4OZDA

Crystal structure of pdsp15a
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
122
structure length
120
Chain Sequence
ETPSQKCEEKYKTDKISCLHHCKYQYYGFIDVNYNIAQSEIRKFSNVLMDYGVVDKSKKRELKKVMHECAKQVKKEARKDSHWLNCRTSINYYRCVLTSKLIGPQRFDKAIQDYDKTISV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 14.4 kDa salivary protein
publication title Protection against cutaneous leishmaniasis in non-human primates by immunization with an insect salivary protein
rcsb
source organism Phlebotomus duboscqi
molecule tags Protein binding
total genus 44
structure length 120
sequence length 122
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2014-02-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 4ozdA00
2L2CA 4FQTA 2QEVA 3VB1A 1T14A 1OOFA 4JD9A 2FJYA 1TWOA 3R1OA 1OOHA 1P28A 3DXLA 3B86A 2WCHA 3BJHA 3QMEA 3CZ0A 2WCLA 3D73A 3R1VA 2PQLA 4OZDA 3NHTA 1C3YA 2WCMA 3BFAA 3B6XA 3D78A 1OOGA 3K1EA 3NHIA 3FE9A 1TUJA 2GTEA 3S0AA 3CZ1A 3N7HA 1OW4A 2WC5A 3NGVA 1ORGA 1XFRA 3CDNA 2QEOA 3DYEA 3B7AA 3OGNA 2P70A 2QEHA 1QWVA 3DZTA 2KPHA 2JPOA 2WCKA 3S0GA 1LS8A 3D76A 4INWA 3B88A 3L4AA 3L4LA 1OOIX 3Q8IA 2WC6A 1C3ZA 3PJIA 4PT1A 3CABA 2H8VA 3L47A 3S0FA 3FE8A 2ERBA 3D74A 3CZ2A 1GM0A 3S0DA 3RZSA 3D77A 3V2LA 3R72A 3BFHA 3R1PA 4INXA 3D75A 4F7FA 3B87A 3FE6A 3DY9A 2QDIA 2P71A 3BFBA 3S0BA 2QEBA 1DQEA 5EL2A 3S0EA 3CYZA 2WCJA 5DICA
chains in the Genus database with same CATH superfamily
2M9GA 3M0WA 3VRQA 2RGIA 1AP4A 4HREE 1SL8A 1YVHA 3HX4A 1EH2A 2L2EA 3EK4A 2I7AA 1Z2CB 1JSAA 2F8PA 2LLTA 2COLB 2QEVA 4GFTA 3TUYB 1F55A 3I5HB 2VRGA 4PE7A 4JD9A 1DGVA 3ZWHA 1XFWO 4XJKA 5FI6A 2AUCA 3DVMA 5BPJA 1A4PA 1NWDA 2Q4UA 2L5XB 3BUXB 1WRLA 4NDDA 2JNFA 4DUQA 2K7DA 3I5IC 2WCLA 2KNEA 3CTNA 1DJHA 1QS7A 3GOFA 4OZDA 1ZOTB 3OHMB 1SPYA 5I2LA 1AJ5A 2MBXA 2JWWA 1BT6A 2M97A 3QRXA 1PULA 3A8RA 3DVEA 1B8CA 5J3XA 2WCMA 2OS8C 2LHLA 1JFKA 2NLNA 3BUWB 3O6BA 3SG4A 4BY4A 4C0KA 3BQ3A 3D78A 3I5FC 5AEQA 1CDPA 4OKHA 2F2PA 1RWYA 2K7OA 3DF0B 3LCPC 1ZACA 5HKWA 2JXLA 1NX2A 1PVAA 1TTXA 4AQJA 1DVIA 1FW4A 2CXJA 3NXAA 3SG2A 4F0ZB 2PYQA 1WLMA 4PE0A 1WDCC 2I2RE 3EK8A 2YGUA 1M39A 1EL4A 1RJVA 3C1VA 5F6TA 1C7WA 3SG6A 4MZKA 2BE4A 4ORCB 1KFXL 1SNLA 1EG4A 4YI8A 2O5GA 1LS8A 1JBAA 3E3RA 1DJXA 3SJSA 2FJUB 2JT0A 3OB1B 2LMUA 1S6CA 1LKJA 1KFXS 1ALVA 1NPQA 4GAOA 2BBMA 4KYNA 1U5IB 2K0JA 1KK8C 2L98A 1S6IA 2LNKA 1BMOA 2F3ZA 4L9MA 2ISDA 2WC6A 1B9AA 1TRFA 3OX5A 4C0LA 3PJIA 5KU1A 3LL8B 3EK7A 2KHNA 1CDLA 4GGNA 5AFPA 1CNPA 1XFUO 1M63B 1NX3A 1NCXA 2G9BA 1BODA 1OMVA 1J1EA 3L47A 3S0FA 1IJ5A 1K95A 2LC5A 1SR6B 4XJKB 1MHOA 1FI5A 2HQWA 1M31A 1B8LA 2K60A 2M0RA 1E8AA 2KOTA 1CB1A 1B8RA 2LANA 2EHBA 4OCIA 1OZOA 1TCOB 4GNKB 1QTXA 2E6WA 3VRNA 1K9UA 2NCOA 3D77A 3MSEB 4ETOA 2KLDA 2KYFA 4OV2A 3SIBA 2BCAA 1QVIZ 2CT9A 5DKRA 1SK6D 3O78A 1W7IB 3OB2B 2KSPA 3BFHA 1MWNA 1YVLA 1ZUZA 3PN7B 1YUTA 1F70A 1K90D 1SCMB 3ZNIA 1LXFC 3RM1A 4MLWA 4CIDA 4OVNF 3UO9A 4HSZA 1CTRA 1MXLC 2QDIA 1QX2A 1RTP1 3BFBA 1YRUB 3FS7A 4JPZB 1QV1A 4P2YB 1MXEA 1Y1AA 2KQYA 5EL2A 4CFQA 3CYZA 1Y0VH 3KO0A 1Y6WA 1UHJA 1F4QA 4HRHA 5AANA 5CSJA 4GGFC 1KFUL 1QLKA 2L51A 2LVVA 1QIWA 1WRZA 1SKTA 1DTLA 2SCPA 3LLEA 3IQOA 1TNQA 1DF0A 3AKAA 1CDMA 1TN4A 3H4SE 1K2HA 4PCWA 1NX0A 2OTGC 1NUBA 3SS5A 2JZIA 3D10A 1C07A 3EKHA 1J7OA 2BKIB 1KFUS 2JTTA 4PHNA 3B86A 5ER5A 3R1VA 2TN4A 3BXKA 2KI6D 2PQLA 2ZFDA 4N5XA 1R2UA 4N1GA 4YRUA 3EVRA 1DJGA 1G8IA 3UNWA 3AAJA 2IS9A 4ORBB 1PK0D 2CNPA 2Y4QA 4HRGA 1S5GZ 3BUMB 5D7FA 2L0PA 3O4XA 2WCEA 1IG5A 1A75A 1L2OC 2LMVA 1QX5B 4D1EA 2K2FA 3NHIA 1TUJA 3OP0A 5HLOA 3DVKA 3KF9A 2LLSA 5DKNA 3SG3A 3KEVA 3S0AA 2F2OA 2K7CA 1CMFA 3JTDC 1CDNA 4PHJA 3I5GB 1TUZA 2HF5A 4JQ0D 2MLFC 4CLNA 2LP3A 3EG5B 4A4BA 1NP8A 3K21A 3CDNA 4PHMA 1DC1A 2Q91A 1N0YA 2EC6B 1CM1A 2L5YA 1PSRA 4QJ3B 1NX1A 1SBJA 2MA2A 1H4BA 3DVJA 1CLLA 3OGNA 4PALA 1LA0A 1IH0A 1IWQA 1TCFA 2JNXA 4M2OA 4ORAB 1HT9A 3DZTA 5KTYA 2LAPA 4N1FA 3D76A 2BKHB 4QJ5B 3LK0A 3NSKA 1PALA 1MUXA 1QIVA 1NIWA 3TUYC 1QXPA 3I5HC 4IJ7A 3SIAA 4PE4A 3CLNA 4YGEB 1IQ3A 1WLZA 2H61C 1DEKA 2ZRSA 1NCZA 2M7LA 1EG3A 3NSOA 3ICBA 1WDCB 2KI6C 5I2OA 4YI9A 3CR5X 4PT1A 2BCBA 1B4CA 3CABA 4GBAA 2KAXA 1CFCA 1ZFSA 4GPLB 2FCEA 1BJFA 1K93D 2HETA 2I18A 1X02A 1Y1XA 1AJ4A 2WOSA 2G2BA 1DF0B 2EGDA 2L50A 1DJZA 2MLEC 4P5OE 1ALWA 2R2IA 1KSOA 3FE8A 1CKKA 2KLEA 2WC8A 2CCMA 3CZ2A 1CMGA 1B7TZ 3S0DA 3WHTB 3FWCA 3EVVA 3BUOB 3BOWA 2M3WA 1TNPA 1A2XA 2WCBA 1YR5A 5HL1A 2KFGA 1XK4A 1UWOA 3R1PA 1JUOA 3NSLA 4USLA 3DD4A 4MEWA 4OR9B 3FE6A 1XFZO 2AAOA 3DY9A 1A75B 1VRKA 3EVUA 2JC2A 3PLFB 4UPGA 1IJ6A 2DOQA 1UP5A 3IQQA 3WNXB 2O60A 2BAPA 5PALA 2E30A 1RECA 1Y1UA 5DICA 1F4OA 1TIZA 1KQMB 5IBWA 5HKYA 5I2QA 3VRPA 1QVIY 4U8DA 1NSHA 3BUNB 2KQ6A 3VB1A 2LUCA 4DS7A 2M1UA 3TDUA 1K8UA 2FJYA 1QV0A 1TWOA 2HQ8A 1CM4A 1OOHA 1IQ5A 2JTZA 4WQ2A 4FQOA 5KSZA 4ZCUA 4MN0A 4YBHB 1S36A 1W7JB 1B47A 1P28A 2Y1NA 3CR4X 3DXLA 2KI4C 4YGCB 3D73A 1OMRA 3CZ0A 1CLBA 2F3YA 2FCDA 3CZTX 1KWOB 4IL1A 4NDBA 2L4HA 3NHTA 2LM5A 4MZLA 3BFAA 3B6XA 4Q04A 2KFHA 2M1KB 3TZ1A 1OOGA 2A4JA 5FYXA 2CBLA 2HPSA 1AHRA 1CFDA 1YTZC 2JQ6A 4JKTA 2PSRA 3K1EA 2KFFA 1SYMA 3SG7A 4FTGA 1XFXO 2JXCA 3JVTB 1GJYA 2GTEA 3PM2A 1PRWA 2B1UA 4NDCA 3F45A 3WHUB 1YUSA 1OW4A 1CFFA 1J55A 1TOPA 2MJWB 2LLUA 2WC5A 2OTGB 3NGVA 1SCMC 2BL0B 2K2AA 1QLSA 2BNXA 4AOMA 1J7QA 3CS1A 1KK7Y 2LHIA 3TDIA 1DJYA 4I5KA 3LK1A 1FBVA 2QEOA 4ICBA 3GK1A 2LVIA 3DYEA 4I5NB 5I8NA 2KGRA 1KK7Z 3B7AA 1S5GY 1XA5A 1RK9A 2QEHA 1QWVA 2KPHA 3PSRA 2M7NA 3S0GA 2LCPA 4INWA 3B88A 1UHHA 1J1DA 1SMGA 2JRFA 1BR1B 4E68A 1OOIX 1PSBA 1L2OB 1R6PA 2M29A 2BCXA 3IF7A 1K9KA 1DJIA 2PASA 3TS5C 2NZ0A 1BOCA 1CLMA 1ODBA 5B8IB 1G33A 2Y5IA 1AK8A 1K9PA 5CSFA 5ER4X 3GK2A 3CR2A 1TNWA 1S1EA 3I5IB 2KAYA 2H8VA 5HLVA 2WNDA 5CPVA 1G4YR 1JF0A 2I94A 4YGDB 1OZSA 3TDZA 2KAVA 3AAKA 5AXIA 2K61A 2NCPA 1SL7A 2QACA 1B1GA 2ERBA 3D74A 4PDZA 2OS8B 2FOTA 3I5FB 1JC2A 3RZSA 1M45A 4GUKA 4CPVA 2MRDA 3VRRA 3PALA 1BG1A 1IIOA 1NCYA 3V2LA 2PVBA 1DELA 4MVFA 3EKJA 4WRIA 3CGAA 4INXA 3SG5A 3I5GC 2JT8A 2LVJA 4F7FA 1NYAA 1BLQA 2BBNA 5JJGA 3B87A 2NXQA 1HQVA 2EC6C 1J7RA 4YGBB 2LV7A 4GGFA 2JOJA 1LINA 5TNCA 1BU3A 2KGBC 1WRKA 2P71A 1N2DA 2CTNA 1JFJA 1V1GA 2QEBA 3S0EA 5HYDA 1B7TY 2Y1MA 1ZMZA 2WCJA 3GK4X 2SASA 4R1EA 1SY9A 1XYDA 4AQIA 1C7VA 1QJTA 2KBIA 4NQGA 1XFYO 1OSAA 1YUUA 3AKBA 3SS3A 5GQQC 4TNCA 2L2CA 4FQTA 4WQ3A 1T14A 1OOFA 2JT3A 3RLZA 5I94A 1KCYA 1K96A 3R1OA 2WCFA 3WXAA 1KK8B 2LVKA 2M49B 1BF5A 2D8NA 2LMTA 5K89A 1OQPA 2WCHA 3BJHA 3QMEA 4YGAA 3NSIA 1UHKA 1RROA 1DJWA 5D69A 5HKZA 2ZNEA 1C3YA 2ZN8A 4MBEA 4CFRA 1KQVA 5D3OA 4BY5A 1UHIA 2PRUA 4M2QA 1IRJA 3BYAA 2K7BA 2LP2A 1SRAA 1TNXA 2QPTA 5CSIA 2GGMA 2KYCA 2ZRTA 3D0YA 1FI6A 2OPOA 3FE9A 4M2PA 1WY9A 4ZCVA 1EXRA 3PATA 1QATA 3CZ1A 3N7HA 1J7PA 1H8BA 2PALA 1YX7A 1D1OA 1XO5A 4A4CA 4MZJA 1ORGA 5CSNA 1UURA 2KI4B 3SS4A 1XFRA 4PHKA 2MAZA 1Z4HA 1OMDA 2MHHA 2ZNDA 4C0JA 4MRXA 1DT7B 1SR6C 1OE9B 1UUSA 1MQ1A 2P70A 1SW8A 2H61A 1SSEB 2JPOA 1GQMA 2WCKA 1FF1A 2PMYA 1KQMC 1YX8A 3OBVA 1IGVA 3L4AA 3L4LA 3O2PA 2BECA 2K8MB 3IVTA 2KDHA 5FI2A 3PFVA 3HCMA 4DIRA 4QJ4B 1XVJA 3CWGA 2JU0A 3Q8IA 5G08A 2GV5A 1C3ZA 2WORA 3FIAA 3PN7C 1W9ZA 1DMOA 1S26D 3PM8A 1A03A 4DCKA 1PVBA 1OOJA 1KWOC 2ZN9A 1AVSA 3DF0A 1BR4B 4XYNA 1LA3A 1SL9A 1YURA 1YRTB 1K94A 1S3PA 2LE9B 3BOWB 3O4YA 4MSPA 1CFPA 1GGWA 2LUXA 4PE1A 2L4IA 1QASA 1S6JA 2AMIA 1JF2A 2BE6A 1DGUA 1EJ3A 2V53A 5DKQA 1GM0A 1AUIB 1KSMA 2JPTA 3OX6A 1L7ZA 4JWQA 2JULA 3JVTC 3TS5B 5AERA 3VROA 3R72A 3A4UB 1MR8A 1RFJA 1IKUA 3D75A 2BL0C 1QX7A 1UHNA 3JTDB 3VGOA 1N65A 1GGZA 1Q80A 5FI7A 4DRWA 2P6BB 3FWBA 1XFVO 1SCVA 2H2KA 1A29A 4MRYA 1FPWA 2GGZA 2F33A 3D0YB 3KHEA 1F54A 1F71A 2KBMA 1LVCD 3S0BA 1JWDA 1MF8B 1XK4C 2ZKMX 4I5LB 1DQEA 1M46A 1U5IA 2M8UA 1V1FA 5JOLA 4I5JA 3KPXA 1F8HA
chains in the Genus database with same CATH topology
2L2CA 4FQTA 2QEVA 3VB1A 1T14A 1OOFA 4JD9A 2FJYA 1TWOA 3R1OA 1OOHA 1P28A 3DXLA 3B86A 2WCHA 3BJHA 3QMEA 3CZ0A 2WCLA 3D73A 3R1VA 2PQLA 4OZDA 3NHTA 1C3YA 2WCMA 3BFAA 3B6XA 3D78A 1OOGA 3K1EA 3NHIA 3FE9A 1TUJA 2GTEA 3S0AA 3CZ1A 3N7HA 1OW4A 2WC5A 3NGVA 1ORGA 1XFRA 3CDNA 2QEOA 3DYEA 3B7AA 3OGNA 2P70A 2QEHA 1QWVA 3DZTA 2KPHA 2JPOA 2WCKA 3S0GA 1LS8A 3D76A 4INWA 3B88A 3L4AA 3L4LA 1OOIX 3Q8IA 2WC6A 1C3ZA 3PJIA 4PT1A 3CABA 2H8VA 3L47A 3S0FA 3FE8A 2ERBA 3D74A 3CZ2A 1GM0A 3S0DA 3RZSA 3D77A 3V2LA 3R72A 3BFHA 3R1PA 4INXA 3D75A 4F7FA 3B87A 3FE6A 3DY9A 2QDIA 2P71A 3BFBA 3S0BA 2QEBA 1DQEA 5EL2A 3S0EA 3CYZA 2WCJA 5DICA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L2C A;  4FQT A;  2QEV A;  3VB1 A;  1T14 A;  1OOF A;  4JD9 A;  2FJY A;  1TWO A;  3R1O A;  1OOH A;  1P28 A;  3DXL A;  3B86 A;  2WCH A;  3BJH A;  3QME A;  3CZ0 A;  2WCL A;  3D73 A;  3R1V A;  2PQL A;  4OZD A;  3NHT A;  1C3Y A;  2WCM A;  3BFA A;  3B6X A;  3D78 A;  1OOG A;  3K1E A;  3NHI A;  3FE9 A;  1TUJ A;  2GTE A;  3S0A A;  3CZ1 A;  3N7H A;  1OW4 A;  2WC5 A;  3NGV A;  1ORG A;  1XFR A;  3CDN A;  2QEO A;  3DYE A;  3B7A A;  3OGN A;  2P70 A;  2QEH A;  1QWV A;  3DZT A;  2KPH A;  2JPO A;  2WCK A;  3S0G A;  1LS8 A;  3D76 A;  4INW A;  3B88 A;  3L4A A;  3L4L A;  1OOI X;  3Q8I A;  2WC6 A;  1C3Z A;  3PJI A;  4PT1 A;  3CAB A;  2H8V A;  3L47 A;  3S0F A;  3FE8 A;  2ERB A;  3D74 A;  3CZ2 A;  1GM0 A;  3S0D A;  3RZS A;  3D77 A;  3V2L A;  3R72 A;  3BFH A;  3R1P A;  4INX A;  3D75 A;  4F7F A;  3B87 A;  3FE6 A;  3DY9 A;  2QDI A;  2P71 A;  3BFB A;  3S0B A;  2QEB A;  1DQE A;  5EL2 A;  3S0E A;  3CYZ A;  2WCJ A;  5DIC A; 
#chains in the Genus database with same CATH topology
 2M9G A;  3M0W A;  3VRQ A;  2RGI A;  1AP4 A;  4HRE E;  1SL8 A;  1YVH A;  3HX4 A;  1EH2 A;  2L2E A;  3EK4 A;  2I7A A;  1Z2C B;  1JSA A;  2F8P A;  2LLT A;  2COL B;  2QEV A;  4GFT A;  3TUY B;  1F55 A;  3I5H B;  2VRG A;  4PE7 A;  4JD9 A;  1DGV A;  3ZWH A;  1XFW O;  4XJK A;  5FI6 A;  2AUC A;  3DVM A;  5BPJ A;  1A4P A;  1NWD A;  2Q4U A;  2L5X B;  3BUX B;  1WRL A;  4NDD A;  2JNF A;  4DUQ A;  2K7D A;  3I5I C;  2WCL A;  2KNE A;  3CTN A;  1DJH A;  1QS7 A;  3GOF A;  4OZD A;  1ZOT B;  3OHM B;  1SPY A;  5I2L A;  1AJ5 A;  2MBX A;  2JWW A;  1BT6 A;  2M97 A;  3QRX A;  1PUL A;  3A8R A;  3DVE A;  1B8C A;  5J3X A;  2WCM A;  2OS8 C;  2LHL A;  1JFK A;  2NLN A;  3BUW B;  3O6B A;  3SG4 A;  4BY4 A;  4C0K A;  3BQ3 A;  3D78 A;  3I5F C;  5AEQ A;  1CDP A;  4OKH A;  2F2P A;  1RWY A;  2K7O A;  3DF0 B;  3LCP C;  1ZAC A;  5HKW A;  2JXL A;  1NX2 A;  1PVA A;  1TTX A;  4AQJ A;  1DVI A;  1FW4 A;  2CXJ A;  3NXA A;  3SG2 A;  4F0Z B;  2PYQ A;  1WLM A;  4PE0 A;  1WDC C;  2I2R E;  3EK8 A;  2YGU A;  1M39 A;  1EL4 A;  1RJV A;  3C1V A;  5F6T A;  1C7W A;  3SG6 A;  4MZK A;  2BE4 A;  4ORC B;  1KFX L;  1SNL A;  1EG4 A;  4YI8 A;  2O5G A;  1LS8 A;  1JBA A;  3E3R A;  1DJX A;  3SJS A;  2FJU B;  2JT0 A;  3OB1 B;  2LMU A;  1S6C A;  1LKJ A;  1KFX S;  1ALV A;  1NPQ A;  4GAO A;  2BBM A;  4KYN A;  1U5I B;  2K0J A;  1KK8 C;  2L98 A;  1S6I A;  2LNK A;  1BMO A;  2F3Z A;  4L9M A;  2ISD A;  2WC6 A;  1B9A A;  1TRF A;  3OX5 A;  4C0L A;  3PJI A;  5KU1 A;  3LL8 B;  3EK7 A;  2KHN A;  1CDL A;  4GGN A;  5AFP A;  1CNP A;  1XFU O;  1M63 B;  1NX3 A;  1NCX A;  2G9B A;  1BOD A;  1OMV A;  1J1E A;  3L47 A;  3S0F A;  1IJ5 A;  1K95 A;  2LC5 A;  1SR6 B;  4XJK B;  1MHO A;  1FI5 A;  2HQW A;  1M31 A;  1B8L A;  2K60 A;  2M0R A;  1E8A A;  2KOT A;  1CB1 A;  1B8R A;  2LAN A;  2EHB A;  4OCI A;  1OZO A;  1TCO B;  4GNK B;  1QTX A;  2E6W A;  3VRN A;  1K9U A;  2NCO A;  3D77 A;  3MSE B;  4ETO A;  2KLD A;  2KYF A;  4OV2 A;  3SIB A;  2BCA A;  1QVI Z;  2CT9 A;  5DKR A;  1SK6 D;  3O78 A;  1W7I B;  3OB2 B;  2KSP A;  3BFH A;  1MWN A;  1YVL A;  1ZUZ A;  3PN7 B;  1YUT A;  1F70 A;  1K90 D;  1SCM B;  3ZNI A;  1LXF C;  3RM1 A;  4MLW A;  4CID A;  4OVN F;  3UO9 A;  4HSZ A;  1CTR A;  1MXL C;  2QDI A;  1QX2 A;  1RTP 1;  3BFB A;  1YRU B;  3FS7 A;  4JPZ B;  1QV1 A;  4P2Y B;  1MXE A;  1Y1A A;  2KQY A;  5EL2 A;  4CFQ A;  3CYZ A;  1Y0V H;  3KO0 A;  1Y6W A;  1UHJ A;  1F4Q A;  4HRH A;  5AAN A;  5CSJ A;  4GGF C;  1KFU L;  1QLK A;  2L51 A;  2LVV A;  1QIW A;  1WRZ A;  1SKT A;  1DTL A;  2SCP A;  3LLE A;  3IQO A;  1TNQ A;  1DF0 A;  3AKA A;  1CDM A;  1TN4 A;  3H4S E;  1K2H A;  4PCW A;  1NX0 A;  2OTG C;  1NUB A;  3SS5 A;  2JZI A;  3D10 A;  1C07 A;  3EKH A;  1J7O A;  2BKI B;  1KFU S;  2JTT A;  4PHN A;  3B86 A;  5ER5 A;  3R1V A;  2TN4 A;  3BXK A;  2KI6 D;  2PQL A;  2ZFD A;  4N5X A;  1R2U A;  4N1G A;  4YRU A;  3EVR A;  1DJG A;  1G8I A;  3UNW A;  3AAJ A;  2IS9 A;  4ORB B;  1PK0 D;  2CNP A;  2Y4Q A;  4HRG A;  1S5G Z;  3BUM B;  5D7F A;  2L0P A;  3O4X A;  2WCE A;  1IG5 A;  1A75 A;  1L2O C;  2LMV A;  1QX5 B;  4D1E A;  2K2F A;  3NHI A;  1TUJ A;  3OP0 A;  5HLO A;  3DVK A;  3KF9 A;  2LLS A;  5DKN A;  3SG3 A;  3KEV A;  3S0A A;  2F2O A;  2K7C A;  1CMF A;  3JTD C;  1CDN A;  4PHJ A;  3I5G B;  1TUZ A;  2HF5 A;  4JQ0 D;  2MLF C;  4CLN A;  2LP3 A;  3EG5 B;  4A4B A;  1NP8 A;  3K21 A;  3CDN A;  4PHM A;  1DC1 A;  2Q91 A;  1N0Y A;  2EC6 B;  1CM1 A;  2L5Y A;  1PSR A;  4QJ3 B;  1NX1 A;  1SBJ A;  2MA2 A;  1H4B A;  3DVJ A;  1CLL A;  3OGN A;  4PAL A;  1LA0 A;  1IH0 A;  1IWQ A;  1TCF A;  2JNX A;  4M2O A;  4ORA B;  1HT9 A;  3DZT A;  5KTY A;  2LAP A;  4N1F A;  3D76 A;  2BKH B;  4QJ5 B;  3LK0 A;  3NSK A;  1PAL A;  1MUX A;  1QIV A;  1NIW A;  3TUY C;  1QXP A;  3I5H C;  4IJ7 A;  3SIA A;  4PE4 A;  3CLN A;  4YGE B;  1IQ3 A;  1WLZ A;  2H61 C;  1DEK A;  2ZRS A;  1NCZ A;  2M7L A;  1EG3 A;  3NSO A;  3ICB A;  1WDC B;  2KI6 C;  5I2O A;  4YI9 A;  3CR5 X;  4PT1 A;  2BCB A;  1B4C A;  3CAB A;  4GBA A;  2KAX A;  1CFC A;  1ZFS A;  4GPL B;  2FCE A;  1BJF A;  1K93 D;  2HET A;  2I18 A;  1X02 A;  1Y1X A;  1AJ4 A;  2WOS A;  2G2B A;  1DF0 B;  2EGD A;  2L50 A;  1DJZ A;  2MLE C;  4P5O E;  1ALW A;  2R2I A;  1KSO A;  3FE8 A;  1CKK A;  2KLE A;  2WC8 A;  2CCM A;  3CZ2 A;  1CMG A;  1B7T Z;  3S0D A;  3WHT B;  3FWC A;  3EVV A;  3BUO B;  3BOW A;  2M3W A;  1TNP A;  1A2X A;  2WCB A;  1YR5 A;  5HL1 A;  2KFG A;  1XK4 A;  1UWO A;  3R1P A;  1JUO A;  3NSL A;  4USL A;  3DD4 A;  4MEW A;  4OR9 B;  3FE6 A;  1XFZ O;  2AAO A;  3DY9 A;  1A75 B;  1VRK A;  3EVU A;  2JC2 A;  3PLF B;  4UPG A;  1IJ6 A;  2DOQ A;  1UP5 A;  3IQQ A;  3WNX B;  2O60 A;  2BAP A;  5PAL A;  2E30 A;  1REC A;  1Y1U A;  5DIC A;  1F4O A;  1TIZ A;  1KQM B;  5IBW A;  5HKY A;  5I2Q A;  3VRP A;  1QVI Y;  4U8D A;  1NSH A;  3BUN B;  2KQ6 A;  3VB1 A;  2LUC A;  4DS7 A;  2M1U A;  3TDU A;  1K8U A;  2FJY A;  1QV0 A;  1TWO A;  2HQ8 A;  1CM4 A;  1OOH A;  1IQ5 A;  2JTZ A;  4WQ2 A;  4FQO A;  5KSZ A;  4ZCU A;  4MN0 A;  4YBH B;  1S36 A;  1W7J B;  1B47 A;  1P28 A;  2Y1N A;  3CR4 X;  3DXL A;  2KI4 C;  4YGC B;  3D73 A;  1OMR A;  3CZ0 A;  1CLB A;  2F3Y A;  2FCD A;  3CZT X;  1KWO B;  4IL1 A;  4NDB A;  2L4H A;  3NHT A;  2LM5 A;  4MZL A;  3BFA A;  3B6X A;  4Q04 A;  2KFH A;  2M1K B;  3TZ1 A;  1OOG A;  2A4J A;  5FYX A;  2CBL A;  2HPS A;  1AHR A;  1CFD A;  1YTZ C;  2JQ6 A;  4JKT A;  2PSR A;  3K1E A;  2KFF A;  1SYM A;  3SG7 A;  4FTG A;  1XFX O;  2JXC A;  3JVT B;  1GJY A;  2GTE A;  3PM2 A;  1PRW A;  2B1U A;  4NDC A;  3F45 A;  3WHU B;  1YUS A;  1OW4 A;  1CFF A;  1J55 A;  1TOP A;  2MJW B;  2LLU A;  2WC5 A;  2OTG B;  3NGV A;  1SCM C;  2BL0 B;  2K2A A;  1QLS A;  2BNX A;  4AOM A;  1J7Q A;  3CS1 A;  1KK7 Y;  2LHI A;  3TDI A;  1DJY A;  4I5K A;  3LK1 A;  1FBV A;  2QEO A;  4ICB A;  3GK1 A;  2LVI A;  3DYE A;  4I5N B;  5I8N A;  2KGR A;  1KK7 Z;  3B7A A;  1S5G Y;  1XA5 A;  1RK9 A;  2QEH A;  1QWV A;  2KPH A;  3PSR A;  2M7N A;  3S0G A;  2LCP A;  4INW A;  3B88 A;  1UHH A;  1J1D A;  1SMG A;  2JRF A;  1BR1 B;  4E68 A;  1OOI X;  1PSB A;  1L2O B;  1R6P A;  2M29 A;  2BCX A;  3IF7 A;  1K9K A;  1DJI A;  2PAS A;  3TS5 C;  2NZ0 A;  1BOC A;  1CLM A;  1ODB A;  5B8I B;  1G33 A;  2Y5I A;  1AK8 A;  1K9P A;  5CSF A;  5ER4 X;  3GK2 A;  3CR2 A;  1TNW A;  1S1E A;  3I5I B;  2KAY A;  2H8V A;  5HLV A;  2WND A;  5CPV A;  1G4Y R;  1JF0 A;  2I94 A;  4YGD B;  1OZS A;  3TDZ A;  2KAV A;  3AAK A;  5AXI A;  2K61 A;  2NCP A;  1SL7 A;  2QAC A;  1B1G A;  2ERB A;  3D74 A;  4PDZ A;  2OS8 B;  2FOT A;  3I5F B;  1JC2 A;  3RZS A;  1M45 A;  4GUK A;  4CPV A;  2MRD A;  3VRR A;  3PAL A;  1BG1 A;  1IIO A;  1NCY A;  3V2L A;  2PVB A;  1DEL A;  4MVF A;  3EKJ A;  4WRI A;  3CGA A;  4INX A;  3SG5 A;  3I5G C;  2JT8 A;  2LVJ A;  4F7F A;  1NYA A;  1BLQ A;  2BBN A;  5JJG A;  3B87 A;  2NXQ A;  1HQV A;  2EC6 C;  1J7R A;  4YGB B;  2LV7 A;  4GGF A;  2JOJ A;  1LIN A;  5TNC A;  1BU3 A;  2KGB C;  1WRK A;  2P71 A;  1N2D A;  2CTN A;  1JFJ A;  1V1G A;  2QEB A;  3S0E A;  5HYD A;  1B7T Y;  2Y1M A;  1ZMZ A;  2WCJ A;  3GK4 X;  2SAS A;  4R1E A;  1SY9 A;  1XYD A;  4AQI A;  1C7V A;  1QJT A;  2KBI A;  4NQG A;  1XFY O;  1OSA A;  1YUU A;  3AKB A;  3SS3 A;  5GQQ C;  4TNC A;  2L2C A;  4FQT A;  4WQ3 A;  1T14 A;  1OOF A;  2JT3 A;  3RLZ A;  5I94 A;  1KCY A;  1K96 A;  3R1O A;  2WCF A;  3WXA A;  1KK8 B;  2LVK A;  2M49 B;  1BF5 A;  2D8N A;  2LMT A;  5K89 A;  1OQP A;  2WCH A;  3BJH A;  3QME A;  4YGA A;  3NSI A;  1UHK A;  1RRO A;  1DJW A;  5D69 A;  5HKZ A;  2ZNE A;  1C3Y A;  2ZN8 A;  4MBE A;  4CFR A;  1KQV A;  5D3O A;  4BY5 A;  1UHI A;  2PRU A;  4M2Q A;  1IRJ A;  3BYA A;  2K7B A;  2LP2 A;  1SRA A;  1TNX A;  2QPT A;  5CSI A;  2GGM A;  2KYC A;  2ZRT A;  3D0Y A;  1FI6 A;  2OPO A;  3FE9 A;  4M2P A;  1WY9 A;  4ZCV A;  1EXR A;  3PAT A;  1QAT A;  3CZ1 A;  3N7H A;  1J7P A;  1H8B A;  2PAL A;  1YX7 A;  1D1O A;  1XO5 A;  4A4C A;  4MZJ A;  1ORG A;  5CSN A;  1UUR A;  2KI4 B;  3SS4 A;  1XFR A;  4PHK A;  2MAZ A;  1Z4H A;  1OMD A;  2MHH A;  2ZND A;  4C0J A;  4MRX A;  1DT7 B;  1SR6 C;  1OE9 B;  1UUS A;  1MQ1 A;  2P70 A;  1SW8 A;  2H61 A;  1SSE B;  2JPO A;  1GQM A;  2WCK A;  1FF1 A;  2PMY A;  1KQM C;  1YX8 A;  3OBV A;  1IGV A;  3L4A A;  3L4L A;  3O2P A;  2BEC A;  2K8M B;  3IVT A;  2KDH A;  5FI2 A;  3PFV A;  3HCM A;  4DIR A;  4QJ4 B;  1XVJ A;  3CWG A;  2JU0 A;  3Q8I A;  5G08 A;  2GV5 A;  1C3Z A;  2WOR A;  3FIA A;  3PN7 C;  1W9Z A;  1DMO A;  1S26 D;  3PM8 A;  1A03 A;  4DCK A;  1PVB A;  1OOJ A;  1KWO C;  2ZN9 A;  1AVS A;  3DF0 A;  1BR4 B;  4XYN A;  1LA3 A;  1SL9 A;  1YUR A;  1YRT B;  1K94 A;  1S3P A;  2LE9 B;  3BOW B;  3O4Y A;  4MSP A;  1CFP A;  1GGW A;  2LUX A;  4PE1 A;  2L4I A;  1QAS A;  1S6J A;  2AMI A;  1JF2 A;  2BE6 A;  1DGU A;  1EJ3 A;  2V53 A;  5DKQ A;  1GM0 A;  1AUI B;  1KSM A;  2JPT A;  3OX6 A;  1L7Z A;  4JWQ A;  2JUL A;  3JVT C;  3TS5 B;  5AER A;  3VRO A;  3R72 A;  3A4U B;  1MR8 A;  1RFJ A;  1IKU A;  3D75 A;  2BL0 C;  1QX7 A;  1UHN A;  3JTD B;  3VGO A;  1N65 A;  1GGZ A;  1Q80 A;  5FI7 A;  4DRW A;  2P6B B;  3FWB A;  1XFV O;  1SCV A;  2H2K A;  1A29 A;  4MRY A;  1FPW A;  2GGZ A;  2F33 A;  3D0Y B;  3KHE A;  1F54 A;  1F71 A;  2KBM A;  1LVC D;  3S0B A;  1JWD A;  1MF8 B;  1XK4 C;  2ZKM X;  4I5L B;  1DQE A;  1M46 A;  1U5I A;  2M8U A;  1V1F A;  5JOL A;  4I5J A;  3KPX A;  1F8H A; 
#chains in the Genus database with same CATH homology
 2L2C A;  4FQT A;  2QEV A;  3VB1 A;  1T14 A;  1OOF A;  4JD9 A;  2FJY A;  1TWO A;  3R1O A;  1OOH A;  1P28 A;  3DXL A;  3B86 A;  2WCH A;  3BJH A;  3QME A;  3CZ0 A;  2WCL A;  3D73 A;  3R1V A;  2PQL A;  4OZD A;  3NHT A;  1C3Y A;  2WCM A;  3BFA A;  3B6X A;  3D78 A;  1OOG A;  3K1E A;  3NHI A;  3FE9 A;  1TUJ A;  2GTE A;  3S0A A;  3CZ1 A;  3N7H A;  1OW4 A;  2WC5 A;  3NGV A;  1ORG A;  1XFR A;  3CDN A;  2QEO A;  3DYE A;  3B7A A;  3OGN A;  2P70 A;  2QEH A;  1QWV A;  3DZT A;  2KPH A;  2JPO A;  2WCK A;  3S0G A;  1LS8 A;  3D76 A;  4INW A;  3B88 A;  3L4A A;  3L4L A;  1OOI X;  3Q8I A;  2WC6 A;  1C3Z A;  3PJI A;  4PT1 A;  3CAB A;  2H8V A;  3L47 A;  3S0F A;  3FE8 A;  2ERB A;  3D74 A;  3CZ2 A;  1GM0 A;  3S0D A;  3RZS A;  3D77 A;  3V2L A;  3R72 A;  3BFH A;  3R1P A;  4INX A;  3D75 A;  4F7F A;  3B87 A;  3FE6 A;  3DY9 A;  2QDI A;  2P71 A;  3BFB A;  3S0B A;  2QEB A;  1DQE A;  5EL2 A;  3S0E A;  3CYZ A;  2WCJ A;  5DIC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...