2OS8B

Rigor-like structures of muscle myosins reveal key mechanical elements in the transduction pathways of this allosteric motor
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
135
structure length
135
Chain Sequence
b'IQEMKEAFTMIDQNRDGFIDINDLKEMFSSLGRTPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFGMFDELDTKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVRFVAMIKGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin heavy chain
publication title Rigor-like Structures from Muscle Myosins Reveal Key Mechanical Elements in the Transduction Pathways of This Allosteric Motor.
pubmed doi rcsb
molecule tags Contractile protein
total genus 24
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2007-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2os8B01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2os8B02
4YGBB 1CDPA 2O5GA 2K2AA 3VRRA 1AVSA 3SG6A 1QATA 4PE4A 3LLEA 3VRNA 1BODA 1DVIA 2BE4A 1JUOA 3OB2B 1HT9A 4OV2A 1KFUL 1IH0A 2LCPA 3BUNB 1WY9A 2K2FA 1CKKA 1AHRA 1DJGA 1NUBA 1S36A 1XFZO 1NIWA 2CNPA 2ZNDA 2PVBA 1S3PA 1ZACA 2KGRA 4MLWA 4PHJA 2MAZA 1XK4C 1B9AA 1OZOA 3I5HB 4MEWA 4PCWA 3DD4A 2CXJA 4OKHA 1J7RA 1YR5A 1K9UA 2LVIA 2CT9A 3I5HC 1QVIZ 1B8LA 3O2PA 4N1FA 2OS8B 3AAJA 2JPTA 5JJGA 2ZKMX 1BOCA 2G9BA 1RWYA 3AKBA 1YRUB 1IJ5A 4PE7A 1JC2A 2PASA 2OS8C 1OMDA 4MRXA 1B1GA 1CLBA 1ZMZA 1DMOA 1MR8A 1CLMA 3QRXA 1KFXS 1ALVA 1PSRA 2K61A 2MJWB 3KO0A 2BBNA 1WRLA 4DUQA 2G2BA 2Q4UA 2BE6A 1UUSA 1QX7A 3HX4A 5AXIA 3AAKA 1OZSA 3DVMA 1IWQA 2JU0A 1CB1A 1BU3A 1TN4A 3BXKA 3BQ3A 1PSBA 1CFFA 1NX0A 2M97A 1TNPA 2LV7A 3CR4X 2KFGA 3IQQA 3TDZA 1TNXA 2WC8A 4BY5A 2CBLA 1OMRA 1AK8A 2ZFDA 1KK8B 1SCVA 1A75A 2JT8A 1AP4A 1SL7A 1WRKA 2Y5IA 5HKZA 1PRWA 2NXQA 4JPZB 1DJYA 4MSPA 1SMGA 1L7ZA 1XA5A 3SIAA 1CFPA 1N65A 2M1UA 3SIBA 4I5LB 2FCEA 1NCZA 2FOTA 2KI6D 2OTGB 4M2QA 3TZ1A 1V1FA 1SK6D 1DT7B 1R6PA 2M8UA 2F2PA 4GGNA 1FPWA 2LANA 2CCMA 3CS1A 4IL1A 3SG2A 2V53A 1G8IA 1BT6A 2OTGC 1IQ3A 3EK7A 4HRHA 1UWOA 3PLFB 1DF0B 1QVIY 1J7QA 1CM4A 1K94A 2KYFA 4ICBA 5CSFA 1RJVA 1GGWA 1SKTA 5HYDA 1K90D 2KHNA 1J1DA 4I5KA 4PDZA 2LNKA 1W7IB 1M63B 1LA3A 3EVRA 2LHIA 3BOWB 4BY4A 2LAPA 2QPTA 2KAYA 1DJHA 1SL9A 3CWGA 1EXRA 4OCIA 3I5GC 3O4YA 2BL0B 1K93D 1B8CA 3CZTX 4PE0A 1NYAA 1AJ5A 1EG3A 2LM5A 5DKNA 4ZCVA 1K95A 1KFXL 1NCYA 2BL0C 1QS7A 2KI4B 4GAOA 4F0ZB 2HPSA 2LLUA 3EK4A 2LP2A 2KI4C 1NX2A 1B47A 2ZNEA 1XK4A 1QLKA 3WHTB 1C7VA 3WHUB 5HKWA 3I5IB 2L50A 3VGOA 1EJ3A 3WXAA 3AKAA 1OOJA 1DGUA 4MZLA 3K21A 4NDCA 1NWDA 3I5IC 3KHEA 5I8NA 1TIZA 2BECA 3PALA 4I5JA 4PHNA 5FYXA 1XFXO 1GQMA 2D8NA 2VRGA 1QLSA 1SY9A 2KYCA 1JF2A 1OQPA 2H61C 4CLNA 3OX6A 4GGFC 5ER5A 3FWBA 2BBMA 2OPOA 4PE1A 4MBEA 1M39A 1U5IA 2NCOA 2MBXA 3RM1A 1MXEA 1MUXA 5AFPA 1J1EA 4P2YB 4USLA 4GUKA 1BG1A 3FS7A 5BPJA 3GOFA 3EKJA 4HSZA 1HQVA 5CSJA 1M31A 4NDDA 3EK8A 1F55A 1XFYO 4XYNA 1JBAA 1CDLA 2KI6C 3ICBA 3NXAA 4DCKA 4C0JA 5I2LA 2WCBA 1ZUZA 1LVCD 1QIVA 2LVVA 4DIRA 1Y1XA 4YGAA 3O6BA 2L2EA 2L98A 3OB1B 4CFQA 1JWDA 1KK7Z 1YX8A 4ORCB 4AQJA 1W7JB 5GQQC 2KFHA 2KSPA 1UHNA 3NSKA 2WCEA 4XJKB 5AANA 2KBIA 3VROA 2P6BB 4AQIA 4I5NB 4WQ2A 3FIAA 3SG4A 1S1EA 1MWNA 1N2DA 1WRZA 4HRGA 4NDBA 1KCYA 2M9GA 2WOSA 5D7FA 1K8UA 3E3RA 4MRYA 2L5XB 2KAXA 1KQMB 2K7OA 2LMTA 1XFVO 5HLVA 2AAOA 1SW8A 2RGIA 2M3WA 1F4OA 1J55A 2M1KB 1TTXA 1KQMC 1XFWO 2Y4QA 3BUMB 5CSIA 1DJXA 1QXPA 2BCBA 2EHBA 2I2RE 1DF0A 3D0YB 3FWCA 1DJWA 1KWOB 5TNCA 4JWQA 2HQ8A 4FTGA 2WCFA 1KK8C 2HQWA 1CDMA 4R1EA 4CIDA 1KWOC 5KSZA 2K8MB 4YI8A 1MF8B 1YX7A 3EVUA 4GFTA 1DTLA 2GGMA 3DF0B 5PALA 1JFJA 3CLNA 1YUTA 2KQ6A 3BOWA 2GGZA 2JZIA 1IG5A 4U8DA 2EGDA 4PHKA 1SL8A 2L51A 3EKHA 4N1GA 1IKUA 2M0RA 2PSRA 2LMUA 2LUXA 3JTDB 4YGDB 4PHMA 2B1UA 3LL8B 5CPVA 1Y1UA 3OP0A 5B8IB 1NSHA 1F4QA 2JC2A 3JTDC 2JTTA 2H2KA 1TCFA 4CPVA 1Q80A 2DOQA 3PATA 2JNFA 1PVAA 1KK7Y 1YUUA 2NLNA 1BF5A 4A4CA 1NCXA 1GGZA 2Y1NA 1QASA 1WLMA 1UHIA 3GK4X 1JFKA 1N0YA 3D10A 1KQVA 1SRAA 1UHKA 4OR9B 1EG4A 1XVJA 1B7TZ 1A2XA 1AJ4A 2H61A 1BJFA 2K7DA 2LVJA 4GGFA 3SG7A 5D69A 1NPQA 2JQ6A 3LK0A 4ZCUA 1SBJA 2KBMA 3CR5X 3MSEB 1NX1A 1CDNA 1RTP1 3DVEA 4UPGA 4QJ5B 3RLZA 1C07A 1OMVA 1RECA 1SNLA 2M29A 4DS7A 1FF1A 3PM8A 1E8AA 1ALWA 1WLZA 1SR6B 2PALA 4E68A 2SCPA 4MN0A 1SCMB 3KF9A 1M46A 1SR6C 1TNQA 4M2OA 2F3YA 5I2OA 1LA0A 4L9MA 3SG3A 2KDHA 2I18A 4P5OE 1RROA 3PFVA 1SPYA 4JQ0D 2LLTA 3O78A 4A4BA 2AUCA 5HKYA 3NSLA 4YGEB 1LINA 3KEVA 2Y1MA 4XJKA 3GK2A 3CTNA 3M0WA 2L0PA 1C7WA 2FCDA 5AERA 4ORAB 1UHJA 5CSNA 5AEQA 1QX5B 4MZKA 2HETA 1X02A 1CLLA 2COLB 2KQYA 2HF5A 2PRUA 1QV0A 1Y6WA 4CFRA 3VRPA 1CFDA 1KSMA 1A4PA 5G08A 2EC6B 2K0JA 2LVKA 2Q91A 2LLSA 4GBAA 2LC5A 3EVVA 2L4HA 1K9PA 4WQ3A 1B7TY 1FI5A 4HREE 4C0LA 2EC6C 1EH2A 4TNCA 2JTZA 4GPLB 3D0YA 3IF7A 3NSOA 2JT0A 3ZNIA 2BKHB 2F2OA 1QIWA 4M2PA 2GV5A 1YURA 1KSOA 4DRWA 5HLOA 1Y1AA 1TOPA 2MLFC 5DKQA 5I2QA 1A03A 1U5IB 3WNXB 3KPXA 3OX5A 1AUIB 1UP5A 1PALA 3DF0A 4OVNF 2LE9B 2JULA 5IBWA 3F45A 1PK0D 2I94A 2JXCA 2MHHA 3ZWHA 2LUCA 2JOJA 1EL4A 1JF0A 3C1VA 1CM1A 5J3XA 1XO5A 1BMOA 1IJ6A 1CTRA 2M7NA 1CNPA 1R2UA 3PN7B 1JSAA 3BYAA 3BUXB 3TDUA 1MXLC 1F70A 3NSIA 1LKJA 5F6TA 1BR1B 5K89A 3PSRA 1QX2A 4ORBB 4Q04A 1DJZA 2E30A 2ZRTA 3LCPC 1FI6A 2ISDA 3PN7C 4N5XA 2M49B 1B4CA 4D1EA 4YRUA 5DKRA 3TDIA 1D1OA 1ODBA 1YUSA 1FW4A 3GK1A 4PALA 2AMIA 1BR4B 1XFUO 2E6WA 1FBVA 4MVFA 1F8HA 2WNDA 2F3ZA 1WDCB 2ZN9A 4AOMA 2K7CA 1TCOB 2R2IA 2KGBC 2TN4A 1PULA 1S5GZ 2JRFA 1MHOA 2KOTA 1WDCC 3SJSA 2LP3A 1XYDA 1YVHA 5KU1A 1BLQA 1J7PA 1KFUS 2MLEC 1IQ5A 1F71A 3BUOB 3TS5B 1ZOTB 3A8RA 4WRIA 1OE9B 2QACA 3SG5A 3TS5C 4NQGA 1YVLA 2WORA 2JNXA 4YI9A 3OHMB 1YRTB 1RK9A 1A75B 2NCPA 4QJ4B 1TNWA 3TUYB 1B8RA 1TRFA 4GNKB 1NP8A 3JVTB 2KAVA 1Y0VH 1DJIA 2JXLA 1DGVA 1MQ1A 1RFJA 4YBHB 2O60A 2F33A 3TUYC 1H8BA 5KTYA 1UURA 2JWWA 3IQOA 3JVTC 1CFCA 1V1GA 4C0KA 1OSAA 2LHLA 1G33A 2ZRSA 1S26D 2F8PA 3DVJA 1A29A 1S6IA 1QV1A 2LMVA 3I5GB 2A4JA 1ZFSA 3A4UB 2BCXA 1J7OA 3BUWB 1UHHA 4YGCB 1VRKA 3CR2A 4FQOA 2L4IA 2I7AA 1IGVA 4ETOA 1YTZC 1L2OB 2IS9A 2M7LA 1LXFC 3H4SE 3LK1A 1IRJA 2BCAA 1CMGA 2K7BA 2MRDA 3VRQA 1L2OC 2BKIB 2ZN8A 1H4BA 2NZ0A 3HCMA 2PMYA 3I5FB 5JOLA 1QTXA 1QJTA 2CTNA 2MA2A 4QJ3B 1K96A 1F54A 3CGAA 2KNEA 1NX3A 1SCMC 3DVKA 3I5FC 5ER4X 2SASA 1K2HA 1SYMA 1G4YR 1S6CA 1CMFA 1S5GY 1M45A 2KFFA 2JT3A 1K9KA 2FJUB 1GJYA 1PVBA 1S6JA 4MZJA
chains in the Genus database with same CATH superfamily
4YGBB 1CDPA 2PQLA 2O5GA 2K2AA 3VRRA 1AVSA 3SG6A 1QATA 4PE4A 3LLEA 3VRNA 1BODA 1DVIA 2BE4A 1JUOA 3OB2B 1HT9A 4KYNA 4OV2A 1KFUL 1IH0A 2LCPA 3BUNB 1WY9A 4OZDA 2K2FA 1CKKA 1AHRA 1DJGA 1NUBA 1S36A 1XFZO 1NIWA 2CNPA 2ZNDA 2PVBA 1S3PA 1ZACA 2KGRA 4MLWA 3S0EA 4PHJA 2MAZA 1XK4C 1B9AA 3S0FA 1OZOA 3I5HB 4MEWA 4PCWA 3DD4A 2CXJA 4OKHA 3DYEA 1J7RA 1YR5A 1K9UA 2LVIA 2CT9A 3I5HC 1QVIZ 2ERBA 1B8LA 3O2PA 4N1FA 2OS8B 3AAJA 2JPTA 5JJGA 2ZKMX 1BOCA 2G9BA 1RWYA 3AKBA 1YRUB 1IJ5A 4PE7A 1JC2A 2PASA 2OS8C 1OMDA 4MRXA 1B1GA 1CLBA 1ZMZA 1DMOA 1MR8A 1CLMA 3QRXA 1KFXS 1ALVA 1PSRA 5FI2A 2K61A 2MJWB 3KO0A 2BBNA 1WRLA 4DUQA 2G2BA 2Q4UA 2BE6A 2KPHA 1UUSA 3D77A 1QX7A 3HX4A 5AXIA 3AAKA 1OZSA 3DVMA 1IWQA 2JU0A 1CB1A 1BU3A 1TN4A 3BXKA 3BQ3A 3OBVA 3D74A 1PSBA 1CFFA 1NX0A 2M97A 1TNPA 2LV7A 2QDIA 2KFGA 3CR4X 3IQQA 3TDZA 1TNXA 2WC8A 3SS4A 4BY5A 2CBLA 2WC5A 1OMRA 3S0AA 1AK8A 2ZFDA 2KLEA 1KK8B 1SCVA 1A75A 1SSEB 2JT8A 3SS3A 1SL7A 1WRKA 2Y5IA 5HKZA 1AP4A 1PRWA 2NXQA 3R1VA 1DJYA 4JPZB 1SMGA 1L7ZA 1XA5A 4MSPA 3SIAA 1CFPA 1N65A 2M1UA 3SIBA 4I5LB 3S0GA 2FCEA 1NCZA 2FOTA 2KI6D 2OTGB 4M2QA 3TZ1A 1GM0A 1V1FA 1SK6D 1DT7B 1R6PA 2WCLA 2K60A 2M8UA 2F2PA 4GGNA 1FPWA 2LANA 2CCMA 3CS1A 4IL1A 3SG2A 2V53A 1G8IA 1BT6A 2OTGC 1IQ3A 3EK7A 4HRHA 1UWOA 3L4AA 3PLFB 1DF0B 1QVIY 1J7QA 1Z4HA 1CM4A 1K94A 2KYFA 4ICBA 5CSFA 1RJVA 1GGWA 1SKTA 5HYDA 1K90D 2KHNA 1J1DA 4I5KA 3D78A 1QWVA 4PDZA 2LNKA 1W7IB 1M63B 1LA3A 3EVRA 3B88A 2LHIA 3CZ1A 2WCMA 3BOWB 4BY4A 2GTEA 2LAPA 2QPTA 2KAYA 1DJHA 2P70A 1SL9A 1C3YA 3CWGA 1EXRA 3IVTA 4OCIA 3I5GC 3O4YA 2BL0B 1K93D 1B8CA 3CZTX 4PE0A 1NYAA 1AJ5A 1EG3A 2LM5A 3DZTA 5DKNA 4ZCVA 1K95A 1KFXL 1OOHA 1NCYA 1DC1A 2BL0C 1QS7A 2KI4B 4GAOA 4F0ZB 2HPSA 3V2LA 4IJ7A 2LLUA 3EK4A 2LP2A 2KI4C 1NX2A 1B47A 1TUZA 2ZNEA 3UO9A 1XK4A 1QLKA 3WHTB 1C7VA 3WHUB 5HKWA 3I5IB 2L50A 3VGOA 1EJ3A 3R1PA 3WXAA 3AKAA 1OOJA 3D75A 1DGUA 5I94A 4MZLA 3K21A 4NDCA 5KSZA 1NWDA 3I5IC 3KHEA 5I8NA 1TIZA 2BECA 3PALA 4I5JA 4PHNA 5FYXA 1XFXO 1GQMA 2KLDA 2D8NA 2VRGA 1QLSA 1SY9A 2KYCA 2QEHA 1JF2A 1OQPA 2H61C 3CYZA 4CLNA 3OX6A 4GGFC 5ER5A 3VB1A 3BFBA 3FWBA 2BBMA 2OPOA 4PE1A 4MBEA 1M39A 1U5IA 2NCOA 2MBXA 3RM1A 1MXEA 1MUXA 5AFPA 1J1EA 4P2YB 4USLA 4GUKA 1BG1A 1OOFA 3FS7A 5BPJA 3NGVA 3GOFA 3EKJA 1DEKA 4HSZA 1HQVA 3QMEA 5CSJA 1M31A 4NDDA 3EK8A 1F55A 1XFYO 2BAPA 4XYNA 1JBAA 1CDLA 2KI6C 3ICBA 3NXAA 4DCKA 4C0JA 5I2LA 5FI6A 2WCBA 1ZUZA 1LVCD 1QIVA 2LVVA 4DIRA 1Y1XA 4YGAA 3O6BA 2L2EA 2L98A 3SS5A 3OB1B 4CFQA 1JWDA 1KK7Z 1YX8A 4ORCB 4AQJA 1W7JB 5GQQC 2KFHA 2KSPA 1UHNA 3NSKA 1LS8A 2WCEA 4XJKB 5AANA 2KBIA 3VROA 2P6BB 4AQIA 3BJHA 4I5NB 4WQ2A 3FIAA 3SG4A 1S1EA 1MWNA 1N2DA 1WRZA 4HRGA 4NDBA 2L2CA 1KCYA 2M9GA 2WOSA 5D7FA 1K8UA 3E3RA 4MRYA 2L5XB 2KAXA 1KQMB 2K7OA 2LMTA 1XFVO 5HLVA 2AAOA 1SW8A 2RGIA 2M3WA 1F4OA 1J55A 2M1KB 1TTXA 1KQMC 1XFWO 2Y4QA 3BUMB 5CSIA 1DJXA 1QXPA 2BCBA 2EHBA 2I2RE 1DF0A 3D0YB 3FWCA 1DJWA 3RZSA 1KWOB 5TNCA 4JWQA 2HQ8A 4FTGA 2WCFA 1KK8C 2HQWA 3R72A 1CDMA 4R1EA 3K1EA 4CIDA 1KWOC 2JPOA 2K8MB 2L5YA 3D73A 4YI8A 1MF8B 1YX7A 3EVUA 4GFTA 1DTLA 2GGMA 3DF0B 5PALA 1JFJA 3CLNA 1YUTA 2KQ6A 3BOWA 2GGZA 2JZIA 1IG5A 1TWOA 4U8DA 2EGDA 4PHKA 1SL8A 2L51A 1W9ZA 3EKHA 4N1GA 1IKUA 5FI7A 2M0RA 2PSRA 1IIOA 2LMUA 3CABA 1TUJA 2LUXA 3NHTA 3JTDB 4JD9A 4YGDB 4PHMA 2B1UA 3LL8B 5CPVA 1Y1UA 4PT1A 3OP0A 5B8IB 1NSHA 1F4QA 2JC2A 3JTDC 2JTTA 2H2KA 1TCFA 4CPVA 1Q80A 2DOQA 3PATA 3R1OA 3BFHA 2JNFA 1PVAA 1KK7Y 1YUUA 2NLNA 1BF5A 1OOGA 2WCJA 4A4CA 1NCXA 1GGZA 1P28A 2Y1NA 1QASA 1WLMA 4F7FA 1UHIA 3B7AA 3GK4X 1JFKA 3FE9A 1N0YA 3D10A 1KQVA 1SRAA 1UHKA 4OR9B 1C3ZA 1EG4A 1XVJA 1B7TZ 1A2XA 1AJ4A 2H61A 1BJFA 1DELA 2K7DA 2LVJA 4GGFA 3SG7A 5D69A 1NPQA 3PJIA 2JQ6A 3LK0A 4ZCUA 1SBJA 2KBMA 3OGNA 2WC6A 3CR5X 3MSEB 1NX1A 1CDNA 3CDNA 1RTP1 3DVEA 4UPGA 4QJ5B 3RLZA 1C07A 1OMVA 1RECA 1SNLA 2M29A 4DS7A 1FF1A 3PM8A 1E8AA 1ALWA 1WLZA 1SR6B 2WCHA 3B87A 2PALA 3S0DA 4E68A 2SCPA 4MN0A 1SCMB 3KF9A 1M46A 1SR6C 1TNQA 4M2OA 2F3YA 3Q8IA 5I2OA 1LA0A 4L9MA 3SG3A 2FJYA 2KDHA 2I18A 4P5OE 1RROA 2WCKA 5HL1A 3PFVA 1SPYA 4JQ0D 2LLTA 3O78A 5DICA 4A4BA 2AUCA 5HKYA 3NSLA 4YGEB 1LINA 3S0BA 3KEVA 2Y1MA 4XJKA 3GK2A 3CTNA 3M0WA 2L0PA 1C7WA 2FCDA 5AERA 4ORAB 1UHJA 5CSNA 5AEQA 1QX5B 4MZKA 2HETA 1X02A 1CLLA 2COLB 2KQYA 2HF5A 2PRUA 1QV0A 1Y6WA 4CFRA 3VRPA 1CFDA 1KSMA 1A4PA 5G08A 2EC6B 2K0JA 2LVKA 2Q91A 5EL2A 2LLSA 1DQEA 1OOIX 2LC5A 3EVVA 4GBAA 2L4HA 1K9PA 4WQ3A 1B7TY 1FI5A 4HREE 4C0LA 2EC6C 1EH2A 4TNCA 2JTZA 4GPLB 3D0YA 3IF7A 3FE6A 3NSOA 2JT0A 3ZNIA 2BKHB 2F2OA 1QIWA 4M2PA 2GV5A 1YURA 1KSOA 4DRWA 5HLOA 1Y1AA 2QEOA 1TOPA 2MLFC 5DKQA 5I2QA 1A03A 1U5IB 3WNXB 3KPXA 3OX5A 1AUIB 1UP5A 1PALA 3DF0A 3L4LA 4OVNF 2LE9B 2JULA 5IBWA 1OW4A 3F45A 1PK0D 1T14A 2I94A 2JXCA 2MHHA 3ZWHA 2LUCA 2JOJA 2QEBA 3N7HA 1EL4A 1JF0A 3C1VA 1CM1A 5J3XA 1XO5A 1BMOA 1IJ6A 1CTRA 2M7NA 2BNXA 1R2UA 3EG5B 1CNPA 3PN7B 1JSAA 3BYAA 3BUXB 3TDUA 1MXLC 1F70A 3NSIA 1LKJA 5F6TA 1BR1B 5K89A 3PSRA 1QX2A 3CZ0A 4ORBB 1DJZA 2E30A 2ZRTA 3LCPC 4Q04A 1FI6A 2ISDA 3PN7C 4N5XA 2M49B 1B4CA 4D1EA 4YRUA 5DKRA 3TDIA 2YGUA 1D1OA 1ODBA 1YUSA 1FW4A 3GK1A 4JKTA 2AMIA 4PALA 3UNWA 3NHIA 1XFRA 1BR4B 1XFUO 2E6WA 1FBVA 4MVFA 1F8HA 2WNDA 2F3ZA 1WDCB 2ZN9A 4AOMA 2K7CA 1TCOB 2R2IA 2KGBC 2TN4A 1PULA 1S5GZ 2JRFA 1MHOA 2KOTA 4INWA 1WDCC 3SJSA 2LP3A 1XYDA 1YVHA 5KU1A 1BLQA 3CZ2A 1J7PA 1KFUS 2MLEC 1IQ5A 1F71A 3BUOB 3TS5B 1ZOTB 3A8RA 3B6XA 4WRIA 1OE9B 2QACA 3SG5A 3TS5C 4NQGA 1YVLA 2WORA 2JNXA 3L47A 4YI9A 3OHMB 1YRTB 1RK9A 1A75B 2H8VA 2NCPA 1TNWA 3DY9A 3TUYB 4QJ4B 1B8RA 1TRFA 4GNKB 1NP8A 3JVTB 2KAVA 4FQTA 1Y0VH 1DJIA 2JXLA 1DGVA 1MQ1A 1RFJA 4YBHB 2O60A 2F33A 2QEVA 3TUYC 1H8BA 5KTYA 1UURA 2JWWA 3IQOA 3JVTC 1CFCA 1V1GA 4C0KA 1OSAA 2LHLA 1G33A 2ZRSA 1S26D 2F8PA 3DVJA 1A29A 4INXA 1S6IA 1QV1A 2LMVA 3PM2A 3I5GB 2A4JA 1ZFSA 3A4UB 2P71A 2BCXA 1J7OA 3BUWB 1UHHA 4YGCB 1VRKA 3CR2A 4FQOA 2L4IA 2I7AA 1IGVA 3D76A 1YTZC 3FE8A 4ETOA 1L2OB 2PYQA 2IS9A 3O4XA 2M7LA 1LXFC 3H4SE 3LK1A 1IRJA 2BCAA 1CMGA 2K7BA 2MRDA 3VRQA 1L2OC 2BKIB 2ZN8A 1H4BA 1ORGA 2NZ0A 3BFAA 2PMYA 3HCMA 3I5FB 1QTXA 1QJTA 1Z2CB 2CTNA 2MA2A 4QJ3B 5D3OA 5JOLA 3B86A 1K96A 3DXLA 1F54A 3CGAA 2KNEA 1NX3A 1SCMC 3DVKA 3I5FC 5ER4X 2SASA 1K2HA 1SYMA 1G4YR 1S6CA 1CMFA 1S5GY 1M45A 2KFFA 2JT3A 1K9KA 2FJUB 1GJYA 1PVBA 1S6JA 4MZJA
chains in the Genus database with same CATH topology
4YGBB 1CDPA 2O5GA 2K2AA 3VRRA 1AVSA 3SG6A 1QATA 4PE4A 3LLEA 3VRNA 1BODA 1DVIA 2BE4A 1JUOA 3OB2B 1HT9A 4OV2A 1KFUL 1IH0A 2LCPA 3BUNB 1WY9A 2K2FA 1CKKA 1AHRA 1DJGA 1NUBA 1S36A 1XFZO 1NIWA 2CNPA 2ZNDA 2PVBA 1S3PA 1ZACA 2KGRA 4MLWA 4PHJA 2MAZA 1XK4C 1B9AA 1OZOA 3I5HB 4MEWA 4PCWA 3DD4A 2CXJA 4OKHA 1J7RA 1YR5A 1K9UA 2LVIA 2CT9A 3I5HC 1QVIZ 1B8LA 3O2PA 4N1FA 2OS8B 3AAJA 2JPTA 5JJGA 2ZKMX 1BOCA 2G9BA 1RWYA 3AKBA 1YRUB 1IJ5A 4PE7A 1JC2A 2PASA 2OS8C 1OMDA 4MRXA 1B1GA 1CLBA 1ZMZA 1DMOA 1MR8A 1CLMA 3QRXA 1KFXS 1ALVA 1PSRA 2K61A 2MJWB 3KO0A 2BBNA 1WRLA 4DUQA 2G2BA 2Q4UA 2BE6A 1UUSA 1QX7A 3HX4A 5AXIA 3AAKA 1OZSA 3DVMA 1IWQA 2JU0A 1CB1A 1BU3A 1TN4A 3BXKA 3BQ3A 1PSBA 1CFFA 1NX0A 2M97A 1TNPA 2LV7A 3CR4X 2KFGA 3IQQA 3TDZA 1TNXA 2WC8A 4BY5A 2CBLA 1OMRA 1AK8A 2ZFDA 1KK8B 1SCVA 1A75A 2JT8A 1AP4A 1SL7A 1WRKA 2Y5IA 5HKZA 1PRWA 2NXQA 4JPZB 1DJYA 4MSPA 1SMGA 1L7ZA 1XA5A 3SIAA 1CFPA 1N65A 2M1UA 3SIBA 4I5LB 2FCEA 1NCZA 2FOTA 2KI6D 2OTGB 4M2QA 3TZ1A 1V1FA 1SK6D 1DT7B 1R6PA 2M8UA 2F2PA 4GGNA 1FPWA 2LANA 2CCMA 3CS1A 4IL1A 3SG2A 2V53A 1G8IA 1BT6A 2OTGC 1IQ3A 3EK7A 4HRHA 1UWOA 3PLFB 1DF0B 1QVIY 1J7QA 1CM4A 1K94A 2KYFA 4ICBA 5CSFA 1RJVA 1GGWA 1SKTA 5HYDA 1K90D 2KHNA 1J1DA 4I5KA 4PDZA 2LNKA 1W7IB 1M63B 1LA3A 3EVRA 2LHIA 3BOWB 4BY4A 2LAPA 2QPTA 2KAYA 1DJHA 1SL9A 3CWGA 1EXRA 4OCIA 3I5GC 3O4YA 2BL0B 1K93D 1B8CA 3CZTX 4PE0A 1NYAA 1AJ5A 1EG3A 2LM5A 5DKNA 4ZCVA 1K95A 1KFXL 1NCYA 2BL0C 1QS7A 2KI4B 4GAOA 4F0ZB 2HPSA 2LLUA 3EK4A 2LP2A 2KI4C 1NX2A 1B47A 2ZNEA 1XK4A 1QLKA 3WHTB 1C7VA 3WHUB 5HKWA 3I5IB 2L50A 3VGOA 1EJ3A 3WXAA 3AKAA 1OOJA 1DGUA 4MZLA 3K21A 4NDCA 1NWDA 3I5IC 3KHEA 5I8NA 1TIZA 2BECA 3PALA 4I5JA 4PHNA 5FYXA 1XFXO 1GQMA 2D8NA 2VRGA 1QLSA 1SY9A 2KYCA 1JF2A 1OQPA 2H61C 4CLNA 3OX6A 4GGFC 5ER5A 3FWBA 2BBMA 2OPOA 4PE1A 4MBEA 1M39A 1U5IA 2NCOA 2MBXA 3RM1A 1MXEA 1MUXA 5AFPA 1J1EA 4P2YB 4USLA 4GUKA 1BG1A 3FS7A 5BPJA 3GOFA 3EKJA 4HSZA 1HQVA 5CSJA 1M31A 4NDDA 3EK8A 1F55A 1XFYO 4XYNA 1JBAA 1CDLA 2KI6C 3ICBA 3NXAA 4DCKA 4C0JA 5I2LA 2WCBA 1ZUZA 1LVCD 1QIVA 2LVVA 4DIRA 1Y1XA 4YGAA 3O6BA 2L2EA 2L98A 3OB1B 4CFQA 1JWDA 1KK7Z 1YX8A 4ORCB 4AQJA 1W7JB 5GQQC 2KFHA 2KSPA 1UHNA 3NSKA 2WCEA 4XJKB 5AANA 2KBIA 3VROA 2P6BB 4AQIA 4I5NB 4WQ2A 3FIAA 3SG4A 1S1EA 1MWNA 1N2DA 1WRZA 4HRGA 4NDBA 1KCYA 2M9GA 2WOSA 5D7FA 1K8UA 3E3RA 4MRYA 2L5XB 2KAXA 1KQMB 2K7OA 2LMTA 1XFVO 5HLVA 2AAOA 1SW8A 2RGIA 2M3WA 1F4OA 1J55A 2M1KB 1TTXA 1KQMC 1XFWO 2Y4QA 3BUMB 5CSIA 1DJXA 1QXPA 2BCBA 2EHBA 2I2RE 1DF0A 3D0YB 3FWCA 1DJWA 1KWOB 5TNCA 4JWQA 2HQ8A 4FTGA 2WCFA 1KK8C 2HQWA 1CDMA 4R1EA 4CIDA 1KWOC 5KSZA 2K8MB 4YI8A 1MF8B 1YX7A 3EVUA 4GFTA 1DTLA 2GGMA 3DF0B 5PALA 1JFJA 3CLNA 1YUTA 2KQ6A 3BOWA 2GGZA 2JZIA 1IG5A 4U8DA 2EGDA 4PHKA 1SL8A 2L51A 3EKHA 4N1GA 1IKUA 2M0RA 2PSRA 2LMUA 2LUXA 3JTDB 4YGDB 4PHMA 2B1UA 3LL8B 5CPVA 1Y1UA 3OP0A 5B8IB 1NSHA 1F4QA 2JC2A 3JTDC 2JTTA 2H2KA 1TCFA 4CPVA 1Q80A 2DOQA 3PATA 2JNFA 1PVAA 1KK7Y 1YUUA 2NLNA 1BF5A 4A4CA 1NCXA 1GGZA 2Y1NA 1QASA 1WLMA 1UHIA 3GK4X 1JFKA 1N0YA 3D10A 1KQVA 1SRAA 1UHKA 4OR9B 1EG4A 1XVJA 1B7TZ 1A2XA 1AJ4A 2H61A 1BJFA 2K7DA 2LVJA 4GGFA 3SG7A 5D69A 1NPQA 2JQ6A 3LK0A 4ZCUA 1SBJA 2KBMA 3CR5X 3MSEB 1NX1A 1CDNA 1RTP1 3DVEA 4UPGA 4QJ5B 3RLZA 1C07A 1OMVA 1RECA 1SNLA 2M29A 4DS7A 1FF1A 3PM8A 1E8AA 1ALWA 1WLZA 1SR6B 2PALA 4E68A 2SCPA 4MN0A 1SCMB 3KF9A 1M46A 1SR6C 1TNQA 4M2OA 2F3YA 5I2OA 1LA0A 4L9MA 3SG3A 2KDHA 2I18A 4P5OE 1RROA 3PFVA 1SPYA 4JQ0D 2LLTA 3O78A 4A4BA 2AUCA 5HKYA 3NSLA 4YGEB 1LINA 3KEVA 2Y1MA 4XJKA 3GK2A 3CTNA 3M0WA 2L0PA 1C7WA 2FCDA 5AERA 4ORAB 1UHJA 5CSNA 5AEQA 1QX5B 4MZKA 2HETA 1X02A 1CLLA 2COLB 2KQYA 2HF5A 2PRUA 1QV0A 1Y6WA 4CFRA 3VRPA 1CFDA 1KSMA 1A4PA 5G08A 2EC6B 2K0JA 2LVKA 2Q91A 2LLSA 4GBAA 2LC5A 3EVVA 2L4HA 1K9PA 4WQ3A 1B7TY 1FI5A 4HREE 4C0LA 2EC6C 1EH2A 4TNCA 2JTZA 4GPLB 3D0YA 3IF7A 3NSOA 2JT0A 3ZNIA 2BKHB 2F2OA 1QIWA 4M2PA 2GV5A 1YURA 1KSOA 4DRWA 5HLOA 1Y1AA 1TOPA 2MLFC 5DKQA 5I2QA 1A03A 1U5IB 3WNXB 3KPXA 3OX5A 1AUIB 1UP5A 1PALA 3DF0A 4OVNF 2LE9B 2JULA 5IBWA 3F45A 1PK0D 2I94A 2JXCA 2MHHA 3ZWHA 2LUCA 2JOJA 1EL4A 1JF0A 3C1VA 1CM1A 5J3XA 1XO5A 1BMOA 1IJ6A 1CTRA 2M7NA 1CNPA 1R2UA 3PN7B 1JSAA 3BYAA 3BUXB 3TDUA 1MXLC 1F70A 3NSIA 1LKJA 5F6TA 1BR1B 5K89A 3PSRA 1QX2A 4ORBB 4Q04A 1DJZA 2E30A 2ZRTA 3LCPC 1FI6A 2ISDA 3PN7C 4N5XA 2M49B 1B4CA 4D1EA 4YRUA 5DKRA 3TDIA 1D1OA 1ODBA 1YUSA 1FW4A 3GK1A 4PALA 2AMIA 1BR4B 1XFUO 2E6WA 1FBVA 4MVFA 1F8HA 2WNDA 2F3ZA 1WDCB 2ZN9A 4AOMA 2K7CA 1TCOB 2R2IA 2KGBC 2TN4A 1PULA 1S5GZ 2JRFA 1MHOA 2KOTA 1WDCC 3SJSA 2LP3A 1XYDA 1YVHA 5KU1A 1BLQA 1J7PA 1KFUS 2MLEC 1IQ5A 1F71A 3BUOB 3TS5B 1ZOTB 3A8RA 4WRIA 1OE9B 2QACA 3SG5A 3TS5C 4NQGA 1YVLA 2WORA 2JNXA 4YI9A 3OHMB 1YRTB 1RK9A 1A75B 2NCPA 4QJ4B 1TNWA 3TUYB 1B8RA 1TRFA 4GNKB 1NP8A 3JVTB 2KAVA 1Y0VH 1DJIA 2JXLA 1DGVA 1MQ1A 1RFJA 4YBHB 2O60A 2F33A 3TUYC 1H8BA 5KTYA 1UURA 2JWWA 3IQOA 3JVTC 1CFCA 1V1GA 4C0KA 1OSAA 2LHLA 1G33A 2ZRSA 1S26D 2F8PA 3DVJA 1A29A 1S6IA 1QV1A 2LMVA 3I5GB 2A4JA 1ZFSA 3A4UB 2BCXA 1J7OA 3BUWB 1UHHA 4YGCB 1VRKA 3CR2A 4FQOA 2L4IA 2I7AA 1IGVA 4ETOA 1YTZC 1L2OB 2IS9A 2M7LA 1LXFC 3H4SE 3LK1A 1IRJA 2BCAA 1CMGA 2K7BA 2MRDA 3VRQA 1L2OC 2BKIB 2ZN8A 1H4BA 2NZ0A 3HCMA 2PMYA 3I5FB 5JOLA 1QTXA 1QJTA 2CTNA 2MA2A 4QJ3B 1K96A 1F54A 3CGAA 2KNEA 1NX3A 1SCMC 3DVKA 3I5FC 5ER4X 2SASA 1K2HA 1SYMA 1G4YR 1S6CA 1CMFA 1S5GY 1M45A 2KFFA 2JT3A 1K9KA 2FJUB 1GJYA 1PVBA 1S6JA 4MZJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YGB B;  1CDP A;  2O5G A;  2K2A A;  3VRR A;  1AVS A;  3SG6 A;  1QAT A;  4PE4 A;  3LLE A;  3VRN A;  1BOD A;  1DVI A;  2BE4 A;  1JUO A;  3OB2 B;  1HT9 A;  4OV2 A;  1KFU L;  1IH0 A;  2LCP A;  3BUN B;  1WY9 A;  2K2F A;  1CKK A;  1AHR A;  1DJG A;  1NUB A;  1S36 A;  1XFZ O;  1NIW A;  2CNP A;  2ZND A;  2PVB A;  1S3P A;  1ZAC A;  2KGR A;  4MLW A;  4PHJ A;  2MAZ A;  1XK4 C;  1B9A A;  1OZO A;  3I5H B;  4MEW A;  4PCW A;  3DD4 A;  2CXJ A;  4OKH A;  1J7R A;  1YR5 A;  1K9U A;  2LVI A;  2CT9 A;  3I5H C;  1QVI Z;  1B8L A;  3O2P A;  4N1F A;  2OS8 B;  3AAJ A;  2JPT A;  5JJG A;  2ZKM X;  1BOC A;  2G9B A;  1RWY A;  3AKB A;  1YRU B;  1IJ5 A;  4PE7 A;  1JC2 A;  2PAS A;  2OS8 C;  1OMD A;  4MRX A;  1B1G A;  1CLB A;  1ZMZ A;  1DMO A;  1MR8 A;  1CLM A;  3QRX A;  1KFX S;  1ALV A;  1PSR A;  2K61 A;  2MJW B;  3KO0 A;  2BBN A;  1WRL A;  4DUQ A;  2G2B A;  2Q4U A;  2BE6 A;  1UUS A;  1QX7 A;  3HX4 A;  5AXI A;  3AAK A;  1OZS A;  3DVM A;  1IWQ A;  2JU0 A;  1CB1 A;  1BU3 A;  1TN4 A;  3BXK A;  3BQ3 A;  1PSB A;  1CFF A;  1NX0 A;  2M97 A;  1TNP A;  2LV7 A;  3CR4 X;  2KFG A;  3IQQ A;  3TDZ A;  1TNX A;  2WC8 A;  4BY5 A;  2CBL A;  1OMR A;  1AK8 A;  2ZFD A;  1KK8 B;  1SCV A;  1A75 A;  2JT8 A;  1AP4 A;  1SL7 A;  1WRK A;  2Y5I A;  5HKZ A;  1PRW A;  2NXQ A;  4JPZ B;  1DJY A;  4MSP A;  1SMG A;  1L7Z A;  1XA5 A;  3SIA A;  1CFP A;  1N65 A;  2M1U A;  3SIB A;  4I5L B;  2FCE A;  1NCZ A;  2FOT A;  2KI6 D;  2OTG B;  4M2Q A;  3TZ1 A;  1V1F A;  1SK6 D;  1DT7 B;  1R6P A;  2M8U A;  2F2P A;  4GGN A;  1FPW A;  2LAN A;  2CCM A;  3CS1 A;  4IL1 A;  3SG2 A;  2V53 A;  1G8I A;  1BT6 A;  2OTG C;  1IQ3 A;  3EK7 A;  4HRH A;  1UWO A;  3PLF B;  1DF0 B;  1QVI Y;  1J7Q A;  1CM4 A;  1K94 A;  2KYF A;  4ICB A;  5CSF A;  1RJV A;  1GGW A;  1SKT A;  5HYD A;  1K90 D;  2KHN A;  1J1D A;  4I5K A;  4PDZ A;  2LNK A;  1W7I B;  1M63 B;  1LA3 A;  3EVR A;  2LHI A;  3BOW B;  4BY4 A;  2LAP A;  2QPT A;  2KAY A;  1DJH A;  1SL9 A;  3CWG A;  1EXR A;  4OCI A;  3I5G C;  3O4Y A;  2BL0 B;  1K93 D;  1B8C A;  3CZT X;  4PE0 A;  1NYA A;  1AJ5 A;  1EG3 A;  2LM5 A;  5DKN A;  4ZCV A;  1K95 A;  1KFX L;  1NCY A;  2BL0 C;  1QS7 A;  2KI4 B;  4GAO A;  4F0Z B;  2HPS A;  2LLU A;  3EK4 A;  2LP2 A;  2KI4 C;  1NX2 A;  1B47 A;  2ZNE A;  1XK4 A;  1QLK A;  3WHT B;  1C7V A;  3WHU B;  5HKW A;  3I5I B;  2L50 A;  3VGO A;  1EJ3 A;  3WXA A;  3AKA A;  1OOJ A;  1DGU A;  4MZL A;  3K21 A;  4NDC A;  1NWD A;  3I5I C;  3KHE A;  5I8N A;  1TIZ A;  2BEC A;  3PAL A;  4I5J A;  4PHN A;  5FYX A;  1XFX O;  1GQM A;  2D8N A;  2VRG A;  1QLS A;  1SY9 A;  2KYC A;  1JF2 A;  1OQP A;  2H61 C;  4CLN A;  3OX6 A;  4GGF C;  5ER5 A;  3FWB A;  2BBM A;  2OPO A;  4PE1 A;  4MBE A;  1M39 A;  1U5I A;  2NCO A;  2MBX A;  3RM1 A;  1MXE A;  1MUX A;  5AFP A;  1J1E A;  4P2Y B;  4USL A;  4GUK A;  1BG1 A;  3FS7 A;  5BPJ A;  3GOF A;  3EKJ A;  4HSZ A;  1HQV A;  5CSJ A;  1M31 A;  4NDD A;  3EK8 A;  1F55 A;  1XFY O;  4XYN A;  1JBA A;  1CDL A;  2KI6 C;  3ICB A;  3NXA A;  4DCK A;  4C0J A;  5I2L A;  2WCB A;  1ZUZ A;  1LVC D;  1QIV A;  2LVV A;  4DIR A;  1Y1X A;  4YGA A;  3O6B A;  2L2E A;  2L98 A;  3OB1 B;  4CFQ A;  1JWD A;  1KK7 Z;  1YX8 A;  4ORC B;  4AQJ A;  1W7J B;  5GQQ C;  2KFH A;  2KSP A;  1UHN A;  3NSK A;  2WCE A;  4XJK B;  5AAN A;  2KBI A;  3VRO A;  2P6B B;  4AQI A;  4I5N B;  4WQ2 A;  3FIA A;  3SG4 A;  1S1E A;  1MWN A;  1N2D A;  1WRZ A;  4HRG A;  4NDB A;  1KCY A;  2M9G A;  2WOS A;  5D7F A;  1K8U A;  3E3R A;  4MRY A;  2L5X B;  2KAX A;  1KQM B;  2K7O A;  2LMT A;  1XFV O;  5HLV A;  2AAO A;  1SW8 A;  2RGI A;  2M3W A;  1F4O A;  1J55 A;  2M1K B;  1TTX A;  1KQM C;  1XFW O;  2Y4Q A;  3BUM B;  5CSI A;  1DJX A;  1QXP A;  2BCB A;  2EHB A;  2I2R E;  1DF0 A;  3D0Y B;  3FWC A;  1DJW A;  1KWO B;  5TNC A;  4JWQ A;  2HQ8 A;  4FTG A;  2WCF A;  1KK8 C;  2HQW A;  1CDM A;  4R1E A;  4CID A;  1KWO C;  5KSZ A;  2K8M B;  4YI8 A;  1MF8 B;  1YX7 A;  3EVU A;  4GFT A;  1DTL A;  2GGM A;  3DF0 B;  5PAL A;  1JFJ A;  3CLN A;  1YUT A;  2KQ6 A;  3BOW A;  2GGZ A;  2JZI A;  1IG5 A;  4U8D A;  2EGD A;  4PHK A;  1SL8 A;  2L51 A;  3EKH A;  4N1G A;  1IKU A;  2M0R A;  2PSR A;  2LMU A;  2LUX A;  3JTD B;  4YGD B;  4PHM A;  2B1U A;  3LL8 B;  5CPV A;  1Y1U A;  3OP0 A;  5B8I B;  1NSH A;  1F4Q A;  2JC2 A;  3JTD C;  2JTT A;  2H2K A;  1TCF A;  4CPV A;  1Q80 A;  2DOQ A;  3PAT A;  2JNF A;  1PVA A;  1KK7 Y;  1YUU A;  2NLN A;  1BF5 A;  4A4C A;  1NCX A;  1GGZ A;  2Y1N A;  1QAS A;  1WLM A;  1UHI A;  3GK4 X;  1JFK A;  1N0Y A;  3D10 A;  1KQV A;  1SRA A;  1UHK A;  4OR9 B;  1EG4 A;  1XVJ A;  1B7T Z;  1A2X A;  1AJ4 A;  2H61 A;  1BJF A;  2K7D A;  2LVJ A;  4GGF A;  3SG7 A;  5D69 A;  1NPQ A;  2JQ6 A;  3LK0 A;  4ZCU A;  1SBJ A;  2KBM A;  3CR5 X;  3MSE B;  1NX1 A;  1CDN A;  1RTP 1;  3DVE A;  4UPG A;  4QJ5 B;  3RLZ A;  1C07 A;  1OMV A;  1REC A;  1SNL A;  2M29 A;  4DS7 A;  1FF1 A;  3PM8 A;  1E8A A;  1ALW A;  1WLZ A;  1SR6 B;  2PAL A;  4E68 A;  2SCP A;  4MN0 A;  1SCM B;  3KF9 A;  1M46 A;  1SR6 C;  1TNQ A;  4M2O A;  2F3Y A;  5I2O A;  1LA0 A;  4L9M A;  3SG3 A;  2KDH A;  2I18 A;  4P5O E;  1RRO A;  3PFV A;  1SPY A;  4JQ0 D;  2LLT A;  3O78 A;  4A4B A;  2AUC A;  5HKY A;  3NSL A;  4YGE B;  1LIN A;  3KEV A;  2Y1M A;  4XJK A;  3GK2 A;  3CTN A;  3M0W A;  2L0P A;  1C7W A;  2FCD A;  5AER A;  4ORA B;  1UHJ A;  5CSN A;  5AEQ A;  1QX5 B;  4MZK A;  2HET A;  1X02 A;  1CLL A;  2COL B;  2KQY A;  2HF5 A;  2PRU A;  1QV0 A;  1Y6W A;  4CFR A;  3VRP A;  1CFD A;  1KSM A;  1A4P A;  5G08 A;  2EC6 B;  2K0J A;  2LVK A;  2Q91 A;  2LLS A;  4GBA A;  2LC5 A;  3EVV A;  2L4H A;  1K9P A;  4WQ3 A;  1B7T Y;  1FI5 A;  4HRE E;  4C0L A;  2EC6 C;  1EH2 A;  4TNC A;  2JTZ A;  4GPL B;  3D0Y A;  3IF7 A;  3NSO A;  2JT0 A;  3ZNI A;  2BKH B;  2F2O A;  1QIW A;  4M2P A;  2GV5 A;  1YUR A;  1KSO A;  4DRW A;  5HLO A;  1Y1A A;  1TOP A;  2MLF C;  5DKQ A;  5I2Q A;  1A03 A;  1U5I B;  3WNX B;  3KPX A;  3OX5 A;  1AUI B;  1UP5 A;  1PAL A;  3DF0 A;  4OVN F;  2LE9 B;  2JUL A;  5IBW A;  3F45 A;  1PK0 D;  2I94 A;  2JXC A;  2MHH A;  3ZWH A;  2LUC A;  2JOJ A;  1EL4 A;  1JF0 A;  3C1V A;  1CM1 A;  5J3X A;  1XO5 A;  1BMO A;  1IJ6 A;  1CTR A;  2M7N A;  1CNP A;  1R2U A;  3PN7 B;  1JSA A;  3BYA A;  3BUX B;  3TDU A;  1MXL C;  1F70 A;  3NSI A;  1LKJ A;  5F6T A;  1BR1 B;  5K89 A;  3PSR A;  1QX2 A;  4ORB B;  4Q04 A;  1DJZ A;  2E30 A;  2ZRT A;  3LCP C;  1FI6 A;  2ISD A;  3PN7 C;  4N5X A;  2M49 B;  1B4C A;  4D1E A;  4YRU A;  5DKR A;  3TDI A;  1D1O A;  1ODB A;  1YUS A;  1FW4 A;  3GK1 A;  4PAL A;  2AMI A;  1BR4 B;  1XFU O;  2E6W A;  1FBV A;  4MVF A;  1F8H A;  2WND A;  2F3Z A;  1WDC B;  2ZN9 A;  4AOM A;  2K7C A;  1TCO B;  2R2I A;  2KGB C;  2TN4 A;  1PUL A;  1S5G Z;  2JRF A;  1MHO A;  2KOT A;  1WDC C;  3SJS A;  2LP3 A;  1XYD A;  1YVH A;  5KU1 A;  1BLQ A;  1J7P A;  1KFU S;  2MLE C;  1IQ5 A;  1F71 A;  3BUO B;  3TS5 B;  1ZOT B;  3A8R A;  4WRI A;  1OE9 B;  2QAC A;  3SG5 A;  3TS5 C;  4NQG A;  1YVL A;  2WOR A;  2JNX A;  4YI9 A;  3OHM B;  1YRT B;  1RK9 A;  1A75 B;  2NCP A;  4QJ4 B;  1TNW A;  3TUY B;  1B8R A;  1TRF A;  4GNK B;  1NP8 A;  3JVT B;  2KAV A;  1Y0V H;  1DJI A;  2JXL A;  1DGV A;  1MQ1 A;  1RFJ A;  4YBH B;  2O60 A;  2F33 A;  3TUY C;  1H8B A;  5KTY A;  1UUR A;  2JWW A;  3IQO A;  3JVT C;  1CFC A;  1V1G A;  4C0K A;  1OSA A;  2LHL A;  1G33 A;  2ZRS A;  1S26 D;  2F8P A;  3DVJ A;  1A29 A;  1S6I A;  1QV1 A;  2LMV A;  3I5G B;  2A4J A;  1ZFS A;  3A4U B;  2BCX A;  1J7O A;  3BUW B;  1UHH A;  4YGC B;  1VRK A;  3CR2 A;  4FQO A;  2L4I A;  2I7A A;  1IGV A;  4ETO A;  1YTZ C;  1L2O B;  2IS9 A;  2M7L A;  1LXF C;  3H4S E;  3LK1 A;  1IRJ A;  2BCA A;  1CMG A;  2K7B A;  2MRD A;  3VRQ A;  1L2O C;  2BKI B;  2ZN8 A;  1H4B A;  2NZ0 A;  3HCM A;  2PMY A;  3I5F B;  5JOL A;  1QTX A;  1QJT A;  2CTN A;  2MA2 A;  4QJ3 B;  1K96 A;  1F54 A;  3CGA A;  2KNE A;  1NX3 A;  1SCM C;  3DVK A;  3I5F C;  5ER4 X;  2SAS A;  1K2H A;  1SYM A;  1G4Y R;  1S6C A;  1CMF A;  1S5G Y;  1M45 A;  2KFF A;  2JT3 A;  1K9K A;  2FJU B;  1GJY A;  1PVB A;  1S6J A;  4MZJ A; 
#chains in the Genus database with same CATH topology
 4YGB B;  1CDP A;  2PQL A;  2O5G A;  2K2A A;  3VRR A;  1AVS A;  3SG6 A;  1QAT A;  4PE4 A;  3LLE A;  3VRN A;  1BOD A;  1DVI A;  2BE4 A;  1JUO A;  3OB2 B;  1HT9 A;  4KYN A;  4OV2 A;  1KFU L;  1IH0 A;  2LCP A;  3BUN B;  1WY9 A;  4OZD A;  2K2F A;  1CKK A;  1AHR A;  1DJG A;  1NUB A;  1S36 A;  1XFZ O;  1NIW A;  2CNP A;  2ZND A;  2PVB A;  1S3P A;  1ZAC A;  2KGR A;  4MLW A;  3S0E A;  4PHJ A;  2MAZ A;  1XK4 C;  1B9A A;  3S0F A;  1OZO A;  3I5H B;  4MEW A;  4PCW A;  3DD4 A;  2CXJ A;  4OKH A;  3DYE A;  1J7R A;  1YR5 A;  1K9U A;  2LVI A;  2CT9 A;  3I5H C;  1QVI Z;  2ERB A;  1B8L A;  3O2P A;  4N1F A;  2OS8 B;  3AAJ A;  2JPT A;  5JJG A;  2ZKM X;  1BOC A;  2G9B A;  1RWY A;  3AKB A;  1YRU B;  1IJ5 A;  4PE7 A;  1JC2 A;  2PAS A;  2OS8 C;  1OMD A;  4MRX A;  1B1G A;  1CLB A;  1ZMZ A;  1DMO A;  1MR8 A;  1CLM A;  3QRX A;  1KFX S;  1ALV A;  1PSR A;  5FI2 A;  2K61 A;  2MJW B;  3KO0 A;  2BBN A;  1WRL A;  4DUQ A;  2G2B A;  2Q4U A;  2BE6 A;  2KPH A;  1UUS A;  3D77 A;  1QX7 A;  3HX4 A;  5AXI A;  3AAK A;  1OZS A;  3DVM A;  1IWQ A;  2JU0 A;  1CB1 A;  1BU3 A;  1TN4 A;  3BXK A;  3BQ3 A;  3OBV A;  3D74 A;  1PSB A;  1CFF A;  1NX0 A;  2M97 A;  1TNP A;  2LV7 A;  2QDI A;  2KFG A;  3CR4 X;  3IQQ A;  3TDZ A;  1TNX A;  2WC8 A;  3SS4 A;  4BY5 A;  2CBL A;  2WC5 A;  1OMR A;  3S0A A;  1AK8 A;  2ZFD A;  2KLE A;  1KK8 B;  1SCV A;  1A75 A;  1SSE B;  2JT8 A;  3SS3 A;  1SL7 A;  1WRK A;  2Y5I A;  5HKZ A;  1AP4 A;  1PRW A;  2NXQ A;  3R1V A;  1DJY A;  4JPZ B;  1SMG A;  1L7Z A;  1XA5 A;  4MSP A;  3SIA A;  1CFP A;  1N65 A;  2M1U A;  3SIB A;  4I5L B;  3S0G A;  2FCE A;  1NCZ A;  2FOT A;  2KI6 D;  2OTG B;  4M2Q A;  3TZ1 A;  1GM0 A;  1V1F A;  1SK6 D;  1DT7 B;  1R6P A;  2WCL A;  2K60 A;  2M8U A;  2F2P A;  4GGN A;  1FPW A;  2LAN A;  2CCM A;  3CS1 A;  4IL1 A;  3SG2 A;  2V53 A;  1G8I A;  1BT6 A;  2OTG C;  1IQ3 A;  3EK7 A;  4HRH A;  1UWO A;  3L4A A;  3PLF B;  1DF0 B;  1QVI Y;  1J7Q A;  1Z4H A;  1CM4 A;  1K94 A;  2KYF A;  4ICB A;  5CSF A;  1RJV A;  1GGW A;  1SKT A;  5HYD A;  1K90 D;  2KHN A;  1J1D A;  4I5K A;  3D78 A;  1QWV A;  4PDZ A;  2LNK A;  1W7I B;  1M63 B;  1LA3 A;  3EVR A;  3B88 A;  2LHI A;  3CZ1 A;  2WCM A;  3BOW B;  4BY4 A;  2GTE A;  2LAP A;  2QPT A;  2KAY A;  1DJH A;  2P70 A;  1SL9 A;  1C3Y A;  3CWG A;  1EXR A;  3IVT A;  4OCI A;  3I5G C;  3O4Y A;  2BL0 B;  1K93 D;  1B8C A;  3CZT X;  4PE0 A;  1NYA A;  1AJ5 A;  1EG3 A;  2LM5 A;  3DZT A;  5DKN A;  4ZCV A;  1K95 A;  1KFX L;  1OOH A;  1NCY A;  1DC1 A;  2BL0 C;  1QS7 A;  2KI4 B;  4GAO A;  4F0Z B;  2HPS A;  3V2L A;  4IJ7 A;  2LLU A;  3EK4 A;  2LP2 A;  2KI4 C;  1NX2 A;  1B47 A;  1TUZ A;  2ZNE A;  3UO9 A;  1XK4 A;  1QLK A;  3WHT B;  1C7V A;  3WHU B;  5HKW A;  3I5I B;  2L50 A;  3VGO A;  1EJ3 A;  3R1P A;  3WXA A;  3AKA A;  1OOJ A;  3D75 A;  1DGU A;  5I94 A;  4MZL A;  3K21 A;  4NDC A;  5KSZ A;  1NWD A;  3I5I C;  3KHE A;  5I8N A;  1TIZ A;  2BEC A;  3PAL A;  4I5J A;  4PHN A;  5FYX A;  1XFX O;  1GQM A;  2KLD A;  2D8N A;  2VRG A;  1QLS A;  1SY9 A;  2KYC A;  2QEH A;  1JF2 A;  1OQP A;  2H61 C;  3CYZ A;  4CLN A;  3OX6 A;  4GGF C;  5ER5 A;  3VB1 A;  3BFB A;  3FWB A;  2BBM A;  2OPO A;  4PE1 A;  4MBE A;  1M39 A;  1U5I A;  2NCO A;  2MBX A;  3RM1 A;  1MXE A;  1MUX A;  5AFP A;  1J1E A;  4P2Y B;  4USL A;  4GUK A;  1BG1 A;  1OOF A;  3FS7 A;  5BPJ A;  3NGV A;  3GOF A;  3EKJ A;  1DEK A;  4HSZ A;  1HQV A;  3QME A;  5CSJ A;  1M31 A;  4NDD A;  3EK8 A;  1F55 A;  1XFY O;  2BAP A;  4XYN A;  1JBA A;  1CDL A;  2KI6 C;  3ICB A;  3NXA A;  4DCK A;  4C0J A;  5I2L A;  5FI6 A;  2WCB A;  1ZUZ A;  1LVC D;  1QIV A;  2LVV A;  4DIR A;  1Y1X A;  4YGA A;  3O6B A;  2L2E A;  2L98 A;  3SS5 A;  3OB1 B;  4CFQ A;  1JWD A;  1KK7 Z;  1YX8 A;  4ORC B;  4AQJ A;  1W7J B;  5GQQ C;  2KFH A;  2KSP A;  1UHN A;  3NSK A;  1LS8 A;  2WCE A;  4XJK B;  5AAN A;  2KBI A;  3VRO A;  2P6B B;  4AQI A;  3BJH A;  4I5N B;  4WQ2 A;  3FIA A;  3SG4 A;  1S1E A;  1MWN A;  1N2D A;  1WRZ A;  4HRG A;  4NDB A;  2L2C A;  1KCY A;  2M9G A;  2WOS A;  5D7F A;  1K8U A;  3E3R A;  4MRY A;  2L5X B;  2KAX A;  1KQM B;  2K7O A;  2LMT A;  1XFV O;  5HLV A;  2AAO A;  1SW8 A;  2RGI A;  2M3W A;  1F4O A;  1J55 A;  2M1K B;  1TTX A;  1KQM C;  1XFW O;  2Y4Q A;  3BUM B;  5CSI A;  1DJX A;  1QXP A;  2BCB A;  2EHB A;  2I2R E;  1DF0 A;  3D0Y B;  3FWC A;  1DJW A;  3RZS A;  1KWO B;  5TNC A;  4JWQ A;  2HQ8 A;  4FTG A;  2WCF A;  1KK8 C;  2HQW A;  3R72 A;  1CDM A;  4R1E A;  3K1E A;  4CID A;  1KWO C;  2JPO A;  2K8M B;  2L5Y A;  3D73 A;  4YI8 A;  1MF8 B;  1YX7 A;  3EVU A;  4GFT A;  1DTL A;  2GGM A;  3DF0 B;  5PAL A;  1JFJ A;  3CLN A;  1YUT A;  2KQ6 A;  3BOW A;  2GGZ A;  2JZI A;  1IG5 A;  1TWO A;  4U8D A;  2EGD A;  4PHK A;  1SL8 A;  2L51 A;  1W9Z A;  3EKH A;  4N1G A;  1IKU A;  5FI7 A;  2M0R A;  2PSR A;  1IIO A;  2LMU A;  3CAB A;  1TUJ A;  2LUX A;  3NHT A;  3JTD B;  4JD9 A;  4YGD B;  4PHM A;  2B1U A;  3LL8 B;  5CPV A;  1Y1U A;  4PT1 A;  3OP0 A;  5B8I B;  1NSH A;  1F4Q A;  2JC2 A;  3JTD C;  2JTT A;  2H2K A;  1TCF A;  4CPV A;  1Q80 A;  2DOQ A;  3PAT A;  3R1O A;  3BFH A;  2JNF A;  1PVA A;  1KK7 Y;  1YUU A;  2NLN A;  1BF5 A;  1OOG A;  2WCJ A;  4A4C A;  1NCX A;  1GGZ A;  1P28 A;  2Y1N A;  1QAS A;  1WLM A;  4F7F A;  1UHI A;  3B7A A;  3GK4 X;  1JFK A;  3FE9 A;  1N0Y A;  3D10 A;  1KQV A;  1SRA A;  1UHK A;  4OR9 B;  1C3Z A;  1EG4 A;  1XVJ A;  1B7T Z;  1A2X A;  1AJ4 A;  2H61 A;  1BJF A;  1DEL A;  2K7D A;  2LVJ A;  4GGF A;  3SG7 A;  5D69 A;  1NPQ A;  3PJI A;  2JQ6 A;  3LK0 A;  4ZCU A;  1SBJ A;  2KBM A;  3OGN A;  2WC6 A;  3CR5 X;  3MSE B;  1NX1 A;  1CDN A;  3CDN A;  1RTP 1;  3DVE A;  4UPG A;  4QJ5 B;  3RLZ A;  1C07 A;  1OMV A;  1REC A;  1SNL A;  2M29 A;  4DS7 A;  1FF1 A;  3PM8 A;  1E8A A;  1ALW A;  1WLZ A;  1SR6 B;  2WCH A;  3B87 A;  2PAL A;  3S0D A;  4E68 A;  2SCP A;  4MN0 A;  1SCM B;  3KF9 A;  1M46 A;  1SR6 C;  1TNQ A;  4M2O A;  2F3Y A;  3Q8I A;  5I2O A;  1LA0 A;  4L9M A;  3SG3 A;  2FJY A;  2KDH A;  2I18 A;  4P5O E;  1RRO A;  2WCK A;  5HL1 A;  3PFV A;  1SPY A;  4JQ0 D;  2LLT A;  3O78 A;  5DIC A;  4A4B A;  2AUC A;  5HKY A;  3NSL A;  4YGE B;  1LIN A;  3S0B A;  3KEV A;  2Y1M A;  4XJK A;  3GK2 A;  3CTN A;  3M0W A;  2L0P A;  1C7W A;  2FCD A;  5AER A;  4ORA B;  1UHJ A;  5CSN A;  5AEQ A;  1QX5 B;  4MZK A;  2HET A;  1X02 A;  1CLL A;  2COL B;  2KQY A;  2HF5 A;  2PRU A;  1QV0 A;  1Y6W A;  4CFR A;  3VRP A;  1CFD A;  1KSM A;  1A4P A;  5G08 A;  2EC6 B;  2K0J A;  2LVK A;  2Q91 A;  5EL2 A;  2LLS A;  1DQE A;  1OOI X;  2LC5 A;  3EVV A;  4GBA A;  2L4H A;  1K9P A;  4WQ3 A;  1B7T Y;  1FI5 A;  4HRE E;  4C0L A;  2EC6 C;  1EH2 A;  4TNC A;  2JTZ A;  4GPL B;  3D0Y A;  3IF7 A;  3FE6 A;  3NSO A;  2JT0 A;  3ZNI A;  2BKH B;  2F2O A;  1QIW A;  4M2P A;  2GV5 A;  1YUR A;  1KSO A;  4DRW A;  5HLO A;  1Y1A A;  2QEO A;  1TOP A;  2MLF C;  5DKQ A;  5I2Q A;  1A03 A;  1U5I B;  3WNX B;  3KPX A;  3OX5 A;  1AUI B;  1UP5 A;  1PAL A;  3DF0 A;  3L4L A;  4OVN F;  2LE9 B;  2JUL A;  5IBW A;  1OW4 A;  3F45 A;  1PK0 D;  1T14 A;  2I94 A;  2JXC A;  2MHH A;  3ZWH A;  2LUC A;  2JOJ A;  2QEB A;  3N7H A;  1EL4 A;  1JF0 A;  3C1V A;  1CM1 A;  5J3X A;  1XO5 A;  1BMO A;  1IJ6 A;  1CTR A;  2M7N A;  2BNX A;  1R2U A;  3EG5 B;  1CNP A;  3PN7 B;  1JSA A;  3BYA A;  3BUX B;  3TDU A;  1MXL C;  1F70 A;  3NSI A;  1LKJ A;  5F6T A;  1BR1 B;  5K89 A;  3PSR A;  1QX2 A;  3CZ0 A;  4ORB B;  1DJZ A;  2E30 A;  2ZRT A;  3LCP C;  4Q04 A;  1FI6 A;  2ISD A;  3PN7 C;  4N5X A;  2M49 B;  1B4C A;  4D1E A;  4YRU A;  5DKR A;  3TDI A;  2YGU A;  1D1O A;  1ODB A;  1YUS A;  1FW4 A;  3GK1 A;  4JKT A;  2AMI A;  4PAL A;  3UNW A;  3NHI A;  1XFR A;  1BR4 B;  1XFU O;  2E6W A;  1FBV A;  4MVF A;  1F8H A;  2WND A;  2F3Z A;  1WDC B;  2ZN9 A;  4AOM A;  2K7C A;  1TCO B;  2R2I A;  2KGB C;  2TN4 A;  1PUL A;  1S5G Z;  2JRF A;  1MHO A;  2KOT A;  4INW A;  1WDC C;  3SJS A;  2LP3 A;  1XYD A;  1YVH A;  5KU1 A;  1BLQ A;  3CZ2 A;  1J7P A;  1KFU S;  2MLE C;  1IQ5 A;  1F71 A;  3BUO B;  3TS5 B;  1ZOT B;  3A8R A;  3B6X A;  4WRI A;  1OE9 B;  2QAC A;  3SG5 A;  3TS5 C;  4NQG A;  1YVL A;  2WOR A;  2JNX A;  3L47 A;  4YI9 A;  3OHM B;  1YRT B;  1RK9 A;  1A75 B;  2H8V A;  2NCP A;  1TNW A;  3DY9 A;  3TUY B;  4QJ4 B;  1B8R A;  1TRF A;  4GNK B;  1NP8 A;  3JVT B;  2KAV A;  4FQT A;  1Y0V H;  1DJI A;  2JXL A;  1DGV A;  1MQ1 A;  1RFJ A;  4YBH B;  2O60 A;  2F33 A;  2QEV A;  3TUY C;  1H8B A;  5KTY A;  1UUR A;  2JWW A;  3IQO A;  3JVT C;  1CFC A;  1V1G A;  4C0K A;  1OSA A;  2LHL A;  1G33 A;  2ZRS A;  1S26 D;  2F8P A;  3DVJ A;  1A29 A;  4INX A;  1S6I A;  1QV1 A;  2LMV A;  3PM2 A;  3I5G B;  2A4J A;  1ZFS A;  3A4U B;  2P71 A;  2BCX A;  1J7O A;  3BUW B;  1UHH A;  4YGC B;  1VRK A;  3CR2 A;  4FQO A;  2L4I A;  2I7A A;  1IGV A;  3D76 A;  1YTZ C;  3FE8 A;  4ETO A;  1L2O B;  2PYQ A;  2IS9 A;  3O4X A;  2M7L A;  1LXF C;  3H4S E;  3LK1 A;  1IRJ A;  2BCA A;  1CMG A;  2K7B A;  2MRD A;  3VRQ A;  1L2O C;  2BKI B;  2ZN8 A;  1H4B A;  1ORG A;  2NZ0 A;  3BFA A;  2PMY A;  3HCM A;  3I5F B;  1QTX A;  1QJT A;  1Z2C B;  2CTN A;  2MA2 A;  4QJ3 B;  5D3O A;  5JOL A;  3B86 A;  1K96 A;  3DXL A;  1F54 A;  3CGA A;  2KNE A;  1NX3 A;  1SCM C;  3DVK A;  3I5F C;  5ER4 X;  2SAS A;  1K2H A;  1SYM A;  1G4Y R;  1S6C A;  1CMF A;  1S5G Y;  1M45 A;  2KFF A;  2JT3 A;  1K9K A;  2FJU B;  1GJY A;  1PVB A;  1S6J A;  4MZJ A; 
#chains in the Genus database with same CATH homology
 4YGB B;  1CDP A;  2O5G A;  2K2A A;  3VRR A;  1AVS A;  3SG6 A;  1QAT A;  4PE4 A;  3LLE A;  3VRN A;  1BOD A;  1DVI A;  2BE4 A;  1JUO A;  3OB2 B;  1HT9 A;  4OV2 A;  1KFU L;  1IH0 A;  2LCP A;  3BUN B;  1WY9 A;  2K2F A;  1CKK A;  1AHR A;  1DJG A;  1NUB A;  1S36 A;  1XFZ O;  1NIW A;  2CNP A;  2ZND A;  2PVB A;  1S3P A;  1ZAC A;  2KGR A;  4MLW A;  4PHJ A;  2MAZ A;  1XK4 C;  1B9A A;  1OZO A;  3I5H B;  4MEW A;  4PCW A;  3DD4 A;  2CXJ A;  4OKH A;  1J7R A;  1YR5 A;  1K9U A;  2LVI A;  2CT9 A;  3I5H C;  1QVI Z;  1B8L A;  3O2P A;  4N1F A;  2OS8 B;  3AAJ A;  2JPT A;  5JJG A;  2ZKM X;  1BOC A;  2G9B A;  1RWY A;  3AKB A;  1YRU B;  1IJ5 A;  4PE7 A;  1JC2 A;  2PAS A;  2OS8 C;  1OMD A;  4MRX A;  1B1G A;  1CLB A;  1ZMZ A;  1DMO A;  1MR8 A;  1CLM A;  3QRX A;  1KFX S;  1ALV A;  1PSR A;  2K61 A;  2MJW B;  3KO0 A;  2BBN A;  1WRL A;  4DUQ A;  2G2B A;  2Q4U A;  2BE6 A;  1UUS A;  1QX7 A;  3HX4 A;  5AXI A;  3AAK A;  1OZS A;  3DVM A;  1IWQ A;  2JU0 A;  1CB1 A;  1BU3 A;  1TN4 A;  3BXK A;  3BQ3 A;  1PSB A;  1CFF A;  1NX0 A;  2M97 A;  1TNP A;  2LV7 A;  3CR4 X;  2KFG A;  3IQQ A;  3TDZ A;  1TNX A;  2WC8 A;  4BY5 A;  2CBL A;  1OMR A;  1AK8 A;  2ZFD A;  1KK8 B;  1SCV A;  1A75 A;  2JT8 A;  1AP4 A;  1SL7 A;  1WRK A;  2Y5I A;  5HKZ A;  1PRW A;  2NXQ A;  4JPZ B;  1DJY A;  4MSP A;  1SMG A;  1L7Z A;  1XA5 A;  3SIA A;  1CFP A;  1N65 A;  2M1U A;  3SIB A;  4I5L B;  2FCE A;  1NCZ A;  2FOT A;  2KI6 D;  2OTG B;  4M2Q A;  3TZ1 A;  1V1F A;  1SK6 D;  1DT7 B;  1R6P A;  2M8U A;  2F2P A;  4GGN A;  1FPW A;  2LAN A;  2CCM A;  3CS1 A;  4IL1 A;  3SG2 A;  2V53 A;  1G8I A;  1BT6 A;  2OTG C;  1IQ3 A;  3EK7 A;  4HRH A;  1UWO A;  3PLF B;  1DF0 B;  1QVI Y;  1J7Q A;  1CM4 A;  1K94 A;  2KYF A;  4ICB A;  5CSF A;  1RJV A;  1GGW A;  1SKT A;  5HYD A;  1K90 D;  2KHN A;  1J1D A;  4I5K A;  4PDZ A;  2LNK A;  1W7I B;  1M63 B;  1LA3 A;  3EVR A;  2LHI A;  3BOW B;  4BY4 A;  2LAP A;  2QPT A;  2KAY A;  1DJH A;  1SL9 A;  3CWG A;  1EXR A;  4OCI A;  3I5G C;  3O4Y A;  2BL0 B;  1K93 D;  1B8C A;  3CZT X;  4PE0 A;  1NYA A;  1AJ5 A;  1EG3 A;  2LM5 A;  5DKN A;  4ZCV A;  1K95 A;  1KFX L;  1NCY A;  2BL0 C;  1QS7 A;  2KI4 B;  4GAO A;  4F0Z B;  2HPS A;  2LLU A;  3EK4 A;  2LP2 A;  2KI4 C;  1NX2 A;  1B47 A;  2ZNE A;  1XK4 A;  1QLK A;  3WHT B;  1C7V A;  3WHU B;  5HKW A;  3I5I B;  2L50 A;  3VGO A;  1EJ3 A;  3WXA A;  3AKA A;  1OOJ A;  1DGU A;  4MZL A;  3K21 A;  4NDC A;  1NWD A;  3I5I C;  3KHE A;  5I8N A;  1TIZ A;  2BEC A;  3PAL A;  4I5J A;  4PHN A;  5FYX A;  1XFX O;  1GQM A;  2D8N A;  2VRG A;  1QLS A;  1SY9 A;  2KYC A;  1JF2 A;  1OQP A;  2H61 C;  4CLN A;  3OX6 A;  4GGF C;  5ER5 A;  3FWB A;  2BBM A;  2OPO A;  4PE1 A;  4MBE A;  1M39 A;  1U5I A;  2NCO A;  2MBX A;  3RM1 A;  1MXE A;  1MUX A;  5AFP A;  1J1E A;  4P2Y B;  4USL A;  4GUK A;  1BG1 A;  3FS7 A;  5BPJ A;  3GOF A;  3EKJ A;  4HSZ A;  1HQV A;  5CSJ A;  1M31 A;  4NDD A;  3EK8 A;  1F55 A;  1XFY O;  4XYN A;  1JBA A;  1CDL A;  2KI6 C;  3ICB A;  3NXA A;  4DCK A;  4C0J A;  5I2L A;  2WCB A;  1ZUZ A;  1LVC D;  1QIV A;  2LVV A;  4DIR A;  1Y1X A;  4YGA A;  3O6B A;  2L2E A;  2L98 A;  3OB1 B;  4CFQ A;  1JWD A;  1KK7 Z;  1YX8 A;  4ORC B;  4AQJ A;  1W7J B;  5GQQ C;  2KFH A;  2KSP A;  1UHN A;  3NSK A;  2WCE A;  4XJK B;  5AAN A;  2KBI A;  3VRO A;  2P6B B;  4AQI A;  4I5N B;  4WQ2 A;  3FIA A;  3SG4 A;  1S1E A;  1MWN A;  1N2D A;  1WRZ A;  4HRG A;  4NDB A;  1KCY A;  2M9G A;  2WOS A;  5D7F A;  1K8U A;  3E3R A;  4MRY A;  2L5X B;  2KAX A;  1KQM B;  2K7O A;  2LMT A;  1XFV O;  5HLV A;  2AAO A;  1SW8 A;  2RGI A;  2M3W A;  1F4O A;  1J55 A;  2M1K B;  1TTX A;  1KQM C;  1XFW O;  2Y4Q A;  3BUM B;  5CSI A;  1DJX A;  1QXP A;  2BCB A;  2EHB A;  2I2R E;  1DF0 A;  3D0Y B;  3FWC A;  1DJW A;  1KWO B;  5TNC A;  4JWQ A;  2HQ8 A;  4FTG A;  2WCF A;  1KK8 C;  2HQW A;  1CDM A;  4R1E A;  4CID A;  1KWO C;  5KSZ A;  2K8M B;  4YI8 A;  1MF8 B;  1YX7 A;  3EVU A;  4GFT A;  1DTL A;  2GGM A;  3DF0 B;  5PAL A;  1JFJ A;  3CLN A;  1YUT A;  2KQ6 A;  3BOW A;  2GGZ A;  2JZI A;  1IG5 A;  4U8D A;  2EGD A;  4PHK A;  1SL8 A;  2L51 A;  3EKH A;  4N1G A;  1IKU A;  2M0R A;  2PSR A;  2LMU A;  2LUX A;  3JTD B;  4YGD B;  4PHM A;  2B1U A;  3LL8 B;  5CPV A;  1Y1U A;  3OP0 A;  5B8I B;  1NSH A;  1F4Q A;  2JC2 A;  3JTD C;  2JTT A;  2H2K A;  1TCF A;  4CPV A;  1Q80 A;  2DOQ A;  3PAT A;  2JNF A;  1PVA A;  1KK7 Y;  1YUU A;  2NLN A;  1BF5 A;  4A4C A;  1NCX A;  1GGZ A;  2Y1N A;  1QAS A;  1WLM A;  1UHI A;  3GK4 X;  1JFK A;  1N0Y A;  3D10 A;  1KQV A;  1SRA A;  1UHK A;  4OR9 B;  1EG4 A;  1XVJ A;  1B7T Z;  1A2X A;  1AJ4 A;  2H61 A;  1BJF A;  2K7D A;  2LVJ A;  4GGF A;  3SG7 A;  5D69 A;  1NPQ A;  2JQ6 A;  3LK0 A;  4ZCU A;  1SBJ A;  2KBM A;  3CR5 X;  3MSE B;  1NX1 A;  1CDN A;  1RTP 1;  3DVE A;  4UPG A;  4QJ5 B;  3RLZ A;  1C07 A;  1OMV A;  1REC A;  1SNL A;  2M29 A;  4DS7 A;  1FF1 A;  3PM8 A;  1E8A A;  1ALW A;  1WLZ A;  1SR6 B;  2PAL A;  4E68 A;  2SCP A;  4MN0 A;  1SCM B;  3KF9 A;  1M46 A;  1SR6 C;  1TNQ A;  4M2O A;  2F3Y A;  5I2O A;  1LA0 A;  4L9M A;  3SG3 A;  2KDH A;  2I18 A;  4P5O E;  1RRO A;  3PFV A;  1SPY A;  4JQ0 D;  2LLT A;  3O78 A;  4A4B A;  2AUC A;  5HKY A;  3NSL A;  4YGE B;  1LIN A;  3KEV A;  2Y1M A;  4XJK A;  3GK2 A;  3CTN A;  3M0W A;  2L0P A;  1C7W A;  2FCD A;  5AER A;  4ORA B;  1UHJ A;  5CSN A;  5AEQ A;  1QX5 B;  4MZK A;  2HET A;  1X02 A;  1CLL A;  2COL B;  2KQY A;  2HF5 A;  2PRU A;  1QV0 A;  1Y6W A;  4CFR A;  3VRP A;  1CFD A;  1KSM A;  1A4P A;  5G08 A;  2EC6 B;  2K0J A;  2LVK A;  2Q91 A;  2LLS A;  4GBA A;  2LC5 A;  3EVV A;  2L4H A;  1K9P A;  4WQ3 A;  1B7T Y;  1FI5 A;  4HRE E;  4C0L A;  2EC6 C;  1EH2 A;  4TNC A;  2JTZ A;  4GPL B;  3D0Y A;  3IF7 A;  3NSO A;  2JT0 A;  3ZNI A;  2BKH B;  2F2O A;  1QIW A;  4M2P A;  2GV5 A;  1YUR A;  1KSO A;  4DRW A;  5HLO A;  1Y1A A;  1TOP A;  2MLF C;  5DKQ A;  5I2Q A;  1A03 A;  1U5I B;  3WNX B;  3KPX A;  3OX5 A;  1AUI B;  1UP5 A;  1PAL A;  3DF0 A;  4OVN F;  2LE9 B;  2JUL A;  5IBW A;  3F45 A;  1PK0 D;  2I94 A;  2JXC A;  2MHH A;  3ZWH A;  2LUC A;  2JOJ A;  1EL4 A;  1JF0 A;  3C1V A;  1CM1 A;  5J3X A;  1XO5 A;  1BMO A;  1IJ6 A;  1CTR A;  2M7N A;  1CNP A;  1R2U A;  3PN7 B;  1JSA A;  3BYA A;  3BUX B;  3TDU A;  1MXL C;  1F70 A;  3NSI A;  1LKJ A;  5F6T A;  1BR1 B;  5K89 A;  3PSR A;  1QX2 A;  4ORB B;  4Q04 A;  1DJZ A;  2E30 A;  2ZRT A;  3LCP C;  1FI6 A;  2ISD A;  3PN7 C;  4N5X A;  2M49 B;  1B4C A;  4D1E A;  4YRU A;  5DKR A;  3TDI A;  1D1O A;  1ODB A;  1YUS A;  1FW4 A;  3GK1 A;  4PAL A;  2AMI A;  1BR4 B;  1XFU O;  2E6W A;  1FBV A;  4MVF A;  1F8H A;  2WND A;  2F3Z A;  1WDC B;  2ZN9 A;  4AOM A;  2K7C A;  1TCO B;  2R2I A;  2KGB C;  2TN4 A;  1PUL A;  1S5G Z;  2JRF A;  1MHO A;  2KOT A;  1WDC C;  3SJS A;  2LP3 A;  1XYD A;  1YVH A;  5KU1 A;  1BLQ A;  1J7P A;  1KFU S;  2MLE C;  1IQ5 A;  1F71 A;  3BUO B;  3TS5 B;  1ZOT B;  3A8R A;  4WRI A;  1OE9 B;  2QAC A;  3SG5 A;  3TS5 C;  4NQG A;  1YVL A;  2WOR A;  2JNX A;  4YI9 A;  3OHM B;  1YRT B;  1RK9 A;  1A75 B;  2NCP A;  4QJ4 B;  1TNW A;  3TUY B;  1B8R A;  1TRF A;  4GNK B;  1NP8 A;  3JVT B;  2KAV A;  1Y0V H;  1DJI A;  2JXL A;  1DGV A;  1MQ1 A;  1RFJ A;  4YBH B;  2O60 A;  2F33 A;  3TUY C;  1H8B A;  5KTY A;  1UUR A;  2JWW A;  3IQO A;  3JVT C;  1CFC A;  1V1G A;  4C0K A;  1OSA A;  2LHL A;  1G33 A;  2ZRS A;  1S26 D;  2F8P A;  3DVJ A;  1A29 A;  1S6I A;  1QV1 A;  2LMV A;  3I5G B;  2A4J A;  1ZFS A;  3A4U B;  2BCX A;  1J7O A;  3BUW B;  1UHH A;  4YGC B;  1VRK A;  3CR2 A;  4FQO A;  2L4I A;  2I7A A;  1IGV A;  4ETO A;  1YTZ C;  1L2O B;  2IS9 A;  2M7L A;  1LXF C;  3H4S E;  3LK1 A;  1IRJ A;  2BCA A;  1CMG A;  2K7B A;  2MRD A;  3VRQ A;  1L2O C;  2BKI B;  2ZN8 A;  1H4B A;  2NZ0 A;  3HCM A;  2PMY A;  3I5F B;  5JOL A;  1QTX A;  1QJT A;  2CTN A;  2MA2 A;  4QJ3 B;  1K96 A;  1F54 A;  3CGA A;  2KNE A;  1NX3 A;  1SCM C;  3DVK A;  3I5F C;  5ER4 X;  2SAS A;  1K2H A;  1SYM A;  1G4Y R;  1S6C A;  1CMF A;  1S5G Y;  1M45 A;  2KFF A;  2JT3 A;  1K9K A;  2FJU B;  1GJY A;  1PVB A;  1S6J A;  4MZJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...