2NCOA

Nmr solution structure for the c-terminal domain of tetrahymena tcb2 in the absence of calcium
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
102
structure length
102
Chain Sequence
SSKPKYNPEVEAKLDVARRLFKRYDKDGSGQLQDDEIAGLLKDTYAEMGMSNFTPTKEDVKIWLQMADTNSDGSVSLEEYEDLIIKSLQKAGIRVEKQSLVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution NMR structures of the C-domain of Tetrahymena cytoskeletal protein Tcb2 reveal distinct calcium-induced structural rearrangements.
pubmed doi rcsb
source organism Tetrahymena thermophila
molecule tags Metal binding protein
molecule keywords 25 kDa calcium-binding protein
total genus 20
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2016-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2ncoA00
1SPYA 3CTNA 1QVIY 2MBXA 1N0YA 1KK7Z 3ICBA 1NCYA 1PRWA 3BXKA 3VRNA 1CFPA 4WRIA 4OKHA 1K8UA 3TS5B 1KK8C 1WY9A 2FCEA 2H61C 2KOTA 2MJWB 3LCPC 3CR5X 2RGIA 4U8DA 4MBEA 5AEQA 4DUQA 2COLB 1DF0A 1B1GA 3KHEA 2KFFA 3BUXB 5KTYA 1RFJA 1WRZA 1AP4A 3WNXB 3AKBA 1BU3A 2JC2A 2Y1NA 2M1UA 1A2XA 3H4SE 2KBIA 1K9PA 1BODA 1OZOA 1TN4A 1JF2A 2CT9A 1PVAA 3VGOA 2K0JA 4HSZA 5TNCA 2ZRSA 4XJKA 1SL7A 1SCMB 2F2PA 4ORAB 3BUNB 2E6WA 3HX4A 1KQMC 1F54A 2JQ6A 2BCXA 4NDCA 3RM1A 4GPLB 1B47A 1SR6B 1IWQA 2LMUA 1B8LA 2JNFA 1RROA 3DVEA 3A8RA 1NUBA 3BUOB 1ZMZA 4I5KA 1J7OA 1SW8A 1Y6WA 4NDDA 1MUXA 1NP8A 1PSBA 1FBVA 1DJIA 4I5LB 3OX6A 1KQVA 3GK1A 2L98A 2LVIA 4ORCB 1Y1AA 3EKHA 4QJ5B 1DJHA 4WQ3A 2CNPA 1QV0A 3I5IB 1YUTA 3DVKA 3I5HB 1FPWA 1AVSA 4DS7A 4P5OE 1QX5B 3BYAA 4MZLA 3BOWB 3CR4X 2VRGA 3I5FC 3LL8B 2BKHB 5AERA 4MEWA 1RECA 1NYAA 2LE9B 4D1EA 3SJSA 1CFFA 1J7PA 1UURA 3D0YB 2KGRA 1F55A 1EL4A 1DVIA 3PLFB 1XFVO 1UHKA 5FYXA 2IS9A 3I5HC 1CLBA 1F8HA 2LUXA 2JULA 1QLKA 3GOFA 2WNDA 3FWCA 1EG3A 1ODBA 4BY5A 2JZIA 2GV5A 5IBWA 2HPSA 3JTDC 1UHIA 2F33A 3KO0A 4MN0A 5F6TA 1BJFA 1OMVA 2JXCA 3DVMA 4YGDB 5I2OA 5J3XA 4AQJA 1S36A 2LHIA 4CPVA 1XFWO 1GJYA 2K8MB 3TDUA 1H4BA 1SL8A 1L2OC 1MHOA 1SNLA 2BE6A 4PHNA 2EHBA 2LCPA 1QTXA 1KFXL 2M3WA 1JBAA 3KEVA 1V1FA 1EXRA 3LK1A 1PK0D 1WDCB 2OTGC 2MLFC 3O6BA 1K90D 2M97A 3ZNIA 2M9GA 4M2QA 1DJWA 1ZOTB 2LP2A 1G33A 1M46A 1SKTA 2BCBA 2JOJA 2R2IA 1TTXA 2BL0C 5I8NA 1MXLC 3WHTB 2LP3A 1IQ3A 3O4YA 2L2EA 3D10A 1KFUS 1CMFA 3CS1A 1JF0A 2KI4B 2L4IA 3IQOA 5CPVA 2SASA 1B4CA 1CDMA 4QJ4B 2LHLA 1CM4A 1IQ5A 3TUYB 1TNWA 1ALWA 4MRYA 2LM5A 4N1FA 2WC8A 3GK4X 1QVIZ 3TDIA 1XK4C 2JU0A 1KK8B 5HKYA 3AKAA 3CWGA 2OTGB 4PE0A 3O2PA 3PATA 3VRRA 1CTRA 1SY9A 4I5NB 1K96A 3TS5C 3FS7A 1CKKA 4MZJA 3I5GC 2JT8A 4OVNF 3SG4A 1YX8A 3SG3A 4C0LA 1YUUA 3FIAA 2K2FA 3IF7A 1XFZO 2K7BA 3D0YA 1CB1A 1FI5A 4YGAA 2LLTA 4ZCUA 2BCAA 2ZFDA 2NZ0A 4GNKB 1SRAA 1TOPA 2G9BA 4BY4A 4IL1A 3SIBA 3SG6A 1S5GY 1U5IB 4GFTA 1JSAA 1K9UA 2MAZA 4AOMA 2ISDA 5HLVA 1NPQA 1S6JA 1NX1A 2HQ8A 2H61A 2Y4QA 1VRKA 4GAOA 2PALA 4JQ0D 1U5IA 1F4OA 1OZSA 1SR6C 1QLSA 1QS7A 1RTP1 2LVKA 1M45A 1XFYO 2I2RE 3AAKA 2NCPA 2GGMA 2BKIB 2HETA 2M29A 3KPXA 3LLEA 2NXQA 3OHMB 1IH0A 3OX5A 1OMDA 2FOTA 1QJTA 2KAVA 5CSIA 1MXEA 2P6BB 1LA3A 4WQ2A 4GBAA 3GK2A 4N1GA 1YVLA 1QIWA 1M31A 1XVJA 2MHHA 1V1GA 1BLQA 4YGCB 1XFUO 4OCIA 5ER5A 2K7OA 3K21A 1KFUL 2OS8C 1CFDA 1B7TZ 1KSMA 1UP5A 1TNXA 2BBMA 3CLNA 3PN7C 2JT0A 1CMGA 2LC5A 3C1VA 1NIWA 4TNCA 1NSHA 2F3ZA 3KF9A 4C0KA 3PN7B 3TDZA 1JFJA 1KFXS 1BOCA 1K2HA 1JC2A 3RLZA 1QX7A 2CCMA 3DF0A 4UPGA 1B8CA 1YR5A 4NDBA 4HREE 3NSKA 2PRUA 1TNQA 1DF0B 1S3PA 1YURA 2MLEC 4ETOA 1K95A 1XA5A 2O5GA 1LKJA 2CXJA 3PALA 2DOQA 1IRJA 3WHUB 2KAXA 5D7FA 1WDCC 1IJ5A 2KI6D 4JPZB 4YI8A 4P2YB 5BPJA 3JTDB 2I94A 2AMIA 4DCKA 2LLUA 1LVCD 2HF5A 1B7TY 3VROA 1MQ1A 2Q91A 5DKRA 5KU1A 1AJ4A 4YBHB 2B1UA 2KYFA 1SBJA 2TN4A 2WORA 1D1OA 1UUSA 3IQQA 1CNPA 2ZN9A 2BE4A 2JT3A 1S26D 2KGBC 1L2OB 3NSOA 1DTLA 4GGFA 1NCXA 5CSJA 2F8PA 1YVHA 1WRKA 2JPTA 1NX2A 1LXFC 1ZACA 4PHKA 1KWOB 2KQ6A 2D8NA 2M8UA 1GQMA 1JFKA 2JWWA 2L4HA 3OB2B 2JNXA 1A75A 4FQOA 2HQWA 5I2LA 1QIVA 1BR1B 1FW4A 3AAJA 3I5GB 1BF5A 2AAOA 2H2KA 2MA2A 2F3YA 3EVUA 1A4PA 3OB1B 4PHJA 1DJYA 1K9KA 1YRUB 4PE7A 4ZCVA 5JJGA 2K2AA 4M2PA 1B8RA 1R2UA 1SL9A 1UHJA 1B9AA 1QV1A 2PMYA 3HCMA 4USLA 4YGBB 1SMGA 3A4UB 4YI9A 5PALA 4GUKA 1YRTB 1EJ3A 1DGVA 1KK7Y 1HQVA 2ZNEA 4PDZA 3JVTC 3BUMB 1KCYA 2KYCA 1OSAA 1F70A 2LVJA 2KAYA 3CGAA 2NCOA 3CR2A 5K89A 1J7QA 1RK9A 4MVFA 2QPTA 1BMOA 2LMTA 3EVVA 4AQIA 1OE9B 1RWYA 1FI6A 2LNKA 1G8IA 2JTTA 2ZN8A 5HYDA 3DD4A 1DT7B 1IJ6A 3PFVA 1SCMC 1JUOA 1SYMA 1WRLA 4I5JA 2Y1MA 4FTGA 1CDPA 1WLZA 4Q04A 3LK0A 1SK6D 5G08A 3TUYC 2BECA 3MSEB 2WCFA 2KHNA 4XJKB 2CTNA 1N2DA 1LINA 4MSPA 2CBLA 1M63B 3TZ1A 2OS8B 1TCOB 2JTZA 1MR8A 1F71A 4QJ3B 1DJZA 2ZNDA 1X02A 1WLMA 2PASA 1ALVA 1S1EA 1OQPA 1YTZC 2EC6C 2M7NA 1TCFA 3E3RA 3M0WA 4M2OA 2K7DA 3EK8A 1EH2A 1CM1A 5AXIA 1LA0A 2L51A 4OR9B 5AANA 3O78A 4XYNA 1Y1XA 2I18A 5ER4X 1G4YR 4PALA 1AK8A 2BL0B 1JWDA 1YX7A 2M0RA 3BUWB 3NXAA 1QX2A 2QACA 1J55A 1HT9A 1J7RA 5DKNA 1DMOA 2KI6C 2JRFA 1GGZA 1S6CA 1QXPA 2KFHA 3EK4A 4JWQA 5HKZA 3DVJA 1EG4A 4A4CA 4C0JA 2E30A 1NWDA 2ZRTA 2AUCA 1K94A 3I5FB 5CSNA 5HLOA 1DGUA 3SG7A 1OMRA 1K93D 2KNEA 1N65A 2LMVA 2Y5IA 4PCWA 4CLNA 4PHMA 1H8BA 1AUIB 2M49B 3NSLA 1NCZA 3CZTX 1C7WA 1KQMB 1UWOA 2ZKMX 3VRQA 2KSPA 1F4QA 5I2QA 2FCDA 5CSFA 1XK4A 3OP0A 5KSZA 4F0ZB 1DJXA 1L7ZA 3I5IC 2KBMA 1W7IB 5GQQC 2SCPA 1XFXO 4CIDA 1NX0A 1R6PA 2LV7A 2WOSA 1ZUZA 3FWBA 3PSRA 1A75B 2WCBA 1XO5A 3DF0B 3EVRA 1A03A 4A4BA 2LUCA 1C7VA 1TIZA 2LAPA 1W7JB 4PE4A 1C07A 2K7CA 3QRXA 1KWOC 4CFRA 1BG1A 1QASA 3EKJA 3NSIA 1QATA 3PM8A 4HRHA 2PSRA 1E8AA 2A4JA 2WCEA 5JOLA 3ZWHA 1IGVA 1J1EA 4HRGA 2MRDA 2KQYA 2K61A 1BT6A 1OOJA 1UHHA 4L9MA 1KSOA 3SG5A 1S6IA 4MLWA 1CLMA 5B8IB 4DRWA 1PSRA 5D69A 2KFGA 1XYDA 4GGFC 4MRXA 1Q80A 4ICBA 1BR4B 2LVVA 2V53A 1NX3A 2NLNA 2KI4C 3EK7A 4E68A 4CFQA 3F45A 2LLSA 3SIAA 1CDNA 1ZFSA 1CLLA 4NQGA 3JVTB 4PE1A 2EC6B 2FJUB 2I7AA 4ORBB 1TRFA 2G2BA 2L50A 1TNPA 1A29A 1S5GZ 1AHRA 4GGNA 2M1KB 1YUSA 3SG2A 1GGWA 2L5XB 1RJVA 2BBNA 4R1EA 2KDHA 1IG5A 2EGDA 2L0PA 1Y1UA 3WXAA 2Q4UA 2F2OA 4MZKA 1PALA 2O60A 1DJGA 1PVBA 1MWNA 1PULA 5AFPA 1CDLA 2M7LA 1IKUA 1MF8B 1Y0VH 1M39A 1UHNA 1J1DA 4YRUA 4YGEB 2PVBA 2JXLA 3BOWA 2LANA 4DIRA 5DKQA 4N5XA 3BQ3A 1AJ5A 1FF1A 5HKWA 2GGZA 2OPOA 1CFCA 1SCVA 3VRPA 4OV2A
chains in the Genus database with same CATH superfamily
1SPYA 3CTNA 1QVIY 2MBXA 1N0YA 1KK7Z 3ICBA 1NCYA 1PRWA 3BXKA 3VRNA 1CFPA 4WRIA 4OKHA 1K8UA 3TS5B 1KK8C 1WY9A 2FCEA 2H61C 2KOTA 2MJWB 3LCPC 3CR5X 2RGIA 4U8DA 2QEHA 4MBEA 5AEQA 3V2LA 4DUQA 1OOIX 2COLB 1DF0A 1B1GA 3KHEA 2KFFA 3BUXB 5KTYA 1RFJA 1WRZA 1AP4A 3WNXB 3AKBA 3Q8IA 1BU3A 2JC2A 2Y1NA 4JD9A 2M1UA 1A2XA 3H4SE 1OOGA 2KBIA 1GM0A 1K9PA 1T14A 1BODA 2KPHA 1OZOA 1TN4A 1JF2A 2CT9A 1PVAA 3VGOA 5DICA 2K0JA 4HSZA 5TNCA 1SSEB 2ZRSA 4XJKA 1SL7A 1SCMB 2F2PA 5FI7A 4ORAB 3BUNB 2E6WA 3HX4A 1KQMC 1F54A 2JQ6A 2BCXA 4NDCA 3PJIA 3R1OA 4GPLB 3RM1A 1B47A 1SR6B 1IWQA 2LMUA 1B8LA 1XFRA 2L2CA 2JNFA 1RROA 3DVEA 3A8RA 1NUBA 2JPOA 1ZMZA 3BUOB 4I5KA 1OW4A 1SW8A 1Y6WA 4NDDA 1MUXA 1NP8A 3FE8A 1PSBA 1FBVA 1DELA 3D77A 1DJIA 4I5LB 3OX6A 1KQVA 3BFAA 3GK1A 2L98A 2LVIA 4ORCB 1Y1AA 3EKHA 4QJ5B 1DJHA 3NGVA 4WQ3A 2CNPA 1QV0A 2FJYA 3I5IB 4INXA 1YUTA 3DVKA 3I5HB 3S0FA 1FPWA 1AVSA 4DS7A 4P5OE 1QX5B 3BYAA 4MZLA 3SS3A 3BOWB 3CR4X 2VRGA 3I5FC 3LL8B 2BKHB 5AERA 4MEWA 1RECA 1NYAA 3CDNA 2LE9B 2BAPA 4D1EA 2WCHA 3SJSA 1CFFA 2PQLA 3O4XA 1UURA 3D0YB 2KGRA 1J7PA 1F55A 1EL4A 1DVIA 3PLFB 1XFVO 1UHKA 5FYXA 2IS9A 3I5HC 1CLBA 1F8HA 2LUXA 1OOHA 1QLKA 2JULA 2WNDA 3FWCA 1EG3A 1ODBA 3GOFA 1W9ZA 3OGNA 4BY5A 1C3YA 1Z4HA 2JZIA 3BFBA 2GV5A 2QEOA 2HPSA 5IBWA 3JTDC 1UHIA 2F33A 3KO0A 4MN0A 5F6TA 1BJFA 1OMVA 2JXCA 3DVMA 4YGDB 5I2OA 5J3XA 4AQJA 1S36A 2LHIA 4CPVA 1XFWO 1GJYA 2K8MB 3TDUA 1H4BA 1SL8A 3B6XA 1L2OC 1MHOA 1SNLA 2BE6A 4PHNA 2EHBA 2LCPA 4JKTA 1QTXA 1KFXL 1Z2CB 2M3WA 1JBAA 1DQEA 1V1FA 1EXRA 3KEVA 1PK0D 1WDCB 2WC6A 2WCKA 3LK1A 3CYZA 4PT1A 2OTGC 2KLDA 2MLFC 3O6BA 1K90D 2M97A 3ZNIA 2M9GA 4M2QA 1DJWA 1ZOTB 2LP2A 1G33A 1M46A 1SKTA 2BCBA 2JOJA 2R2IA 1TTXA 2BL0C 5I8NA 1MXLC 3WHTB 2LP3A 1IQ3A 3O4YA 2L2EA 3D10A 1KFUS 3R1PA 3CS1A 1CMFA 1JF0A 2KI4B 2L4IA 3IQOA 5CPVA 2SASA 3D75A 1CDMA 4QJ4B 2LHLA 1B4CA 1CM4A 1IQ5A 3TUYB 1TNWA 3RZSA 3L4AA 1ALWA 3DZTA 4MRYA 2LM5A 4N1FA 2WC8A 3GK4X 3BJHA 1QVIZ 3TDIA 1XK4C 2JU0A 1KK8B 5HKYA 3AKAA 3CWGA 2OTGB 4PE0A 3O2PA 3PATA 5I94A 3VRRA 1CTRA 1SY9A 2ERBA 1K96A 4I5NB 3FS7A 3TS5C 1CKKA 3R72A 4MZJA 1J7OA 5HL1A 2P71A 2JT8A 3I5GC 3B86A 4OVNF 3SG4A 1YX8A 3SG3A 4C0LA 1YUUA 3FIAA 2K2FA 3IF7A 1XFZO 2K7BA 3D0YA 1CB1A 1FI5A 4YGAA 2LLTA 5FI6A 2BCAA 2ZFDA 4ZCUA 2NZ0A 4GNKB 1SRAA 1TOPA 2G9BA 4BY4A 3N7HA 4IL1A 3SIBA 3SG6A 1S5GY 1U5IB 4GFTA 1JSAA 1K9UA 2MAZA 2WCMA 4AOMA 2ISDA 5HLVA 1NPQA 1S6JA 1NX1A 2HQ8A 2H61A 2Y4QA 1VRKA 4GAOA 2PALA 4JQ0D 1U5IA 1F4OA 1OZSA 1SR6C 1QLSA 1QS7A 1RTP1 2LVKA 1M45A 1XFYO 2I2RE 3AAKA 3NHTA 2NCPA 2GGMA 2BKIB 2HETA 2M29A 3KPXA 3LLEA 2NXQA 3OHMB 1IH0A 3OX5A 1OMDA 2FOTA 1QJTA 2KAVA 5CSIA 1MXEA 2P6BB 1LA3A 4WQ2A 4GBAA 3GK2A 4N1GA 1YVLA 1QIWA 1M31A 1XVJA 2MHHA 1V1GA 1BLQA 4YGCB 2KLEA 1XFUO 4OCIA 5ER5A 4INWA 2K7OA 3K21A 1KFUL 2OS8C 1CFDA 1B7TZ 1KSMA 1UP5A 1TNXA 2BBMA 3CLNA 3CZ0A 2JT0A 3PN7C 1CMGA 2LC5A 3UNWA 3C1VA 1NIWA 4TNCA 1NSHA 2F3ZA 3KF9A 4C0KA 3PN7B 5EL2A 3TDZA 1JFJA 1KFXS 3QMEA 1BOCA 1K2HA 1JC2A 3RLZA 1QX7A 2CCMA 3DF0A 4UPGA 1B8CA 1YR5A 4NDBA 4HREE 3NSKA 2PRUA 1TNQA 1DF0B 1S3PA 1YURA 2MLEC 4ETOA 1K95A 1XA5A 2GTEA 1LKJA 2CXJA 2O5GA 3S0BA 3PALA 2DOQA 1IRJA 3WHUB 1P28A 2KAXA 3B88A 5D7FA 1WDCC 1IJ5A 2KI6D 4JPZB 4YI8A 4P2YB 5BPJA 3JTDB 2I94A 2AMIA 4DCKA 2LLUA 1LVCD 2HF5A 1B7TY 3VROA 1MQ1A 2Q91A 5DKRA 5KU1A 1AJ4A 4YBHB 1OOFA 2B1UA 2KYFA 1SBJA 2TN4A 2WORA 3S0DA 1D1OA 1UUSA 3IQQA 1CNPA 2ZN9A 2QDIA 2BE4A 2JT3A 1S26D 2KGBC 1L2OB 3NSOA 1DTLA 4GGFA 1NCXA 5CSJA 2F8PA 3D76A 1YVHA 1WRKA 2JPTA 1NX2A 1LXFC 2PYQA 4IJ7A 1ZACA 4PHKA 1KWOB 2KQ6A 2D8NA 2M8UA 1GQMA 1JFKA 2JWWA 2L4HA 3OB2B 2YGUA 2JNXA 3S0GA 1A75A 3SS4A 4FQOA 2HQWA 5I2LA 1QIVA 1BR1B 1FW4A 3AAJA 3I5GB 1BF5A 2AAOA 2H2KA 2MA2A 2F3YA 3EVUA 1A4PA 3OB1B 4PHJA 1DJYA 1K9KA 1YRUB 4PE7A 4ZCVA 5JJGA 2K2AA 3PM2A 4M2PA 1B8RA 1R2UA 1SL9A 1UHJA 1B9AA 1QV1A 2BNXA 5FI2A 2PMYA 3HCMA 4USLA 4YGBB 1SMGA 3A4UB 4YI9A 3CZ2A 5PALA 4GUKA 1EH2A 1YRTB 1TUZA 2QEBA 1EJ3A 1DGVA 1KK7Y 3NHIA 1HQVA 2WC5A 2ZNEA 3D78A 4PDZA 3JVTC 1TUJA 3BUMB 1KCYA 2KYCA 1OSAA 1F70A 2LVJA 3CZ1A 2KAYA 3CGAA 2NCOA 3CR2A 5K89A 1J7QA 1RK9A 4MVFA 2QPTA 1BMOA 2LMTA 3EVVA 4AQIA 1OE9B 1RWYA 1FI6A 2LNKA 1G8IA 2JTTA 2ZN8A 5HYDA 2L5YA 3DD4A 2WCLA 1DT7B 1IJ6A 3PFVA 1SCMC 1JUOA 1SYMA 1WRLA 2H8VA 4I5JA 2Y1MA 4FTGA 1CDPA 1WLZA 4Q04A 3LK0A 1SK6D 5G08A 3TUYC 2BECA 3MSEB 2QEVA 2WCFA 2KHNA 4XJKB 2CTNA 1N2DA 1LINA 4MSPA 2CBLA 3DYEA 3CABA 3EG5B 1M63B 3TZ1A 2OS8B 1TCOB 2JTZA 1MR8A 1F71A 3OBVA 4QJ3B 1DJZA 2ZNDA 1X02A 1WLMA 2PASA 1ALVA 1S1EA 1OQPA 1YTZC 2EC6C 2M7NA 1TCFA 1QWVA 3E3RA 3M0WA 2K7DA 1LS8A 3EK8A 4M2OA 3L4LA 1CM1A 3R1VA 1LA0A 2L51A 4OR9B 5AXIA 5AANA 3O78A 4XYNA 3FE6A 1Y1XA 2I18A 5ER4X 1G4YR 4PALA 1AK8A 1DC1A 2BL0B 1JWDA 1YX7A 2M0RA 3BUWB 3NXAA 1QX2A 3VB1A 2QACA 1J55A 1HT9A 1J7RA 5DKNA 1DMOA 2KI6C 2JRFA 1GGZA 1S6CA 1QXPA 2KFHA 3EK4A 1DEKA 4JWQA 3DVJA 1EG4A 5HKZA 4A4CA 4C0JA 1C3ZA 2E30A 1NWDA 2ZRTA 2AUCA 1K94A 3I5FB 5CSNA 5HLOA 4KYNA 1DGUA 3SG7A 1OMRA 1K93D 2KNEA 1N65A 2LMVA 2Y5IA 4PCWA 4CLNA 4PHMA 1H8BA 1AUIB 2M49B 3NSLA 1NCZA 3CZTX 1C7WA 1KQMB 1UWOA 2ZKMX 3VRQA 2KSPA 1F4QA 5I2QA 2FCDA 5CSFA 1XK4A 3OP0A 5KSZA 4F0ZB 1DJXA 1L7ZA 3I5IC 2KBMA 1W7IB 5GQQC 2SCPA 1XFXO 4CIDA 1NX0A 1R6PA 2LV7A 2WOSA 1ZUZA 3FWBA 3PSRA 1A75B 2WCBA 1XO5A 3DF0B 3EVRA 1A03A 5D3OA 4A4BA 3D73A 2LUCA 1C7VA 1TIZA 2LAPA 3D74A 1W7JB 4PE4A 1C07A 2K7CA 3QRXA 1KWOC 4CFRA 1BG1A 1QASA 3EKJA 3NSIA 1QATA 3PM8A 4HRHA 2PSRA 1E8AA 2A4JA 2WCEA 3IVTA 3K1EA 4F7FA 5JOLA 3ZWHA 1IGVA 1J1EA 4HRGA 2MRDA 2KQYA 2K61A 4OZDA 1BT6A 1OOJA 1UHHA 4L9MA 1KSOA 3SG5A 1S6IA 3SS5A 4MLWA 1CLMA 3L47A 5B8IB 4DRWA 1PSRA 5D69A 2KFGA 3B87A 1XYDA 4GGFC 4MRXA 1Q80A 3B7AA 4ICBA 1BR4B 2LVVA 2V53A 1NX3A 2NLNA 2KI4C 3EK7A 4E68A 4CFQA 3F45A 2LLSA 3SIAA 2K60A 1CDNA 1ZFSA 3DY9A 1CLLA 4NQGA 3JVTB 4PE1A 2EC6B 2FJUB 2I7AA 4ORBB 1TRFA 1ORGA 2G2BA 2L50A 4FQTA 1TNPA 1A29A 1S5GZ 1AHRA 4GGNA 2M1KB 1YUSA 3S0EA 3SG2A 1GGWA 3DXLA 2L5XB 1RJVA 3FE9A 2BBNA 4R1EA 2KDHA 1IG5A 2EGDA 2L0PA 1Y1UA 3WXAA 2Q4UA 2F2OA 4MZKA 1IIOA 1PALA 2O60A 1DJGA 1PVBA 1MWNA 1PULA 3S0AA 5AFPA 1CDLA 3UO9A 2M7LA 1IKUA 1MF8B 1Y0VH 1M39A 1UHNA 3BFHA 1J1DA 4YRUA 4YGEB 2PVBA 2JXLA 3BOWA 1TWOA 2LANA 2WCJA 4DIRA 5DKQA 4N5XA 3BQ3A 1AJ5A 1FF1A 5HKWA 2GGZA 2OPOA 1CFCA 1SCVA 3VRPA 4OV2A 2P70A
chains in the Genus database with same CATH topology
1SPYA 3CTNA 1QVIY 2MBXA 1N0YA 1KK7Z 3ICBA 1NCYA 1PRWA 3BXKA 3VRNA 1CFPA 4WRIA 4OKHA 1K8UA 3TS5B 1KK8C 1WY9A 2FCEA 2H61C 2KOTA 2MJWB 3LCPC 3CR5X 2RGIA 4U8DA 4MBEA 5AEQA 4DUQA 2COLB 1DF0A 1B1GA 3KHEA 2KFFA 3BUXB 5KTYA 1RFJA 1WRZA 1AP4A 3WNXB 3AKBA 1BU3A 2JC2A 2Y1NA 2M1UA 1A2XA 3H4SE 2KBIA 1K9PA 1BODA 1OZOA 1TN4A 1JF2A 2CT9A 1PVAA 3VGOA 2K0JA 4HSZA 5TNCA 2ZRSA 4XJKA 1SL7A 1SCMB 2F2PA 4ORAB 3BUNB 2E6WA 3HX4A 1KQMC 1F54A 2JQ6A 2BCXA 4NDCA 3RM1A 4GPLB 1B47A 1SR6B 1IWQA 2LMUA 1B8LA 2JNFA 1RROA 3DVEA 3A8RA 1NUBA 3BUOB 1ZMZA 4I5KA 1J7OA 1SW8A 1Y6WA 4NDDA 1MUXA 1NP8A 1PSBA 1FBVA 1DJIA 4I5LB 3OX6A 1KQVA 3GK1A 2L98A 2LVIA 4ORCB 1Y1AA 3EKHA 4QJ5B 1DJHA 4WQ3A 2CNPA 1QV0A 3I5IB 1YUTA 3DVKA 3I5HB 1FPWA 1AVSA 4DS7A 4P5OE 1QX5B 3BYAA 4MZLA 3BOWB 3CR4X 2VRGA 3I5FC 3LL8B 2BKHB 5AERA 4MEWA 1RECA 1NYAA 2LE9B 4D1EA 3SJSA 1CFFA 1J7PA 1UURA 3D0YB 2KGRA 1F55A 1EL4A 1DVIA 3PLFB 1XFVO 1UHKA 5FYXA 2IS9A 3I5HC 1CLBA 1F8HA 2LUXA 2JULA 1QLKA 3GOFA 2WNDA 3FWCA 1EG3A 1ODBA 4BY5A 2JZIA 2GV5A 5IBWA 2HPSA 3JTDC 1UHIA 2F33A 3KO0A 4MN0A 5F6TA 1BJFA 1OMVA 2JXCA 3DVMA 4YGDB 5I2OA 5J3XA 4AQJA 1S36A 2LHIA 4CPVA 1XFWO 1GJYA 2K8MB 3TDUA 1H4BA 1SL8A 1L2OC 1MHOA 1SNLA 2BE6A 4PHNA 2EHBA 2LCPA 1QTXA 1KFXL 2M3WA 1JBAA 3KEVA 1V1FA 1EXRA 3LK1A 1PK0D 1WDCB 2OTGC 2MLFC 3O6BA 1K90D 2M97A 3ZNIA 2M9GA 4M2QA 1DJWA 1ZOTB 2LP2A 1G33A 1M46A 1SKTA 2BCBA 2JOJA 2R2IA 1TTXA 2BL0C 5I8NA 1MXLC 3WHTB 2LP3A 1IQ3A 3O4YA 2L2EA 3D10A 1KFUS 1CMFA 3CS1A 1JF0A 2KI4B 2L4IA 3IQOA 5CPVA 2SASA 1B4CA 1CDMA 4QJ4B 2LHLA 1CM4A 1IQ5A 3TUYB 1TNWA 1ALWA 4MRYA 2LM5A 4N1FA 2WC8A 3GK4X 1QVIZ 3TDIA 1XK4C 2JU0A 1KK8B 5HKYA 3AKAA 3CWGA 2OTGB 4PE0A 3O2PA 3PATA 3VRRA 1CTRA 1SY9A 4I5NB 1K96A 3TS5C 3FS7A 1CKKA 4MZJA 3I5GC 2JT8A 4OVNF 3SG4A 1YX8A 3SG3A 4C0LA 1YUUA 3FIAA 2K2FA 3IF7A 1XFZO 2K7BA 3D0YA 1CB1A 1FI5A 4YGAA 2LLTA 4ZCUA 2BCAA 2ZFDA 2NZ0A 4GNKB 1SRAA 1TOPA 2G9BA 4BY4A 4IL1A 3SIBA 3SG6A 1S5GY 1U5IB 4GFTA 1JSAA 1K9UA 2MAZA 4AOMA 2ISDA 5HLVA 1NPQA 1S6JA 1NX1A 2HQ8A 2H61A 2Y4QA 1VRKA 4GAOA 2PALA 4JQ0D 1U5IA 1F4OA 1OZSA 1SR6C 1QLSA 1QS7A 1RTP1 2LVKA 1M45A 1XFYO 2I2RE 3AAKA 2NCPA 2GGMA 2BKIB 2HETA 2M29A 3KPXA 3LLEA 2NXQA 3OHMB 1IH0A 3OX5A 1OMDA 2FOTA 1QJTA 2KAVA 5CSIA 1MXEA 2P6BB 1LA3A 4WQ2A 4GBAA 3GK2A 4N1GA 1YVLA 1QIWA 1M31A 1XVJA 2MHHA 1V1GA 1BLQA 4YGCB 1XFUO 4OCIA 5ER5A 2K7OA 3K21A 1KFUL 2OS8C 1CFDA 1B7TZ 1KSMA 1UP5A 1TNXA 2BBMA 3CLNA 3PN7C 2JT0A 1CMGA 2LC5A 3C1VA 1NIWA 4TNCA 1NSHA 2F3ZA 3KF9A 4C0KA 3PN7B 3TDZA 1JFJA 1KFXS 1BOCA 1K2HA 1JC2A 3RLZA 1QX7A 2CCMA 3DF0A 4UPGA 1B8CA 1YR5A 4NDBA 4HREE 3NSKA 2PRUA 1TNQA 1DF0B 1S3PA 1YURA 2MLEC 4ETOA 1K95A 1XA5A 2O5GA 1LKJA 2CXJA 3PALA 2DOQA 1IRJA 3WHUB 2KAXA 5D7FA 1WDCC 1IJ5A 2KI6D 4JPZB 4YI8A 4P2YB 5BPJA 3JTDB 2I94A 2AMIA 4DCKA 2LLUA 1LVCD 2HF5A 1B7TY 3VROA 1MQ1A 2Q91A 5DKRA 5KU1A 1AJ4A 4YBHB 2B1UA 2KYFA 1SBJA 2TN4A 2WORA 1D1OA 1UUSA 3IQQA 1CNPA 2ZN9A 2BE4A 2JT3A 1S26D 2KGBC 1L2OB 3NSOA 1DTLA 4GGFA 1NCXA 5CSJA 2F8PA 1YVHA 1WRKA 2JPTA 1NX2A 1LXFC 1ZACA 4PHKA 1KWOB 2KQ6A 2D8NA 2M8UA 1GQMA 1JFKA 2JWWA 2L4HA 3OB2B 2JNXA 1A75A 4FQOA 2HQWA 5I2LA 1QIVA 1BR1B 1FW4A 3AAJA 3I5GB 1BF5A 2AAOA 2H2KA 2MA2A 2F3YA 3EVUA 1A4PA 3OB1B 4PHJA 1DJYA 1K9KA 1YRUB 4PE7A 4ZCVA 5JJGA 2K2AA 4M2PA 1B8RA 1R2UA 1SL9A 1UHJA 1B9AA 1QV1A 2PMYA 3HCMA 4USLA 4YGBB 1SMGA 3A4UB 4YI9A 5PALA 4GUKA 1YRTB 1EJ3A 1DGVA 1KK7Y 1HQVA 2ZNEA 4PDZA 3JVTC 3BUMB 1KCYA 2KYCA 1OSAA 1F70A 2LVJA 2KAYA 3CGAA 2NCOA 3CR2A 5K89A 1J7QA 1RK9A 4MVFA 2QPTA 1BMOA 2LMTA 3EVVA 4AQIA 1OE9B 1RWYA 1FI6A 2LNKA 1G8IA 2JTTA 2ZN8A 5HYDA 3DD4A 1DT7B 1IJ6A 3PFVA 1SCMC 1JUOA 1SYMA 1WRLA 4I5JA 2Y1MA 4FTGA 1CDPA 1WLZA 4Q04A 3LK0A 1SK6D 5G08A 3TUYC 2BECA 3MSEB 2WCFA 2KHNA 4XJKB 2CTNA 1N2DA 1LINA 4MSPA 2CBLA 1M63B 3TZ1A 2OS8B 1TCOB 2JTZA 1MR8A 1F71A 4QJ3B 1DJZA 2ZNDA 1X02A 1WLMA 2PASA 1ALVA 1S1EA 1OQPA 1YTZC 2EC6C 2M7NA 1TCFA 3E3RA 3M0WA 4M2OA 2K7DA 3EK8A 1EH2A 1CM1A 5AXIA 1LA0A 2L51A 4OR9B 5AANA 3O78A 4XYNA 1Y1XA 2I18A 5ER4X 1G4YR 4PALA 1AK8A 2BL0B 1JWDA 1YX7A 2M0RA 3BUWB 3NXAA 1QX2A 2QACA 1J55A 1HT9A 1J7RA 5DKNA 1DMOA 2KI6C 2JRFA 1GGZA 1S6CA 1QXPA 2KFHA 3EK4A 4JWQA 5HKZA 3DVJA 1EG4A 4A4CA 4C0JA 2E30A 1NWDA 2ZRTA 2AUCA 1K94A 3I5FB 5CSNA 5HLOA 1DGUA 3SG7A 1OMRA 1K93D 2KNEA 1N65A 2LMVA 2Y5IA 4PCWA 4CLNA 4PHMA 1H8BA 1AUIB 2M49B 3NSLA 1NCZA 3CZTX 1C7WA 1KQMB 1UWOA 2ZKMX 3VRQA 2KSPA 1F4QA 5I2QA 2FCDA 5CSFA 1XK4A 3OP0A 5KSZA 4F0ZB 1DJXA 1L7ZA 3I5IC 2KBMA 1W7IB 5GQQC 2SCPA 1XFXO 4CIDA 1NX0A 1R6PA 2LV7A 2WOSA 1ZUZA 3FWBA 3PSRA 1A75B 2WCBA 1XO5A 3DF0B 3EVRA 1A03A 4A4BA 2LUCA 1C7VA 1TIZA 2LAPA 1W7JB 4PE4A 1C07A 2K7CA 3QRXA 1KWOC 4CFRA 1BG1A 1QASA 3EKJA 3NSIA 1QATA 3PM8A 4HRHA 2PSRA 1E8AA 2A4JA 2WCEA 5JOLA 3ZWHA 1IGVA 1J1EA 4HRGA 2MRDA 2KQYA 2K61A 1BT6A 1OOJA 1UHHA 4L9MA 1KSOA 3SG5A 1S6IA 4MLWA 1CLMA 5B8IB 4DRWA 1PSRA 5D69A 2KFGA 1XYDA 4GGFC 4MRXA 1Q80A 4ICBA 1BR4B 2LVVA 2V53A 1NX3A 2NLNA 2KI4C 3EK7A 4E68A 4CFQA 3F45A 2LLSA 3SIAA 1CDNA 1ZFSA 1CLLA 4NQGA 3JVTB 4PE1A 2EC6B 2FJUB 2I7AA 4ORBB 1TRFA 2G2BA 2L50A 1TNPA 1A29A 1S5GZ 1AHRA 4GGNA 2M1KB 1YUSA 3SG2A 1GGWA 2L5XB 1RJVA 2BBNA 4R1EA 2KDHA 1IG5A 2EGDA 2L0PA 1Y1UA 3WXAA 2Q4UA 2F2OA 4MZKA 1PALA 2O60A 1DJGA 1PVBA 1MWNA 1PULA 5AFPA 1CDLA 2M7LA 1IKUA 1MF8B 1Y0VH 1M39A 1UHNA 1J1DA 4YRUA 4YGEB 2PVBA 2JXLA 3BOWA 2LANA 4DIRA 5DKQA 4N5XA 3BQ3A 1AJ5A 1FF1A 5HKWA 2GGZA 2OPOA 1CFCA 1SCVA 3VRPA 4OV2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SPY A;  3CTN A;  1QVI Y;  2MBX A;  1N0Y A;  1KK7 Z;  3ICB A;  1NCY A;  1PRW A;  3BXK A;  3VRN A;  1CFP A;  4WRI A;  4OKH A;  1K8U A;  3TS5 B;  1KK8 C;  1WY9 A;  2FCE A;  2H61 C;  2KOT A;  2MJW B;  3LCP C;  3CR5 X;  2RGI A;  4U8D A;  4MBE A;  5AEQ A;  4DUQ A;  2COL B;  1DF0 A;  1B1G A;  3KHE A;  2KFF A;  3BUX B;  5KTY A;  1RFJ A;  1WRZ A;  1AP4 A;  3WNX B;  3AKB A;  1BU3 A;  2JC2 A;  2Y1N A;  2M1U A;  1A2X A;  3H4S E;  2KBI A;  1K9P A;  1BOD A;  1OZO A;  1TN4 A;  1JF2 A;  2CT9 A;  1PVA A;  3VGO A;  2K0J A;  4HSZ A;  5TNC A;  2ZRS A;  4XJK A;  1SL7 A;  1SCM B;  2F2P A;  4ORA B;  3BUN B;  2E6W A;  3HX4 A;  1KQM C;  1F54 A;  2JQ6 A;  2BCX A;  4NDC A;  3RM1 A;  4GPL B;  1B47 A;  1SR6 B;  1IWQ A;  2LMU A;  1B8L A;  2JNF A;  1RRO A;  3DVE A;  3A8R A;  1NUB A;  3BUO B;  1ZMZ A;  4I5K A;  1J7O A;  1SW8 A;  1Y6W A;  4NDD A;  1MUX A;  1NP8 A;  1PSB A;  1FBV A;  1DJI A;  4I5L B;  3OX6 A;  1KQV A;  3GK1 A;  2L98 A;  2LVI A;  4ORC B;  1Y1A A;  3EKH A;  4QJ5 B;  1DJH A;  4WQ3 A;  2CNP A;  1QV0 A;  3I5I B;  1YUT A;  3DVK A;  3I5H B;  1FPW A;  1AVS A;  4DS7 A;  4P5O E;  1QX5 B;  3BYA A;  4MZL A;  3BOW B;  3CR4 X;  2VRG A;  3I5F C;  3LL8 B;  2BKH B;  5AER A;  4MEW A;  1REC A;  1NYA A;  2LE9 B;  4D1E A;  3SJS A;  1CFF A;  1J7P A;  1UUR A;  3D0Y B;  2KGR A;  1F55 A;  1EL4 A;  1DVI A;  3PLF B;  1XFV O;  1UHK A;  5FYX A;  2IS9 A;  3I5H C;  1CLB A;  1F8H A;  2LUX A;  2JUL A;  1QLK A;  3GOF A;  2WND A;  3FWC A;  1EG3 A;  1ODB A;  4BY5 A;  2JZI A;  2GV5 A;  5IBW A;  2HPS A;  3JTD C;  1UHI A;  2F33 A;  3KO0 A;  4MN0 A;  5F6T A;  1BJF A;  1OMV A;  2JXC A;  3DVM A;  4YGD B;  5I2O A;  5J3X A;  4AQJ A;  1S36 A;  2LHI A;  4CPV A;  1XFW O;  1GJY A;  2K8M B;  3TDU A;  1H4B A;  1SL8 A;  1L2O C;  1MHO A;  1SNL A;  2BE6 A;  4PHN A;  2EHB A;  2LCP A;  1QTX A;  1KFX L;  2M3W A;  1JBA A;  3KEV A;  1V1F A;  1EXR A;  3LK1 A;  1PK0 D;  1WDC B;  2OTG C;  2MLF C;  3O6B A;  1K90 D;  2M97 A;  3ZNI A;  2M9G A;  4M2Q A;  1DJW A;  1ZOT B;  2LP2 A;  1G33 A;  1M46 A;  1SKT A;  2BCB A;  2JOJ A;  2R2I A;  1TTX A;  2BL0 C;  5I8N A;  1MXL C;  3WHT B;  2LP3 A;  1IQ3 A;  3O4Y A;  2L2E A;  3D10 A;  1KFU S;  1CMF A;  3CS1 A;  1JF0 A;  2KI4 B;  2L4I A;  3IQO A;  5CPV A;  2SAS A;  1B4C A;  1CDM A;  4QJ4 B;  2LHL A;  1CM4 A;  1IQ5 A;  3TUY B;  1TNW A;  1ALW A;  4MRY A;  2LM5 A;  4N1F A;  2WC8 A;  3GK4 X;  1QVI Z;  3TDI A;  1XK4 C;  2JU0 A;  1KK8 B;  5HKY A;  3AKA A;  3CWG A;  2OTG B;  4PE0 A;  3O2P A;  3PAT A;  3VRR A;  1CTR A;  1SY9 A;  4I5N B;  1K96 A;  3TS5 C;  3FS7 A;  1CKK A;  4MZJ A;  3I5G C;  2JT8 A;  4OVN F;  3SG4 A;  1YX8 A;  3SG3 A;  4C0L A;  1YUU A;  3FIA A;  2K2F A;  3IF7 A;  1XFZ O;  2K7B A;  3D0Y A;  1CB1 A;  1FI5 A;  4YGA A;  2LLT A;  4ZCU A;  2BCA A;  2ZFD A;  2NZ0 A;  4GNK B;  1SRA A;  1TOP A;  2G9B A;  4BY4 A;  4IL1 A;  3SIB A;  3SG6 A;  1S5G Y;  1U5I B;  4GFT A;  1JSA A;  1K9U A;  2MAZ A;  4AOM A;  2ISD A;  5HLV A;  1NPQ A;  1S6J A;  1NX1 A;  2HQ8 A;  2H61 A;  2Y4Q A;  1VRK A;  4GAO A;  2PAL A;  4JQ0 D;  1U5I A;  1F4O A;  1OZS A;  1SR6 C;  1QLS A;  1QS7 A;  1RTP 1;  2LVK A;  1M45 A;  1XFY O;  2I2R E;  3AAK A;  2NCP A;  2GGM A;  2BKI B;  2HET A;  2M29 A;  3KPX A;  3LLE A;  2NXQ A;  3OHM B;  1IH0 A;  3OX5 A;  1OMD A;  2FOT A;  1QJT A;  2KAV A;  5CSI A;  1MXE A;  2P6B B;  1LA3 A;  4WQ2 A;  4GBA A;  3GK2 A;  4N1G A;  1YVL A;  1QIW A;  1M31 A;  1XVJ A;  2MHH A;  1V1G A;  1BLQ A;  4YGC B;  1XFU O;  4OCI A;  5ER5 A;  2K7O A;  3K21 A;  1KFU L;  2OS8 C;  1CFD A;  1B7T Z;  1KSM A;  1UP5 A;  1TNX A;  2BBM A;  3CLN A;  3PN7 C;  2JT0 A;  1CMG A;  2LC5 A;  3C1V A;  1NIW A;  4TNC A;  1NSH A;  2F3Z A;  3KF9 A;  4C0K A;  3PN7 B;  3TDZ A;  1JFJ A;  1KFX S;  1BOC A;  1K2H A;  1JC2 A;  3RLZ A;  1QX7 A;  2CCM A;  3DF0 A;  4UPG A;  1B8C A;  1YR5 A;  4NDB A;  4HRE E;  3NSK A;  2PRU A;  1TNQ A;  1DF0 B;  1S3P A;  1YUR A;  2MLE C;  4ETO A;  1K95 A;  1XA5 A;  2O5G A;  1LKJ A;  2CXJ A;  3PAL A;  2DOQ A;  1IRJ A;  3WHU B;  2KAX A;  5D7F A;  1WDC C;  1IJ5 A;  2KI6 D;  4JPZ B;  4YI8 A;  4P2Y B;  5BPJ A;  3JTD B;  2I94 A;  2AMI A;  4DCK A;  2LLU A;  1LVC D;  2HF5 A;  1B7T Y;  3VRO A;  1MQ1 A;  2Q91 A;  5DKR A;  5KU1 A;  1AJ4 A;  4YBH B;  2B1U A;  2KYF A;  1SBJ A;  2TN4 A;  2WOR A;  1D1O A;  1UUS A;  3IQQ A;  1CNP A;  2ZN9 A;  2BE4 A;  2JT3 A;  1S26 D;  2KGB C;  1L2O B;  3NSO A;  1DTL A;  4GGF A;  1NCX A;  5CSJ A;  2F8P A;  1YVH A;  1WRK A;  2JPT A;  1NX2 A;  1LXF C;  1ZAC A;  4PHK A;  1KWO B;  2KQ6 A;  2D8N A;  2M8U A;  1GQM A;  1JFK A;  2JWW A;  2L4H A;  3OB2 B;  2JNX A;  1A75 A;  4FQO A;  2HQW A;  5I2L A;  1QIV A;  1BR1 B;  1FW4 A;  3AAJ A;  3I5G B;  1BF5 A;  2AAO A;  2H2K A;  2MA2 A;  2F3Y A;  3EVU A;  1A4P A;  3OB1 B;  4PHJ A;  1DJY A;  1K9K A;  1YRU B;  4PE7 A;  4ZCV A;  5JJG A;  2K2A A;  4M2P A;  1B8R A;  1R2U A;  1SL9 A;  1UHJ A;  1B9A A;  1QV1 A;  2PMY A;  3HCM A;  4USL A;  4YGB B;  1SMG A;  3A4U B;  4YI9 A;  5PAL A;  4GUK A;  1YRT B;  1EJ3 A;  1DGV A;  1KK7 Y;  1HQV A;  2ZNE A;  4PDZ A;  3JVT C;  3BUM B;  1KCY A;  2KYC A;  1OSA A;  1F70 A;  2LVJ A;  2KAY A;  3CGA A;  2NCO A;  3CR2 A;  5K89 A;  1J7Q A;  1RK9 A;  4MVF A;  2QPT A;  1BMO A;  2LMT A;  3EVV A;  4AQI A;  1OE9 B;  1RWY A;  1FI6 A;  2LNK A;  1G8I A;  2JTT A;  2ZN8 A;  5HYD A;  3DD4 A;  1DT7 B;  1IJ6 A;  3PFV A;  1SCM C;  1JUO A;  1SYM A;  1WRL A;  4I5J A;  2Y1M A;  4FTG A;  1CDP A;  1WLZ A;  4Q04 A;  3LK0 A;  1SK6 D;  5G08 A;  3TUY C;  2BEC A;  3MSE B;  2WCF A;  2KHN A;  4XJK B;  2CTN A;  1N2D A;  1LIN A;  4MSP A;  2CBL A;  1M63 B;  3TZ1 A;  2OS8 B;  1TCO B;  2JTZ A;  1MR8 A;  1F71 A;  4QJ3 B;  1DJZ A;  2ZND A;  1X02 A;  1WLM A;  2PAS A;  1ALV A;  1S1E A;  1OQP A;  1YTZ C;  2EC6 C;  2M7N A;  1TCF A;  3E3R A;  3M0W A;  4M2O A;  2K7D A;  3EK8 A;  1EH2 A;  1CM1 A;  5AXI A;  1LA0 A;  2L51 A;  4OR9 B;  5AAN A;  3O78 A;  4XYN A;  1Y1X A;  2I18 A;  5ER4 X;  1G4Y R;  4PAL A;  1AK8 A;  2BL0 B;  1JWD A;  1YX7 A;  2M0R A;  3BUW B;  3NXA A;  1QX2 A;  2QAC A;  1J55 A;  1HT9 A;  1J7R A;  5DKN A;  1DMO A;  2KI6 C;  2JRF A;  1GGZ A;  1S6C A;  1QXP A;  2KFH A;  3EK4 A;  4JWQ A;  5HKZ A;  3DVJ A;  1EG4 A;  4A4C A;  4C0J A;  2E30 A;  1NWD A;  2ZRT A;  2AUC A;  1K94 A;  3I5F B;  5CSN A;  5HLO A;  1DGU A;  3SG7 A;  1OMR A;  1K93 D;  2KNE A;  1N65 A;  2LMV A;  2Y5I A;  4PCW A;  4CLN A;  4PHM A;  1H8B A;  1AUI B;  2M49 B;  3NSL A;  1NCZ A;  3CZT X;  1C7W A;  1KQM B;  1UWO A;  2ZKM X;  3VRQ A;  2KSP A;  1F4Q A;  5I2Q A;  2FCD A;  5CSF A;  1XK4 A;  3OP0 A;  5KSZ A;  4F0Z B;  1DJX A;  1L7Z A;  3I5I C;  2KBM A;  1W7I B;  5GQQ C;  2SCP A;  1XFX O;  4CID A;  1NX0 A;  1R6P A;  2LV7 A;  2WOS A;  1ZUZ A;  3FWB A;  3PSR A;  1A75 B;  2WCB A;  1XO5 A;  3DF0 B;  3EVR A;  1A03 A;  4A4B A;  2LUC A;  1C7V A;  1TIZ A;  2LAP A;  1W7J B;  4PE4 A;  1C07 A;  2K7C A;  3QRX A;  1KWO C;  4CFR A;  1BG1 A;  1QAS A;  3EKJ A;  3NSI A;  1QAT A;  3PM8 A;  4HRH A;  2PSR A;  1E8A A;  2A4J A;  2WCE A;  5JOL A;  3ZWH A;  1IGV A;  1J1E A;  4HRG A;  2MRD A;  2KQY A;  2K61 A;  1BT6 A;  1OOJ A;  1UHH A;  4L9M A;  1KSO A;  3SG5 A;  1S6I A;  4MLW A;  1CLM A;  5B8I B;  4DRW A;  1PSR A;  5D69 A;  2KFG A;  1XYD A;  4GGF C;  4MRX A;  1Q80 A;  4ICB A;  1BR4 B;  2LVV A;  2V53 A;  1NX3 A;  2NLN A;  2KI4 C;  3EK7 A;  4E68 A;  4CFQ A;  3F45 A;  2LLS A;  3SIA A;  1CDN A;  1ZFS A;  1CLL A;  4NQG A;  3JVT B;  4PE1 A;  2EC6 B;  2FJU B;  2I7A A;  4ORB B;  1TRF A;  2G2B A;  2L50 A;  1TNP A;  1A29 A;  1S5G Z;  1AHR A;  4GGN A;  2M1K B;  1YUS A;  3SG2 A;  1GGW A;  2L5X B;  1RJV A;  2BBN A;  4R1E A;  2KDH A;  1IG5 A;  2EGD A;  2L0P A;  1Y1U A;  3WXA A;  2Q4U A;  2F2O A;  4MZK A;  1PAL A;  2O60 A;  1DJG A;  1PVB A;  1MWN A;  1PUL A;  5AFP A;  1CDL A;  2M7L A;  1IKU A;  1MF8 B;  1Y0V H;  1M39 A;  1UHN A;  1J1D A;  4YRU A;  4YGE B;  2PVB A;  2JXL A;  3BOW A;  2LAN A;  4DIR A;  5DKQ A;  4N5X A;  3BQ3 A;  1AJ5 A;  1FF1 A;  5HKW A;  2GGZ A;  2OPO A;  1CFC A;  1SCV A;  3VRP A;  4OV2 A; 
#chains in the Genus database with same CATH topology
 1SPY A;  3CTN A;  1QVI Y;  2MBX A;  1N0Y A;  1KK7 Z;  3ICB A;  1NCY A;  1PRW A;  3BXK A;  3VRN A;  1CFP A;  4WRI A;  4OKH A;  1K8U A;  3TS5 B;  1KK8 C;  1WY9 A;  2FCE A;  2H61 C;  2KOT A;  2MJW B;  3LCP C;  3CR5 X;  2RGI A;  4U8D A;  2QEH A;  4MBE A;  5AEQ A;  3V2L A;  4DUQ A;  1OOI X;  2COL B;  1DF0 A;  1B1G A;  3KHE A;  2KFF A;  3BUX B;  5KTY A;  1RFJ A;  1WRZ A;  1AP4 A;  3WNX B;  3AKB A;  3Q8I A;  1BU3 A;  2JC2 A;  2Y1N A;  4JD9 A;  2M1U A;  1A2X A;  3H4S E;  1OOG A;  2KBI A;  1GM0 A;  1K9P A;  1T14 A;  1BOD A;  2KPH A;  1OZO A;  1TN4 A;  1JF2 A;  2CT9 A;  1PVA A;  3VGO A;  5DIC A;  2K0J A;  4HSZ A;  5TNC A;  1SSE B;  2ZRS A;  4XJK A;  1SL7 A;  1SCM B;  2F2P A;  5FI7 A;  4ORA B;  3BUN B;  2E6W A;  3HX4 A;  1KQM C;  1F54 A;  2JQ6 A;  2BCX A;  4NDC A;  3PJI A;  3R1O A;  4GPL B;  3RM1 A;  1B47 A;  1SR6 B;  1IWQ A;  2LMU A;  1B8L A;  1XFR A;  2L2C A;  2JNF A;  1RRO A;  3DVE A;  3A8R A;  1NUB A;  2JPO A;  1ZMZ A;  3BUO B;  4I5K A;  1OW4 A;  1SW8 A;  1Y6W A;  4NDD A;  1MUX A;  1NP8 A;  3FE8 A;  1PSB A;  1FBV A;  1DEL A;  3D77 A;  1DJI A;  4I5L B;  3OX6 A;  1KQV A;  3BFA A;  3GK1 A;  2L98 A;  2LVI A;  4ORC B;  1Y1A A;  3EKH A;  4QJ5 B;  1DJH A;  3NGV A;  4WQ3 A;  2CNP A;  1QV0 A;  2FJY A;  3I5I B;  4INX A;  1YUT A;  3DVK A;  3I5H B;  3S0F A;  1FPW A;  1AVS A;  4DS7 A;  4P5O E;  1QX5 B;  3BYA A;  4MZL A;  3SS3 A;  3BOW B;  3CR4 X;  2VRG A;  3I5F C;  3LL8 B;  2BKH B;  5AER A;  4MEW A;  1REC A;  1NYA A;  3CDN A;  2LE9 B;  2BAP A;  4D1E A;  2WCH A;  3SJS A;  1CFF A;  2PQL A;  3O4X A;  1UUR A;  3D0Y B;  2KGR A;  1J7P A;  1F55 A;  1EL4 A;  1DVI A;  3PLF B;  1XFV O;  1UHK A;  5FYX A;  2IS9 A;  3I5H C;  1CLB A;  1F8H A;  2LUX A;  1OOH A;  1QLK A;  2JUL A;  2WND A;  3FWC A;  1EG3 A;  1ODB A;  3GOF A;  1W9Z A;  3OGN A;  4BY5 A;  1C3Y A;  1Z4H A;  2JZI A;  3BFB A;  2GV5 A;  2QEO A;  2HPS A;  5IBW A;  3JTD C;  1UHI A;  2F33 A;  3KO0 A;  4MN0 A;  5F6T A;  1BJF A;  1OMV A;  2JXC A;  3DVM A;  4YGD B;  5I2O A;  5J3X A;  4AQJ A;  1S36 A;  2LHI A;  4CPV A;  1XFW O;  1GJY A;  2K8M B;  3TDU A;  1H4B A;  1SL8 A;  3B6X A;  1L2O C;  1MHO A;  1SNL A;  2BE6 A;  4PHN A;  2EHB A;  2LCP A;  4JKT A;  1QTX A;  1KFX L;  1Z2C B;  2M3W A;  1JBA A;  1DQE A;  1V1F A;  1EXR A;  3KEV A;  1PK0 D;  1WDC B;  2WC6 A;  2WCK A;  3LK1 A;  3CYZ A;  4PT1 A;  2OTG C;  2KLD A;  2MLF C;  3O6B A;  1K90 D;  2M97 A;  3ZNI A;  2M9G A;  4M2Q A;  1DJW A;  1ZOT B;  2LP2 A;  1G33 A;  1M46 A;  1SKT A;  2BCB A;  2JOJ A;  2R2I A;  1TTX A;  2BL0 C;  5I8N A;  1MXL C;  3WHT B;  2LP3 A;  1IQ3 A;  3O4Y A;  2L2E A;  3D10 A;  1KFU S;  3R1P A;  3CS1 A;  1CMF A;  1JF0 A;  2KI4 B;  2L4I A;  3IQO A;  5CPV A;  2SAS A;  3D75 A;  1CDM A;  4QJ4 B;  2LHL A;  1B4C A;  1CM4 A;  1IQ5 A;  3TUY B;  1TNW A;  3RZS A;  3L4A A;  1ALW A;  3DZT A;  4MRY A;  2LM5 A;  4N1F A;  2WC8 A;  3GK4 X;  3BJH A;  1QVI Z;  3TDI A;  1XK4 C;  2JU0 A;  1KK8 B;  5HKY A;  3AKA A;  3CWG A;  2OTG B;  4PE0 A;  3O2P A;  3PAT A;  5I94 A;  3VRR A;  1CTR A;  1SY9 A;  2ERB A;  1K96 A;  4I5N B;  3FS7 A;  3TS5 C;  1CKK A;  3R72 A;  4MZJ A;  1J7O A;  5HL1 A;  2P71 A;  2JT8 A;  3I5G C;  3B86 A;  4OVN F;  3SG4 A;  1YX8 A;  3SG3 A;  4C0L A;  1YUU A;  3FIA A;  2K2F A;  3IF7 A;  1XFZ O;  2K7B A;  3D0Y A;  1CB1 A;  1FI5 A;  4YGA A;  2LLT A;  5FI6 A;  2BCA A;  2ZFD A;  4ZCU A;  2NZ0 A;  4GNK B;  1SRA A;  1TOP A;  2G9B A;  4BY4 A;  3N7H A;  4IL1 A;  3SIB A;  3SG6 A;  1S5G Y;  1U5I B;  4GFT A;  1JSA A;  1K9U A;  2MAZ A;  2WCM A;  4AOM A;  2ISD A;  5HLV A;  1NPQ A;  1S6J A;  1NX1 A;  2HQ8 A;  2H61 A;  2Y4Q A;  1VRK A;  4GAO A;  2PAL A;  4JQ0 D;  1U5I A;  1F4O A;  1OZS A;  1SR6 C;  1QLS A;  1QS7 A;  1RTP 1;  2LVK A;  1M45 A;  1XFY O;  2I2R E;  3AAK A;  3NHT A;  2NCP A;  2GGM A;  2BKI B;  2HET A;  2M29 A;  3KPX A;  3LLE A;  2NXQ A;  3OHM B;  1IH0 A;  3OX5 A;  1OMD A;  2FOT A;  1QJT A;  2KAV A;  5CSI A;  1MXE A;  2P6B B;  1LA3 A;  4WQ2 A;  4GBA A;  3GK2 A;  4N1G A;  1YVL A;  1QIW A;  1M31 A;  1XVJ A;  2MHH A;  1V1G A;  1BLQ A;  4YGC B;  2KLE A;  1XFU O;  4OCI A;  5ER5 A;  4INW A;  2K7O A;  3K21 A;  1KFU L;  2OS8 C;  1CFD A;  1B7T Z;  1KSM A;  1UP5 A;  1TNX A;  2BBM A;  3CLN A;  3CZ0 A;  2JT0 A;  3PN7 C;  1CMG A;  2LC5 A;  3UNW A;  3C1V A;  1NIW A;  4TNC A;  1NSH A;  2F3Z A;  3KF9 A;  4C0K A;  3PN7 B;  5EL2 A;  3TDZ A;  1JFJ A;  1KFX S;  3QME A;  1BOC A;  1K2H A;  1JC2 A;  3RLZ A;  1QX7 A;  2CCM A;  3DF0 A;  4UPG A;  1B8C A;  1YR5 A;  4NDB A;  4HRE E;  3NSK A;  2PRU A;  1TNQ A;  1DF0 B;  1S3P A;  1YUR A;  2MLE C;  4ETO A;  1K95 A;  1XA5 A;  2GTE A;  1LKJ A;  2CXJ A;  2O5G A;  3S0B A;  3PAL A;  2DOQ A;  1IRJ A;  3WHU B;  1P28 A;  2KAX A;  3B88 A;  5D7F A;  1WDC C;  1IJ5 A;  2KI6 D;  4JPZ B;  4YI8 A;  4P2Y B;  5BPJ A;  3JTD B;  2I94 A;  2AMI A;  4DCK A;  2LLU A;  1LVC D;  2HF5 A;  1B7T Y;  3VRO A;  1MQ1 A;  2Q91 A;  5DKR A;  5KU1 A;  1AJ4 A;  4YBH B;  1OOF A;  2B1U A;  2KYF A;  1SBJ A;  2TN4 A;  2WOR A;  3S0D A;  1D1O A;  1UUS A;  3IQQ A;  1CNP A;  2ZN9 A;  2QDI A;  2BE4 A;  2JT3 A;  1S26 D;  2KGB C;  1L2O B;  3NSO A;  1DTL A;  4GGF A;  1NCX A;  5CSJ A;  2F8P A;  3D76 A;  1YVH A;  1WRK A;  2JPT A;  1NX2 A;  1LXF C;  2PYQ A;  4IJ7 A;  1ZAC A;  4PHK A;  1KWO B;  2KQ6 A;  2D8N A;  2M8U A;  1GQM A;  1JFK A;  2JWW A;  2L4H A;  3OB2 B;  2YGU A;  2JNX A;  3S0G A;  1A75 A;  3SS4 A;  4FQO A;  2HQW A;  5I2L A;  1QIV A;  1BR1 B;  1FW4 A;  3AAJ A;  3I5G B;  1BF5 A;  2AAO A;  2H2K A;  2MA2 A;  2F3Y A;  3EVU A;  1A4P A;  3OB1 B;  4PHJ A;  1DJY A;  1K9K A;  1YRU B;  4PE7 A;  4ZCV A;  5JJG A;  2K2A A;  3PM2 A;  4M2P A;  1B8R A;  1R2U A;  1SL9 A;  1UHJ A;  1B9A A;  1QV1 A;  2BNX A;  5FI2 A;  2PMY A;  3HCM A;  4USL A;  4YGB B;  1SMG A;  3A4U B;  4YI9 A;  3CZ2 A;  5PAL A;  4GUK A;  1EH2 A;  1YRT B;  1TUZ A;  2QEB A;  1EJ3 A;  1DGV A;  1KK7 Y;  3NHI A;  1HQV A;  2WC5 A;  2ZNE A;  3D78 A;  4PDZ A;  3JVT C;  1TUJ A;  3BUM B;  1KCY A;  2KYC A;  1OSA A;  1F70 A;  2LVJ A;  3CZ1 A;  2KAY A;  3CGA A;  2NCO A;  3CR2 A;  5K89 A;  1J7Q A;  1RK9 A;  4MVF A;  2QPT A;  1BMO A;  2LMT A;  3EVV A;  4AQI A;  1OE9 B;  1RWY A;  1FI6 A;  2LNK A;  1G8I A;  2JTT A;  2ZN8 A;  5HYD A;  2L5Y A;  3DD4 A;  2WCL A;  1DT7 B;  1IJ6 A;  3PFV A;  1SCM C;  1JUO A;  1SYM A;  1WRL A;  2H8V A;  4I5J A;  2Y1M A;  4FTG A;  1CDP A;  1WLZ A;  4Q04 A;  3LK0 A;  1SK6 D;  5G08 A;  3TUY C;  2BEC A;  3MSE B;  2QEV A;  2WCF A;  2KHN A;  4XJK B;  2CTN A;  1N2D A;  1LIN A;  4MSP A;  2CBL A;  3DYE A;  3CAB A;  3EG5 B;  1M63 B;  3TZ1 A;  2OS8 B;  1TCO B;  2JTZ A;  1MR8 A;  1F71 A;  3OBV A;  4QJ3 B;  1DJZ A;  2ZND A;  1X02 A;  1WLM A;  2PAS A;  1ALV A;  1S1E A;  1OQP A;  1YTZ C;  2EC6 C;  2M7N A;  1TCF A;  1QWV A;  3E3R A;  3M0W A;  2K7D A;  1LS8 A;  3EK8 A;  4M2O A;  3L4L A;  1CM1 A;  3R1V A;  1LA0 A;  2L51 A;  4OR9 B;  5AXI A;  5AAN A;  3O78 A;  4XYN A;  3FE6 A;  1Y1X A;  2I18 A;  5ER4 X;  1G4Y R;  4PAL A;  1AK8 A;  1DC1 A;  2BL0 B;  1JWD A;  1YX7 A;  2M0R A;  3BUW B;  3NXA A;  1QX2 A;  3VB1 A;  2QAC A;  1J55 A;  1HT9 A;  1J7R A;  5DKN A;  1DMO A;  2KI6 C;  2JRF A;  1GGZ A;  1S6C A;  1QXP A;  2KFH A;  3EK4 A;  1DEK A;  4JWQ A;  3DVJ A;  1EG4 A;  5HKZ A;  4A4C A;  4C0J A;  1C3Z A;  2E30 A;  1NWD A;  2ZRT A;  2AUC A;  1K94 A;  3I5F B;  5CSN A;  5HLO A;  4KYN A;  1DGU A;  3SG7 A;  1OMR A;  1K93 D;  2KNE A;  1N65 A;  2LMV A;  2Y5I A;  4PCW A;  4CLN A;  4PHM A;  1H8B A;  1AUI B;  2M49 B;  3NSL A;  1NCZ A;  3CZT X;  1C7W A;  1KQM B;  1UWO A;  2ZKM X;  3VRQ A;  2KSP A;  1F4Q A;  5I2Q A;  2FCD A;  5CSF A;  1XK4 A;  3OP0 A;  5KSZ A;  4F0Z B;  1DJX A;  1L7Z A;  3I5I C;  2KBM A;  1W7I B;  5GQQ C;  2SCP A;  1XFX O;  4CID A;  1NX0 A;  1R6P A;  2LV7 A;  2WOS A;  1ZUZ A;  3FWB A;  3PSR A;  1A75 B;  2WCB A;  1XO5 A;  3DF0 B;  3EVR A;  1A03 A;  5D3O A;  4A4B A;  3D73 A;  2LUC A;  1C7V A;  1TIZ A;  2LAP A;  3D74 A;  1W7J B;  4PE4 A;  1C07 A;  2K7C A;  3QRX A;  1KWO C;  4CFR A;  1BG1 A;  1QAS A;  3EKJ A;  3NSI A;  1QAT A;  3PM8 A;  4HRH A;  2PSR A;  1E8A A;  2A4J A;  2WCE A;  3IVT A;  3K1E A;  4F7F A;  5JOL A;  3ZWH A;  1IGV A;  1J1E A;  4HRG A;  2MRD A;  2KQY A;  2K61 A;  4OZD A;  1BT6 A;  1OOJ A;  1UHH A;  4L9M A;  1KSO A;  3SG5 A;  1S6I A;  3SS5 A;  4MLW A;  1CLM A;  3L47 A;  5B8I B;  4DRW A;  1PSR A;  5D69 A;  2KFG A;  3B87 A;  1XYD A;  4GGF C;  4MRX A;  1Q80 A;  3B7A A;  4ICB A;  1BR4 B;  2LVV A;  2V53 A;  1NX3 A;  2NLN A;  2KI4 C;  3EK7 A;  4E68 A;  4CFQ A;  3F45 A;  2LLS A;  3SIA A;  2K60 A;  1CDN A;  1ZFS A;  3DY9 A;  1CLL A;  4NQG A;  3JVT B;  4PE1 A;  2EC6 B;  2FJU B;  2I7A A;  4ORB B;  1TRF A;  1ORG A;  2G2B A;  2L50 A;  4FQT A;  1TNP A;  1A29 A;  1S5G Z;  1AHR A;  4GGN A;  2M1K B;  1YUS A;  3S0E A;  3SG2 A;  1GGW A;  3DXL A;  2L5X B;  1RJV A;  3FE9 A;  2BBN A;  4R1E A;  2KDH A;  1IG5 A;  2EGD A;  2L0P A;  1Y1U A;  3WXA A;  2Q4U A;  2F2O A;  4MZK A;  1IIO A;  1PAL A;  2O60 A;  1DJG A;  1PVB A;  1MWN A;  1PUL A;  3S0A A;  5AFP A;  1CDL A;  3UO9 A;  2M7L A;  1IKU A;  1MF8 B;  1Y0V H;  1M39 A;  1UHN A;  3BFH A;  1J1D A;  4YRU A;  4YGE B;  2PVB A;  2JXL A;  3BOW A;  1TWO A;  2LAN A;  2WCJ A;  4DIR A;  5DKQ A;  4N5X A;  3BQ3 A;  1AJ5 A;  1FF1 A;  5HKW A;  2GGZ A;  2OPO A;  1CFC A;  1SCV A;  3VRP A;  4OV2 A;  2P70 A; 
#chains in the Genus database with same CATH homology
 1SPY A;  3CTN A;  1QVI Y;  2MBX A;  1N0Y A;  1KK7 Z;  3ICB A;  1NCY A;  1PRW A;  3BXK A;  3VRN A;  1CFP A;  4WRI A;  4OKH A;  1K8U A;  3TS5 B;  1KK8 C;  1WY9 A;  2FCE A;  2H61 C;  2KOT A;  2MJW B;  3LCP C;  3CR5 X;  2RGI A;  4U8D A;  4MBE A;  5AEQ A;  4DUQ A;  2COL B;  1DF0 A;  1B1G A;  3KHE A;  2KFF A;  3BUX B;  5KTY A;  1RFJ A;  1WRZ A;  1AP4 A;  3WNX B;  3AKB A;  1BU3 A;  2JC2 A;  2Y1N A;  2M1U A;  1A2X A;  3H4S E;  2KBI A;  1K9P A;  1BOD A;  1OZO A;  1TN4 A;  1JF2 A;  2CT9 A;  1PVA A;  3VGO A;  2K0J A;  4HSZ A;  5TNC A;  2ZRS A;  4XJK A;  1SL7 A;  1SCM B;  2F2P A;  4ORA B;  3BUN B;  2E6W A;  3HX4 A;  1KQM C;  1F54 A;  2JQ6 A;  2BCX A;  4NDC A;  3RM1 A;  4GPL B;  1B47 A;  1SR6 B;  1IWQ A;  2LMU A;  1B8L A;  2JNF A;  1RRO A;  3DVE A;  3A8R A;  1NUB A;  3BUO B;  1ZMZ A;  4I5K A;  1J7O A;  1SW8 A;  1Y6W A;  4NDD A;  1MUX A;  1NP8 A;  1PSB A;  1FBV A;  1DJI A;  4I5L B;  3OX6 A;  1KQV A;  3GK1 A;  2L98 A;  2LVI A;  4ORC B;  1Y1A A;  3EKH A;  4QJ5 B;  1DJH A;  4WQ3 A;  2CNP A;  1QV0 A;  3I5I B;  1YUT A;  3DVK A;  3I5H B;  1FPW A;  1AVS A;  4DS7 A;  4P5O E;  1QX5 B;  3BYA A;  4MZL A;  3BOW B;  3CR4 X;  2VRG A;  3I5F C;  3LL8 B;  2BKH B;  5AER A;  4MEW A;  1REC A;  1NYA A;  2LE9 B;  4D1E A;  3SJS A;  1CFF A;  1J7P A;  1UUR A;  3D0Y B;  2KGR A;  1F55 A;  1EL4 A;  1DVI A;  3PLF B;  1XFV O;  1UHK A;  5FYX A;  2IS9 A;  3I5H C;  1CLB A;  1F8H A;  2LUX A;  2JUL A;  1QLK A;  3GOF A;  2WND A;  3FWC A;  1EG3 A;  1ODB A;  4BY5 A;  2JZI A;  2GV5 A;  5IBW A;  2HPS A;  3JTD C;  1UHI A;  2F33 A;  3KO0 A;  4MN0 A;  5F6T A;  1BJF A;  1OMV A;  2JXC A;  3DVM A;  4YGD B;  5I2O A;  5J3X A;  4AQJ A;  1S36 A;  2LHI A;  4CPV A;  1XFW O;  1GJY A;  2K8M B;  3TDU A;  1H4B A;  1SL8 A;  1L2O C;  1MHO A;  1SNL A;  2BE6 A;  4PHN A;  2EHB A;  2LCP A;  1QTX A;  1KFX L;  2M3W A;  1JBA A;  3KEV A;  1V1F A;  1EXR A;  3LK1 A;  1PK0 D;  1WDC B;  2OTG C;  2MLF C;  3O6B A;  1K90 D;  2M97 A;  3ZNI A;  2M9G A;  4M2Q A;  1DJW A;  1ZOT B;  2LP2 A;  1G33 A;  1M46 A;  1SKT A;  2BCB A;  2JOJ A;  2R2I A;  1TTX A;  2BL0 C;  5I8N A;  1MXL C;  3WHT B;  2LP3 A;  1IQ3 A;  3O4Y A;  2L2E A;  3D10 A;  1KFU S;  1CMF A;  3CS1 A;  1JF0 A;  2KI4 B;  2L4I A;  3IQO A;  5CPV A;  2SAS A;  1B4C A;  1CDM A;  4QJ4 B;  2LHL A;  1CM4 A;  1IQ5 A;  3TUY B;  1TNW A;  1ALW A;  4MRY A;  2LM5 A;  4N1F A;  2WC8 A;  3GK4 X;  1QVI Z;  3TDI A;  1XK4 C;  2JU0 A;  1KK8 B;  5HKY A;  3AKA A;  3CWG A;  2OTG B;  4PE0 A;  3O2P A;  3PAT A;  3VRR A;  1CTR A;  1SY9 A;  4I5N B;  1K96 A;  3TS5 C;  3FS7 A;  1CKK A;  4MZJ A;  3I5G C;  2JT8 A;  4OVN F;  3SG4 A;  1YX8 A;  3SG3 A;  4C0L A;  1YUU A;  3FIA A;  2K2F A;  3IF7 A;  1XFZ O;  2K7B A;  3D0Y A;  1CB1 A;  1FI5 A;  4YGA A;  2LLT A;  4ZCU A;  2BCA A;  2ZFD A;  2NZ0 A;  4GNK B;  1SRA A;  1TOP A;  2G9B A;  4BY4 A;  4IL1 A;  3SIB A;  3SG6 A;  1S5G Y;  1U5I B;  4GFT A;  1JSA A;  1K9U A;  2MAZ A;  4AOM A;  2ISD A;  5HLV A;  1NPQ A;  1S6J A;  1NX1 A;  2HQ8 A;  2H61 A;  2Y4Q A;  1VRK A;  4GAO A;  2PAL A;  4JQ0 D;  1U5I A;  1F4O A;  1OZS A;  1SR6 C;  1QLS A;  1QS7 A;  1RTP 1;  2LVK A;  1M45 A;  1XFY O;  2I2R E;  3AAK A;  2NCP A;  2GGM A;  2BKI B;  2HET A;  2M29 A;  3KPX A;  3LLE A;  2NXQ A;  3OHM B;  1IH0 A;  3OX5 A;  1OMD A;  2FOT A;  1QJT A;  2KAV A;  5CSI A;  1MXE A;  2P6B B;  1LA3 A;  4WQ2 A;  4GBA A;  3GK2 A;  4N1G A;  1YVL A;  1QIW A;  1M31 A;  1XVJ A;  2MHH A;  1V1G A;  1BLQ A;  4YGC B;  1XFU O;  4OCI A;  5ER5 A;  2K7O A;  3K21 A;  1KFU L;  2OS8 C;  1CFD A;  1B7T Z;  1KSM A;  1UP5 A;  1TNX A;  2BBM A;  3CLN A;  3PN7 C;  2JT0 A;  1CMG A;  2LC5 A;  3C1V A;  1NIW A;  4TNC A;  1NSH A;  2F3Z A;  3KF9 A;  4C0K A;  3PN7 B;  3TDZ A;  1JFJ A;  1KFX S;  1BOC A;  1K2H A;  1JC2 A;  3RLZ A;  1QX7 A;  2CCM A;  3DF0 A;  4UPG A;  1B8C A;  1YR5 A;  4NDB A;  4HRE E;  3NSK A;  2PRU A;  1TNQ A;  1DF0 B;  1S3P A;  1YUR A;  2MLE C;  4ETO A;  1K95 A;  1XA5 A;  2O5G A;  1LKJ A;  2CXJ A;  3PAL A;  2DOQ A;  1IRJ A;  3WHU B;  2KAX A;  5D7F A;  1WDC C;  1IJ5 A;  2KI6 D;  4JPZ B;  4YI8 A;  4P2Y B;  5BPJ A;  3JTD B;  2I94 A;  2AMI A;  4DCK A;  2LLU A;  1LVC D;  2HF5 A;  1B7T Y;  3VRO A;  1MQ1 A;  2Q91 A;  5DKR A;  5KU1 A;  1AJ4 A;  4YBH B;  2B1U A;  2KYF A;  1SBJ A;  2TN4 A;  2WOR A;  1D1O A;  1UUS A;  3IQQ A;  1CNP A;  2ZN9 A;  2BE4 A;  2JT3 A;  1S26 D;  2KGB C;  1L2O B;  3NSO A;  1DTL A;  4GGF A;  1NCX A;  5CSJ A;  2F8P A;  1YVH A;  1WRK A;  2JPT A;  1NX2 A;  1LXF C;  1ZAC A;  4PHK A;  1KWO B;  2KQ6 A;  2D8N A;  2M8U A;  1GQM A;  1JFK A;  2JWW A;  2L4H A;  3OB2 B;  2JNX A;  1A75 A;  4FQO A;  2HQW A;  5I2L A;  1QIV A;  1BR1 B;  1FW4 A;  3AAJ A;  3I5G B;  1BF5 A;  2AAO A;  2H2K A;  2MA2 A;  2F3Y A;  3EVU A;  1A4P A;  3OB1 B;  4PHJ A;  1DJY A;  1K9K A;  1YRU B;  4PE7 A;  4ZCV A;  5JJG A;  2K2A A;  4M2P A;  1B8R A;  1R2U A;  1SL9 A;  1UHJ A;  1B9A A;  1QV1 A;  2PMY A;  3HCM A;  4USL A;  4YGB B;  1SMG A;  3A4U B;  4YI9 A;  5PAL A;  4GUK A;  1YRT B;  1EJ3 A;  1DGV A;  1KK7 Y;  1HQV A;  2ZNE A;  4PDZ A;  3JVT C;  3BUM B;  1KCY A;  2KYC A;  1OSA A;  1F70 A;  2LVJ A;  2KAY A;  3CGA A;  2NCO A;  3CR2 A;  5K89 A;  1J7Q A;  1RK9 A;  4MVF A;  2QPT A;  1BMO A;  2LMT A;  3EVV A;  4AQI A;  1OE9 B;  1RWY A;  1FI6 A;  2LNK A;  1G8I A;  2JTT A;  2ZN8 A;  5HYD A;  3DD4 A;  1DT7 B;  1IJ6 A;  3PFV A;  1SCM C;  1JUO A;  1SYM A;  1WRL A;  4I5J A;  2Y1M A;  4FTG A;  1CDP A;  1WLZ A;  4Q04 A;  3LK0 A;  1SK6 D;  5G08 A;  3TUY C;  2BEC A;  3MSE B;  2WCF A;  2KHN A;  4XJK B;  2CTN A;  1N2D A;  1LIN A;  4MSP A;  2CBL A;  1M63 B;  3TZ1 A;  2OS8 B;  1TCO B;  2JTZ A;  1MR8 A;  1F71 A;  4QJ3 B;  1DJZ A;  2ZND A;  1X02 A;  1WLM A;  2PAS A;  1ALV A;  1S1E A;  1OQP A;  1YTZ C;  2EC6 C;  2M7N A;  1TCF A;  3E3R A;  3M0W A;  4M2O A;  2K7D A;  3EK8 A;  1EH2 A;  1CM1 A;  5AXI A;  1LA0 A;  2L51 A;  4OR9 B;  5AAN A;  3O78 A;  4XYN A;  1Y1X A;  2I18 A;  5ER4 X;  1G4Y R;  4PAL A;  1AK8 A;  2BL0 B;  1JWD A;  1YX7 A;  2M0R A;  3BUW B;  3NXA A;  1QX2 A;  2QAC A;  1J55 A;  1HT9 A;  1J7R A;  5DKN A;  1DMO A;  2KI6 C;  2JRF A;  1GGZ A;  1S6C A;  1QXP A;  2KFH A;  3EK4 A;  4JWQ A;  5HKZ A;  3DVJ A;  1EG4 A;  4A4C A;  4C0J A;  2E30 A;  1NWD A;  2ZRT A;  2AUC A;  1K94 A;  3I5F B;  5CSN A;  5HLO A;  1DGU A;  3SG7 A;  1OMR A;  1K93 D;  2KNE A;  1N65 A;  2LMV A;  2Y5I A;  4PCW A;  4CLN A;  4PHM A;  1H8B A;  1AUI B;  2M49 B;  3NSL A;  1NCZ A;  3CZT X;  1C7W A;  1KQM B;  1UWO A;  2ZKM X;  3VRQ A;  2KSP A;  1F4Q A;  5I2Q A;  2FCD A;  5CSF A;  1XK4 A;  3OP0 A;  5KSZ A;  4F0Z B;  1DJX A;  1L7Z A;  3I5I C;  2KBM A;  1W7I B;  5GQQ C;  2SCP A;  1XFX O;  4CID A;  1NX0 A;  1R6P A;  2LV7 A;  2WOS A;  1ZUZ A;  3FWB A;  3PSR A;  1A75 B;  2WCB A;  1XO5 A;  3DF0 B;  3EVR A;  1A03 A;  4A4B A;  2LUC A;  1C7V A;  1TIZ A;  2LAP A;  1W7J B;  4PE4 A;  1C07 A;  2K7C A;  3QRX A;  1KWO C;  4CFR A;  1BG1 A;  1QAS A;  3EKJ A;  3NSI A;  1QAT A;  3PM8 A;  4HRH A;  2PSR A;  1E8A A;  2A4J A;  2WCE A;  5JOL A;  3ZWH A;  1IGV A;  1J1E A;  4HRG A;  2MRD A;  2KQY A;  2K61 A;  1BT6 A;  1OOJ A;  1UHH A;  4L9M A;  1KSO A;  3SG5 A;  1S6I A;  4MLW A;  1CLM A;  5B8I B;  4DRW A;  1PSR A;  5D69 A;  2KFG A;  1XYD A;  4GGF C;  4MRX A;  1Q80 A;  4ICB A;  1BR4 B;  2LVV A;  2V53 A;  1NX3 A;  2NLN A;  2KI4 C;  3EK7 A;  4E68 A;  4CFQ A;  3F45 A;  2LLS A;  3SIA A;  1CDN A;  1ZFS A;  1CLL A;  4NQG A;  3JVT B;  4PE1 A;  2EC6 B;  2FJU B;  2I7A A;  4ORB B;  1TRF A;  2G2B A;  2L50 A;  1TNP A;  1A29 A;  1S5G Z;  1AHR A;  4GGN A;  2M1K B;  1YUS A;  3SG2 A;  1GGW A;  2L5X B;  1RJV A;  2BBN A;  4R1E A;  2KDH A;  1IG5 A;  2EGD A;  2L0P A;  1Y1U A;  3WXA A;  2Q4U A;  2F2O A;  4MZK A;  1PAL A;  2O60 A;  1DJG A;  1PVB A;  1MWN A;  1PUL A;  5AFP A;  1CDL A;  2M7L A;  1IKU A;  1MF8 B;  1Y0V H;  1M39 A;  1UHN A;  1J1D A;  4YRU A;  4YGE B;  2PVB A;  2JXL A;  3BOW A;  2LAN A;  4DIR A;  5DKQ A;  4N5X A;  3BQ3 A;  1AJ5 A;  1FF1 A;  5HKW A;  2GGZ A;  2OPO A;  1CFC A;  1SCV A;  3VRP A;  4OV2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...