2NCOA

Nmr solution structure for the c-terminal domain of tetrahymena tcb2 in the absence of calcium
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
102
structure length
102
Chain Sequence
SSKPKYNPEVEAKLDVARRLFKRYDKDGSGQLQDDEIAGLLKDTYAEMGMSNFTPTKEDVKIWLQMADTNSDGSVSLEEYEDLIIKSLQKAGIRVEKQSLVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords 25 kDa calcium-binding protein
publication title Solution NMR structures of the C-domain of Tetrahymena cytoskeletal protein Tcb2 reveal distinct calcium-induced structural rearrangements.
pubmed doi rcsb
source organism Tetrahymena thermophila
total genus 20
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2016-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2ncoA00
3TDZA 1TNXA 4MSPA 1XFUO 3JTDB 1ZMZA 1K95A 2ZNEA 3RM1A 4GNKB 5PALA 1GJYA 4MLWA 4DS7A 3GK2A 4GGNA 1RFJA 1TNPA 4U8DA 3GK1A 4BY4A 4YGEB 1DGUA 1JUOA 2LVVA 5FYXA 3TUYB 4MZJA 2K0JA 1KWOB 1NWDA 1QX5B 2BBNA 5JJGA 1KFUS 5DKQA 4GPLB 2SASA 1BU3A 2FOTA 2B1UA 2JXCA 5DKNA 1BOCA 1SR6B 4DCKA 4PE7A 4GGFC 4PDZA 3I5FB 1S26D 2CXJA 5HYDA 2CCMA 3BUWB 3M0WA 1JSAA 1Y0VH 3I5IC 1RROA 2FCDA 2ZN9A 2LLSA 3SG6A 3AAJA 2L51A 4I5JA 1C7VA 1FW4A 1ZACA 4OVNF 3PALA 1CKKA 1CMGA 1J7QA 2LM5A 1AUIB 4MZLA 4PE4A 3OB2B 2KYFA 1SCMC 1HT9A 1SL8A 3DVEA 2PALA 1IWQA 2KOTA 4FQOA 1NX1A 1KSMA 3OX6A 1SMGA 2AAOA 1WRLA 3CGAA 1DGVA 5G08A 3SG2A 5K89A 2IS9A 1K9KA 4AQIA 1SY9A 1F55A 4GBAA 1OMRA 1S3PA 5CSFA 2K7DA 2E6WA 4WQ2A 1MUXA 1U5IB 2L5XB 2FCEA 2ZFDA 2ZKMX 1UWOA 1YUSA 1TCOB 1F4QA 4HREE 1K90D 2CNPA 3EK8A 4MEWA 4NDCA 2MLEC 3LLEA 3OP0A 1KQMC 2QACA 1OOJA 1EJ3A 1CLBA 1YRTB 4ZCVA 1QX2A 4OKHA 3D0YA 1WDCB 3KPXA 3BXKA 3TZ1A 1RJVA 1BF5A 5KTYA 2LMVA 1IQ3A 1QATA 1KK8B 3ZWHA 1SW8A 1Y1AA 1BR1B 3EK7A 3QRXA 2O60A 4QJ5B 1AHRA 1A29A 4HSZA 1SRAA 1YVHA 2V53A 2M29A 4I5KA 4P5OE 1B7TY 2PVBA 3SG3A 1QASA 5IBWA 2F2OA 3O78A 1LA3A 1LVCD 1UHIA 1DT7B 4XJKB 3DD4A 1UUSA 3PATA 1J55A 1QXPA 1B9AA 4I5NB 1B1GA 1QVIY 1CTRA 2WCEA 3CS1A 3I5GC 1QIVA 1QX7A 1YX8A 2M1UA 2L50A 1DF0B 1PSRA 1G8IA 2ZRTA 2NCPA 1G4YR 1OE9B 5ER4X 3WNXB 1G33A 2ZNDA 1EG3A 3LK1A 1YTZC 1OMVA 2PMYA 1NIWA 3NSOA 3NXAA 2LE9B 2Y1MA 1XK4C 1W7JB 1FF1A 1DTLA 1NX3A 2KGBC 1D1OA 1OSAA 3JTDC 4NDBA 2GGZA 3KO0A 2KDHA 4MZKA 4ORAB 3SG5A 2M8UA 3JVTB 3IF7A 4PHNA 3VRQA 5GQQC 1CFPA 3O2PA 1CFDA 3TUYC 3DF0A 1JWDA 1KWOC 3OB1B 3SIAA 1AVSA 3EK4A 1QJTA 1QV0A 2NCOA 1FI5A 2LUXA 2L98A 1SKTA 1A75A 1S5GZ 4MVFA 1SR6C 2M49B 1WRKA 2H61C 3CR5X 1FI6A 1B7TZ 1TCFA 2BKIB 3I5FC 1XVJA 2WORA 1AJ4A 4L9MA 2K7BA 2K8MB 1X02A 2F3YA 3FWCA 1KFUL 2JZIA 5KU1A 1S1EA 3F45A 2WC8A 2Y1NA 1V1FA 2K2AA 3EVVA 1UHHA 1QIWA 1QVIZ 3O6BA 2F33A 5AEQA 3I5HB 2QPTA 2PASA 2K61A 2LAPA 4PHJA 1TN4A 5HKZA 2SCPA 2Y4QA 1AJ5A 2M97A 1B8CA 1NCXA 1EG4A 5HKWA 3TS5B 3CR2A 1RTP1 1K96A 3PN7B 5AANA 2OS8C 2DOQA 1C07A 1XYDA 3BUMB 2JNFA 3BYAA 4PE1A 2KI4B 4OCIA 1IGVA 1J7RA 5ER5A 3CWGA 1B47A 1S6IA 3PSRA 2OPOA 4GFTA 1CFFA 4D1EA 1A4PA 2I94A 1M45A 1PRWA 2JOJA 2LHIA 3BQ3A 2LP3A 1A03A 1DJGA 1R2UA 2KQ6A 4YI9A 3O4YA 4FTGA 3CR4X 4A4CA 3LCPC 4I5LB 1SK6D 1KK7Z 1OMDA 2E30A 3AKBA 4CIDA 1LA0A 3EVRA 2ZRSA 2P6BB 4GGFA 1Y6WA 3CZTX 1K94A 2M7LA 1F71A 3HX4A 1WDCC 2A4JA 3AKAA 4YRUA 2JTTA 1JFJA 4MRYA 5CPVA 3SJSA 3EKHA 2M0RA 4MRXA 3ZNIA 2KI6D 1KK8C 1MWNA 1TTXA 2AMIA 1Y1XA 2VRGA 2MBXA 2KNEA 2COLB 1XFVO 1FBVA 4CPVA 1IJ5A 1BMOA 2L4IA 2KGRA 3A4UB 1J7OA 4AQJA 1BT6A 1SL9A 2HQ8A 2GGMA 1NCYA 2BCXA 3TDUA 1SCVA 1JBAA 1DVIA 1PVAA 3D10A 3I5IB 4YBHB 1LXFC 4QJ3B 3WXAA 2BCAA 4C0LA 2KAXA 2GV5A 1K8UA 1S5GY 3GK4X 4N1FA 1NUBA 1M63B 1YUTA 2H2KA 3TDIA 5AFPA 3FS7A 2EHBA 3K21A 1PSBA 4ETOA 3CLNA 2LLTA 4YGDB 1MQ1A 2BL0B 1B8LA 2ISDA 1L2OB 1SYMA 2LVJA 1N2DA 3D0YB 1Q80A 1CDLA 1BG1A 1PALA 4N5XA 2KHNA 1DJWA 1YVLA 4F0ZB 2LHLA 2Q4UA 1TIZA 4Q04A 1PVBA 1DMOA 3KF9A 1XFYO 1UHNA 1CB1A 3JVTC 3NSLA 1OQPA 1WLZA 1YURA 1A2XA 1TOPA 4ORCB 1K9UA 4QJ4B 4P2YB 1WRZA 1KFXS 1QLSA 1MXEA 2NZ0A 1CFCA 1HQVA 2WCBA 2F2PA 2JC2A 2TN4A 1UURA 1EXRA 2CBLA 3A8RA 5B8IB 5I2LA 3IQQA 2MA2A 5CSIA 2OTGB 3BUNB 1F54A 1BODA 4MN0A 2KSPA 1C7WA 4DUQA 2G2BA 1KK7Y 3C1VA 5I8NA 2M1KB 2EC6B 1UHJA 3AAKA 1EL4A 1VRKA 1MHOA 1QTXA 3I5HC 2JNXA 2EGDA 2LCPA 1IQ5A 1OZOA 3TS5C 3PN7C 4ICBA 3BOWA 1KCYA 2LNKA 1SBJA 2LC5A 2Y5IA 4PE0A 3EKJA 1CM1A 2HPSA 2L4HA 2D8NA 2KI4C 1MR8A 1H8BA 1SNLA 3ICBA 3PFVA 1IKUA 4DRWA 3DF0B 5CSJA 3DVJA 4USLA 3OHMB 4N1GA 2LANA 5D7FA 1ODBA 1UP5A 1JFKA 1WLMA 1RWYA 2WOSA 4WQ3A 1A75B 2FJUB 1GGWA 1K2HA 1IH0A 2F8PA 2RGIA 2HETA 3VRNA 2M9GA 1XFWO 2JPTA 3FIAA 1DJZA 1M46A 1NYAA 1RECA 2BKHB 4DIRA 1F8HA 3RLZA 4M2PA 2KFGA 3FWBA 2BECA 2WNDA 2JRFA 1E8AA 2JT3A 2BBMA 3BUOB 1F4OA 2LMTA 2MRDA 2PSRA 2K7OA 2K7CA 2LUCA 5J3XA 2O5GA 1S36A 4A4BA 2LMUA 1ZUZA 1GQMA 1BJFA 1NSHA 1DJYA 4NQGA 3SIBA 4CFRA 1ZFSA 4GAOA 4NDDA 1U5IA 4JQ0D 2KAVA 5D69A 1MXLC 1TNQA 2HQWA 2NLNA 4PCWA 1FPWA 1UHKA 1IRJA 3LK0A 4HRHA 5HKYA 1BR4B 1L7ZA 1QS7A 2KI6C 2MJWB 3KHEA 2ZN8A 1B4CA 2MAZA 1DJIA 4HRGA 1OZSA 2MHHA 5I2OA 4PHKA 1LKJA 4ZCUA 5F6TA 2LP2A 1BLQA 4CFQA 2LVIA 1WY9A 5DKRA 2I7AA 1AK8A 2OS8B 2BL0C 2M3WA 3GOFA 5CSNA 5BPJA 1L2OC 1SL7A 1QV1A 1MF8B 1LINA 1S6CA 3VRRA 1DJHA 2F3ZA 2I18A 3WHUB 1Y1UA 5AXIA 2PRUA 1IJ6A 1XO5A 1NP8A 2M7NA 1PK0D 2NXQA 3IQOA 1ALVA 3VRPA 4YGAA 1SCMB 2LV7A 4YGCB 1CDPA 5TNCA 1S6JA 1J7PA 1K9PA 1KSOA 1K93D 4JPZB 1NPQA 1F70A 1CMFA 4XJKA 1V1GA 3EVUA 5I2QA 1H4BA 2KFFA 1GGZA 2BE4A 5JOLA 1IG5A 1TRFA 1SPYA 1CLLA 4YI8A 4M2QA 3SG7A 3SG4A 2JQ6A 2OTGC 2WCFA 4GUKA 1QLKA 3OX5A 1ZOTB 4JWQA 1J1DA 4PALA 4WRIA 5AERA 4E68A 1RK9A 1CLMA 1NCZA 1KFXL 3BUXB 1CM4A 4C0JA 1DF0A 3HCMA 2EC6C 3H4SE 3MSEB 2L0PA 1NX0A 1JC2A 1KQMB 4ORBB 1YX7A 2HF5A 3DVKA 4M2OA 1EH2A 3PLFB 2I2RE 1YR5A 3PM8A 1DJXA 5HLOA 1XFXO 2KBIA 4R1EA 2CTNA 4OV2A 4UPGA 5KSZA 2AUCA 1CDMA 2R2IA 4CLNA 4BY5A 2K2FA 4TNCA 4C0KA 3KEVA 2JULA 2JXLA 1M31A 1N0YA 3NSIA 5HLVA 2KAYA 2KFHA 1YRUB 1XFZO 2BE6A 4OR9B 1JF2A 2JWWA 3WHTB 1TNWA 3LL8B 1N65A 1W7IB 3CTNA 1M39A 1YUUA 3VROA 4IL1A 1R6PA 2JT0A 2JU0A 1XK4A 4AOMA 1KQVA 2L2EA 2G9BA 2JT8A 2LLUA 2LVKA 4MBEA 4XYNA 3I5GB 1CNPA 1B8RA 1JF0A 1AP4A 1XA5A 2MLFC 2CT9A 2KQYA 2KYCA 3DVMA 1J1EA 3E3RA 2Q91A 1ALWA 2JTZA 1PULA 4PHMA 2KBMA 3VGOA 2BCBA 3NSKA 2H61A 4YGBB 3BOWB 1NX2A 1CDNA
chains in the Genus database with same CATH superfamily
3TDZA 1TNXA 4MSPA 1XFUO 3D73A 1ZMZA 1K95A 2ZNEA 3JTDB 4GNKB 5PALA 1GJYA 3N7HA 4MLWA 3GK2A 4DS7A 4GGNA 1RFJA 1TNPA 4U8DA 3GK1A 4BY4A 4YGEB 1DGUA 1JUOA 2LVVA 5FYXA 3FE9A 3UO9A 3R1PA 2QDIA 3S0BA 4MZJA 2K0JA 1KWOB 1NWDA 3TUYB 1QX5B 2BBNA 5JJGA 1KFUS 5DKQA 4GPLB 2SASA 1BU3A 2FOTA 2B1UA 2JXCA 5DKNA 1BOCA 1SR6B 4DCKA 3RM1A 4PE7A 4GGFC 4PDZA 3I5FB 1S26D 2CXJA 5HYDA 2CCMA 3BUWB 3B87A 3M0WA 3PM2A 1JSAA 1Y0VH 4INXA 3I5IC 1RROA 2FCDA 2ZN9A 2LLSA 3SG6A 2WCJA 3AAJA 2L51A 4I5JA 1C7VA 4OZDA 1FW4A 1ZACA 4OVNF 3PALA 1CKKA 1CMGA 1J7QA 2LM5A 1AUIB 4MZLA 4PE4A 3OB2B 2KYFA 1SCMC 1HT9A 1SL8A 2YGUA 3DVEA 2PALA 1IWQA 2KOTA 4FQOA 1NX1A 1KSMA 3OX6A 1SMGA 2AAOA 1WRLA 3CGAA 1DGVA 5G08A 3SG2A 5K89A 2IS9A 3CZ2A 1K9KA 4AQIA 1SY9A 1IIOA 5I94A 1F55A 4GBAA 1OMRA 1S3PA 3Q8IA 1QWVA 2K7DA 5CSFA 2E6WA 4WQ2A 1MUXA 1U5IB 2L5XB 2FCEA 2ZFDA 5EL2A 2ZKMX 1UWOA 1YUSA 1TCOB 3PJIA 1F4QA 4HREE 1K90D 2CNPA 3EK8A 4MEWA 4NDCA 2MLEC 3LLEA 3OP0A 1KQMC 2QACA 4FQTA 1OOJA 3L47A 1EJ3A 1CLBA 1YRTB 1DQEA 1DEKA 4ZCVA 1QX2A 4OKHA 3D0YA 3D75A 1WDCB 1XFRA 3KPXA 3BXKA 3TZ1A 1RJVA 1BF5A 5KTYA 2LMVA 1IQ3A 1QATA 1KK8B 3ZWHA 1SW8A 1Y1AA 1BR1B 3EK7A 3QRXA 2O60A 4QJ5B 1AHRA 1A29A 4HSZA 1SRAA 1YVHA 2V53A 2M29A 4I5KA 4P5OE 1B7TY 2PVBA 3SG3A 1QASA 5IBWA 2F2OA 2PYQA 3O78A 1LA3A 1LVCD 1UHIA 3R1VA 1DT7B 4XJKB 3DD4A 1UUSA 3PATA 1J55A 1QXPA 1B9AA 4I5NB 1B1GA 1QVIY 1CTRA 2WCEA 3CS1A 3I5GC 1QIVA 1QX7A 1YX8A 2M1UA 2L50A 1ORGA 1DF0B 3OBVA 1PSRA 1G8IA 2ZRTA 2NCPA 1G4YR 1OE9B 3L4AA 5ER4X 3WNXB 1G33A 2ZNDA 1EG3A 3LK1A 1YTZC 3O4XA 1OMVA 1Z4HA 2PMYA 1NIWA 3NSOA 3NXAA 2LE9B 2Y1MA 1XK4C 1W7JB 1FF1A 1DTLA 1NX3A 2KGBC 1D1OA 1OSAA 3JTDC 4NDBA 2GGZA 3B88A 2L2CA 3KO0A 2KDHA 4MZKA 4ORAB 2ERBA 2QEOA 3SG5A 2M8UA 3JVTB 3IF7A 4PHNA 3VRQA 5GQQC 1CFPA 3O2PA 1CFDA 3TUYC 3DF0A 1JWDA 1KWOC 3OB1B 3SIAA 2PQLA 1AVSA 3EK4A 1QJTA 1QV0A 2NCOA 1FI5A 2KLEA 2LUXA 2L98A 1SKTA 1A75A 1S5GZ 4INWA 4MVFA 1SR6C 2M49B 1WRKA 2H61C 3CR5X 1FI6A 1B7TZ 1TCFA 2BKIB 3I5FC 1XVJA 2WORA 1AJ4A 4L9MA 2K7BA 3D74A 2K8MB 1X02A 2F3YA 3FWCA 1KFUL 2JZIA 5KU1A 1OW4A 1S1EA 5DICA 1OOIX 2BNXA 4F7FA 3F45A 3S0DA 2WC8A 2Y1NA 1V1FA 2K2AA 3EVVA 1UHHA 1QIWA 1QVIZ 3O6BA 2F33A 5AEQA 3I5HB 2QPTA 2PASA 2K61A 2LAPA 4PHJA 1TN4A 5HKZA 2SCPA 2Y4QA 1SSEB 1AJ5A 2M97A 1B8CA 1NCXA 2K60A 1EG4A 5HKWA 3TS5B 3CR2A 1RTP1 1K96A 3PN7B 5AANA 2OS8C 2DOQA 1C07A 1XYDA 3BUMB 2JNFA 3BYAA 3RZSA 4PE1A 2WC5A 2KI4B 4OCIA 1IGVA 5FI7A 1J7RA 5ER5A 2KLDA 3CWGA 1B47A 1S6IA 3PSRA 3B6XA 2OPOA 4GFTA 1CFFA 4D1EA 1A4PA 2I94A 1M45A 1PRWA 2JOJA 4IJ7A 2LHIA 3BQ3A 2LP3A 1A03A 1DJGA 1R2UA 2KQ6A 4YI9A 3O4YA 4FTGA 3CR4X 4A4CA 3LCPC 4I5LB 1SK6D 1KK7Z 1OMDA 2E30A 3AKBA 4CIDA 1LA0A 3EVRA 1C3YA 2ZRSA 2P6BB 4GGFA 1Y6WA 3CZTX 1P28A 1K94A 3DXLA 2M7LA 3DZTA 5D3OA 1F71A 3HX4A 1WDCC 2A4JA 3AKAA 4YRUA 2JTTA 2WCHA 4MRYA 1JFJA 5CPVA 4JKTA 3EKHA 2M0RA 4MRXA 3SJSA 2KI6D 3ZNIA 1KK8C 1MWNA 1TTXA 2AMIA 1Y1XA 2VRGA 3B86A 2MBXA 3SS5A 2KNEA 2COLB 1XFVO 1FBVA 1C3ZA 3FE6A 3CABA 4CPVA 1IJ5A 1BMOA 2L4IA 2KGRA 3A4UB 1J7OA 4AQJA 1BT6A 1SL9A 2HQ8A 2GGMA 3IVTA 4PT1A 1NCYA 3L4LA 2BCXA 3TDUA 1OOGA 1SCVA 3SS3A 1DVIA 1JBAA 1PVAA 3D10A 3I5IB 4YBHB 1LXFC 4QJ3B 3WXAA 2P71A 2BCAA 4C0LA 2KAXA 2GV5A 1K8UA 1S5GY 3GK4X 4N1FA 1NUBA 1M63B 1YUTA 2H2KA 3TDIA 5AFPA 3FS7A 2EHBA 3K21A 1PSBA 4ETOA 3CLNA 2LLTA 4YGDB 1MQ1A 2BL0B 3CZ1A 1DELA 1B8LA 2ISDA 1L2OB 1SYMA 2LVJA 1N2DA 3D0YB 1Q80A 1CDLA 1BG1A 1LS8A 1PALA 2KHNA 4N5XA 1DJWA 1YVLA 4F0ZB 2LHLA 3OGNA 2Q4UA 1TIZA 4Q04A 1PVBA 1DMOA 3KF9A 1XFYO 1UHNA 1CB1A 3JVTC 3NSLA 1OQPA 1WLZA 1YURA 1A2XA 1TOPA 4ORCB 1K9UA 4QJ4B 4P2YB 1WRZA 1KFXS 1QLSA 1MXEA 1TUJA 2NZ0A 1CFCA 3BFBA 1HQVA 2WCBA 2F2PA 2JC2A 2TN4A 1UURA 1EXRA 2CBLA 3A8RA 5B8IB 5I2LA 3IQQA 2L5YA 2MA2A 5CSIA 1T14A 2OTGB 3BUNB 1F54A 3BFHA 4MN0A 1BODA 1TUZA 2KSPA 1C7WA 4DUQA 2G2BA 1KK7Y 3C1VA 3D78A 5I8NA 2M1KB 2EC6B 1UHJA 3AAKA 1EL4A 1VRKA 1MHOA 1QTXA 3I5HC 3K1EA 2JNXA 2EGDA 2LCPA 3CZ0A 1IQ5A 1OZOA 3TS5C 3PN7C 4ICBA 3BOWA 1KCYA 2LNKA 1SBJA 2LC5A 2Y5IA 4PE0A 3EKJA 1CM1A 3S0FA 2H8VA 2HPSA 2L4HA 2D8NA 2KI4C 2BAPA 5HL1A 1MR8A 1H8BA 3B7AA 1SNLA 3ICBA 3PFVA 1IKUA 2GTEA 4DRWA 3DF0B 5CSJA 3DVJA 4USLA 3OHMB 3BFAA 4N1GA 2LANA 5D7FA 1ODBA 1UP5A 1JFKA 1WLMA 1RWYA 2WOSA 4WQ3A 1A75B 2FJUB 1GGWA 1K2HA 1IH0A 2F8PA 2RGIA 2HETA 3VRNA 2M9GA 1TWOA 1XFWO 2JPTA 3D76A 3FIAA 1DJZA 1M46A 1NYAA 1RECA 2BKHB 4DIRA 3DYEA 3S0AA 1F8HA 3RLZA 4M2PA 2KFGA 3FWBA 2BECA 2WNDA 1Z2CB 2JRFA 1E8AA 2JT3A 2BBMA 3BUOB 1F4OA 2LMTA 2MRDA 2PSRA 2K7OA 2K7CA 2LUCA 5J3XA 2O5GA 1S36A 4A4BA 2LMUA 1ZUZA 1GQMA 1BJFA 1NSHA 1DJYA 4NQGA 3SIBA 4CFRA 1ZFSA 4GAOA 4NDDA 1U5IA 4JQ0D 2KAVA 5D69A 1MXLC 1TNQA 2HQWA 2NLNA 4PCWA 1FPWA 1UHKA 1IRJA 3LK0A 4HRHA 5HKYA 1BR4B 1L7ZA 1QS7A 2KI6C 3DY9A 3SS4A 2MJWB 3VB1A 3KHEA 2ZN8A 3S0EA 2MAZA 1DJIA 1B4CA 4HRGA 1OZSA 2MHHA 1OOHA 4PHKA 1LKJA 2JPOA 5F6TA 4ZCUA 2LP2A 5I2OA 1BLQA 4CFQA 2LVIA 1WY9A 5DKRA 2I7AA 1AK8A 1GM0A 3UNWA 2OS8B 2P70A 2BL0C 2M3WA 3GOFA 5CSNA 5FI6A 5BPJA 1L2OC 1SL7A 1QV1A 1MF8B 1LINA 1S6CA 3VRRA 1DJHA 2F3ZA 2I18A 3WHUB 1Y1UA 5AXIA 2PRUA 1IJ6A 1XO5A 1NP8A 2M7NA 1PK0D 2NXQA 3IQOA 1ALVA 3VRPA 4YGAA 1SCMB 2LV7A 4YGCB 1CDPA 3FE8A 1S6JA 2QEVA 1K9PA 1KSOA 1K93D 4JPZB 1NPQA 5TNCA 1J7PA 1F70A 1CMFA 4XJKA 1V1GA 3EVUA 5I2QA 1H4BA 2KFFA 3EG5B 1GGZA 2BE4A 5JOLA 1IG5A 1TRFA 1OOFA 1SPYA 3S0GA 1CLLA 4YI8A 4M2QA 3SG7A 3SG4A 2JQ6A 2OTGC 2WCFA 3NHTA 4GUKA 1QLKA 3OX5A 1ZOTB 4JWQA 1J1DA 4PALA 4WRIA 5AERA 4E68A 1RK9A 1CLMA 1NCZA 1KFXL 3BUXB 1CM4A 4C0JA 1DF0A 3HCMA 3BJHA 2EC6C 3H4SE 3MSEB 3NGVA 2L0PA 1NX0A 1JC2A 1KQMB 4ORBB 1YX7A 2HF5A 1W9ZA 2FJYA 3DVKA 4M2OA 1EH2A 3PLFB 2I2RE 1YR5A 3R72A 4KYNA 3PM8A 1DJXA 5HLOA 1XFXO 2KBIA 4R1EA 2CTNA 4OV2A 4UPGA 5KSZA 2AUCA 1CDMA 2R2IA 4CLNA 4BY5A 2K2FA 4TNCA 4C0KA 3KEVA 2JULA 1DC1A 2JXLA 1M31A 1N0YA 3NSIA 5FI2A 5HLVA 2KAYA 2KFHA 1YRUB 4JD9A 1XFZO 2BE6A 4OR9B 1JF2A 2JWWA 3WHTB 1TNWA 3LL8B 1N65A 1W7IB 2WCMA 3CTNA 1M39A 1YUUA 3VROA 3CYZA 4IL1A 3CDNA 1R6PA 2JT0A 2JU0A 1XK4A 3V2LA 4AOMA 1KQVA 2L2EA 2WCLA 2G9BA 2WCKA 2JT8A 2LLUA 2LVKA 4MBEA 4XYNA 3I5GB 1CNPA 1B8RA 3D77A 1JF0A 2QEBA 1XA5A 2MLFC 3QMEA 1AP4A 2WC6A 2QEHA 2CT9A 2KQYA 2KYCA 3NHIA 3DVMA 2KPHA 1J1EA 3E3RA 2Q91A 1ALWA 2JTZA 1PULA 4PHMA 2KBMA 3VGOA 2BCBA 3R1OA 3NSKA 2H61A 4YGBB 3BOWB 1NX2A 1CDNA
chains in the Genus database with same CATH topology
3TDZA 1TNXA 4MSPA 1XFUO 3JTDB 1ZMZA 1K95A 2ZNEA 3RM1A 4GNKB 5PALA 1GJYA 4MLWA 4DS7A 3GK2A 4GGNA 1RFJA 1TNPA 4U8DA 3GK1A 4BY4A 4YGEB 1DGUA 1JUOA 2LVVA 5FYXA 3TUYB 4MZJA 2K0JA 1KWOB 1NWDA 1QX5B 2BBNA 5JJGA 1KFUS 5DKQA 4GPLB 2SASA 1BU3A 2FOTA 2B1UA 2JXCA 5DKNA 1BOCA 1SR6B 4DCKA 4PE7A 4GGFC 4PDZA 3I5FB 1S26D 2CXJA 5HYDA 2CCMA 3BUWB 3M0WA 1JSAA 1Y0VH 3I5IC 1RROA 2FCDA 2ZN9A 2LLSA 3SG6A 3AAJA 2L51A 4I5JA 1C7VA 1FW4A 1ZACA 4OVNF 3PALA 1CKKA 1CMGA 1J7QA 2LM5A 1AUIB 4MZLA 4PE4A 3OB2B 2KYFA 1SCMC 1HT9A 1SL8A 3DVEA 2PALA 1IWQA 2KOTA 4FQOA 1NX1A 1KSMA 3OX6A 1SMGA 2AAOA 1WRLA 3CGAA 1DGVA 5G08A 3SG2A 5K89A 2IS9A 1K9KA 4AQIA 1SY9A 1F55A 4GBAA 1OMRA 1S3PA 5CSFA 2K7DA 2E6WA 4WQ2A 1MUXA 1U5IB 2L5XB 2FCEA 2ZFDA 2ZKMX 1UWOA 1YUSA 1TCOB 1F4QA 4HREE 1K90D 2CNPA 3EK8A 4MEWA 4NDCA 2MLEC 3LLEA 3OP0A 1KQMC 2QACA 1OOJA 1EJ3A 1CLBA 1YRTB 4ZCVA 1QX2A 4OKHA 3D0YA 1WDCB 3KPXA 3BXKA 3TZ1A 1RJVA 1BF5A 5KTYA 2LMVA 1IQ3A 1QATA 1KK8B 3ZWHA 1SW8A 1Y1AA 1BR1B 3EK7A 3QRXA 2O60A 4QJ5B 1AHRA 1A29A 4HSZA 1SRAA 1YVHA 2V53A 2M29A 4I5KA 4P5OE 1B7TY 2PVBA 3SG3A 1QASA 5IBWA 2F2OA 3O78A 1LA3A 1LVCD 1UHIA 1DT7B 4XJKB 3DD4A 1UUSA 3PATA 1J55A 1QXPA 1B9AA 4I5NB 1B1GA 1QVIY 1CTRA 2WCEA 3CS1A 3I5GC 1QIVA 1QX7A 1YX8A 2M1UA 2L50A 1DF0B 1PSRA 1G8IA 2ZRTA 2NCPA 1G4YR 1OE9B 5ER4X 3WNXB 1G33A 2ZNDA 1EG3A 3LK1A 1YTZC 1OMVA 2PMYA 1NIWA 3NSOA 3NXAA 2LE9B 2Y1MA 1XK4C 1W7JB 1FF1A 1DTLA 1NX3A 2KGBC 1D1OA 1OSAA 3JTDC 4NDBA 2GGZA 3KO0A 2KDHA 4MZKA 4ORAB 3SG5A 2M8UA 3JVTB 3IF7A 4PHNA 3VRQA 5GQQC 1CFPA 3O2PA 1CFDA 3TUYC 3DF0A 1JWDA 1KWOC 3OB1B 3SIAA 1AVSA 3EK4A 1QJTA 1QV0A 2NCOA 1FI5A 2LUXA 2L98A 1SKTA 1A75A 1S5GZ 4MVFA 1SR6C 2M49B 1WRKA 2H61C 3CR5X 1FI6A 1B7TZ 1TCFA 2BKIB 3I5FC 1XVJA 2WORA 1AJ4A 4L9MA 2K7BA 2K8MB 1X02A 2F3YA 3FWCA 1KFUL 2JZIA 5KU1A 1S1EA 3F45A 2WC8A 2Y1NA 1V1FA 2K2AA 3EVVA 1UHHA 1QIWA 1QVIZ 3O6BA 2F33A 5AEQA 3I5HB 2QPTA 2PASA 2K61A 2LAPA 4PHJA 1TN4A 5HKZA 2SCPA 2Y4QA 1AJ5A 2M97A 1B8CA 1NCXA 1EG4A 5HKWA 3TS5B 3CR2A 1RTP1 1K96A 3PN7B 5AANA 2OS8C 2DOQA 1C07A 1XYDA 3BUMB 2JNFA 3BYAA 4PE1A 2KI4B 4OCIA 1IGVA 1J7RA 5ER5A 3CWGA 1B47A 1S6IA 3PSRA 2OPOA 4GFTA 1CFFA 4D1EA 1A4PA 2I94A 1M45A 1PRWA 2JOJA 2LHIA 3BQ3A 2LP3A 1A03A 1DJGA 1R2UA 2KQ6A 4YI9A 3O4YA 4FTGA 3CR4X 4A4CA 3LCPC 4I5LB 1SK6D 1KK7Z 1OMDA 2E30A 3AKBA 4CIDA 1LA0A 3EVRA 2ZRSA 2P6BB 4GGFA 1Y6WA 3CZTX 1K94A 2M7LA 1F71A 3HX4A 1WDCC 2A4JA 3AKAA 4YRUA 2JTTA 1JFJA 4MRYA 5CPVA 3SJSA 3EKHA 2M0RA 4MRXA 3ZNIA 2KI6D 1KK8C 1MWNA 1TTXA 2AMIA 1Y1XA 2VRGA 2MBXA 2KNEA 2COLB 1XFVO 1FBVA 4CPVA 1IJ5A 1BMOA 2L4IA 2KGRA 3A4UB 1J7OA 4AQJA 1BT6A 1SL9A 2HQ8A 2GGMA 1NCYA 2BCXA 3TDUA 1SCVA 1JBAA 1DVIA 1PVAA 3D10A 3I5IB 4YBHB 1LXFC 4QJ3B 3WXAA 2BCAA 4C0LA 2KAXA 2GV5A 1K8UA 1S5GY 3GK4X 4N1FA 1NUBA 1M63B 1YUTA 2H2KA 3TDIA 5AFPA 3FS7A 2EHBA 3K21A 1PSBA 4ETOA 3CLNA 2LLTA 4YGDB 1MQ1A 2BL0B 1B8LA 2ISDA 1L2OB 1SYMA 2LVJA 1N2DA 3D0YB 1Q80A 1CDLA 1BG1A 1PALA 4N5XA 2KHNA 1DJWA 1YVLA 4F0ZB 2LHLA 2Q4UA 1TIZA 4Q04A 1PVBA 1DMOA 3KF9A 1XFYO 1UHNA 1CB1A 3JVTC 3NSLA 1OQPA 1WLZA 1YURA 1A2XA 1TOPA 4ORCB 1K9UA 4QJ4B 4P2YB 1WRZA 1KFXS 1QLSA 1MXEA 2NZ0A 1CFCA 1HQVA 2WCBA 2F2PA 2JC2A 2TN4A 1UURA 1EXRA 2CBLA 3A8RA 5B8IB 5I2LA 3IQQA 2MA2A 5CSIA 2OTGB 3BUNB 1F54A 1BODA 4MN0A 2KSPA 1C7WA 4DUQA 2G2BA 1KK7Y 3C1VA 5I8NA 2M1KB 2EC6B 1UHJA 3AAKA 1EL4A 1VRKA 1MHOA 1QTXA 3I5HC 2JNXA 2EGDA 2LCPA 1IQ5A 1OZOA 3TS5C 3PN7C 4ICBA 3BOWA 1KCYA 2LNKA 1SBJA 2LC5A 2Y5IA 4PE0A 3EKJA 1CM1A 2HPSA 2L4HA 2D8NA 2KI4C 1MR8A 1H8BA 1SNLA 3ICBA 3PFVA 1IKUA 4DRWA 3DF0B 5CSJA 3DVJA 4USLA 3OHMB 4N1GA 2LANA 5D7FA 1ODBA 1UP5A 1JFKA 1WLMA 1RWYA 2WOSA 4WQ3A 1A75B 2FJUB 1GGWA 1K2HA 1IH0A 2F8PA 2RGIA 2HETA 3VRNA 2M9GA 1XFWO 2JPTA 3FIAA 1DJZA 1M46A 1NYAA 1RECA 2BKHB 4DIRA 1F8HA 3RLZA 4M2PA 2KFGA 3FWBA 2BECA 2WNDA 2JRFA 1E8AA 2JT3A 2BBMA 3BUOB 1F4OA 2LMTA 2MRDA 2PSRA 2K7OA 2K7CA 2LUCA 5J3XA 2O5GA 1S36A 4A4BA 2LMUA 1ZUZA 1GQMA 1BJFA 1NSHA 1DJYA 4NQGA 3SIBA 4CFRA 1ZFSA 4GAOA 4NDDA 1U5IA 4JQ0D 2KAVA 5D69A 1MXLC 1TNQA 2HQWA 2NLNA 4PCWA 1FPWA 1UHKA 1IRJA 3LK0A 4HRHA 5HKYA 1BR4B 1L7ZA 1QS7A 2KI6C 2MJWB 3KHEA 2ZN8A 1B4CA 2MAZA 1DJIA 4HRGA 1OZSA 2MHHA 5I2OA 4PHKA 1LKJA 4ZCUA 5F6TA 2LP2A 1BLQA 4CFQA 2LVIA 1WY9A 5DKRA 2I7AA 1AK8A 2OS8B 2BL0C 2M3WA 3GOFA 5CSNA 5BPJA 1L2OC 1SL7A 1QV1A 1MF8B 1LINA 1S6CA 3VRRA 1DJHA 2F3ZA 2I18A 3WHUB 1Y1UA 5AXIA 2PRUA 1IJ6A 1XO5A 1NP8A 2M7NA 1PK0D 2NXQA 3IQOA 1ALVA 3VRPA 4YGAA 1SCMB 2LV7A 4YGCB 1CDPA 5TNCA 1S6JA 1J7PA 1K9PA 1KSOA 1K93D 4JPZB 1NPQA 1F70A 1CMFA 4XJKA 1V1GA 3EVUA 5I2QA 1H4BA 2KFFA 1GGZA 2BE4A 5JOLA 1IG5A 1TRFA 1SPYA 1CLLA 4YI8A 4M2QA 3SG7A 3SG4A 2JQ6A 2OTGC 2WCFA 4GUKA 1QLKA 3OX5A 1ZOTB 4JWQA 1J1DA 4PALA 4WRIA 5AERA 4E68A 1RK9A 1CLMA 1NCZA 1KFXL 3BUXB 1CM4A 4C0JA 1DF0A 3HCMA 2EC6C 3H4SE 3MSEB 2L0PA 1NX0A 1JC2A 1KQMB 4ORBB 1YX7A 2HF5A 3DVKA 4M2OA 1EH2A 3PLFB 2I2RE 1YR5A 3PM8A 1DJXA 5HLOA 1XFXO 2KBIA 4R1EA 2CTNA 4OV2A 4UPGA 5KSZA 2AUCA 1CDMA 2R2IA 4CLNA 4BY5A 2K2FA 4TNCA 4C0KA 3KEVA 2JULA 2JXLA 1M31A 1N0YA 3NSIA 5HLVA 2KAYA 2KFHA 1YRUB 1XFZO 2BE6A 4OR9B 1JF2A 2JWWA 3WHTB 1TNWA 3LL8B 1N65A 1W7IB 3CTNA 1M39A 1YUUA 3VROA 4IL1A 1R6PA 2JT0A 2JU0A 1XK4A 4AOMA 1KQVA 2L2EA 2G9BA 2JT8A 2LLUA 2LVKA 4MBEA 4XYNA 3I5GB 1CNPA 1B8RA 1JF0A 1AP4A 1XA5A 2MLFC 2CT9A 2KQYA 2KYCA 3DVMA 1J1EA 3E3RA 2Q91A 1ALWA 2JTZA 1PULA 4PHMA 2KBMA 3VGOA 2BCBA 3NSKA 2H61A 4YGBB 3BOWB 1NX2A 1CDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TDZ A;  1TNX A;  4MSP A;  1XFU O;  3JTD B;  1ZMZ A;  1K95 A;  2ZNE A;  3RM1 A;  4GNK B;  5PAL A;  1GJY A;  4MLW A;  4DS7 A;  3GK2 A;  4GGN A;  1RFJ A;  1TNP A;  4U8D A;  3GK1 A;  4BY4 A;  4YGE B;  1DGU A;  1JUO A;  2LVV A;  5FYX A;  3TUY B;  4MZJ A;  2K0J A;  1KWO B;  1NWD A;  1QX5 B;  2BBN A;  5JJG A;  1KFU S;  5DKQ A;  4GPL B;  2SAS A;  1BU3 A;  2FOT A;  2B1U A;  2JXC A;  5DKN A;  1BOC A;  1SR6 B;  4DCK A;  4PE7 A;  4GGF C;  4PDZ A;  3I5F B;  1S26 D;  2CXJ A;  5HYD A;  2CCM A;  3BUW B;  3M0W A;  1JSA A;  1Y0V H;  3I5I C;  1RRO A;  2FCD A;  2ZN9 A;  2LLS A;  3SG6 A;  3AAJ A;  2L51 A;  4I5J A;  1C7V A;  1FW4 A;  1ZAC A;  4OVN F;  3PAL A;  1CKK A;  1CMG A;  1J7Q A;  2LM5 A;  1AUI B;  4MZL A;  4PE4 A;  3OB2 B;  2KYF A;  1SCM C;  1HT9 A;  1SL8 A;  3DVE A;  2PAL A;  1IWQ A;  2KOT A;  4FQO A;  1NX1 A;  1KSM A;  3OX6 A;  1SMG A;  2AAO A;  1WRL A;  3CGA A;  1DGV A;  5G08 A;  3SG2 A;  5K89 A;  2IS9 A;  1K9K A;  4AQI A;  1SY9 A;  1F55 A;  4GBA A;  1OMR A;  1S3P A;  5CSF A;  2K7D A;  2E6W A;  4WQ2 A;  1MUX A;  1U5I B;  2L5X B;  2FCE A;  2ZFD A;  2ZKM X;  1UWO A;  1YUS A;  1TCO B;  1F4Q A;  4HRE E;  1K90 D;  2CNP A;  3EK8 A;  4MEW A;  4NDC A;  2MLE C;  3LLE A;  3OP0 A;  1KQM C;  2QAC A;  1OOJ A;  1EJ3 A;  1CLB A;  1YRT B;  4ZCV A;  1QX2 A;  4OKH A;  3D0Y A;  1WDC B;  3KPX A;  3BXK A;  3TZ1 A;  1RJV A;  1BF5 A;  5KTY A;  2LMV A;  1IQ3 A;  1QAT A;  1KK8 B;  3ZWH A;  1SW8 A;  1Y1A A;  1BR1 B;  3EK7 A;  3QRX A;  2O60 A;  4QJ5 B;  1AHR A;  1A29 A;  4HSZ A;  1SRA A;  1YVH A;  2V53 A;  2M29 A;  4I5K A;  4P5O E;  1B7T Y;  2PVB A;  3SG3 A;  1QAS A;  5IBW A;  2F2O A;  3O78 A;  1LA3 A;  1LVC D;  1UHI A;  1DT7 B;  4XJK B;  3DD4 A;  1UUS A;  3PAT A;  1J55 A;  1QXP A;  1B9A A;  4I5N B;  1B1G A;  1QVI Y;  1CTR A;  2WCE A;  3CS1 A;  3I5G C;  1QIV A;  1QX7 A;  1YX8 A;  2M1U A;  2L50 A;  1DF0 B;  1PSR A;  1G8I A;  2ZRT A;  2NCP A;  1G4Y R;  1OE9 B;  5ER4 X;  3WNX B;  1G33 A;  2ZND A;  1EG3 A;  3LK1 A;  1YTZ C;  1OMV A;  2PMY A;  1NIW A;  3NSO A;  3NXA A;  2LE9 B;  2Y1M A;  1XK4 C;  1W7J B;  1FF1 A;  1DTL A;  1NX3 A;  2KGB C;  1D1O A;  1OSA A;  3JTD C;  4NDB A;  2GGZ A;  3KO0 A;  2KDH A;  4MZK A;  4ORA B;  3SG5 A;  2M8U A;  3JVT B;  3IF7 A;  4PHN A;  3VRQ A;  5GQQ C;  1CFP A;  3O2P A;  1CFD A;  3TUY C;  3DF0 A;  1JWD A;  1KWO C;  3OB1 B;  3SIA A;  1AVS A;  3EK4 A;  1QJT A;  1QV0 A;  2NCO A;  1FI5 A;  2LUX A;  2L98 A;  1SKT A;  1A75 A;  1S5G Z;  4MVF A;  1SR6 C;  2M49 B;  1WRK A;  2H61 C;  3CR5 X;  1FI6 A;  1B7T Z;  1TCF A;  2BKI B;  3I5F C;  1XVJ A;  2WOR A;  1AJ4 A;  4L9M A;  2K7B A;  2K8M B;  1X02 A;  2F3Y A;  3FWC A;  1KFU L;  2JZI A;  5KU1 A;  1S1E A;  3F45 A;  2WC8 A;  2Y1N A;  1V1F A;  2K2A A;  3EVV A;  1UHH A;  1QIW A;  1QVI Z;  3O6B A;  2F33 A;  5AEQ A;  3I5H B;  2QPT A;  2PAS A;  2K61 A;  2LAP A;  4PHJ A;  1TN4 A;  5HKZ A;  2SCP A;  2Y4Q A;  1AJ5 A;  2M97 A;  1B8C A;  1NCX A;  1EG4 A;  5HKW A;  3TS5 B;  3CR2 A;  1RTP 1;  1K96 A;  3PN7 B;  5AAN A;  2OS8 C;  2DOQ A;  1C07 A;  1XYD A;  3BUM B;  2JNF A;  3BYA A;  4PE1 A;  2KI4 B;  4OCI A;  1IGV A;  1J7R A;  5ER5 A;  3CWG A;  1B47 A;  1S6I A;  3PSR A;  2OPO A;  4GFT A;  1CFF A;  4D1E A;  1A4P A;  2I94 A;  1M45 A;  1PRW A;  2JOJ A;  2LHI A;  3BQ3 A;  2LP3 A;  1A03 A;  1DJG A;  1R2U A;  2KQ6 A;  4YI9 A;  3O4Y A;  4FTG A;  3CR4 X;  4A4C A;  3LCP C;  4I5L B;  1SK6 D;  1KK7 Z;  1OMD A;  2E30 A;  3AKB A;  4CID A;  1LA0 A;  3EVR A;  2ZRS A;  2P6B B;  4GGF A;  1Y6W A;  3CZT X;  1K94 A;  2M7L A;  1F71 A;  3HX4 A;  1WDC C;  2A4J A;  3AKA A;  4YRU A;  2JTT A;  1JFJ A;  4MRY A;  5CPV A;  3SJS A;  3EKH A;  2M0R A;  4MRX A;  3ZNI A;  2KI6 D;  1KK8 C;  1MWN A;  1TTX A;  2AMI A;  1Y1X A;  2VRG A;  2MBX A;  2KNE A;  2COL B;  1XFV O;  1FBV A;  4CPV A;  1IJ5 A;  1BMO A;  2L4I A;  2KGR A;  3A4U B;  1J7O A;  4AQJ A;  1BT6 A;  1SL9 A;  2HQ8 A;  2GGM A;  1NCY A;  2BCX A;  3TDU A;  1SCV A;  1JBA A;  1DVI A;  1PVA A;  3D10 A;  3I5I B;  4YBH B;  1LXF C;  4QJ3 B;  3WXA A;  2BCA A;  4C0L A;  2KAX A;  2GV5 A;  1K8U A;  1S5G Y;  3GK4 X;  4N1F A;  1NUB A;  1M63 B;  1YUT A;  2H2K A;  3TDI A;  5AFP A;  3FS7 A;  2EHB A;  3K21 A;  1PSB A;  4ETO A;  3CLN A;  2LLT A;  4YGD B;  1MQ1 A;  2BL0 B;  1B8L A;  2ISD A;  1L2O B;  1SYM A;  2LVJ A;  1N2D A;  3D0Y B;  1Q80 A;  1CDL A;  1BG1 A;  1PAL A;  4N5X A;  2KHN A;  1DJW A;  1YVL A;  4F0Z B;  2LHL A;  2Q4U A;  1TIZ A;  4Q04 A;  1PVB A;  1DMO A;  3KF9 A;  1XFY O;  1UHN A;  1CB1 A;  3JVT C;  3NSL A;  1OQP A;  1WLZ A;  1YUR A;  1A2X A;  1TOP A;  4ORC B;  1K9U A;  4QJ4 B;  4P2Y B;  1WRZ A;  1KFX S;  1QLS A;  1MXE A;  2NZ0 A;  1CFC A;  1HQV A;  2WCB A;  2F2P A;  2JC2 A;  2TN4 A;  1UUR A;  1EXR A;  2CBL A;  3A8R A;  5B8I B;  5I2L A;  3IQQ A;  2MA2 A;  5CSI A;  2OTG B;  3BUN B;  1F54 A;  1BOD A;  4MN0 A;  2KSP A;  1C7W A;  4DUQ A;  2G2B A;  1KK7 Y;  3C1V A;  5I8N A;  2M1K B;  2EC6 B;  1UHJ A;  3AAK A;  1EL4 A;  1VRK A;  1MHO A;  1QTX A;  3I5H C;  2JNX A;  2EGD A;  2LCP A;  1IQ5 A;  1OZO A;  3TS5 C;  3PN7 C;  4ICB A;  3BOW A;  1KCY A;  2LNK A;  1SBJ A;  2LC5 A;  2Y5I A;  4PE0 A;  3EKJ A;  1CM1 A;  2HPS A;  2L4H A;  2D8N A;  2KI4 C;  1MR8 A;  1H8B A;  1SNL A;  3ICB A;  3PFV A;  1IKU A;  4DRW A;  3DF0 B;  5CSJ A;  3DVJ A;  4USL A;  3OHM B;  4N1G A;  2LAN A;  5D7F A;  1ODB A;  1UP5 A;  1JFK A;  1WLM A;  1RWY A;  2WOS A;  4WQ3 A;  1A75 B;  2FJU B;  1GGW A;  1K2H A;  1IH0 A;  2F8P A;  2RGI A;  2HET A;  3VRN A;  2M9G A;  1XFW O;  2JPT A;  3FIA A;  1DJZ A;  1M46 A;  1NYA A;  1REC A;  2BKH B;  4DIR A;  1F8H A;  3RLZ A;  4M2P A;  2KFG A;  3FWB A;  2BEC A;  2WND A;  2JRF A;  1E8A A;  2JT3 A;  2BBM A;  3BUO B;  1F4O A;  2LMT A;  2MRD A;  2PSR A;  2K7O A;  2K7C A;  2LUC A;  5J3X A;  2O5G A;  1S36 A;  4A4B A;  2LMU A;  1ZUZ A;  1GQM A;  1BJF A;  1NSH A;  1DJY A;  4NQG A;  3SIB A;  4CFR A;  1ZFS A;  4GAO A;  4NDD A;  1U5I A;  4JQ0 D;  2KAV A;  5D69 A;  1MXL C;  1TNQ A;  2HQW A;  2NLN A;  4PCW A;  1FPW A;  1UHK A;  1IRJ A;  3LK0 A;  4HRH A;  5HKY A;  1BR4 B;  1L7Z A;  1QS7 A;  2KI6 C;  2MJW B;  3KHE A;  2ZN8 A;  1B4C A;  2MAZ A;  1DJI A;  4HRG A;  1OZS A;  2MHH A;  5I2O A;  4PHK A;  1LKJ A;  4ZCU A;  5F6T A;  2LP2 A;  1BLQ A;  4CFQ A;  2LVI A;  1WY9 A;  5DKR A;  2I7A A;  1AK8 A;  2OS8 B;  2BL0 C;  2M3W A;  3GOF A;  5CSN A;  5BPJ A;  1L2O C;  1SL7 A;  1QV1 A;  1MF8 B;  1LIN A;  1S6C A;  3VRR A;  1DJH A;  2F3Z A;  2I18 A;  3WHU B;  1Y1U A;  5AXI A;  2PRU A;  1IJ6 A;  1XO5 A;  1NP8 A;  2M7N A;  1PK0 D;  2NXQ A;  3IQO A;  1ALV A;  3VRP A;  4YGA A;  1SCM B;  2LV7 A;  4YGC B;  1CDP A;  5TNC A;  1S6J A;  1J7P A;  1K9P A;  1KSO A;  1K93 D;  4JPZ B;  1NPQ A;  1F70 A;  1CMF A;  4XJK A;  1V1G A;  3EVU A;  5I2Q A;  1H4B A;  2KFF A;  1GGZ A;  2BE4 A;  5JOL A;  1IG5 A;  1TRF A;  1SPY A;  1CLL A;  4YI8 A;  4M2Q A;  3SG7 A;  3SG4 A;  2JQ6 A;  2OTG C;  2WCF A;  4GUK A;  1QLK A;  3OX5 A;  1ZOT B;  4JWQ A;  1J1D A;  4PAL A;  4WRI A;  5AER A;  4E68 A;  1RK9 A;  1CLM A;  1NCZ A;  1KFX L;  3BUX B;  1CM4 A;  4C0J A;  1DF0 A;  3HCM A;  2EC6 C;  3H4S E;  3MSE B;  2L0P A;  1NX0 A;  1JC2 A;  1KQM B;  4ORB B;  1YX7 A;  2HF5 A;  3DVK A;  4M2O A;  1EH2 A;  3PLF B;  2I2R E;  1YR5 A;  3PM8 A;  1DJX A;  5HLO A;  1XFX O;  2KBI A;  4R1E A;  2CTN A;  4OV2 A;  4UPG A;  5KSZ A;  2AUC A;  1CDM A;  2R2I A;  4CLN A;  4BY5 A;  2K2F A;  4TNC A;  4C0K A;  3KEV A;  2JUL A;  2JXL A;  1M31 A;  1N0Y A;  3NSI A;  5HLV A;  2KAY A;  2KFH A;  1YRU B;  1XFZ O;  2BE6 A;  4OR9 B;  1JF2 A;  2JWW A;  3WHT B;  1TNW A;  3LL8 B;  1N65 A;  1W7I B;  3CTN A;  1M39 A;  1YUU A;  3VRO A;  4IL1 A;  1R6P A;  2JT0 A;  2JU0 A;  1XK4 A;  4AOM A;  1KQV A;  2L2E A;  2G9B A;  2JT8 A;  2LLU A;  2LVK A;  4MBE A;  4XYN A;  3I5G B;  1CNP A;  1B8R A;  1JF0 A;  1AP4 A;  1XA5 A;  2MLF C;  2CT9 A;  2KQY A;  2KYC A;  3DVM A;  1J1E A;  3E3R A;  2Q91 A;  1ALW A;  2JTZ A;  1PUL A;  4PHM A;  2KBM A;  3VGO A;  2BCB A;  3NSK A;  2H61 A;  4YGB B;  3BOW B;  1NX2 A;  1CDN A; 
#chains in the Genus database with same CATH topology
 3TDZ A;  1TNX A;  4MSP A;  1XFU O;  3D73 A;  1ZMZ A;  1K95 A;  2ZNE A;  3JTD B;  4GNK B;  5PAL A;  1GJY A;  3N7H A;  4MLW A;  3GK2 A;  4DS7 A;  4GGN A;  1RFJ A;  1TNP A;  4U8D A;  3GK1 A;  4BY4 A;  4YGE B;  1DGU A;  1JUO A;  2LVV A;  5FYX A;  3FE9 A;  3UO9 A;  3R1P A;  2QDI A;  3S0B A;  4MZJ A;  2K0J A;  1KWO B;  1NWD A;  3TUY B;  1QX5 B;  2BBN A;  5JJG A;  1KFU S;  5DKQ A;  4GPL B;  2SAS A;  1BU3 A;  2FOT A;  2B1U A;  2JXC A;  5DKN A;  1BOC A;  1SR6 B;  4DCK A;  3RM1 A;  4PE7 A;  4GGF C;  4PDZ A;  3I5F B;  1S26 D;  2CXJ A;  5HYD A;  2CCM A;  3BUW B;  3B87 A;  3M0W A;  3PM2 A;  1JSA A;  1Y0V H;  4INX A;  3I5I C;  1RRO A;  2FCD A;  2ZN9 A;  2LLS A;  3SG6 A;  2WCJ A;  3AAJ A;  2L51 A;  4I5J A;  1C7V A;  4OZD A;  1FW4 A;  1ZAC A;  4OVN F;  3PAL A;  1CKK A;  1CMG A;  1J7Q A;  2LM5 A;  1AUI B;  4MZL A;  4PE4 A;  3OB2 B;  2KYF A;  1SCM C;  1HT9 A;  1SL8 A;  2YGU A;  3DVE A;  2PAL A;  1IWQ A;  2KOT A;  4FQO A;  1NX1 A;  1KSM A;  3OX6 A;  1SMG A;  2AAO A;  1WRL A;  3CGA A;  1DGV A;  5G08 A;  3SG2 A;  5K89 A;  2IS9 A;  3CZ2 A;  1K9K A;  4AQI A;  1SY9 A;  1IIO A;  5I94 A;  1F55 A;  4GBA A;  1OMR A;  1S3P A;  3Q8I A;  1QWV A;  2K7D A;  5CSF A;  2E6W A;  4WQ2 A;  1MUX A;  1U5I B;  2L5X B;  2FCE A;  2ZFD A;  5EL2 A;  2ZKM X;  1UWO A;  1YUS A;  1TCO B;  3PJI A;  1F4Q A;  4HRE E;  1K90 D;  2CNP A;  3EK8 A;  4MEW A;  4NDC A;  2MLE C;  3LLE A;  3OP0 A;  1KQM C;  2QAC A;  4FQT A;  1OOJ A;  3L47 A;  1EJ3 A;  1CLB A;  1YRT B;  1DQE A;  1DEK A;  4ZCV A;  1QX2 A;  4OKH A;  3D0Y A;  3D75 A;  1WDC B;  1XFR A;  3KPX A;  3BXK A;  3TZ1 A;  1RJV A;  1BF5 A;  5KTY A;  2LMV A;  1IQ3 A;  1QAT A;  1KK8 B;  3ZWH A;  1SW8 A;  1Y1A A;  1BR1 B;  3EK7 A;  3QRX A;  2O60 A;  4QJ5 B;  1AHR A;  1A29 A;  4HSZ A;  1SRA A;  1YVH A;  2V53 A;  2M29 A;  4I5K A;  4P5O E;  1B7T Y;  2PVB A;  3SG3 A;  1QAS A;  5IBW A;  2F2O A;  2PYQ A;  3O78 A;  1LA3 A;  1LVC D;  1UHI A;  3R1V A;  1DT7 B;  4XJK B;  3DD4 A;  1UUS A;  3PAT A;  1J55 A;  1QXP A;  1B9A A;  4I5N B;  1B1G A;  1QVI Y;  1CTR A;  2WCE A;  3CS1 A;  3I5G C;  1QIV A;  1QX7 A;  1YX8 A;  2M1U A;  2L50 A;  1ORG A;  1DF0 B;  3OBV A;  1PSR A;  1G8I A;  2ZRT A;  2NCP A;  1G4Y R;  1OE9 B;  3L4A A;  5ER4 X;  3WNX B;  1G33 A;  2ZND A;  1EG3 A;  3LK1 A;  1YTZ C;  3O4X A;  1OMV A;  1Z4H A;  2PMY A;  1NIW A;  3NSO A;  3NXA A;  2LE9 B;  2Y1M A;  1XK4 C;  1W7J B;  1FF1 A;  1DTL A;  1NX3 A;  2KGB C;  1D1O A;  1OSA A;  3JTD C;  4NDB A;  2GGZ A;  3B88 A;  2L2C A;  3KO0 A;  2KDH A;  4MZK A;  4ORA B;  2ERB A;  2QEO A;  3SG5 A;  2M8U A;  3JVT B;  3IF7 A;  4PHN A;  3VRQ A;  5GQQ C;  1CFP A;  3O2P A;  1CFD A;  3TUY C;  3DF0 A;  1JWD A;  1KWO C;  3OB1 B;  3SIA A;  2PQL A;  1AVS A;  3EK4 A;  1QJT A;  1QV0 A;  2NCO A;  1FI5 A;  2KLE A;  2LUX A;  2L98 A;  1SKT A;  1A75 A;  1S5G Z;  4INW A;  4MVF A;  1SR6 C;  2M49 B;  1WRK A;  2H61 C;  3CR5 X;  1FI6 A;  1B7T Z;  1TCF A;  2BKI B;  3I5F C;  1XVJ A;  2WOR A;  1AJ4 A;  4L9M A;  2K7B A;  3D74 A;  2K8M B;  1X02 A;  2F3Y A;  3FWC A;  1KFU L;  2JZI A;  5KU1 A;  1OW4 A;  1S1E A;  5DIC A;  1OOI X;  2BNX A;  4F7F A;  3F45 A;  3S0D A;  2WC8 A;  2Y1N A;  1V1F A;  2K2A A;  3EVV A;  1UHH A;  1QIW A;  1QVI Z;  3O6B A;  2F33 A;  5AEQ A;  3I5H B;  2QPT A;  2PAS A;  2K61 A;  2LAP A;  4PHJ A;  1TN4 A;  5HKZ A;  2SCP A;  2Y4Q A;  1SSE B;  1AJ5 A;  2M97 A;  1B8C A;  1NCX A;  2K60 A;  1EG4 A;  5HKW A;  3TS5 B;  3CR2 A;  1RTP 1;  1K96 A;  3PN7 B;  5AAN A;  2OS8 C;  2DOQ A;  1C07 A;  1XYD A;  3BUM B;  2JNF A;  3BYA A;  3RZS A;  4PE1 A;  2WC5 A;  2KI4 B;  4OCI A;  1IGV A;  5FI7 A;  1J7R A;  5ER5 A;  2KLD A;  3CWG A;  1B47 A;  1S6I A;  3PSR A;  3B6X A;  2OPO A;  4GFT A;  1CFF A;  4D1E A;  1A4P A;  2I94 A;  1M45 A;  1PRW A;  2JOJ A;  4IJ7 A;  2LHI A;  3BQ3 A;  2LP3 A;  1A03 A;  1DJG A;  1R2U A;  2KQ6 A;  4YI9 A;  3O4Y A;  4FTG A;  3CR4 X;  4A4C A;  3LCP C;  4I5L B;  1SK6 D;  1KK7 Z;  1OMD A;  2E30 A;  3AKB A;  4CID A;  1LA0 A;  3EVR A;  1C3Y A;  2ZRS A;  2P6B B;  4GGF A;  1Y6W A;  3CZT X;  1P28 A;  1K94 A;  3DXL A;  2M7L A;  3DZT A;  5D3O A;  1F71 A;  3HX4 A;  1WDC C;  2A4J A;  3AKA A;  4YRU A;  2JTT A;  2WCH A;  4MRY A;  1JFJ A;  5CPV A;  4JKT A;  3EKH A;  2M0R A;  4MRX A;  3SJS A;  2KI6 D;  3ZNI A;  1KK8 C;  1MWN A;  1TTX A;  2AMI A;  1Y1X A;  2VRG A;  3B86 A;  2MBX A;  3SS5 A;  2KNE A;  2COL B;  1XFV O;  1FBV A;  1C3Z A;  3FE6 A;  3CAB A;  4CPV A;  1IJ5 A;  1BMO A;  2L4I A;  2KGR A;  3A4U B;  1J7O A;  4AQJ A;  1BT6 A;  1SL9 A;  2HQ8 A;  2GGM A;  3IVT A;  4PT1 A;  1NCY A;  3L4L A;  2BCX A;  3TDU A;  1OOG A;  1SCV A;  3SS3 A;  1DVI A;  1JBA A;  1PVA A;  3D10 A;  3I5I B;  4YBH B;  1LXF C;  4QJ3 B;  3WXA A;  2P71 A;  2BCA A;  4C0L A;  2KAX A;  2GV5 A;  1K8U A;  1S5G Y;  3GK4 X;  4N1F A;  1NUB A;  1M63 B;  1YUT A;  2H2K A;  3TDI A;  5AFP A;  3FS7 A;  2EHB A;  3K21 A;  1PSB A;  4ETO A;  3CLN A;  2LLT A;  4YGD B;  1MQ1 A;  2BL0 B;  3CZ1 A;  1DEL A;  1B8L A;  2ISD A;  1L2O B;  1SYM A;  2LVJ A;  1N2D A;  3D0Y B;  1Q80 A;  1CDL A;  1BG1 A;  1LS8 A;  1PAL A;  2KHN A;  4N5X A;  1DJW A;  1YVL A;  4F0Z B;  2LHL A;  3OGN A;  2Q4U A;  1TIZ A;  4Q04 A;  1PVB A;  1DMO A;  3KF9 A;  1XFY O;  1UHN A;  1CB1 A;  3JVT C;  3NSL A;  1OQP A;  1WLZ A;  1YUR A;  1A2X A;  1TOP A;  4ORC B;  1K9U A;  4QJ4 B;  4P2Y B;  1WRZ A;  1KFX S;  1QLS A;  1MXE A;  1TUJ A;  2NZ0 A;  1CFC A;  3BFB A;  1HQV A;  2WCB A;  2F2P A;  2JC2 A;  2TN4 A;  1UUR A;  1EXR A;  2CBL A;  3A8R A;  5B8I B;  5I2L A;  3IQQ A;  2L5Y A;  2MA2 A;  5CSI A;  1T14 A;  2OTG B;  3BUN B;  1F54 A;  3BFH A;  4MN0 A;  1BOD A;  1TUZ A;  2KSP A;  1C7W A;  4DUQ A;  2G2B A;  1KK7 Y;  3C1V A;  3D78 A;  5I8N A;  2M1K B;  2EC6 B;  1UHJ A;  3AAK A;  1EL4 A;  1VRK A;  1MHO A;  1QTX A;  3I5H C;  3K1E A;  2JNX A;  2EGD A;  2LCP A;  3CZ0 A;  1IQ5 A;  1OZO A;  3TS5 C;  3PN7 C;  4ICB A;  3BOW A;  1KCY A;  2LNK A;  1SBJ A;  2LC5 A;  2Y5I A;  4PE0 A;  3EKJ A;  1CM1 A;  3S0F A;  2H8V A;  2HPS A;  2L4H A;  2D8N A;  2KI4 C;  2BAP A;  5HL1 A;  1MR8 A;  1H8B A;  3B7A A;  1SNL A;  3ICB A;  3PFV A;  1IKU A;  2GTE A;  4DRW A;  3DF0 B;  5CSJ A;  3DVJ A;  4USL A;  3OHM B;  3BFA A;  4N1G A;  2LAN A;  5D7F A;  1ODB A;  1UP5 A;  1JFK A;  1WLM A;  1RWY A;  2WOS A;  4WQ3 A;  1A75 B;  2FJU B;  1GGW A;  1K2H A;  1IH0 A;  2F8P A;  2RGI A;  2HET A;  3VRN A;  2M9G A;  1TWO A;  1XFW O;  2JPT A;  3D76 A;  3FIA A;  1DJZ A;  1M46 A;  1NYA A;  1REC A;  2BKH B;  4DIR A;  3DYE A;  3S0A A;  1F8H A;  3RLZ A;  4M2P A;  2KFG A;  3FWB A;  2BEC A;  2WND A;  1Z2C B;  2JRF A;  1E8A A;  2JT3 A;  2BBM A;  3BUO B;  1F4O A;  2LMT A;  2MRD A;  2PSR A;  2K7O A;  2K7C A;  2LUC A;  5J3X A;  2O5G A;  1S36 A;  4A4B A;  2LMU A;  1ZUZ A;  1GQM A;  1BJF A;  1NSH A;  1DJY A;  4NQG A;  3SIB A;  4CFR A;  1ZFS A;  4GAO A;  4NDD A;  1U5I A;  4JQ0 D;  2KAV A;  5D69 A;  1MXL C;  1TNQ A;  2HQW A;  2NLN A;  4PCW A;  1FPW A;  1UHK A;  1IRJ A;  3LK0 A;  4HRH A;  5HKY A;  1BR4 B;  1L7Z A;  1QS7 A;  2KI6 C;  3DY9 A;  3SS4 A;  2MJW B;  3VB1 A;  3KHE A;  2ZN8 A;  3S0E A;  2MAZ A;  1DJI A;  1B4C A;  4HRG A;  1OZS A;  2MHH A;  1OOH A;  4PHK A;  1LKJ A;  2JPO A;  5F6T A;  4ZCU A;  2LP2 A;  5I2O A;  1BLQ A;  4CFQ A;  2LVI A;  1WY9 A;  5DKR A;  2I7A A;  1AK8 A;  1GM0 A;  3UNW A;  2OS8 B;  2P70 A;  2BL0 C;  2M3W A;  3GOF A;  5CSN A;  5FI6 A;  5BPJ A;  1L2O C;  1SL7 A;  1QV1 A;  1MF8 B;  1LIN A;  1S6C A;  3VRR A;  1DJH A;  2F3Z A;  2I18 A;  3WHU B;  1Y1U A;  5AXI A;  2PRU A;  1IJ6 A;  1XO5 A;  1NP8 A;  2M7N A;  1PK0 D;  2NXQ A;  3IQO A;  1ALV A;  3VRP A;  4YGA A;  1SCM B;  2LV7 A;  4YGC B;  1CDP A;  3FE8 A;  1S6J A;  2QEV A;  1K9P A;  1KSO A;  1K93 D;  4JPZ B;  1NPQ A;  5TNC A;  1J7P A;  1F70 A;  1CMF A;  4XJK A;  1V1G A;  3EVU A;  5I2Q A;  1H4B A;  2KFF A;  3EG5 B;  1GGZ A;  2BE4 A;  5JOL A;  1IG5 A;  1TRF A;  1OOF A;  1SPY A;  3S0G A;  1CLL A;  4YI8 A;  4M2Q A;  3SG7 A;  3SG4 A;  2JQ6 A;  2OTG C;  2WCF A;  3NHT A;  4GUK A;  1QLK A;  3OX5 A;  1ZOT B;  4JWQ A;  1J1D A;  4PAL A;  4WRI A;  5AER A;  4E68 A;  1RK9 A;  1CLM A;  1NCZ A;  1KFX L;  3BUX B;  1CM4 A;  4C0J A;  1DF0 A;  3HCM A;  3BJH A;  2EC6 C;  3H4S E;  3MSE B;  3NGV A;  2L0P A;  1NX0 A;  1JC2 A;  1KQM B;  4ORB B;  1YX7 A;  2HF5 A;  1W9Z A;  2FJY A;  3DVK A;  4M2O A;  1EH2 A;  3PLF B;  2I2R E;  1YR5 A;  3R72 A;  4KYN A;  3PM8 A;  1DJX A;  5HLO A;  1XFX O;  2KBI A;  4R1E A;  2CTN A;  4OV2 A;  4UPG A;  5KSZ A;  2AUC A;  1CDM A;  2R2I A;  4CLN A;  4BY5 A;  2K2F A;  4TNC A;  4C0K A;  3KEV A;  2JUL A;  1DC1 A;  2JXL A;  1M31 A;  1N0Y A;  3NSI A;  5FI2 A;  5HLV A;  2KAY A;  2KFH A;  1YRU B;  4JD9 A;  1XFZ O;  2BE6 A;  4OR9 B;  1JF2 A;  2JWW A;  3WHT B;  1TNW A;  3LL8 B;  1N65 A;  1W7I B;  2WCM A;  3CTN A;  1M39 A;  1YUU A;  3VRO A;  3CYZ A;  4IL1 A;  3CDN A;  1R6P A;  2JT0 A;  2JU0 A;  1XK4 A;  3V2L A;  4AOM A;  1KQV A;  2L2E A;  2WCL A;  2G9B A;  2WCK A;  2JT8 A;  2LLU A;  2LVK A;  4MBE A;  4XYN A;  3I5G B;  1CNP A;  1B8R A;  3D77 A;  1JF0 A;  2QEB A;  1XA5 A;  2MLF C;  3QME A;  1AP4 A;  2WC6 A;  2QEH A;  2CT9 A;  2KQY A;  2KYC A;  3NHI A;  3DVM A;  2KPH A;  1J1E A;  3E3R A;  2Q91 A;  1ALW A;  2JTZ A;  1PUL A;  4PHM A;  2KBM A;  3VGO A;  2BCB A;  3R1O A;  3NSK A;  2H61 A;  4YGB B;  3BOW B;  1NX2 A;  1CDN A; 
#chains in the Genus database with same CATH homology
 3TDZ A;  1TNX A;  4MSP A;  1XFU O;  3JTD B;  1ZMZ A;  1K95 A;  2ZNE A;  3RM1 A;  4GNK B;  5PAL A;  1GJY A;  4MLW A;  4DS7 A;  3GK2 A;  4GGN A;  1RFJ A;  1TNP A;  4U8D A;  3GK1 A;  4BY4 A;  4YGE B;  1DGU A;  1JUO A;  2LVV A;  5FYX A;  3TUY B;  4MZJ A;  2K0J A;  1KWO B;  1NWD A;  1QX5 B;  2BBN A;  5JJG A;  1KFU S;  5DKQ A;  4GPL B;  2SAS A;  1BU3 A;  2FOT A;  2B1U A;  2JXC A;  5DKN A;  1BOC A;  1SR6 B;  4DCK A;  4PE7 A;  4GGF C;  4PDZ A;  3I5F B;  1S26 D;  2CXJ A;  5HYD A;  2CCM A;  3BUW B;  3M0W A;  1JSA A;  1Y0V H;  3I5I C;  1RRO A;  2FCD A;  2ZN9 A;  2LLS A;  3SG6 A;  3AAJ A;  2L51 A;  4I5J A;  1C7V A;  1FW4 A;  1ZAC A;  4OVN F;  3PAL A;  1CKK A;  1CMG A;  1J7Q A;  2LM5 A;  1AUI B;  4MZL A;  4PE4 A;  3OB2 B;  2KYF A;  1SCM C;  1HT9 A;  1SL8 A;  3DVE A;  2PAL A;  1IWQ A;  2KOT A;  4FQO A;  1NX1 A;  1KSM A;  3OX6 A;  1SMG A;  2AAO A;  1WRL A;  3CGA A;  1DGV A;  5G08 A;  3SG2 A;  5K89 A;  2IS9 A;  1K9K A;  4AQI A;  1SY9 A;  1F55 A;  4GBA A;  1OMR A;  1S3P A;  5CSF A;  2K7D A;  2E6W A;  4WQ2 A;  1MUX A;  1U5I B;  2L5X B;  2FCE A;  2ZFD A;  2ZKM X;  1UWO A;  1YUS A;  1TCO B;  1F4Q A;  4HRE E;  1K90 D;  2CNP A;  3EK8 A;  4MEW A;  4NDC A;  2MLE C;  3LLE A;  3OP0 A;  1KQM C;  2QAC A;  1OOJ A;  1EJ3 A;  1CLB A;  1YRT B;  4ZCV A;  1QX2 A;  4OKH A;  3D0Y A;  1WDC B;  3KPX A;  3BXK A;  3TZ1 A;  1RJV A;  1BF5 A;  5KTY A;  2LMV A;  1IQ3 A;  1QAT A;  1KK8 B;  3ZWH A;  1SW8 A;  1Y1A A;  1BR1 B;  3EK7 A;  3QRX A;  2O60 A;  4QJ5 B;  1AHR A;  1A29 A;  4HSZ A;  1SRA A;  1YVH A;  2V53 A;  2M29 A;  4I5K A;  4P5O E;  1B7T Y;  2PVB A;  3SG3 A;  1QAS A;  5IBW A;  2F2O A;  3O78 A;  1LA3 A;  1LVC D;  1UHI A;  1DT7 B;  4XJK B;  3DD4 A;  1UUS A;  3PAT A;  1J55 A;  1QXP A;  1B9A A;  4I5N B;  1B1G A;  1QVI Y;  1CTR A;  2WCE A;  3CS1 A;  3I5G C;  1QIV A;  1QX7 A;  1YX8 A;  2M1U A;  2L50 A;  1DF0 B;  1PSR A;  1G8I A;  2ZRT A;  2NCP A;  1G4Y R;  1OE9 B;  5ER4 X;  3WNX B;  1G33 A;  2ZND A;  1EG3 A;  3LK1 A;  1YTZ C;  1OMV A;  2PMY A;  1NIW A;  3NSO A;  3NXA A;  2LE9 B;  2Y1M A;  1XK4 C;  1W7J B;  1FF1 A;  1DTL A;  1NX3 A;  2KGB C;  1D1O A;  1OSA A;  3JTD C;  4NDB A;  2GGZ A;  3KO0 A;  2KDH A;  4MZK A;  4ORA B;  3SG5 A;  2M8U A;  3JVT B;  3IF7 A;  4PHN A;  3VRQ A;  5GQQ C;  1CFP A;  3O2P A;  1CFD A;  3TUY C;  3DF0 A;  1JWD A;  1KWO C;  3OB1 B;  3SIA A;  1AVS A;  3EK4 A;  1QJT A;  1QV0 A;  2NCO A;  1FI5 A;  2LUX A;  2L98 A;  1SKT A;  1A75 A;  1S5G Z;  4MVF A;  1SR6 C;  2M49 B;  1WRK A;  2H61 C;  3CR5 X;  1FI6 A;  1B7T Z;  1TCF A;  2BKI B;  3I5F C;  1XVJ A;  2WOR A;  1AJ4 A;  4L9M A;  2K7B A;  2K8M B;  1X02 A;  2F3Y A;  3FWC A;  1KFU L;  2JZI A;  5KU1 A;  1S1E A;  3F45 A;  2WC8 A;  2Y1N A;  1V1F A;  2K2A A;  3EVV A;  1UHH A;  1QIW A;  1QVI Z;  3O6B A;  2F33 A;  5AEQ A;  3I5H B;  2QPT A;  2PAS A;  2K61 A;  2LAP A;  4PHJ A;  1TN4 A;  5HKZ A;  2SCP A;  2Y4Q A;  1AJ5 A;  2M97 A;  1B8C A;  1NCX A;  1EG4 A;  5HKW A;  3TS5 B;  3CR2 A;  1RTP 1;  1K96 A;  3PN7 B;  5AAN A;  2OS8 C;  2DOQ A;  1C07 A;  1XYD A;  3BUM B;  2JNF A;  3BYA A;  4PE1 A;  2KI4 B;  4OCI A;  1IGV A;  1J7R A;  5ER5 A;  3CWG A;  1B47 A;  1S6I A;  3PSR A;  2OPO A;  4GFT A;  1CFF A;  4D1E A;  1A4P A;  2I94 A;  1M45 A;  1PRW A;  2JOJ A;  2LHI A;  3BQ3 A;  2LP3 A;  1A03 A;  1DJG A;  1R2U A;  2KQ6 A;  4YI9 A;  3O4Y A;  4FTG A;  3CR4 X;  4A4C A;  3LCP C;  4I5L B;  1SK6 D;  1KK7 Z;  1OMD A;  2E30 A;  3AKB A;  4CID A;  1LA0 A;  3EVR A;  2ZRS A;  2P6B B;  4GGF A;  1Y6W A;  3CZT X;  1K94 A;  2M7L A;  1F71 A;  3HX4 A;  1WDC C;  2A4J A;  3AKA A;  4YRU A;  2JTT A;  1JFJ A;  4MRY A;  5CPV A;  3SJS A;  3EKH A;  2M0R A;  4MRX A;  3ZNI A;  2KI6 D;  1KK8 C;  1MWN A;  1TTX A;  2AMI A;  1Y1X A;  2VRG A;  2MBX A;  2KNE A;  2COL B;  1XFV O;  1FBV A;  4CPV A;  1IJ5 A;  1BMO A;  2L4I A;  2KGR A;  3A4U B;  1J7O A;  4AQJ A;  1BT6 A;  1SL9 A;  2HQ8 A;  2GGM A;  1NCY A;  2BCX A;  3TDU A;  1SCV A;  1JBA A;  1DVI A;  1PVA A;  3D10 A;  3I5I B;  4YBH B;  1LXF C;  4QJ3 B;  3WXA A;  2BCA A;  4C0L A;  2KAX A;  2GV5 A;  1K8U A;  1S5G Y;  3GK4 X;  4N1F A;  1NUB A;  1M63 B;  1YUT A;  2H2K A;  3TDI A;  5AFP A;  3FS7 A;  2EHB A;  3K21 A;  1PSB A;  4ETO A;  3CLN A;  2LLT A;  4YGD B;  1MQ1 A;  2BL0 B;  1B8L A;  2ISD A;  1L2O B;  1SYM A;  2LVJ A;  1N2D A;  3D0Y B;  1Q80 A;  1CDL A;  1BG1 A;  1PAL A;  4N5X A;  2KHN A;  1DJW A;  1YVL A;  4F0Z B;  2LHL A;  2Q4U A;  1TIZ A;  4Q04 A;  1PVB A;  1DMO A;  3KF9 A;  1XFY O;  1UHN A;  1CB1 A;  3JVT C;  3NSL A;  1OQP A;  1WLZ A;  1YUR A;  1A2X A;  1TOP A;  4ORC B;  1K9U A;  4QJ4 B;  4P2Y B;  1WRZ A;  1KFX S;  1QLS A;  1MXE A;  2NZ0 A;  1CFC A;  1HQV A;  2WCB A;  2F2P A;  2JC2 A;  2TN4 A;  1UUR A;  1EXR A;  2CBL A;  3A8R A;  5B8I B;  5I2L A;  3IQQ A;  2MA2 A;  5CSI A;  2OTG B;  3BUN B;  1F54 A;  1BOD A;  4MN0 A;  2KSP A;  1C7W A;  4DUQ A;  2G2B A;  1KK7 Y;  3C1V A;  5I8N A;  2M1K B;  2EC6 B;  1UHJ A;  3AAK A;  1EL4 A;  1VRK A;  1MHO A;  1QTX A;  3I5H C;  2JNX A;  2EGD A;  2LCP A;  1IQ5 A;  1OZO A;  3TS5 C;  3PN7 C;  4ICB A;  3BOW A;  1KCY A;  2LNK A;  1SBJ A;  2LC5 A;  2Y5I A;  4PE0 A;  3EKJ A;  1CM1 A;  2HPS A;  2L4H A;  2D8N A;  2KI4 C;  1MR8 A;  1H8B A;  1SNL A;  3ICB A;  3PFV A;  1IKU A;  4DRW A;  3DF0 B;  5CSJ A;  3DVJ A;  4USL A;  3OHM B;  4N1G A;  2LAN A;  5D7F A;  1ODB A;  1UP5 A;  1JFK A;  1WLM A;  1RWY A;  2WOS A;  4WQ3 A;  1A75 B;  2FJU B;  1GGW A;  1K2H A;  1IH0 A;  2F8P A;  2RGI A;  2HET A;  3VRN A;  2M9G A;  1XFW O;  2JPT A;  3FIA A;  1DJZ A;  1M46 A;  1NYA A;  1REC A;  2BKH B;  4DIR A;  1F8H A;  3RLZ A;  4M2P A;  2KFG A;  3FWB A;  2BEC A;  2WND A;  2JRF A;  1E8A A;  2JT3 A;  2BBM A;  3BUO B;  1F4O A;  2LMT A;  2MRD A;  2PSR A;  2K7O A;  2K7C A;  2LUC A;  5J3X A;  2O5G A;  1S36 A;  4A4B A;  2LMU A;  1ZUZ A;  1GQM A;  1BJF A;  1NSH A;  1DJY A;  4NQG A;  3SIB A;  4CFR A;  1ZFS A;  4GAO A;  4NDD A;  1U5I A;  4JQ0 D;  2KAV A;  5D69 A;  1MXL C;  1TNQ A;  2HQW A;  2NLN A;  4PCW A;  1FPW A;  1UHK A;  1IRJ A;  3LK0 A;  4HRH A;  5HKY A;  1BR4 B;  1L7Z A;  1QS7 A;  2KI6 C;  2MJW B;  3KHE A;  2ZN8 A;  1B4C A;  2MAZ A;  1DJI A;  4HRG A;  1OZS A;  2MHH A;  5I2O A;  4PHK A;  1LKJ A;  4ZCU A;  5F6T A;  2LP2 A;  1BLQ A;  4CFQ A;  2LVI A;  1WY9 A;  5DKR A;  2I7A A;  1AK8 A;  2OS8 B;  2BL0 C;  2M3W A;  3GOF A;  5CSN A;  5BPJ A;  1L2O C;  1SL7 A;  1QV1 A;  1MF8 B;  1LIN A;  1S6C A;  3VRR A;  1DJH A;  2F3Z A;  2I18 A;  3WHU B;  1Y1U A;  5AXI A;  2PRU A;  1IJ6 A;  1XO5 A;  1NP8 A;  2M7N A;  1PK0 D;  2NXQ A;  3IQO A;  1ALV A;  3VRP A;  4YGA A;  1SCM B;  2LV7 A;  4YGC B;  1CDP A;  5TNC A;  1S6J A;  1J7P A;  1K9P A;  1KSO A;  1K93 D;  4JPZ B;  1NPQ A;  1F70 A;  1CMF A;  4XJK A;  1V1G A;  3EVU A;  5I2Q A;  1H4B A;  2KFF A;  1GGZ A;  2BE4 A;  5JOL A;  1IG5 A;  1TRF A;  1SPY A;  1CLL A;  4YI8 A;  4M2Q A;  3SG7 A;  3SG4 A;  2JQ6 A;  2OTG C;  2WCF A;  4GUK A;  1QLK A;  3OX5 A;  1ZOT B;  4JWQ A;  1J1D A;  4PAL A;  4WRI A;  5AER A;  4E68 A;  1RK9 A;  1CLM A;  1NCZ A;  1KFX L;  3BUX B;  1CM4 A;  4C0J A;  1DF0 A;  3HCM A;  2EC6 C;  3H4S E;  3MSE B;  2L0P A;  1NX0 A;  1JC2 A;  1KQM B;  4ORB B;  1YX7 A;  2HF5 A;  3DVK A;  4M2O A;  1EH2 A;  3PLF B;  2I2R E;  1YR5 A;  3PM8 A;  1DJX A;  5HLO A;  1XFX O;  2KBI A;  4R1E A;  2CTN A;  4OV2 A;  4UPG A;  5KSZ A;  2AUC A;  1CDM A;  2R2I A;  4CLN A;  4BY5 A;  2K2F A;  4TNC A;  4C0K A;  3KEV A;  2JUL A;  2JXL A;  1M31 A;  1N0Y A;  3NSI A;  5HLV A;  2KAY A;  2KFH A;  1YRU B;  1XFZ O;  2BE6 A;  4OR9 B;  1JF2 A;  2JWW A;  3WHT B;  1TNW A;  3LL8 B;  1N65 A;  1W7I B;  3CTN A;  1M39 A;  1YUU A;  3VRO A;  4IL1 A;  1R6P A;  2JT0 A;  2JU0 A;  1XK4 A;  4AOM A;  1KQV A;  2L2E A;  2G9B A;  2JT8 A;  2LLU A;  2LVK A;  4MBE A;  4XYN A;  3I5G B;  1CNP A;  1B8R A;  1JF0 A;  1AP4 A;  1XA5 A;  2MLF C;  2CT9 A;  2KQY A;  2KYC A;  3DVM A;  1J1E A;  3E3R A;  2Q91 A;  1ALW A;  2JTZ A;  1PUL A;  4PHM A;  2KBM A;  3VGO A;  2BCB A;  3NSK A;  2H61 A;  4YGB B;  3BOW B;  1NX2 A;  1CDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...