2OS8B

Rigor-like structures of muscle myosins reveal key mechanical elements in the transduction pathways of this allosteric motor
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
135
structure length
135
Chain Sequence
IQEMKEAFTMIDQNRDGFIDINDLKEMFSSLGRTPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFGMFDELDTKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVRFVAMIKGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rigor-like Structures from Muscle Myosins Reveal Key Mechanical Elements in the Transduction Pathways of This Allosteric Motor.
pubmed doi rcsb
molecule tags Contractile protein
molecule keywords Myosin heavy chain
total genus 24
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2007-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2os8B01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2os8B02
2Y4QA 1KK7Z 1XFUO 1WRLA 1SMGA 3VRQA 1GJYA 1FW4A 2ZRTA 2BKIB 3O4YA 4PCWA 5HKWA 1AP4A 2K2AA 4XJKA 2NLNA 4TNCA 3EVUA 3AKAA 2KGBC 2WCFA 1TRFA 4D1EA 1Y1XA 1KFUS 5CSNA 1L2OC 1ZOTB 1K93D 4XJKB 1QTXA 4YGDB 2FOTA 3CWGA 1TNQA 1TOPA 2JNXA 1NWDA 1HQVA 2CXJA 2OS8C 5J3XA 5I8NA 1DJYA 2I7AA 4M2QA 1BR1B 1CDLA 2BECA 1OZOA 1PALA 2L0PA 4M2PA 3VRNA 5K89A 2I18A 3IF7A 2LVVA 1W7IB 1RWYA 2LANA 2CCMA 5AFPA 2Q4UA 2P6BB 1EG4A 4I5LB 1KFXS 5HKZA 4AQJA 5KSZA 3SG6A 4PE1A 2LLTA 5KTYA 1FF1A 4XYNA 2JC2A 3NSIA 4YRUA 1XYDA 1XFXO 3SIAA 4MZLA 1SRAA 3CR4X 1SL7A 4UPGA 1TNXA 1RECA 2A4JA 3WHTB 1S6IA 3FIAA 1FBVA 2BCBA 2KAXA 1QJTA 3AAJA 3SJSA 1B8RA 4E68A 4GBAA 2E30A 1B9AA 1R2UA 1YUUA 4MBEA 4PDZA 4PE0A 1YX7A 4PALA 1JFJA 1G4YR 2L98A 1RROA 1BR4B 3BXKA 1CLLA 3PFVA 3KO0A 3JTDC 1ALVA 1DMOA 1MR8A 1DGVA 2K7BA 2M0RA 3KEVA 1GQMA 1N0YA 1K8UA 1F4QA 2CBLA 2LHLA 3DVMA 1ZACA 3GK1A 2BBMA 3MSEB 2M7LA 2FCDA 2ZRSA 1K2HA 2LV7A 1QLKA 2MBXA 1WRKA 2OS8B 4C0KA 1U5IB 1DTLA 1PVAA 3CS1A 2JTTA 3DD4A 5G08A 4FTGA 2JT3A 4HRGA 1DJGA 2NZ0A 2PSRA 3BQ3A 5HLVA 4MLWA 1CFCA 3AAKA 3ZWHA 1TN4A 1UHHA 1K90D 1BJFA 3D0YB 1SCMB 5FYXA 5BPJA 1TTXA 2R2IA 1YRTB 4ZCUA 4N5XA 2AUCA 2LHIA 1XFVO 4AOMA 1CKKA 1KQMC 1KWOB 4MEWA 2K7OA 1C07A 1QX2A 1QATA 1JUOA 4PE4A 3LK0A 2JXCA 1SPYA 1B7TY 2ZN8A 1QIVA 1V1FA 1YUTA 1B7TZ 5D69A 1BG1A 1N65A 3CLNA 1K9UA 1BODA 2LAPA 5HLOA 1M63B 3DVJA 3HCMA 1WLZA 2B1UA 1LA0A 1CMGA 4FQOA 1CM1A 1B4CA 4USLA 4YGCB 4MRYA 3OX5A 4DRWA 1IWQA 1EJ3A 3TDIA 4PHJA 3NSOA 1J1DA 1OQPA 3BYAA 3I5FC 3PM8A 3PN7B 5HYDA 1NPQA 3GK2A 1MUXA 2KBMA 2LLSA 4L9MA 2K2FA 1QV1A 2ZKMX 2WCBA 3DF0B 2KI4B 1QLSA 1CFPA 1G33A 2JRFA 2PVBA 4BY5A 1CNPA 3FWCA 4NQGA 4NDBA 1UP5A 1M46A 1DVIA 1EH2A 2IS9A 2M3WA 1QVIZ 2HQWA 1V1GA 1JFKA 1FPWA 1K94A 1WY9A 3OB1B 3CTNA 2L4HA 2CTNA 1S1EA 2H61C 2VRGA 4NDCA 4QJ3B 5F6TA 4GGNA 1KQMB 1J7PA 2ZNEA 1U5IA 1A75A 4GGFA 4MVFA 1C7VA 2G2BA 2AMIA 2KDHA 5CSFA 1KFUL 1MXEA 3FWBA 4MZKA 2LP3A 3BUOB 1XFZO 1KWOC 1AJ5A 2M1KB 2KQ6A 2CNPA 1WLMA 2JOJA 2KI6C 1EXRA 1KK8B 1F4OA 5AANA 1SCVA 2LVJA 3I5FB 1NIWA 3EK7A 1H8BA 1FI5A 3WXAA 1A4PA 4MRXA 2NCPA 1JC2A 4DCKA 1KFXL 1PK0D 2KAVA 2KFHA 3A8RA 1NYAA 1CTRA 2BKHB 3OHMB 2L51A 1MHOA 4ORAB 1QX7A 2BBNA 2NXQA 2LCPA 3TUYC 2LVKA 3OX6A 4PE7A 1OMVA 1BLQA 1CLBA 1LINA 2MRDA 1UHNA 1K95A 1KQVA 3ZNIA 1J7QA 2LNKA 1JWDA 3SG5A 4P5OE 2M1UA 4PHMA 3VROA 4AQIA 2O5GA 4C0JA 2ZFDA 1VRKA 4NDDA 1AVSA 2KFGA 4GNKB 2KOTA 2WC8A 3PLFB 1NUBA 1DJIA 2L5XB 2ZN9A 3QRXA 1RK9A 1QX5B 1QXPA 3DVEA 1RFJA 1AHRA 4P2YB 1F8HA 3D0YA 1YUSA 3BUNB 2ZNDA 1DT7B 1DJZA 1SBJA 2HETA 2MLEC 3JVTB 1L7ZA 1SYMA 2NCOA 3PN7C 3A4UB 2WOSA 4I5KA 2HF5A 2M8UA 1A03A 2M49B 2OTGC 2EC6B 5ER5A 1XO5A 1WRZA 2D8NA 2GGZA 1LKJA 4JPZB 3DF0A 4YGBB 2PRUA 4CFQA 3GK4X 1XK4A 2K8MB 1PSBA 1S36A 2G9BA 1JBAA 2L4IA 2LUCA 1SCMC 1CDMA 1CLMA 3VGOA 1YURA 1YTZC 4DS7A 1G8IA 1B8LA 3EVVA 1K9KA 1HT9A 4GAOA 4CLNA 2QACA 3LK1A 1GGZA 4ICBA 2LM5A 2JZIA 1TIZA 2L50A 5AXIA 5PALA 5JJGA 4YGAA 2F2OA 2KNEA 2MLFC 1RJVA 3F45A 3LCPC 3O6BA 2ISDA 1KCYA 3OB2B 3FS7A 1M31A 2O60A 2SASA 3ICBA 1OOJA 1NCZA 1RTP1 1QV0A 3BOWA 2WORA 1MXLC 1B8CA 4BY4A 2MHHA 1S6JA 4WQ3A 1F71A 3GOFA 3JTDB 1KK8C 4A4CA 1OZSA 4WQ2A 2KGRA 2BCAA 1AUIB 3PSRA 5CPVA 1ZFSA 3LLEA 2JQ6A 4ETOA 1CDNA 1S6CA 3EK4A 2DOQA 3WNXB 1Y6WA 1H4BA 2F33A 1NX2A 1UURA 3PALA 1FI6A 1SR6C 2KBIA 2GV5A 3VRRA 2KI6D 2Q91A 4I5NB 2BCXA 1IGVA 1F70A 1IRJA 2JULA 2WCEA 1LXFC 2H2KA 2GGMA 5B8IB 2F2PA 1K96A 1S5GY 2I2RE 3BUMB 3TS5B 1PSRA 2BL0B 2EC6C 4PHNA 3EK8A 1Y1UA 1GGWA 1OE9B 1F54A 1S3PA 1XFYO 2WNDA 3CR2A 5TNCA 1NCYA 3E3RA 1XFWO 2LC5A 1XVJA 2FJUB 2E6WA 1IQ3A 1R6PA 4MN0A 2KHNA 4GGFC 4YBHB 1CM4A 2HPSA 1J7RA 1TNPA 2FCEA 1N2DA 1MQ1A 3AKBA 3SG2A 2JT0A 4ZCVA 2M7NA 3LL8B 2H61A 5JOLA 1ZMZA 1SKTA 2SCPA 3IQOA 1QASA 5I2LA 2QPTA 2LP2A 3O2PA 5ER4X 3TDUA 4N1FA 1NX1A 1KSMA 3C1VA 1A29A 4OR9B 1CDPA 2KQYA 1EG3A 4OVNF 4A4BA 2MAZA 3D10A 2JWWA 3BUXB 1F55A 1PVBA 1CB1A 2K0JA 3TDZA 3I5GC 1QS7A 2Y5IA 5HKYA 1MWNA 2V53A 3PATA 2OTGB 1IG5A 5DKNA 1NSHA 4M2OA 4JQ0D 2M9GA 1IJ6A 1IJ5A 3JVTC 2JTZA 4Q04A 3SG4A 5IBWA 2F3ZA 3BUWB 4C0LA 1QIWA 1UHIA 3I5HC 2K7DA 4DUQA 1SNLA 1OMDA 2JPTA 4GPLB 2HQ8A 4HSZA 4R1EA 2OPOA 1M39A 1Y0VH 2LE9B 3IQQA 2JU0A 3I5HB 1YRUB 3EVRA 3RM1A 2JT8A 1E8AA 1QVIY 1EL4A 1IQ5A 2LMTA 2K61A 1J7OA 2AAOA 5GQQC 2BE6A 4ORCB 1DF0B 3CZTX 3O78A 4ORBB 1L2OB 2JNFA 1DJWA 3TUYB 1ALWA 2Y1MA 3KPXA 4DIRA 1J1EA 1CFDA 3EKJA 1DF0A 2F3YA 3KF9A 3K21A 2LUXA 2EHBA 2KFFA 3NSLA 2KI4C 1B1GA 1B47A 1NCXA 3VRPA 2Y1NA 2EGDA 5DKRA 1M45A 4I5JA 4PHKA 2I94A 5I2OA 2MJWB 5CSJA 1X02A 1YX8A 1D1OA 3CGAA 4QJ5B 1SY9A 1KK7Y 1WDCC 1BOCA 1J55A 1DJXA 1SL9A 3M0WA 3WHUB 1ODBA 3RLZA 3I5IC 1UUSA 4CFRA 1TNWA 4MZJA 1UWOA 3I5GB 4OCIA 2KYCA 2CT9A 3TZ1A 3NSKA 3SG7A 1SW8A 3HX4A 1KSOA 2LMUA 4F0ZB 1PULA 1S26D 2PASA 1DGUA 1NX0A 2COLB 4MSPA 2L2EA 3SG3A 4HREE 4YI9A 1W7JB 2MA2A 1TCFA 4GUKA 1WDCB 2M29A 4WRIA 1A2XA 1UHJA 2JXLA 1YR5A 4IL1A 4OV2A 2LLUA 1IKUA 1PRWA 1SK6D 5D7FA 4CPVA 2TN4A 5AEQA 2PMYA 4JWQA 3I5IB 1YVLA 1JF0A 4N1GA 1JSAA 1NX3A 1SL8A 1XK4C 4HRHA 1BMOA 3EKHA 4CIDA 1YVHA 2PALA 5I2QA 1C7WA 2LVIA 4OKHA 1IH0A 1S5GZ 1UHKA 2M97A 1LA3A 1AJ4A 1JF2A 1BU3A 2BE4A 1OMRA 4YGEB 2F8PA 1CMFA 2KSPA 5CSIA 5KU1A 2KYFA 1OSAA 2BL0C 1Q80A 2KAYA 3SIBA 1XA5A 1LVCD 1CFFA 3KHEA 3OP0A 1NP8A 1BT6A 5DKQA 1AK8A 3CR5X 4GFTA 1MF8B 3BOWB 2RGIA 2K7CA 1TCOB 1Y1AA 2LMVA 4U8DA 1A75B 4YI8A 3TS5C 3H4SE 3DVKA 4QJ4B 3NXAA 1BF5A 5AERA 1K9PA 1DJHA 1SR6B 1ZUZA
chains in the Genus database with same CATH superfamily
2Y4QA 1KK7Z 1XFUO 1WRLA 1OOIX 1SMGA 3B88A 3VRQA 1GJYA 3BFBA 1FW4A 2ZRTA 2BKIB 3O4YA 4PCWA 5HKWA 1AP4A 2K2AA 4XJKA 2NLNA 4TNCA 2QEVA 2JPOA 3EVUA 3AKAA 3EG5B 2KGBC 2WCFA 1TRFA 4D1EA 1Y1XA 1KFUS 5CSNA 1L2OC 1ZOTB 1K93D 4XJKB 1QTXA 2WC6A 4YGDB 1XFRA 2FOTA 3CWGA 1TNQA 1TOPA 2JNXA 1NWDA 1HQVA 2CXJA 2OS8C 5J3XA 1LS8A 1DJYA 2I7AA 5I8NA 4M2QA 1BR1B 1CDLA 2BECA 1OZOA 1PALA 2L0PA 4M2PA 3VRNA 5K89A 2I18A 3IF7A 2LVVA 1W7IB 1RWYA 2LANA 4OZDA 2CCMA 5AFPA 2Q4UA 2P6BB 1EG4A 2P70A 4F7FA 4I5LB 1KFXS 3D74A 5D3OA 5HKZA 4AQJA 5KSZA 3SG6A 4PE1A 2LLTA 3CDNA 3S0GA 5KTYA 1FF1A 4XYNA 2JC2A 3NSIA 4YRUA 1XYDA 1XFXO 3SIAA 4MZLA 1C3YA 1SRAA 3CR4X 1SL7A 4UPGA 1TNXA 1RECA 2A4JA 3WHTB 1S6IA 3BFHA 3FIAA 1FBVA 2BCBA 2KAXA 1QJTA 3AAJA 4JKTA 1B8RA 3SJSA 4E68A 4GBAA 2E30A 1B9AA 1R2UA 1YUUA 4MBEA 4PDZA 1QWVA 4PE0A 1YX7A 4PALA 1JFJA 1G4YR 2L98A 1RROA 1BR4B 3BXKA 3L4AA 1TWOA 1CLLA 3PFVA 3KO0A 3JTDC 1ALVA 3PM2A 1DMOA 1MR8A 1DGVA 3DXLA 2K7BA 2M0RA 3KEVA 1GQMA 1N0YA 1K8UA 1F4QA 2CBLA 2LHLA 3DVMA 1ZACA 3GK1A 2BBMA 3MSEB 2M7LA 2FCDA 3OGNA 2ZRSA 1K2HA 2LV7A 3S0FA 1QLKA 2MBXA 1WRKA 2OS8B 4C0KA 1U5IB 1DTLA 1PVAA 3CS1A 5EL2A 2JTTA 1Z4HA 3DD4A 5G08A 4FTGA 2JT3A 4HRGA 1DJGA 2NZ0A 2PSRA 3BQ3A 5HLVA 4MLWA 1CFCA 3AAKA 3D75A 3Q8IA 3ZWHA 1TN4A 3CZ0A 1GM0A 1UHHA 1K90D 1BJFA 3D0YB 1SCMB 5FI2A 5FYXA 1TTXA 5BPJA 2R2IA 1YRTB 4ZCUA 4N5XA 2AUCA 2LHIA 1XFVO 4AOMA 1CKKA 1KQMC 1KWOB 4MEWA 2K7OA 1C07A 1QX2A 1QATA 1JUOA 4PE4A 3LK0A 2JXCA 1SPYA 1B7TY 2ZN8A 1QIVA 1V1FA 1YUTA 1B7TZ 5D69A 1BG1A 1N65A 3CLNA 1K9UA 1BODA 2L5YA 2LAPA 5HLOA 1M63B 3DVJA 3HCMA 1WLZA 2B1UA 1LA0A 3K1EA 1CMGA 4FQOA 1CM1A 1B4CA 4USLA 4YGCB 3OBVA 4MRYA 3OX5A 3CZ2A 4DRWA 1IWQA 1EJ3A 4INWA 3TDIA 4PHJA 3NSOA 1J1DA 1OQPA 3BYAA 3I5FC 3PM8A 3PN7B 5HYDA 1NPQA 3GK2A 1MUXA 2KBMA 2LLSA 4L9MA 2K2FA 1QV1A 2ZKMX 2WCBA 3DF0B 2KI4B 1QLSA 1DC1A 3N7HA 1CFPA 1G33A 2JRFA 2PVBA 2QEHA 4BY5A 3FWCA 1CNPA 4NQGA 4NDBA 1UP5A 1M46A 1DVIA 1EH2A 2IS9A 2M3WA 1QVIZ 2HQWA 1V1GA 1JFKA 1FPWA 1K94A 1WY9A 3OB1B 3CTNA 2L4HA 2CTNA 1S1EA 2H61C 2VRGA 3BFAA 4NDCA 4QJ3B 5F6TA 3VB1A 4GGNA 1KQMB 1J7PA 2ZNEA 1U5IA 1A75A 4GGFA 4MVFA 1C7VA 3D77A 2G2BA 2AMIA 2KDHA 5CSFA 1KFUL 1MXEA 3FWBA 1OW4A 2LP3A 3BUOB 4MZKA 2WCKA 1XFZO 1KWOC 3UNWA 1AJ5A 2M1KB 2KQ6A 2CNPA 1WLMA 3CABA 2JOJA 2KI6C 1EXRA 1KK8B 1F4OA 5AANA 1SCVA 2LVJA 1FI6A 3I5FB 1NIWA 1TUJA 3EK7A 1H8BA 3SS5A 3WXAA 1FI5A 1A4PA 4MRXA 2NCPA 1JC2A 4DCKA 1KFXL 1PK0D 2KAVA 2KFHA 3A8RA 3DZTA 1NYAA 1CTRA 2BKHB 1TUZA 2L51A 2WCMA 1MHOA 3OHMB 4ORAB 1QX7A 2BBNA 2NXQA 2LCPA 3TUYC 2LVKA 3OX6A 3PJIA 4PE7A 1OMVA 1BLQA 1CLBA 5FI7A 1LINA 2MRDA 1UHNA 1K95A 1KQVA 3ZNIA 1J7QA 2LNKA 1JWDA 3S0EA 3SG5A 4P5OE 2M1UA 4PHMA 3VROA 5FI6A 4AQIA 2O5GA 2QEBA 4C0JA 2ZFDA 1VRKA 4NDDA 1AVSA 3SS4A 2KFGA 4GNKB 2KOTA 2WC8A 3PLFB 1NUBA 1DJIA 2L5XB 2ZN9A 3QRXA 1RK9A 1QX5B 1W9ZA 1QXPA 3DVEA 3FE6A 1RFJA 1AHRA 4P2YB 1F8HA 3D0YA 1YUSA 3BUNB 2ZNDA 1DT7B 3B87A 1DJZA 1SBJA 2HETA 2MLEC 3JVTB 1L7ZA 1SYMA 2NCOA 3PN7C 3A4UB 2WOSA 4I5KA 3L47A 2HF5A 2M8UA 1A03A 2M49B 2OTGC 2EC6B 5ER5A 1XO5A 1WRZA 2D8NA 2GGZA 2QDIA 1LKJA 4JPZB 3DF0A 4YGBB 2PRUA 1DQEA 4CFQA 3GK4X 1XK4A 2H8VA 2K8MB 1PSBA 1S36A 2G9BA 3DYEA 1JBAA 2L4IA 2LUCA 1SCMC 1CDMA 1CLMA 3VGOA 1YURA 1YTZC 4DS7A 1G8IA 1B8LA 3EVVA 1K9KA 1HT9A 3D73A 4GAOA 4CLNA 2QACA 3LK1A 3BJHA 1GGZA 4ICBA 2LM5A 2JZIA 1TIZA 2L50A 5AXIA 5PALA 5JJGA 3B86A 4YGAA 2F2OA 2KNEA 2MLFC 1RJVA 3S0BA 3F45A 3LCPC 3O6BA 2ISDA 5I94A 1KCYA 2L2CA 3FE9A 3OB2B 3FS7A 1M31A 2O60A 2SASA 3ICBA 1OOJA 1NCZA 1RTP1 1QV0A 3BOWA 2WORA 1MXLC 1B8CA 4BY4A 2MHHA 1S6JA 4WQ3A 1F71A 3GOFA 3JTDB 1KK8C 4A4CA 1OZSA 4WQ2A 2KGRA 2BCAA 1IIOA 1AUIB 3PSRA 5CPVA 3RZSA 3O4XA 1ZFSA 3LLEA 2JQ6A 3QMEA 4ETOA 1CDNA 1S6CA 3EK4A 2DOQA 3WNXB 1Y6WA 5HL1A 1H4BA 2F33A 1NX2A 1UURA 2FJYA 1DELA 1SR6C 2KBIA 2GV5A 3PALA 2KI6D 2Q91A 4I5NB 2BCXA 3VRRA 1IGVA 4JD9A 1F70A 1IRJA 2JULA 2WCEA 1LXFC 2H2KA 3D76A 2GGMA 5B8IB 2F2PA 1K96A 1S5GY 2I2RE 3BUMB 3TS5B 2K60A 1PSRA 2BAPA 2EC6C 2BL0B 4PHNA 3EK8A 3CZ1A 1Y1UA 2PYQA 1GGWA 1OE9B 2ERBA 1F54A 1S3PA 1XFYO 2WNDA 3CR2A 5TNCA 1C3ZA 1NCYA 1XFWO 3E3RA 3B7AA 2LC5A 1XVJA 2FJUB 2E6WA 1IQ3A 1R6PA 4MN0A 1OOFA 2KHNA 4GGFC 2KLEA 4YBHB 1CM4A 1P28A 2HPSA 1J7RA 1TNPA 2FCEA 1N2DA 1MQ1A 3AKBA 3SG2A 2JT0A 4ZCVA 2M7NA 3LL8B 2H61A 3CYZA 5JOLA 1SSEB 1ZMZA 1SKTA 2SCPA 3IQOA 1QASA 5I2LA 2QPTA 4IJ7A 2LP2A 3O2PA 4FQTA 5ER4X 3TDUA 4N1FA 1NX1A 1KSMA 3B6XA 1A29A 3C1VA 4OR9B 1T14A 1CDPA 3NHTA 2KQYA 3S0DA 2PQLA 1EG3A 2QEOA 4OVNF 4A4BA 2MAZA 3D10A 2JWWA 2KPHA 3BUXB 1PVBA 1CB1A 2WCLA 2K0JA 1F55A 1DEKA 3TDZA 3I5GC 1OOGA 1QS7A 2Y5IA 5HKYA 1MWNA 2V53A 3PATA 2OTGB 1IG5A 5DKNA 1NSHA 4M2OA 3UO9A 4JQ0D 2M9GA 3R1PA 1IJ6A 1IJ5A 3JVTC 4INXA 2JTZA 4Q04A 3SG4A 5IBWA 2F3ZA 3BUWB 4C0LA 1QIWA 1UHIA 3FE8A 3I5HC 2K7DA 4DUQA 1SNLA 3DY9A 1OMDA 2JPTA 4GPLB 2HQ8A 4HSZA 4R1EA 2OPOA 1M39A 1Y0VH 2LE9B 3IQQA 2JU0A 3I5HB 1YRUB 3EVRA 3RM1A 2JT8A 1E8AA 1QVIY 1EL4A 1IQ5A 2LMTA 2K61A 1J7OA 2AAOA 3R1OA 5GQQC 2BE6A 4ORCB 1DF0B 3CZTX 3O78A 4ORBB 1L2OB 2JNFA 1DJWA 3TUYB 1ALWA 2Y1MA 3KPXA 4DIRA 1J1EA 1CFDA 3EKJA 1DF0A 2F3YA 3D78A 3K21A 3KF9A 2LUXA 2GTEA 2KLDA 2EHBA 2KFFA 3NSLA 2KI4C 1B1GA 1B47A 1NCXA 3VRPA 2Y1NA 2WC5A 2EGDA 5DKRA 1Z2CB 1M45A 4I5JA 4PHKA 2I94A 5I2OA 2MJWB 5CSJA 1X02A 1YX8A 1D1OA 3CGAA 4QJ5B 3SS3A 1SY9A 1KK7Y 1WDCC 1BOCA 2P71A 1J55A 1DJXA 1SL9A 3M0WA 3WHUB 1ODBA 3RLZA 3I5IC 1UUSA 4CFRA 1TNWA 4MZJA 1UWOA 3I5GB 4PT1A 4OCIA 2KYCA 2CT9A 3TZ1A 3NSKA 3SG7A 1SW8A 3HX4A 1KSOA 2LMUA 4F0ZB 1PULA 1S26D 2PASA 1OOHA 1DGUA 1NX0A 2COLB 4MSPA 2L2EA 3SG3A 4HREE 4YI9A 1W7JB 2MA2A 1TCFA 4GUKA 1WDCB 2M29A 4WRIA 1A2XA 1UHJA 2JXLA 1YR5A 4IL1A 4OV2A 2LLUA 4KYNA 1IKUA 1PRWA 1SK6D 5D7FA 4CPVA 2TN4A 5AEQA 2PMYA 4JWQA 3I5IB 3R1VA 3V2LA 1YVLA 1JF0A 4N1GA 1JSAA 1NX3A 1SL8A 1XK4C 4HRHA 1BMOA 3EKHA 4CIDA 1YVHA 2PALA 2WCJA 1C7WA 5I2QA 2LVIA 3NHIA 4OKHA 5DICA 1IH0A 1S5GZ 1UHKA 3R72A 2M97A 3IVTA 1LA3A 1AJ4A 1JF2A 1BU3A 2BE4A 1OMRA 4YGEB 2F8PA 3NGVA 1CMFA 2WCHA 2KSPA 2YGUA 5CSIA 2BNXA 3L4LA 5KU1A 2KYFA 1OSAA 2BL0C 1Q80A 2KAYA 3SIBA 1XA5A 1LVCD 1CFFA 3KHEA 3OP0A 1NP8A 1BT6A 5DKQA 1AK8A 3S0AA 3CR5X 4GFTA 1MF8B 3BOWB 2RGIA 2K7CA 1TCOB 1Y1AA 2LMVA 4U8DA 1A75B 4YI8A 3TS5C 3H4SE 3DVKA 4QJ4B 3NXAA 1BF5A 5AERA 1K9PA 1DJHA 1ORGA 1SR6B 1ZUZA
chains in the Genus database with same CATH topology
2Y4QA 1KK7Z 1XFUO 1WRLA 1SMGA 3VRQA 1GJYA 1FW4A 2ZRTA 2BKIB 3O4YA 4PCWA 5HKWA 1AP4A 2K2AA 4XJKA 2NLNA 4TNCA 3EVUA 3AKAA 2KGBC 2WCFA 1TRFA 4D1EA 1Y1XA 1KFUS 5CSNA 1L2OC 1ZOTB 1K93D 4XJKB 1QTXA 4YGDB 2FOTA 3CWGA 1TNQA 1TOPA 2JNXA 1NWDA 1HQVA 2CXJA 2OS8C 5J3XA 5I8NA 1DJYA 2I7AA 4M2QA 1BR1B 1CDLA 2BECA 1OZOA 1PALA 2L0PA 4M2PA 3VRNA 5K89A 2I18A 3IF7A 2LVVA 1W7IB 1RWYA 2LANA 2CCMA 5AFPA 2Q4UA 2P6BB 1EG4A 4I5LB 1KFXS 5HKZA 4AQJA 5KSZA 3SG6A 4PE1A 2LLTA 5KTYA 1FF1A 4XYNA 2JC2A 3NSIA 4YRUA 1XYDA 1XFXO 3SIAA 4MZLA 1SRAA 3CR4X 1SL7A 4UPGA 1TNXA 1RECA 2A4JA 3WHTB 1S6IA 3FIAA 1FBVA 2BCBA 2KAXA 1QJTA 3AAJA 3SJSA 1B8RA 4E68A 4GBAA 2E30A 1B9AA 1R2UA 1YUUA 4MBEA 4PDZA 4PE0A 1YX7A 4PALA 1JFJA 1G4YR 2L98A 1RROA 1BR4B 3BXKA 1CLLA 3PFVA 3KO0A 3JTDC 1ALVA 1DMOA 1MR8A 1DGVA 2K7BA 2M0RA 3KEVA 1GQMA 1N0YA 1K8UA 1F4QA 2CBLA 2LHLA 3DVMA 1ZACA 3GK1A 2BBMA 3MSEB 2M7LA 2FCDA 2ZRSA 1K2HA 2LV7A 1QLKA 2MBXA 1WRKA 2OS8B 4C0KA 1U5IB 1DTLA 1PVAA 3CS1A 2JTTA 3DD4A 5G08A 4FTGA 2JT3A 4HRGA 1DJGA 2NZ0A 2PSRA 3BQ3A 5HLVA 4MLWA 1CFCA 3AAKA 3ZWHA 1TN4A 1UHHA 1K90D 1BJFA 3D0YB 1SCMB 5FYXA 5BPJA 1TTXA 2R2IA 1YRTB 4ZCUA 4N5XA 2AUCA 2LHIA 1XFVO 4AOMA 1CKKA 1KQMC 1KWOB 4MEWA 2K7OA 1C07A 1QX2A 1QATA 1JUOA 4PE4A 3LK0A 2JXCA 1SPYA 1B7TY 2ZN8A 1QIVA 1V1FA 1YUTA 1B7TZ 5D69A 1BG1A 1N65A 3CLNA 1K9UA 1BODA 2LAPA 5HLOA 1M63B 3DVJA 3HCMA 1WLZA 2B1UA 1LA0A 1CMGA 4FQOA 1CM1A 1B4CA 4USLA 4YGCB 4MRYA 3OX5A 4DRWA 1IWQA 1EJ3A 3TDIA 4PHJA 3NSOA 1J1DA 1OQPA 3BYAA 3I5FC 3PM8A 3PN7B 5HYDA 1NPQA 3GK2A 1MUXA 2KBMA 2LLSA 4L9MA 2K2FA 1QV1A 2ZKMX 2WCBA 3DF0B 2KI4B 1QLSA 1CFPA 1G33A 2JRFA 2PVBA 4BY5A 1CNPA 3FWCA 4NQGA 4NDBA 1UP5A 1M46A 1DVIA 1EH2A 2IS9A 2M3WA 1QVIZ 2HQWA 1V1GA 1JFKA 1FPWA 1K94A 1WY9A 3OB1B 3CTNA 2L4HA 2CTNA 1S1EA 2H61C 2VRGA 4NDCA 4QJ3B 5F6TA 4GGNA 1KQMB 1J7PA 2ZNEA 1U5IA 1A75A 4GGFA 4MVFA 1C7VA 2G2BA 2AMIA 2KDHA 5CSFA 1KFUL 1MXEA 3FWBA 4MZKA 2LP3A 3BUOB 1XFZO 1KWOC 1AJ5A 2M1KB 2KQ6A 2CNPA 1WLMA 2JOJA 2KI6C 1EXRA 1KK8B 1F4OA 5AANA 1SCVA 2LVJA 3I5FB 1NIWA 3EK7A 1H8BA 1FI5A 3WXAA 1A4PA 4MRXA 2NCPA 1JC2A 4DCKA 1KFXL 1PK0D 2KAVA 2KFHA 3A8RA 1NYAA 1CTRA 2BKHB 3OHMB 2L51A 1MHOA 4ORAB 1QX7A 2BBNA 2NXQA 2LCPA 3TUYC 2LVKA 3OX6A 4PE7A 1OMVA 1BLQA 1CLBA 1LINA 2MRDA 1UHNA 1K95A 1KQVA 3ZNIA 1J7QA 2LNKA 1JWDA 3SG5A 4P5OE 2M1UA 4PHMA 3VROA 4AQIA 2O5GA 4C0JA 2ZFDA 1VRKA 4NDDA 1AVSA 2KFGA 4GNKB 2KOTA 2WC8A 3PLFB 1NUBA 1DJIA 2L5XB 2ZN9A 3QRXA 1RK9A 1QX5B 1QXPA 3DVEA 1RFJA 1AHRA 4P2YB 1F8HA 3D0YA 1YUSA 3BUNB 2ZNDA 1DT7B 1DJZA 1SBJA 2HETA 2MLEC 3JVTB 1L7ZA 1SYMA 2NCOA 3PN7C 3A4UB 2WOSA 4I5KA 2HF5A 2M8UA 1A03A 2M49B 2OTGC 2EC6B 5ER5A 1XO5A 1WRZA 2D8NA 2GGZA 1LKJA 4JPZB 3DF0A 4YGBB 2PRUA 4CFQA 3GK4X 1XK4A 2K8MB 1PSBA 1S36A 2G9BA 1JBAA 2L4IA 2LUCA 1SCMC 1CDMA 1CLMA 3VGOA 1YURA 1YTZC 4DS7A 1G8IA 1B8LA 3EVVA 1K9KA 1HT9A 4GAOA 4CLNA 2QACA 3LK1A 1GGZA 4ICBA 2LM5A 2JZIA 1TIZA 2L50A 5AXIA 5PALA 5JJGA 4YGAA 2F2OA 2KNEA 2MLFC 1RJVA 3F45A 3LCPC 3O6BA 2ISDA 1KCYA 3OB2B 3FS7A 1M31A 2O60A 2SASA 3ICBA 1OOJA 1NCZA 1RTP1 1QV0A 3BOWA 2WORA 1MXLC 1B8CA 4BY4A 2MHHA 1S6JA 4WQ3A 1F71A 3GOFA 3JTDB 1KK8C 4A4CA 1OZSA 4WQ2A 2KGRA 2BCAA 1AUIB 3PSRA 5CPVA 1ZFSA 3LLEA 2JQ6A 4ETOA 1CDNA 1S6CA 3EK4A 2DOQA 3WNXB 1Y6WA 1H4BA 2F33A 1NX2A 1UURA 3PALA 1FI6A 1SR6C 2KBIA 2GV5A 3VRRA 2KI6D 2Q91A 4I5NB 2BCXA 1IGVA 1F70A 1IRJA 2JULA 2WCEA 1LXFC 2H2KA 2GGMA 5B8IB 2F2PA 1K96A 1S5GY 2I2RE 3BUMB 3TS5B 1PSRA 2BL0B 2EC6C 4PHNA 3EK8A 1Y1UA 1GGWA 1OE9B 1F54A 1S3PA 1XFYO 2WNDA 3CR2A 5TNCA 1NCYA 3E3RA 1XFWO 2LC5A 1XVJA 2FJUB 2E6WA 1IQ3A 1R6PA 4MN0A 2KHNA 4GGFC 4YBHB 1CM4A 2HPSA 1J7RA 1TNPA 2FCEA 1N2DA 1MQ1A 3AKBA 3SG2A 2JT0A 4ZCVA 2M7NA 3LL8B 2H61A 5JOLA 1ZMZA 1SKTA 2SCPA 3IQOA 1QASA 5I2LA 2QPTA 2LP2A 3O2PA 5ER4X 3TDUA 4N1FA 1NX1A 1KSMA 3C1VA 1A29A 4OR9B 1CDPA 2KQYA 1EG3A 4OVNF 4A4BA 2MAZA 3D10A 2JWWA 3BUXB 1F55A 1PVBA 1CB1A 2K0JA 3TDZA 3I5GC 1QS7A 2Y5IA 5HKYA 1MWNA 2V53A 3PATA 2OTGB 1IG5A 5DKNA 1NSHA 4M2OA 4JQ0D 2M9GA 1IJ6A 1IJ5A 3JVTC 2JTZA 4Q04A 3SG4A 5IBWA 2F3ZA 3BUWB 4C0LA 1QIWA 1UHIA 3I5HC 2K7DA 4DUQA 1SNLA 1OMDA 2JPTA 4GPLB 2HQ8A 4HSZA 4R1EA 2OPOA 1M39A 1Y0VH 2LE9B 3IQQA 2JU0A 3I5HB 1YRUB 3EVRA 3RM1A 2JT8A 1E8AA 1QVIY 1EL4A 1IQ5A 2LMTA 2K61A 1J7OA 2AAOA 5GQQC 2BE6A 4ORCB 1DF0B 3CZTX 3O78A 4ORBB 1L2OB 2JNFA 1DJWA 3TUYB 1ALWA 2Y1MA 3KPXA 4DIRA 1J1EA 1CFDA 3EKJA 1DF0A 2F3YA 3KF9A 3K21A 2LUXA 2EHBA 2KFFA 3NSLA 2KI4C 1B1GA 1B47A 1NCXA 3VRPA 2Y1NA 2EGDA 5DKRA 1M45A 4I5JA 4PHKA 2I94A 5I2OA 2MJWB 5CSJA 1X02A 1YX8A 1D1OA 3CGAA 4QJ5B 1SY9A 1KK7Y 1WDCC 1BOCA 1J55A 1DJXA 1SL9A 3M0WA 3WHUB 1ODBA 3RLZA 3I5IC 1UUSA 4CFRA 1TNWA 4MZJA 1UWOA 3I5GB 4OCIA 2KYCA 2CT9A 3TZ1A 3NSKA 3SG7A 1SW8A 3HX4A 1KSOA 2LMUA 4F0ZB 1PULA 1S26D 2PASA 1DGUA 1NX0A 2COLB 4MSPA 2L2EA 3SG3A 4HREE 4YI9A 1W7JB 2MA2A 1TCFA 4GUKA 1WDCB 2M29A 4WRIA 1A2XA 1UHJA 2JXLA 1YR5A 4IL1A 4OV2A 2LLUA 1IKUA 1PRWA 1SK6D 5D7FA 4CPVA 2TN4A 5AEQA 2PMYA 4JWQA 3I5IB 1YVLA 1JF0A 4N1GA 1JSAA 1NX3A 1SL8A 1XK4C 4HRHA 1BMOA 3EKHA 4CIDA 1YVHA 2PALA 5I2QA 1C7WA 2LVIA 4OKHA 1IH0A 1S5GZ 1UHKA 2M97A 1LA3A 1AJ4A 1JF2A 1BU3A 2BE4A 1OMRA 4YGEB 2F8PA 1CMFA 2KSPA 5CSIA 5KU1A 2KYFA 1OSAA 2BL0C 1Q80A 2KAYA 3SIBA 1XA5A 1LVCD 1CFFA 3KHEA 3OP0A 1NP8A 1BT6A 5DKQA 1AK8A 3CR5X 4GFTA 1MF8B 3BOWB 2RGIA 2K7CA 1TCOB 1Y1AA 2LMVA 4U8DA 1A75B 4YI8A 3TS5C 3H4SE 3DVKA 4QJ4B 3NXAA 1BF5A 5AERA 1K9PA 1DJHA 1SR6B 1ZUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y4Q A;  1KK7 Z;  1XFU O;  1WRL A;  1SMG A;  3VRQ A;  1GJY A;  1FW4 A;  2ZRT A;  2BKI B;  3O4Y A;  4PCW A;  5HKW A;  1AP4 A;  2K2A A;  4XJK A;  2NLN A;  4TNC A;  3EVU A;  3AKA A;  2KGB C;  2WCF A;  1TRF A;  4D1E A;  1Y1X A;  1KFU S;  5CSN A;  1L2O C;  1ZOT B;  1K93 D;  4XJK B;  1QTX A;  4YGD B;  2FOT A;  3CWG A;  1TNQ A;  1TOP A;  2JNX A;  1NWD A;  1HQV A;  2CXJ A;  2OS8 C;  5J3X A;  5I8N A;  1DJY A;  2I7A A;  4M2Q A;  1BR1 B;  1CDL A;  2BEC A;  1OZO A;  1PAL A;  2L0P A;  4M2P A;  3VRN A;  5K89 A;  2I18 A;  3IF7 A;  2LVV A;  1W7I B;  1RWY A;  2LAN A;  2CCM A;  5AFP A;  2Q4U A;  2P6B B;  1EG4 A;  4I5L B;  1KFX S;  5HKZ A;  4AQJ A;  5KSZ A;  3SG6 A;  4PE1 A;  2LLT A;  5KTY A;  1FF1 A;  4XYN A;  2JC2 A;  3NSI A;  4YRU A;  1XYD A;  1XFX O;  3SIA A;  4MZL A;  1SRA A;  3CR4 X;  1SL7 A;  4UPG A;  1TNX A;  1REC A;  2A4J A;  3WHT B;  1S6I A;  3FIA A;  1FBV A;  2BCB A;  2KAX A;  1QJT A;  3AAJ A;  3SJS A;  1B8R A;  4E68 A;  4GBA A;  2E30 A;  1B9A A;  1R2U A;  1YUU A;  4MBE A;  4PDZ A;  4PE0 A;  1YX7 A;  4PAL A;  1JFJ A;  1G4Y R;  2L98 A;  1RRO A;  1BR4 B;  3BXK A;  1CLL A;  3PFV A;  3KO0 A;  3JTD C;  1ALV A;  1DMO A;  1MR8 A;  1DGV A;  2K7B A;  2M0R A;  3KEV A;  1GQM A;  1N0Y A;  1K8U A;  1F4Q A;  2CBL A;  2LHL A;  3DVM A;  1ZAC A;  3GK1 A;  2BBM A;  3MSE B;  2M7L A;  2FCD A;  2ZRS A;  1K2H A;  2LV7 A;  1QLK A;  2MBX A;  1WRK A;  2OS8 B;  4C0K A;  1U5I B;  1DTL A;  1PVA A;  3CS1 A;  2JTT A;  3DD4 A;  5G08 A;  4FTG A;  2JT3 A;  4HRG A;  1DJG A;  2NZ0 A;  2PSR A;  3BQ3 A;  5HLV A;  4MLW A;  1CFC A;  3AAK A;  3ZWH A;  1TN4 A;  1UHH A;  1K90 D;  1BJF A;  3D0Y B;  1SCM B;  5FYX A;  5BPJ A;  1TTX A;  2R2I A;  1YRT B;  4ZCU A;  4N5X A;  2AUC A;  2LHI A;  1XFV O;  4AOM A;  1CKK A;  1KQM C;  1KWO B;  4MEW A;  2K7O A;  1C07 A;  1QX2 A;  1QAT A;  1JUO A;  4PE4 A;  3LK0 A;  2JXC A;  1SPY A;  1B7T Y;  2ZN8 A;  1QIV A;  1V1F A;  1YUT A;  1B7T Z;  5D69 A;  1BG1 A;  1N65 A;  3CLN A;  1K9U A;  1BOD A;  2LAP A;  5HLO A;  1M63 B;  3DVJ A;  3HCM A;  1WLZ A;  2B1U A;  1LA0 A;  1CMG A;  4FQO A;  1CM1 A;  1B4C A;  4USL A;  4YGC B;  4MRY A;  3OX5 A;  4DRW A;  1IWQ A;  1EJ3 A;  3TDI A;  4PHJ A;  3NSO A;  1J1D A;  1OQP A;  3BYA A;  3I5F C;  3PM8 A;  3PN7 B;  5HYD A;  1NPQ A;  3GK2 A;  1MUX A;  2KBM A;  2LLS A;  4L9M A;  2K2F A;  1QV1 A;  2ZKM X;  2WCB A;  3DF0 B;  2KI4 B;  1QLS A;  1CFP A;  1G33 A;  2JRF A;  2PVB A;  4BY5 A;  1CNP A;  3FWC A;  4NQG A;  4NDB A;  1UP5 A;  1M46 A;  1DVI A;  1EH2 A;  2IS9 A;  2M3W A;  1QVI Z;  2HQW A;  1V1G A;  1JFK A;  1FPW A;  1K94 A;  1WY9 A;  3OB1 B;  3CTN A;  2L4H A;  2CTN A;  1S1E A;  2H61 C;  2VRG A;  4NDC A;  4QJ3 B;  5F6T A;  4GGN A;  1KQM B;  1J7P A;  2ZNE A;  1U5I A;  1A75 A;  4GGF A;  4MVF A;  1C7V A;  2G2B A;  2AMI A;  2KDH A;  5CSF A;  1KFU L;  1MXE A;  3FWB A;  4MZK A;  2LP3 A;  3BUO B;  1XFZ O;  1KWO C;  1AJ5 A;  2M1K B;  2KQ6 A;  2CNP A;  1WLM A;  2JOJ A;  2KI6 C;  1EXR A;  1KK8 B;  1F4O A;  5AAN A;  1SCV A;  2LVJ A;  3I5F B;  1NIW A;  3EK7 A;  1H8B A;  1FI5 A;  3WXA A;  1A4P A;  4MRX A;  2NCP A;  1JC2 A;  4DCK A;  1KFX L;  1PK0 D;  2KAV A;  2KFH A;  3A8R A;  1NYA A;  1CTR A;  2BKH B;  3OHM B;  2L51 A;  1MHO A;  4ORA B;  1QX7 A;  2BBN A;  2NXQ A;  2LCP A;  3TUY C;  2LVK A;  3OX6 A;  4PE7 A;  1OMV A;  1BLQ A;  1CLB A;  1LIN A;  2MRD A;  1UHN A;  1K95 A;  1KQV A;  3ZNI A;  1J7Q A;  2LNK A;  1JWD A;  3SG5 A;  4P5O E;  2M1U A;  4PHM A;  3VRO A;  4AQI A;  2O5G A;  4C0J A;  2ZFD A;  1VRK A;  4NDD A;  1AVS A;  2KFG A;  4GNK B;  2KOT A;  2WC8 A;  3PLF B;  1NUB A;  1DJI A;  2L5X B;  2ZN9 A;  3QRX A;  1RK9 A;  1QX5 B;  1QXP A;  3DVE A;  1RFJ A;  1AHR A;  4P2Y B;  1F8H A;  3D0Y A;  1YUS A;  3BUN B;  2ZND A;  1DT7 B;  1DJZ A;  1SBJ A;  2HET A;  2MLE C;  3JVT B;  1L7Z A;  1SYM A;  2NCO A;  3PN7 C;  3A4U B;  2WOS A;  4I5K A;  2HF5 A;  2M8U A;  1A03 A;  2M49 B;  2OTG C;  2EC6 B;  5ER5 A;  1XO5 A;  1WRZ A;  2D8N A;  2GGZ A;  1LKJ A;  4JPZ B;  3DF0 A;  4YGB B;  2PRU A;  4CFQ A;  3GK4 X;  1XK4 A;  2K8M B;  1PSB A;  1S36 A;  2G9B A;  1JBA A;  2L4I A;  2LUC A;  1SCM C;  1CDM A;  1CLM A;  3VGO A;  1YUR A;  1YTZ C;  4DS7 A;  1G8I A;  1B8L A;  3EVV A;  1K9K A;  1HT9 A;  4GAO A;  4CLN A;  2QAC A;  3LK1 A;  1GGZ A;  4ICB A;  2LM5 A;  2JZI A;  1TIZ A;  2L50 A;  5AXI A;  5PAL A;  5JJG A;  4YGA A;  2F2O A;  2KNE A;  2MLF C;  1RJV A;  3F45 A;  3LCP C;  3O6B A;  2ISD A;  1KCY A;  3OB2 B;  3FS7 A;  1M31 A;  2O60 A;  2SAS A;  3ICB A;  1OOJ A;  1NCZ A;  1RTP 1;  1QV0 A;  3BOW A;  2WOR A;  1MXL C;  1B8C A;  4BY4 A;  2MHH A;  1S6J A;  4WQ3 A;  1F71 A;  3GOF A;  3JTD B;  1KK8 C;  4A4C A;  1OZS A;  4WQ2 A;  2KGR A;  2BCA A;  1AUI B;  3PSR A;  5CPV A;  1ZFS A;  3LLE A;  2JQ6 A;  4ETO A;  1CDN A;  1S6C A;  3EK4 A;  2DOQ A;  3WNX B;  1Y6W A;  1H4B A;  2F33 A;  1NX2 A;  1UUR A;  3PAL A;  1FI6 A;  1SR6 C;  2KBI A;  2GV5 A;  3VRR A;  2KI6 D;  2Q91 A;  4I5N B;  2BCX A;  1IGV A;  1F70 A;  1IRJ A;  2JUL A;  2WCE A;  1LXF C;  2H2K A;  2GGM A;  5B8I B;  2F2P A;  1K96 A;  1S5G Y;  2I2R E;  3BUM B;  3TS5 B;  1PSR A;  2BL0 B;  2EC6 C;  4PHN A;  3EK8 A;  1Y1U A;  1GGW A;  1OE9 B;  1F54 A;  1S3P A;  1XFY O;  2WND A;  3CR2 A;  5TNC A;  1NCY A;  3E3R A;  1XFW O;  2LC5 A;  1XVJ A;  2FJU B;  2E6W A;  1IQ3 A;  1R6P A;  4MN0 A;  2KHN A;  4GGF C;  4YBH B;  1CM4 A;  2HPS A;  1J7R A;  1TNP A;  2FCE A;  1N2D A;  1MQ1 A;  3AKB A;  3SG2 A;  2JT0 A;  4ZCV A;  2M7N A;  3LL8 B;  2H61 A;  5JOL A;  1ZMZ A;  1SKT A;  2SCP A;  3IQO A;  1QAS A;  5I2L A;  2QPT A;  2LP2 A;  3O2P A;  5ER4 X;  3TDU A;  4N1F A;  1NX1 A;  1KSM A;  3C1V A;  1A29 A;  4OR9 B;  1CDP A;  2KQY A;  1EG3 A;  4OVN F;  4A4B A;  2MAZ A;  3D10 A;  2JWW A;  3BUX B;  1F55 A;  1PVB A;  1CB1 A;  2K0J A;  3TDZ A;  3I5G C;  1QS7 A;  2Y5I A;  5HKY A;  1MWN A;  2V53 A;  3PAT A;  2OTG B;  1IG5 A;  5DKN A;  1NSH A;  4M2O A;  4JQ0 D;  2M9G A;  1IJ6 A;  1IJ5 A;  3JVT C;  2JTZ A;  4Q04 A;  3SG4 A;  5IBW A;  2F3Z A;  3BUW B;  4C0L A;  1QIW A;  1UHI A;  3I5H C;  2K7D A;  4DUQ A;  1SNL A;  1OMD A;  2JPT A;  4GPL B;  2HQ8 A;  4HSZ A;  4R1E A;  2OPO A;  1M39 A;  1Y0V H;  2LE9 B;  3IQQ A;  2JU0 A;  3I5H B;  1YRU B;  3EVR A;  3RM1 A;  2JT8 A;  1E8A A;  1QVI Y;  1EL4 A;  1IQ5 A;  2LMT A;  2K61 A;  1J7O A;  2AAO A;  5GQQ C;  2BE6 A;  4ORC B;  1DF0 B;  3CZT X;  3O78 A;  4ORB B;  1L2O B;  2JNF A;  1DJW A;  3TUY B;  1ALW A;  2Y1M A;  3KPX A;  4DIR A;  1J1E A;  1CFD A;  3EKJ A;  1DF0 A;  2F3Y A;  3KF9 A;  3K21 A;  2LUX A;  2EHB A;  2KFF A;  3NSL A;  2KI4 C;  1B1G A;  1B47 A;  1NCX A;  3VRP A;  2Y1N A;  2EGD A;  5DKR A;  1M45 A;  4I5J A;  4PHK A;  2I94 A;  5I2O A;  2MJW B;  5CSJ A;  1X02 A;  1YX8 A;  1D1O A;  3CGA A;  4QJ5 B;  1SY9 A;  1KK7 Y;  1WDC C;  1BOC A;  1J55 A;  1DJX A;  1SL9 A;  3M0W A;  3WHU B;  1ODB A;  3RLZ A;  3I5I C;  1UUS A;  4CFR A;  1TNW A;  4MZJ A;  1UWO A;  3I5G B;  4OCI A;  2KYC A;  2CT9 A;  3TZ1 A;  3NSK A;  3SG7 A;  1SW8 A;  3HX4 A;  1KSO A;  2LMU A;  4F0Z B;  1PUL A;  1S26 D;  2PAS A;  1DGU A;  1NX0 A;  2COL B;  4MSP A;  2L2E A;  3SG3 A;  4HRE E;  4YI9 A;  1W7J B;  2MA2 A;  1TCF A;  4GUK A;  1WDC B;  2M29 A;  4WRI A;  1A2X A;  1UHJ A;  2JXL A;  1YR5 A;  4IL1 A;  4OV2 A;  2LLU A;  1IKU A;  1PRW A;  1SK6 D;  5D7F A;  4CPV A;  2TN4 A;  5AEQ A;  2PMY A;  4JWQ A;  3I5I B;  1YVL A;  1JF0 A;  4N1G A;  1JSA A;  1NX3 A;  1SL8 A;  1XK4 C;  4HRH A;  1BMO A;  3EKH A;  4CID A;  1YVH A;  2PAL A;  5I2Q A;  1C7W A;  2LVI A;  4OKH A;  1IH0 A;  1S5G Z;  1UHK A;  2M97 A;  1LA3 A;  1AJ4 A;  1JF2 A;  1BU3 A;  2BE4 A;  1OMR A;  4YGE B;  2F8P A;  1CMF A;  2KSP A;  5CSI A;  5KU1 A;  2KYF A;  1OSA A;  2BL0 C;  1Q80 A;  2KAY A;  3SIB A;  1XA5 A;  1LVC D;  1CFF A;  3KHE A;  3OP0 A;  1NP8 A;  1BT6 A;  5DKQ A;  1AK8 A;  3CR5 X;  4GFT A;  1MF8 B;  3BOW B;  2RGI A;  2K7C A;  1TCO B;  1Y1A A;  2LMV A;  4U8D A;  1A75 B;  4YI8 A;  3TS5 C;  3H4S E;  3DVK A;  4QJ4 B;  3NXA A;  1BF5 A;  5AER A;  1K9P A;  1DJH A;  1SR6 B;  1ZUZ A; 
#chains in the Genus database with same CATH topology
 2Y4Q A;  1KK7 Z;  1XFU O;  1WRL A;  1OOI X;  1SMG A;  3B88 A;  3VRQ A;  1GJY A;  3BFB A;  1FW4 A;  2ZRT A;  2BKI B;  3O4Y A;  4PCW A;  5HKW A;  1AP4 A;  2K2A A;  4XJK A;  2NLN A;  4TNC A;  2QEV A;  2JPO A;  3EVU A;  3AKA A;  3EG5 B;  2KGB C;  2WCF A;  1TRF A;  4D1E A;  1Y1X A;  1KFU S;  5CSN A;  1L2O C;  1ZOT B;  1K93 D;  4XJK B;  1QTX A;  2WC6 A;  4YGD B;  1XFR A;  2FOT A;  3CWG A;  1TNQ A;  1TOP A;  2JNX A;  1NWD A;  1HQV A;  2CXJ A;  2OS8 C;  5J3X A;  1LS8 A;  1DJY A;  2I7A A;  5I8N A;  4M2Q A;  1BR1 B;  1CDL A;  2BEC A;  1OZO A;  1PAL A;  2L0P A;  4M2P A;  3VRN A;  5K89 A;  2I18 A;  3IF7 A;  2LVV A;  1W7I B;  1RWY A;  2LAN A;  4OZD A;  2CCM A;  5AFP A;  2Q4U A;  2P6B B;  1EG4 A;  2P70 A;  4F7F A;  4I5L B;  1KFX S;  3D74 A;  5D3O A;  5HKZ A;  4AQJ A;  5KSZ A;  3SG6 A;  4PE1 A;  2LLT A;  3CDN A;  3S0G A;  5KTY A;  1FF1 A;  4XYN A;  2JC2 A;  3NSI A;  4YRU A;  1XYD A;  1XFX O;  3SIA A;  4MZL A;  1C3Y A;  1SRA A;  3CR4 X;  1SL7 A;  4UPG A;  1TNX A;  1REC A;  2A4J A;  3WHT B;  1S6I A;  3BFH A;  3FIA A;  1FBV A;  2BCB A;  2KAX A;  1QJT A;  3AAJ A;  4JKT A;  1B8R A;  3SJS A;  4E68 A;  4GBA A;  2E30 A;  1B9A A;  1R2U A;  1YUU A;  4MBE A;  4PDZ A;  1QWV A;  4PE0 A;  1YX7 A;  4PAL A;  1JFJ A;  1G4Y R;  2L98 A;  1RRO A;  1BR4 B;  3BXK A;  3L4A A;  1TWO A;  1CLL A;  3PFV A;  3KO0 A;  3JTD C;  1ALV A;  3PM2 A;  1DMO A;  1MR8 A;  1DGV A;  3DXL A;  2K7B A;  2M0R A;  3KEV A;  1GQM A;  1N0Y A;  1K8U A;  1F4Q A;  2CBL A;  2LHL A;  3DVM A;  1ZAC A;  3GK1 A;  2BBM A;  3MSE B;  2M7L A;  2FCD A;  3OGN A;  2ZRS A;  1K2H A;  2LV7 A;  3S0F A;  1QLK A;  2MBX A;  1WRK A;  2OS8 B;  4C0K A;  1U5I B;  1DTL A;  1PVA A;  3CS1 A;  5EL2 A;  2JTT A;  1Z4H A;  3DD4 A;  5G08 A;  4FTG A;  2JT3 A;  4HRG A;  1DJG A;  2NZ0 A;  2PSR A;  3BQ3 A;  5HLV A;  4MLW A;  1CFC A;  3AAK A;  3D75 A;  3Q8I A;  3ZWH A;  1TN4 A;  3CZ0 A;  1GM0 A;  1UHH A;  1K90 D;  1BJF A;  3D0Y B;  1SCM B;  5FI2 A;  5FYX A;  1TTX A;  5BPJ A;  2R2I A;  1YRT B;  4ZCU A;  4N5X A;  2AUC A;  2LHI A;  1XFV O;  4AOM A;  1CKK A;  1KQM C;  1KWO B;  4MEW A;  2K7O A;  1C07 A;  1QX2 A;  1QAT A;  1JUO A;  4PE4 A;  3LK0 A;  2JXC A;  1SPY A;  1B7T Y;  2ZN8 A;  1QIV A;  1V1F A;  1YUT A;  1B7T Z;  5D69 A;  1BG1 A;  1N65 A;  3CLN A;  1K9U A;  1BOD A;  2L5Y A;  2LAP A;  5HLO A;  1M63 B;  3DVJ A;  3HCM A;  1WLZ A;  2B1U A;  1LA0 A;  3K1E A;  1CMG A;  4FQO A;  1CM1 A;  1B4C A;  4USL A;  4YGC B;  3OBV A;  4MRY A;  3OX5 A;  3CZ2 A;  4DRW A;  1IWQ A;  1EJ3 A;  4INW A;  3TDI A;  4PHJ A;  3NSO A;  1J1D A;  1OQP A;  3BYA A;  3I5F C;  3PM8 A;  3PN7 B;  5HYD A;  1NPQ A;  3GK2 A;  1MUX A;  2KBM A;  2LLS A;  4L9M A;  2K2F A;  1QV1 A;  2ZKM X;  2WCB A;  3DF0 B;  2KI4 B;  1QLS A;  1DC1 A;  3N7H A;  1CFP A;  1G33 A;  2JRF A;  2PVB A;  2QEH A;  4BY5 A;  3FWC A;  1CNP A;  4NQG A;  4NDB A;  1UP5 A;  1M46 A;  1DVI A;  1EH2 A;  2IS9 A;  2M3W A;  1QVI Z;  2HQW A;  1V1G A;  1JFK A;  1FPW A;  1K94 A;  1WY9 A;  3OB1 B;  3CTN A;  2L4H A;  2CTN A;  1S1E A;  2H61 C;  2VRG A;  3BFA A;  4NDC A;  4QJ3 B;  5F6T A;  3VB1 A;  4GGN A;  1KQM B;  1J7P A;  2ZNE A;  1U5I A;  1A75 A;  4GGF A;  4MVF A;  1C7V A;  3D77 A;  2G2B A;  2AMI A;  2KDH A;  5CSF A;  1KFU L;  1MXE A;  3FWB A;  1OW4 A;  2LP3 A;  3BUO B;  4MZK A;  2WCK A;  1XFZ O;  1KWO C;  3UNW A;  1AJ5 A;  2M1K B;  2KQ6 A;  2CNP A;  1WLM A;  3CAB A;  2JOJ A;  2KI6 C;  1EXR A;  1KK8 B;  1F4O A;  5AAN A;  1SCV A;  2LVJ A;  1FI6 A;  3I5F B;  1NIW A;  1TUJ A;  3EK7 A;  1H8B A;  3SS5 A;  3WXA A;  1FI5 A;  1A4P A;  4MRX A;  2NCP A;  1JC2 A;  4DCK A;  1KFX L;  1PK0 D;  2KAV A;  2KFH A;  3A8R A;  3DZT A;  1NYA A;  1CTR A;  2BKH B;  1TUZ A;  2L51 A;  2WCM A;  1MHO A;  3OHM B;  4ORA B;  1QX7 A;  2BBN A;  2NXQ A;  2LCP A;  3TUY C;  2LVK A;  3OX6 A;  3PJI A;  4PE7 A;  1OMV A;  1BLQ A;  1CLB A;  5FI7 A;  1LIN A;  2MRD A;  1UHN A;  1K95 A;  1KQV A;  3ZNI A;  1J7Q A;  2LNK A;  1JWD A;  3S0E A;  3SG5 A;  4P5O E;  2M1U A;  4PHM A;  3VRO A;  5FI6 A;  4AQI A;  2O5G A;  2QEB A;  4C0J A;  2ZFD A;  1VRK A;  4NDD A;  1AVS A;  3SS4 A;  2KFG A;  4GNK B;  2KOT A;  2WC8 A;  3PLF B;  1NUB A;  1DJI A;  2L5X B;  2ZN9 A;  3QRX A;  1RK9 A;  1QX5 B;  1W9Z A;  1QXP A;  3DVE A;  3FE6 A;  1RFJ A;  1AHR A;  4P2Y B;  1F8H A;  3D0Y A;  1YUS A;  3BUN B;  2ZND A;  1DT7 B;  3B87 A;  1DJZ A;  1SBJ A;  2HET A;  2MLE C;  3JVT B;  1L7Z A;  1SYM A;  2NCO A;  3PN7 C;  3A4U B;  2WOS A;  4I5K A;  3L47 A;  2HF5 A;  2M8U A;  1A03 A;  2M49 B;  2OTG C;  2EC6 B;  5ER5 A;  1XO5 A;  1WRZ A;  2D8N A;  2GGZ A;  2QDI A;  1LKJ A;  4JPZ B;  3DF0 A;  4YGB B;  2PRU A;  1DQE A;  4CFQ A;  3GK4 X;  1XK4 A;  2H8V A;  2K8M B;  1PSB A;  1S36 A;  2G9B A;  3DYE A;  1JBA A;  2L4I A;  2LUC A;  1SCM C;  1CDM A;  1CLM A;  3VGO A;  1YUR A;  1YTZ C;  4DS7 A;  1G8I A;  1B8L A;  3EVV A;  1K9K A;  1HT9 A;  3D73 A;  4GAO A;  4CLN A;  2QAC A;  3LK1 A;  3BJH A;  1GGZ A;  4ICB A;  2LM5 A;  2JZI A;  1TIZ A;  2L50 A;  5AXI A;  5PAL A;  5JJG A;  3B86 A;  4YGA A;  2F2O A;  2KNE A;  2MLF C;  1RJV A;  3S0B A;  3F45 A;  3LCP C;  3O6B A;  2ISD A;  5I94 A;  1KCY A;  2L2C A;  3FE9 A;  3OB2 B;  3FS7 A;  1M31 A;  2O60 A;  2SAS A;  3ICB A;  1OOJ A;  1NCZ A;  1RTP 1;  1QV0 A;  3BOW A;  2WOR A;  1MXL C;  1B8C A;  4BY4 A;  2MHH A;  1S6J A;  4WQ3 A;  1F71 A;  3GOF A;  3JTD B;  1KK8 C;  4A4C A;  1OZS A;  4WQ2 A;  2KGR A;  2BCA A;  1IIO A;  1AUI B;  3PSR A;  5CPV A;  3RZS A;  3O4X A;  1ZFS A;  3LLE A;  2JQ6 A;  3QME A;  4ETO A;  1CDN A;  1S6C A;  3EK4 A;  2DOQ A;  3WNX B;  1Y6W A;  5HL1 A;  1H4B A;  2F33 A;  1NX2 A;  1UUR A;  2FJY A;  1DEL A;  1SR6 C;  2KBI A;  2GV5 A;  3PAL A;  2KI6 D;  2Q91 A;  4I5N B;  2BCX A;  3VRR A;  1IGV A;  4JD9 A;  1F70 A;  1IRJ A;  2JUL A;  2WCE A;  1LXF C;  2H2K A;  3D76 A;  2GGM A;  5B8I B;  2F2P A;  1K96 A;  1S5G Y;  2I2R E;  3BUM B;  3TS5 B;  2K60 A;  1PSR A;  2BAP A;  2EC6 C;  2BL0 B;  4PHN A;  3EK8 A;  3CZ1 A;  1Y1U A;  2PYQ A;  1GGW A;  1OE9 B;  2ERB A;  1F54 A;  1S3P A;  1XFY O;  2WND A;  3CR2 A;  5TNC A;  1C3Z A;  1NCY A;  1XFW O;  3E3R A;  3B7A A;  2LC5 A;  1XVJ A;  2FJU B;  2E6W A;  1IQ3 A;  1R6P A;  4MN0 A;  1OOF A;  2KHN A;  4GGF C;  2KLE A;  4YBH B;  1CM4 A;  1P28 A;  2HPS A;  1J7R A;  1TNP A;  2FCE A;  1N2D A;  1MQ1 A;  3AKB A;  3SG2 A;  2JT0 A;  4ZCV A;  2M7N A;  3LL8 B;  2H61 A;  3CYZ A;  5JOL A;  1SSE B;  1ZMZ A;  1SKT A;  2SCP A;  3IQO A;  1QAS A;  5I2L A;  2QPT A;  4IJ7 A;  2LP2 A;  3O2P A;  4FQT A;  5ER4 X;  3TDU A;  4N1F A;  1NX1 A;  1KSM A;  3B6X A;  1A29 A;  3C1V A;  4OR9 B;  1T14 A;  1CDP A;  3NHT A;  2KQY A;  3S0D A;  2PQL A;  1EG3 A;  2QEO A;  4OVN F;  4A4B A;  2MAZ A;  3D10 A;  2JWW A;  2KPH A;  3BUX B;  1PVB A;  1CB1 A;  2WCL A;  2K0J A;  1F55 A;  1DEK A;  3TDZ A;  3I5G C;  1OOG A;  1QS7 A;  2Y5I A;  5HKY A;  1MWN A;  2V53 A;  3PAT A;  2OTG B;  1IG5 A;  5DKN A;  1NSH A;  4M2O A;  3UO9 A;  4JQ0 D;  2M9G A;  3R1P A;  1IJ6 A;  1IJ5 A;  3JVT C;  4INX A;  2JTZ A;  4Q04 A;  3SG4 A;  5IBW A;  2F3Z A;  3BUW B;  4C0L A;  1QIW A;  1UHI A;  3FE8 A;  3I5H C;  2K7D A;  4DUQ A;  1SNL A;  3DY9 A;  1OMD A;  2JPT A;  4GPL B;  2HQ8 A;  4HSZ A;  4R1E A;  2OPO A;  1M39 A;  1Y0V H;  2LE9 B;  3IQQ A;  2JU0 A;  3I5H B;  1YRU B;  3EVR A;  3RM1 A;  2JT8 A;  1E8A A;  1QVI Y;  1EL4 A;  1IQ5 A;  2LMT A;  2K61 A;  1J7O A;  2AAO A;  3R1O A;  5GQQ C;  2BE6 A;  4ORC B;  1DF0 B;  3CZT X;  3O78 A;  4ORB B;  1L2O B;  2JNF A;  1DJW A;  3TUY B;  1ALW A;  2Y1M A;  3KPX A;  4DIR A;  1J1E A;  1CFD A;  3EKJ A;  1DF0 A;  2F3Y A;  3D78 A;  3K21 A;  3KF9 A;  2LUX A;  2GTE A;  2KLD A;  2EHB A;  2KFF A;  3NSL A;  2KI4 C;  1B1G A;  1B47 A;  1NCX A;  3VRP A;  2Y1N A;  2WC5 A;  2EGD A;  5DKR A;  1Z2C B;  1M45 A;  4I5J A;  4PHK A;  2I94 A;  5I2O A;  2MJW B;  5CSJ A;  1X02 A;  1YX8 A;  1D1O A;  3CGA A;  4QJ5 B;  3SS3 A;  1SY9 A;  1KK7 Y;  1WDC C;  1BOC A;  2P71 A;  1J55 A;  1DJX A;  1SL9 A;  3M0W A;  3WHU B;  1ODB A;  3RLZ A;  3I5I C;  1UUS A;  4CFR A;  1TNW A;  4MZJ A;  1UWO A;  3I5G B;  4PT1 A;  4OCI A;  2KYC A;  2CT9 A;  3TZ1 A;  3NSK A;  3SG7 A;  1SW8 A;  3HX4 A;  1KSO A;  2LMU A;  4F0Z B;  1PUL A;  1S26 D;  2PAS A;  1OOH A;  1DGU A;  1NX0 A;  2COL B;  4MSP A;  2L2E A;  3SG3 A;  4HRE E;  4YI9 A;  1W7J B;  2MA2 A;  1TCF A;  4GUK A;  1WDC B;  2M29 A;  4WRI A;  1A2X A;  1UHJ A;  2JXL A;  1YR5 A;  4IL1 A;  4OV2 A;  2LLU A;  4KYN A;  1IKU A;  1PRW A;  1SK6 D;  5D7F A;  4CPV A;  2TN4 A;  5AEQ A;  2PMY A;  4JWQ A;  3I5I B;  3R1V A;  3V2L A;  1YVL A;  1JF0 A;  4N1G A;  1JSA A;  1NX3 A;  1SL8 A;  1XK4 C;  4HRH A;  1BMO A;  3EKH A;  4CID A;  1YVH A;  2PAL A;  2WCJ A;  1C7W A;  5I2Q A;  2LVI A;  3NHI A;  4OKH A;  5DIC A;  1IH0 A;  1S5G Z;  1UHK A;  3R72 A;  2M97 A;  3IVT A;  1LA3 A;  1AJ4 A;  1JF2 A;  1BU3 A;  2BE4 A;  1OMR A;  4YGE B;  2F8P A;  3NGV A;  1CMF A;  2WCH A;  2KSP A;  2YGU A;  5CSI A;  2BNX A;  3L4L A;  5KU1 A;  2KYF A;  1OSA A;  2BL0 C;  1Q80 A;  2KAY A;  3SIB A;  1XA5 A;  1LVC D;  1CFF A;  3KHE A;  3OP0 A;  1NP8 A;  1BT6 A;  5DKQ A;  1AK8 A;  3S0A A;  3CR5 X;  4GFT A;  1MF8 B;  3BOW B;  2RGI A;  2K7C A;  1TCO B;  1Y1A A;  2LMV A;  4U8D A;  1A75 B;  4YI8 A;  3TS5 C;  3H4S E;  3DVK A;  4QJ4 B;  3NXA A;  1BF5 A;  5AER A;  1K9P A;  1DJH A;  1ORG A;  1SR6 B;  1ZUZ A; 
#chains in the Genus database with same CATH homology
 2Y4Q A;  1KK7 Z;  1XFU O;  1WRL A;  1SMG A;  3VRQ A;  1GJY A;  1FW4 A;  2ZRT A;  2BKI B;  3O4Y A;  4PCW A;  5HKW A;  1AP4 A;  2K2A A;  4XJK A;  2NLN A;  4TNC A;  3EVU A;  3AKA A;  2KGB C;  2WCF A;  1TRF A;  4D1E A;  1Y1X A;  1KFU S;  5CSN A;  1L2O C;  1ZOT B;  1K93 D;  4XJK B;  1QTX A;  4YGD B;  2FOT A;  3CWG A;  1TNQ A;  1TOP A;  2JNX A;  1NWD A;  1HQV A;  2CXJ A;  2OS8 C;  5J3X A;  5I8N A;  1DJY A;  2I7A A;  4M2Q A;  1BR1 B;  1CDL A;  2BEC A;  1OZO A;  1PAL A;  2L0P A;  4M2P A;  3VRN A;  5K89 A;  2I18 A;  3IF7 A;  2LVV A;  1W7I B;  1RWY A;  2LAN A;  2CCM A;  5AFP A;  2Q4U A;  2P6B B;  1EG4 A;  4I5L B;  1KFX S;  5HKZ A;  4AQJ A;  5KSZ A;  3SG6 A;  4PE1 A;  2LLT A;  5KTY A;  1FF1 A;  4XYN A;  2JC2 A;  3NSI A;  4YRU A;  1XYD A;  1XFX O;  3SIA A;  4MZL A;  1SRA A;  3CR4 X;  1SL7 A;  4UPG A;  1TNX A;  1REC A;  2A4J A;  3WHT B;  1S6I A;  3FIA A;  1FBV A;  2BCB A;  2KAX A;  1QJT A;  3AAJ A;  3SJS A;  1B8R A;  4E68 A;  4GBA A;  2E30 A;  1B9A A;  1R2U A;  1YUU A;  4MBE A;  4PDZ A;  4PE0 A;  1YX7 A;  4PAL A;  1JFJ A;  1G4Y R;  2L98 A;  1RRO A;  1BR4 B;  3BXK A;  1CLL A;  3PFV A;  3KO0 A;  3JTD C;  1ALV A;  1DMO A;  1MR8 A;  1DGV A;  2K7B A;  2M0R A;  3KEV A;  1GQM A;  1N0Y A;  1K8U A;  1F4Q A;  2CBL A;  2LHL A;  3DVM A;  1ZAC A;  3GK1 A;  2BBM A;  3MSE B;  2M7L A;  2FCD A;  2ZRS A;  1K2H A;  2LV7 A;  1QLK A;  2MBX A;  1WRK A;  2OS8 B;  4C0K A;  1U5I B;  1DTL A;  1PVA A;  3CS1 A;  2JTT A;  3DD4 A;  5G08 A;  4FTG A;  2JT3 A;  4HRG A;  1DJG A;  2NZ0 A;  2PSR A;  3BQ3 A;  5HLV A;  4MLW A;  1CFC A;  3AAK A;  3ZWH A;  1TN4 A;  1UHH A;  1K90 D;  1BJF A;  3D0Y B;  1SCM B;  5FYX A;  5BPJ A;  1TTX A;  2R2I A;  1YRT B;  4ZCU A;  4N5X A;  2AUC A;  2LHI A;  1XFV O;  4AOM A;  1CKK A;  1KQM C;  1KWO B;  4MEW A;  2K7O A;  1C07 A;  1QX2 A;  1QAT A;  1JUO A;  4PE4 A;  3LK0 A;  2JXC A;  1SPY A;  1B7T Y;  2ZN8 A;  1QIV A;  1V1F A;  1YUT A;  1B7T Z;  5D69 A;  1BG1 A;  1N65 A;  3CLN A;  1K9U A;  1BOD A;  2LAP A;  5HLO A;  1M63 B;  3DVJ A;  3HCM A;  1WLZ A;  2B1U A;  1LA0 A;  1CMG A;  4FQO A;  1CM1 A;  1B4C A;  4USL A;  4YGC B;  4MRY A;  3OX5 A;  4DRW A;  1IWQ A;  1EJ3 A;  3TDI A;  4PHJ A;  3NSO A;  1J1D A;  1OQP A;  3BYA A;  3I5F C;  3PM8 A;  3PN7 B;  5HYD A;  1NPQ A;  3GK2 A;  1MUX A;  2KBM A;  2LLS A;  4L9M A;  2K2F A;  1QV1 A;  2ZKM X;  2WCB A;  3DF0 B;  2KI4 B;  1QLS A;  1CFP A;  1G33 A;  2JRF A;  2PVB A;  4BY5 A;  1CNP A;  3FWC A;  4NQG A;  4NDB A;  1UP5 A;  1M46 A;  1DVI A;  1EH2 A;  2IS9 A;  2M3W A;  1QVI Z;  2HQW A;  1V1G A;  1JFK A;  1FPW A;  1K94 A;  1WY9 A;  3OB1 B;  3CTN A;  2L4H A;  2CTN A;  1S1E A;  2H61 C;  2VRG A;  4NDC A;  4QJ3 B;  5F6T A;  4GGN A;  1KQM B;  1J7P A;  2ZNE A;  1U5I A;  1A75 A;  4GGF A;  4MVF A;  1C7V A;  2G2B A;  2AMI A;  2KDH A;  5CSF A;  1KFU L;  1MXE A;  3FWB A;  4MZK A;  2LP3 A;  3BUO B;  1XFZ O;  1KWO C;  1AJ5 A;  2M1K B;  2KQ6 A;  2CNP A;  1WLM A;  2JOJ A;  2KI6 C;  1EXR A;  1KK8 B;  1F4O A;  5AAN A;  1SCV A;  2LVJ A;  3I5F B;  1NIW A;  3EK7 A;  1H8B A;  1FI5 A;  3WXA A;  1A4P A;  4MRX A;  2NCP A;  1JC2 A;  4DCK A;  1KFX L;  1PK0 D;  2KAV A;  2KFH A;  3A8R A;  1NYA A;  1CTR A;  2BKH B;  3OHM B;  2L51 A;  1MHO A;  4ORA B;  1QX7 A;  2BBN A;  2NXQ A;  2LCP A;  3TUY C;  2LVK A;  3OX6 A;  4PE7 A;  1OMV A;  1BLQ A;  1CLB A;  1LIN A;  2MRD A;  1UHN A;  1K95 A;  1KQV A;  3ZNI A;  1J7Q A;  2LNK A;  1JWD A;  3SG5 A;  4P5O E;  2M1U A;  4PHM A;  3VRO A;  4AQI A;  2O5G A;  4C0J A;  2ZFD A;  1VRK A;  4NDD A;  1AVS A;  2KFG A;  4GNK B;  2KOT A;  2WC8 A;  3PLF B;  1NUB A;  1DJI A;  2L5X B;  2ZN9 A;  3QRX A;  1RK9 A;  1QX5 B;  1QXP A;  3DVE A;  1RFJ A;  1AHR A;  4P2Y B;  1F8H A;  3D0Y A;  1YUS A;  3BUN B;  2ZND A;  1DT7 B;  1DJZ A;  1SBJ A;  2HET A;  2MLE C;  3JVT B;  1L7Z A;  1SYM A;  2NCO A;  3PN7 C;  3A4U B;  2WOS A;  4I5K A;  2HF5 A;  2M8U A;  1A03 A;  2M49 B;  2OTG C;  2EC6 B;  5ER5 A;  1XO5 A;  1WRZ A;  2D8N A;  2GGZ A;  1LKJ A;  4JPZ B;  3DF0 A;  4YGB B;  2PRU A;  4CFQ A;  3GK4 X;  1XK4 A;  2K8M B;  1PSB A;  1S36 A;  2G9B A;  1JBA A;  2L4I A;  2LUC A;  1SCM C;  1CDM A;  1CLM A;  3VGO A;  1YUR A;  1YTZ C;  4DS7 A;  1G8I A;  1B8L A;  3EVV A;  1K9K A;  1HT9 A;  4GAO A;  4CLN A;  2QAC A;  3LK1 A;  1GGZ A;  4ICB A;  2LM5 A;  2JZI A;  1TIZ A;  2L50 A;  5AXI A;  5PAL A;  5JJG A;  4YGA A;  2F2O A;  2KNE A;  2MLF C;  1RJV A;  3F45 A;  3LCP C;  3O6B A;  2ISD A;  1KCY A;  3OB2 B;  3FS7 A;  1M31 A;  2O60 A;  2SAS A;  3ICB A;  1OOJ A;  1NCZ A;  1RTP 1;  1QV0 A;  3BOW A;  2WOR A;  1MXL C;  1B8C A;  4BY4 A;  2MHH A;  1S6J A;  4WQ3 A;  1F71 A;  3GOF A;  3JTD B;  1KK8 C;  4A4C A;  1OZS A;  4WQ2 A;  2KGR A;  2BCA A;  1AUI B;  3PSR A;  5CPV A;  1ZFS A;  3LLE A;  2JQ6 A;  4ETO A;  1CDN A;  1S6C A;  3EK4 A;  2DOQ A;  3WNX B;  1Y6W A;  1H4B A;  2F33 A;  1NX2 A;  1UUR A;  3PAL A;  1FI6 A;  1SR6 C;  2KBI A;  2GV5 A;  3VRR A;  2KI6 D;  2Q91 A;  4I5N B;  2BCX A;  1IGV A;  1F70 A;  1IRJ A;  2JUL A;  2WCE A;  1LXF C;  2H2K A;  2GGM A;  5B8I B;  2F2P A;  1K96 A;  1S5G Y;  2I2R E;  3BUM B;  3TS5 B;  1PSR A;  2BL0 B;  2EC6 C;  4PHN A;  3EK8 A;  1Y1U A;  1GGW A;  1OE9 B;  1F54 A;  1S3P A;  1XFY O;  2WND A;  3CR2 A;  5TNC A;  1NCY A;  3E3R A;  1XFW O;  2LC5 A;  1XVJ A;  2FJU B;  2E6W A;  1IQ3 A;  1R6P A;  4MN0 A;  2KHN A;  4GGF C;  4YBH B;  1CM4 A;  2HPS A;  1J7R A;  1TNP A;  2FCE A;  1N2D A;  1MQ1 A;  3AKB A;  3SG2 A;  2JT0 A;  4ZCV A;  2M7N A;  3LL8 B;  2H61 A;  5JOL A;  1ZMZ A;  1SKT A;  2SCP A;  3IQO A;  1QAS A;  5I2L A;  2QPT A;  2LP2 A;  3O2P A;  5ER4 X;  3TDU A;  4N1F A;  1NX1 A;  1KSM A;  3C1V A;  1A29 A;  4OR9 B;  1CDP A;  2KQY A;  1EG3 A;  4OVN F;  4A4B A;  2MAZ A;  3D10 A;  2JWW A;  3BUX B;  1F55 A;  1PVB A;  1CB1 A;  2K0J A;  3TDZ A;  3I5G C;  1QS7 A;  2Y5I A;  5HKY A;  1MWN A;  2V53 A;  3PAT A;  2OTG B;  1IG5 A;  5DKN A;  1NSH A;  4M2O A;  4JQ0 D;  2M9G A;  1IJ6 A;  1IJ5 A;  3JVT C;  2JTZ A;  4Q04 A;  3SG4 A;  5IBW A;  2F3Z A;  3BUW B;  4C0L A;  1QIW A;  1UHI A;  3I5H C;  2K7D A;  4DUQ A;  1SNL A;  1OMD A;  2JPT A;  4GPL B;  2HQ8 A;  4HSZ A;  4R1E A;  2OPO A;  1M39 A;  1Y0V H;  2LE9 B;  3IQQ A;  2JU0 A;  3I5H B;  1YRU B;  3EVR A;  3RM1 A;  2JT8 A;  1E8A A;  1QVI Y;  1EL4 A;  1IQ5 A;  2LMT A;  2K61 A;  1J7O A;  2AAO A;  5GQQ C;  2BE6 A;  4ORC B;  1DF0 B;  3CZT X;  3O78 A;  4ORB B;  1L2O B;  2JNF A;  1DJW A;  3TUY B;  1ALW A;  2Y1M A;  3KPX A;  4DIR A;  1J1E A;  1CFD A;  3EKJ A;  1DF0 A;  2F3Y A;  3KF9 A;  3K21 A;  2LUX A;  2EHB A;  2KFF A;  3NSL A;  2KI4 C;  1B1G A;  1B47 A;  1NCX A;  3VRP A;  2Y1N A;  2EGD A;  5DKR A;  1M45 A;  4I5J A;  4PHK A;  2I94 A;  5I2O A;  2MJW B;  5CSJ A;  1X02 A;  1YX8 A;  1D1O A;  3CGA A;  4QJ5 B;  1SY9 A;  1KK7 Y;  1WDC C;  1BOC A;  1J55 A;  1DJX A;  1SL9 A;  3M0W A;  3WHU B;  1ODB A;  3RLZ A;  3I5I C;  1UUS A;  4CFR A;  1TNW A;  4MZJ A;  1UWO A;  3I5G B;  4OCI A;  2KYC A;  2CT9 A;  3TZ1 A;  3NSK A;  3SG7 A;  1SW8 A;  3HX4 A;  1KSO A;  2LMU A;  4F0Z B;  1PUL A;  1S26 D;  2PAS A;  1DGU A;  1NX0 A;  2COL B;  4MSP A;  2L2E A;  3SG3 A;  4HRE E;  4YI9 A;  1W7J B;  2MA2 A;  1TCF A;  4GUK A;  1WDC B;  2M29 A;  4WRI A;  1A2X A;  1UHJ A;  2JXL A;  1YR5 A;  4IL1 A;  4OV2 A;  2LLU A;  1IKU A;  1PRW A;  1SK6 D;  5D7F A;  4CPV A;  2TN4 A;  5AEQ A;  2PMY A;  4JWQ A;  3I5I B;  1YVL A;  1JF0 A;  4N1G A;  1JSA A;  1NX3 A;  1SL8 A;  1XK4 C;  4HRH A;  1BMO A;  3EKH A;  4CID A;  1YVH A;  2PAL A;  5I2Q A;  1C7W A;  2LVI A;  4OKH A;  1IH0 A;  1S5G Z;  1UHK A;  2M97 A;  1LA3 A;  1AJ4 A;  1JF2 A;  1BU3 A;  2BE4 A;  1OMR A;  4YGE B;  2F8P A;  1CMF A;  2KSP A;  5CSI A;  5KU1 A;  2KYF A;  1OSA A;  2BL0 C;  1Q80 A;  2KAY A;  3SIB A;  1XA5 A;  1LVC D;  1CFF A;  3KHE A;  3OP0 A;  1NP8 A;  1BT6 A;  5DKQ A;  1AK8 A;  3CR5 X;  4GFT A;  1MF8 B;  3BOW B;  2RGI A;  2K7C A;  1TCO B;  1Y1A A;  2LMV A;  4U8D A;  1A75 B;  4YI8 A;  3TS5 C;  3H4S E;  3DVK A;  4QJ4 B;  3NXA A;  1BF5 A;  5AER A;  1K9P A;  1DJH A;  1SR6 B;  1ZUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...