOA 1YUTA 4FQOA 1ZMZA 3A8RA 3GK4X 3NSOA 2M29A 2ZN9A 5PALA 4MLWA 1SL8A 1SCVA 2F2OA 5KTYA 2KI4C 1B8RA 2LNKA 1RJVA 1MXEA 4PHKA 1QJTA 1WRLA 2F2PA 1FI6A 1QS7A 2BCAA 1J55A 2KAVA 1AJ4A 3KEVA 5D7FA 2FJUB 1DGVA 1F70A 1BLQA 4N1FA 3BUWB 1BR1B 3EK8A 2OTGC 3VROA 2JNXA 1QASA 4C0LA 4ORCB 3JVTC 2HETA 1GJYA 3PLFB 3ZNIA 3JTDC 1IQ5A 1MXLC 3VRQA 3I5FC 1CDPA 2KBMA 3BOWB 1QVIY 4WQ3A 1CMFA 2CNPA 1NCXA 2HPSA 3KPXA 2LMTA 1ALVA 4YGCB 1W7IB 1XO5A 2H61C 2M8UA 2CTNA 1EJ3A 5ER4X 4MEWA 3SG3A 1AVSA 2M49B 3LK1A 4ICBA 1S5GY 3SIAA 1IH0A 2JZIA 4PHNA 2CXJA 1CLLA 1OSAA 1TTXA 1Y1AA 1SMGA 2LCPA 1F4OA 3LLEA 4CLNA 5I2QA 4YI8A 2KI6D 1UWOA 3QRXA 4E68A 2A4JA 1QX7A 1L2OB 2K61A 3DVJA 2LC5A 1CNPA 1KQMB 1VRKA 2K0JA 3RM1A 4OVNF 4XJKA 1J7RA 4MZLA 1LINA 1C07A 1Y1XA 1QIWA 1RK9A 4JQ0D 2BCXA 1R2UA 2P6BB 1WY9A 1PK0D 5CSJA 1LKJA 2M97A 1AK8A 2I2RE 1JSAA 1JF0A 5ER5A 1BT6A 2O60A 2G9BA 4GGFA 3OB2B 1K93D 1SY9A 2B1UA 1MR8A 4Q04A 2KGBC 2LHIA 1A2XA 2ZNEA 1XVJA 2JT3A 3ICBA 1TCFA 2O5GA 1F54A 1PVAA 4F0ZB 3CR2A 4PHJA 2PMYA 2JRFA 1F71A 2MRDA 1J7QA 2AAOA 4HREE 4DIRA 2L50A 1SK6D 5I2OA 1M46A 1QX5B 4P2YB 5G08A 2BBNA 2L2EA 2IS9A 1SBJA 2Y1NA 1XK4A 3DVKA 1DF0A 1UUSA 1OOJA 1CTRA 1K96A 1NCZA 2E6WA 3I5HC 2CBLA 2KI4B 2R2IA 1WRKA 2MAZA 2JC2A 3OX5A 5I2LA 1KK8B 3OB1B 1K9KA 1UHNA 2JTZA 1B9AA 1RECA 2L0PA 2L98A 1JFJA 2WC8A 4PCWA 1KFXL 2L4IA 1BR4B 2F33A 3O78A 1K94A 2KFGA 4PALA 4AQIA 3D0YB 4QJ5B 1RTP1 3GK2A 4M2OA 2KAYA 4DCKA 2LAPA 1JFKA 1CFFA 2RGIA 3KF9A 2KGRA 2LLTA 3CLNA 1H4BA 1TNPA 4OKHA 2KAXA 3GK1A 1G33A 2AUCA 2JT8A 3A4UB 3WXAA 1FI5A 1D1OA 2MLFC 1PVBA 3WHUB 1OZOA 2K8MB 1M63B 2BL0B 5AXIA 2WORA 1BU3A 3BYAA 1CDMA 4YRUA 2VRGA 2MLEC 3TZ1A 1XFUO 1IQ3A 1ZOTB 3FWBA 1CLBA 4OCIA 5K89A 1AP4A 1DF0B 2COLB 1SL7A 3PATA 1M39A 1K2HA 3VGOA 4GBAA 1KFUL 1S3PA 1R6PA 2JXCA 1YVLA 4MVFA 2EGDA 2JXLA 2BECA 2PSRA 3EK4A 1KSMA 1S1EA 1BODA 2JWWA 3F45A 2ZFDA 1PSBA 3EKJA 1A75A 1NX0A 2GGZA 4OV2A 1KK7Y 4CFRA 1CLMA 1RROA 1X02A 1Y0VH 1GGZA 1DJYA 2Y1MA 1NP8A 3BUOB 1SRAA 3EVUA 4MZKA 2BL0C 1CMGA 2Y5IA 1FPWA 1EXRA 1Y6WA 4GAOA 4DS7A 2KQYA 1JC2A 1S6CA 1NX1A 1QLSA 5JOLA 4BY4A 1XYDA 5HLVA 1F4QA 4I5JA 5AANA 5KU1A 3WHTB 4YGBB 1M45A 4I5NB 2WNDA 2E30A 1A4PA 4ZCVA 4AOMA 1U5IA 2SASA 2KQ6A 1SYMA 5CSFA 1IWQA 4UPGA 1B7TY 3FIAA 3BUMB 3I5FB 2EHBA 1B8CA 1CFPA 2PASA 1MHOA 4PDZA 1S6IA 1SR6C 3JVTB 5HKZA 3DVEA 3SG7A 4CFQA 2K7CA 5JJGA 2KBIA 1Y1UA 2LVIA 5CPVA 2K7BA 4WRIA 2LVJA 4C0KA 4I5KA 2MHHA 1IRJA 1B7TZ 1CM4A 2WOSA 4N5XA 2KYCA 5CSIA 2LHLA 2FCEA 1A75B 1KCYA 1ODBA 2BE6A 2ZRSA 1Q80A 1PULA 2EC6C 3DF0A 1RWYA 2LUXA 1QIVA 2NCPA 4ORBB 1SKTA 2LM5A 4XYNA 4YBHB 4MSPA 5BPJA 1PALA 3OX6A 1KSOA 2EC6B 2M0RA 3BOWA 3NSLA 1J7OA 1KK8C 1SCMB 3H4SE 1B8LA 2K2AA 2OTGB 3BXKA 1CB1A 1ZFSA 1CFCA 2KDHA 5AERA 3HX4A 1LA0A 4GUKA 1K9PA 3I5GC 1CKKA 1J1EA 5DKNA 2LP3A 5FYXA 4C0JA 1XFVO 2JU0A 2M9GA 1BMOA 2LMUA 1XFXO 1SL9A 1KQMC 1MQ1A 1TRFA 1TIZA 1ALWA 3SG5A 1TNXA 1J7PA 2GGMA 1EG3A 2BBMA 3VRNA 1EG4A 1UHKA 2Q91A 1YUUA 4JPZB 2BCBA 1SCMC 4USLA 4YGDB 1DMOA 1IJ6A 4ORAB 5DKRA 2WCEA 4MRYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TNQ A;  1FF1 A;  4MZJ A;  1DJH A;  1LVC D;  2L4H A;  5AEQ A;  1GGW A;  2ZND A;  1V1F A;  2KYF A;  2ZN8 A;  5HKW A;  4MBE A;  3GOF A;  1LA3 A;  1G4Y R;  1DJZ A;  2SCP A;  3CTN A;  3PAL A;  5D69 A;  1QVI Z;  5AFP A;  2ZKM X;  1XFW O;  1AHR A;  3LK0 A;  4U8D A;  1EL4 A;  1UHJ A;  1QLK A;  1N0Y A;  1NX3 A;  2KFF A;  5CSN A;  2MJW B;  3EKH A;  2Q4U A;  4QJ3 B;  4PE1 A;  1SW8 A;  3EVV A;  3VRR A;  1YUR A;  1KFX S;  2ZRT A;  1YX8 A;  1DGU A;  1L7Z A;  3AKA A;  3TDZ A;  4PE0 A;  1A29 A;  2HQW A;  2NCO A;  4A4B A;  1GQM A;  4NDB A;  1NCY A;  1AUI B;  2LE9 B;  3TS5 C;  3IQQ A;  4FTG A;  1K9U A;  3SIB A;  2KI6 C;  2NZ0 A;  2FOT A;  1KWO B;  1OMD A;  2Y4Q A;  3SG2 A;  1XFZ O;  1K90 D;  1S6J A;  2H2K A;  3DD4 A;  1UP5 A;  3DVM A;  3I5H B;  3PM8 A;  4M2P A;  4D1E A;  1OE9 B;  1NUB A;  3CS1 A;  3JTD B;  1G8I A;  4R1E A;  1QX2 A;  3KO0 A;  1NPQ A;  3D0Y A;  1F8H A;  5J3X A;  3TUY B;  2OS8 B;  1LXF C;  2HQ8 A;  3PN7 B;  1QAT A;  1SR6 B;  1NSH A;  4DRW A;  2GV5 A;  4DUQ A;  2MA2 A;  1IKU A;  1CFD A;  1XK4 C;  2M7N A;  4IL1 A;  4XJK B;  2CCM A;  2NLN A;  4GFT A;  3I5I C;  4NQG A;  1OMV A;  2JTT A;  3FS7 A;  1KQV A;  1YX7 A;  3IF7 A;  1YTZ C;  4PHM A;  2LLU A;  1ZAC A;  2F3Z A;  3CWG A;  1HT9 A;  1JWD A;  1WDC C;  2LLS A;  2KFH A;  3BQ3 A;  3TS5 B;  3SG4 A;  1NYA A;  1B47 A;  3PFV A;  2KSP A;  1S36 A;  1QXP A;  3PN7 C;  5GQQ C;  3TUY C;  1FBV A;  2LV7 A;  2JNF A;  2L51 A;  2LP2 A;  3TDI A;  2M7L A;  1SNL A;  3AAK A;  1W7J B;  1KK7 Z;  2LVK A;  2PAL A;  1N65 A;  1QV1 A;  4HRG A;  4NDD A;  4ZCU A;  4BY5 A;  2JPT A;  4AQJ A;  1YR5 A;  1KWO C;  5F6T A;  1E8A A;  2LAN A;  2LVV A;  1TCO B;  3AKB A;  1WRZ A;  1AJ5 A;  3LCP C;  1A03 A;  1JUO A;  3C1V A;  2QPT A;  1N2D A;  5HLO A;  2PRU A;  2JOJ A;  3E3R A;  2QAC A;  1TOP A;  2KOT A;  2LUC A;  2L5X B;  2OS8 C;  3MSE B;  1RFJ A;  4CPV A;  2ISD A;  3CGA A;  1H8B A;  2MBX A;  1UHI A;  1XFY O;  1IG5 A;  3SJS A;  1V1G A;  1TNW A;  2HF5 A;  4YI9 A;  1EH2 A;  4TNC A;  2TN4 A;  2WCB A;  4L9M A;  1NIW A;  1WDC B;  4ETO A;  1S5G Z;  1CDN A;  4WQ2 A;  4QJ4 B;  4JWQ A;  1U5I B;  1J1D A;  5HYD A;  1QV0 A;  2F8P A;  3BUN B;  5B8I B;  3I5I B;  1YRU B;  2JT0 A;  1ZUZ A;  2BKH B;  5HKY A;  4MN0 A;  4P5O E;  1K95 A;  1K8U A;  4A4C A;  2BKI B;  1CDL A;  2I18 A;  1MUX A;  1PSR A;  1WLM A;  2BE4 A;  2F3Y A;  4N1G A;  2I7A A;  1FW4 A;  1DTL A;  3CR4 X;  1DVI A;  3CZT X;  1UUR A;  1BOC A;  3CR5 X;  3O2P A;  4MRX A;  2CT9 A;  1F55 A;  1C7W A;  1OMR A;  2WCF A;  2DOQ A;  1KFU S;  3HCM A;  3PSR A;  3EK7 A;  1OQP A;  2M3W A;  2G2B A;  4I5L B;  2JQ6 A;  2V53 A;  4PE4 A;  3EVR A;  1WLZ A;  1HQV A;  2AMI A;  2K2F A;  2KNE A;  3DF0 B;  3RLZ A;  4M2Q A;  4CID A;  2LMV A;  3FWC A;  3SG6 A;  3WNX B;  4YGA A;  1DJX A;  1DJW A;  1QTX A;  1CM1 A;  1YVH A;  3I5G B;  3OHM B;  3O6B A;  4GGF C;  4GNK B;  3AAJ A;  3LL8 B;  5DKQ A;  5I8N A;  1JF2 A;  4GGN A;  3ZWH A;  2FCD A;  5KSZ A;  4OR9 B;  4HSZ A;  3O4Y A;  2KHN A;  4GPL B;  1IJ5 A;  3IQO A;  1BG1 A;  1JBA A;  1PRW A;  1SPY A;  3VRP A;  1DJG A;  1UHH A;  1B4C A;  1YRT B;  2I94 A;  1XA5 A;  1OZS A;  2K7O A;  1DT7 B;  2D8N A;  1B1G A;  1IGV A;  3BUX B;  2K7D A;  2M1U A;  4PE7 A;  1MWN A;  1YUS A;  2JUL A;  1S26 D;  1NWD A;  1TN4 A;  3NXA A;  5TNC A;  1M31 A;  4YGE B;  1BJF A;  3NSK A;  2H61 A;  1NX2 A;  2NXQ A;  3OP0 A;  3TDU A;  1L2O C;  1BF5 A;  2PVB A;  1DJI A;  4HRH A;  1MF8 B;  3K21 A;  3M0W A;  3NSI A;  4NDC A;  3KHE A;  5IBW A;  1C7V A;  2M1K B;  3D10 A;  2OPO A;  1YUT A;  4FQO A;  1ZMZ A;  3A8R A;  3GK4 X;  3NSO A;  2M29 A;  2ZN9 A;  5PAL A;  4MLW A;  1SL8 A;  1SCV A;  2F2O A;  5KTY A;  2KI4 C;  1B8R A;  2LNK A;  1RJV A;  1MXE A;  4PHK A;  1QJT A;  1WRL A;  2F2P A;  1FI6 A;  1QS7 A;  2BCA A;  1J55 A;  2KAV A;  1AJ4 A;  3KEV A;  5D7F A;  2FJU B;  1DGV A;  1F70 A;  1BLQ A;  4N1F A;  3BUW B;  1BR1 B;  3EK8 A;  2OTG C;  3VRO A;  2JNX A;  1QAS A;  4C0L A;  4ORC B;  3JVT C;  2HET A;  1GJY A;  3PLF B;  3ZNI A;  3JTD C;  1IQ5 A;  1MXL C;  3VRQ A;  3I5F C;  1CDP A;  2KBM A;  3BOW B;  1QVI Y;  4WQ3 A;  1CMF A;  2CNP A;  1NCX A;  2HPS A;  3KPX A;  2LMT A;  1ALV A;  4YGC B;  1W7I B;  1XO5 A;  2H61 C;  2M8U A;  2CTN A;  1EJ3 A;  5ER4 X;  4MEW A;  3SG3 A;  1AVS A;  2M49 B;  3LK1 A;  4ICB A;  1S5G Y;  3SIA A;  1IH0 A;  2JZI A;  4PHN A;  2CXJ A;  1CLL A;  1OSA A;  1TTX A;  1Y1A A;  1SMG A;  2LCP A;  1F4O A;  3LLE A;  4CLN A;  5I2Q A;  4YI8 A;  2KI6 D;  1UWO A;  3QRX A;  4E68 A;  2A4J A;  1QX7 A;  1L2O B;  2K61 A;  3DVJ A;  2LC5 A;  1CNP A;  1KQM B;  1VRK A;  2K0J A;  3RM1 A;  4OVN F;  4XJK A;  1J7R A;  4MZL A;  1LIN A;  1C07 A;  1Y1X A;  1QIW A;  1RK9 A;  4JQ0 D;  2BCX A;  1R2U A;  2P6B B;  1WY9 A;  1PK0 D;  5CSJ A;  1LKJ A;  2M97 A;  1AK8 A;  2I2R E;  1JSA A;  1JF0 A;  5ER5 A;  1BT6 A;  2O60 A;  2G9B A;  4GGF A;  3OB2 B;  1K93 D;  1SY9 A;  2B1U A;  1MR8 A;  4Q04 A;  2KGB C;  2LHI A;  1A2X A;  2ZNE A;  1XVJ A;  2JT3 A;  3ICB A;  1TCF A;  2O5G A;  1F54 A;  1PVA A;  4F0Z B;  3CR2 A;  4PHJ A;  2PMY A;  2JRF A;  1F71 A;  2MRD A;  1J7Q A;  2AAO A;  4HRE E;  4DIR A;  2L50 A;  1SK6 D;  5I2O A;  1M46 A;  1QX5 B;  4P2Y B;  5G08 A;  2BBN A;  2L2E A;  2IS9 A;  1SBJ A;  2Y1N A;  1XK4 A;  3DVK A;  1DF0 A;  1UUS A;  1OOJ A;  1CTR A;  1K96 A;  1NCZ A;  2E6W A;  3I5H C;  2CBL A;  2KI4 B;  2R2I A;  1WRK A;  2MAZ A;  2JC2 A;  3OX5 A;  5I2L A;  1KK8 B;  3OB1 B;  1K9K A;  1UHN A;  2JTZ A;  1B9A A;  1REC A;  2L0P A;  2L98 A;  1JFJ A;  2WC8 A;  4PCW A;  1KFX L;  2L4I A;  1BR4 B;  2F33 A;  3O78 A;  1K94 A;  2KFG A;  4PAL A;  4AQI A;  3D0Y B;  4QJ5 B;  1RTP 1;  3GK2 A;  4M2O A;  2KAY A;  4DCK A;  2LAP A;  1JFK A;  1CFF A;  2RGI A;  3KF9 A;  2KGR A;  2LLT A;  3CLN A;  1H4B A;  1TNP A;  4OKH A;  2KAX A;  3GK1 A;  1G33 A;  2AUC A;  2JT8 A;  3A4U B;  3WXA A;  1FI5 A;  1D1O A;  2MLF C;  1PVB A;  3WHU B;  1OZO A;  2K8M B;  1M63 B;  2BL0 B;  5AXI A;  2WOR A;  1BU3 A;  3BYA A;  1CDM A;  4YRU A;  2VRG A;  2MLE C;  3TZ1 A;  1XFU O;  1IQ3 A;  1ZOT B;  3FWB A;  1CLB A;  4OCI A;  5K89 A;  1AP4 A;  1DF0 B;  2COL B;  1SL7 A;  3PAT A;  1M39 A;  1K2H A;  3VGO A;  4GBA A;  1KFU L;  1S3P A;  1R6P A;  2JXC A;  1YVL A;  4MVF A;  2EGD A;  2JXL A;  2BEC A;  2PSR A;  3EK4 A;  1KSM A;  1S1E A;  1BOD A;  2JWW A;  3F45 A;  2ZFD A;  1PSB A;  3EKJ A;  1A75 A;  1NX0 A;  2GGZ A;  4OV2 A;  1KK7 Y;  4CFR A;  1CLM A;  1RRO A;  1X02 A;  1Y0V H;  1GGZ A;  1DJY A;  2Y1M A;  1NP8 A;  3BUO B;  1SRA A;  3EVU A;  4MZK A;  2BL0 C;  1CMG A;  2Y5I A;  1FPW A;  1EXR A;  1Y6W A;  4GAO A;  4DS7 A;  2KQY A;  1JC2 A;  1S6C A;  1NX1 A;  1QLS A;  5JOL A;  4BY4 A;  1XYD A;  5HLV A;  1F4Q A;  4I5J A;  5AAN A;  5KU1 A;  3WHT B;  4YGB B;  1M45 A;  4I5N B;  2WND A;  2E30 A;  1A4P A;  4ZCV A;  4AOM A;  1U5I A;  2SAS A;  2KQ6 A;  1SYM A;  5CSF A;  1IWQ A;  4UPG A;  1B7T Y;  3FIA A;  3BUM B;  3I5F B;  2EHB A;  1B8C A;  1CFP A;  2PAS A;  1MHO A;  4PDZ A;  1S6I A;  1SR6 C;  3JVT B;  5HKZ A;  3DVE A;  3SG7 A;  4CFQ A;  2K7C A;  5JJG A;  2KBI A;  1Y1U A;  2LVI A;  5CPV A;  2K7B A;  4WRI A;  2LVJ A;  4C0K A;  4I5K A;  2MHH A;  1IRJ A;  1B7T Z;  1CM4 A;  2WOS A;  4N5X A;  2KYC A;  5CSI A;  2LHL A;  2FCE A;  1A75 B;  1KCY A;  1ODB A;  2BE6 A;  2ZRS A;  1Q80 A;  1PUL A;  2EC6 C;  3DF0 A;  1RWY A;  2LUX A;  1QIV A;  2NCP A;  4ORB B;  1SKT A;  2LM5 A;  4XYN A;  4YBH B;  4MSP A;  5BPJ A;  1PAL A;  3OX6 A;  1KSO A;  2EC6 B;  2M0R A;  3BOW A;  3NSL A;  1J7O A;  1KK8 C;  1SCM B;  3H4S E;  1B8L A;  2K2A A;  2OTG B;  3BXK A;  1CB1 A;  1ZFS A;  1CFC A;  2KDH A;  5AER A;  3HX4 A;  1LA0 A;  4GUK A;  1K9P A;  3I5G C;  1CKK A;  1J1E A;  5DKN A;  2LP3 A;  5FYX A;  4C0J A;  1XFV O;  2JU0 A;  2M9G A;  1BMO A;  2LMU A;  1XFX O;  1SL9 A;  1KQM C;  1MQ1 A;  1TRF A;  1TIZ A;  1ALW A;  3SG5 A;  1TNX A;  1J7P A;  2GGM A;  1EG3 A;  2BBM A;  3VRN A;  1EG4 A;  1UHK A;  2Q91 A;  1YUU A;  4JPZ B;  2BCB A;  1SCM C;  4USL A;  4YGD B;  1DMO A;  1IJ6 A;  4ORA B;  5DKR A;  2WCE A;  4MRY A; 
#chains in the Genus database with same CATH topology
 1TNQ A;  1FF1 A;  3PM2 A;  1DJH A;  1LVC D;  2L4H A;  4MZJ A;  5AEQ A;  1GGW A;  2ZND A;  1V1F A;  2KYF A;  2ZN8 A;  5HKW A;  4MBE A;  3GOF A;  1LA3 A;  1G4Y R;  1DJZ A;  2SCP A;  3CTN A;  3PAL A;  5D69 A;  1QVI Z;  5AFP A;  2ZKM X;  1XFW O;  1AHR A;  3LK0 A;  4U8D A;  1EL4 A;  1TUJ A;  1UHJ A;  1QLK A;  1N0Y A;  1NX3 A;  2KFF A;  5CSN A;  2MJW B;  3EKH A;  2Q4U A;  3FE8 A;  4PE1 A;  1SW8 A;  3EVV A;  4QJ3 B;  2KPH A;  3VRR A;  3DY9 A;  1YUR A;  1KFX S;  2ZRT A;  1YX8 A;  1DGU A;  1LS8 A;  1L7Z A;  3AKA A;  3TDZ A;  4PE0 A;  1A29 A;  2HQW A;  2NCO A;  4A4B A;  1GQM A;  4NDB A;  1NCY A;  1AUI B;  2LE9 B;  3S0D A;  3TS5 C;  3IQQ A;  4FTG A;  5FI6 A;  1K9U A;  3SIB A;  2KI6 C;  2NZ0 A;  2FOT A;  2L5Y A;  1KWO B;  1OMD A;  2Y4Q A;  2WC5 A;  3SG2 A;  1XFZ O;  1K90 D;  1S6J A;  2H2K A;  3CYZ A;  1UP5 A;  3DD4 A;  3DVM A;  3I5H B;  3PM8 A;  4M2P A;  1OE9 B;  4D1E A;  1NUB A;  3CS1 A;  3JTD B;  1G8I A;  4R1E A;  1DEL A;  1QX2 A;  3KO0 A;  1NPQ A;  3D0Y A;  1F8H A;  5J3X A;  5DIC A;  3TUY B;  2OS8 B;  1LXF C;  2HQ8 A;  3PN7 B;  1QAT A;  1SR6 B;  1NSH A;  2PYQ A;  4DRW A;  2GV5 A;  4DUQ A;  2MA2 A;  1IKU A;  1CFD A;  1XK4 C;  2M7N A;  4IL1 A;  4XJK B;  2CCM A;  2NLN A;  1OOG A;  4GFT A;  3I5I C;  4NQG A;  1OMV A;  2JTT A;  3FS7 A;  1KQV A;  1YX7 A;  3IF7 A;  1YTZ C;  2P71 A;  4PHM A;  2LLU A;  1ZAC A;  2F3Z A;  3CWG A;  1HT9 A;  1JWD A;  1WDC C;  2LLS A;  2KFH A;  3BQ3 A;  3TS5 B;  3SG4 A;  1NYA A;  1B47 A;  3PFV A;  2KSP A;  1S36 A;  1QXP A;  3PN7 C;  5GQQ C;  2FJY A;  3TUY C;  1FBV A;  2LV7 A;  2JNF A;  2L51 A;  2LP2 A;  2BNX A;  1T14 A;  2M7L A;  3TDI A;  1SNL A;  3AAK A;  1W7J B;  2K60 A;  1KK7 Z;  2LVK A;  2PAL A;  1N65 A;  1QV1 A;  4HRG A;  4NDD A;  4ZCU A;  4BY5 A;  2JPT A;  4AQJ A;  1YR5 A;  1DQE A;  1KWO C;  5F6T A;  1E8A A;  2LAN A;  2LVV A;  2ERB A;  1TCO B;  3O4X A;  3AKB A;  1WRZ A;  1AJ5 A;  3LCP C;  1A03 A;  3EG5 B;  1JUO A;  2WCK A;  2WCM A;  3C1V A;  2QPT A;  1N2D A;  5HLO A;  2PRU A;  2JOJ A;  3CAB A;  3E3R A;  2QAC A;  1SSE B;  1TOP A;  2KOT A;  2LUC A;  2L5X B;  3DYE A;  2OS8 C;  3MSE B;  1RFJ A;  4CPV A;  2ISD A;  3CGA A;  1H8B A;  2MBX A;  1UHI A;  1XFY O;  1IG5 A;  3SJS A;  1QWV A;  1V1G A;  1TNW A;  2HF5 A;  1DC1 A;  4YI9 A;  1EH2 A;  4TNC A;  2TN4 A;  2WCB A;  4L9M A;  1NIW A;  1WDC B;  4ETO A;  1S5G Z;  1CDN A;  4WQ2 A;  4QJ4 B;  4JWQ A;  1U5I B;  1J1D A;  5HYD A;  1QV0 A;  2F8P A;  3BUN B;  5B8I B;  3R1V A;  3I5I B;  1YRU B;  2JT0 A;  1ZUZ A;  2BKH B;  5HKY A;  4MN0 A;  4P5O E;  2YGU A;  1K95 A;  1K8U A;  4A4C A;  2BKI B;  4F7F A;  1CDL A;  2I18 A;  1MUX A;  1PSR A;  1WLM A;  3D76 A;  2BE4 A;  2F3Y A;  4N1G A;  2I7A A;  1FW4 A;  2WCJ A;  1DTL A;  3CR4 X;  1DVI A;  3CZT X;  1UUR A;  1BOC A;  3CR5 X;  3O2P A;  4MRX A;  2CT9 A;  3L4A A;  1F55 A;  2QEV A;  1C7W A;  1OMR A;  2WCF A;  2DOQ A;  1KFU S;  3HCM A;  3PSR A;  3S0B A;  3EK7 A;  1OQP A;  2M3W A;  2G2B A;  4I5L B;  1W9Z A;  2JQ6 A;  2V53 A;  4PE4 A;  3EVR A;  1WLZ A;  1GM0 A;  1HQV A;  2AMI A;  2K2F A;  2KNE A;  3DF0 B;  3RLZ A;  4M2Q A;  4CID A;  2LMV A;  3FWC A;  3SG6 A;  5EL2 A;  4YGA A;  3WNX B;  1DJX A;  1DJW A;  1QTX A;  1CM1 A;  3R1P A;  1YVH A;  3I5G B;  3OHM B;  3O6B A;  4GGF C;  4GNK B;  3AAJ A;  3LL8 B;  5DKQ A;  5I8N A;  1JF2 A;  4GGN A;  3ZWH A;  5I94 A;  3S0F A;  2FCD A;  5KSZ A;  4OR9 B;  4HSZ A;  3O4Y A;  2KHN A;  4GPL B;  1IJ5 A;  3IQO A;  1BG1 A;  1JBA A;  1PRW A;  1SPY A;  3VRP A;  1DJG A;  1UHH A;  2JPO A;  1B4C A;  1YRT B;  2I94 A;  2QEB A;  1XA5 A;  1C3Y A;  1OZS A;  2K7O A;  1DT7 B;  3R72 A;  2D8N A;  1B1G A;  1IGV A;  3BUX B;  2K7D A;  2M1U A;  4PE7 A;  1MWN A;  1YUS A;  2JUL A;  5HL1 A;  1S26 D;  1NWD A;  1TN4 A;  3NXA A;  5TNC A;  1M31 A;  4YGE B;  1BJF A;  3NSK A;  2H61 A;  1NX2 A;  2NXQ A;  1TWO A;  3OP0 A;  3TDU A;  1L2O C;  1BF5 A;  2PVB A;  1DJI A;  4HRH A;  4JKT A;  1MF8 B;  3K21 A;  3M0W A;  3NGV A;  3NSI A;  4NDC A;  3KHE A;  5IBW A;  1C7V A;  2M1K B;  3D10 A;  2OPO A;  1YUT A;  4FQO A;  1ZMZ A;  3A8R A;  3GK4 X;  3NSO A;  2M29 A;  4IJ7 A;  3S0E A;  2ZN9 A;  5PAL A;  4MLW A;  1SL8 A;  1SCV A;  5FI7 A;  2F2O A;  5KTY A;  2KI4 C;  4INX A;  1B8R A;  1TUZ A;  1RJV A;  1MXE A;  2LNK A;  4PHK A;  1QJT A;  1WRL A;  2F2P A;  3BJH A;  1FI6 A;  1QS7 A;  2BCA A;  1J55 A;  2KAV A;  1AJ4 A;  1XFR A;  3KEV A;  5D7F A;  2FJU B;  1DGV A;  1F70 A;  1BLQ A;  4N1F A;  3BUW B;  1BR1 B;  3L47 A;  2BAP A;  2OTG C;  3EK8 A;  2JNX A;  1QAS A;  3VRO A;  4C0L A;  4ORC B;  3JVT C;  2HET A;  1GJY A;  3BFA A;  3PLF B;  3ZNI A;  3JTD C;  1IQ5 A;  1MXL C;  1Z2C B;  3VRQ A;  3I5F C;  1CDP A;  2KBM A;  3BOW B;  1QVI Y;  4WQ3 A;  1CMF A;  2CNP A;  1NCX A;  2HPS A;  3KPX A;  2LMT A;  1ALV A;  4YGC B;  1W7I B;  1XO5 A;  2H61 C;  2M8U A;  2CTN A;  3CZ2 A;  1EJ3 A;  5ER4 X;  4MEW A;  3SG3 A;  1AVS A;  2M49 B;  3LK1 A;  1Z4H A;  4ICB A;  1S5G Y;  2P70 A;  3SIA A;  1IH0 A;  2JZI A;  4PHN A;  2CXJ A;  1CLL A;  1OSA A;  1TTX A;  1Y1A A;  1SMG A;  2LCP A;  1F4O A;  2QEH A;  3LLE A;  3V2L A;  4CLN A;  5I2Q A;  4YI8 A;  2KI6 D;  3S0A A;  1UWO A;  3QRX A;  4E68 A;  2A4J A;  1QX7 A;  1L2O B;  2K61 A;  3DVJ A;  2LC5 A;  1CNP A;  1KQM B;  1VRK A;  2K0J A;  3CZ0 A;  3RM1 A;  4OVN F;  4XJK A;  1J7R A;  4MZL A;  1LIN A;  1C07 A;  1Y1X A;  1QIW A;  1RK9 A;  4JQ0 D;  4OZD A;  1DEK A;  2BCX A;  1R2U A;  2P6B B;  1WY9 A;  1PK0 D;  5CSJ A;  1LKJ A;  2M97 A;  1AK8 A;  2I2R E;  1JSA A;  1JF0 A;  5ER5 A;  1BT6 A;  2O60 A;  2G9B A;  4GGF A;  3OB2 B;  1K93 D;  1SY9 A;  2B1U A;  2H8V A;  1MR8 A;  4Q04 A;  2KGB C;  2LHI A;  1A2X A;  3D77 A;  3FE9 A;  2ZNE A;  1XVJ A;  2JT3 A;  3ICB A;  2WCL A;  1TCF A;  2O5G A;  3OGN A;  1F54 A;  1PVA A;  1IIO A;  3Q8I A;  3CR2 A;  4PHJ A;  4F0Z B;  2PMY A;  2JRF A;  1F71 A;  2MRD A;  1J7Q A;  3B87 A;  2AAO A;  4HRE E;  4DIR A;  2L50 A;  1SK6 D;  5I2O A;  1M46 A;  3BFB A;  1QX5 B;  4P2Y B;  2L2C A;  1P28 A;  2BBN A;  2KLD A;  2L2E A;  3B86 A;  2IS9 A;  3CDN A;  1SBJ A;  2Y1N A;  3B7A A;  1XK4 A;  3SS4 A;  3DVK A;  1DF0 A;  1UUS A;  1OOJ A;  1CTR A;  1K96 A;  1NCZ A;  2E6W A;  3I5H C;  2CBL A;  2KI4 B;  2R2I A;  1WRK A;  2MAZ A;  2JC2 A;  3OX5 A;  5I2L A;  1KK8 B;  3OB1 B;  1K9K A;  1UHN A;  2JTZ A;  1B9A A;  1REC A;  2L0P A;  2L98 A;  1JFJ A;  2WC8 A;  4PCW A;  1KFX L;  2L4I A;  1BR4 B;  2F33 A;  3O78 A;  1K94 A;  2KFG A;  4PAL A;  4AQI A;  3UNW A;  3D0Y B;  4QJ5 B;  1RTP 1;  3GK2 A;  4M2O A;  2KAY A;  4DCK A;  2LAP A;  1JFK A;  3PJI A;  2RGI A;  3KF9 A;  2KGR A;  2LLT A;  3CLN A;  4INW A;  1CFF A;  1H4B A;  1TNP A;  4OKH A;  2KAX A;  3GK1 A;  1G33 A;  2AUC A;  2JT8 A;  3A4U B;  3WXA A;  1FI5 A;  1D1O A;  2MLF C;  1PVB A;  3WHU B;  1OZO A;  2K8M B;  3NHT A;  3B6X A;  1M63 B;  5G08 A;  2BL0 B;  5AXI A;  2WOR A;  1BU3 A;  3BYA A;  1CDM A;  3BFH A;  4YRU A;  2VRG A;  3DXL A;  2MLE C;  3TZ1 A;  1XFU O;  1IQ3 A;  1ZOT B;  3FWB A;  1CLB A;  4OCI A;  5K89 A;  3CZ1 A;  3OBV A;  1DF0 B;  3N7H A;  1AP4 A;  2COL B;  1SL7 A;  3PAT A;  1M39 A;  1K2H A;  3VGO A;  4GBA A;  1KFU L;  1S3P A;  1R6P A;  2JXC A;  1YVL A;  4MVF A;  2EGD A;  2JXL A;  2BEC A;  2PSR A;  3EK4 A;  1KSM A;  1S1E A;  3VB1 A;  1BOD A;  2JWW A;  3F45 A;  2ZFD A;  3IVT A;  1PSB A;  3EKJ A;  4JD9 A;  1A75 A;  1NX0 A;  2GGZ A;  4OV2 A;  1KK7 Y;  4CFR A;  1CLM A;  1RRO A;  1X02 A;  1Y0V H;  1GGZ A;  1DJY A;  2Y1M A;  1NP8 A;  3BUO B;  1SRA A;  3EVU A;  4MZK A;  2BL0 C;  1CMG A;  2Y5I A;  1FPW A;  3D75 A;  1EXR A;  1Y6W A;  4GAO A;  4DS7 A;  2KQY A;  1JC2 A;  1S6C A;  1NX1 A;  1QLS A;  5JOL A;  4BY4 A;  1XYD A;  2PQL A;  1ORG A;  5HLV A;  1F4Q A;  4I5J A;  5AAN A;  5KU1 A;  3WHT B;  4YGB B;  1M45 A;  4I5N B;  3R1O A;  2WND A;  2E30 A;  1A4P A;  4ZCV A;  4AOM A;  1U5I A;  2SAS A;  3D73 A;  1OOF A;  2KQ6 A;  1SYM A;  4PT1 A;  1IWQ A;  5CSF A;  4UPG A;  4FQT A;  1B7T Y;  2WCH A;  3FIA A;  3BUM B;  3I5F B;  2EHB A;  1B8C A;  1CFP A;  2PAS A;  1MHO A;  4PDZ A;  1S6I A;  1SR6 C;  3JVT B;  5HKZ A;  3DVE A;  3B88 A;  1OOH A;  3SG7 A;  4KYN A;  4CFQ A;  2K7C A;  5JJG A;  2KBI A;  1Y1U A;  2LVI A;  5CPV A;  2QDI A;  2K7B A;  3D74 A;  4WRI A;  3S0G A;  2LVJ A;  3RZS A;  4C0K A;  3D78 A;  4I5K A;  2KLE A;  2MHH A;  1IRJ A;  1B7T Z;  1CM4 A;  2WOS A;  4N5X A;  2KYC A;  5CSI A;  2LHL A;  2FCE A;  1A75 B;  1KCY A;  1ODB A;  2BE6 A;  2ZRS A;  1Q80 A;  1PUL A;  2EC6 C;  3DF0 A;  1RWY A;  2LUX A;  1QIV A;  3DZT A;  2NCP A;  4ORB B;  3SS3 A;  1SKT A;  2LM5 A;  4XYN A;  4YBH B;  4MSP A;  5BPJ A;  1PAL A;  3OX6 A;  1KSO A;  2EC6 B;  2M0R A;  3BOW A;  3NSL A;  3UO9 A;  1J7O A;  5FI2 A;  1KK8 C;  3L4L A;  1SCM B;  3H4S E;  1B8L A;  2K2A A;  2OTG B;  3BXK A;  1CB1 A;  1ZFS A;  3K1E A;  1CFC A;  2KDH A;  3NHI A;  5AER A;  3HX4 A;  1LA0 A;  3FE6 A;  1K9P A;  4GUK A;  1OW4 A;  3I5G C;  1CKK A;  3SS5 A;  1J1E A;  1C3Z A;  5DKN A;  2LP3 A;  5FYX A;  2GTE A;  4C0J A;  1XFV O;  2JU0 A;  2M9G A;  1BMO A;  2LMU A;  1XFX O;  1SL9 A;  1KQM C;  1MQ1 A;  1TRF A;  3QME A;  1TIZ A;  1ALW A;  3SG5 A;  1OOI X;  5D3O A;  1TNX A;  1J7P A;  2GGM A;  1EG3 A;  2BBM A;  3VRN A;  2QEO A;  2WC6 A;  1EG4 A;  1UHK A;  2Q91 A;  1YUU A;  4JPZ B;  2BCB A;  1SCM C;  4USL A;  4YGD B;  1DMO A;  1IJ6 A;  4ORA B;  5DKR A;  2WCE A;  4MRY A; 
#chains in the Genus database with same CATH homology
 1TNQ A;  1FF1 A;  4MZJ A;  1DJH A;  1LVC D;  2L4H A;  5AEQ A;  1GGW A;  2ZND A;  1V1F A;  2KYF A;  2ZN8 A;  5HKW A;  4MBE A;  3GOF A;  1LA3 A;  1G4Y R;  1DJZ A;  2SCP A;  3CTN A;  3PAL A;  5D69 A;  1QVI Z;  5AFP A;  2ZKM X;  1XFW O;  1AHR A;  3LK0 A;  4U8D A;  1EL4 A;  1UHJ A;  1QLK A;  1N0Y A;  1NX3 A;  2KFF A;  5CSN A;  2MJW B;  3EKH A;  2Q4U A;  4QJ3 B;  4PE1 A;  1SW8 A;  3EVV A;  3VRR A;  1YUR A;  1KFX S;  2ZRT A;  1YX8 A;  1DGU A;  1L7Z A;  3AKA A;  3TDZ A;  4PE0 A;  1A29 A;  2HQW A;  2NCO A;  4A4B A;  1GQM A;  4NDB A;  1NCY A;  1AUI B;  2LE9 B;  3TS5 C;  3IQQ A;  4FTG A;  1K9U A;  3SIB A;  2KI6 C;  2NZ0 A;  2FOT A;  1KWO B;  1OMD A;  2Y4Q A;  3SG2 A;  1XFZ O;  1K90 D;  1S6J A;  2H2K A;  3DD4 A;  1UP5 A;  3DVM A;  3I5H B;  3PM8 A;  4M2P A;  4D1E A;  1OE9 B;  1NUB A;  3CS1 A;  3JTD B;  1G8I A;  4R1E A;  1QX2 A;  3KO0 A;  1NPQ A;  3D0Y A;  1F8H A;  5J3X A;  3TUY B;  2OS8 B;  1LXF C;  2HQ8 A;  3PN7 B;  1QAT A;  1SR6 B;  1NSH A;  4DRW A;  2GV5 A;  4DUQ A;  2MA2 A;  1IKU A;  1CFD A;  1XK4 C;  2M7N A;  4IL1 A;  4XJK B;  2CCM A;  2NLN A;  4GFT A;  3I5I C;  4NQG A;  1OMV A;  2JTT A;  3FS7 A;  1KQV A;  1YX7 A;  3IF7 A;  1YTZ C;  4PHM A;  2LLU A;  1ZAC A;  2F3Z A;  3CWG A;  1HT9 A;  1JWD A;  1WDC C;  2LLS A;  2KFH A;  3BQ3 A;  3TS5 B;  3SG4 A;  1NYA A;  1B47 A;  3PFV A;  2KSP A;  1S36 A;  1QXP A;  3PN7 C;  5GQQ C;  3TUY C;  1FBV A;  2LV7 A;  2JNF A;  2L51 A;  2LP2 A;  3TDI A;  2M7L A;  1SNL A;  3AAK A;  1W7J B;  1KK7 Z;  2LVK A;  2PAL A;  1N65 A;  1QV1 A;  4HRG A;  4NDD A;  4ZCU A;  4BY5 A;  2JPT A;  4AQJ A;  1YR5 A;  1KWO C;  5F6T A;  1E8A A;  2LAN A;  2LVV A;  1TCO B;  3AKB A;  1WRZ A;  1AJ5 A;  3LCP C;  1A03 A;  1JUO A;  3C1V A;  2QPT A;  1N2D A;  5HLO A;  2PRU A;  2JOJ A;  3E3R A;  2QAC A;  1TOP A;  2KOT A;  2LUC A;  2L5X B;  2OS8 C;  3MSE B;  1RFJ A;  4CPV A;  2ISD A;  3CGA A;  1H8B A;  2MBX A;  1UHI A;  1XFY O;  1IG5 A;  3SJS A;  1V1G A;  1TNW A;  2HF5 A;  4YI9 A;  1EH2 A;  4TNC A;  2TN4 A;  2WCB A;  4L9M A;  1NIW A;  1WDC B;  4ETO A;  1S5G Z;  1CDN A;  4WQ2 A;  4QJ4 B;  4JWQ A;  1U5I B;  1J1D A;  5HYD A;  1QV0 A;  2F8P A;  3BUN B;  5B8I B;  3I5I B;  1YRU B;  2JT0 A;  1ZUZ A;  2BKH B;  5HKY A;  4MN0 A;  4P5O E;  1K95 A;  1K8U A;  4A4C A;  2BKI B;  1CDL A;  2I18 A;  1MUX A;  1PSR A;  1WLM A;  2BE4 A;  2F3Y A;  4N1G A;  2I7A A;  1FW4 A;  1DTL A;  3CR4 X;  1DVI A;  3CZT X;  1UUR A;  1BOC A;  3CR5 X;  3O2P A;  4MRX A;  2CT9 A;  1F55 A;  1C7W A;  1OMR A;  2WCF A;  2DOQ A;  1KFU S;  3HCM A;  3PSR A;  3EK7 A;  1OQP A;  2M3W A;  2G2B A;  4I5L B;  2JQ6 A;  2V53 A;  4PE4 A;  3EVR A;  1WLZ A;  1HQV A;  2AMI A;  2K2F A;  2KNE A;  3DF0 B;  3RLZ A;  4M2Q A;  4CID A;  2LMV A;  3FWC A;  3SG6 A;  3WNX B;  4YGA A;  1DJX A;  1DJW A;  1QTX A;  1CM1 A;  1YVH A;  3I5G B;  3OHM B;  3O6B A;  4GGF C;  4GNK B;  3AAJ A;  3LL8 B;  5DKQ A;  5I8N A;  1JF2 A;  4GGN A;  3ZWH A;  2FCD A;  5KSZ A;  4OR9 B;  4HSZ A;  3O4Y A;  2KHN A;  4GPL B;  1IJ5 A;  3IQO A;  1BG1 A;  1JBA A;  1PRW A;  1SPY A;  3VRP A;  1DJG A;  1UHH A;  1B4C A;  1YRT B;  2I94 A;  1XA5 A;  1OZS A;  2K7O A;  1DT7 B;  2D8N A;  1B1G A;  1IGV A;  3BUX B;  2K7D A;  2M1U A;  4PE7 A;  1MWN A;  1YUS A;  2JUL A;  1S26 D;  1NWD A;  1TN4 A;  3NXA A;  5TNC A;  1M31 A;  4YGE B;  1BJF A;  3NSK A;  2H61 A;  1NX2 A;  2NXQ A;  3OP0 A;  3TDU A;  1L2O C;  1BF5 A;  2PVB A;  1DJI A;  4HRH A;  1MF8 B;  3K21 A;  3M0W A;  3NSI A;  4NDC A;  3KHE A;  5IBW A;  1C7V A;  2M1K B;  3D10 A;  2OPO A;  1YUT A;  4FQO A;  1ZMZ A;  3A8R A;  3GK4 X;  3NSO A;  2M29 A;  2ZN9 A;  5PAL A;  4MLW A;  1SL8 A;  1SCV A;  2F2O A;  5KTY A;  2KI4 C;  1B8R A;  2LNK A;  1RJV A;  1MXE A;  4PHK A;  1QJT A;  1WRL A;  2F2P A;  1FI6 A;  1QS7 A;  2BCA A;  1J55 A;  2KAV A;  1AJ4 A;  3KEV A;  5D7F A;  2FJU B;  1DGV A;  1F70 A;  1BLQ A;  4N1F A;  3BUW B;  1BR1 B;  3EK8 A;  2OTG C;  3VRO A;  2JNX A;  1QAS A;  4C0L A;  4ORC B;  3JVT C;  2HET A;  1GJY A;  3PLF B;  3ZNI A;  3JTD C;  1IQ5 A;  1MXL C;  3VRQ A;  3I5F C;  1CDP A;  2KBM A;  3BOW B;  1QVI Y;  4WQ3 A;  1CMF A;  2CNP A;  1NCX A;  2HPS A;  3KPX A;  2LMT A;  1ALV A;  4YGC B;  1W7I B;  1XO5 A;  2H61 C;  2M8U A;  2CTN A;  1EJ3 A;  5ER4 X;  4MEW A;  3SG3 A;  1AVS A;  2M49 B;  3LK1 A;  4ICB A;  1S5G Y;  3SIA A;  1IH0 A;  2JZI A;  4PHN A;  2CXJ A;  1CLL A;  1OSA A;  1TTX A;  1Y1A A;  1SMG A;  2LCP A;  1F4O A;  3LLE A;  4CLN A;  5I2Q A;  4YI8 A;  2KI6 D;  1UWO A;  3QRX A;  4E68 A;  2A4J A;  1QX7 A;  1L2O B;  2K61 A;  3DVJ A;  2LC5 A;  1CNP A;  1KQM B;  1VRK A;  2K0J A;  3RM1 A;  4OVN F;  4XJK A;  1J7R A;  4MZL A;  1LIN A;  1C07 A;  1Y1X A;  1QIW A;  1RK9 A;  4JQ0 D;  2BCX A;  1R2U A;  2P6B B;  1WY9 A;  1PK0 D;  5CSJ A;  1LKJ A;  2M97 A;  1AK8 A;  2I2R E;  1JSA A;  1JF0 A;  5ER5 A;  1BT6 A;  2O60 A;  2G9B A;  4GGF A;  3OB2 B;  1K93 D;  1SY9 A;  2B1U A;  1MR8 A;  4Q04 A;  2KGB C;  2LHI A;  1A2X A;  2ZNE A;  1XVJ A;  2JT3 A;  3ICB A;  1TCF A;  2O5G A;  1F54 A;  1PVA A;  4F0Z B;  3CR2 A;  4PHJ A;  2PMY A;  2JRF A;  1F71 A;  2MRD A;  1J7Q A;  2AAO A;  4HRE E;  4DIR A;  2L50 A;  1SK6 D;  5I2O A;  1M46 A;  1QX5 B;  4P2Y B;  5G08 A;  2BBN A;  2L2E A;  2IS9 A;  1SBJ A;  2Y1N A;  1XK4 A;  3DVK A;  1DF0 A;  1UUS A;  1OOJ A;  1CTR A;  1K96 A;  1NCZ A;  2E6W A;  3I5H C;  2CBL A;  2KI4 B;  2R2I A;  1WRK A;  2MAZ A;  2JC2 A;  3OX5 A;  5I2L A;  1KK8 B;  3OB1 B;  1K9K A;  1UHN A;  2JTZ A;  1B9A A;  1REC A;  2L0P A;  2L98 A;  1JFJ A;  2WC8 A;  4PCW A;  1KFX L;  2L4I A;  1BR4 B;  2F33 A;  3O78 A;  1K94 A;  2KFG A;  4PAL A;  4AQI A;  3D0Y B;  4QJ5 B;  1RTP 1;  3GK2 A;  4M2O A;  2KAY A;  4DCK A;  2LAP A;  1JFK A;  1CFF A;  2RGI A;  3KF9 A;  2KGR A;  2LLT A;  3CLN A;  1H4B A;  1TNP A;  4OKH A;  2KAX A;  3GK1 A;  1G33 A;  2AUC A;  2JT8 A;  3A4U B;  3WXA A;  1FI5 A;  1D1O A;  2MLF C;  1PVB A;  3WHU B;  1OZO A;  2K8M B;  1M63 B;  2BL0 B;  5AXI A;  2WOR A;  1BU3 A;  3BYA A;  1CDM A;  4YRU A;  2VRG A;  2MLE C;  3TZ1 A;  1XFU O;  1IQ3 A;  1ZOT B;  3FWB A;  1CLB A;  4OCI A;  5K89 A;  1AP4 A;  1DF0 B;  2COL B;  1SL7 A;  3PAT A;  1M39 A;  1K2H A;  3VGO A;  4GBA A;  1KFU L;  1S3P A;  1R6P A;  2JXC A;  1YVL A;  4MVF A;  2EGD A;  2JXL A;  2BEC A;  2PSR A;  3EK4 A;  1KSM A;  1S1E A;  1BOD A;  2JWW A;  3F45 A;  2ZFD A;  1PSB A;  3EKJ A;  1A75 A;  1NX0 A;  2GGZ A;  4OV2 A;  1KK7 Y;  4CFR A;  1CLM A;  1RRO A;  1X02 A;  1Y0V H;  1GGZ A;  1DJY A;  2Y1M A;  1NP8 A;  3BUO B;  1SRA A;  3EVU A;  4MZK A;  2BL0 C;  1CMG A;  2Y5I A;  1FPW A;  1EXR A;  1Y6W A;  4GAO A;  4DS7 A;  2KQY A;  1JC2 A;  1S6C A;  1NX1 A;  1QLS A;  5JOL A;  4BY4 A;  1XYD A;  5HLV A;  1F4Q A;  4I5J A;  5AAN A;  5KU1 A;  3WHT B;  4YGB B;  1M45 A;  4I5N B;  2WND A;  2E30 A;  1A4P A;  4ZCV A;  4AOM A;  1U5I A;  2SAS A;  2KQ6 A;  1SYM A;  5CSF A;  1IWQ A;  4UPG A;  1B7T Y;  3FIA A;  3BUM B;  3I5F B;  2EHB A;  1B8C A;  1CFP A;  2PAS A;  1MHO A;  4PDZ A;  1S6I A;  1SR6 C;  3JVT B;  5HKZ A;  3DVE A;  3SG7 A;  4CFQ A;  2K7C A;  5JJG A;  2KBI A;  1Y1U A;  2LVI A;  5CPV A;  2K7B A;  4WRI A;  2LVJ A;  4C0K A;  4I5K A;  2MHH A;  1IRJ A;  1B7T Z;  1CM4 A;  2WOS A;  4N5X A;  2KYC A;  5CSI A;  2LHL A;  2FCE A;  1A75 B;  1KCY A;  1ODB A;  2BE6 A;  2ZRS A;  1Q80 A;  1PUL A;  2EC6 C;  3DF0 A;  1RWY A;  2LUX A;  1QIV A;  2NCP A;  4ORB B;  1SKT A;  2LM5 A;  4XYN A;  4YBH B;  4MSP A;  5BPJ A;  1PAL A;  3OX6 A;  1KSO A;  2EC6 B;  2M0R A;  3BOW A;  3NSL A;  1J7O A;  1KK8 C;  1SCM B;  3H4S E;  1B8L A;  2K2A A;  2OTG B;  3BXK A;  1CB1 A;  1ZFS A;  1CFC A;  2KDH A;  5AER A;  3HX4 A;  1LA0 A;  4GUK A;  1K9P A;  3I5G C;  1CKK A;  1J1E A;  5DKN A;  2LP3 A;  5FYX A;  4C0J A;  1XFV O;  2JU0 A;  2M9G A;  1BMO A;  2LMU A;  1XFX O;  1SL9 A;  1KQM C;  1MQ1 A;  1TRF A;  1TIZ A;  1ALW A;  3SG5 A;  1TNX A;  1J7P A;  2GGM A;  1EG3 A;  2BBM A;  3VRN A;  1EG4 A;  1UHK A;  2Q91 A;  1YUU A;  4JPZ B;  2BCB A;  1SCM C;  4USL A;  4YGD B;  1DMO A;  1IJ6 A;  4ORA B;  5DKR A;  2WCE A;  4MRY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...