2OS8B

Rigor-like structures of muscle myosins reveal key mechanical elements in the transduction pathways of this allosteric motor
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
135
structure length
135
Chain Sequence
IQEMKEAFTMIDQNRDGFIDINDLKEMFSSLGRTPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFGMFDELDTKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVRFVAMIKGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin heavy chain
publication title Rigor-like Structures from Muscle Myosins Reveal Key Mechanical Elements in the Transduction Pathways of This Allosteric Motor.
pubmed doi rcsb
molecule tags Contractile protein
total genus 24
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2007-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2os8B01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2os8B02
1YX8A 1K9UA 1PSBA 4GAOA 3BQ3A 3VGOA 3PFVA 1JFKA 2K7DA 1FW4A 2NXQA 1OE9B 1JSAA 4PE0A 1KCYA 1MUXA 3ZNIA 2M1UA 1NX3A 4ORAB 1A03A 4XJKB 4QJ3B 1K8UA 1Y1UA 3LL8B 1PALA 2WCFA 3O6BA 1K95A 4YRUA 3E3RA 3OB1B 1A75B 1RFJA 4L9MA 5AERA 2KQYA 5IBWA 3KPXA 2B1UA 2LLTA 3EK4A 1CB1A 1K9PA 2CT9A 2MHHA 3BOWB 4JPZB 4M2PA 1KK8B 2LANA 1NX0A 3D0YA 3H4SE 1IJ5A 2EHBA 4N5XA 1PRWA 1R6PA 1DVIA 1EH2A 1YUUA 2SCPA 2FCDA 1K96A 2LHIA 1ZMZA 4A4BA 1A29A 2MLFC 2ZNDA 2K0JA 2I7AA 3BUOB 2JWWA 2WOSA 2KQ6A 2BECA 1M45A 1CM4A 3EK7A 3GK1A 4USLA 3TZ1A 4DS7A 1OMDA 2JRFA 2RGIA 1IQ3A 4GPLB 4PHMA 2JU0A 1EL4A 1K9KA 1L7ZA 1Q80A 1SRAA 2KSPA 3AAJA 2GGMA 3DVMA 3O4YA 1DTLA 1CNPA 2PALA 3PATA 2KI4C 2LVVA 1K93D 5J3XA 1RROA 5AXIA 1MR8A 1IWQA 1KSOA 1SCMC 2BKHB 2KYCA 2Y1MA 1ZFSA 1F4OA 4MSPA 1NCZA 1TNQA 4PALA 4WQ3A 2BBNA 5HKWA 1CDMA 1F4QA 1S36A 2BL0B 2L4IA 1ODBA 4MVFA 4TNCA 2OTGB 4JQ0D 3D10A 3PALA 3EKHA 2LP3A 3A8RA 1DJYA 1A4PA 4NDDA 4YGDB 1LKJA 4M2OA 3DVKA 1EG3A 1KQMB 3BXKA 4HSZA 1CFFA 2MJWB 3WHTB 2LHLA 4GFTA 1DGUA 3BUXB 3TUYB 2KAXA 2KI6C 1B47A 5CSIA 4UPGA 1KK8C 1UHIA 1AP4A 1NSHA 1H8BA 1BLQA 2M0RA 1TNPA 1SKTA 1X02A 4YGBB 3SJSA 3SG5A 1OSAA 2R2IA 1PVAA 2KFFA 2PRUA 4HRHA 1PULA 2P6BB 3OB2B 3O2PA 5HKYA 1ALVA 5PALA 4ORBB 2HQWA 2F3YA 1TOPA 1NX2A 1QX2A 2E6WA 4JWQA 1AHRA 3QRXA 1Y6WA 1KQVA 2LVIA 1AJ4A 1LA3A 3CR2A 1A2XA 4MLWA 2AUCA 1ZOTB 1BJFA 3IQQA 1F70A 3DF0B 5I2QA 1XK4A 4PHKA 2FCEA 3VRQA 2JC2A 1MF8B 1PK0D 3I5GB 3OP0A 2BL0C 2K8MB 4D1EA 2HF5A 3DVJA 2KBMA 2WC8A 2OTGC 3VROA 2ZRSA 1J55A 1NWDA 3LK0A 4PCWA 1V1GA 1WRLA 1WRZA 4GBAA 1KK7Z 1YRUB 1Y0VH 1U5IA 1YR5A 3PSRA 2K2AA 2OS8B 1KQMC 2CCMA 1QATA 2LLUA 4YBHB 2PVBA 4MBEA 1CLMA 4MN0A 3TUYC 1FI6A 4MZLA 1DF0A 1MWNA 1UHHA 3BOWA 2KAYA 1J7RA 1GGWA 3I5IB 4NQGA 1QTXA 1YTZC 2KDHA 3LK1A 2JT0A 1TNWA 1SK6D 1UHKA 2KBIA 2F3ZA 2M97A 4MRXA 4N1GA 1JWDA 3SG3A 4QJ5B 1DJWA 3FIAA 3NSKA 3TDZA 1SR6B 1SL9A 4CIDA 4PDZA 1S6IA 4CFRA 2H61C 3SG2A 1K2HA 4IL1A 1QVIZ 5KSZA 1KFUL 4HREE 3EKJA 2JPTA 2LM5A 2F8PA 2O5GA 1J7PA 2M9GA 3WHUB 1QX5B 1RK9A 1SYMA 3MSEB 3TS5B 2CNPA 1CFDA 3DVEA 2PASA 2K2FA 1D1OA 1CDLA 3I5GC 2QACA 3HX4A 2KFGA 1LINA 2Q4UA 4GUKA 2BCXA 1DT7B 1FF1A 1KSMA 5HYDA 1J1DA 1NX1A 1JUOA 2H2KA 4MZKA 2I2RE 3AKAA 5I2OA 1GGZA 1B7TZ 2EGDA 3VRPA 1YRTB 1E8AA 1S3PA 1KK7Y 2JQ6A 4YI8A 1KFUS 2QPTA 2OS8C 1NCXA 3OHMB 4GGFA 3CTNA 3RM1A 2LUXA 2DOQA 1SL7A 2L4HA 2LNKA 1BG1A 1CFCA 5DKQA 3I5IC 2G2BA 1BODA 1AVSA 1QASA 5DKNA 1SL8A 1EJ3A 1QV0A 2LV7A 4I5LB 1XA5A 3CS1A 3HCMA 1MQ1A 4MZJA 4C0KA 1N0YA 4AQJA 1BMOA 4U8DA 1V1FA 2LCPA 1SR6C 5CPVA 2AMIA 3D0YB 2M3WA 1JFJA 1CLLA 4ICBA 4GGNA 4PE7A 5CSNA 2H61A 1TNXA 2KYFA 2M49B 1DJIA 1QVIY 1IH0A 4ZCVA 4YGAA 5HKZA 3WNXB 1SPYA 2ZN9A 1IJ6A 2KFHA 1N65A 3TS5C 2L0PA 1R2UA 4WQ2A 2JT8A 1G8IA 2M7NA 1JF2A 2ZFDA 1CFPA 2D8NA 1S5GZ 3NSLA 5GQQC 2VRGA 2MBXA 4NDCA 2KOTA 5AANA 1F71A 3PLFB 1F54A 2KGRA 3AAKA 3BYAA 1CTRA 1DJGA 2CTNA 2L2EA 2NCPA 2JT3A 4MEWA 2SASA 1KFXL 1YUSA 3SIBA 4OKHA 2A4JA 4YI9A 2L5XB 1UUSA 3JTDB 1CMGA 1TRFA 1B1GA 1B7TY 1DJXA 1K90D 3OX6A 4R1EA 1FI5A 1XFYO 5TNCA 1ALWA 1NIWA 2HPSA 2GGZA 1XFUO 3RLZA 3JVTB 4I5JA 3M0WA 1XYDA 1IG5A 1SY9A 1TTXA 4DUQA 2JTTA 4QJ4B 3O78A 1LVCD 2LC5A 1NPQA 1B4CA 1KWOB 4CPVA 1AUIB 2BE6A 2NLNA 4XJKA 1B9AA 1K94A 1IRJA 2JTZA 3TDUA 1RWYA 3LLEA 2WCEA 5AFPA 4HRGA 1A75A 1Y1XA 3OX5A 2MLEC 3KF9A 3AKBA 1QJTA 1WRKA 1HT9A 1M39A 1WDCB 4FTGA 4CFQA 4BY5A 1OQPA 2FOTA 3PM8A 2LAPA 5HLVA 1MXLC 3CZTX 4N1FA 1M31A 1ZUZA 1J1EA 3NXAA 2G9BA 1NCYA 1DJHA 1XFZO 1XFVO 1S5GY 1OMRA 2EC6B 2PMYA 4OV2A 2M8UA 2K7OA 1W7JB 5JJGA 4NDBA 1L2OB 3KHEA 4ORCB 4BY4A 1H4BA 4P2YB 1NP8A 5FYXA 2ZKMX 2BCAA 3NSIA 4DCKA 2WORA 3JTDC 2KAVA 4YGCB 4E68A 2LVKA 1XFWO 3GK4X 1OZOA 1TCFA 1FPWA 5I8NA 1AK8A 2LLSA 5AEQA 2ISDA 1MHOA 3K21A 3WXAA 2V53A 3EVUA 1FBVA 3EK8A 3CLNA 1WLZA 3JVTC 1WY9A 1QXPA 1U5IB 1EG4A 4C0JA 1NYAA 1S6JA 1ZACA 3EVRA 5D7FA 1CMFA 1BF5A 1QIVA 2KGBC 1KWOC 2NZ0A 3I5HB 1DF0B 2AAOA 2JZIA 2TN4A 1HQVA 1JC2A 3SG7A 1SMGA 1BOCA 2Q91A 3SG4A 1S6CA 1GJYA 2BBMA 3CGAA 5CSFA 5D69A 1YUTA 1WDCC 5DKRA 3VRRA 2K7CA 1N2DA 1QLSA 2JXCA 1W7IB 2GV5A 3C1VA 1AJ5A 1YX7A 1DGVA 1JF0A 1B8LA 1TIZA 2IS9A 4YGEB 1C07A 3GOFA 4ETOA 2KNEA 1BU3A 2Y4QA 3DD4A 2M7LA 3CWGA 2LMTA 1QV1A 2F2OA 2EC6C 3I5FB 1UURA 1QX7A 2KI6D 2LMVA 5F6TA 1GQMA 1UP5A 2CXJA 2M29A 3LCPC 1L2OC 1QS7A 1VRKA 2BCBA 1CDPA 5KTYA 1SCVA 1UHNA 1CKKA 2NCOA 3KO0A 5CSJA 2K61A 1YVLA 1XFXO 2JULA 1B8CA 1XK4C 2M1KB 2ZN8A 1BT6A 5ER5A 2I94A 2LMUA 3BUWB 4Q04A 1M46A 3F45A 2HETA 1YVHA 1YURA 2JOJA 3DF0A 4PHNA 2FJUB 3VRNA 4OCIA 5G08A 4GNKB 2I18A 1C7VA 1OOJA 2LP2A 1BR4B 2LE9B 1OMVA 2COLB 1DMOA 2PSRA 5KU1A 3IF7A 3PN7B 2LVJA 2O60A 5JOLA 1RECA 4ZCUA 1WLMA 2Y5IA 3KEVA 1CDNA 1RTP1 3BUMB 1B8RA 1PSRA 3I5HC 3ICBA 2L51A 3SG6A 2F33A 1M63B 4F0ZB 1TCOB 3EVVA 2JNXA 3CR5X 4I5NB 1LXFC 2JXLA 1XVJA 3IQOA 1C7WA 4AQIA 4AOMA 1S1EA 3SIAA 4OR9B 4C0LA 3GK2A 1SW8A 2Y1NA 5ER4X 1UWOA 1UHJA 1S26D 3BUNB 4PE1A 1BR1B 1J7QA 4A4CA 1PVBA 3I5FC 2L98A 2MRDA 1KFXS 2ZRTA 3TDIA 2MAZA 1NUBA 4WRIA 1TN4A 4P5OE 2ZNEA 1F55A 3ZWHA 4DIRA 1MXEA 2MA2A 3FS7A 1LA0A 1SBJA 1RJVA 5HLOA 2BE4A 3NSOA 4FQOA 4PHJA 2WNDA 1QLKA 3CR4X 5BPJA 1OZSA 1G4YR 2L50A 4MRYA 5I2LA 4PE4A 1IGVA 3FWCA 1EXRA 2LUCA 4DRWA 1JBAA 4OVNF 4CLNA 2BKIB 2HQ8A 1CM1A 2CBLA 4XYNA 1Y1AA 1IQ5A 3PN7C 1SNLA 4M2QA 1J7OA 2E30A 1XO5A 3A4UB 1CLBA 2WCBA 2KI4B 4GGFC 1QIWA 2K7BA 3FWBA 1G33A 4I5KA 5B8IB 2F2PA 2OPOA 1IKUA 1SCMB 2KHNA 1DJZA 2JNFA 1F8HA 5K89A
chains in the Genus database with same CATH superfamily
1YX8A 1K9UA 1PSBA 4GAOA 3BQ3A 3VGOA 3PFVA 1JFKA 2K7DA 1FW4A 2NXQA 1OE9B 3S0FA 4PE0A 1JSAA 5FI7A 1KCYA 1MUXA 3ZNIA 2M1UA 1NX3A 4ORAB 1DQEA 1A03A 4XJKB 4QJ3B 1K8UA 1Y1UA 3LL8B 1PALA 2WCFA 3O6BA 1K95A 4YRUA 3E3RA 3OB1B 1A75B 1RFJA 3BFHA 4L9MA 5AERA 2KQYA 5IBWA 3KPXA 2B1UA 2LLTA 3EK4A 1CB1A 1K9PA 2CT9A 2MHHA 3BOWB 4JPZB 4M2PA 1KK8B 2LANA 1NX0A 3D0YA 3H4SE 1IJ5A 2EHBA 4N5XA 1PRWA 1R6PA 1DVIA 1EH2A 1YUUA 2SCPA 2FCDA 1K96A 2LHIA 1ZMZA 4A4BA 1A29A 2MLFC 2ZNDA 2K0JA 3SS4A 2I7AA 3BUOB 2JWWA 2WOSA 2KQ6A 2BECA 1M45A 1CM4A 3EK7A 3GK1A 4USLA 3TZ1A 4DS7A 1OMDA 2JRFA 2RGIA 1IQ3A 4GPLB 4PHMA 2JU0A 3BJHA 1EL4A 1K9KA 1L7ZA 1Q80A 1SRAA 2KSPA 3AAJA 2GGMA 3DVMA 3O4YA 1DTLA 1CNPA 2PALA 3PATA 2KI4C 2LVVA 1K93D 3OGNA 1RROA 5J3XA 5AXIA 1OOFA 1MR8A 1IWQA 1KSOA 1DC1A 1SCMC 2BKHB 2KYCA 2Y1MA 1ZFSA 1F4OA 4MSPA 1NCZA 1TNQA 4PALA 4WQ3A 2BBNA 5HKWA 1CDMA 1F4QA 1S36A 2BL0B 2L4IA 3NHTA 1ODBA 4MVFA 4TNCA 2OTGB 3R72A 4JQ0D 3D10A 3PALA 3EKHA 3PJIA 2LP3A 3A8RA 1DJYA 1A4PA 4NDDA 4YGDB 1LKJA 4M2OA 3DVKA 1EG3A 1KQMB 3BXKA 4HSZA 1CFFA 2MJWB 3FE8A 2LHLA 3WHTB 4GFTA 1DGUA 3BUXB 3TUYB 2KAXA 2KI6C 1B47A 5CSIA 4UPGA 1KK8C 1UHIA 1AP4A 1NSHA 1H8BA 3CDNA 2M0RA 2WCLA 1TNPA 1BLQA 1SKTA 1X02A 4YGBB 3SJSA 3SG5A 1OSAA 2R2IA 1PVAA 2KFFA 2PRUA 4HRHA 1PULA 2P6BB 3OB2B 3O2PA 3NHIA 1ALVA 5PALA 5HKYA 4ORBB 2HQWA 2F3YA 1TOPA 1NX2A 1QX2A 2E6WA 4JWQA 1AHRA 3QRXA 1Y6WA 1KQVA 2WCKA 2LVIA 1AJ4A 1LA3A 3CR2A 1A2XA 4MLWA 2AUCA 1ZOTB 1BJFA 3IQQA 1F70A 3DF0B 5I2QA 1XK4A 2FJYA 2FCEA 4PHKA 3VRQA 2JC2A 1MF8B 1PK0D 3I5GB 3OP0A 2BL0C 2K8MB 4D1EA 2HF5A 3DVJA 2KBMA 2H8VA 2WC8A 3NGVA 4INWA 2OTGC 3VROA 2ZRSA 1J55A 1NWDA 1OW4A 3LK0A 1V1GA 1WRLA 4PCWA 1WRZA 4GBAA 1KK7Z 1YRUB 1Y0VH 1U5IA 1YR5A 3PSRA 2K2AA 2OS8B 1KQMC 2YGUA 2CCMA 1QATA 2LLUA 4YBHB 3V2LA 2PVBA 4MBEA 1CLMA 4MN0A 3TUYC 1FI6A 2QEOA 4MZLA 1DF0A 1MWNA 1UHHA 3BOWA 3L4AA 1C3YA 2KAYA 1J7RA 1IIOA 1GGWA 3I5IB 4NQGA 3UO9A 1QTXA 1YTZC 2KDHA 3D74A 3LK1A 2JT0A 1TNWA 1SK6D 1UHKA 2L5YA 2KBIA 2F3ZA 2M97A 4MRXA 4N1GA 3CZ0A 1JWDA 3SG3A 4QJ5B 1DJWA 3FIAA 3NSKA 3TDZA 1ORGA 3VB1A 4FQTA 1SR6B 1SL9A 4CIDA 4PDZA 1S6IA 4CFRA 2H61C 3SG2A 1K2HA 4IL1A 1QVIZ 5KSZA 2QDIA 1KFUL 4HREE 3EKJA 2JPTA 2LM5A 1OOHA 2F8PA 2O5GA 1J7PA 2M9GA 3WHUB 1QX5B 1RK9A 1SYMA 3FE9A 3MSEB 3TS5B 2CNPA 1CFDA 3DVEA 2PASA 2K2FA 1D1OA 1CDLA 4JKTA 2QEVA 3CZ1A 3I5GC 2QACA 3HX4A 2KFGA 1LINA 2Q4UA 4GUKA 2BCXA 1DT7B 1FF1A 1KSMA 5HYDA 1J1DA 1NX1A 2WC5A 1JUOA 2H2KA 4MZKA 2I2RE 3AKAA 2WCJA 5I2OA 1GGZA 2BAPA 3EG5B 3S0AA 1B7TZ 1TWOA 2EGDA 1YRTB 1E8AA 1S3PA 3VRPA 1KK7Y 2JQ6A 4YI8A 1KFUS 2QPTA 2OS8C 1NCXA 3S0EA 5D3OA 3OHMB 4GGFA 3CTNA 3RM1A 2LUXA 2DOQA 1SL7A 2L4HA 2LNKA 1TUJA 1BG1A 1CFCA 5DKQA 3I5IC 2G2BA 1BODA 1AVSA 1QASA 5DKNA 1SL8A 1EJ3A 1QV0A 2LV7A 2QEHA 4I5LB 1XA5A 3CS1A 3HCMA 1MQ1A 4MZJA 4C0KA 1N0YA 4AQJA 1BMOA 4U8DA 1V1FA 2LCPA 1SR6C 5CPVA 2AMIA 3D0YB 2M3WA 1JFJA 1CLLA 3DYEA 4GGNA 4ICBA 4PE7A 5CSNA 2H61A 1TNXA 2KYFA 2M49B 3B86A 1DJIA 1QVIY 1IH0A 4ZCVA 3DY9A 4YGAA 5HKZA 3WNXB 1SPYA 2ZN9A 1IJ6A 2KFHA 1N65A 3TS5C 2L0PA 1OOGA 1R2UA 3D75A 2JT8A 4WQ2A 5I94A 1G8IA 2M7NA 1JF2A 2ZFDA 1CFPA 2D8NA 1S5GZ 3NSLA 2L2CA 2VRGA 5GQQC 4NDCA 2MBXA 2KOTA 3R1PA 5AANA 1F71A 3PLFB 1F54A 2KGRA 3AAKA 3BYAA 1CTRA 1DJGA 2CTNA 2L2EA 2NCPA 2JT3A 4MEWA 2SASA 1KFXL 1YUSA 3SIBA 4OKHA 2A4JA 4YI9A 2L5XB 1UUSA 3JTDB 1CMGA 1TUZA 1TRFA 2GTEA 1B1GA 1B7TY 1DJXA 1K90D 1LS8A 1C3ZA 3OX6A 3SS5A 4R1EA 1FI5A 1XFYO 1W9ZA 5TNCA 1ALWA 3CABA 1NIWA 2HPSA 2GGZA 4PT1A 1XFUO 3RLZA 3JVTB 4I5JA 3M0WA 1XYDA 1IG5A 1SY9A 1TTXA 4DUQA 2JTTA 4QJ4B 3O78A 1LVCD 2LC5A 3D76A 1NPQA 1B4CA 1KWOB 4CPVA 1AUIB 2BE6A 2NLNA 2PQLA 4XJKA 1B9AA 1K94A 1IRJA 2JTZA 3TDUA 1QWVA 1RWYA 3LLEA 4IJ7A 2WCEA 5AFPA 4HRGA 2BNXA 1A75A 1Y1XA 3OX5A 2MLEC 3KF9A 3AKBA 1QJTA 1WRKA 1HT9A 1M39A 1WDCB 4FTGA 4JD9A 2KPHA 4BY5A 4CFQA 1OQPA 2FOTA 3PM8A 2LAPA 3BFAA 5HLVA 1MXLC 3CZTX 1T14A 1M31A 3DXLA 1ZUZA 1J1EA 3NXAA 2G9BA 3N7HA 1NCYA 5FI2A 1DJHA 1XFZO 1XFVO 1S5GY 1OMRA 3BFBA 2EC6B 2PMYA 3B88A 4OV2A 2M8UA 2K7OA 1W7JB 5JJGA 3FE6A 4NDBA 1L2OB 3KHEA 4ORCB 4BY4A 1H4BA 4P2YB 1NP8A 5FYXA 2ZKMX 2BCAA 3NSIA 4DCKA 2WORA 3JTDC 2KAVA 4YGCB 4E68A 2LVKA 1XFWO 3GK4X 1OZOA 1TCFA 3S0DA 1FPWA 4INXA 5I8NA 3IVTA 1AK8A 2LLSA 3K1EA 5AEQA 2ISDA 1MHOA 3K21A 3WXAA 2V53A 3EVUA 1P28A 1FBVA 3QMEA 3EK8A 3RZSA 3CLNA 1WLZA 3JVTC 1WY9A 1C07A 1QXPA 1U5IB 1EG4A 4C0JA 1NYAA 1S6JA 1ZACA 3EVRA 4KYNA 5D7FA 1CMFA 1BF5A 1QIVA 2KGBC 1KWOC 2NZ0A 3I5HB 3CYZA 1DF0B 2AAOA 2JZIA 2TN4A 2WCHA 1HQVA 1JC2A 3SG7A 1SMGA 1BOCA 2KLEA 2K60A 2Q91A 3SG4A 1Z2CB 1S6CA 1GJYA 2BBMA 3CGAA 2KLDA 5CSFA 5D69A 3L47A 1YUTA 1WDCC 5DKRA 3O4XA 3B6XA 3VRRA 2K7CA 1N2DA 1QLSA 2JXCA 1W7IB 2GV5A 3C1VA 4OZDA 1AJ5A 1YX7A 1DGVA 1JF0A 1B8LA 1TIZA 2IS9A 3Q8IA 4YGEB 3GOFA 5HL1A 1OOIX 2KNEA 1BU3A 2Y4QA 3DD4A 2M7LA 4ETOA 3CWGA 2LMTA 1QV1A 2F2OA 2EC6C 3I5FB 1UURA 1QX7A 2KI6D 2LMVA 5F6TA 1GQMA 1UP5A 2CXJA 2M29A 3LCPC 1L2OC 1QS7A 1VRKA 2BCBA 1CDPA 5KTYA 1SCVA 1UHNA 1CKKA 2NCOA 3KO0A 5CSJA 2K61A 2WCMA 1YVLA 1XFXO 2ERBA 2JULA 5FI6A 1B8CA 1DELA 1XK4C 2M1KB 3DZTA 5EL2A 2ZN8A 1BT6A 5ER5A 2I94A 2LMUA 3BUWB 4Q04A 1M46A 3F45A 2HETA 1YVHA 1YURA 2JOJA 3DF0A 4PHNA 2FJUB 3S0GA 3CZ2A 3VRNA 4OCIA 5G08A 4GNKB 2I18A 1C7VA 1OOJA 2LP2A 2P70A 1BR4B 2LE9B 1OMVA 2COLB 2JPOA 2QEBA 3B7AA 2PSRA 3OBVA 1DMOA 1SSEB 5KU1A 3IF7A 3PN7B 2LVJA 2O60A 5JOLA 1RECA 4ZCUA 3PM2A 1WLMA 2Y5IA 3KEVA 1CDNA 1RTP1 3BUMB 1B8RA 1PSRA 3I5HC 3ICBA 2L51A 3SG6A 2F33A 1M63B 4F0ZB 1TCOB 3EVVA 2JNXA 3CR5X 3L4LA 1LXFC 4I5NB 2JXLA 1XVJA 4N1FA 1XFRA 3UNWA 3IQOA 1C7WA 4AQIA 1GM0A 4AOMA 1S1EA 3SIAA 4OR9B 4C0LA 3GK2A 1SW8A 2Y1NA 3R1VA 5ER4X 3D77A 1UWOA 3SS3A 1UHJA 1S26D 3BUNB 4PE1A 1BR1B 1J7QA 4A4CA 1PVBA 3I5FC 2L98A 2MRDA 1KFXS 2ZRTA 3TDIA 2MAZA 1NUBA 4WRIA 1TN4A 4P5OE 2ZNEA 1DEKA 1F55A 3ZWHA 4F7FA 4DIRA 1MXEA 2MA2A 3FS7A 3B87A 1LA0A 1Z4HA 1SBJA 1RJVA 5HLOA 2BE4A 2WC6A 3NSOA 4FQOA 2WNDA 4PHJA 1QLKA 3CR4X 3R1OA 5BPJA 1OZSA 1G4YR 2L50A 4MRYA 5I2LA 4PE4A 3D73A 1IGVA 2PYQA 3FWCA 1EXRA 2LUCA 5DICA 4DRWA 1JBAA 4OVNF 4CLNA 2BKIB 2HQ8A 1CM1A 2CBLA 4XYNA 1Y1AA 3D78A 1IQ5A 3PN7C 2P71A 1SNLA 4M2QA 1J7OA 2E30A 1XO5A 3A4UB 1CLBA 2WCBA 3S0BA 2KI4B 4GGFC 1QIWA 2K7BA 3FWBA 1G33A 4I5KA 5B8IB 2F2PA 2OPOA 1IKUA 1SCMB 2KHNA 1DJZA 2JNFA 1F8HA 5K89A
chains in the Genus database with same CATH topology
1YX8A 1K9UA 1PSBA 4GAOA 3BQ3A 3VGOA 3PFVA 1JFKA 2K7DA 1FW4A 2NXQA 1OE9B 1JSAA 4PE0A 1KCYA 1MUXA 3ZNIA 2M1UA 1NX3A 4ORAB 1A03A 4XJKB 4QJ3B 1K8UA 1Y1UA 3LL8B 1PALA 2WCFA 3O6BA 1K95A 4YRUA 3E3RA 3OB1B 1A75B 1RFJA 4L9MA 5AERA 2KQYA 5IBWA 3KPXA 2B1UA 2LLTA 3EK4A 1CB1A 1K9PA 2CT9A 2MHHA 3BOWB 4JPZB 4M2PA 1KK8B 2LANA 1NX0A 3D0YA 3H4SE 1IJ5A 2EHBA 4N5XA 1PRWA 1R6PA 1DVIA 1EH2A 1YUUA 2SCPA 2FCDA 1K96A 2LHIA 1ZMZA 4A4BA 1A29A 2MLFC 2ZNDA 2K0JA 2I7AA 3BUOB 2JWWA 2WOSA 2KQ6A 2BECA 1M45A 1CM4A 3EK7A 3GK1A 4USLA 3TZ1A 4DS7A 1OMDA 2JRFA 2RGIA 1IQ3A 4GPLB 4PHMA 2JU0A 1EL4A 1K9KA 1L7ZA 1Q80A 1SRAA 2KSPA 3AAJA 2GGMA 3DVMA 3O4YA 1DTLA 1CNPA 2PALA 3PATA 2KI4C 2LVVA 1K93D 5J3XA 1RROA 5AXIA 1MR8A 1IWQA 1KSOA 1SCMC 2BKHB 2KYCA 2Y1MA 1ZFSA 1F4OA 4MSPA 1NCZA 1TNQA 4PALA 4WQ3A 2BBNA 5HKWA 1CDMA 1F4QA 1S36A 2BL0B 2L4IA 1ODBA 4MVFA 4TNCA 2OTGB 4JQ0D 3D10A 3PALA 3EKHA 2LP3A 3A8RA 1DJYA 1A4PA 4NDDA 4YGDB 1LKJA 4M2OA 3DVKA 1EG3A 1KQMB 3BXKA 4HSZA 1CFFA 2MJWB 3WHTB 2LHLA 4GFTA 1DGUA 3BUXB 3TUYB 2KAXA 2KI6C 1B47A 5CSIA 4UPGA 1KK8C 1UHIA 1AP4A 1NSHA 1H8BA 1BLQA 2M0RA 1TNPA 1SKTA 1X02A 4YGBB 3SJSA 3SG5A 1OSAA 2R2IA 1PVAA 2KFFA 2PRUA 4HRHA 1PULA 2P6BB 3OB2B 3O2PA 5HKYA 1ALVA 5PALA 4ORBB 2HQWA 2F3YA 1TOPA 1NX2A 1QX2A 2E6WA 4JWQA 1AHRA 3QRXA 1Y6WA 1KQVA 2LVIA 1AJ4A 1LA3A 3CR2A 1A2XA 4MLWA 2AUCA 1ZOTB 1BJFA 3IQQA 1F70A 3DF0B 5I2QA 1XK4A 4PHKA 2FCEA 3VRQA 2JC2A 1MF8B 1PK0D 3I5GB 3OP0A 2BL0C 2K8MB 4D1EA 2HF5A 3DVJA 2KBMA 2WC8A 2OTGC 3VROA 2ZRSA 1J55A 1NWDA 3LK0A 4PCWA 1V1GA 1WRLA 1WRZA 4GBAA 1KK7Z 1YRUB 1Y0VH 1U5IA 1YR5A 3PSRA 2K2AA 2OS8B 1KQMC 2CCMA 1QATA 2LLUA 4YBHB 2PVBA 4MBEA 1CLMA 4MN0A 3TUYC 1FI6A 4MZLA 1DF0A 1MWNA 1UHHA 3BOWA 2KAYA 1J7RA 1GGWA 3I5IB 4NQGA 1QTXA 1YTZC 2KDHA 3LK1A 2JT0A 1TNWA 1SK6D 1UHKA 2KBIA 2F3ZA 2M97A 4MRXA 4N1GA 1JWDA 3SG3A 4QJ5B 1DJWA 3FIAA 3NSKA 3TDZA 1SR6B 1SL9A 4CIDA 4PDZA 1S6IA 4CFRA 2H61C 3SG2A 1K2HA 4IL1A 1QVIZ 5KSZA 1KFUL 4HREE 3EKJA 2JPTA 2LM5A 2F8PA 2O5GA 1J7PA 2M9GA 3WHUB 1QX5B 1RK9A 1SYMA 3MSEB 3TS5B 2CNPA 1CFDA 3DVEA 2PASA 2K2FA 1D1OA 1CDLA 3I5GC 2QACA 3HX4A 2KFGA 1LINA 2Q4UA 4GUKA 2BCXA 1DT7B 1FF1A 1KSMA 5HYDA 1J1DA 1NX1A 1JUOA 2H2KA 4MZKA 2I2RE 3AKAA 5I2OA 1GGZA 1B7TZ 2EGDA 3VRPA 1YRTB 1E8AA 1S3PA 1KK7Y 2JQ6A 4YI8A 1KFUS 2QPTA 2OS8C 1NCXA 3OHMB 4GGFA 3CTNA 3RM1A 2LUXA 2DOQA 1SL7A 2L4HA 2LNKA 1BG1A 1CFCA 5DKQA 3I5IC 2G2BA 1BODA 1AVSA 1QASA 5DKNA 1SL8A 1EJ3A 1QV0A 2LV7A 4I5LB 1XA5A 3CS1A 3HCMA 1MQ1A 4MZJA 4C0KA 1N0YA 4AQJA 1BMOA 4U8DA 1V1FA 2LCPA 1SR6C 5CPVA 2AMIA 3D0YB 2M3WA 1JFJA 1CLLA 4ICBA 4GGNA 4PE7A 5CSNA 2H61A 1TNXA 2KYFA 2M49B 1DJIA 1QVIY 1IH0A 4ZCVA 4YGAA 5HKZA 3WNXB 1SPYA 2ZN9A 1IJ6A 2KFHA 1N65A 3TS5C 2L0PA 1R2UA 4WQ2A 2JT8A 1G8IA 2M7NA 1JF2A 2ZFDA 1CFPA 2D8NA 1S5GZ 3NSLA 5GQQC 2VRGA 2MBXA 4NDCA 2KOTA 5AANA 1F71A 3PLFB 1F54A 2KGRA 3AAKA 3BYAA 1CTRA 1DJGA 2CTNA 2L2EA 2NCPA 2JT3A 4MEWA 2SASA 1KFXL 1YUSA 3SIBA 4OKHA 2A4JA 4YI9A 2L5XB 1UUSA 3JTDB 1CMGA 1TRFA 1B1GA 1B7TY 1DJXA 1K90D 3OX6A 4R1EA 1FI5A 1XFYO 5TNCA 1ALWA 1NIWA 2HPSA 2GGZA 1XFUO 3RLZA 3JVTB 4I5JA 3M0WA 1XYDA 1IG5A 1SY9A 1TTXA 4DUQA 2JTTA 4QJ4B 3O78A 1LVCD 2LC5A 1NPQA 1B4CA 1KWOB 4CPVA 1AUIB 2BE6A 2NLNA 4XJKA 1B9AA 1K94A 1IRJA 2JTZA 3TDUA 1RWYA 3LLEA 2WCEA 5AFPA 4HRGA 1A75A 1Y1XA 3OX5A 2MLEC 3KF9A 3AKBA 1QJTA 1WRKA 1HT9A 1M39A 1WDCB 4FTGA 4CFQA 4BY5A 1OQPA 2FOTA 3PM8A 2LAPA 5HLVA 1MXLC 3CZTX 4N1FA 1M31A 1ZUZA 1J1EA 3NXAA 2G9BA 1NCYA 1DJHA 1XFZO 1XFVO 1S5GY 1OMRA 2EC6B 2PMYA 4OV2A 2M8UA 2K7OA 1W7JB 5JJGA 4NDBA 1L2OB 3KHEA 4ORCB 4BY4A 1H4BA 4P2YB 1NP8A 5FYXA 2ZKMX 2BCAA 3NSIA 4DCKA 2WORA 3JTDC 2KAVA 4YGCB 4E68A 2LVKA 1XFWO 3GK4X 1OZOA 1TCFA 1FPWA 5I8NA 1AK8A 2LLSA 5AEQA 2ISDA 1MHOA 3K21A 3WXAA 2V53A 3EVUA 1FBVA 3EK8A 3CLNA 1WLZA 3JVTC 1WY9A 1QXPA 1U5IB 1EG4A 4C0JA 1NYAA 1S6JA 1ZACA 3EVRA 5D7FA 1CMFA 1BF5A 1QIVA 2KGBC 1KWOC 2NZ0A 3I5HB 1DF0B 2AAOA 2JZIA 2TN4A 1HQVA 1JC2A 3SG7A 1SMGA 1BOCA 2Q91A 3SG4A 1S6CA 1GJYA 2BBMA 3CGAA 5CSFA 5D69A 1YUTA 1WDCC 5DKRA 3VRRA 2K7CA 1N2DA 1QLSA 2JXCA 1W7IB 2GV5A 3C1VA 1AJ5A 1YX7A 1DGVA 1JF0A 1B8LA 1TIZA 2IS9A 4YGEB 1C07A 3GOFA 4ETOA 2KNEA 1BU3A 2Y4QA 3DD4A 2M7LA 3CWGA 2LMTA 1QV1A 2F2OA 2EC6C 3I5FB 1UURA 1QX7A 2KI6D 2LMVA 5F6TA 1GQMA 1UP5A 2CXJA 2M29A 3LCPC 1L2OC 1QS7A 1VRKA 2BCBA 1CDPA 5KTYA 1SCVA 1UHNA 1CKKA 2NCOA 3KO0A 5CSJA 2K61A 1YVLA 1XFXO 2JULA 1B8CA 1XK4C 2M1KB 2ZN8A 1BT6A 5ER5A 2I94A 2LMUA 3BUWB 4Q04A 1M46A 3F45A 2HETA 1YVHA 1YURA 2JOJA 3DF0A 4PHNA 2FJUB 3VRNA 4OCIA 5G08A 4GNKB 2I18A 1C7VA 1OOJA 2LP2A 1BR4B 2LE9B 1OMVA 2COLB 1DMOA 2PSRA 5KU1A 3IF7A 3PN7B 2LVJA 2O60A 5JOLA 1RECA 4ZCUA 1WLMA 2Y5IA 3KEVA 1CDNA 1RTP1 3BUMB 1B8RA 1PSRA 3I5HC 3ICBA 2L51A 3SG6A 2F33A 1M63B 4F0ZB 1TCOB 3EVVA 2JNXA 3CR5X 4I5NB 1LXFC 2JXLA 1XVJA 3IQOA 1C7WA 4AQIA 4AOMA 1S1EA 3SIAA 4OR9B 4C0LA 3GK2A 1SW8A 2Y1NA 5ER4X 1UWOA 1UHJA 1S26D 3BUNB 4PE1A 1BR1B 1J7QA 4A4CA 1PVBA 3I5FC 2L98A 2MRDA 1KFXS 2ZRTA 3TDIA 2MAZA 1NUBA 4WRIA 1TN4A 4P5OE 2ZNEA 1F55A 3ZWHA 4DIRA 1MXEA 2MA2A 3FS7A 1LA0A 1SBJA 1RJVA 5HLOA 2BE4A 3NSOA 4FQOA 4PHJA 2WNDA 1QLKA 3CR4X 5BPJA 1OZSA 1G4YR 2L50A 4MRYA 5I2LA 4PE4A 1IGVA 3FWCA 1EXRA 2LUCA 4DRWA 1JBAA 4OVNF 4CLNA 2BKIB 2HQ8A 1CM1A 2CBLA 4XYNA 1Y1AA 1IQ5A 3PN7C 1SNLA 4M2QA 1J7OA 2E30A 1XO5A 3A4UB 1CLBA 2WCBA 2KI4B 4GGFC 1QIWA 2K7BA 3FWBA 1G33A 4I5KA 5B8IB 2F2PA 2OPOA 1IKUA 1SCMB 2KHNA 1DJZA 2JNFA 1F8HA 5K89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YX8 A;  1K9U A;  1PSB A;  4GAO A;  3BQ3 A;  3VGO A;  3PFV A;  1JFK A;  2K7D A;  1FW4 A;  2NXQ A;  1OE9 B;  1JSA A;  4PE0 A;  1KCY A;  1MUX A;  3ZNI A;  2M1U A;  1NX3 A;  4ORA B;  1A03 A;  4XJK B;  4QJ3 B;  1K8U A;  1Y1U A;  3LL8 B;  1PAL A;  2WCF A;  3O6B A;  1K95 A;  4YRU A;  3E3R A;  3OB1 B;  1A75 B;  1RFJ A;  4L9M A;  5AER A;  2KQY A;  5IBW A;  3KPX A;  2B1U A;  2LLT A;  3EK4 A;  1CB1 A;  1K9P A;  2CT9 A;  2MHH A;  3BOW B;  4JPZ B;  4M2P A;  1KK8 B;  2LAN A;  1NX0 A;  3D0Y A;  3H4S E;  1IJ5 A;  2EHB A;  4N5X A;  1PRW A;  1R6P A;  1DVI A;  1EH2 A;  1YUU A;  2SCP A;  2FCD A;  1K96 A;  2LHI A;  1ZMZ A;  4A4B A;  1A29 A;  2MLF C;  2ZND A;  2K0J A;  2I7A A;  3BUO B;  2JWW A;  2WOS A;  2KQ6 A;  2BEC A;  1M45 A;  1CM4 A;  3EK7 A;  3GK1 A;  4USL A;  3TZ1 A;  4DS7 A;  1OMD A;  2JRF A;  2RGI A;  1IQ3 A;  4GPL B;  4PHM A;  2JU0 A;  1EL4 A;  1K9K A;  1L7Z A;  1Q80 A;  1SRA A;  2KSP A;  3AAJ A;  2GGM A;  3DVM A;  3O4Y A;  1DTL A;  1CNP A;  2PAL A;  3PAT A;  2KI4 C;  2LVV A;  1K93 D;  5J3X A;  1RRO A;  5AXI A;  1MR8 A;  1IWQ A;  1KSO A;  1SCM C;  2BKH B;  2KYC A;  2Y1M A;  1ZFS A;  1F4O A;  4MSP A;  1NCZ A;  1TNQ A;  4PAL A;  4WQ3 A;  2BBN A;  5HKW A;  1CDM A;  1F4Q A;  1S36 A;  2BL0 B;  2L4I A;  1ODB A;  4MVF A;  4TNC A;  2OTG B;  4JQ0 D;  3D10 A;  3PAL A;  3EKH A;  2LP3 A;  3A8R A;  1DJY A;  1A4P A;  4NDD A;  4YGD B;  1LKJ A;  4M2O A;  3DVK A;  1EG3 A;  1KQM B;  3BXK A;  4HSZ A;  1CFF A;  2MJW B;  3WHT B;  2LHL A;  4GFT A;  1DGU A;  3BUX B;  3TUY B;  2KAX A;  2KI6 C;  1B47 A;  5CSI A;  4UPG A;  1KK8 C;  1UHI A;  1AP4 A;  1NSH A;  1H8B A;  1BLQ A;  2M0R A;  1TNP A;  1SKT A;  1X02 A;  4YGB B;  3SJS A;  3SG5 A;  1OSA A;  2R2I A;  1PVA A;  2KFF A;  2PRU A;  4HRH A;  1PUL A;  2P6B B;  3OB2 B;  3O2P A;  5HKY A;  1ALV A;  5PAL A;  4ORB B;  2HQW A;  2F3Y A;  1TOP A;  1NX2 A;  1QX2 A;  2E6W A;  4JWQ A;  1AHR A;  3QRX A;  1Y6W A;  1KQV A;  2LVI A;  1AJ4 A;  1LA3 A;  3CR2 A;  1A2X A;  4MLW A;  2AUC A;  1ZOT B;  1BJF A;  3IQQ A;  1F70 A;  3DF0 B;  5I2Q A;  1XK4 A;  4PHK A;  2FCE A;  3VRQ A;  2JC2 A;  1MF8 B;  1PK0 D;  3I5G B;  3OP0 A;  2BL0 C;  2K8M B;  4D1E A;  2HF5 A;  3DVJ A;  2KBM A;  2WC8 A;  2OTG C;  3VRO A;  2ZRS A;  1J55 A;  1NWD A;  3LK0 A;  4PCW A;  1V1G A;  1WRL A;  1WRZ A;  4GBA A;  1KK7 Z;  1YRU B;  1Y0V H;  1U5I A;  1YR5 A;  3PSR A;  2K2A A;  2OS8 B;  1KQM C;  2CCM A;  1QAT A;  2LLU A;  4YBH B;  2PVB A;  4MBE A;  1CLM A;  4MN0 A;  3TUY C;  1FI6 A;  4MZL A;  1DF0 A;  1MWN A;  1UHH A;  3BOW A;  2KAY A;  1J7R A;  1GGW A;  3I5I B;  4NQG A;  1QTX A;  1YTZ C;  2KDH A;  3LK1 A;  2JT0 A;  1TNW A;  1SK6 D;  1UHK A;  2KBI A;  2F3Z A;  2M97 A;  4MRX A;  4N1G A;  1JWD A;  3SG3 A;  4QJ5 B;  1DJW A;  3FIA A;  3NSK A;  3TDZ A;  1SR6 B;  1SL9 A;  4CID A;  4PDZ A;  1S6I A;  4CFR A;  2H61 C;  3SG2 A;  1K2H A;  4IL1 A;  1QVI Z;  5KSZ A;  1KFU L;  4HRE E;  3EKJ A;  2JPT A;  2LM5 A;  2F8P A;  2O5G A;  1J7P A;  2M9G A;  3WHU B;  1QX5 B;  1RK9 A;  1SYM A;  3MSE B;  3TS5 B;  2CNP A;  1CFD A;  3DVE A;  2PAS A;  2K2F A;  1D1O A;  1CDL A;  3I5G C;  2QAC A;  3HX4 A;  2KFG A;  1LIN A;  2Q4U A;  4GUK A;  2BCX A;  1DT7 B;  1FF1 A;  1KSM A;  5HYD A;  1J1D A;  1NX1 A;  1JUO A;  2H2K A;  4MZK A;  2I2R E;  3AKA A;  5I2O A;  1GGZ A;  1B7T Z;  2EGD A;  3VRP A;  1YRT B;  1E8A A;  1S3P A;  1KK7 Y;  2JQ6 A;  4YI8 A;  1KFU S;  2QPT A;  2OS8 C;  1NCX A;  3OHM B;  4GGF A;  3CTN A;  3RM1 A;  2LUX A;  2DOQ A;  1SL7 A;  2L4H A;  2LNK A;  1BG1 A;  1CFC A;  5DKQ A;  3I5I C;  2G2B A;  1BOD A;  1AVS A;  1QAS A;  5DKN A;  1SL8 A;  1EJ3 A;  1QV0 A;  2LV7 A;  4I5L B;  1XA5 A;  3CS1 A;  3HCM A;  1MQ1 A;  4MZJ A;  4C0K A;  1N0Y A;  4AQJ A;  1BMO A;  4U8D A;  1V1F A;  2LCP A;  1SR6 C;  5CPV A;  2AMI A;  3D0Y B;  2M3W A;  1JFJ A;  1CLL A;  4ICB A;  4GGN A;  4PE7 A;  5CSN A;  2H61 A;  1TNX A;  2KYF A;  2M49 B;  1DJI A;  1QVI Y;  1IH0 A;  4ZCV A;  4YGA A;  5HKZ A;  3WNX B;  1SPY A;  2ZN9 A;  1IJ6 A;  2KFH A;  1N65 A;  3TS5 C;  2L0P A;  1R2U A;  4WQ2 A;  2JT8 A;  1G8I A;  2M7N A;  1JF2 A;  2ZFD A;  1CFP A;  2D8N A;  1S5G Z;  3NSL A;  5GQQ C;  2VRG A;  2MBX A;  4NDC A;  2KOT A;  5AAN A;  1F71 A;  3PLF B;  1F54 A;  2KGR A;  3AAK A;  3BYA A;  1CTR A;  1DJG A;  2CTN A;  2L2E A;  2NCP A;  2JT3 A;  4MEW A;  2SAS A;  1KFX L;  1YUS A;  3SIB A;  4OKH A;  2A4J A;  4YI9 A;  2L5X B;  1UUS A;  3JTD B;  1CMG A;  1TRF A;  1B1G A;  1B7T Y;  1DJX A;  1K90 D;  3OX6 A;  4R1E A;  1FI5 A;  1XFY O;  5TNC A;  1ALW A;  1NIW A;  2HPS A;  2GGZ A;  1XFU O;  3RLZ A;  3JVT B;  4I5J A;  3M0W A;  1XYD A;  1IG5 A;  1SY9 A;  1TTX A;  4DUQ A;  2JTT A;  4QJ4 B;  3O78 A;  1LVC D;  2LC5 A;  1NPQ A;  1B4C A;  1KWO B;  4CPV A;  1AUI B;  2BE6 A;  2NLN A;  4XJK A;  1B9A A;  1K94 A;  1IRJ A;  2JTZ A;  3TDU A;  1RWY A;  3LLE A;  2WCE A;  5AFP A;  4HRG A;  1A75 A;  1Y1X A;  3OX5 A;  2MLE C;  3KF9 A;  3AKB A;  1QJT A;  1WRK A;  1HT9 A;  1M39 A;  1WDC B;  4FTG A;  4CFQ A;  4BY5 A;  1OQP A;  2FOT A;  3PM8 A;  2LAP A;  5HLV A;  1MXL C;  3CZT X;  4N1F A;  1M31 A;  1ZUZ A;  1J1E A;  3NXA A;  2G9B A;  1NCY A;  1DJH A;  1XFZ O;  1XFV O;  1S5G Y;  1OMR A;  2EC6 B;  2PMY A;  4OV2 A;  2M8U A;  2K7O A;  1W7J B;  5JJG A;  4NDB A;  1L2O B;  3KHE A;  4ORC B;  4BY4 A;  1H4B A;  4P2Y B;  1NP8 A;  5FYX A;  2ZKM X;  2BCA A;  3NSI A;  4DCK A;  2WOR A;  3JTD C;  2KAV A;  4YGC B;  4E68 A;  2LVK A;  1XFW O;  3GK4 X;  1OZO A;  1TCF A;  1FPW A;  5I8N A;  1AK8 A;  2LLS A;  5AEQ A;  2ISD A;  1MHO A;  3K21 A;  3WXA A;  2V53 A;  3EVU A;  1FBV A;  3EK8 A;  3CLN A;  1WLZ A;  3JVT C;  1WY9 A;  1QXP A;  1U5I B;  1EG4 A;  4C0J A;  1NYA A;  1S6J A;  1ZAC A;  3EVR A;  5D7F A;  1CMF A;  1BF5 A;  1QIV A;  2KGB C;  1KWO C;  2NZ0 A;  3I5H B;  1DF0 B;  2AAO A;  2JZI A;  2TN4 A;  1HQV A;  1JC2 A;  3SG7 A;  1SMG A;  1BOC A;  2Q91 A;  3SG4 A;  1S6C A;  1GJY A;  2BBM A;  3CGA A;  5CSF A;  5D69 A;  1YUT A;  1WDC C;  5DKR A;  3VRR A;  2K7C A;  1N2D A;  1QLS A;  2JXC A;  1W7I B;  2GV5 A;  3C1V A;  1AJ5 A;  1YX7 A;  1DGV A;  1JF0 A;  1B8L A;  1TIZ A;  2IS9 A;  4YGE B;  1C07 A;  3GOF A;  4ETO A;  2KNE A;  1BU3 A;  2Y4Q A;  3DD4 A;  2M7L A;  3CWG A;  2LMT A;  1QV1 A;  2F2O A;  2EC6 C;  3I5F B;  1UUR A;  1QX7 A;  2KI6 D;  2LMV A;  5F6T A;  1GQM A;  1UP5 A;  2CXJ A;  2M29 A;  3LCP C;  1L2O C;  1QS7 A;  1VRK A;  2BCB A;  1CDP A;  5KTY A;  1SCV A;  1UHN A;  1CKK A;  2NCO A;  3KO0 A;  5CSJ A;  2K61 A;  1YVL A;  1XFX O;  2JUL A;  1B8C A;  1XK4 C;  2M1K B;  2ZN8 A;  1BT6 A;  5ER5 A;  2I94 A;  2LMU A;  3BUW B;  4Q04 A;  1M46 A;  3F45 A;  2HET A;  1YVH A;  1YUR A;  2JOJ A;  3DF0 A;  4PHN A;  2FJU B;  3VRN A;  4OCI A;  5G08 A;  4GNK B;  2I18 A;  1C7V A;  1OOJ A;  2LP2 A;  1BR4 B;  2LE9 B;  1OMV A;  2COL B;  1DMO A;  2PSR A;  5KU1 A;  3IF7 A;  3PN7 B;  2LVJ A;  2O60 A;  5JOL A;  1REC A;  4ZCU A;  1WLM A;  2Y5I A;  3KEV A;  1CDN A;  1RTP 1;  3BUM B;  1B8R A;  1PSR A;  3I5H C;  3ICB A;  2L51 A;  3SG6 A;  2F33 A;  1M63 B;  4F0Z B;  1TCO B;  3EVV A;  2JNX A;  3CR5 X;  4I5N B;  1LXF C;  2JXL A;  1XVJ A;  3IQO A;  1C7W A;  4AQI A;  4AOM A;  1S1E A;  3SIA A;  4OR9 B;  4C0L A;  3GK2 A;  1SW8 A;  2Y1N A;  5ER4 X;  1UWO A;  1UHJ A;  1S26 D;  3BUN B;  4PE1 A;  1BR1 B;  1J7Q A;  4A4C A;  1PVB A;  3I5F C;  2L98 A;  2MRD A;  1KFX S;  2ZRT A;  3TDI A;  2MAZ A;  1NUB A;  4WRI A;  1TN4 A;  4P5O E;  2ZNE A;  1F55 A;  3ZWH A;  4DIR A;  1MXE A;  2MA2 A;  3FS7 A;  1LA0 A;  1SBJ A;  1RJV A;  5HLO A;  2BE4 A;  3NSO A;  4FQO A;  4PHJ A;  2WND A;  1QLK A;  3CR4 X;  5BPJ A;  1OZS A;  1G4Y R;  2L50 A;  4MRY A;  5I2L A;  4PE4 A;  1IGV A;  3FWC A;  1EXR A;  2LUC A;  4DRW A;  1JBA A;  4OVN F;  4CLN A;  2BKI B;  2HQ8 A;  1CM1 A;  2CBL A;  4XYN A;  1Y1A A;  1IQ5 A;  3PN7 C;  1SNL A;  4M2Q A;  1J7O A;  2E30 A;  1XO5 A;  3A4U B;  1CLB A;  2WCB A;  2KI4 B;  4GGF C;  1QIW A;  2K7B A;  3FWB A;  1G33 A;  4I5K A;  5B8I B;  2F2P A;  2OPO A;  1IKU A;  1SCM B;  2KHN A;  1DJZ A;  2JNF A;  1F8H A;  5K89 A; 
#chains in the Genus database with same CATH topology
 1YX8 A;  1K9U A;  1PSB A;  4GAO A;  3BQ3 A;  3VGO A;  3PFV A;  1JFK A;  2K7D A;  1FW4 A;  2NXQ A;  1OE9 B;  3S0F A;  4PE0 A;  1JSA A;  5FI7 A;  1KCY A;  1MUX A;  3ZNI A;  2M1U A;  1NX3 A;  4ORA B;  1DQE A;  1A03 A;  4XJK B;  4QJ3 B;  1K8U A;  1Y1U A;  3LL8 B;  1PAL A;  2WCF A;  3O6B A;  1K95 A;  4YRU A;  3E3R A;  3OB1 B;  1A75 B;  1RFJ A;  3BFH A;  4L9M A;  5AER A;  2KQY A;  5IBW A;  3KPX A;  2B1U A;  2LLT A;  3EK4 A;  1CB1 A;  1K9P A;  2CT9 A;  2MHH A;  3BOW B;  4JPZ B;  4M2P A;  1KK8 B;  2LAN A;  1NX0 A;  3D0Y A;  3H4S E;  1IJ5 A;  2EHB A;  4N5X A;  1PRW A;  1R6P A;  1DVI A;  1EH2 A;  1YUU A;  2SCP A;  2FCD A;  1K96 A;  2LHI A;  1ZMZ A;  4A4B A;  1A29 A;  2MLF C;  2ZND A;  2K0J A;  3SS4 A;  2I7A A;  3BUO B;  2JWW A;  2WOS A;  2KQ6 A;  2BEC A;  1M45 A;  1CM4 A;  3EK7 A;  3GK1 A;  4USL A;  3TZ1 A;  4DS7 A;  1OMD A;  2JRF A;  2RGI A;  1IQ3 A;  4GPL B;  4PHM A;  2JU0 A;  3BJH A;  1EL4 A;  1K9K A;  1L7Z A;  1Q80 A;  1SRA A;  2KSP A;  3AAJ A;  2GGM A;  3DVM A;  3O4Y A;  1DTL A;  1CNP A;  2PAL A;  3PAT A;  2KI4 C;  2LVV A;  1K93 D;  3OGN A;  1RRO A;  5J3X A;  5AXI A;  1OOF A;  1MR8 A;  1IWQ A;  1KSO A;  1DC1 A;  1SCM C;  2BKH B;  2KYC A;  2Y1M A;  1ZFS A;  1F4O A;  4MSP A;  1NCZ A;  1TNQ A;  4PAL A;  4WQ3 A;  2BBN A;  5HKW A;  1CDM A;  1F4Q A;  1S36 A;  2BL0 B;  2L4I A;  3NHT A;  1ODB A;  4MVF A;  4TNC A;  2OTG B;  3R72 A;  4JQ0 D;  3D10 A;  3PAL A;  3EKH A;  3PJI A;  2LP3 A;  3A8R A;  1DJY A;  1A4P A;  4NDD A;  4YGD B;  1LKJ A;  4M2O A;  3DVK A;  1EG3 A;  1KQM B;  3BXK A;  4HSZ A;  1CFF A;  2MJW B;  3FE8 A;  2LHL A;  3WHT B;  4GFT A;  1DGU A;  3BUX B;  3TUY B;  2KAX A;  2KI6 C;  1B47 A;  5CSI A;  4UPG A;  1KK8 C;  1UHI A;  1AP4 A;  1NSH A;  1H8B A;  3CDN A;  2M0R A;  2WCL A;  1TNP A;  1BLQ A;  1SKT A;  1X02 A;  4YGB B;  3SJS A;  3SG5 A;  1OSA A;  2R2I A;  1PVA A;  2KFF A;  2PRU A;  4HRH A;  1PUL A;  2P6B B;  3OB2 B;  3O2P A;  3NHI A;  1ALV A;  5PAL A;  5HKY A;  4ORB B;  2HQW A;  2F3Y A;  1TOP A;  1NX2 A;  1QX2 A;  2E6W A;  4JWQ A;  1AHR A;  3QRX A;  1Y6W A;  1KQV A;  2WCK A;  2LVI A;  1AJ4 A;  1LA3 A;  3CR2 A;  1A2X A;  4MLW A;  2AUC A;  1ZOT B;  1BJF A;  3IQQ A;  1F70 A;  3DF0 B;  5I2Q A;  1XK4 A;  2FJY A;  2FCE A;  4PHK A;  3VRQ A;  2JC2 A;  1MF8 B;  1PK0 D;  3I5G B;  3OP0 A;  2BL0 C;  2K8M B;  4D1E A;  2HF5 A;  3DVJ A;  2KBM A;  2H8V A;  2WC8 A;  3NGV A;  4INW A;  2OTG C;  3VRO A;  2ZRS A;  1J55 A;  1NWD A;  1OW4 A;  3LK0 A;  1V1G A;  1WRL A;  4PCW A;  1WRZ A;  4GBA A;  1KK7 Z;  1YRU B;  1Y0V H;  1U5I A;  1YR5 A;  3PSR A;  2K2A A;  2OS8 B;  1KQM C;  2YGU A;  2CCM A;  1QAT A;  2LLU A;  4YBH B;  3V2L A;  2PVB A;  4MBE A;  1CLM A;  4MN0 A;  3TUY C;  1FI6 A;  2QEO A;  4MZL A;  1DF0 A;  1MWN A;  1UHH A;  3BOW A;  3L4A A;  1C3Y A;  2KAY A;  1J7R A;  1IIO A;  1GGW A;  3I5I B;  4NQG A;  3UO9 A;  1QTX A;  1YTZ C;  2KDH A;  3D74 A;  3LK1 A;  2JT0 A;  1TNW A;  1SK6 D;  1UHK A;  2L5Y A;  2KBI A;  2F3Z A;  2M97 A;  4MRX A;  4N1G A;  3CZ0 A;  1JWD A;  3SG3 A;  4QJ5 B;  1DJW A;  3FIA A;  3NSK A;  3TDZ A;  1ORG A;  3VB1 A;  4FQT A;  1SR6 B;  1SL9 A;  4CID A;  4PDZ A;  1S6I A;  4CFR A;  2H61 C;  3SG2 A;  1K2H A;  4IL1 A;  1QVI Z;  5KSZ A;  2QDI A;  1KFU L;  4HRE E;  3EKJ A;  2JPT A;  2LM5 A;  1OOH A;  2F8P A;  2O5G A;  1J7P A;  2M9G A;  3WHU B;  1QX5 B;  1RK9 A;  1SYM A;  3FE9 A;  3MSE B;  3TS5 B;  2CNP A;  1CFD A;  3DVE A;  2PAS A;  2K2F A;  1D1O A;  1CDL A;  4JKT A;  2QEV A;  3CZ1 A;  3I5G C;  2QAC A;  3HX4 A;  2KFG A;  1LIN A;  2Q4U A;  4GUK A;  2BCX A;  1DT7 B;  1FF1 A;  1KSM A;  5HYD A;  1J1D A;  1NX1 A;  2WC5 A;  1JUO A;  2H2K A;  4MZK A;  2I2R E;  3AKA A;  2WCJ A;  5I2O A;  1GGZ A;  2BAP A;  3EG5 B;  3S0A A;  1B7T Z;  1TWO A;  2EGD A;  1YRT B;  1E8A A;  1S3P A;  3VRP A;  1KK7 Y;  2JQ6 A;  4YI8 A;  1KFU S;  2QPT A;  2OS8 C;  1NCX A;  3S0E A;  5D3O A;  3OHM B;  4GGF A;  3CTN A;  3RM1 A;  2LUX A;  2DOQ A;  1SL7 A;  2L4H A;  2LNK A;  1TUJ A;  1BG1 A;  1CFC A;  5DKQ A;  3I5I C;  2G2B A;  1BOD A;  1AVS A;  1QAS A;  5DKN A;  1SL8 A;  1EJ3 A;  1QV0 A;  2LV7 A;  2QEH A;  4I5L B;  1XA5 A;  3CS1 A;  3HCM A;  1MQ1 A;  4MZJ A;  4C0K A;  1N0Y A;  4AQJ A;  1BMO A;  4U8D A;  1V1F A;  2LCP A;  1SR6 C;  5CPV A;  2AMI A;  3D0Y B;  2M3W A;  1JFJ A;  1CLL A;  3DYE A;  4GGN A;  4ICB A;  4PE7 A;  5CSN A;  2H61 A;  1TNX A;  2KYF A;  2M49 B;  3B86 A;  1DJI A;  1QVI Y;  1IH0 A;  4ZCV A;  3DY9 A;  4YGA A;  5HKZ A;  3WNX B;  1SPY A;  2ZN9 A;  1IJ6 A;  2KFH A;  1N65 A;  3TS5 C;  2L0P A;  1OOG A;  1R2U A;  3D75 A;  2JT8 A;  4WQ2 A;  5I94 A;  1G8I A;  2M7N A;  1JF2 A;  2ZFD A;  1CFP A;  2D8N A;  1S5G Z;  3NSL A;  2L2C A;  2VRG A;  5GQQ C;  4NDC A;  2MBX A;  2KOT A;  3R1P A;  5AAN A;  1F71 A;  3PLF B;  1F54 A;  2KGR A;  3AAK A;  3BYA A;  1CTR A;  1DJG A;  2CTN A;  2L2E A;  2NCP A;  2JT3 A;  4MEW A;  2SAS A;  1KFX L;  1YUS A;  3SIB A;  4OKH A;  2A4J A;  4YI9 A;  2L5X B;  1UUS A;  3JTD B;  1CMG A;  1TUZ A;  1TRF A;  2GTE A;  1B1G A;  1B7T Y;  1DJX A;  1K90 D;  1LS8 A;  1C3Z A;  3OX6 A;  3SS5 A;  4R1E A;  1FI5 A;  1XFY O;  1W9Z A;  5TNC A;  1ALW A;  3CAB A;  1NIW A;  2HPS A;  2GGZ A;  4PT1 A;  1XFU O;  3RLZ A;  3JVT B;  4I5J A;  3M0W A;  1XYD A;  1IG5 A;  1SY9 A;  1TTX A;  4DUQ A;  2JTT A;  4QJ4 B;  3O78 A;  1LVC D;  2LC5 A;  3D76 A;  1NPQ A;  1B4C A;  1KWO B;  4CPV A;  1AUI B;  2BE6 A;  2NLN A;  2PQL A;  4XJK A;  1B9A A;  1K94 A;  1IRJ A;  2JTZ A;  3TDU A;  1QWV A;  1RWY A;  3LLE A;  4IJ7 A;  2WCE A;  5AFP A;  4HRG A;  2BNX A;  1A75 A;  1Y1X A;  3OX5 A;  2MLE C;  3KF9 A;  3AKB A;  1QJT A;  1WRK A;  1HT9 A;  1M39 A;  1WDC B;  4FTG A;  4JD9 A;  2KPH A;  4BY5 A;  4CFQ A;  1OQP A;  2FOT A;  3PM8 A;  2LAP A;  3BFA A;  5HLV A;  1MXL C;  3CZT X;  1T14 A;  1M31 A;  3DXL A;  1ZUZ A;  1J1E A;  3NXA A;  2G9B A;  3N7H A;  1NCY A;  5FI2 A;  1DJH A;  1XFZ O;  1XFV O;  1S5G Y;  1OMR A;  3BFB A;  2EC6 B;  2PMY A;  3B88 A;  4OV2 A;  2M8U A;  2K7O A;  1W7J B;  5JJG A;  3FE6 A;  4NDB A;  1L2O B;  3KHE A;  4ORC B;  4BY4 A;  1H4B A;  4P2Y B;  1NP8 A;  5FYX A;  2ZKM X;  2BCA A;  3NSI A;  4DCK A;  2WOR A;  3JTD C;  2KAV A;  4YGC B;  4E68 A;  2LVK A;  1XFW O;  3GK4 X;  1OZO A;  1TCF A;  3S0D A;  1FPW A;  4INX A;  5I8N A;  3IVT A;  1AK8 A;  2LLS A;  3K1E A;  5AEQ A;  2ISD A;  1MHO A;  3K21 A;  3WXA A;  2V53 A;  3EVU A;  1P28 A;  1FBV A;  3QME A;  3EK8 A;  3RZS A;  3CLN A;  1WLZ A;  3JVT C;  1WY9 A;  1C07 A;  1QXP A;  1U5I B;  1EG4 A;  4C0J A;  1NYA A;  1S6J A;  1ZAC A;  3EVR A;  4KYN A;  5D7F A;  1CMF A;  1BF5 A;  1QIV A;  2KGB C;  1KWO C;  2NZ0 A;  3I5H B;  3CYZ A;  1DF0 B;  2AAO A;  2JZI A;  2TN4 A;  2WCH A;  1HQV A;  1JC2 A;  3SG7 A;  1SMG A;  1BOC A;  2KLE A;  2K60 A;  2Q91 A;  3SG4 A;  1Z2C B;  1S6C A;  1GJY A;  2BBM A;  3CGA A;  2KLD A;  5CSF A;  5D69 A;  3L47 A;  1YUT A;  1WDC C;  5DKR A;  3O4X A;  3B6X A;  3VRR A;  2K7C A;  1N2D A;  1QLS A;  2JXC A;  1W7I B;  2GV5 A;  3C1V A;  4OZD A;  1AJ5 A;  1YX7 A;  1DGV A;  1JF0 A;  1B8L A;  1TIZ A;  2IS9 A;  3Q8I A;  4YGE B;  3GOF A;  5HL1 A;  1OOI X;  2KNE A;  1BU3 A;  2Y4Q A;  3DD4 A;  2M7L A;  4ETO A;  3CWG A;  2LMT A;  1QV1 A;  2F2O A;  2EC6 C;  3I5F B;  1UUR A;  1QX7 A;  2KI6 D;  2LMV A;  5F6T A;  1GQM A;  1UP5 A;  2CXJ A;  2M29 A;  3LCP C;  1L2O C;  1QS7 A;  1VRK A;  2BCB A;  1CDP A;  5KTY A;  1SCV A;  1UHN A;  1CKK A;  2NCO A;  3KO0 A;  5CSJ A;  2K61 A;  2WCM A;  1YVL A;  1XFX O;  2ERB A;  2JUL A;  5FI6 A;  1B8C A;  1DEL A;  1XK4 C;  2M1K B;  3DZT A;  5EL2 A;  2ZN8 A;  1BT6 A;  5ER5 A;  2I94 A;  2LMU A;  3BUW B;  4Q04 A;  1M46 A;  3F45 A;  2HET A;  1YVH A;  1YUR A;  2JOJ A;  3DF0 A;  4PHN A;  2FJU B;  3S0G A;  3CZ2 A;  3VRN A;  4OCI A;  5G08 A;  4GNK B;  2I18 A;  1C7V A;  1OOJ A;  2LP2 A;  2P70 A;  1BR4 B;  2LE9 B;  1OMV A;  2COL B;  2JPO A;  2QEB A;  3B7A A;  2PSR A;  3OBV A;  1DMO A;  1SSE B;  5KU1 A;  3IF7 A;  3PN7 B;  2LVJ A;  2O60 A;  5JOL A;  1REC A;  4ZCU A;  3PM2 A;  1WLM A;  2Y5I A;  3KEV A;  1CDN A;  1RTP 1;  3BUM B;  1B8R A;  1PSR A;  3I5H C;  3ICB A;  2L51 A;  3SG6 A;  2F33 A;  1M63 B;  4F0Z B;  1TCO B;  3EVV A;  2JNX A;  3CR5 X;  3L4L A;  1LXF C;  4I5N B;  2JXL A;  1XVJ A;  4N1F A;  1XFR A;  3UNW A;  3IQO A;  1C7W A;  4AQI A;  1GM0 A;  4AOM A;  1S1E A;  3SIA A;  4OR9 B;  4C0L A;  3GK2 A;  1SW8 A;  2Y1N A;  3R1V A;  5ER4 X;  3D77 A;  1UWO A;  3SS3 A;  1UHJ A;  1S26 D;  3BUN B;  4PE1 A;  1BR1 B;  1J7Q A;  4A4C A;  1PVB A;  3I5F C;  2L98 A;  2MRD A;  1KFX S;  2ZRT A;  3TDI A;  2MAZ A;  1NUB A;  4WRI A;  1TN4 A;  4P5O E;  2ZNE A;  1DEK A;  1F55 A;  3ZWH A;  4F7F A;  4DIR A;  1MXE A;  2MA2 A;  3FS7 A;  3B87 A;  1LA0 A;  1Z4H A;  1SBJ A;  1RJV A;  5HLO A;  2BE4 A;  2WC6 A;  3NSO A;  4FQO A;  2WND A;  4PHJ A;  1QLK A;  3CR4 X;  3R1O A;  5BPJ A;  1OZS A;  1G4Y R;  2L50 A;  4MRY A;  5I2L A;  4PE4 A;  3D73 A;  1IGV A;  2PYQ A;  3FWC A;  1EXR A;  2LUC A;  5DIC A;  4DRW A;  1JBA A;  4OVN F;  4CLN A;  2BKI B;  2HQ8 A;  1CM1 A;  2CBL A;  4XYN A;  1Y1A A;  3D78 A;  1IQ5 A;  3PN7 C;  2P71 A;  1SNL A;  4M2Q A;  1J7O A;  2E30 A;  1XO5 A;  3A4U B;  1CLB A;  2WCB A;  3S0B A;  2KI4 B;  4GGF C;  1QIW A;  2K7B A;  3FWB A;  1G33 A;  4I5K A;  5B8I B;  2F2P A;  2OPO A;  1IKU A;  1SCM B;  2KHN A;  1DJZ A;  2JNF A;  1F8H A;  5K89 A; 
#chains in the Genus database with same CATH homology
 1YX8 A;  1K9U A;  1PSB A;  4GAO A;  3BQ3 A;  3VGO A;  3PFV A;  1JFK A;  2K7D A;  1FW4 A;  2NXQ A;  1OE9 B;  1JSA A;  4PE0 A;  1KCY A;  1MUX A;  3ZNI A;  2M1U A;  1NX3 A;  4ORA B;  1A03 A;  4XJK B;  4QJ3 B;  1K8U A;  1Y1U A;  3LL8 B;  1PAL A;  2WCF A;  3O6B A;  1K95 A;  4YRU A;  3E3R A;  3OB1 B;  1A75 B;  1RFJ A;  4L9M A;  5AER A;  2KQY A;  5IBW A;  3KPX A;  2B1U A;  2LLT A;  3EK4 A;  1CB1 A;  1K9P A;  2CT9 A;  2MHH A;  3BOW B;  4JPZ B;  4M2P A;  1KK8 B;  2LAN A;  1NX0 A;  3D0Y A;  3H4S E;  1IJ5 A;  2EHB A;  4N5X A;  1PRW A;  1R6P A;  1DVI A;  1EH2 A;  1YUU A;  2SCP A;  2FCD A;  1K96 A;  2LHI A;  1ZMZ A;  4A4B A;  1A29 A;  2MLF C;  2ZND A;  2K0J A;  2I7A A;  3BUO B;  2JWW A;  2WOS A;  2KQ6 A;  2BEC A;  1M45 A;  1CM4 A;  3EK7 A;  3GK1 A;  4USL A;  3TZ1 A;  4DS7 A;  1OMD A;  2JRF A;  2RGI A;  1IQ3 A;  4GPL B;  4PHM A;  2JU0 A;  1EL4 A;  1K9K A;  1L7Z A;  1Q80 A;  1SRA A;  2KSP A;  3AAJ A;  2GGM A;  3DVM A;  3O4Y A;  1DTL A;  1CNP A;  2PAL A;  3PAT A;  2KI4 C;  2LVV A;  1K93 D;  5J3X A;  1RRO A;  5AXI A;  1MR8 A;  1IWQ A;  1KSO A;  1SCM C;  2BKH B;  2KYC A;  2Y1M A;  1ZFS A;  1F4O A;  4MSP A;  1NCZ A;  1TNQ A;  4PAL A;  4WQ3 A;  2BBN A;  5HKW A;  1CDM A;  1F4Q A;  1S36 A;  2BL0 B;  2L4I A;  1ODB A;  4MVF A;  4TNC A;  2OTG B;  4JQ0 D;  3D10 A;  3PAL A;  3EKH A;  2LP3 A;  3A8R A;  1DJY A;  1A4P A;  4NDD A;  4YGD B;  1LKJ A;  4M2O A;  3DVK A;  1EG3 A;  1KQM B;  3BXK A;  4HSZ A;  1CFF A;  2MJW B;  3WHT B;  2LHL A;  4GFT A;  1DGU A;  3BUX B;  3TUY B;  2KAX A;  2KI6 C;  1B47 A;  5CSI A;  4UPG A;  1KK8 C;  1UHI A;  1AP4 A;  1NSH A;  1H8B A;  1BLQ A;  2M0R A;  1TNP A;  1SKT A;  1X02 A;  4YGB B;  3SJS A;  3SG5 A;  1OSA A;  2R2I A;  1PVA A;  2KFF A;  2PRU A;  4HRH A;  1PUL A;  2P6B B;  3OB2 B;  3O2P A;  5HKY A;  1ALV A;  5PAL A;  4ORB B;  2HQW A;  2F3Y A;  1TOP A;  1NX2 A;  1QX2 A;  2E6W A;  4JWQ A;  1AHR A;  3QRX A;  1Y6W A;  1KQV A;  2LVI A;  1AJ4 A;  1LA3 A;  3CR2 A;  1A2X A;  4MLW A;  2AUC A;  1ZOT B;  1BJF A;  3IQQ A;  1F70 A;  3DF0 B;  5I2Q A;  1XK4 A;  4PHK A;  2FCE A;  3VRQ A;  2JC2 A;  1MF8 B;  1PK0 D;  3I5G B;  3OP0 A;  2BL0 C;  2K8M B;  4D1E A;  2HF5 A;  3DVJ A;  2KBM A;  2WC8 A;  2OTG C;  3VRO A;  2ZRS A;  1J55 A;  1NWD A;  3LK0 A;  4PCW A;  1V1G A;  1WRL A;  1WRZ A;  4GBA A;  1KK7 Z;  1YRU B;  1Y0V H;  1U5I A;  1YR5 A;  3PSR A;  2K2A A;  2OS8 B;  1KQM C;  2CCM A;  1QAT A;  2LLU A;  4YBH B;  2PVB A;  4MBE A;  1CLM A;  4MN0 A;  3TUY C;  1FI6 A;  4MZL A;  1DF0 A;  1MWN A;  1UHH A;  3BOW A;  2KAY A;  1J7R A;  1GGW A;  3I5I B;  4NQG A;  1QTX A;  1YTZ C;  2KDH A;  3LK1 A;  2JT0 A;  1TNW A;  1SK6 D;  1UHK A;  2KBI A;  2F3Z A;  2M97 A;  4MRX A;  4N1G A;  1JWD A;  3SG3 A;  4QJ5 B;  1DJW A;  3FIA A;  3NSK A;  3TDZ A;  1SR6 B;  1SL9 A;  4CID A;  4PDZ A;  1S6I A;  4CFR A;  2H61 C;  3SG2 A;  1K2H A;  4IL1 A;  1QVI Z;  5KSZ A;  1KFU L;  4HRE E;  3EKJ A;  2JPT A;  2LM5 A;  2F8P A;  2O5G A;  1J7P A;  2M9G A;  3WHU B;  1QX5 B;  1RK9 A;  1SYM A;  3MSE B;  3TS5 B;  2CNP A;  1CFD A;  3DVE A;  2PAS A;  2K2F A;  1D1O A;  1CDL A;  3I5G C;  2QAC A;  3HX4 A;  2KFG A;  1LIN A;  2Q4U A;  4GUK A;  2BCX A;  1DT7 B;  1FF1 A;  1KSM A;  5HYD A;  1J1D A;  1NX1 A;  1JUO A;  2H2K A;  4MZK A;  2I2R E;  3AKA A;  5I2O A;  1GGZ A;  1B7T Z;  2EGD A;  3VRP A;  1YRT B;  1E8A A;  1S3P A;  1KK7 Y;  2JQ6 A;  4YI8 A;  1KFU S;  2QPT A;  2OS8 C;  1NCX A;  3OHM B;  4GGF A;  3CTN A;  3RM1 A;  2LUX A;  2DOQ A;  1SL7 A;  2L4H A;  2LNK A;  1BG1 A;  1CFC A;  5DKQ A;  3I5I C;  2G2B A;  1BOD A;  1AVS A;  1QAS A;  5DKN A;  1SL8 A;  1EJ3 A;  1QV0 A;  2LV7 A;  4I5L B;  1XA5 A;  3CS1 A;  3HCM A;  1MQ1 A;  4MZJ A;  4C0K A;  1N0Y A;  4AQJ A;  1BMO A;  4U8D A;  1V1F A;  2LCP A;  1SR6 C;  5CPV A;  2AMI A;  3D0Y B;  2M3W A;  1JFJ A;  1CLL A;  4ICB A;  4GGN A;  4PE7 A;  5CSN A;  2H61 A;  1TNX A;  2KYF A;  2M49 B;  1DJI A;  1QVI Y;  1IH0 A;  4ZCV A;  4YGA A;  5HKZ A;  3WNX B;  1SPY A;  2ZN9 A;  1IJ6 A;  2KFH A;  1N65 A;  3TS5 C;  2L0P A;  1R2U A;  4WQ2 A;  2JT8 A;  1G8I A;  2M7N A;  1JF2 A;  2ZFD A;  1CFP A;  2D8N A;  1S5G Z;  3NSL A;  5GQQ C;  2VRG A;  2MBX A;  4NDC A;  2KOT A;  5AAN A;  1F71 A;  3PLF B;  1F54 A;  2KGR A;  3AAK A;  3BYA A;  1CTR A;  1DJG A;  2CTN A;  2L2E A;  2NCP A;  2JT3 A;  4MEW A;  2SAS A;  1KFX L;  1YUS A;  3SIB A;  4OKH A;  2A4J A;  4YI9 A;  2L5X B;  1UUS A;  3JTD B;  1CMG A;  1TRF A;  1B1G A;  1B7T Y;  1DJX A;  1K90 D;  3OX6 A;  4R1E A;  1FI5 A;  1XFY O;  5TNC A;  1ALW A;  1NIW A;  2HPS A;  2GGZ A;  1XFU O;  3RLZ A;  3JVT B;  4I5J A;  3M0W A;  1XYD A;  1IG5 A;  1SY9 A;  1TTX A;  4DUQ A;  2JTT A;  4QJ4 B;  3O78 A;  1LVC D;  2LC5 A;  1NPQ A;  1B4C A;  1KWO B;  4CPV A;  1AUI B;  2BE6 A;  2NLN A;  4XJK A;  1B9A A;  1K94 A;  1IRJ A;  2JTZ A;  3TDU A;  1RWY A;  3LLE A;  2WCE A;  5AFP A;  4HRG A;  1A75 A;  1Y1X A;  3OX5 A;  2MLE C;  3KF9 A;  3AKB A;  1QJT A;  1WRK A;  1HT9 A;  1M39 A;  1WDC B;  4FTG A;  4CFQ A;  4BY5 A;  1OQP A;  2FOT A;  3PM8 A;  2LAP A;  5HLV A;  1MXL C;  3CZT X;  4N1F A;  1M31 A;  1ZUZ A;  1J1E A;  3NXA A;  2G9B A;  1NCY A;  1DJH A;  1XFZ O;  1XFV O;  1S5G Y;  1OMR A;  2EC6 B;  2PMY A;  4OV2 A;  2M8U A;  2K7O A;  1W7J B;  5JJG A;  4NDB A;  1L2O B;  3KHE A;  4ORC B;  4BY4 A;  1H4B A;  4P2Y B;  1NP8 A;  5FYX A;  2ZKM X;  2BCA A;  3NSI A;  4DCK A;  2WOR A;  3JTD C;  2KAV A;  4YGC B;  4E68 A;  2LVK A;  1XFW O;  3GK4 X;  1OZO A;  1TCF A;  1FPW A;  5I8N A;  1AK8 A;  2LLS A;  5AEQ A;  2ISD A;  1MHO A;  3K21 A;  3WXA A;  2V53 A;  3EVU A;  1FBV A;  3EK8 A;  3CLN A;  1WLZ A;  3JVT C;  1WY9 A;  1QXP A;  1U5I B;  1EG4 A;  4C0J A;  1NYA A;  1S6J A;  1ZAC A;  3EVR A;  5D7F A;  1CMF A;  1BF5 A;  1QIV A;  2KGB C;  1KWO C;  2NZ0 A;  3I5H B;  1DF0 B;  2AAO A;  2JZI A;  2TN4 A;  1HQV A;  1JC2 A;  3SG7 A;  1SMG A;  1BOC A;  2Q91 A;  3SG4 A;  1S6C A;  1GJY A;  2BBM A;  3CGA A;  5CSF A;  5D69 A;  1YUT A;  1WDC C;  5DKR A;  3VRR A;  2K7C A;  1N2D A;  1QLS A;  2JXC A;  1W7I B;  2GV5 A;  3C1V A;  1AJ5 A;  1YX7 A;  1DGV A;  1JF0 A;  1B8L A;  1TIZ A;  2IS9 A;  4YGE B;  1C07 A;  3GOF A;  4ETO A;  2KNE A;  1BU3 A;  2Y4Q A;  3DD4 A;  2M7L A;  3CWG A;  2LMT A;  1QV1 A;  2F2O A;  2EC6 C;  3I5F B;  1UUR A;  1QX7 A;  2KI6 D;  2LMV A;  5F6T A;  1GQM A;  1UP5 A;  2CXJ A;  2M29 A;  3LCP C;  1L2O C;  1QS7 A;  1VRK A;  2BCB A;  1CDP A;  5KTY A;  1SCV A;  1UHN A;  1CKK A;  2NCO A;  3KO0 A;  5CSJ A;  2K61 A;  1YVL A;  1XFX O;  2JUL A;  1B8C A;  1XK4 C;  2M1K B;  2ZN8 A;  1BT6 A;  5ER5 A;  2I94 A;  2LMU A;  3BUW B;  4Q04 A;  1M46 A;  3F45 A;  2HET A;  1YVH A;  1YUR A;  2JOJ A;  3DF0 A;  4PHN A;  2FJU B;  3VRN A;  4OCI A;  5G08 A;  4GNK B;  2I18 A;  1C7V A;  1OOJ A;  2LP2 A;  1BR4 B;  2LE9 B;  1OMV A;  2COL B;  1DMO A;  2PSR A;  5KU1 A;  3IF7 A;  3PN7 B;  2LVJ A;  2O60 A;  5JOL A;  1REC A;  4ZCU A;  1WLM A;  2Y5I A;  3KEV A;  1CDN A;  1RTP 1;  3BUM B;  1B8R A;  1PSR A;  3I5H C;  3ICB A;  2L51 A;  3SG6 A;  2F33 A;  1M63 B;  4F0Z B;  1TCO B;  3EVV A;  2JNX A;  3CR5 X;  4I5N B;  1LXF C;  2JXL A;  1XVJ A;  3IQO A;  1C7W A;  4AQI A;  4AOM A;  1S1E A;  3SIA A;  4OR9 B;  4C0L A;  3GK2 A;  1SW8 A;  2Y1N A;  5ER4 X;  1UWO A;  1UHJ A;  1S26 D;  3BUN B;  4PE1 A;  1BR1 B;  1J7Q A;  4A4C A;  1PVB A;  3I5F C;  2L98 A;  2MRD A;  1KFX S;  2ZRT A;  3TDI A;  2MAZ A;  1NUB A;  4WRI A;  1TN4 A;  4P5O E;  2ZNE A;  1F55 A;  3ZWH A;  4DIR A;  1MXE A;  2MA2 A;  3FS7 A;  1LA0 A;  1SBJ A;  1RJV A;  5HLO A;  2BE4 A;  3NSO A;  4FQO A;  4PHJ A;  2WND A;  1QLK A;  3CR4 X;  5BPJ A;  1OZS A;  1G4Y R;  2L50 A;  4MRY A;  5I2L A;  4PE4 A;  1IGV A;  3FWC A;  1EXR A;  2LUC A;  4DRW A;  1JBA A;  4OVN F;  4CLN A;  2BKI B;  2HQ8 A;  1CM1 A;  2CBL A;  4XYN A;  1Y1A A;  1IQ5 A;  3PN7 C;  1SNL A;  4M2Q A;  1J7O A;  2E30 A;  1XO5 A;  3A4U B;  1CLB A;  2WCB A;  2KI4 B;  4GGF C;  1QIW A;  2K7B A;  3FWB A;  1G33 A;  4I5K A;  5B8I B;  2F2P A;  2OPO A;  1IKU A;  1SCM B;  2KHN A;  1DJZ A;  2JNF A;  1F8H A;  5K89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...