4OZDA

Crystal structure of pdsp15a
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
122
structure length
120
Chain Sequence
ETPSQKCEEKYKTDKISCLHHCKYQYYGFIDVNYNIAQSEIRKFSNVLMDYGVVDKSKKRELKKVMHECAKQVKKEARKDSHWLNCRTSINYYRCVLTSKLIGPQRFDKAIQDYDKTISV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 14.4 kDa salivary protein
publication title Protection against cutaneous leishmaniasis in non-human primates by immunization with an insect salivary protein
rcsb
source organism Phlebotomus duboscqi
molecule tags Protein binding
total genus 44
structure length 120
sequence length 122
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2014-02-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 4ozdA00
2QEHA 3BFAA 4FQTA 2L2CA 2WCHA 4INXA 3DXLA 3FE9A 3S0EA 1P28A 2WCKA 1TUJA 1C3ZA 3NGVA 3S0BA 1T14A 3S0DA 3RZSA 4PT1A 3D77A 3QMEA 3OGNA 3K1EA 3D75A 2KPHA 2FJYA 2WC6A 3D78A 3S0AA 3B7AA 2P70A 3D73A 1ORGA 1OOGA 2QDIA 3B87A 3R72A 3N7HA 1TWOA 2QEBA 3BFHA 2WCLA 3CZ1A 2PQLA 2QEOA 5EL2A 1QWVA 3D74A 4INWA 2H8VA 3D76A 3S0GA 3L4LA 1XFRA 3Q8IA 1DQEA 3VB1A 3V2LA 2P71A 3DZTA 5DICA 2ERBA 3BJHA 3NHTA 3PJIA 2WCJA 4JD9A 3B86A 1LS8A 3B6XA 1OOFA 3R1OA 3L4AA 3CABA 3CZ0A 3B88A 1C3YA 1GM0A 3CDNA 1OOIX 2GTEA 2WCMA 2QEVA 2WC5A 3R1PA 4OZDA 3CYZA 3DY9A 3R1VA 3S0FA 3CZ2A 3FE8A 1OW4A 3DYEA 2JPOA 1OOHA 3BFBA 3FE6A 3NHIA 3L47A 4F7FA
chains in the Genus database with same CATH superfamily
1JC2A 1W7IB 4NDCA 5GQQC 4DRWA 2E6WA 1GGZA 5JJGA 5I2LA 4UPGA 5FYXA 3IQQA 1KK8B 1Y0VH 1MR8A 2LC5A 2M97A 4MSPA 1NWDA 3S0EA 1EH2A 1F8HA 5AEQA 1K94A 1XK4C 3KHEA 1GQMA 3TDZA 1P28A 3NSOA 2WCKA 1TUJA 1UUSA 2AUCA 3VRQA 2BE4A 2Y4QA 2JZIA 2MAZA 1WRKA 2PVBA 4ZCUA 5B8IB 3RZSA 1G4YR 2OTGC 4ICBA 1M46A 1DMOA 3PM2A 2CBLA 1FI5A 1FW4A 3CLNA 1AUIB 2GGMA 2GGZA 2KYCA 2KBMA 1FF1A 3WHUB 2PALA 1QASA 2L4IA 1PALA 5HL1A 1AJ5A 1KCYA 4WQ2A 5KU1A 1Q80A 2KGBC 2K8MB 1C07A 3N7HA 1BR1B 1TWOA 2JU0A 1SCMB 2KFGA 3KEVA 1JF0A 3D0YA 1DJWA 1KQMC 3GOFA 4MVFA 2QPTA 3OHMB 3SS3A 1QV1A 3PLFB 4MRXA 1A2XA 2M8UA 2KYFA 2F33A 2K7BA 1QLKA 2WOSA 2LMVA 1CFDA 5JOLA 1YX7A 3NSLA 2KI4C 5ER5A 1PK0D 1XK4A 3PALA 1BG1A 2COLB 1SW8A 1XFVO 3I5HC 4PHJA 5PALA 3VGOA 1RROA 2H8VA 1HT9A 1IGVA 3O4XA 5FI6A 2MJWB 2TN4A 1DTLA 1WLZA 2L0PA 1CTRA 1SL8A 2L2EA 2L98A 1S3PA 1YRUB 1SPYA 4N5XA 1DJGA 4PHKA 1PVBA 2LVKA 3TUYB 1CKKA 1YVLA 1KK7Z 3VB1A 5DKRA 2WCFA 2KBIA 1AJ4A 2OS8B 3BUXB 3M0WA 2K7CA 2ERBA 3DD4A 5HLVA 5D3OA 3ZWHA 1L2OC 4WRIA 2K7DA 3BQ3A 1K93D 2F2PA 3I5FB 5F6TA 3CR4X 1TCOB 1B7TY 2AAOA 1UHKA 4MBEA 2H61C 4ORCB 1GM0A 2JT8A 1QATA 1QTXA 3CDNA 1YUTA 3NXAA 4I5NB 5BPJA 2WCBA 3WNXB 2HPSA 2WCMA 1ODBA 4QJ3B 4YGDB 1QX2A 3D0YB 2NCOA 4CFRA 1E8AA 3E3RA 2CT9A 1SL9A 4A4CA 4MZJA 4OZDA 1CDLA 4HREE 3I5IC 2M9GA 3R1VA 3WXAA 4XYNA 3CZ2A 4JPZB 3BOWB 2MRDA 3SG5A 1DJHA 1OW4A 3I5GC 2LM5A 1IG5A 1Z4HA 1TUZA 1Y1UA 1IQ5A 1RK9A 2JQ6A 5I2QA 1SK6D 1KQVA 3EG5B 4XJKA 4NDBA 3BFBA 3FE6A 1JFKA 5HLOA 1S6IA 2M7LA 2LP3A 3PATA 1XFZO 1NIWA 2L5YA 4MLWA 3BFAA 3IVTA 4C0KA 1BLQA 1WLMA 1JF2A 2K2FA 2ZKMX 3WHTB 4C0JA 1MUXA 3TS5C 2H2KA 2JPTA 4AQJA 3JTDB 1DELA 4INXA 1DGUA 1J1EA 1RFJA 2M29A 3KO0A 3LL8B 2M3WA 3PM8A 2H61A 2KI6D 2MBXA 4GUKA 1TNQA 2KDHA 4I5KA 1TIZA 1TTXA 4DIRA 2JC2A 2WC8A 1N0YA 2CXJA 3SIAA 1ALWA 2WNDA 3CR2A 3NGVA 3OX5A 2MA2A 1TN4A 2LLUA 1T14A 1CLLA 1CLMA 1CM4A 1QX7A 1VRKA 1YR5A 1F70A 2FJUB 4I5LB 1M31A 1KFUL 3OB2B 4HRHA 2GV5A 4P2YB 3VROA 3K1EA 3D75A 2YGUA 2WC6A 3D78A 4ETOA 2CCMA 1FPWA 2K2AA 2LANA 3S0AA 2L51A 3JVTB 2P70A 1A75A 3D73A 1DJZA 1SR6C 3DF0A 2KLDA 1WRLA 1KFUS 1ORGA 2KHNA 1OOGA 3BUWB 1A4PA 5DKNA 1N65A 1XVJA 1S5GZ 2IS9A 3PN7C 3IQOA 1UURA 3O2PA 1S6JA 1BU3A 1WDCB 3OB1B 1BODA 4NQGA 1SRAA 2ZRTA 4PE4A 4PHNA 4M2QA 4XJKB 1KSMA 1BR4B 1K9KA 1QVIY 4GBAA 1NX2A 3EVUA 1XO5A 3EK7A 1F55A 5AFPA 2Q4UA 5CSNA 2KGRA 1F4QA 2NZ0A 4YBHB 4M2PA 1K9UA 1QIVA 1JFJA 1IQ3A 1OOJA 2I7AA 2HF5A 3SG6A 1UHIA 1QLSA 1QWVA 1B8CA 3D74A 1BOCA 1CFFA 3EVVA 1AVSA 3OP0A 5CSIA 1TNXA 2LLTA 1LINA 1QJTA 3SG7A 2EC6C 1Y1AA 1HQVA 4PE1A 3VRPA 1DQEA 1TNPA 2M7NA 1IWQA 3RM1A 1SYMA 2VRGA 5DICA 2ZNDA 4ORBB 3BJHA 2Q91A 2BCAA 4JD9A 1V1FA 3B86A 5HYDA 4CPVA 3OX6A 1IKUA 3PFVA 1OOFA 1X02A 1NX0A 4A4BA 3HX4A 3CZ0A 4KYNA 1CB1A 1H8BA 2JNXA 4OVNF 4CLNA 1EJ3A 1UWOA 2ZN8A 2LVJA 2ZFDA 4D1EA 1SMGA 1D1OA 2AMIA 1OZSA 2QEVA 1KWOB 3O4YA 2PRUA 3QRXA 3R1PA 2ZN9A 2Y1MA 1IJ5A 2KI6C 2KOTA 4YI9A 3DY9A 2JNFA 1IJ6A 2F2OA 3AKBA 1C7WA 4USLA 2KQYA 1ZUZA 2BL0C 2JXCA 1OQPA 3RLZA 1NPQA 1OZOA 1XA5A 1B47A 1OOHA 2ZRSA 4DCKA 2BE6A 1OE9B 3TZ1A 3BUMB 1FI6A 2JTTA 1K96A 5FI7A 1CLBA 1IRJA 3BYAA 3NHIA 2LVVA 2EGDA 2G9BA 1CFCA 1FBVA 4AOMA 4FQTA 3ICBA 4NDDA 4YGAA 1BJFA 1XFYO 3EVRA 2M1KB 4JKTA 1CDPA 1NCXA 1DF0A 3CWGA 3ZNIA 2FCDA 1KSOA 5DKQA 3SJSA 4MRYA 3BXKA 3FS7A 1TCFA 4JWQA 3AAKA 4OKHA 3DVJA 1SSEB 1C3ZA 4HSZA 4PCWA 2KAVA 1UHHA 1UP5A 4ORAB 5J3XA 3S0DA 1LA0A 3OBVA 3GK4X 1K90D 3OGNA 2KPHA 2FJYA 1K8UA 1U5IA 2M1UA 2OTGB 3CR5X 2I94A 3B7AA 1IIOA 1XFWO 3FWCA 3UO9A 1SCMC 1Z2CB 4QJ5B 2R2IA 2KNEA 1AK8A 2KQ6A 5CSJA 3R72A 4HRGA 5I94A 1JWDA 2QEBA 3BFHA 1DC1A 1M63B 4YGBB 1K95A 1Y6WA 2EC6B 1LKJA 2BKIB 2WORA 2WCLA 3SG2A 4E68A 1RJVA 5CPVA 4R1EA 2F3ZA 1KQMB 1QIWA 2PQLA 2LVIA 3VRRA 2WCEA 2QEOA 4CFQA 1J7OA 2HETA 3CGAA 5EL2A 1KFXS 3SS5A 2KFHA 1W7JB 1G8IA 3DVEA 1ZOTB 3KPXA 2CTNA 2KI4B 4JQ0D 1GJYA 3A4UB 4INWA 2KSPA 3D76A 3C1VA 1F4OA 3S0GA 1CDMA 3I5HB 2FOTA 3L4LA 3NSKA 1QX5B 2LUXA 1KK7Y 3TUYC 3Q8IA 2OS8C 2LAPA 4OR9B 1TRFA 2BCXA 1LXFC 4DUQA 4GGNA 3V2LA 2P71A 1YTZC 1Y1XA 1W9ZA 1TOPA 1R6PA 1RECA 1WY9A 1NP8A 2NCPA 2KAYA 2PMYA 2SCPA 3A8RA 3NHTA 4I5JA 2WCJA 4FQOA 1V1GA 4N1FA 3SS4A 2B1UA 2BL0B 1XYDA 4P5OE 1F71A 3R1OA 1LVCD 4YGCB 1L2OB 1NYAA 2JT0A 2JTZA 2OPOA 3CABA 2LCPA 4OV2A 4PHMA 4BY4A 3B88A 2KAXA 3LK0A 1JSAA 1B7TZ 4BY5A 1YUSA 1JUOA 1UHJA 1DJIA 2GTEA 1DGVA 4TNCA 3BUOB 1YX8A 1MF8B 1YUUA 3AAJA 1SNLA 3KF9A 1K9PA 1OMDA 2NXQA 2Y5IA 3CYZA 1J7PA 1DEKA 3PSRA 4C0LA 2M0RA 1M39A 2MLFC 3FE8A 3SIBA 1PSBA 1AHRA 3I5IB 1QS7A 2G2BA 2JPOA 4DS7A 4AQIA 1PSRA 1C7VA 2SASA 2MLEC 3I5GB 2E30A 1A75B 1SY9A 1IH0A 1M45A 1K2HA 2BECA 3DF0B 1NUBA 1CDNA 1OSAA 2HQ8A 4ZCVA 3JTDC 1OMRA 2QEHA 2LLSA 3GK1A 2O60A 5HKYA 1B4CA 2L2CA 1EL4A 5KSZA 1H4BA 1S1EA 2WCHA 5I8NA 4GGFC 1S6CA 3DXLA 5K89A 2KFFA 3DZTA 1PRWA 3FE9A 4IL1A 5D69A 3TS5B 2EHBA 1BMOA 3O6BA 3CTNA 1JBAA 1DT7B 5AXIA 1AP4A 3IF7A 2LV7A 2LHLA 2BNXA 3O78A 1YRTB 3BUNB 4MZKA 1SCVA 5HKZA 3GK2A 3S0BA 5ER4X 3LLEA 3DVMA 4N1GA 1EG3A 3BOWA 4PT1A 2FCEA 3D77A 3CS1A 3NSIA 3QMEA 3JVTC 4M2OA 1A03A 5I2OA 2K7OA 1SKTA 1BF5A 1MQ1A 1ZFSA 1ZMZA 2D8NA 2V53A 1ALVA 1SBJA 1S5GY 1DVIA 2PASA 3H4SE 1CFPA 1F54A 2K61A 1MHOA 1KK8C 1LA3A 1WDCC 1XFUO 1S26D 2QDIA 4GFTA 2L50A 2K60A 2JWWA 3B87A 1SR6B 1DJXA 1J7RA 1S36A 3SG3A 2K0JA 2RGIA 2JXLA 4GPLB 1J7QA 3AKAA 1B1GA 4MN0A 2QACA 2BKHB 5CSFA 3PN7B 2ZNEA 4PE0A 1UHNA 2L4HA 2JOJA 3CZ1A 4GGFA 2O5GA 1QV0A 1XFXO 3K21A 1MXLC 1NCZA 1L7ZA 1QVIZ 2I2RE 2PSRA 3LCPC 3UNWA 3EK8A 2BBMA 2P6BB 4F0ZB 2L5XB 1PVAA 1RTP1 1NX3A 1WRZA 2Y1NA 5G08A 2F3YA 4YRUA 1EXRA 1XFRA 2I18A 1B8RA 3LK1A 2LUCA 1CNPA 1CMFA 1CM1A 4PE7A 1J1DA 1DJYA 3TDUA 4L9MA 3CZTX 2LNKA 5D7FA 4WQ3A 1BT6A 1SL7A 2M49B 4OCIA 1R2UA 2KLEA 1KFXL 5FI2A 2MHHA 1B9AA 2LE9B 3MSEB 3PJIA 1NX1A 2HQWA 2JULA 3SG4A 1PULA 2DOQA 3EK4A 1YVHA 1OMVA 1LS8A 3B6XA 3L4AA 1QXPA 1MXEA 1NSHA 1MWNA 1NCYA 3F45A 3EKJA 1C3YA 4GAOA 1DF0B 1OOIX 2NLNA 2LP2A 1KWOC 4MZLA 4QJ4B 2CNPA 1TNWA 2BBNA 2LHIA 5IBWA 1EG4A 5KTYA 1RWYA 4FTGA 1B8LA 3VRNA 5AERA 4YI8A 1G33A 1A29A 4IJ7A 4CIDA 3TDIA 2WC5A 4PALA 1CMGA 3D10A 5AANA 1YURA 2LMTA 2A4JA 3S0FA 4YGEB 5TNCA 3DVKA 2LMUA 1N2DA 2JRFA 3FWBA 2PYQA 2F8PA 4PDZA 3I5FC 4GNKB 3DYEA 5HKWA 1J55A 2JT3A 3FIAA 1ZACA 1U5IB 4U8DA 1GGWA 4MEWA 3EKHA 3HCMA 2ISDA 4Q04A 3L47A 4F7FA 2BCBA 2BAPA
chains in the Genus database with same CATH topology
2QEHA 3BFAA 4FQTA 2L2CA 2WCHA 4INXA 3DXLA 3FE9A 3S0EA 1P28A 2WCKA 1TUJA 1C3ZA 3NGVA 3S0BA 1T14A 3S0DA 3RZSA 4PT1A 3D77A 3QMEA 3OGNA 3K1EA 3D75A 2KPHA 2FJYA 2WC6A 3D78A 3S0AA 3B7AA 2P70A 3D73A 1ORGA 1OOGA 2QDIA 3B87A 3R72A 3N7HA 1TWOA 2QEBA 3BFHA 2WCLA 3CZ1A 2PQLA 2QEOA 5EL2A 1QWVA 3D74A 4INWA 2H8VA 3D76A 3S0GA 3L4LA 1XFRA 3Q8IA 1DQEA 3VB1A 3V2LA 2P71A 3DZTA 5DICA 2ERBA 3BJHA 3NHTA 3PJIA 2WCJA 4JD9A 3B86A 1LS8A 3B6XA 1OOFA 3R1OA 3L4AA 3CABA 3CZ0A 3B88A 1C3YA 1GM0A 3CDNA 1OOIX 2GTEA 2WCMA 2QEVA 2WC5A 3R1PA 4OZDA 3CYZA 3DY9A 3R1VA 3S0FA 3CZ2A 3FE8A 1OW4A 3DYEA 2JPOA 1OOHA 3BFBA 3FE6A 3NHIA 3L47A 4F7FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEH A;  3BFA A;  4FQT A;  2L2C A;  2WCH A;  4INX A;  3DXL A;  3FE9 A;  3S0E A;  1P28 A;  2WCK A;  1TUJ A;  1C3Z A;  3NGV A;  3S0B A;  1T14 A;  3S0D A;  3RZS A;  4PT1 A;  3D77 A;  3QME A;  3OGN A;  3K1E A;  3D75 A;  2KPH A;  2FJY A;  2WC6 A;  3D78 A;  3S0A A;  3B7A A;  2P70 A;  3D73 A;  1ORG A;  1OOG A;  2QDI A;  3B87 A;  3R72 A;  3N7H A;  1TWO A;  2QEB A;  3BFH A;  2WCL A;  3CZ1 A;  2PQL A;  2QEO A;  5EL2 A;  1QWV A;  3D74 A;  4INW A;  2H8V A;  3D76 A;  3S0G A;  3L4L A;  1XFR A;  3Q8I A;  1DQE A;  3VB1 A;  3V2L A;  2P71 A;  3DZT A;  5DIC A;  2ERB A;  3BJH A;  3NHT A;  3PJI A;  2WCJ A;  4JD9 A;  3B86 A;  1LS8 A;  3B6X A;  1OOF A;  3R1O A;  3L4A A;  3CAB A;  3CZ0 A;  3B88 A;  1C3Y A;  1GM0 A;  3CDN A;  1OOI X;  2GTE A;  2WCM A;  2QEV A;  2WC5 A;  3R1P A;  4OZD A;  3CYZ A;  3DY9 A;  3R1V A;  3S0F A;  3CZ2 A;  3FE8 A;  1OW4 A;  3DYE A;  2JPO A;  1OOH A;  3BFB A;  3FE6 A;  3NHI A;  3L47 A;  4F7F A; 
#chains in the Genus database with same CATH topology
 1JC2 A;  1W7I B;  4NDC A;  5GQQ C;  4DRW A;  2E6W A;  1GGZ A;  5JJG A;  5I2L A;  4UPG A;  5FYX A;  3IQQ A;  1KK8 B;  1Y0V H;  1MR8 A;  2LC5 A;  2M97 A;  4MSP A;  1NWD A;  3S0E A;  1EH2 A;  1F8H A;  5AEQ A;  1K94 A;  1XK4 C;  3KHE A;  1GQM A;  3TDZ A;  1P28 A;  3NSO A;  2WCK A;  1TUJ A;  1UUS A;  2AUC A;  3VRQ A;  2BE4 A;  2Y4Q A;  2JZI A;  2MAZ A;  1WRK A;  2PVB A;  4ZCU A;  5B8I B;  3RZS A;  1G4Y R;  2OTG C;  4ICB A;  1M46 A;  1DMO A;  3PM2 A;  2CBL A;  1FI5 A;  1FW4 A;  3CLN A;  1AUI B;  2GGM A;  2GGZ A;  2KYC A;  2KBM A;  1FF1 A;  3WHU B;  2PAL A;  1QAS A;  2L4I A;  1PAL A;  5HL1 A;  1AJ5 A;  1KCY A;  4WQ2 A;  5KU1 A;  1Q80 A;  2KGB C;  2K8M B;  1C07 A;  3N7H A;  1BR1 B;  1TWO A;  2JU0 A;  1SCM B;  2KFG A;  3KEV A;  1JF0 A;  3D0Y A;  1DJW A;  1KQM C;  3GOF A;  4MVF A;  2QPT A;  3OHM B;  3SS3 A;  1QV1 A;  3PLF B;  4MRX A;  1A2X A;  2M8U A;  2KYF A;  2F33 A;  2K7B A;  1QLK A;  2WOS A;  2LMV A;  1CFD A;  5JOL A;  1YX7 A;  3NSL A;  2KI4 C;  5ER5 A;  1PK0 D;  1XK4 A;  3PAL A;  1BG1 A;  2COL B;  1SW8 A;  1XFV O;  3I5H C;  4PHJ A;  5PAL A;  3VGO A;  1RRO A;  2H8V A;  1HT9 A;  1IGV A;  3O4X A;  5FI6 A;  2MJW B;  2TN4 A;  1DTL A;  1WLZ A;  2L0P A;  1CTR A;  1SL8 A;  2L2E A;  2L98 A;  1S3P A;  1YRU B;  1SPY A;  4N5X A;  1DJG A;  4PHK A;  1PVB A;  2LVK A;  3TUY B;  1CKK A;  1YVL A;  1KK7 Z;  3VB1 A;  5DKR A;  2WCF A;  2KBI A;  1AJ4 A;  2OS8 B;  3BUX B;  3M0W A;  2K7C A;  2ERB A;  3DD4 A;  5HLV A;  5D3O A;  3ZWH A;  1L2O C;  4WRI A;  2K7D A;  3BQ3 A;  1K93 D;  2F2P A;  3I5F B;  5F6T A;  3CR4 X;  1TCO B;  1B7T Y;  2AAO A;  1UHK A;  4MBE A;  2H61 C;  4ORC B;  1GM0 A;  2JT8 A;  1QAT A;  1QTX A;  3CDN A;  1YUT A;  3NXA A;  4I5N B;  5BPJ A;  2WCB A;  3WNX B;  2HPS A;  2WCM A;  1ODB A;  4QJ3 B;  4YGD B;  1QX2 A;  3D0Y B;  2NCO A;  4CFR A;  1E8A A;  3E3R A;  2CT9 A;  1SL9 A;  4A4C A;  4MZJ A;  4OZD A;  1CDL A;  4HRE E;  3I5I C;  2M9G A;  3R1V A;  3WXA A;  4XYN A;  3CZ2 A;  4JPZ B;  3BOW B;  2MRD A;  3SG5 A;  1DJH A;  1OW4 A;  3I5G C;  2LM5 A;  1IG5 A;  1Z4H A;  1TUZ A;  1Y1U A;  1IQ5 A;  1RK9 A;  2JQ6 A;  5I2Q A;  1SK6 D;  1KQV A;  3EG5 B;  4XJK A;  4NDB A;  3BFB A;  3FE6 A;  1JFK A;  5HLO A;  1S6I A;  2M7L A;  2LP3 A;  3PAT A;  1XFZ O;  1NIW A;  2L5Y A;  4MLW A;  3BFA A;  3IVT A;  4C0K A;  1BLQ A;  1WLM A;  1JF2 A;  2K2F A;  2ZKM X;  3WHT B;  4C0J A;  1MUX A;  3TS5 C;  2H2K A;  2JPT A;  4AQJ A;  3JTD B;  1DEL A;  4INX A;  1DGU A;  1J1E A;  1RFJ A;  2M29 A;  3KO0 A;  3LL8 B;  2M3W A;  3PM8 A;  2H61 A;  2KI6 D;  2MBX A;  4GUK A;  1TNQ A;  2KDH A;  4I5K A;  1TIZ A;  1TTX A;  4DIR A;  2JC2 A;  2WC8 A;  1N0Y A;  2CXJ A;  3SIA A;  1ALW A;  2WND A;  3CR2 A;  3NGV A;  3OX5 A;  2MA2 A;  1TN4 A;  2LLU A;  1T14 A;  1CLL A;  1CLM A;  1CM4 A;  1QX7 A;  1VRK A;  1YR5 A;  1F70 A;  2FJU B;  4I5L B;  1M31 A;  1KFU L;  3OB2 B;  4HRH A;  2GV5 A;  4P2Y B;  3VRO A;  3K1E A;  3D75 A;  2YGU A;  2WC6 A;  3D78 A;  4ETO A;  2CCM A;  1FPW A;  2K2A A;  2LAN A;  3S0A A;  2L51 A;  3JVT B;  2P70 A;  1A75 A;  3D73 A;  1DJZ A;  1SR6 C;  3DF0 A;  2KLD A;  1WRL A;  1KFU S;  1ORG A;  2KHN A;  1OOG A;  3BUW B;  1A4P A;  5DKN A;  1N65 A;  1XVJ A;  1S5G Z;  2IS9 A;  3PN7 C;  3IQO A;  1UUR A;  3O2P A;  1S6J A;  1BU3 A;  1WDC B;  3OB1 B;  1BOD A;  4NQG A;  1SRA A;  2ZRT A;  4PE4 A;  4PHN A;  4M2Q A;  4XJK B;  1KSM A;  1BR4 B;  1K9K A;  1QVI Y;  4GBA A;  1NX2 A;  3EVU A;  1XO5 A;  3EK7 A;  1F55 A;  5AFP A;  2Q4U A;  5CSN A;  2KGR A;  1F4Q A;  2NZ0 A;  4YBH B;  4M2P A;  1K9U A;  1QIV A;  1JFJ A;  1IQ3 A;  1OOJ A;  2I7A A;  2HF5 A;  3SG6 A;  1UHI A;  1QLS A;  1QWV A;  1B8C A;  3D74 A;  1BOC A;  1CFF A;  3EVV A;  1AVS A;  3OP0 A;  5CSI A;  1TNX A;  2LLT A;  1LIN A;  1QJT A;  3SG7 A;  2EC6 C;  1Y1A A;  1HQV A;  4PE1 A;  3VRP A;  1DQE A;  1TNP A;  2M7N A;  1IWQ A;  3RM1 A;  1SYM A;  2VRG A;  5DIC A;  2ZND A;  4ORB B;  3BJH A;  2Q91 A;  2BCA A;  4JD9 A;  1V1F A;  3B86 A;  5HYD A;  4CPV A;  3OX6 A;  1IKU A;  3PFV A;  1OOF A;  1X02 A;  1NX0 A;  4A4B A;  3HX4 A;  3CZ0 A;  4KYN A;  1CB1 A;  1H8B A;  2JNX A;  4OVN F;  4CLN A;  1EJ3 A;  1UWO A;  2ZN8 A;  2LVJ A;  2ZFD A;  4D1E A;  1SMG A;  1D1O A;  2AMI A;  1OZS A;  2QEV A;  1KWO B;  3O4Y A;  2PRU A;  3QRX A;  3R1P A;  2ZN9 A;  2Y1M A;  1IJ5 A;  2KI6 C;  2KOT A;  4YI9 A;  3DY9 A;  2JNF A;  1IJ6 A;  2F2O A;  3AKB A;  1C7W A;  4USL A;  2KQY A;  1ZUZ A;  2BL0 C;  2JXC A;  1OQP A;  3RLZ A;  1NPQ A;  1OZO A;  1XA5 A;  1B47 A;  1OOH A;  2ZRS A;  4DCK A;  2BE6 A;  1OE9 B;  3TZ1 A;  3BUM B;  1FI6 A;  2JTT A;  1K96 A;  5FI7 A;  1CLB A;  1IRJ A;  3BYA A;  3NHI A;  2LVV A;  2EGD A;  2G9B A;  1CFC A;  1FBV A;  4AOM A;  4FQT A;  3ICB A;  4NDD A;  4YGA A;  1BJF A;  1XFY O;  3EVR A;  2M1K B;  4JKT A;  1CDP A;  1NCX A;  1DF0 A;  3CWG A;  3ZNI A;  2FCD A;  1KSO A;  5DKQ A;  3SJS A;  4MRY A;  3BXK A;  3FS7 A;  1TCF A;  4JWQ A;  3AAK A;  4OKH A;  3DVJ A;  1SSE B;  1C3Z A;  4HSZ A;  4PCW A;  2KAV A;  1UHH A;  1UP5 A;  4ORA B;  5J3X A;  3S0D A;  1LA0 A;  3OBV A;  3GK4 X;  1K90 D;  3OGN A;  2KPH A;  2FJY A;  1K8U A;  1U5I A;  2M1U A;  2OTG B;  3CR5 X;  2I94 A;  3B7A A;  1IIO A;  1XFW O;  3FWC A;  3UO9 A;  1SCM C;  1Z2C B;  4QJ5 B;  2R2I A;  2KNE A;  1AK8 A;  2KQ6 A;  5CSJ A;  3R72 A;  4HRG A;  5I94 A;  1JWD A;  2QEB A;  3BFH A;  1DC1 A;  1M63 B;  4YGB B;  1K95 A;  1Y6W A;  2EC6 B;  1LKJ A;  2BKI B;  2WOR A;  2WCL A;  3SG2 A;  4E68 A;  1RJV A;  5CPV A;  4R1E A;  2F3Z A;  1KQM B;  1QIW A;  2PQL A;  2LVI A;  3VRR A;  2WCE A;  2QEO A;  4CFQ A;  1J7O A;  2HET A;  3CGA A;  5EL2 A;  1KFX S;  3SS5 A;  2KFH A;  1W7J B;  1G8I A;  3DVE A;  1ZOT B;  3KPX A;  2CTN A;  2KI4 B;  4JQ0 D;  1GJY A;  3A4U B;  4INW A;  2KSP A;  3D76 A;  3C1V A;  1F4O A;  3S0G A;  1CDM A;  3I5H B;  2FOT A;  3L4L A;  3NSK A;  1QX5 B;  2LUX A;  1KK7 Y;  3TUY C;  3Q8I A;  2OS8 C;  2LAP A;  4OR9 B;  1TRF A;  2BCX A;  1LXF C;  4DUQ A;  4GGN A;  3V2L A;  2P71 A;  1YTZ C;  1Y1X A;  1W9Z A;  1TOP A;  1R6P A;  1REC A;  1WY9 A;  1NP8 A;  2NCP A;  2KAY A;  2PMY A;  2SCP A;  3A8R A;  3NHT A;  4I5J A;  2WCJ A;  4FQO A;  1V1G A;  4N1F A;  3SS4 A;  2B1U A;  2BL0 B;  1XYD A;  4P5O E;  1F71 A;  3R1O A;  1LVC D;  4YGC B;  1L2O B;  1NYA A;  2JT0 A;  2JTZ A;  2OPO A;  3CAB A;  2LCP A;  4OV2 A;  4PHM A;  4BY4 A;  3B88 A;  2KAX A;  3LK0 A;  1JSA A;  1B7T Z;  4BY5 A;  1YUS A;  1JUO A;  1UHJ A;  1DJI A;  2GTE A;  1DGV A;  4TNC A;  3BUO B;  1YX8 A;  1MF8 B;  1YUU A;  3AAJ A;  1SNL A;  3KF9 A;  1K9P A;  1OMD A;  2NXQ A;  2Y5I A;  3CYZ A;  1J7P A;  1DEK A;  3PSR A;  4C0L A;  2M0R A;  1M39 A;  2MLF C;  3FE8 A;  3SIB A;  1PSB A;  1AHR A;  3I5I B;  1QS7 A;  2G2B A;  2JPO A;  4DS7 A;  4AQI A;  1PSR A;  1C7V A;  2SAS A;  2MLE C;  3I5G B;  2E30 A;  1A75 B;  1SY9 A;  1IH0 A;  1M45 A;  1K2H A;  2BEC A;  3DF0 B;  1NUB A;  1CDN A;  1OSA A;  2HQ8 A;  4ZCV A;  3JTD C;  1OMR A;  2QEH A;  2LLS A;  3GK1 A;  2O60 A;  5HKY A;  1B4C A;  2L2C A;  1EL4 A;  5KSZ A;  1H4B A;  1S1E A;  2WCH A;  5I8N A;  4GGF C;  1S6C A;  3DXL A;  5K89 A;  2KFF A;  3DZT A;  1PRW A;  3FE9 A;  4IL1 A;  5D69 A;  3TS5 B;  2EHB A;  1BMO A;  3O6B A;  3CTN A;  1JBA A;  1DT7 B;  5AXI A;  1AP4 A;  3IF7 A;  2LV7 A;  2LHL A;  2BNX A;  3O78 A;  1YRT B;  3BUN B;  4MZK A;  1SCV A;  5HKZ A;  3GK2 A;  3S0B A;  5ER4 X;  3LLE A;  3DVM A;  4N1G A;  1EG3 A;  3BOW A;  4PT1 A;  2FCE A;  3D77 A;  3CS1 A;  3NSI A;  3QME A;  3JVT C;  4M2O A;  1A03 A;  5I2O A;  2K7O A;  1SKT A;  1BF5 A;  1MQ1 A;  1ZFS A;  1ZMZ A;  2D8N A;  2V53 A;  1ALV A;  1SBJ A;  1S5G Y;  1DVI A;  2PAS A;  3H4S E;  1CFP A;  1F54 A;  2K61 A;  1MHO A;  1KK8 C;  1LA3 A;  1WDC C;  1XFU O;  1S26 D;  2QDI A;  4GFT A;  2L50 A;  2K60 A;  2JWW A;  3B87 A;  1SR6 B;  1DJX A;  1J7R A;  1S36 A;  3SG3 A;  2K0J A;  2RGI A;  2JXL A;  4GPL B;  1J7Q A;  3AKA A;  1B1G A;  4MN0 A;  2QAC A;  2BKH B;  5CSF A;  3PN7 B;  2ZNE A;  4PE0 A;  1UHN A;  2L4H A;  2JOJ A;  3CZ1 A;  4GGF A;  2O5G A;  1QV0 A;  1XFX O;  3K21 A;  1MXL C;  1NCZ A;  1L7Z A;  1QVI Z;  2I2R E;  2PSR A;  3LCP C;  3UNW A;  3EK8 A;  2BBM A;  2P6B B;  4F0Z B;  2L5X B;  1PVA A;  1RTP 1;  1NX3 A;  1WRZ A;  2Y1N A;  5G08 A;  2F3Y A;  4YRU A;  1EXR A;  1XFR A;  2I18 A;  1B8R A;  3LK1 A;  2LUC A;  1CNP A;  1CMF A;  1CM1 A;  4PE7 A;  1J1D A;  1DJY A;  3TDU A;  4L9M A;  3CZT X;  2LNK A;  5D7F A;  4WQ3 A;  1BT6 A;  1SL7 A;  2M49 B;  4OCI A;  1R2U A;  2KLE A;  1KFX L;  5FI2 A;  2MHH A;  1B9A A;  2LE9 B;  3MSE B;  3PJI A;  1NX1 A;  2HQW A;  2JUL A;  3SG4 A;  1PUL A;  2DOQ A;  3EK4 A;  1YVH A;  1OMV A;  1LS8 A;  3B6X A;  3L4A A;  1QXP A;  1MXE A;  1NSH A;  1MWN A;  1NCY A;  3F45 A;  3EKJ A;  1C3Y A;  4GAO A;  1DF0 B;  1OOI X;  2NLN A;  2LP2 A;  1KWO C;  4MZL A;  4QJ4 B;  2CNP A;  1TNW A;  2BBN A;  2LHI A;  5IBW A;  1EG4 A;  5KTY A;  1RWY A;  4FTG A;  1B8L A;  3VRN A;  5AER A;  4YI8 A;  1G33 A;  1A29 A;  4IJ7 A;  4CID A;  3TDI A;  2WC5 A;  4PAL A;  1CMG A;  3D10 A;  5AAN A;  1YUR A;  2LMT A;  2A4J A;  3S0F A;  4YGE B;  5TNC A;  3DVK A;  2LMU A;  1N2D A;  2JRF A;  3FWB A;  2PYQ A;  2F8P A;  4PDZ A;  3I5F C;  4GNK B;  3DYE A;  5HKW A;  1J55 A;  2JT3 A;  3FIA A;  1ZAC A;  1U5I B;  4U8D A;  1GGW A;  4MEW A;  3EKH A;  3HCM A;  2ISD A;  4Q04 A;  3L47 A;  4F7F A;  2BCB A;  2BAP A; 
#chains in the Genus database with same CATH homology
 2QEH A;  3BFA A;  4FQT A;  2L2C A;  2WCH A;  4INX A;  3DXL A;  3FE9 A;  3S0E A;  1P28 A;  2WCK A;  1TUJ A;  1C3Z A;  3NGV A;  3S0B A;  1T14 A;  3S0D A;  3RZS A;  4PT1 A;  3D77 A;  3QME A;  3OGN A;  3K1E A;  3D75 A;  2KPH A;  2FJY A;  2WC6 A;  3D78 A;  3S0A A;  3B7A A;  2P70 A;  3D73 A;  1ORG A;  1OOG A;  2QDI A;  3B87 A;  3R72 A;  3N7H A;  1TWO A;  2QEB A;  3BFH A;  2WCL A;  3CZ1 A;  2PQL A;  2QEO A;  5EL2 A;  1QWV A;  3D74 A;  4INW A;  2H8V A;  3D76 A;  3S0G A;  3L4L A;  1XFR A;  3Q8I A;  1DQE A;  3VB1 A;  3V2L A;  2P71 A;  3DZT A;  5DIC A;  2ERB A;  3BJH A;  3NHT A;  3PJI A;  2WCJ A;  4JD9 A;  3B86 A;  1LS8 A;  3B6X A;  1OOF A;  3R1O A;  3L4A A;  3CAB A;  3CZ0 A;  3B88 A;  1C3Y A;  1GM0 A;  3CDN A;  1OOI X;  2GTE A;  2WCM A;  2QEV A;  2WC5 A;  3R1P A;  4OZD A;  3CYZ A;  3DY9 A;  3R1V A;  3S0F A;  3CZ2 A;  3FE8 A;  1OW4 A;  3DYE A;  2JPO A;  1OOH A;  3BFB A;  3FE6 A;  3NHI A;  3L47 A;  4F7F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...