2NCOA

Nmr solution structure for the c-terminal domain of tetrahymena tcb2 in the absence of calcium
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
102
structure length
102
Chain Sequence
SSKPKYNPEVEAKLDVARRLFKRYDKDGSGQLQDDEIAGLLKDTYAEMGMSNFTPTKEDVKIWLQMADTNSDGSVSLEEYEDLIIKSLQKAGIRVEKQSLVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 25 kDa calcium-binding protein
publication title Solution NMR structures of the C-domain of Tetrahymena cytoskeletal protein Tcb2 reveal distinct calcium-induced structural rearrangements.
pubmed doi rcsb
source organism Tetrahymena thermophila
molecule tags Metal binding protein
total genus 20
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2016-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2ncoA00
1EJ3A 1OMVA 1PK0D 4HREE 5FYXA 2H61A 1J7OA 1PVAA 1S6JA 2L4IA 4ZCVA 2NCOA 4OV2A 1YVLA 2O60A 5JOLA 1UHKA 1JUOA 1SYMA 2JXCA 4DIRA 2KDHA 2KI4C 4GGNA 1UHNA 2MAZA 3PN7B 1KQVA 1B8RA 2I94A 5I2OA 2KGBC 1B7TZ 2KFHA 1QLSA 1DJIA 1SY9A 2BCXA 2LLSA 5KTYA 1UWOA 1J7PA 1QX2A 5CSIA 5AERA 1DF0A 4GBAA 1KQMC 3CR4X 3LK0A 2DOQA 1KWOB 1OQPA 2KOTA 2LCPA 1BG1A 1FI5A 2F2OA 1H8BA 3O2PA 4MEWA 2I18A 1UURA 2ZRTA 4I5KA 1B7TY 1RFJA 1TNWA 2AMIA 2TN4A 1BR4B 3CZTX 1GJYA 1OMDA 3RLZA 2KAXA 1YUTA 4P5OE 2KI6D 3VRRA 1OMRA 4N1GA 2PRUA 2COLB 5HKYA 2F3YA 1TNPA 3BUNB 2K61A 2AUCA 1AK8A 3MSEB 3I5FC 2KFFA 5B8IB 1UHHA 4M2PA 1K96A 1YRUB 3DVJA 2L50A 1QXPA 1C7WA 1SPYA 1F55A 1KK8C 1OZSA 5G08A 1IGVA 1GGWA 1BT6A 1DJHA 1NIWA 2L51A 4ICBA 3VRPA 3A8RA 4CFQA 1DT7B 1V1FA 2B1UA 2MA2A 1M45A 4NQGA 5AANA 1AJ4A 1ALWA 4PHKA 3TS5C 1QJTA 2BL0B 3EK7A 2L5XB 1YRTB 1NUBA 1AHRA 1BR1B 1S36A 2ZKMX 1U5IA 4F0ZB 5D7FA 1QIWA 3I5GC 1LXFC 1YTZC 2KQYA 4WQ2A 1RWYA 3H4SE 1R6PA 2NLNA 1WLZA 1ALVA 3GK1A 2FCEA 4YGEB 1MR8A 2M3WA 1K9UA 2Y1NA 4DRWA 4NDCA 2L2EA 2ZFDA 3IQQA 1XFZO 3A4UB 1UHIA 1SL7A 3SG7A 4PHNA 3TDUA 1SBJA 4Q04A 3NSIA 4PDZA 4MRYA 1MF8B 1ZFSA 2JXLA 4YI9A 2EGDA 4PHJA 1XFYO 1CKKA 1SW8A 1F4OA 2LE9B 1MXLC 2JPTA 2MLFC 2M97A 5DKRA 2KI6C 2LMUA 3DF0A 3CR2A 4DUQA 1MQ1A 1NCZA 3BUOB 4HRGA 3PM8A 3O6BA 1RJVA 2NXQA 1DF0B 2WCFA 1PSRA 1OZOA 3NXAA 1RROA 4USLA 2LVVA 2LMTA 2JTZA 1FW4A 1QIVA 1NX0A 4PE1A 1B1GA 1JSAA 1JBAA 3LK1A 1PSBA 1S6CA 3I5IB 1BODA 3PATA 1N2DA 4A4CA 1TOPA 1CTRA 1B8CA 2LNKA 1IRJA 1S6IA 1DJGA 5HLVA 4QJ4B 1D1OA 4WRIA 3SG4A 3KO0A 1WDCB 2CCMA 1YX8A 3EVVA 1J7RA 2SASA 4C0LA 1K90D 2LC5A 3D0YA 4OCIA 1SNLA 1MXEA 2I2RE 3TUYC 1J1DA 1J55A 3IF7A 1L2OC 4MRXA 1XYDA 2JT8A 2FJUB 2K2AA 1YR5A 1UHJA 4CLNA 1LA3A 1CDNA 2OS8B 1SK6D 2CXJA 3DD4A 1BU3A 4ORBB 3QRXA 1DVIA 2F3ZA 2MJWB 4GGFC 3BQ3A 3TS5B 1SCMC 1NYAA 5CSJA 3BUMB 5DKQA 3O78A 1KCYA 5TNCA 4P2YB 2KAVA 1CFPA 1U5IB 1AVSA 3OP0A 1QASA 2KYCA 3ZNIA 4QJ3B 1N65A 1IWQA 2ZRSA 2WORA 2LHIA 2WCBA 1CM4A 3PFVA 2MBXA 1M31A 2K7OA 1QV1A 1IJ5A 2F2PA 2EC6C 2FOTA 2Q91A 3KF9A 3SIBA 2HQWA 1IKUA 1CLBA 2BE6A 2RGIA 3AKBA 2LUCA 1WRZA 4NDBA 1XFWO 4OR9B 1VRKA 1SR6C 2I7AA 1EG4A 2LVIA 2P6BB 1XVJA 2SCPA 5CSNA 3NSKA 1TCOB 1XFXO 3GK2A 1S3PA 3JTDB 1JFJA 2Y1MA 1CNPA 3O4YA 4CIDA 1NSHA 1MUXA 3OX5A 1A03A 1BJFA 4YGAA 1GGZA 3I5HB 3FWCA 3DF0B 3BUXB 3CTNA 5I2LA 1NPQA 2LP3A 2M29A 1RECA 2WOSA 1SKTA 2BKHB 1QV0A 5HKZA 4L9MA 1X02A 2LLUA 1KFXL 2EHBA 1K93D 1S26D 3FWBA 3JVTB 1CFFA 2GV5A 2CTNA 1XFUO 2QPTA 5HKWA 3KEVA 3TDZA 4N5XA 3HCMA 2OTGC 1NWDA 1ZOTB 5HLOA 1S5GY 2ISDA 5D69A 1CDLA 2KSPA 1BMOA 2NCPA 1F4QA 2KFGA 1RK9A 2JQ6A 3CWGA 3D0YB 1JF2A 2ZN9A 3EKJA 2ZN8A 3ICBA 3KHEA 3M0WA 4XJKA 1QVIZ 1E8AA 2G2BA 1WLMA 2KHNA 2LHLA 2Y4QA 1EL4A 1CDMA 1NX2A 1ZACA 1UP5A 2FCDA 2WC8A 3PN7C 5DKNA 1KK7Y 1KSMA 5AEQA 3PSRA 5AXIA 2GGMA 2WCEA 1G8IA 3VROA 2E6WA 1KWOC 2JZIA 2K7BA 2L4HA 3BYAA 2BBNA 3EVRA 4HRHA 1DTLA 2KI4B 1QVIY 2MHHA 4YRUA 3KPXA 1PULA 1CMFA 1L7ZA 1QTXA 2K2FA 5J3XA 2Q4UA 1LA0A 1TRFA 2MLEC 1A75A 2L0PA 1UUSA 1ZUZA 2IS9A 5I2QA 1H4BA 1KQMB 1YURA 4MSPA 1V1GA 4ETOA 2JC2A 3BUWB 4FTGA 1DJZA 2JULA 3E3RA 4ZCUA 3TZ1A 4PE4A 2LAPA 1HQVA 2JT0A 2KAYA 1B8LA 1SMGA 4PCWA 2NZ0A 1KFUS 4MLWA 2PMYA 3PALA 4U8DA 1YUUA 5F6TA 1A4PA 4MZJA 2M7LA 2LP2A 3EK4A 4I5NB 1CMGA 2QACA 3K21A 2VRGA 4R1EA 1GQMA 2JU0A 3EK8A 4YGDB 4DS7A 1FBVA 3EKHA 1DJXA 1CLMA 2LVJA 1W7IB 3I5FB 1F71A 1QLKA 2L98A 2K7CA 2E30A 1M46A 1Q80A 2BL0C 1WRKA 2M7NA 1CM1A 1KK8B 4FQOA 2M9GA 1R2UA 1Y0VH 2H2KA 4I5LB 1C7VA 1MHOA 1QS7A 4PHMA 4YI8A 1YX7A 2O5GA 3SG3A 2JT3A 2BE4A 2HPSA 3GK4X 1QX5B 4GGFA 5HYDA 4HSZA 1XK4C 3LLEA 1LVCD 1SRAA 2M8UA 1SL8A 5GQQC 1QX7A 2JNXA 3ZWHA 1LINA 4XYNA 3WXAA 3F45A 3I5GB 3LCPC 2BCBA 2PALA 4NDDA 4JWQA 1G33A 1WRLA 4OVNF 4MVFA 1J7QA 1AUIB 3RM1A 3VGOA 2LVKA 4PALA 1PRWA 2H61C 1EH2A 2M49B 1Y1UA 1QATA 2G9BA 3SG5A 5JJGA 1CB1A 2AAOA 4XJKB 3OHMB 1IJ6A 1K9KA 1OSAA 3AKAA 3DVKA 2OPOA 2K8MB 2F8PA 3VRQA 2BKIB 1M39A 1DGUA 2D8NA 1B4CA 2JNFA 1Y1AA 1TCFA 3CLNA 2BCAA 1N0YA 1IG5A 5KU1A 2LV7A 1CDPA 1NP8A 4PE7A 4ORAB 3EVUA 4ORCB 1S5GZ 3CR5X 3I5IC 1A75B 1S1EA 2Y5IA 2KNEA 3BXKA 1FPWA 3SG6A 2PVBA 1Y6WA 1KFUL 4GFTA 1WDCC 3WHUB 1BOCA 4JQ0D 1CFDA 4A4BA 4MZLA 4C0KA 1BLQA 1C07A 4AQIA 2R2IA 1J1EA 1TNQA 3SIAA 3LL8B 1K9PA 3CGAA 4QJ5B 1CFCA 5K89A 1FI6A 3OB2B 1KK7Z 4TNCA 4IL1A 2LM5A 1NCXA 1NCYA 2OS8C 1M63B 2KQ6A 2M1KB 1HT9A 4I5JA 2CT9A 4N1FA 4OKHA 4YGBB 3FIAA 4YBHB 3TUYB 4UPGA 4GPLB 1L2OB 1K2HA 4M2QA 1ZMZA 4GNKB 1B9AA 1RTP1 2GGZA 3SG2A 2JOJA 4BY5A 2LMVA 2JRFA 3IQOA 1A29A 4BY4A 4MZKA 1SCVA 5AFPA 5KSZA 3GOFA 5PALA 1LKJA 1SCMB 3DVMA 4AQJA 2MRDA 4M2OA 2HQ8A 1DJYA 1DJWA 2PSRA 2KGRA 1TN4A 3AAJA 1PALA 3DVEA 4E68A 1KSOA 4C0JA 2A4JA 2LUXA 1EXRA 1W7JB 2K7DA 3PLFB 2M1UA 3BOWB 1YUSA 2HETA 5ER4X 5ER5A 3D10A 1DGVA 3OB1B 1WY9A 1F54A 2F33A 1B47A 1JF0A 2JWWA 5CSFA 1Y1XA 2K0JA 1DMOA 3JTDC 1AP4A 1A2XA 1EG3A 2BBMA 2EC6B 4CFRA 2M0RA 2LANA 4PE0A 1JC2A 1G4YR 2LLTA 3I5HC 4WQ3A 3WHTB 1CLLA 2V53A 1K95A 1SR6B 3VRNA 3OX6A 2WNDA 1AJ5A 1XA5A 2ZNDA 2HF5A 1K8UA 1TTXA 1IH0A 1NX3A 3NSLA 3NSOA 4CPVA 1FF1A 2PASA 2KBMA 2KBIA 1XFVO 5BPJA 2BECA 1YVHA 3C1VA 1NX1A 1OOJA 3JVTC 1XO5A 1TIZA 1IQ3A 2CBLA 4D1EA 4DCKA 1OE9B 2ZNEA 4YGCB 1F70A 5IBWA 3HX4A 1KFXS 1F8HA 2KYFA 1BF5A 3CS1A 4MN0A 5CPVA 1IQ5A 1MWNA 1XK4A 2CNPA 3TDIA 5I8NA 4GAOA 1ODBA 1JWDA 4AOMA 2OTGB 1TNXA 3WNXB 1JFKA 3FS7A 3SJSA 3BOWA 4GUKA 3AAKA 1PVBA 1SL9A 1K94A 2JTTA 4JPZB 4MBEA
chains in the Genus database with same CATH superfamily
3O4XA 1EJ3A 1OMVA 5HL1A 2WCLA 1PK0D 4HREE 5FYXA 2H61A 1J7OA 1PVAA 1S6JA 2L4IA 4ZCVA 2NCOA 4OV2A 3DXLA 1YVLA 2O60A 5JOLA 1UHKA 1JUOA 1SYMA 2JXCA 5FI7A 4DIRA 2KDHA 2KI4C 3FE8A 3N7HA 4GGNA 1UHNA 2MAZA 2JPOA 3CYZA 3PN7B 1B8RA 2I94A 5I2OA 1KQVA 2KGBC 1B7TZ 2KFHA 1QLSA 1DJIA 1SY9A 2BCXA 2LLSA 5KTYA 1UWOA 1J7PA 1QX2A 5CSIA 3K1EA 1DF0A 4GBAA 5AERA 3S0AA 1KQMC 3CR4X 3LK0A 2DOQA 1KWOB 4KYNA 1OQPA 2KOTA 2LCPA 1BG1A 1FI5A 4YRUA 2F2OA 5FI6A 1H8BA 3O2PA 3R72A 4MEWA 2I18A 1UURA 2ZRTA 4I5KA 3SS5A 1B7TY 1RFJA 1TNWA 2AMIA 2TN4A 1BR4B 3CZTX 1GJYA 3FE6A 1OMDA 3RLZA 2KAXA 1YUTA 4P5OE 2KI6D 3VRRA 5EL2A 1OMRA 4N1GA 2PRUA 3IVTA 2COLB 5HKYA 2F3YA 1TNPA 3BUNB 2K61A 2AUCA 1AK8A 3MSEB 3I5FC 2KFFA 5B8IB 1UHHA 3R1VA 1K96A 1YRUB 3DVJA 4M2PA 2L50A 1QXPA 1C7WA 1SPYA 1F55A 1KK8C 1OZSA 5G08A 1IGVA 1GGWA 1BT6A 1DJHA 1NIWA 2L51A 4ICBA 3VRPA 3A8RA 2L5YA 4CFQA 1DT7B 1V1FA 2B1UA 2MA2A 1M45A 4NQGA 5AANA 1AJ4A 1ALWA 4PHKA 3S0BA 3TS5C 1QJTA 2BL0B 3EK7A 2L5XB 3UO9A 1YRTB 1NUBA 1AHRA 1BR1B 1S36A 2ZKMX 1U5IA 4F0ZB 5D7FA 1QIWA 4JKTA 3I5GC 1LXFC 1YTZC 2KQYA 3B87A 1RWYA 4WQ2A 3D77A 3H4SE 3S0FA 2L2CA 1R6PA 1LS8A 2NLNA 1WLZA 1ALVA 3GK1A 2FCEA 4YGEB 1MR8A 2M3WA 1K9UA 1P28A 2Y1NA 4DRWA 4NDCA 2L2EA 2ZFDA 3IQQA 1XFZO 3A4UB 1C3YA 1UHIA 2KLDA 1SL7A 3BJHA 3SG7A 4PHNA 3TDUA 1SBJA 4Q04A 3NSIA 4PDZA 3NGVA 4MRYA 1MF8B 1ZFSA 2JXLA 4YI9A 2EGDA 4PHJA 1OOHA 1XFYO 1CKKA 1SW8A 1F4OA 2LE9B 1MXLC 2JPTA 2MLFC 2M97A 5DKRA 2KI6C 2LMUA 3DF0A 3CR2A 4DUQA 1MQ1A 2ERBA 1NCZA 3BUOB 4HRGA 3SS4A 3PM8A 5D3OA 3S0EA 3O6BA 1RJVA 2NXQA 1DF0B 2WCFA 1PSRA 1OZOA 3NXAA 1RROA 4USLA 2LVVA 2LMTA 2JTZA 1FW4A 1QIVA 2QEOA 1NX0A 4PE1A 1B1GA 1JSAA 1JBAA 3LK1A 1PSBA 1S6CA 3I5IB 1BODA 3PATA 1N2DA 4A4CA 1TOPA 1CTRA 1B8CA 2LNKA 1IRJA 1S6IA 1DJGA 5HLVA 4QJ4B 1TWOA 1D1OA 4WRIA 3SG4A 3KO0A 1WDCB 3D78A 2CCMA 1YX8A 2WCJA 3BFAA 3EVVA 1J7RA 2SASA 4C0LA 1K90D 2LC5A 3D0YA 4OCIA 1IIOA 3Q8IA 1SNLA 1MXEA 2I2RE 3TUYC 1J1DA 1J55A 3IF7A 1L2OC 4MRXA 1XYDA 2JT8A 2FJUB 2K2AA 1YR5A 1UHJA 4CLNA 1LA3A 1CDNA 2OS8B 1SK6D 1QWVA 2CXJA 3DD4A 1XFRA 1BU3A 4ORBB 3VB1A 3QRXA 1DVIA 2F3ZA 2MJWB 4GGFC 3BQ3A 3TS5B 1SCMC 1NYAA 5CSJA 3BUMB 5DKQA 3O78A 1KCYA 5TNCA 4P2YB 2KAVA 1CFPA 1U5IB 1AVSA 3OP0A 1QASA 2KYCA 3ZNIA 4QJ3B 1N65A 1IWQA 2ZRSA 2WORA 2LHIA 2WCBA 1CM4A 3PFVA 2MBXA 1M31A 2K7OA 1QV1A 1IJ5A 2F2PA 2EC6C 2FOTA 2Q91A 3KF9A 3SIBA 3D76A 1SSEB 2HQWA 1IKUA 1CLBA 2BE6A 2RGIA 3AKBA 2LUCA 1WRZA 4NDBA 1XFWO 4OR9B 1VRKA 1SR6C 2I7AA 1EG4A 2LVIA 2P6BB 1XVJA 2SCPA 5CSNA 3NSKA 1DC1A 1TCOB 1DEKA 1XFXO 3GK2A 1S3PA 3JTDB 1JFJA 2Y1MA 1CNPA 2WCMA 3O4YA 1NSHA 4CIDA 1MUXA 4HRHA 3OX5A 1A03A 1BJFA 4YGAA 1GGZA 3I5HB 3CZ2A 3FWCA 3DF0B 3BUXB 3CTNA 5I2LA 1NPQA 2LP3A 2M29A 3OGNA 1RECA 2WOSA 1SKTA 2BKHB 1QV0A 5HKZA 4L9MA 1OOFA 1X02A 2LLUA 1KFXL 3CDNA 2EHBA 1K93D 1S26D 3FWBA 3JVTB 1CFFA 3B88A 2GV5A 2CTNA 1XFUO 2KPHA 2QPTA 3KEVA 5HKWA 3TDZA 4N5XA 3HCMA 2OTGC 1NWDA 1ZOTB 5HLOA 1S5GY 3EG5B 2ISDA 5D69A 1CDLA 1C3ZA 2KSPA 1BMOA 2NCPA 3D73A 2WC5A 1W9ZA 1F4QA 2KFGA 1RK9A 2JQ6A 3CWGA 3D0YB 1JF2A 2ZN9A 3EKJA 2ZN8A 3ICBA 3KHEA 3M0WA 4XJKA 1QVIZ 1E8AA 2G2BA 1WLMA 2KHNA 2LHLA 2Y4QA 1TUJA 3DZTA 1EL4A 1CDMA 1NX2A 1ZACA 1UP5A 2FCDA 2WC8A 3PN7C 5DKNA 1KK7Y 1KSMA 5AEQA 3PSRA 5AXIA 2GGMA 2WCEA 1G8IA 3VROA 2E6WA 1KWOC 2JZIA 2K7BA 2L4HA 3BYAA 2BBNA 3EVRA 3L4LA 1DTLA 2KI4B 1QVIY 2MHHA 3NHTA 3KPXA 1PULA 4FQTA 1L7ZA 1CMFA 1QTXA 1Z4HA 2K2FA 5J3XA 2Q4UA 1LA0A 1TRFA 2MLEC 1A75A 4INXA 2L0PA 1UUSA 1ZUZA 2IS9A 5I2QA 2PYQA 1H4BA 1KQMB 1YURA 4MSPA 1V1GA 4ETOA 2JC2A 3BUWB 4FTGA 1DJZA 1ORGA 2JULA 3E3RA 2K60A 4ZCUA 3TZ1A 4PE4A 2LAPA 1HQVA 2JT0A 2KAYA 1B8LA 1SMGA 4PCWA 2NZ0A 1KFUS 4MLWA 2PMYA 3PALA 4U8DA 1YUUA 5F6TA 1A4PA 2BAPA 4MZJA 2M7LA 2LP2A 3EK4A 4I5NB 1CMGA 2QACA 3K21A 3BFBA 2VRGA 4R1EA 1GQMA 2JU0A 2GTEA 3EK8A 4YGDB 4DS7A 1FBVA 3EKHA 1DJXA 1CLMA 2LVJA 1W7IB 3I5FB 1F71A 1QLKA 2L98A 2K7CA 2E30A 3CZ0A 1M46A 1Q80A 2BL0C 1DQEA 1WRKA 1CM1A 1KK8B 2M7NA 2M9GA 1R2UA 1Y0VH 2H2KA 3D74A 3D75A 4I5LB 1C7VA 1MHOA 1QS7A 2H8VA 4PHMA 4YI8A 1YX7A 2O5GA 3SG3A 2JT3A 2BE4A 2HPSA 3GK4X 1QX5B 4GGFA 1Z2CB 4HSZA 5HYDA 1XK4C 3LLEA 2QDIA 1LVCD 1SRAA 2M8UA 1DELA 1SL8A 5GQQC 1QX7A 2JNXA 3ZWHA 1LINA 4XYNA 3B7AA 3WXAA 3F45A 3I5GB 3LCPC 2BCBA 2PALA 4NDDA 4JWQA 1G33A 1WRLA 4OVNF 4MVFA 1J7QA 1AUIB 3NHIA 3RM1A 3VGOA 2LVKA 4PALA 1PRWA 2H61C 3RZSA 1EH2A 2M49B 1Y1UA 1QATA 2G9BA 3SG5A 5JJGA 3CZ1A 1CB1A 2AAOA 3PM2A 4XJKB 3R1OA 3OHMB 1IJ6A 1K9KA 1OSAA 3AKAA 3DVKA 2OPOA 2K8MB 2QEVA 2F8PA 3VRQA 1GM0A 2BKIB 1M39A 1DGUA 2D8NA 1B4CA 2JNFA 1Y1AA 3L47A 1TCFA 3CLNA 3S0DA 2BCAA 1N0YA 1IG5A 5KU1A 2LV7A 1CDPA 3R1PA 1NP8A 4PE7A 4ORAB 3EVUA 4ORCB 1S5GZ 3CR5X 3I5IC 3DY9A 1A75B 3L4AA 5DICA 2BNXA 1S1EA 2Y5IA 4PT1A 2KNEA 3BXKA 1FPWA 3SG6A 2PVBA 1Y6WA 1KFUL 4GFTA 1WDCC 4F7FA 3DYEA 3WHUB 3FE9A 2WCHA 1BOCA 4JQ0D 1CFDA 2P71A 4MZLA 4A4BA 4C0KA 1BLQA 1C07A 4AQIA 2R2IA 1J1EA 1TNQA 3BFHA 3LL8B 1K9PA 3CGAA 3SIAA 3SS3A 4QJ5B 5K89A 1CFCA 1FI6A 3OB2B 1KK7Z 4TNCA 4IL1A 2LM5A 1NCXA 1NCYA 2OS8C 1M63B 2KQ6A 2M1KB 1HT9A 4I5JA 2CT9A 3OBVA 4N1FA 4OKHA 4YGBB 2KLEA 3FIAA 4YBHB 3TUYB 4GPLB 4UPGA 1L2OB 3UNWA 1K2HA 2PQLA 4M2QA 1ZMZA 4GNKB 1B9AA 1RTP1 2GGZA 4INWA 3SG2A 2JOJA 4BY5A 2LMVA 2JRFA 3IQOA 1A29A 4BY4A 2FJYA 4MZKA 2WCKA 3B6XA 3QMEA 1SCVA 5AFPA 5KSZA 5FI2A 3GOFA 5PALA 1LKJA 1SCMB 3DVMA 4AQJA 1OW4A 1T14A 2MRDA 4M2OA 2HQ8A 1DJYA 1DJWA 1OOIX 2KGRA 1TN4A 2PSRA 1PALA 3AAJA 3DVEA 4E68A 1KSOA 3PJIA 4C0JA 2A4JA 2LUXA 3CABA 1EXRA 1W7JB 2K7DA 3PLFB 2M1UA 3BOWB 1YUSA 2HETA 2P70A 5ER4X 5ER5A 3D10A 1DGVA 3OB1B 1WY9A 1F54A 2F33A 1B47A 1JF0A 2JWWA 5CSFA 1Y1XA 2K0JA 1DMOA 3JTDC 1AP4A 3S0GA 1A2XA 1EG3A 2BBMA 2EC6B 3V2LA 2M0RA 4CFRA 4JD9A 2LANA 4FQOA 4PE0A 1G4YR 2LLTA 3I5HC 4WQ3A 1JC2A 3WHTB 1CLLA 2V53A 1K95A 1SR6B 3VRNA 3OX6A 2WNDA 1AJ5A 1XA5A 2ZNDA 2HF5A 1K8UA 1TTXA 1IH0A 1NX3A 1OOGA 3NSLA 3NSOA 4CPVA 1FF1A 2PASA 2KBMA 2KBIA 1XFVO 5BPJA 2WC6A 4OZDA 2YGUA 2BECA 1YVHA 5I94A 3C1VA 1NX1A 1OOJA 3JVTC 1XO5A 1TIZA 1IQ3A 2CBLA 4D1EA 4DCKA 1OE9B 2ZNEA 4YGCB 1F70A 5IBWA 2QEHA 3HX4A 1KFXS 1F8HA 2KYFA 1BF5A 3CS1A 4MN0A 5CPVA 1IQ5A 1MWNA 4IJ7A 1XK4A 2CNPA 3TDIA 5I8NA 3B86A 4GAOA 1ODBA 1JWDA 4AOMA 1TUZA 1TNXA 2OTGB 3WNXB 1JFKA 3FS7A 3SJSA 3BOWA 4GUKA 3AAKA 1PVBA 1SL9A 1K94A 2JTTA 4JPZB 4MBEA 2QEBA
chains in the Genus database with same CATH topology
1EJ3A 1OMVA 1PK0D 4HREE 5FYXA 2H61A 1J7OA 1PVAA 1S6JA 2L4IA 4ZCVA 2NCOA 4OV2A 1YVLA 2O60A 5JOLA 1UHKA 1JUOA 1SYMA 2JXCA 4DIRA 2KDHA 2KI4C 4GGNA 1UHNA 2MAZA 3PN7B 1KQVA 1B8RA 2I94A 5I2OA 2KGBC 1B7TZ 2KFHA 1QLSA 1DJIA 1SY9A 2BCXA 2LLSA 5KTYA 1UWOA 1J7PA 1QX2A 5CSIA 5AERA 1DF0A 4GBAA 1KQMC 3CR4X 3LK0A 2DOQA 1KWOB 1OQPA 2KOTA 2LCPA 1BG1A 1FI5A 2F2OA 1H8BA 3O2PA 4MEWA 2I18A 1UURA 2ZRTA 4I5KA 1B7TY 1RFJA 1TNWA 2AMIA 2TN4A 1BR4B 3CZTX 1GJYA 1OMDA 3RLZA 2KAXA 1YUTA 4P5OE 2KI6D 3VRRA 1OMRA 4N1GA 2PRUA 2COLB 5HKYA 2F3YA 1TNPA 3BUNB 2K61A 2AUCA 1AK8A 3MSEB 3I5FC 2KFFA 5B8IB 1UHHA 4M2PA 1K96A 1YRUB 3DVJA 2L50A 1QXPA 1C7WA 1SPYA 1F55A 1KK8C 1OZSA 5G08A 1IGVA 1GGWA 1BT6A 1DJHA 1NIWA 2L51A 4ICBA 3VRPA 3A8RA 4CFQA 1DT7B 1V1FA 2B1UA 2MA2A 1M45A 4NQGA 5AANA 1AJ4A 1ALWA 4PHKA 3TS5C 1QJTA 2BL0B 3EK7A 2L5XB 1YRTB 1NUBA 1AHRA 1BR1B 1S36A 2ZKMX 1U5IA 4F0ZB 5D7FA 1QIWA 3I5GC 1LXFC 1YTZC 2KQYA 4WQ2A 1RWYA 3H4SE 1R6PA 2NLNA 1WLZA 1ALVA 3GK1A 2FCEA 4YGEB 1MR8A 2M3WA 1K9UA 2Y1NA 4DRWA 4NDCA 2L2EA 2ZFDA 3IQQA 1XFZO 3A4UB 1UHIA 1SL7A 3SG7A 4PHNA 3TDUA 1SBJA 4Q04A 3NSIA 4PDZA 4MRYA 1MF8B 1ZFSA 2JXLA 4YI9A 2EGDA 4PHJA 1XFYO 1CKKA 1SW8A 1F4OA 2LE9B 1MXLC 2JPTA 2MLFC 2M97A 5DKRA 2KI6C 2LMUA 3DF0A 3CR2A 4DUQA 1MQ1A 1NCZA 3BUOB 4HRGA 3PM8A 3O6BA 1RJVA 2NXQA 1DF0B 2WCFA 1PSRA 1OZOA 3NXAA 1RROA 4USLA 2LVVA 2LMTA 2JTZA 1FW4A 1QIVA 1NX0A 4PE1A 1B1GA 1JSAA 1JBAA 3LK1A 1PSBA 1S6CA 3I5IB 1BODA 3PATA 1N2DA 4A4CA 1TOPA 1CTRA 1B8CA 2LNKA 1IRJA 1S6IA 1DJGA 5HLVA 4QJ4B 1D1OA 4WRIA 3SG4A 3KO0A 1WDCB 2CCMA 1YX8A 3EVVA 1J7RA 2SASA 4C0LA 1K90D 2LC5A 3D0YA 4OCIA 1SNLA 1MXEA 2I2RE 3TUYC 1J1DA 1J55A 3IF7A 1L2OC 4MRXA 1XYDA 2JT8A 2FJUB 2K2AA 1YR5A 1UHJA 4CLNA 1LA3A 1CDNA 2OS8B 1SK6D 2CXJA 3DD4A 1BU3A 4ORBB 3QRXA 1DVIA 2F3ZA 2MJWB 4GGFC 3BQ3A 3TS5B 1SCMC 1NYAA 5CSJA 3BUMB 5DKQA 3O78A 1KCYA 5TNCA 4P2YB 2KAVA 1CFPA 1U5IB 1AVSA 3OP0A 1QASA 2KYCA 3ZNIA 4QJ3B 1N65A 1IWQA 2ZRSA 2WORA 2LHIA 2WCBA 1CM4A 3PFVA 2MBXA 1M31A 2K7OA 1QV1A 1IJ5A 2F2PA 2EC6C 2FOTA 2Q91A 3KF9A 3SIBA 2HQWA 1IKUA 1CLBA 2BE6A 2RGIA 3AKBA 2LUCA 1WRZA 4NDBA 1XFWO 4OR9B 1VRKA 1SR6C 2I7AA 1EG4A 2LVIA 2P6BB 1XVJA 2SCPA 5CSNA 3NSKA 1TCOB 1XFXO 3GK2A 1S3PA 3JTDB 1JFJA 2Y1MA 1CNPA 3O4YA 4CIDA 1NSHA 1MUXA 3OX5A 1A03A 1BJFA 4YGAA 1GGZA 3I5HB 3FWCA 3DF0B 3BUXB 3CTNA 5I2LA 1NPQA 2LP3A 2M29A 1RECA 2WOSA 1SKTA 2BKHB 1QV0A 5HKZA 4L9MA 1X02A 2LLUA 1KFXL 2EHBA 1K93D 1S26D 3FWBA 3JVTB 1CFFA 2GV5A 2CTNA 1XFUO 2QPTA 5HKWA 3KEVA 3TDZA 4N5XA 3HCMA 2OTGC 1NWDA 1ZOTB 5HLOA 1S5GY 2ISDA 5D69A 1CDLA 2KSPA 1BMOA 2NCPA 1F4QA 2KFGA 1RK9A 2JQ6A 3CWGA 3D0YB 1JF2A 2ZN9A 3EKJA 2ZN8A 3ICBA 3KHEA 3M0WA 4XJKA 1QVIZ 1E8AA 2G2BA 1WLMA 2KHNA 2LHLA 2Y4QA 1EL4A 1CDMA 1NX2A 1ZACA 1UP5A 2FCDA 2WC8A 3PN7C 5DKNA 1KK7Y 1KSMA 5AEQA 3PSRA 5AXIA 2GGMA 2WCEA 1G8IA 3VROA 2E6WA 1KWOC 2JZIA 2K7BA 2L4HA 3BYAA 2BBNA 3EVRA 4HRHA 1DTLA 2KI4B 1QVIY 2MHHA 4YRUA 3KPXA 1PULA 1CMFA 1L7ZA 1QTXA 2K2FA 5J3XA 2Q4UA 1LA0A 1TRFA 2MLEC 1A75A 2L0PA 1UUSA 1ZUZA 2IS9A 5I2QA 1H4BA 1KQMB 1YURA 4MSPA 1V1GA 4ETOA 2JC2A 3BUWB 4FTGA 1DJZA 2JULA 3E3RA 4ZCUA 3TZ1A 4PE4A 2LAPA 1HQVA 2JT0A 2KAYA 1B8LA 1SMGA 4PCWA 2NZ0A 1KFUS 4MLWA 2PMYA 3PALA 4U8DA 1YUUA 5F6TA 1A4PA 4MZJA 2M7LA 2LP2A 3EK4A 4I5NB 1CMGA 2QACA 3K21A 2VRGA 4R1EA 1GQMA 2JU0A 3EK8A 4YGDB 4DS7A 1FBVA 3EKHA 1DJXA 1CLMA 2LVJA 1W7IB 3I5FB 1F71A 1QLKA 2L98A 2K7CA 2E30A 1M46A 1Q80A 2BL0C 1WRKA 2M7NA 1CM1A 1KK8B 4FQOA 2M9GA 1R2UA 1Y0VH 2H2KA 4I5LB 1C7VA 1MHOA 1QS7A 4PHMA 4YI8A 1YX7A 2O5GA 3SG3A 2JT3A 2BE4A 2HPSA 3GK4X 1QX5B 4GGFA 5HYDA 4HSZA 1XK4C 3LLEA 1LVCD 1SRAA 2M8UA 1SL8A 5GQQC 1QX7A 2JNXA 3ZWHA 1LINA 4XYNA 3WXAA 3F45A 3I5GB 3LCPC 2BCBA 2PALA 4NDDA 4JWQA 1G33A 1WRLA 4OVNF 4MVFA 1J7QA 1AUIB 3RM1A 3VGOA 2LVKA 4PALA 1PRWA 2H61C 1EH2A 2M49B 1Y1UA 1QATA 2G9BA 3SG5A 5JJGA 1CB1A 2AAOA 4XJKB 3OHMB 1IJ6A 1K9KA 1OSAA 3AKAA 3DVKA 2OPOA 2K8MB 2F8PA 3VRQA 2BKIB 1M39A 1DGUA 2D8NA 1B4CA 2JNFA 1Y1AA 1TCFA 3CLNA 2BCAA 1N0YA 1IG5A 5KU1A 2LV7A 1CDPA 1NP8A 4PE7A 4ORAB 3EVUA 4ORCB 1S5GZ 3CR5X 3I5IC 1A75B 1S1EA 2Y5IA 2KNEA 3BXKA 1FPWA 3SG6A 2PVBA 1Y6WA 1KFUL 4GFTA 1WDCC 3WHUB 1BOCA 4JQ0D 1CFDA 4A4BA 4MZLA 4C0KA 1BLQA 1C07A 4AQIA 2R2IA 1J1EA 1TNQA 3SIAA 3LL8B 1K9PA 3CGAA 4QJ5B 1CFCA 5K89A 1FI6A 3OB2B 1KK7Z 4TNCA 4IL1A 2LM5A 1NCXA 1NCYA 2OS8C 1M63B 2KQ6A 2M1KB 1HT9A 4I5JA 2CT9A 4N1FA 4OKHA 4YGBB 3FIAA 4YBHB 3TUYB 4UPGA 4GPLB 1L2OB 1K2HA 4M2QA 1ZMZA 4GNKB 1B9AA 1RTP1 2GGZA 3SG2A 2JOJA 4BY5A 2LMVA 2JRFA 3IQOA 1A29A 4BY4A 4MZKA 1SCVA 5AFPA 5KSZA 3GOFA 5PALA 1LKJA 1SCMB 3DVMA 4AQJA 2MRDA 4M2OA 2HQ8A 1DJYA 1DJWA 2PSRA 2KGRA 1TN4A 3AAJA 1PALA 3DVEA 4E68A 1KSOA 4C0JA 2A4JA 2LUXA 1EXRA 1W7JB 2K7DA 3PLFB 2M1UA 3BOWB 1YUSA 2HETA 5ER4X 5ER5A 3D10A 1DGVA 3OB1B 1WY9A 1F54A 2F33A 1B47A 1JF0A 2JWWA 5CSFA 1Y1XA 2K0JA 1DMOA 3JTDC 1AP4A 1A2XA 1EG3A 2BBMA 2EC6B 4CFRA 2M0RA 2LANA 4PE0A 1JC2A 1G4YR 2LLTA 3I5HC 4WQ3A 3WHTB 1CLLA 2V53A 1K95A 1SR6B 3VRNA 3OX6A 2WNDA 1AJ5A 1XA5A 2ZNDA 2HF5A 1K8UA 1TTXA 1IH0A 1NX3A 3NSLA 3NSOA 4CPVA 1FF1A 2PASA 2KBMA 2KBIA 1XFVO 5BPJA 2BECA 1YVHA 3C1VA 1NX1A 1OOJA 3JVTC 1XO5A 1TIZA 1IQ3A 2CBLA 4D1EA 4DCKA 1OE9B 2ZNEA 4YGCB 1F70A 5IBWA 3HX4A 1KFXS 1F8HA 2KYFA 1BF5A 3CS1A 4MN0A 5CPVA 1IQ5A 1MWNA 1XK4A 2CNPA 3TDIA 5I8NA 4GAOA 1ODBA 1JWDA 4AOMA 2OTGB 1TNXA 3WNXB 1JFKA 3FS7A 3SJSA 3BOWA 4GUKA 3AAKA 1PVBA 1SL9A 1K94A 2JTTA 4JPZB 4MBEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EJ3 A;  1OMV A;  1PK0 D;  4HRE E;  5FYX A;  2H61 A;  1J7O A;  1PVA A;  1S6J A;  2L4I A;  4ZCV A;  2NCO A;  4OV2 A;  1YVL A;  2O60 A;  5JOL A;  1UHK A;  1JUO A;  1SYM A;  2JXC A;  4DIR A;  2KDH A;  2KI4 C;  4GGN A;  1UHN A;  2MAZ A;  3PN7 B;  1KQV A;  1B8R A;  2I94 A;  5I2O A;  2KGB C;  1B7T Z;  2KFH A;  1QLS A;  1DJI A;  1SY9 A;  2BCX A;  2LLS A;  5KTY A;  1UWO A;  1J7P A;  1QX2 A;  5CSI A;  5AER A;  1DF0 A;  4GBA A;  1KQM C;  3CR4 X;  3LK0 A;  2DOQ A;  1KWO B;  1OQP A;  2KOT A;  2LCP A;  1BG1 A;  1FI5 A;  2F2O A;  1H8B A;  3O2P A;  4MEW A;  2I18 A;  1UUR A;  2ZRT A;  4I5K A;  1B7T Y;  1RFJ A;  1TNW A;  2AMI A;  2TN4 A;  1BR4 B;  3CZT X;  1GJY A;  1OMD A;  3RLZ A;  2KAX A;  1YUT A;  4P5O E;  2KI6 D;  3VRR A;  1OMR A;  4N1G A;  2PRU A;  2COL B;  5HKY A;  2F3Y A;  1TNP A;  3BUN B;  2K61 A;  2AUC A;  1AK8 A;  3MSE B;  3I5F C;  2KFF A;  5B8I B;  1UHH A;  4M2P A;  1K96 A;  1YRU B;  3DVJ A;  2L50 A;  1QXP A;  1C7W A;  1SPY A;  1F55 A;  1KK8 C;  1OZS A;  5G08 A;  1IGV A;  1GGW A;  1BT6 A;  1DJH A;  1NIW A;  2L51 A;  4ICB A;  3VRP A;  3A8R A;  4CFQ A;  1DT7 B;  1V1F A;  2B1U A;  2MA2 A;  1M45 A;  4NQG A;  5AAN A;  1AJ4 A;  1ALW A;  4PHK A;  3TS5 C;  1QJT A;  2BL0 B;  3EK7 A;  2L5X B;  1YRT B;  1NUB A;  1AHR A;  1BR1 B;  1S36 A;  2ZKM X;  1U5I A;  4F0Z B;  5D7F A;  1QIW A;  3I5G C;  1LXF C;  1YTZ C;  2KQY A;  4WQ2 A;  1RWY A;  3H4S E;  1R6P A;  2NLN A;  1WLZ A;  1ALV A;  3GK1 A;  2FCE A;  4YGE B;  1MR8 A;  2M3W A;  1K9U A;  2Y1N A;  4DRW A;  4NDC A;  2L2E A;  2ZFD A;  3IQQ A;  1XFZ O;  3A4U B;  1UHI A;  1SL7 A;  3SG7 A;  4PHN A;  3TDU A;  1SBJ A;  4Q04 A;  3NSI A;  4PDZ A;  4MRY A;  1MF8 B;  1ZFS A;  2JXL A;  4YI9 A;  2EGD A;  4PHJ A;  1XFY O;  1CKK A;  1SW8 A;  1F4O A;  2LE9 B;  1MXL C;  2JPT A;  2MLF C;  2M97 A;  5DKR A;  2KI6 C;  2LMU A;  3DF0 A;  3CR2 A;  4DUQ A;  1MQ1 A;  1NCZ A;  3BUO B;  4HRG A;  3PM8 A;  3O6B A;  1RJV A;  2NXQ A;  1DF0 B;  2WCF A;  1PSR A;  1OZO A;  3NXA A;  1RRO A;  4USL A;  2LVV A;  2LMT A;  2JTZ A;  1FW4 A;  1QIV A;  1NX0 A;  4PE1 A;  1B1G A;  1JSA A;  1JBA A;  3LK1 A;  1PSB A;  1S6C A;  3I5I B;  1BOD A;  3PAT A;  1N2D A;  4A4C A;  1TOP A;  1CTR A;  1B8C A;  2LNK A;  1IRJ A;  1S6I A;  1DJG A;  5HLV A;  4QJ4 B;  1D1O A;  4WRI A;  3SG4 A;  3KO0 A;  1WDC B;  2CCM A;  1YX8 A;  3EVV A;  1J7R A;  2SAS A;  4C0L A;  1K90 D;  2LC5 A;  3D0Y A;  4OCI A;  1SNL A;  1MXE A;  2I2R E;  3TUY C;  1J1D A;  1J55 A;  3IF7 A;  1L2O C;  4MRX A;  1XYD A;  2JT8 A;  2FJU B;  2K2A A;  1YR5 A;  1UHJ A;  4CLN A;  1LA3 A;  1CDN A;  2OS8 B;  1SK6 D;  2CXJ A;  3DD4 A;  1BU3 A;  4ORB B;  3QRX A;  1DVI A;  2F3Z A;  2MJW B;  4GGF C;  3BQ3 A;  3TS5 B;  1SCM C;  1NYA A;  5CSJ A;  3BUM B;  5DKQ A;  3O78 A;  1KCY A;  5TNC A;  4P2Y B;  2KAV A;  1CFP A;  1U5I B;  1AVS A;  3OP0 A;  1QAS A;  2KYC A;  3ZNI A;  4QJ3 B;  1N65 A;  1IWQ A;  2ZRS A;  2WOR A;  2LHI A;  2WCB A;  1CM4 A;  3PFV A;  2MBX A;  1M31 A;  2K7O A;  1QV1 A;  1IJ5 A;  2F2P A;  2EC6 C;  2FOT A;  2Q91 A;  3KF9 A;  3SIB A;  2HQW A;  1IKU A;  1CLB A;  2BE6 A;  2RGI A;  3AKB A;  2LUC A;  1WRZ A;  4NDB A;  1XFW O;  4OR9 B;  1VRK A;  1SR6 C;  2I7A A;  1EG4 A;  2LVI A;  2P6B B;  1XVJ A;  2SCP A;  5CSN A;  3NSK A;  1TCO B;  1XFX O;  3GK2 A;  1S3P A;  3JTD B;  1JFJ A;  2Y1M A;  1CNP A;  3O4Y A;  4CID A;  1NSH A;  1MUX A;  3OX5 A;  1A03 A;  1BJF A;  4YGA A;  1GGZ A;  3I5H B;  3FWC A;  3DF0 B;  3BUX B;  3CTN A;  5I2L A;  1NPQ A;  2LP3 A;  2M29 A;  1REC A;  2WOS A;  1SKT A;  2BKH B;  1QV0 A;  5HKZ A;  4L9M A;  1X02 A;  2LLU A;  1KFX L;  2EHB A;  1K93 D;  1S26 D;  3FWB A;  3JVT B;  1CFF A;  2GV5 A;  2CTN A;  1XFU O;  2QPT A;  5HKW A;  3KEV A;  3TDZ A;  4N5X A;  3HCM A;  2OTG C;  1NWD A;  1ZOT B;  5HLO A;  1S5G Y;  2ISD A;  5D69 A;  1CDL A;  2KSP A;  1BMO A;  2NCP A;  1F4Q A;  2KFG A;  1RK9 A;  2JQ6 A;  3CWG A;  3D0Y B;  1JF2 A;  2ZN9 A;  3EKJ A;  2ZN8 A;  3ICB A;  3KHE A;  3M0W A;  4XJK A;  1QVI Z;  1E8A A;  2G2B A;  1WLM A;  2KHN A;  2LHL A;  2Y4Q A;  1EL4 A;  1CDM A;  1NX2 A;  1ZAC A;  1UP5 A;  2FCD A;  2WC8 A;  3PN7 C;  5DKN A;  1KK7 Y;  1KSM A;  5AEQ A;  3PSR A;  5AXI A;  2GGM A;  2WCE A;  1G8I A;  3VRO A;  2E6W A;  1KWO C;  2JZI A;  2K7B A;  2L4H A;  3BYA A;  2BBN A;  3EVR A;  4HRH A;  1DTL A;  2KI4 B;  1QVI Y;  2MHH A;  4YRU A;  3KPX A;  1PUL A;  1CMF A;  1L7Z A;  1QTX A;  2K2F A;  5J3X A;  2Q4U A;  1LA0 A;  1TRF A;  2MLE C;  1A75 A;  2L0P A;  1UUS A;  1ZUZ A;  2IS9 A;  5I2Q A;  1H4B A;  1KQM B;  1YUR A;  4MSP A;  1V1G A;  4ETO A;  2JC2 A;  3BUW B;  4FTG A;  1DJZ A;  2JUL A;  3E3R A;  4ZCU A;  3TZ1 A;  4PE4 A;  2LAP A;  1HQV A;  2JT0 A;  2KAY A;  1B8L A;  1SMG A;  4PCW A;  2NZ0 A;  1KFU S;  4MLW A;  2PMY A;  3PAL A;  4U8D A;  1YUU A;  5F6T A;  1A4P A;  4MZJ A;  2M7L A;  2LP2 A;  3EK4 A;  4I5N B;  1CMG A;  2QAC A;  3K21 A;  2VRG A;  4R1E A;  1GQM A;  2JU0 A;  3EK8 A;  4YGD B;  4DS7 A;  1FBV A;  3EKH A;  1DJX A;  1CLM A;  2LVJ A;  1W7I B;  3I5F B;  1F71 A;  1QLK A;  2L98 A;  2K7C A;  2E30 A;  1M46 A;  1Q80 A;  2BL0 C;  1WRK A;  2M7N A;  1CM1 A;  1KK8 B;  4FQO A;  2M9G A;  1R2U A;  1Y0V H;  2H2K A;  4I5L B;  1C7V A;  1MHO A;  1QS7 A;  4PHM A;  4YI8 A;  1YX7 A;  2O5G A;  3SG3 A;  2JT3 A;  2BE4 A;  2HPS A;  3GK4 X;  1QX5 B;  4GGF A;  5HYD A;  4HSZ A;  1XK4 C;  3LLE A;  1LVC D;  1SRA A;  2M8U A;  1SL8 A;  5GQQ C;  1QX7 A;  2JNX A;  3ZWH A;  1LIN A;  4XYN A;  3WXA A;  3F45 A;  3I5G B;  3LCP C;  2BCB A;  2PAL A;  4NDD A;  4JWQ A;  1G33 A;  1WRL A;  4OVN F;  4MVF A;  1J7Q A;  1AUI B;  3RM1 A;  3VGO A;  2LVK A;  4PAL A;  1PRW A;  2H61 C;  1EH2 A;  2M49 B;  1Y1U A;  1QAT A;  2G9B A;  3SG5 A;  5JJG A;  1CB1 A;  2AAO A;  4XJK B;  3OHM B;  1IJ6 A;  1K9K A;  1OSA A;  3AKA A;  3DVK A;  2OPO A;  2K8M B;  2F8P A;  3VRQ A;  2BKI B;  1M39 A;  1DGU A;  2D8N A;  1B4C A;  2JNF A;  1Y1A A;  1TCF A;  3CLN A;  2BCA A;  1N0Y A;  1IG5 A;  5KU1 A;  2LV7 A;  1CDP A;  1NP8 A;  4PE7 A;  4ORA B;  3EVU A;  4ORC B;  1S5G Z;  3CR5 X;  3I5I C;  1A75 B;  1S1E A;  2Y5I A;  2KNE A;  3BXK A;  1FPW A;  3SG6 A;  2PVB A;  1Y6W A;  1KFU L;  4GFT A;  1WDC C;  3WHU B;  1BOC A;  4JQ0 D;  1CFD A;  4A4B A;  4MZL A;  4C0K A;  1BLQ A;  1C07 A;  4AQI A;  2R2I A;  1J1E A;  1TNQ A;  3SIA A;  3LL8 B;  1K9P A;  3CGA A;  4QJ5 B;  1CFC A;  5K89 A;  1FI6 A;  3OB2 B;  1KK7 Z;  4TNC A;  4IL1 A;  2LM5 A;  1NCX A;  1NCY A;  2OS8 C;  1M63 B;  2KQ6 A;  2M1K B;  1HT9 A;  4I5J A;  2CT9 A;  4N1F A;  4OKH A;  4YGB B;  3FIA A;  4YBH B;  3TUY B;  4UPG A;  4GPL B;  1L2O B;  1K2H A;  4M2Q A;  1ZMZ A;  4GNK B;  1B9A A;  1RTP 1;  2GGZ A;  3SG2 A;  2JOJ A;  4BY5 A;  2LMV A;  2JRF A;  3IQO A;  1A29 A;  4BY4 A;  4MZK A;  1SCV A;  5AFP A;  5KSZ A;  3GOF A;  5PAL A;  1LKJ A;  1SCM B;  3DVM A;  4AQJ A;  2MRD A;  4M2O A;  2HQ8 A;  1DJY A;  1DJW A;  2PSR A;  2KGR A;  1TN4 A;  3AAJ A;  1PAL A;  3DVE A;  4E68 A;  1KSO A;  4C0J A;  2A4J A;  2LUX A;  1EXR A;  1W7J B;  2K7D A;  3PLF B;  2M1U A;  3BOW B;  1YUS A;  2HET A;  5ER4 X;  5ER5 A;  3D10 A;  1DGV A;  3OB1 B;  1WY9 A;  1F54 A;  2F33 A;  1B47 A;  1JF0 A;  2JWW A;  5CSF A;  1Y1X A;  2K0J A;  1DMO A;  3JTD C;  1AP4 A;  1A2X A;  1EG3 A;  2BBM A;  2EC6 B;  4CFR A;  2M0R A;  2LAN A;  4PE0 A;  1JC2 A;  1G4Y R;  2LLT A;  3I5H C;  4WQ3 A;  3WHT B;  1CLL A;  2V53 A;  1K95 A;  1SR6 B;  3VRN A;  3OX6 A;  2WND A;  1AJ5 A;  1XA5 A;  2ZND A;  2HF5 A;  1K8U A;  1TTX A;  1IH0 A;  1NX3 A;  3NSL A;  3NSO A;  4CPV A;  1FF1 A;  2PAS A;  2KBM A;  2KBI A;  1XFV O;  5BPJ A;  2BEC A;  1YVH A;  3C1V A;  1NX1 A;  1OOJ A;  3JVT C;  1XO5 A;  1TIZ A;  1IQ3 A;  2CBL A;  4D1E A;  4DCK A;  1OE9 B;  2ZNE A;  4YGC B;  1F70 A;  5IBW A;  3HX4 A;  1KFX S;  1F8H A;  2KYF A;  1BF5 A;  3CS1 A;  4MN0 A;  5CPV A;  1IQ5 A;  1MWN A;  1XK4 A;  2CNP A;  3TDI A;  5I8N A;  4GAO A;  1ODB A;  1JWD A;  4AOM A;  2OTG B;  1TNX A;  3WNX B;  1JFK A;  3FS7 A;  3SJS A;  3BOW A;  4GUK A;  3AAK A;  1PVB A;  1SL9 A;  1K94 A;  2JTT A;  4JPZ B;  4MBE A; 
#chains in the Genus database with same CATH topology
 3O4X A;  1EJ3 A;  1OMV A;  5HL1 A;  2WCL A;  1PK0 D;  4HRE E;  5FYX A;  2H61 A;  1J7O A;  1PVA A;  1S6J A;  2L4I A;  4ZCV A;  2NCO A;  4OV2 A;  3DXL A;  1YVL A;  2O60 A;  5JOL A;  1UHK A;  1JUO A;  1SYM A;  2JXC A;  5FI7 A;  4DIR A;  2KDH A;  2KI4 C;  3FE8 A;  3N7H A;  4GGN A;  1UHN A;  2MAZ A;  2JPO A;  3CYZ A;  3PN7 B;  1B8R A;  2I94 A;  5I2O A;  1KQV A;  2KGB C;  1B7T Z;  2KFH A;  1QLS A;  1DJI A;  1SY9 A;  2BCX A;  2LLS A;  5KTY A;  1UWO A;  1J7P A;  1QX2 A;  5CSI A;  3K1E A;  1DF0 A;  4GBA A;  5AER A;  3S0A A;  1KQM C;  3CR4 X;  3LK0 A;  2DOQ A;  1KWO B;  4KYN A;  1OQP A;  2KOT A;  2LCP A;  1BG1 A;  1FI5 A;  4YRU A;  2F2O A;  5FI6 A;  1H8B A;  3O2P A;  3R72 A;  4MEW A;  2I18 A;  1UUR A;  2ZRT A;  4I5K A;  3SS5 A;  1B7T Y;  1RFJ A;  1TNW A;  2AMI A;  2TN4 A;  1BR4 B;  3CZT X;  1GJY A;  3FE6 A;  1OMD A;  3RLZ A;  2KAX A;  1YUT A;  4P5O E;  2KI6 D;  3VRR A;  5EL2 A;  1OMR A;  4N1G A;  2PRU A;  3IVT A;  2COL B;  5HKY A;  2F3Y A;  1TNP A;  3BUN B;  2K61 A;  2AUC A;  1AK8 A;  3MSE B;  3I5F C;  2KFF A;  5B8I B;  1UHH A;  3R1V A;  1K96 A;  1YRU B;  3DVJ A;  4M2P A;  2L50 A;  1QXP A;  1C7W A;  1SPY A;  1F55 A;  1KK8 C;  1OZS A;  5G08 A;  1IGV A;  1GGW A;  1BT6 A;  1DJH A;  1NIW A;  2L51 A;  4ICB A;  3VRP A;  3A8R A;  2L5Y A;  4CFQ A;  1DT7 B;  1V1F A;  2B1U A;  2MA2 A;  1M45 A;  4NQG A;  5AAN A;  1AJ4 A;  1ALW A;  4PHK A;  3S0B A;  3TS5 C;  1QJT A;  2BL0 B;  3EK7 A;  2L5X B;  3UO9 A;  1YRT B;  1NUB A;  1AHR A;  1BR1 B;  1S36 A;  2ZKM X;  1U5I A;  4F0Z B;  5D7F A;  1QIW A;  4JKT A;  3I5G C;  1LXF C;  1YTZ C;  2KQY A;  3B87 A;  1RWY A;  4WQ2 A;  3D77 A;  3H4S E;  3S0F A;  2L2C A;  1R6P A;  1LS8 A;  2NLN A;  1WLZ A;  1ALV A;  3GK1 A;  2FCE A;  4YGE B;  1MR8 A;  2M3W A;  1K9U A;  1P28 A;  2Y1N A;  4DRW A;  4NDC A;  2L2E A;  2ZFD A;  3IQQ A;  1XFZ O;  3A4U B;  1C3Y A;  1UHI A;  2KLD A;  1SL7 A;  3BJH A;  3SG7 A;  4PHN A;  3TDU A;  1SBJ A;  4Q04 A;  3NSI A;  4PDZ A;  3NGV A;  4MRY A;  1MF8 B;  1ZFS A;  2JXL A;  4YI9 A;  2EGD A;  4PHJ A;  1OOH A;  1XFY O;  1CKK A;  1SW8 A;  1F4O A;  2LE9 B;  1MXL C;  2JPT A;  2MLF C;  2M97 A;  5DKR A;  2KI6 C;  2LMU A;  3DF0 A;  3CR2 A;  4DUQ A;  1MQ1 A;  2ERB A;  1NCZ A;  3BUO B;  4HRG A;  3SS4 A;  3PM8 A;  5D3O A;  3S0E A;  3O6B A;  1RJV A;  2NXQ A;  1DF0 B;  2WCF A;  1PSR A;  1OZO A;  3NXA A;  1RRO A;  4USL A;  2LVV A;  2LMT A;  2JTZ A;  1FW4 A;  1QIV A;  2QEO A;  1NX0 A;  4PE1 A;  1B1G A;  1JSA A;  1JBA A;  3LK1 A;  1PSB A;  1S6C A;  3I5I B;  1BOD A;  3PAT A;  1N2D A;  4A4C A;  1TOP A;  1CTR A;  1B8C A;  2LNK A;  1IRJ A;  1S6I A;  1DJG A;  5HLV A;  4QJ4 B;  1TWO A;  1D1O A;  4WRI A;  3SG4 A;  3KO0 A;  1WDC B;  3D78 A;  2CCM A;  1YX8 A;  2WCJ A;  3BFA A;  3EVV A;  1J7R A;  2SAS A;  4C0L A;  1K90 D;  2LC5 A;  3D0Y A;  4OCI A;  1IIO A;  3Q8I A;  1SNL A;  1MXE A;  2I2R E;  3TUY C;  1J1D A;  1J55 A;  3IF7 A;  1L2O C;  4MRX A;  1XYD A;  2JT8 A;  2FJU B;  2K2A A;  1YR5 A;  1UHJ A;  4CLN A;  1LA3 A;  1CDN A;  2OS8 B;  1SK6 D;  1QWV A;  2CXJ A;  3DD4 A;  1XFR A;  1BU3 A;  4ORB B;  3VB1 A;  3QRX A;  1DVI A;  2F3Z A;  2MJW B;  4GGF C;  3BQ3 A;  3TS5 B;  1SCM C;  1NYA A;  5CSJ A;  3BUM B;  5DKQ A;  3O78 A;  1KCY A;  5TNC A;  4P2Y B;  2KAV A;  1CFP A;  1U5I B;  1AVS A;  3OP0 A;  1QAS A;  2KYC A;  3ZNI A;  4QJ3 B;  1N65 A;  1IWQ A;  2ZRS A;  2WOR A;  2LHI A;  2WCB A;  1CM4 A;  3PFV A;  2MBX A;  1M31 A;  2K7O A;  1QV1 A;  1IJ5 A;  2F2P A;  2EC6 C;  2FOT A;  2Q91 A;  3KF9 A;  3SIB A;  3D76 A;  1SSE B;  2HQW A;  1IKU A;  1CLB A;  2BE6 A;  2RGI A;  3AKB A;  2LUC A;  1WRZ A;  4NDB A;  1XFW O;  4OR9 B;  1VRK A;  1SR6 C;  2I7A A;  1EG4 A;  2LVI A;  2P6B B;  1XVJ A;  2SCP A;  5CSN A;  3NSK A;  1DC1 A;  1TCO B;  1DEK A;  1XFX O;  3GK2 A;  1S3P A;  3JTD B;  1JFJ A;  2Y1M A;  1CNP A;  2WCM A;  3O4Y A;  1NSH A;  4CID A;  1MUX A;  4HRH A;  3OX5 A;  1A03 A;  1BJF A;  4YGA A;  1GGZ A;  3I5H B;  3CZ2 A;  3FWC A;  3DF0 B;  3BUX B;  3CTN A;  5I2L A;  1NPQ A;  2LP3 A;  2M29 A;  3OGN A;  1REC A;  2WOS A;  1SKT A;  2BKH B;  1QV0 A;  5HKZ A;  4L9M A;  1OOF A;  1X02 A;  2LLU A;  1KFX L;  3CDN A;  2EHB A;  1K93 D;  1S26 D;  3FWB A;  3JVT B;  1CFF A;  3B88 A;  2GV5 A;  2CTN A;  1XFU O;  2KPH A;  2QPT A;  3KEV A;  5HKW A;  3TDZ A;  4N5X A;  3HCM A;  2OTG C;  1NWD A;  1ZOT B;  5HLO A;  1S5G Y;  3EG5 B;  2ISD A;  5D69 A;  1CDL A;  1C3Z A;  2KSP A;  1BMO A;  2NCP A;  3D73 A;  2WC5 A;  1W9Z A;  1F4Q A;  2KFG A;  1RK9 A;  2JQ6 A;  3CWG A;  3D0Y B;  1JF2 A;  2ZN9 A;  3EKJ A;  2ZN8 A;  3ICB A;  3KHE A;  3M0W A;  4XJK A;  1QVI Z;  1E8A A;  2G2B A;  1WLM A;  2KHN A;  2LHL A;  2Y4Q A;  1TUJ A;  3DZT A;  1EL4 A;  1CDM A;  1NX2 A;  1ZAC A;  1UP5 A;  2FCD A;  2WC8 A;  3PN7 C;  5DKN A;  1KK7 Y;  1KSM A;  5AEQ A;  3PSR A;  5AXI A;  2GGM A;  2WCE A;  1G8I A;  3VRO A;  2E6W A;  1KWO C;  2JZI A;  2K7B A;  2L4H A;  3BYA A;  2BBN A;  3EVR A;  3L4L A;  1DTL A;  2KI4 B;  1QVI Y;  2MHH A;  3NHT A;  3KPX A;  1PUL A;  4FQT A;  1L7Z A;  1CMF A;  1QTX A;  1Z4H A;  2K2F A;  5J3X A;  2Q4U A;  1LA0 A;  1TRF A;  2MLE C;  1A75 A;  4INX A;  2L0P A;  1UUS A;  1ZUZ A;  2IS9 A;  5I2Q A;  2PYQ A;  1H4B A;  1KQM B;  1YUR A;  4MSP A;  1V1G A;  4ETO A;  2JC2 A;  3BUW B;  4FTG A;  1DJZ A;  1ORG A;  2JUL A;  3E3R A;  2K60 A;  4ZCU A;  3TZ1 A;  4PE4 A;  2LAP A;  1HQV A;  2JT0 A;  2KAY A;  1B8L A;  1SMG A;  4PCW A;  2NZ0 A;  1KFU S;  4MLW A;  2PMY A;  3PAL A;  4U8D A;  1YUU A;  5F6T A;  1A4P A;  2BAP A;  4MZJ A;  2M7L A;  2LP2 A;  3EK4 A;  4I5N B;  1CMG A;  2QAC A;  3K21 A;  3BFB A;  2VRG A;  4R1E A;  1GQM A;  2JU0 A;  2GTE A;  3EK8 A;  4YGD B;  4DS7 A;  1FBV A;  3EKH A;  1DJX A;  1CLM A;  2LVJ A;  1W7I B;  3I5F B;  1F71 A;  1QLK A;  2L98 A;  2K7C A;  2E30 A;  3CZ0 A;  1M46 A;  1Q80 A;  2BL0 C;  1DQE A;  1WRK A;  1CM1 A;  1KK8 B;  2M7N A;  2M9G A;  1R2U A;  1Y0V H;  2H2K A;  3D74 A;  3D75 A;  4I5L B;  1C7V A;  1MHO A;  1QS7 A;  2H8V A;  4PHM A;  4YI8 A;  1YX7 A;  2O5G A;  3SG3 A;  2JT3 A;  2BE4 A;  2HPS A;  3GK4 X;  1QX5 B;  4GGF A;  1Z2C B;  4HSZ A;  5HYD A;  1XK4 C;  3LLE A;  2QDI A;  1LVC D;  1SRA A;  2M8U A;  1DEL A;  1SL8 A;  5GQQ C;  1QX7 A;  2JNX A;  3ZWH A;  1LIN A;  4XYN A;  3B7A A;  3WXA A;  3F45 A;  3I5G B;  3LCP C;  2BCB A;  2PAL A;  4NDD A;  4JWQ A;  1G33 A;  1WRL A;  4OVN F;  4MVF A;  1J7Q A;  1AUI B;  3NHI A;  3RM1 A;  3VGO A;  2LVK A;  4PAL A;  1PRW A;  2H61 C;  3RZS A;  1EH2 A;  2M49 B;  1Y1U A;  1QAT A;  2G9B A;  3SG5 A;  5JJG A;  3CZ1 A;  1CB1 A;  2AAO A;  3PM2 A;  4XJK B;  3R1O A;  3OHM B;  1IJ6 A;  1K9K A;  1OSA A;  3AKA A;  3DVK A;  2OPO A;  2K8M B;  2QEV A;  2F8P A;  3VRQ A;  1GM0 A;  2BKI B;  1M39 A;  1DGU A;  2D8N A;  1B4C A;  2JNF A;  1Y1A A;  3L47 A;  1TCF A;  3CLN A;  3S0D A;  2BCA A;  1N0Y A;  1IG5 A;  5KU1 A;  2LV7 A;  1CDP A;  3R1P A;  1NP8 A;  4PE7 A;  4ORA B;  3EVU A;  4ORC B;  1S5G Z;  3CR5 X;  3I5I C;  3DY9 A;  1A75 B;  3L4A A;  5DIC A;  2BNX A;  1S1E A;  2Y5I A;  4PT1 A;  2KNE A;  3BXK A;  1FPW A;  3SG6 A;  2PVB A;  1Y6W A;  1KFU L;  4GFT A;  1WDC C;  4F7F A;  3DYE A;  3WHU B;  3FE9 A;  2WCH A;  1BOC A;  4JQ0 D;  1CFD A;  2P71 A;  4MZL A;  4A4B A;  4C0K A;  1BLQ A;  1C07 A;  4AQI A;  2R2I A;  1J1E A;  1TNQ A;  3BFH A;  3LL8 B;  1K9P A;  3CGA A;  3SIA A;  3SS3 A;  4QJ5 B;  5K89 A;  1CFC A;  1FI6 A;  3OB2 B;  1KK7 Z;  4TNC A;  4IL1 A;  2LM5 A;  1NCX A;  1NCY A;  2OS8 C;  1M63 B;  2KQ6 A;  2M1K B;  1HT9 A;  4I5J A;  2CT9 A;  3OBV A;  4N1F A;  4OKH A;  4YGB B;  2KLE A;  3FIA A;  4YBH B;  3TUY B;  4GPL B;  4UPG A;  1L2O B;  3UNW A;  1K2H A;  2PQL A;  4M2Q A;  1ZMZ A;  4GNK B;  1B9A A;  1RTP 1;  2GGZ A;  4INW A;  3SG2 A;  2JOJ A;  4BY5 A;  2LMV A;  2JRF A;  3IQO A;  1A29 A;  4BY4 A;  2FJY A;  4MZK A;  2WCK A;  3B6X A;  3QME A;  1SCV A;  5AFP A;  5KSZ A;  5FI2 A;  3GOF A;  5PAL A;  1LKJ A;  1SCM B;  3DVM A;  4AQJ A;  1OW4 A;  1T14 A;  2MRD A;  4M2O A;  2HQ8 A;  1DJY A;  1DJW A;  1OOI X;  2KGR A;  1TN4 A;  2PSR A;  1PAL A;  3AAJ A;  3DVE A;  4E68 A;  1KSO A;  3PJI A;  4C0J A;  2A4J A;  2LUX A;  3CAB A;  1EXR A;  1W7J B;  2K7D A;  3PLF B;  2M1U A;  3BOW B;  1YUS A;  2HET A;  2P70 A;  5ER4 X;  5ER5 A;  3D10 A;  1DGV A;  3OB1 B;  1WY9 A;  1F54 A;  2F33 A;  1B47 A;  1JF0 A;  2JWW A;  5CSF A;  1Y1X A;  2K0J A;  1DMO A;  3JTD C;  1AP4 A;  3S0G A;  1A2X A;  1EG3 A;  2BBM A;  2EC6 B;  3V2L A;  2M0R A;  4CFR A;  4JD9 A;  2LAN A;  4FQO A;  4PE0 A;  1G4Y R;  2LLT A;  3I5H C;  4WQ3 A;  1JC2 A;  3WHT B;  1CLL A;  2V53 A;  1K95 A;  1SR6 B;  3VRN A;  3OX6 A;  2WND A;  1AJ5 A;  1XA5 A;  2ZND A;  2HF5 A;  1K8U A;  1TTX A;  1IH0 A;  1NX3 A;  1OOG A;  3NSL A;  3NSO A;  4CPV A;  1FF1 A;  2PAS A;  2KBM A;  2KBI A;  1XFV O;  5BPJ A;  2WC6 A;  4OZD A;  2YGU A;  2BEC A;  1YVH A;  5I94 A;  3C1V A;  1NX1 A;  1OOJ A;  3JVT C;  1XO5 A;  1TIZ A;  1IQ3 A;  2CBL A;  4D1E A;  4DCK A;  1OE9 B;  2ZNE A;  4YGC B;  1F70 A;  5IBW A;  2QEH A;  3HX4 A;  1KFX S;  1F8H A;  2KYF A;  1BF5 A;  3CS1 A;  4MN0 A;  5CPV A;  1IQ5 A;  1MWN A;  4IJ7 A;  1XK4 A;  2CNP A;  3TDI A;  5I8N A;  3B86 A;  4GAO A;  1ODB A;  1JWD A;  4AOM A;  1TUZ A;  1TNX A;  2OTG B;  3WNX B;  1JFK A;  3FS7 A;  3SJS A;  3BOW A;  4GUK A;  3AAK A;  1PVB A;  1SL9 A;  1K94 A;  2JTT A;  4JPZ B;  4MBE A;  2QEB A; 
#chains in the Genus database with same CATH homology
 1EJ3 A;  1OMV A;  1PK0 D;  4HRE E;  5FYX A;  2H61 A;  1J7O A;  1PVA A;  1S6J A;  2L4I A;  4ZCV A;  2NCO A;  4OV2 A;  1YVL A;  2O60 A;  5JOL A;  1UHK A;  1JUO A;  1SYM A;  2JXC A;  4DIR A;  2KDH A;  2KI4 C;  4GGN A;  1UHN A;  2MAZ A;  3PN7 B;  1KQV A;  1B8R A;  2I94 A;  5I2O A;  2KGB C;  1B7T Z;  2KFH A;  1QLS A;  1DJI A;  1SY9 A;  2BCX A;  2LLS A;  5KTY A;  1UWO A;  1J7P A;  1QX2 A;  5CSI A;  5AER A;  1DF0 A;  4GBA A;  1KQM C;  3CR4 X;  3LK0 A;  2DOQ A;  1KWO B;  1OQP A;  2KOT A;  2LCP A;  1BG1 A;  1FI5 A;  2F2O A;  1H8B A;  3O2P A;  4MEW A;  2I18 A;  1UUR A;  2ZRT A;  4I5K A;  1B7T Y;  1RFJ A;  1TNW A;  2AMI A;  2TN4 A;  1BR4 B;  3CZT X;  1GJY A;  1OMD A;  3RLZ A;  2KAX A;  1YUT A;  4P5O E;  2KI6 D;  3VRR A;  1OMR A;  4N1G A;  2PRU A;  2COL B;  5HKY A;  2F3Y A;  1TNP A;  3BUN B;  2K61 A;  2AUC A;  1AK8 A;  3MSE B;  3I5F C;  2KFF A;  5B8I B;  1UHH A;  4M2P A;  1K96 A;  1YRU B;  3DVJ A;  2L50 A;  1QXP A;  1C7W A;  1SPY A;  1F55 A;  1KK8 C;  1OZS A;  5G08 A;  1IGV A;  1GGW A;  1BT6 A;  1DJH A;  1NIW A;  2L51 A;  4ICB A;  3VRP A;  3A8R A;  4CFQ A;  1DT7 B;  1V1F A;  2B1U A;  2MA2 A;  1M45 A;  4NQG A;  5AAN A;  1AJ4 A;  1ALW A;  4PHK A;  3TS5 C;  1QJT A;  2BL0 B;  3EK7 A;  2L5X B;  1YRT B;  1NUB A;  1AHR A;  1BR1 B;  1S36 A;  2ZKM X;  1U5I A;  4F0Z B;  5D7F A;  1QIW A;  3I5G C;  1LXF C;  1YTZ C;  2KQY A;  4WQ2 A;  1RWY A;  3H4S E;  1R6P A;  2NLN A;  1WLZ A;  1ALV A;  3GK1 A;  2FCE A;  4YGE B;  1MR8 A;  2M3W A;  1K9U A;  2Y1N A;  4DRW A;  4NDC A;  2L2E A;  2ZFD A;  3IQQ A;  1XFZ O;  3A4U B;  1UHI A;  1SL7 A;  3SG7 A;  4PHN A;  3TDU A;  1SBJ A;  4Q04 A;  3NSI A;  4PDZ A;  4MRY A;  1MF8 B;  1ZFS A;  2JXL A;  4YI9 A;  2EGD A;  4PHJ A;  1XFY O;  1CKK A;  1SW8 A;  1F4O A;  2LE9 B;  1MXL C;  2JPT A;  2MLF C;  2M97 A;  5DKR A;  2KI6 C;  2LMU A;  3DF0 A;  3CR2 A;  4DUQ A;  1MQ1 A;  1NCZ A;  3BUO B;  4HRG A;  3PM8 A;  3O6B A;  1RJV A;  2NXQ A;  1DF0 B;  2WCF A;  1PSR A;  1OZO A;  3NXA A;  1RRO A;  4USL A;  2LVV A;  2LMT A;  2JTZ A;  1FW4 A;  1QIV A;  1NX0 A;  4PE1 A;  1B1G A;  1JSA A;  1JBA A;  3LK1 A;  1PSB A;  1S6C A;  3I5I B;  1BOD A;  3PAT A;  1N2D A;  4A4C A;  1TOP A;  1CTR A;  1B8C A;  2LNK A;  1IRJ A;  1S6I A;  1DJG A;  5HLV A;  4QJ4 B;  1D1O A;  4WRI A;  3SG4 A;  3KO0 A;  1WDC B;  2CCM A;  1YX8 A;  3EVV A;  1J7R A;  2SAS A;  4C0L A;  1K90 D;  2LC5 A;  3D0Y A;  4OCI A;  1SNL A;  1MXE A;  2I2R E;  3TUY C;  1J1D A;  1J55 A;  3IF7 A;  1L2O C;  4MRX A;  1XYD A;  2JT8 A;  2FJU B;  2K2A A;  1YR5 A;  1UHJ A;  4CLN A;  1LA3 A;  1CDN A;  2OS8 B;  1SK6 D;  2CXJ A;  3DD4 A;  1BU3 A;  4ORB B;  3QRX A;  1DVI A;  2F3Z A;  2MJW B;  4GGF C;  3BQ3 A;  3TS5 B;  1SCM C;  1NYA A;  5CSJ A;  3BUM B;  5DKQ A;  3O78 A;  1KCY A;  5TNC A;  4P2Y B;  2KAV A;  1CFP A;  1U5I B;  1AVS A;  3OP0 A;  1QAS A;  2KYC A;  3ZNI A;  4QJ3 B;  1N65 A;  1IWQ A;  2ZRS A;  2WOR A;  2LHI A;  2WCB A;  1CM4 A;  3PFV A;  2MBX A;  1M31 A;  2K7O A;  1QV1 A;  1IJ5 A;  2F2P A;  2EC6 C;  2FOT A;  2Q91 A;  3KF9 A;  3SIB A;  2HQW A;  1IKU A;  1CLB A;  2BE6 A;  2RGI A;  3AKB A;  2LUC A;  1WRZ A;  4NDB A;  1XFW O;  4OR9 B;  1VRK A;  1SR6 C;  2I7A A;  1EG4 A;  2LVI A;  2P6B B;  1XVJ A;  2SCP A;  5CSN A;  3NSK A;  1TCO B;  1XFX O;  3GK2 A;  1S3P A;  3JTD B;  1JFJ A;  2Y1M A;  1CNP A;  3O4Y A;  4CID A;  1NSH A;  1MUX A;  3OX5 A;  1A03 A;  1BJF A;  4YGA A;  1GGZ A;  3I5H B;  3FWC A;  3DF0 B;  3BUX B;  3CTN A;  5I2L A;  1NPQ A;  2LP3 A;  2M29 A;  1REC A;  2WOS A;  1SKT A;  2BKH B;  1QV0 A;  5HKZ A;  4L9M A;  1X02 A;  2LLU A;  1KFX L;  2EHB A;  1K93 D;  1S26 D;  3FWB A;  3JVT B;  1CFF A;  2GV5 A;  2CTN A;  1XFU O;  2QPT A;  5HKW A;  3KEV A;  3TDZ A;  4N5X A;  3HCM A;  2OTG C;  1NWD A;  1ZOT B;  5HLO A;  1S5G Y;  2ISD A;  5D69 A;  1CDL A;  2KSP A;  1BMO A;  2NCP A;  1F4Q A;  2KFG A;  1RK9 A;  2JQ6 A;  3CWG A;  3D0Y B;  1JF2 A;  2ZN9 A;  3EKJ A;  2ZN8 A;  3ICB A;  3KHE A;  3M0W A;  4XJK A;  1QVI Z;  1E8A A;  2G2B A;  1WLM A;  2KHN A;  2LHL A;  2Y4Q A;  1EL4 A;  1CDM A;  1NX2 A;  1ZAC A;  1UP5 A;  2FCD A;  2WC8 A;  3PN7 C;  5DKN A;  1KK7 Y;  1KSM A;  5AEQ A;  3PSR A;  5AXI A;  2GGM A;  2WCE A;  1G8I A;  3VRO A;  2E6W A;  1KWO C;  2JZI A;  2K7B A;  2L4H A;  3BYA A;  2BBN A;  3EVR A;  4HRH A;  1DTL A;  2KI4 B;  1QVI Y;  2MHH A;  4YRU A;  3KPX A;  1PUL A;  1CMF A;  1L7Z A;  1QTX A;  2K2F A;  5J3X A;  2Q4U A;  1LA0 A;  1TRF A;  2MLE C;  1A75 A;  2L0P A;  1UUS A;  1ZUZ A;  2IS9 A;  5I2Q A;  1H4B A;  1KQM B;  1YUR A;  4MSP A;  1V1G A;  4ETO A;  2JC2 A;  3BUW B;  4FTG A;  1DJZ A;  2JUL A;  3E3R A;  4ZCU A;  3TZ1 A;  4PE4 A;  2LAP A;  1HQV A;  2JT0 A;  2KAY A;  1B8L A;  1SMG A;  4PCW A;  2NZ0 A;  1KFU S;  4MLW A;  2PMY A;  3PAL A;  4U8D A;  1YUU A;  5F6T A;  1A4P A;  4MZJ A;  2M7L A;  2LP2 A;  3EK4 A;  4I5N B;  1CMG A;  2QAC A;  3K21 A;  2VRG A;  4R1E A;  1GQM A;  2JU0 A;  3EK8 A;  4YGD B;  4DS7 A;  1FBV A;  3EKH A;  1DJX A;  1CLM A;  2LVJ A;  1W7I B;  3I5F B;  1F71 A;  1QLK A;  2L98 A;  2K7C A;  2E30 A;  1M46 A;  1Q80 A;  2BL0 C;  1WRK A;  2M7N A;  1CM1 A;  1KK8 B;  4FQO A;  2M9G A;  1R2U A;  1Y0V H;  2H2K A;  4I5L B;  1C7V A;  1MHO A;  1QS7 A;  4PHM A;  4YI8 A;  1YX7 A;  2O5G A;  3SG3 A;  2JT3 A;  2BE4 A;  2HPS A;  3GK4 X;  1QX5 B;  4GGF A;  5HYD A;  4HSZ A;  1XK4 C;  3LLE A;  1LVC D;  1SRA A;  2M8U A;  1SL8 A;  5GQQ C;  1QX7 A;  2JNX A;  3ZWH A;  1LIN A;  4XYN A;  3WXA A;  3F45 A;  3I5G B;  3LCP C;  2BCB A;  2PAL A;  4NDD A;  4JWQ A;  1G33 A;  1WRL A;  4OVN F;  4MVF A;  1J7Q A;  1AUI B;  3RM1 A;  3VGO A;  2LVK A;  4PAL A;  1PRW A;  2H61 C;  1EH2 A;  2M49 B;  1Y1U A;  1QAT A;  2G9B A;  3SG5 A;  5JJG A;  1CB1 A;  2AAO A;  4XJK B;  3OHM B;  1IJ6 A;  1K9K A;  1OSA A;  3AKA A;  3DVK A;  2OPO A;  2K8M B;  2F8P A;  3VRQ A;  2BKI B;  1M39 A;  1DGU A;  2D8N A;  1B4C A;  2JNF A;  1Y1A A;  1TCF A;  3CLN A;  2BCA A;  1N0Y A;  1IG5 A;  5KU1 A;  2LV7 A;  1CDP A;  1NP8 A;  4PE7 A;  4ORA B;  3EVU A;  4ORC B;  1S5G Z;  3CR5 X;  3I5I C;  1A75 B;  1S1E A;  2Y5I A;  2KNE A;  3BXK A;  1FPW A;  3SG6 A;  2PVB A;  1Y6W A;  1KFU L;  4GFT A;  1WDC C;  3WHU B;  1BOC A;  4JQ0 D;  1CFD A;  4A4B A;  4MZL A;  4C0K A;  1BLQ A;  1C07 A;  4AQI A;  2R2I A;  1J1E A;  1TNQ A;  3SIA A;  3LL8 B;  1K9P A;  3CGA A;  4QJ5 B;  1CFC A;  5K89 A;  1FI6 A;  3OB2 B;  1KK7 Z;  4TNC A;  4IL1 A;  2LM5 A;  1NCX A;  1NCY A;  2OS8 C;  1M63 B;  2KQ6 A;  2M1K B;  1HT9 A;  4I5J A;  2CT9 A;  4N1F A;  4OKH A;  4YGB B;  3FIA A;  4YBH B;  3TUY B;  4UPG A;  4GPL B;  1L2O B;  1K2H A;  4M2Q A;  1ZMZ A;  4GNK B;  1B9A A;  1RTP 1;  2GGZ A;  3SG2 A;  2JOJ A;  4BY5 A;  2LMV A;  2JRF A;  3IQO A;  1A29 A;  4BY4 A;  4MZK A;  1SCV A;  5AFP A;  5KSZ A;  3GOF A;  5PAL A;  1LKJ A;  1SCM B;  3DVM A;  4AQJ A;  2MRD A;  4M2O A;  2HQ8 A;  1DJY A;  1DJW A;  2PSR A;  2KGR A;  1TN4 A;  3AAJ A;  1PAL A;  3DVE A;  4E68 A;  1KSO A;  4C0J A;  2A4J A;  2LUX A;  1EXR A;  1W7J B;  2K7D A;  3PLF B;  2M1U A;  3BOW B;  1YUS A;  2HET A;  5ER4 X;  5ER5 A;  3D10 A;  1DGV A;  3OB1 B;  1WY9 A;  1F54 A;  2F33 A;  1B47 A;  1JF0 A;  2JWW A;  5CSF A;  1Y1X A;  2K0J A;  1DMO A;  3JTD C;  1AP4 A;  1A2X A;  1EG3 A;  2BBM A;  2EC6 B;  4CFR A;  2M0R A;  2LAN A;  4PE0 A;  1JC2 A;  1G4Y R;  2LLT A;  3I5H C;  4WQ3 A;  3WHT B;  1CLL A;  2V53 A;  1K95 A;  1SR6 B;  3VRN A;  3OX6 A;  2WND A;  1AJ5 A;  1XA5 A;  2ZND A;  2HF5 A;  1K8U A;  1TTX A;  1IH0 A;  1NX3 A;  3NSL A;  3NSO A;  4CPV A;  1FF1 A;  2PAS A;  2KBM A;  2KBI A;  1XFV O;  5BPJ A;  2BEC A;  1YVH A;  3C1V A;  1NX1 A;  1OOJ A;  3JVT C;  1XO5 A;  1TIZ A;  1IQ3 A;  2CBL A;  4D1E A;  4DCK A;  1OE9 B;  2ZNE A;  4YGC B;  1F70 A;  5IBW A;  3HX4 A;  1KFX S;  1F8H A;  2KYF A;  1BF5 A;  3CS1 A;  4MN0 A;  5CPV A;  1IQ5 A;  1MWN A;  1XK4 A;  2CNP A;  3TDI A;  5I8N A;  4GAO A;  1ODB A;  1JWD A;  4AOM A;  2OTG B;  1TNX A;  3WNX B;  1JFK A;  3FS7 A;  3SJS A;  3BOW A;  4GUK A;  3AAK A;  1PVB A;  1SL9 A;  1K94 A;  2JTT A;  4JPZ B;  4MBE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...