1UHNA

The crystal structure of the calcium binding protein atcbl2 from arabidopsis thaliana
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
189
structure length
189
Chain Sequence
DPELLARDTVFSVSEIEALYELFKKISSAVIDDGLINKEEFQLALFKTNKKESLFADRVFDLFDTKHNGILGFEEFARALSVFHPNAPIDDKIHFSFQLYDLKQQGFIERQEVKQMVVATLAESGMNLKDTVIEDIIDKTFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the Novel Calcium-binding Protein AtCBL2 from Arabidopsis thaliana
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Metal binding protein
molecule keywords calcineurin B-like protein 2
total genus 63
structure length 189
sequence length 189
ec nomenclature
pdb deposition date 2003-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1uhnA00
1FF1A 2JNXA 2M7NA 4QJ4B 3M0WA 2AUCA 2GV5A 3TS5B 1JWDA 4YGEB 1Q80A 4AQJA 3A4UB 2OTGB 3EK4A 1KFXL 2K8MB 4MSPA 1KQVA 5F6TA 1SW8A 5D69A 1K96A 2F3YA 4C0JA 1U5IB 4PHNA 2WOSA 2ZN9A 1NWDA 1R2UA 5AEQA 1CTRA 1A75A 1OMRA 3I5GB 2I7AA 2LMVA 2KI6D 1CM1A 4I5NB 1K9UA 4D1EA 4NDCA 1F4OA 1U5IA 2I2RE 2F3ZA 3TS5C 1S3PA 2MBXA 2EC6B 3BUNB 1QTXA 2KI4B 1MR8A 2VRGA 2I18A 4NDDA 3TZ1A 1ZACA 4P2YB 2KAXA 1QVIZ 2HETA 1PVAA 1N65A 1YR5A 4YBHB 2LLSA 2M29A 2M1KB 3O4YA 1TNXA 1QV1A 3O2PA 3LCPC 2H61A 1K94A 2OPOA 1F8HA 2JPTA 2LLTA 1M63B 1NX0A 2BECA 1PSRA 2KFGA 2MHHA 1DJYA 3F45A 2MLFC 1JC2A 1DGVA 3CR2A 4I5KA 2LVJA 3SG7A 2ZRSA 3LK1A 2I94A 2PVBA 1J7PA 1DT7B 2CXJA 1KSOA 3JTDB 1D1OA 1B7TZ 1V1FA 1YRTB 2PALA 3IQOA 1NCYA 3KF9A 1A29A 2LM5A 2D8NA 2LV7A 4BY4A 4A4CA 1SMGA 2L98A 3PSRA 2LUXA 1R6PA 2NZ0A 4MZKA 1J7QA 1IQ3A 3PALA 4R1EA 2PRUA 4USLA 2G2BA 3LLEA 1LKJA 5CSFA 2JOJA 1B7TY 2EHBA 1M31A 1AHRA 4CFQA 2ZFDA 3CR4X 3BUMB 4I5JA 3SIBA 4XJKA 1KCYA 2CBLA 1DJZA 1UUSA 1QIVA 2L2EA 1YRUB 4OCIA 1TNQA 1K95A 4YRUA 5KU1A 2HPSA 1PSBA 1QXPA 3I5HC 2HF5A 2SASA 1JSAA 3OP0A 3KHEA 2MJWB 2WCBA 1J7RA 3TUYB 4PE0A 1JUOA 3WHTB 1SNLA 4CPVA 2FCEA 1WDCB 2BE6A 2LC5A 3DF0A 1CFCA 5ER5A 4FTGA 4XJKB 4YI9A 3TDUA 3OHMB 1B47A 4GPLB 4MLWA 1A75B 2Q4UA 1HQVA 3CGAA 3EKHA 1JF2A 1UHKA 2KQ6A 2KGBC 3BUXB 1IQ5A 1M46A 2COLB 1EXRA 3EKJA 4M2QA 1S5GZ 2WCEA 3DVEA 4C0KA 4E68A 3VRPA 4MRYA 1CDNA 2AAOA 5IBWA 1FI6A 3I5IC 4MRXA 3WXAA 1IRJA 1XO5A 4IL1A 2NLNA 1IJ6A 3TUYC 1TCFA 2MAZA 2MRDA 4N5XA 2KFHA 3QRXA 2LAPA 4I5LB 1CM4A 4MZLA 2FJUB 3KEVA 4YGAA 1J55A 5CPVA 2K7CA 1NUBA 1DJXA 1MWNA 2HQ8A 3I5FC 4DS7A 1KWOB 2OS8C 1OZSA 2O60A 1CLMA 1WLMA 2KFFA 2WC8A 5HLVA 1WRKA 1UHNA 5DKRA 5AANA 1B1GA 1QS7A 1RTP1 4YGCB 1SL9A 1YVHA 2OS8B 4PALA 2K0JA 1YTZC 1NPQA 1S1EA 2FOTA 4TNCA 2JULA 2ZNEA 1M39A 3VRQA 1A03A 5CSIA 1BOCA 4JPZB 1DF0A 1BMOA 1ZMZA 1NP8A 3TDIA 1QASA 3CTNA 2QACA 3IQQA 4NQGA 1KFUL 4ZCUA 2KDHA 1IWQA 5DKQA 3CWGA 2ZN8A 5PALA 3I5HB 4WQ3A 1XFXO 3FIAA 2KGRA 4WRIA 5HLOA 4CLNA 3RM1A 1TCOB 1BLQA 1F70A 1W7IB 2FCDA 2F2PA 3NSKA 1ZFSA 3FWBA 4JWQA 2ISDA 1SY9A 1QV0A 4PCWA 3SG3A 1S6CA 2KI6C 1GGZA 1IKUA 5GQQC 3HX4A 4ORAB 1K8UA 2M3WA 1A4PA 1K2HA 1HT9A 3AAKA 2JZIA 1AK8A 1G8IA 1KFXS 1XK4C 2BBNA 2K61A 3CLNA 2ZNDA 2LLUA 1MQ1A 1UHJA 1OMDA 3JVTC 1EG4A 1M45A 1LINA 5CSJA 1SCVA 1YUTA 5KSZA 1CFDA 1YVLA 2M49B 3HCMA 1IH0A 4ORCB 1G4YR 3BQ3A 4YGDB 2MA2A 2LVKA 4MBEA 1LVCD 4C0LA 3BOWB 5CSNA 5HKZA 2K2AA 1SCMB 1KK8B 3OB1B 3OX6A 4JQ0D 1MUXA 1YUUA 2K7BA 1XK4A 4QJ3B 5KTYA 1EG3A 2KNEA 1UWOA 2Q91A 3DD4A 2MLEC 3RLZA 1LA3A 1QX2A 1X02A 1J1DA 2AMIA 1WY9A 3JVTB 2JRFA 2RGIA 4Q04A 1Y1AA 1XFWO 1QATA 1PK0D 3CS1A 4PHKA 4ICBA 1NX3A 1FI5A 1UHIA 2M8UA 2LVIA 3GK2A 2NXQA 3KPXA 5AXIA 2JT3A 1XFYO 4WQ2A 2B1UA 1WRZA 1N0YA 2L50A 3BUOB 5J3XA 4AQIA 1C07A 1F71A 1DF0B 1RROA 1BODA 1TRFA 1DMOA 2JT0A 4NDBA 1ZUZA 1F54A 4GGFC 3BYAA 2KYCA 3EVRA 2KOTA 4HREE 1NIWA 1KQMC 2M0RA 1CLBA 3NSLA 2LMUA 1MHOA 1SL8A 3OB2B 2KQYA 1S5GY 3K21A 5I2QA 1AJ4A 2LUCA 4M2PA 2LMTA 1CDPA 1EH2A 1L2OC 1PALA 2JWWA 2KAYA 2K7OA 2R2IA 1MXEA 1TOPA 3BUWB 2E30A 4PE4A 1QLSA 3SG5A 4QJ5B 1B4CA 1UP5A 1AVSA 1IG5A 3SG6A 2IS9A 1QX7A 3PM8A 5HKWA 1IGVA 4DCKA 1QJTA 2Y5IA 2BKIB 2L0PA 1TNPA 1K93D 2JC2A 3I5FB 1S36A 1KWOC 3ZNIA 2K7DA 2NCPA 1BG1A 1SR6C 4PHMA 3SIAA 1OZOA 2PASA 1J7OA 3DVJA 1F55A 1JFKA 4YI8A 1L2OB 2F33A 1JBAA 2JNFA 2NCOA 1EL4A 3AKBA 1ALVA 1RFJA 4GGFA 3BXKA 2Y1NA 2BCXA 2M97A 1N2DA 2H2KA 1TTXA 2JXCA 3A8RA 1OQPA 3EK7A 5AFPA 1CMGA 2BBMA 2K2FA 1NCZA 2KHNA 2M9GA 2O5GA 1WRLA 1A2XA 3OX5A 1KK7Z 1NX2A 2Y4QA 3D10A 3PN7C 1TNWA 3VROA 1KSMA 2BCBA 4AOMA 2A4JA 1BF5A 1L7ZA 1FBVA 3ICBA 3GK1A 3DVMA 1NCXA 3WHUB 2LNKA 2JQ6A 1PRWA 3AKAA 1B8RA 1SR6B 1OE9B 2BL0C 1CMFA 2HQWA 4YGBB 1CKKA 3D0YA 2BE4A 1XFUO 1XFVO 1XA5A 2L51A 1AP4A 3EK8A 1MXLC 1JFJA 4DRWA 4F0ZB 1DJGA 1Y6WA 1W7JB 4FQOA 1JF0A 1RECA 2H61C 2BL0B 2LANA 4MZJA 3GOFA 2LP3A 2JXLA 2DOQA 1AUIB 1CNPA 1PULA 1SCMC 3FS7A 3PATA 4L9MA 1V1GA 5AERA 1J1EA 3PN7B 4OR9B 2WORA 3O78A 2KYFA 3FWCA 4DUQA 1SPYA 2V53A 2JT8A 3TDZA 2BKHB 4UPGA 2M1UA 1OMVA 3PFVA 2JTZA 1Y1UA 1TIZA 1MF8B 4PE7A 1YX7A 3VGOA 1ALWA 1K90D 1KK7Y 2GGMA 1RWYA 3JTDC 1SRAA 5JOLA 1SYMA 1BT6A 2G9BA 2L5XB 4GFTA 1BR4B 5K89A 3C1VA 1C7WA 5DKNA 2CT9A 2CCMA 1BR1B 2L4HA 2E6WA 3AAJA 2GGZA 4CFRA 1K9KA 4N1GA 3DF0B 5I2LA 4MVFA 2M7LA 3VRNA 1CDMA 1LXFC 1KQMB 3PLFB 4OKHA 1UHHA 1NYAA 1ODBA 1PVBA 3SG4A 2PMYA 4GAOA 1YUSA 1CDLA 1GQMA 2LVVA 2EGDA 2OTGC 1KFUS 2Y1MA 1BU3A 3MSEB 3NXAA 2EC6C 3E3RA 4CIDA 4ETOA 3IF7A 3ZWHA 1OOJA 1EJ3A 2SCPA 4PDZA 1SKTA 1WDCC 1CB1A 4GUKA 4M2OA 1KK8C 1YURA 3EVUA 1H4BA 1CFFA 5BPJA 1DJHA 1OSAA 1S6IA 1ZOTB 4DIRA 1NSHA 3DVKA 5D7FA 1XFZO 3LL8B 4HRHA 5B8IB 1G33A 1RJVA 2KBIA 2ZRTA 3SG2A 4PE1A 1Y0VH 3I5IB 3CZTX 4GNKB 4HSZA 5I8NA 4BY5A 4OVNF 1BJFA 2KBMA 1E8AA 4HRGA 2KSPA 4ORBB 1SL7A 1GGWA 2JTTA 3BOWA 1QLKA 2LE9B 3WNXB 1GJYA 1CLLA 1DJWA 1AJ5A 2JU0A 3NSIA 4GGNA 1DGUA 1S26D 1S6JA 4MN0A 4PHJA 1VRKA 1C7VA 3CR5X 4GBAA 1K9PA 3NSOA 2P6BB 1B9AA 1XVJA 1QIWA 2TN4A 2LHIA 1FPWA 1Y1XA 5G08A 2KAVA 3H4SE 5HYDA 2L4IA 1SBJA 2F2OA 3SJSA 1FW4A 4ZCVA 2CTNA 2BCAA 1B8CA 1SK6D 2KI4C 2ZKMX 5FYXA 1H8BA 3D0YB 5JJGA 3KO0A 4N1FA 4OV2A 1F4QA 1QVIY 4MEWA 1RK9A 2LCPA 5ER4X 1LA0A 4U8DA 1DTLA 2PSRA 4P5OE 1TN4A 1WLZA 5TNCA 5I2OA 2LP2A 1IJ5A 1XYDA 1DVIA 1QX5B 3GK4X 1B8LA 4A4BA 3LK0A 3I5GC 4XYNA 1UURA 2QPTA 2CNPA 3O6BA 1DJIA 2F8PA 1NX1A 5HKYA 1CFPA 3EVVA 3VRRA 2WNDA 1YX8A 2LHLA 2WCFA
chains in the Genus database with same CATH superfamily
1FF1A 2JNXA 2M7NA 4QJ4B 3M0WA 2AUCA 2GV5A 3TS5B 1JWDA 4YGEB 1Q80A 2BNXA 3A4UB 5D3OA 2OTGB 4AQJA 3EK4A 1KFXL 2K8MB 4MSPA 1KQVA 5F6TA 1SW8A 5D69A 3SS5A 1K96A 2WCJA 2K60A 2F3YA 2KLDA 4F7FA 4C0JA 1U5IB 4PHNA 2WOSA 2ZN9A 1NWDA 1R2UA 5AEQA 1CTRA 1A75A 1OMRA 3I5GB 2I7AA 3CZ2A 2LMVA 2KI6D 1CM1A 4I5NB 1K9UA 4D1EA 4NDCA 1F4OA 1TWOA 1U5IA 2I2RE 2WCLA 2F3ZA 3TS5C 1S3PA 2MBXA 2EC6B 3BUNB 1QTXA 2KI4B 1MR8A 2VRGA 2I18A 4NDDA 3TZ1A 1ZACA 4P2YB 2KAXA 1QVIZ 2HETA 1PVAA 1N65A 2WCHA 1YR5A 4YBHB 2LLSA 3N7HA 2M29A 2M1KB 3O4YA 2KLEA 1TNXA 1QV1A 3O2PA 3LCPC 2H61A 1K94A 2OPOA 3D75A 1F8HA 2H8VA 3B7AA 2JPTA 2LLTA 1M63B 1NX0A 2BECA 1PSRA 2KFGA 2MHHA 1DJYA 3F45A 2MLFC 1JC2A 1DGVA 1XFRA 3CR2A 4I5KA 2LVJA 3SG7A 2ZRSA 3L4LA 3LK1A 2I94A 2PVBA 1J7PA 3B86A 1DT7B 2CXJA 1KSOA 3JTDB 3K1EA 1D1OA 1B7TZ 1V1FA 1YRTB 2PALA 3IQOA 1NCYA 3R1VA 3SS4A 3KF9A 1A29A 2LM5A 2D8NA 2LV7A 4BY4A 4A4CA 1SMGA 2L98A 3PSRA 2LUXA 1R6PA 2NZ0A 4MZKA 1J7QA 1IQ3A 3PALA 4R1EA 2PRUA 4USLA 2G2BA 3LLEA 1LKJA 5CSFA 2JOJA 1B7TY 2EHBA 1M31A 1AHRA 4CFQA 2ZFDA 3CR4X 3BUMB 3L4AA 4I5JA 3SIBA 4XJKA 1KCYA 2CBLA 1DJZA 1UUSA 1QIVA 2L2EA 3S0GA 1YRUB 4OCIA 1TNQA 1K95A 3B6XA 4YRUA 5KU1A 2HPSA 1PSBA 1QXPA 1OOFA 3I5HC 2HF5A 4KYNA 3RZSA 2SASA 1JSAA 3OP0A 3KHEA 3S0DA 2MJWB 2WCBA 1J7RA 2QEVA 3TUYB 4PE0A 1JUOA 3WHTB 1SNLA 4CPVA 2FCEA 1WDCB 2BE6A 2LC5A 3DF0A 1CFCA 3NHIA 5ER5A 4FTGA 4XJKB 4YI9A 3TDUA 3OHMB 1B47A 1DC1A 4GPLB 4MLWA 1A75B 2Q4UA 1HQVA 3CGAA 3EKHA 2WCMA 1QWVA 1JF2A 1UHKA 2KQ6A 2KGBC 3BUXB 1IQ5A 1M46A 2COLB 1EXRA 3EKJA 4M2QA 1S5GZ 2WCEA 3DVEA 4C0KA 4E68A 3VRPA 4MRYA 1CDNA 2AAOA 5IBWA 1FI6A 3I5IC 4MRXA 3WXAA 1IRJA 1XO5A 4IL1A 2NLNA 1IJ6A 3TUYC 1TCFA 2MAZA 3L47A 2MRDA 4INXA 4N5XA 1W9ZA 2KFHA 3QRXA 1LS8A 2LAPA 4I5LB 1CM4A 4MZLA 2ERBA 2FJUB 3KEVA 4YGAA 1J55A 5CPVA 2K7CA 4IJ7A 1NUBA 1DJXA 1MWNA 2HQ8A 1OOGA 3I5FC 4DS7A 1KWOB 2OS8C 1OZSA 2O60A 3S0FA 1CLMA 1WLMA 2KFFA 2WC8A 5HLVA 1WRKA 3V2LA 1UHNA 3NGVA 5DKRA 5AANA 1B1GA 1QS7A 2JPOA 1RTP1 4YGCB 1SL9A 1YVHA 2OS8B 4PALA 2K0JA 1YTZC 3BFAA 1NPQA 1S1EA 2FOTA 4TNCA 2QDIA 2JULA 2ZNEA 1M39A 3VRQA 1A03A 5CSIA 1BOCA 3NHTA 4JPZB 1DF0A 1BMOA 1ZMZA 1NP8A 3TDIA 1QASA 3CTNA 2QACA 3IQQA 4NQGA 2KPHA 1KFUL 4ZCUA 1DQEA 3B88A 2KDHA 1IWQA 5DKQA 3CWGA 2ZN8A 5PALA 3I5HB 4WQ3A 1XFXO 1TUZA 3FIAA 2KGRA 4PT1A 4WRIA 5HLOA 4CLNA 3RM1A 1TCOB 1DELA 3DZTA 1BLQA 1W7IB 2FCDA 1F70A 2F2PA 3NSKA 1ZFSA 3FWBA 4JWQA 2ISDA 1SY9A 1QV0A 4PCWA 3SG3A 1S6CA 2KI6C 1GGZA 1IKUA 5GQQC 3HX4A 4ORAB 1K8UA 2M3WA 1A4PA 1K2HA 1HT9A 3AAKA 2JZIA 1AK8A 1G8IA 1KFXS 1XK4C 2BBNA 2K61A 3CLNA 3VB1A 3S0AA 2ZNDA 2LLUA 1MQ1A 1UHJA 1OMDA 3JVTC 1EG4A 1M45A 1LINA 5CSJA 1SCVA 2WCKA 1YUTA 5KSZA 1CFDA 1YVLA 2M49B 3DXLA 3HCMA 1IH0A 4ORCB 1G4YR 3BQ3A 4YGDB 2MA2A 2LVKA 4MBEA 1DEKA 1LVCD 4C0LA 3BOWB 5CSNA 3BFHA 2K2AA 1SCMB 1KK8B 3OB1B 3OX6A 5HKZA 4JQ0D 1MUXA 1YUUA 2K7BA 1XK4A 4QJ3B 5KTYA 1EG3A 1Z2CB 2KNEA 1UWOA 2Q91A 3DD4A 2MLEC 3RLZA 1LA3A 1QX2A 1X02A 5FI7A 1J1DA 2AMIA 1WY9A 3JVTB 2JRFA 2RGIA 4Q04A 1Y1AA 1XFWO 1QATA 1PK0D 3CS1A 4PHKA 3CYZA 4ICBA 1NX3A 3UO9A 1FI5A 1UHIA 2M8UA 2QEBA 2LVIA 3GK2A 2NXQA 3KPXA 5AXIA 2JT3A 3SS3A 1XFYO 3CZ0A 2B1UA 4WQ2A 1WRZA 1N0YA 5FI6A 2L50A 3BUOB 5J3XA 4AQIA 1C07A 1F71A 1DF0B 1RROA 1BODA 1TRFA 1DMOA 2JT0A 4NDBA 1ZUZA 1F54A 3DYEA 4GGFC 3BYAA 2KYCA 3EVRA 2KOTA 2BAPA 1NIWA 1KQMC 4HREE 2M0RA 1CLBA 3NSLA 2LMUA 1MHOA 2QEHA 1SL8A 3OB2B 2KQYA 1S5GY 3K21A 5I2QA 1AJ4A 2LUCA 4M2PA 2LMTA 1CDPA 1EH2A 1L2OC 1PALA 2JWWA 2KAYA 2K7OA 2R2IA 1MXEA 1TOPA 3BUWB 2E30A 3R72A 1QLSA 4PE4A 3SG5A 4QJ5B 1B4CA 1UP5A 1AVSA 1IG5A 3SG6A 2IS9A 1QX7A 3PM8A 5HKWA 1IGVA 4DCKA 1QJTA 2Y5IA 2BKIB 2L0PA 1TNPA 1K93D 2JC2A 5EL2A 3I5FB 1S36A 1KWOC 3ZNIA 2K7DA 2NCPA 1BG1A 1SR6C 4PHMA 2L2CA 2P70A 3SIAA 1OZOA 2PASA 1J7OA 3DVJA 1F55A 1JFKA 4YI8A 1L2OB 2F33A 1JBAA 2JNFA 2NCOA 4JKTA 1EL4A 3AKBA 1ALVA 1RFJA 4GGFA 3BXKA 2Y1NA 4FQTA 2BCXA 2M97A 1N2DA 2H2KA 1TTXA 2JXCA 3A8RA 1OQPA 3EK7A 5AFPA 1CMGA 1TUJA 2BBMA 2K2FA 1NCZA 2KHNA 2M9GA 3S0BA 2O5GA 1WRLA 1A2XA 3OX5A 1KK7Z 1NX2A 2Y4QA 3D10A 3PN7C 1TNWA 3VROA 1KSMA 2BCBA 4AOMA 2A4JA 1BF5A 1L7ZA 3R1OA 2P71A 1FBVA 3ICBA 2PYQA 3GK1A 3DVMA 1NCXA 1T14A 2L5YA 2LNKA 3WHUB 2JQ6A 1PRWA 3AKAA 1B8RA 1SR6B 1SSEB 3PJIA 1OE9B 2BL0C 1CMFA 2HQWA 4YGBB 4INWA 1CKKA 3D0YA 3FE9A 2BE4A 1XFUO 1XFVO 1XA5A 2L51A 1AP4A 3EK8A 1MXLC 1JFJA 4DRWA 4F0ZB 1Y6WA 1C3ZA 1DJGA 1W7JB 4FQOA 1JF0A 1RECA 2H61C 2BL0B 2LANA 4MZJA 5FI2A 4JD9A 3GOFA 2LP3A 3CZ1A 2JXLA 2DOQA 1AUIB 1CNPA 1PULA 1SCMC 3FS7A 3PATA 3IVTA 4L9MA 1V1GA 5AERA 1J1EA 3PN7B 4OR9B 2WORA 3O78A 2KYFA 3FWCA 1ORGA 4DUQA 1SPYA 2QEOA 2V53A 2JT8A 3TDZA 3O4XA 2BKHB 1P28A 4UPGA 2M1UA 1OMVA 3PFVA 2JTZA 1Y1UA 1TIZA 1MF8B 3BFBA 4PE7A 1YX7A 3S0EA 3VGOA 1ALWA 3OBVA 1K90D 1KK7Y 2GGMA 1RWYA 3JTDC 2GTEA 1SRAA 2FJYA 5JOLA 1SYMA 1BT6A 2G9BA 2L5XB 4GFTA 1BR4B 5K89A 1GM0A 3C1VA 1C7WA 2WC5A 3PM2A 5DKNA 2CT9A 2CCMA 1BR1B 2L4HA 2E6WA 3AAJA 2GGZA 4CFRA 1K9KA 4N1GA 3DF0B 4OZDA 5DICA 5I2LA 4MVFA 2M7LA 3B87A 3VRNA 1CDMA 1LXFC 1KQMB 3PLFB 3Q8IA 4OKHA 1UHHA 1NYAA 1ODBA 1PVBA 3D77A 2WC6A 3SG4A 2PMYA 4GAOA 1YUSA 1CDLA 1GQMA 2LVVA 2PQLA 2EGDA 2OTGC 1KFUS 3EG5B 2Y1MA 1BU3A 3MSEB 3BJHA 3NXAA 2EC6C 3E3RA 3OGNA 4CIDA 4ETOA 3D78A 3IF7A 3ZWHA 1OOJA 1EJ3A 2SCPA 4PDZA 1SKTA 1WDCC 1CB1A 4GUKA 4M2OA 1KK8C 1YURA 3EVUA 3D74A 1H4BA 1CFFA 3UNWA 5BPJA 1DJHA 5HL1A 1OSAA 1S6IA 1ZOTB 4DIRA 1NSHA 1Z4HA 3DVKA 5D7FA 1XFZO 3LL8B 4HRHA 5B8IB 5I94A 1G33A 1RJVA 2KBIA 2ZRTA 1OW4A 4PE1A 3SG2A 1Y0VH 3D76A 3I5IB 3CZTX 4GNKB 4HSZA 5I8NA 4BY5A 4OVNF 1BJFA 2KBMA 1E8AA 4HRGA 3FE6A 2KSPA 4ORBB 1SL7A 3R1PA 1GGWA 2JTTA 3BOWA 1QLKA 2LE9B 3WNXB 1GJYA 1CLLA 1DJWA 1AJ5A 2JU0A 3NSIA 4GGNA 1DGUA 1S26D 1S6JA 4MN0A 3CABA 1VRKA 4PHJA 3CR5X 4GBAA 1C7VA 1K9PA 3NSOA 1OOHA 2P6BB 1B9AA 1XVJA 1QIWA 2TN4A 2LHIA 3CDNA 1FPWA 1IIOA 1Y1XA 5G08A 2KAVA 3H4SE 5HYDA 2L4IA 1SBJA 2F2OA 3SJSA 1FW4A 4ZCVA 2CTNA 2BCAA 1B8CA 1OOIX 2YGUA 1SK6D 2KI4C 2ZKMX 5FYXA 1H8BA 3D0YB 5JJGA 3KO0A 4N1FA 4OV2A 1F4QA 1QVIY 4MEWA 1C3YA 1RK9A 2LCPA 3DY9A 5ER4X 1LA0A 4U8DA 3FE8A 1DTLA 2PSRA 4P5OE 1TN4A 1WLZA 3D73A 5TNCA 5I2OA 2LP2A 1IJ5A 1XYDA 1DVIA 1QX5B 3GK4X 1B8LA 4A4BA 3LK0A 3QMEA 3I5GC 4XYNA 1UURA 2QPTA 2CNPA 3O6BA 1DJIA 2F8PA 1NX1A 5HKYA 1CFPA 3EVVA 3VRRA 2WNDA 1YX8A 2LHLA 2WCFA
chains in the Genus database with same CATH topology
1FF1A 2JNXA 2M7NA 4QJ4B 3M0WA 2AUCA 2GV5A 3TS5B 1JWDA 4YGEB 1Q80A 4AQJA 3A4UB 2OTGB 3EK4A 1KFXL 2K8MB 4MSPA 1KQVA 5F6TA 1SW8A 5D69A 1K96A 2F3YA 4C0JA 1U5IB 4PHNA 2WOSA 2ZN9A 1NWDA 1R2UA 5AEQA 1CTRA 1A75A 1OMRA 3I5GB 2I7AA 2LMVA 2KI6D 1CM1A 4I5NB 1K9UA 4D1EA 4NDCA 1F4OA 1U5IA 2I2RE 2F3ZA 3TS5C 1S3PA 2MBXA 2EC6B 3BUNB 1QTXA 2KI4B 1MR8A 2VRGA 2I18A 4NDDA 3TZ1A 1ZACA 4P2YB 2KAXA 1QVIZ 2HETA 1PVAA 1N65A 1YR5A 4YBHB 2LLSA 2M29A 2M1KB 3O4YA 1TNXA 1QV1A 3O2PA 3LCPC 2H61A 1K94A 2OPOA 1F8HA 2JPTA 2LLTA 1M63B 1NX0A 2BECA 1PSRA 2KFGA 2MHHA 1DJYA 3F45A 2MLFC 1JC2A 1DGVA 3CR2A 4I5KA 2LVJA 3SG7A 2ZRSA 3LK1A 2I94A 2PVBA 1J7PA 1DT7B 2CXJA 1KSOA 3JTDB 1D1OA 1B7TZ 1V1FA 1YRTB 2PALA 3IQOA 1NCYA 3KF9A 1A29A 2LM5A 2D8NA 2LV7A 4BY4A 4A4CA 1SMGA 2L98A 3PSRA 2LUXA 1R6PA 2NZ0A 4MZKA 1J7QA 1IQ3A 3PALA 4R1EA 2PRUA 4USLA 2G2BA 3LLEA 1LKJA 5CSFA 2JOJA 1B7TY 2EHBA 1M31A 1AHRA 4CFQA 2ZFDA 3CR4X 3BUMB 4I5JA 3SIBA 4XJKA 1KCYA 2CBLA 1DJZA 1UUSA 1QIVA 2L2EA 1YRUB 4OCIA 1TNQA 1K95A 4YRUA 5KU1A 2HPSA 1PSBA 1QXPA 3I5HC 2HF5A 2SASA 1JSAA 3OP0A 3KHEA 2MJWB 2WCBA 1J7RA 3TUYB 4PE0A 1JUOA 3WHTB 1SNLA 4CPVA 2FCEA 1WDCB 2BE6A 2LC5A 3DF0A 1CFCA 5ER5A 4FTGA 4XJKB 4YI9A 3TDUA 3OHMB 1B47A 4GPLB 4MLWA 1A75B 2Q4UA 1HQVA 3CGAA 3EKHA 1JF2A 1UHKA 2KQ6A 2KGBC 3BUXB 1IQ5A 1M46A 2COLB 1EXRA 3EKJA 4M2QA 1S5GZ 2WCEA 3DVEA 4C0KA 4E68A 3VRPA 4MRYA 1CDNA 2AAOA 5IBWA 1FI6A 3I5IC 4MRXA 3WXAA 1IRJA 1XO5A 4IL1A 2NLNA 1IJ6A 3TUYC 1TCFA 2MAZA 2MRDA 4N5XA 2KFHA 3QRXA 2LAPA 4I5LB 1CM4A 4MZLA 2FJUB 3KEVA 4YGAA 1J55A 5CPVA 2K7CA 1NUBA 1DJXA 1MWNA 2HQ8A 3I5FC 4DS7A 1KWOB 2OS8C 1OZSA 2O60A 1CLMA 1WLMA 2KFFA 2WC8A 5HLVA 1WRKA 1UHNA 5DKRA 5AANA 1B1GA 1QS7A 1RTP1 4YGCB 1SL9A 1YVHA 2OS8B 4PALA 2K0JA 1YTZC 1NPQA 1S1EA 2FOTA 4TNCA 2JULA 2ZNEA 1M39A 3VRQA 1A03A 5CSIA 1BOCA 4JPZB 1DF0A 1BMOA 1ZMZA 1NP8A 3TDIA 1QASA 3CTNA 2QACA 3IQQA 4NQGA 1KFUL 4ZCUA 2KDHA 1IWQA 5DKQA 3CWGA 2ZN8A 5PALA 3I5HB 4WQ3A 1XFXO 3FIAA 2KGRA 4WRIA 5HLOA 4CLNA 3RM1A 1TCOB 1BLQA 1F70A 1W7IB 2FCDA 2F2PA 3NSKA 1ZFSA 3FWBA 4JWQA 2ISDA 1SY9A 1QV0A 4PCWA 3SG3A 1S6CA 2KI6C 1GGZA 1IKUA 5GQQC 3HX4A 4ORAB 1K8UA 2M3WA 1A4PA 1K2HA 1HT9A 3AAKA 2JZIA 1AK8A 1G8IA 1KFXS 1XK4C 2BBNA 2K61A 3CLNA 2ZNDA 2LLUA 1MQ1A 1UHJA 1OMDA 3JVTC 1EG4A 1M45A 1LINA 5CSJA 1SCVA 1YUTA 5KSZA 1CFDA 1YVLA 2M49B 3HCMA 1IH0A 4ORCB 1G4YR 3BQ3A 4YGDB 2MA2A 2LVKA 4MBEA 1LVCD 4C0LA 3BOWB 5CSNA 5HKZA 2K2AA 1SCMB 1KK8B 3OB1B 3OX6A 4JQ0D 1MUXA 1YUUA 2K7BA 1XK4A 4QJ3B 5KTYA 1EG3A 2KNEA 1UWOA 2Q91A 3DD4A 2MLEC 3RLZA 1LA3A 1QX2A 1X02A 1J1DA 2AMIA 1WY9A 3JVTB 2JRFA 2RGIA 4Q04A 1Y1AA 1XFWO 1QATA 1PK0D 3CS1A 4PHKA 4ICBA 1NX3A 1FI5A 1UHIA 2M8UA 2LVIA 3GK2A 2NXQA 3KPXA 5AXIA 2JT3A 1XFYO 4WQ2A 2B1UA 1WRZA 1N0YA 2L50A 3BUOB 5J3XA 4AQIA 1C07A 1F71A 1DF0B 1RROA 1BODA 1TRFA 1DMOA 2JT0A 4NDBA 1ZUZA 1F54A 4GGFC 3BYAA 2KYCA 3EVRA 2KOTA 4HREE 1NIWA 1KQMC 2M0RA 1CLBA 3NSLA 2LMUA 1MHOA 1SL8A 3OB2B 2KQYA 1S5GY 3K21A 5I2QA 1AJ4A 2LUCA 4M2PA 2LMTA 1CDPA 1EH2A 1L2OC 1PALA 2JWWA 2KAYA 2K7OA 2R2IA 1MXEA 1TOPA 3BUWB 2E30A 4PE4A 1QLSA 3SG5A 4QJ5B 1B4CA 1UP5A 1AVSA 1IG5A 3SG6A 2IS9A 1QX7A 3PM8A 5HKWA 1IGVA 4DCKA 1QJTA 2Y5IA 2BKIB 2L0PA 1TNPA 1K93D 2JC2A 3I5FB 1S36A 1KWOC 3ZNIA 2K7DA 2NCPA 1BG1A 1SR6C 4PHMA 3SIAA 1OZOA 2PASA 1J7OA 3DVJA 1F55A 1JFKA 4YI8A 1L2OB 2F33A 1JBAA 2JNFA 2NCOA 1EL4A 3AKBA 1ALVA 1RFJA 4GGFA 3BXKA 2Y1NA 2BCXA 2M97A 1N2DA 2H2KA 1TTXA 2JXCA 3A8RA 1OQPA 3EK7A 5AFPA 1CMGA 2BBMA 2K2FA 1NCZA 2KHNA 2M9GA 2O5GA 1WRLA 1A2XA 3OX5A 1KK7Z 1NX2A 2Y4QA 3D10A 3PN7C 1TNWA 3VROA 1KSMA 2BCBA 4AOMA 2A4JA 1BF5A 1L7ZA 1FBVA 3ICBA 3GK1A 3DVMA 1NCXA 3WHUB 2LNKA 2JQ6A 1PRWA 3AKAA 1B8RA 1SR6B 1OE9B 2BL0C 1CMFA 2HQWA 4YGBB 1CKKA 3D0YA 2BE4A 1XFUO 1XFVO 1XA5A 2L51A 1AP4A 3EK8A 1MXLC 1JFJA 4DRWA 4F0ZB 1DJGA 1Y6WA 1W7JB 4FQOA 1JF0A 1RECA 2H61C 2BL0B 2LANA 4MZJA 3GOFA 2LP3A 2JXLA 2DOQA 1AUIB 1CNPA 1PULA 1SCMC 3FS7A 3PATA 4L9MA 1V1GA 5AERA 1J1EA 3PN7B 4OR9B 2WORA 3O78A 2KYFA 3FWCA 4DUQA 1SPYA 2V53A 2JT8A 3TDZA 2BKHB 4UPGA 2M1UA 1OMVA 3PFVA 2JTZA 1Y1UA 1TIZA 1MF8B 4PE7A 1YX7A 3VGOA 1ALWA 1K90D 1KK7Y 2GGMA 1RWYA 3JTDC 1SRAA 5JOLA 1SYMA 1BT6A 2G9BA 2L5XB 4GFTA 1BR4B 5K89A 3C1VA 1C7WA 5DKNA 2CT9A 2CCMA 1BR1B 2L4HA 2E6WA 3AAJA 2GGZA 4CFRA 1K9KA 4N1GA 3DF0B 5I2LA 4MVFA 2M7LA 3VRNA 1CDMA 1LXFC 1KQMB 3PLFB 4OKHA 1UHHA 1NYAA 1ODBA 1PVBA 3SG4A 2PMYA 4GAOA 1YUSA 1CDLA 1GQMA 2LVVA 2EGDA 2OTGC 1KFUS 2Y1MA 1BU3A 3MSEB 3NXAA 2EC6C 3E3RA 4CIDA 4ETOA 3IF7A 3ZWHA 1OOJA 1EJ3A 2SCPA 4PDZA 1SKTA 1WDCC 1CB1A 4GUKA 4M2OA 1KK8C 1YURA 3EVUA 1H4BA 1CFFA 5BPJA 1DJHA 1OSAA 1S6IA 1ZOTB 4DIRA 1NSHA 3DVKA 5D7FA 1XFZO 3LL8B 4HRHA 5B8IB 1G33A 1RJVA 2KBIA 2ZRTA 3SG2A 4PE1A 1Y0VH 3I5IB 3CZTX 4GNKB 4HSZA 5I8NA 4BY5A 4OVNF 1BJFA 2KBMA 1E8AA 4HRGA 2KSPA 4ORBB 1SL7A 1GGWA 2JTTA 3BOWA 1QLKA 2LE9B 3WNXB 1GJYA 1CLLA 1DJWA 1AJ5A 2JU0A 3NSIA 4GGNA 1DGUA 1S26D 1S6JA 4MN0A 4PHJA 1VRKA 1C7VA 3CR5X 4GBAA 1K9PA 3NSOA 2P6BB 1B9AA 1XVJA 1QIWA 2TN4A 2LHIA 1FPWA 1Y1XA 5G08A 2KAVA 3H4SE 5HYDA 2L4IA 1SBJA 2F2OA 3SJSA 1FW4A 4ZCVA 2CTNA 2BCAA 1B8CA 1SK6D 2KI4C 2ZKMX 5FYXA 1H8BA 3D0YB 5JJGA 3KO0A 4N1FA 4OV2A 1F4QA 1QVIY 4MEWA 1RK9A 2LCPA 5ER4X 1LA0A 4U8DA 1DTLA 2PSRA 4P5OE 1TN4A 1WLZA 5TNCA 5I2OA 2LP2A 1IJ5A 1XYDA 1DVIA 1QX5B 3GK4X 1B8LA 4A4BA 3LK0A 3I5GC 4XYNA 1UURA 2QPTA 2CNPA 3O6BA 1DJIA 2F8PA 1NX1A 5HKYA 1CFPA 3EVVA 3VRRA 2WNDA 1YX8A 2LHLA 2WCFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FF1 A;  2JNX A;  2M7N A;  4QJ4 B;  3M0W A;  2AUC A;  2GV5 A;  3TS5 B;  1JWD A;  4YGE B;  1Q80 A;  4AQJ A;  3A4U B;  2OTG B;  3EK4 A;  1KFX L;  2K8M B;  4MSP A;  1KQV A;  5F6T A;  1SW8 A;  5D69 A;  1K96 A;  2F3Y A;  4C0J A;  1U5I B;  4PHN A;  2WOS A;  2ZN9 A;  1NWD A;  1R2U A;  5AEQ A;  1CTR A;  1A75 A;  1OMR A;  3I5G B;  2I7A A;  2LMV A;  2KI6 D;  1CM1 A;  4I5N B;  1K9U A;  4D1E A;  4NDC A;  1F4O A;  1U5I A;  2I2R E;  2F3Z A;  3TS5 C;  1S3P A;  2MBX A;  2EC6 B;  3BUN B;  1QTX A;  2KI4 B;  1MR8 A;  2VRG A;  2I18 A;  4NDD A;  3TZ1 A;  1ZAC A;  4P2Y B;  2KAX A;  1QVI Z;  2HET A;  1PVA A;  1N65 A;  1YR5 A;  4YBH B;  2LLS A;  2M29 A;  2M1K B;  3O4Y A;  1TNX A;  1QV1 A;  3O2P A;  3LCP C;  2H61 A;  1K94 A;  2OPO A;  1F8H A;  2JPT A;  2LLT A;  1M63 B;  1NX0 A;  2BEC A;  1PSR A;  2KFG A;  2MHH A;  1DJY A;  3F45 A;  2MLF C;  1JC2 A;  1DGV A;  3CR2 A;  4I5K A;  2LVJ A;  3SG7 A;  2ZRS A;  3LK1 A;  2I94 A;  2PVB A;  1J7P A;  1DT7 B;  2CXJ A;  1KSO A;  3JTD B;  1D1O A;  1B7T Z;  1V1F A;  1YRT B;  2PAL A;  3IQO A;  1NCY A;  3KF9 A;  1A29 A;  2LM5 A;  2D8N A;  2LV7 A;  4BY4 A;  4A4C A;  1SMG A;  2L98 A;  3PSR A;  2LUX A;  1R6P A;  2NZ0 A;  4MZK A;  1J7Q A;  1IQ3 A;  3PAL A;  4R1E A;  2PRU A;  4USL A;  2G2B A;  3LLE A;  1LKJ A;  5CSF A;  2JOJ A;  1B7T Y;  2EHB A;  1M31 A;  1AHR A;  4CFQ A;  2ZFD A;  3CR4 X;  3BUM B;  4I5J A;  3SIB A;  4XJK A;  1KCY A;  2CBL A;  1DJZ A;  1UUS A;  1QIV A;  2L2E A;  1YRU B;  4OCI A;  1TNQ A;  1K95 A;  4YRU A;  5KU1 A;  2HPS A;  1PSB A;  1QXP A;  3I5H C;  2HF5 A;  2SAS A;  1JSA A;  3OP0 A;  3KHE A;  2MJW B;  2WCB A;  1J7R A;  3TUY B;  4PE0 A;  1JUO A;  3WHT B;  1SNL A;  4CPV A;  2FCE A;  1WDC B;  2BE6 A;  2LC5 A;  3DF0 A;  1CFC A;  5ER5 A;  4FTG A;  4XJK B;  4YI9 A;  3TDU A;  3OHM B;  1B47 A;  4GPL B;  4MLW A;  1A75 B;  2Q4U A;  1HQV A;  3CGA A;  3EKH A;  1JF2 A;  1UHK A;  2KQ6 A;  2KGB C;  3BUX B;  1IQ5 A;  1M46 A;  2COL B;  1EXR A;  3EKJ A;  4M2Q A;  1S5G Z;  2WCE A;  3DVE A;  4C0K A;  4E68 A;  3VRP A;  4MRY A;  1CDN A;  2AAO A;  5IBW A;  1FI6 A;  3I5I C;  4MRX A;  3WXA A;  1IRJ A;  1XO5 A;  4IL1 A;  2NLN A;  1IJ6 A;  3TUY C;  1TCF A;  2MAZ A;  2MRD A;  4N5X A;  2KFH A;  3QRX A;  2LAP A;  4I5L B;  1CM4 A;  4MZL A;  2FJU B;  3KEV A;  4YGA A;  1J55 A;  5CPV A;  2K7C A;  1NUB A;  1DJX A;  1MWN A;  2HQ8 A;  3I5F C;  4DS7 A;  1KWO B;  2OS8 C;  1OZS A;  2O60 A;  1CLM A;  1WLM A;  2KFF A;  2WC8 A;  5HLV A;  1WRK A;  1UHN A;  5DKR A;  5AAN A;  1B1G A;  1QS7 A;  1RTP 1;  4YGC B;  1SL9 A;  1YVH A;  2OS8 B;  4PAL A;  2K0J A;  1YTZ C;  1NPQ A;  1S1E A;  2FOT A;  4TNC A;  2JUL A;  2ZNE A;  1M39 A;  3VRQ A;  1A03 A;  5CSI A;  1BOC A;  4JPZ B;  1DF0 A;  1BMO A;  1ZMZ A;  1NP8 A;  3TDI A;  1QAS A;  3CTN A;  2QAC A;  3IQQ A;  4NQG A;  1KFU L;  4ZCU A;  2KDH A;  1IWQ A;  5DKQ A;  3CWG A;  2ZN8 A;  5PAL A;  3I5H B;  4WQ3 A;  1XFX O;  3FIA A;  2KGR A;  4WRI A;  5HLO A;  4CLN A;  3RM1 A;  1TCO B;  1BLQ A;  1F70 A;  1W7I B;  2FCD A;  2F2P A;  3NSK A;  1ZFS A;  3FWB A;  4JWQ A;  2ISD A;  1SY9 A;  1QV0 A;  4PCW A;  3SG3 A;  1S6C A;  2KI6 C;  1GGZ A;  1IKU A;  5GQQ C;  3HX4 A;  4ORA B;  1K8U A;  2M3W A;  1A4P A;  1K2H A;  1HT9 A;  3AAK A;  2JZI A;  1AK8 A;  1G8I A;  1KFX S;  1XK4 C;  2BBN A;  2K61 A;  3CLN A;  2ZND A;  2LLU A;  1MQ1 A;  1UHJ A;  1OMD A;  3JVT C;  1EG4 A;  1M45 A;  1LIN A;  5CSJ A;  1SCV A;  1YUT A;  5KSZ A;  1CFD A;  1YVL A;  2M49 B;  3HCM A;  1IH0 A;  4ORC B;  1G4Y R;  3BQ3 A;  4YGD B;  2MA2 A;  2LVK A;  4MBE A;  1LVC D;  4C0L A;  3BOW B;  5CSN A;  5HKZ A;  2K2A A;  1SCM B;  1KK8 B;  3OB1 B;  3OX6 A;  4JQ0 D;  1MUX A;  1YUU A;  2K7B A;  1XK4 A;  4QJ3 B;  5KTY A;  1EG3 A;  2KNE A;  1UWO A;  2Q91 A;  3DD4 A;  2MLE C;  3RLZ A;  1LA3 A;  1QX2 A;  1X02 A;  1J1D A;  2AMI A;  1WY9 A;  3JVT B;  2JRF A;  2RGI A;  4Q04 A;  1Y1A A;  1XFW O;  1QAT A;  1PK0 D;  3CS1 A;  4PHK A;  4ICB A;  1NX3 A;  1FI5 A;  1UHI A;  2M8U A;  2LVI A;  3GK2 A;  2NXQ A;  3KPX A;  5AXI A;  2JT3 A;  1XFY O;  4WQ2 A;  2B1U A;  1WRZ A;  1N0Y A;  2L50 A;  3BUO B;  5J3X A;  4AQI A;  1C07 A;  1F71 A;  1DF0 B;  1RRO A;  1BOD A;  1TRF A;  1DMO A;  2JT0 A;  4NDB A;  1ZUZ A;  1F54 A;  4GGF C;  3BYA A;  2KYC A;  3EVR A;  2KOT A;  4HRE E;  1NIW A;  1KQM C;  2M0R A;  1CLB A;  3NSL A;  2LMU A;  1MHO A;  1SL8 A;  3OB2 B;  2KQY A;  1S5G Y;  3K21 A;  5I2Q A;  1AJ4 A;  2LUC A;  4M2P A;  2LMT A;  1CDP A;  1EH2 A;  1L2O C;  1PAL A;  2JWW A;  2KAY A;  2K7O A;  2R2I A;  1MXE A;  1TOP A;  3BUW B;  2E30 A;  4PE4 A;  1QLS A;  3SG5 A;  4QJ5 B;  1B4C A;  1UP5 A;  1AVS A;  1IG5 A;  3SG6 A;  2IS9 A;  1QX7 A;  3PM8 A;  5HKW A;  1IGV A;  4DCK A;  1QJT A;  2Y5I A;  2BKI B;  2L0P A;  1TNP A;  1K93 D;  2JC2 A;  3I5F B;  1S36 A;  1KWO C;  3ZNI A;  2K7D A;  2NCP A;  1BG1 A;  1SR6 C;  4PHM A;  3SIA A;  1OZO A;  2PAS A;  1J7O A;  3DVJ A;  1F55 A;  1JFK A;  4YI8 A;  1L2O B;  2F33 A;  1JBA A;  2JNF A;  2NCO A;  1EL4 A;  3AKB A;  1ALV A;  1RFJ A;  4GGF A;  3BXK A;  2Y1N A;  2BCX A;  2M97 A;  1N2D A;  2H2K A;  1TTX A;  2JXC A;  3A8R A;  1OQP A;  3EK7 A;  5AFP A;  1CMG A;  2BBM A;  2K2F A;  1NCZ A;  2KHN A;  2M9G A;  2O5G A;  1WRL A;  1A2X A;  3OX5 A;  1KK7 Z;  1NX2 A;  2Y4Q A;  3D10 A;  3PN7 C;  1TNW A;  3VRO A;  1KSM A;  2BCB A;  4AOM A;  2A4J A;  1BF5 A;  1L7Z A;  1FBV A;  3ICB A;  3GK1 A;  3DVM A;  1NCX A;  3WHU B;  2LNK A;  2JQ6 A;  1PRW A;  3AKA A;  1B8R A;  1SR6 B;  1OE9 B;  2BL0 C;  1CMF A;  2HQW A;  4YGB B;  1CKK A;  3D0Y A;  2BE4 A;  1XFU O;  1XFV O;  1XA5 A;  2L51 A;  1AP4 A;  3EK8 A;  1MXL C;  1JFJ A;  4DRW A;  4F0Z B;  1DJG A;  1Y6W A;  1W7J B;  4FQO A;  1JF0 A;  1REC A;  2H61 C;  2BL0 B;  2LAN A;  4MZJ A;  3GOF A;  2LP3 A;  2JXL A;  2DOQ A;  1AUI B;  1CNP A;  1PUL A;  1SCM C;  3FS7 A;  3PAT A;  4L9M A;  1V1G A;  5AER A;  1J1E A;  3PN7 B;  4OR9 B;  2WOR A;  3O78 A;  2KYF A;  3FWC A;  4DUQ A;  1SPY A;  2V53 A;  2JT8 A;  3TDZ A;  2BKH B;  4UPG A;  2M1U A;  1OMV A;  3PFV A;  2JTZ A;  1Y1U A;  1TIZ A;  1MF8 B;  4PE7 A;  1YX7 A;  3VGO A;  1ALW A;  1K90 D;  1KK7 Y;  2GGM A;  1RWY A;  3JTD C;  1SRA A;  5JOL A;  1SYM A;  1BT6 A;  2G9B A;  2L5X B;  4GFT A;  1BR4 B;  5K89 A;  3C1V A;  1C7W A;  5DKN A;  2CT9 A;  2CCM A;  1BR1 B;  2L4H A;  2E6W A;  3AAJ A;  2GGZ A;  4CFR A;  1K9K A;  4N1G A;  3DF0 B;  5I2L A;  4MVF A;  2M7L A;  3VRN A;  1CDM A;  1LXF C;  1KQM B;  3PLF B;  4OKH A;  1UHH A;  1NYA A;  1ODB A;  1PVB A;  3SG4 A;  2PMY A;  4GAO A;  1YUS A;  1CDL A;  1GQM A;  2LVV A;  2EGD A;  2OTG C;  1KFU S;  2Y1M A;  1BU3 A;  3MSE B;  3NXA A;  2EC6 C;  3E3R A;  4CID A;  4ETO A;  3IF7 A;  3ZWH A;  1OOJ A;  1EJ3 A;  2SCP A;  4PDZ A;  1SKT A;  1WDC C;  1CB1 A;  4GUK A;  4M2O A;  1KK8 C;  1YUR A;  3EVU A;  1H4B A;  1CFF A;  5BPJ A;  1DJH A;  1OSA A;  1S6I A;  1ZOT B;  4DIR A;  1NSH A;  3DVK A;  5D7F A;  1XFZ O;  3LL8 B;  4HRH A;  5B8I B;  1G33 A;  1RJV A;  2KBI A;  2ZRT A;  3SG2 A;  4PE1 A;  1Y0V H;  3I5I B;  3CZT X;  4GNK B;  4HSZ A;  5I8N A;  4BY5 A;  4OVN F;  1BJF A;  2KBM A;  1E8A A;  4HRG A;  2KSP A;  4ORB B;  1SL7 A;  1GGW A;  2JTT A;  3BOW A;  1QLK A;  2LE9 B;  3WNX B;  1GJY A;  1CLL A;  1DJW A;  1AJ5 A;  2JU0 A;  3NSI A;  4GGN A;  1DGU A;  1S26 D;  1S6J A;  4MN0 A;  4PHJ A;  1VRK A;  1C7V A;  3CR5 X;  4GBA A;  1K9P A;  3NSO A;  2P6B B;  1B9A A;  1XVJ A;  1QIW A;  2TN4 A;  2LHI A;  1FPW A;  1Y1X A;  5G08 A;  2KAV A;  3H4S E;  5HYD A;  2L4I A;  1SBJ A;  2F2O A;  3SJS A;  1FW4 A;  4ZCV A;  2CTN A;  2BCA A;  1B8C A;  1SK6 D;  2KI4 C;  2ZKM X;  5FYX A;  1H8B A;  3D0Y B;  5JJG A;  3KO0 A;  4N1F A;  4OV2 A;  1F4Q A;  1QVI Y;  4MEW A;  1RK9 A;  2LCP A;  5ER4 X;  1LA0 A;  4U8D A;  1DTL A;  2PSR A;  4P5O E;  1TN4 A;  1WLZ A;  5TNC A;  5I2O A;  2LP2 A;  1IJ5 A;  1XYD A;  1DVI A;  1QX5 B;  3GK4 X;  1B8L A;  4A4B A;  3LK0 A;  3I5G C;  4XYN A;  1UUR A;  2QPT A;  2CNP A;  3O6B A;  1DJI A;  2F8P A;  1NX1 A;  5HKY A;  1CFP A;  3EVV A;  3VRR A;  2WND A;  1YX8 A;  2LHL A;  2WCF A; 
#chains in the Genus database with same CATH topology
 1FF1 A;  2JNX A;  2M7N A;  4QJ4 B;  3M0W A;  2AUC A;  2GV5 A;  3TS5 B;  1JWD A;  4YGE B;  1Q80 A;  2BNX A;  3A4U B;  5D3O A;  2OTG B;  4AQJ A;  3EK4 A;  1KFX L;  2K8M B;  4MSP A;  1KQV A;  5F6T A;  1SW8 A;  5D69 A;  3SS5 A;  1K96 A;  2WCJ A;  2K60 A;  2F3Y A;  2KLD A;  4F7F A;  4C0J A;  1U5I B;  4PHN A;  2WOS A;  2ZN9 A;  1NWD A;  1R2U A;  5AEQ A;  1CTR A;  1A75 A;  1OMR A;  3I5G B;  2I7A A;  3CZ2 A;  2LMV A;  2KI6 D;  1CM1 A;  4I5N B;  1K9U A;  4D1E A;  4NDC A;  1F4O A;  1TWO A;  1U5I A;  2I2R E;  2WCL A;  2F3Z A;  3TS5 C;  1S3P A;  2MBX A;  2EC6 B;  3BUN B;  1QTX A;  2KI4 B;  1MR8 A;  2VRG A;  2I18 A;  4NDD A;  3TZ1 A;  1ZAC A;  4P2Y B;  2KAX A;  1QVI Z;  2HET A;  1PVA A;  1N65 A;  2WCH A;  1YR5 A;  4YBH B;  2LLS A;  3N7H A;  2M29 A;  2M1K B;  3O4Y A;  2KLE A;  1TNX A;  1QV1 A;  3O2P A;  3LCP C;  2H61 A;  1K94 A;  2OPO A;  3D75 A;  1F8H A;  2H8V A;  3B7A A;  2JPT A;  2LLT A;  1M63 B;  1NX0 A;  2BEC A;  1PSR A;  2KFG A;  2MHH A;  1DJY A;  3F45 A;  2MLF C;  1JC2 A;  1DGV A;  1XFR A;  3CR2 A;  4I5K A;  2LVJ A;  3SG7 A;  2ZRS A;  3L4L A;  3LK1 A;  2I94 A;  2PVB A;  1J7P A;  3B86 A;  1DT7 B;  2CXJ A;  1KSO A;  3JTD B;  3K1E A;  1D1O A;  1B7T Z;  1V1F A;  1YRT B;  2PAL A;  3IQO A;  1NCY A;  3R1V A;  3SS4 A;  3KF9 A;  1A29 A;  2LM5 A;  2D8N A;  2LV7 A;  4BY4 A;  4A4C A;  1SMG A;  2L98 A;  3PSR A;  2LUX A;  1R6P A;  2NZ0 A;  4MZK A;  1J7Q A;  1IQ3 A;  3PAL A;  4R1E A;  2PRU A;  4USL A;  2G2B A;  3LLE A;  1LKJ A;  5CSF A;  2JOJ A;  1B7T Y;  2EHB A;  1M31 A;  1AHR A;  4CFQ A;  2ZFD A;  3CR4 X;  3BUM B;  3L4A A;  4I5J A;  3SIB A;  4XJK A;  1KCY A;  2CBL A;  1DJZ A;  1UUS A;  1QIV A;  2L2E A;  3S0G A;  1YRU B;  4OCI A;  1TNQ A;  1K95 A;  3B6X A;  4YRU A;  5KU1 A;  2HPS A;  1PSB A;  1QXP A;  1OOF A;  3I5H C;  2HF5 A;  4KYN A;  3RZS A;  2SAS A;  1JSA A;  3OP0 A;  3KHE A;  3S0D A;  2MJW B;  2WCB A;  1J7R A;  2QEV A;  3TUY B;  4PE0 A;  1JUO A;  3WHT B;  1SNL A;  4CPV A;  2FCE A;  1WDC B;  2BE6 A;  2LC5 A;  3DF0 A;  1CFC A;  3NHI A;  5ER5 A;  4FTG A;  4XJK B;  4YI9 A;  3TDU A;  3OHM B;  1B47 A;  1DC1 A;  4GPL B;  4MLW A;  1A75 B;  2Q4U A;  1HQV A;  3CGA A;  3EKH A;  2WCM A;  1QWV A;  1JF2 A;  1UHK A;  2KQ6 A;  2KGB C;  3BUX B;  1IQ5 A;  1M46 A;  2COL B;  1EXR A;  3EKJ A;  4M2Q A;  1S5G Z;  2WCE A;  3DVE A;  4C0K A;  4E68 A;  3VRP A;  4MRY A;  1CDN A;  2AAO A;  5IBW A;  1FI6 A;  3I5I C;  4MRX A;  3WXA A;  1IRJ A;  1XO5 A;  4IL1 A;  2NLN A;  1IJ6 A;  3TUY C;  1TCF A;  2MAZ A;  3L47 A;  2MRD A;  4INX A;  4N5X A;  1W9Z A;  2KFH A;  3QRX A;  1LS8 A;  2LAP A;  4I5L B;  1CM4 A;  4MZL A;  2ERB A;  2FJU B;  3KEV A;  4YGA A;  1J55 A;  5CPV A;  2K7C A;  4IJ7 A;  1NUB A;  1DJX A;  1MWN A;  2HQ8 A;  1OOG A;  3I5F C;  4DS7 A;  1KWO B;  2OS8 C;  1OZS A;  2O60 A;  3S0F A;  1CLM A;  1WLM A;  2KFF A;  2WC8 A;  5HLV A;  1WRK A;  3V2L A;  1UHN A;  3NGV A;  5DKR A;  5AAN A;  1B1G A;  1QS7 A;  2JPO A;  1RTP 1;  4YGC B;  1SL9 A;  1YVH A;  2OS8 B;  4PAL A;  2K0J A;  1YTZ C;  3BFA A;  1NPQ A;  1S1E A;  2FOT A;  4TNC A;  2QDI A;  2JUL A;  2ZNE A;  1M39 A;  3VRQ A;  1A03 A;  5CSI A;  1BOC A;  3NHT A;  4JPZ B;  1DF0 A;  1BMO A;  1ZMZ A;  1NP8 A;  3TDI A;  1QAS A;  3CTN A;  2QAC A;  3IQQ A;  4NQG A;  2KPH A;  1KFU L;  4ZCU A;  1DQE A;  3B88 A;  2KDH A;  1IWQ A;  5DKQ A;  3CWG A;  2ZN8 A;  5PAL A;  3I5H B;  4WQ3 A;  1XFX O;  1TUZ A;  3FIA A;  2KGR A;  4PT1 A;  4WRI A;  5HLO A;  4CLN A;  3RM1 A;  1TCO B;  1DEL A;  3DZT A;  1BLQ A;  1W7I B;  2FCD A;  1F70 A;  2F2P A;  3NSK A;  1ZFS A;  3FWB A;  4JWQ A;  2ISD A;  1SY9 A;  1QV0 A;  4PCW A;  3SG3 A;  1S6C A;  2KI6 C;  1GGZ A;  1IKU A;  5GQQ C;  3HX4 A;  4ORA B;  1K8U A;  2M3W A;  1A4P A;  1K2H A;  1HT9 A;  3AAK A;  2JZI A;  1AK8 A;  1G8I A;  1KFX S;  1XK4 C;  2BBN A;  2K61 A;  3CLN A;  3VB1 A;  3S0A A;  2ZND A;  2LLU A;  1MQ1 A;  1UHJ A;  1OMD A;  3JVT C;  1EG4 A;  1M45 A;  1LIN A;  5CSJ A;  1SCV A;  2WCK A;  1YUT A;  5KSZ A;  1CFD A;  1YVL A;  2M49 B;  3DXL A;  3HCM A;  1IH0 A;  4ORC B;  1G4Y R;  3BQ3 A;  4YGD B;  2MA2 A;  2LVK A;  4MBE A;  1DEK A;  1LVC D;  4C0L A;  3BOW B;  5CSN A;  3BFH A;  2K2A A;  1SCM B;  1KK8 B;  3OB1 B;  3OX6 A;  5HKZ A;  4JQ0 D;  1MUX A;  1YUU A;  2K7B A;  1XK4 A;  4QJ3 B;  5KTY A;  1EG3 A;  1Z2C B;  2KNE A;  1UWO A;  2Q91 A;  3DD4 A;  2MLE C;  3RLZ A;  1LA3 A;  1QX2 A;  1X02 A;  5FI7 A;  1J1D A;  2AMI A;  1WY9 A;  3JVT B;  2JRF A;  2RGI A;  4Q04 A;  1Y1A A;  1XFW O;  1QAT A;  1PK0 D;  3CS1 A;  4PHK A;  3CYZ A;  4ICB A;  1NX3 A;  3UO9 A;  1FI5 A;  1UHI A;  2M8U A;  2QEB A;  2LVI A;  3GK2 A;  2NXQ A;  3KPX A;  5AXI A;  2JT3 A;  3SS3 A;  1XFY O;  3CZ0 A;  2B1U A;  4WQ2 A;  1WRZ A;  1N0Y A;  5FI6 A;  2L50 A;  3BUO B;  5J3X A;  4AQI A;  1C07 A;  1F71 A;  1DF0 B;  1RRO A;  1BOD A;  1TRF A;  1DMO A;  2JT0 A;  4NDB A;  1ZUZ A;  1F54 A;  3DYE A;  4GGF C;  3BYA A;  2KYC A;  3EVR A;  2KOT A;  2BAP A;  1NIW A;  1KQM C;  4HRE E;  2M0R A;  1CLB A;  3NSL A;  2LMU A;  1MHO A;  2QEH A;  1SL8 A;  3OB2 B;  2KQY A;  1S5G Y;  3K21 A;  5I2Q A;  1AJ4 A;  2LUC A;  4M2P A;  2LMT A;  1CDP A;  1EH2 A;  1L2O C;  1PAL A;  2JWW A;  2KAY A;  2K7O A;  2R2I A;  1MXE A;  1TOP A;  3BUW B;  2E30 A;  3R72 A;  1QLS A;  4PE4 A;  3SG5 A;  4QJ5 B;  1B4C A;  1UP5 A;  1AVS A;  1IG5 A;  3SG6 A;  2IS9 A;  1QX7 A;  3PM8 A;  5HKW A;  1IGV A;  4DCK A;  1QJT A;  2Y5I A;  2BKI B;  2L0P A;  1TNP A;  1K93 D;  2JC2 A;  5EL2 A;  3I5F B;  1S36 A;  1KWO C;  3ZNI A;  2K7D A;  2NCP A;  1BG1 A;  1SR6 C;  4PHM A;  2L2C A;  2P70 A;  3SIA A;  1OZO A;  2PAS A;  1J7O A;  3DVJ A;  1F55 A;  1JFK A;  4YI8 A;  1L2O B;  2F33 A;  1JBA A;  2JNF A;  2NCO A;  4JKT A;  1EL4 A;  3AKB A;  1ALV A;  1RFJ A;  4GGF A;  3BXK A;  2Y1N A;  4FQT A;  2BCX A;  2M97 A;  1N2D A;  2H2K A;  1TTX A;  2JXC A;  3A8R A;  1OQP A;  3EK7 A;  5AFP A;  1CMG A;  1TUJ A;  2BBM A;  2K2F A;  1NCZ A;  2KHN A;  2M9G A;  3S0B A;  2O5G A;  1WRL A;  1A2X A;  3OX5 A;  1KK7 Z;  1NX2 A;  2Y4Q A;  3D10 A;  3PN7 C;  1TNW A;  3VRO A;  1KSM A;  2BCB A;  4AOM A;  2A4J A;  1BF5 A;  1L7Z A;  3R1O A;  2P71 A;  1FBV A;  3ICB A;  2PYQ A;  3GK1 A;  3DVM A;  1NCX A;  1T14 A;  2L5Y A;  2LNK A;  3WHU B;  2JQ6 A;  1PRW A;  3AKA A;  1B8R A;  1SR6 B;  1SSE B;  3PJI A;  1OE9 B;  2BL0 C;  1CMF A;  2HQW A;  4YGB B;  4INW A;  1CKK A;  3D0Y A;  3FE9 A;  2BE4 A;  1XFU O;  1XFV O;  1XA5 A;  2L51 A;  1AP4 A;  3EK8 A;  1MXL C;  1JFJ A;  4DRW A;  4F0Z B;  1Y6W A;  1C3Z A;  1DJG A;  1W7J B;  4FQO A;  1JF0 A;  1REC A;  2H61 C;  2BL0 B;  2LAN A;  4MZJ A;  5FI2 A;  4JD9 A;  3GOF A;  2LP3 A;  3CZ1 A;  2JXL A;  2DOQ A;  1AUI B;  1CNP A;  1PUL A;  1SCM C;  3FS7 A;  3PAT A;  3IVT A;  4L9M A;  1V1G A;  5AER A;  1J1E A;  3PN7 B;  4OR9 B;  2WOR A;  3O78 A;  2KYF A;  3FWC A;  1ORG A;  4DUQ A;  1SPY A;  2QEO A;  2V53 A;  2JT8 A;  3TDZ A;  3O4X A;  2BKH B;  1P28 A;  4UPG A;  2M1U A;  1OMV A;  3PFV A;  2JTZ A;  1Y1U A;  1TIZ A;  1MF8 B;  3BFB A;  4PE7 A;  1YX7 A;  3S0E A;  3VGO A;  1ALW A;  3OBV A;  1K90 D;  1KK7 Y;  2GGM A;  1RWY A;  3JTD C;  2GTE A;  1SRA A;  2FJY A;  5JOL A;  1SYM A;  1BT6 A;  2G9B A;  2L5X B;  4GFT A;  1BR4 B;  5K89 A;  1GM0 A;  3C1V A;  1C7W A;  2WC5 A;  3PM2 A;  5DKN A;  2CT9 A;  2CCM A;  1BR1 B;  2L4H A;  2E6W A;  3AAJ A;  2GGZ A;  4CFR A;  1K9K A;  4N1G A;  3DF0 B;  4OZD A;  5DIC A;  5I2L A;  4MVF A;  2M7L A;  3B87 A;  3VRN A;  1CDM A;  1LXF C;  1KQM B;  3PLF B;  3Q8I A;  4OKH A;  1UHH A;  1NYA A;  1ODB A;  1PVB A;  3D77 A;  2WC6 A;  3SG4 A;  2PMY A;  4GAO A;  1YUS A;  1CDL A;  1GQM A;  2LVV A;  2PQL A;  2EGD A;  2OTG C;  1KFU S;  3EG5 B;  2Y1M A;  1BU3 A;  3MSE B;  3BJH A;  3NXA A;  2EC6 C;  3E3R A;  3OGN A;  4CID A;  4ETO A;  3D78 A;  3IF7 A;  3ZWH A;  1OOJ A;  1EJ3 A;  2SCP A;  4PDZ A;  1SKT A;  1WDC C;  1CB1 A;  4GUK A;  4M2O A;  1KK8 C;  1YUR A;  3EVU A;  3D74 A;  1H4B A;  1CFF A;  3UNW A;  5BPJ A;  1DJH A;  5HL1 A;  1OSA A;  1S6I A;  1ZOT B;  4DIR A;  1NSH A;  1Z4H A;  3DVK A;  5D7F A;  1XFZ O;  3LL8 B;  4HRH A;  5B8I B;  5I94 A;  1G33 A;  1RJV A;  2KBI A;  2ZRT A;  1OW4 A;  4PE1 A;  3SG2 A;  1Y0V H;  3D76 A;  3I5I B;  3CZT X;  4GNK B;  4HSZ A;  5I8N A;  4BY5 A;  4OVN F;  1BJF A;  2KBM A;  1E8A A;  4HRG A;  3FE6 A;  2KSP A;  4ORB B;  1SL7 A;  3R1P A;  1GGW A;  2JTT A;  3BOW A;  1QLK A;  2LE9 B;  3WNX B;  1GJY A;  1CLL A;  1DJW A;  1AJ5 A;  2JU0 A;  3NSI A;  4GGN A;  1DGU A;  1S26 D;  1S6J A;  4MN0 A;  3CAB A;  1VRK A;  4PHJ A;  3CR5 X;  4GBA A;  1C7V A;  1K9P A;  3NSO A;  1OOH A;  2P6B B;  1B9A A;  1XVJ A;  1QIW A;  2TN4 A;  2LHI A;  3CDN A;  1FPW A;  1IIO A;  1Y1X A;  5G08 A;  2KAV A;  3H4S E;  5HYD A;  2L4I A;  1SBJ A;  2F2O A;  3SJS A;  1FW4 A;  4ZCV A;  2CTN A;  2BCA A;  1B8C A;  1OOI X;  2YGU A;  1SK6 D;  2KI4 C;  2ZKM X;  5FYX A;  1H8B A;  3D0Y B;  5JJG A;  3KO0 A;  4N1F A;  4OV2 A;  1F4Q A;  1QVI Y;  4MEW A;  1C3Y A;  1RK9 A;  2LCP A;  3DY9 A;  5ER4 X;  1LA0 A;  4U8D A;  3FE8 A;  1DTL A;  2PSR A;  4P5O E;  1TN4 A;  1WLZ A;  3D73 A;  5TNC A;  5I2O A;  2LP2 A;  1IJ5 A;  1XYD A;  1DVI A;  1QX5 B;  3GK4 X;  1B8L A;  4A4B A;  3LK0 A;  3QME A;  3I5G C;  4XYN A;  1UUR A;  2QPT A;  2CNP A;  3O6B A;  1DJI A;  2F8P A;  1NX1 A;  5HKY A;  1CFP A;  3EVV A;  3VRR A;  2WND A;  1YX8 A;  2LHL A;  2WCF A; 
#chains in the Genus database with same CATH homology
 1FF1 A;  2JNX A;  2M7N A;  4QJ4 B;  3M0W A;  2AUC A;  2GV5 A;  3TS5 B;  1JWD A;  4YGE B;  1Q80 A;  4AQJ A;  3A4U B;  2OTG B;  3EK4 A;  1KFX L;  2K8M B;  4MSP A;  1KQV A;  5F6T A;  1SW8 A;  5D69 A;  1K96 A;  2F3Y A;  4C0J A;  1U5I B;  4PHN A;  2WOS A;  2ZN9 A;  1NWD A;  1R2U A;  5AEQ A;  1CTR A;  1A75 A;  1OMR A;  3I5G B;  2I7A A;  2LMV A;  2KI6 D;  1CM1 A;  4I5N B;  1K9U A;  4D1E A;  4NDC A;  1F4O A;  1U5I A;  2I2R E;  2F3Z A;  3TS5 C;  1S3P A;  2MBX A;  2EC6 B;  3BUN B;  1QTX A;  2KI4 B;  1MR8 A;  2VRG A;  2I18 A;  4NDD A;  3TZ1 A;  1ZAC A;  4P2Y B;  2KAX A;  1QVI Z;  2HET A;  1PVA A;  1N65 A;  1YR5 A;  4YBH B;  2LLS A;  2M29 A;  2M1K B;  3O4Y A;  1TNX A;  1QV1 A;  3O2P A;  3LCP C;  2H61 A;  1K94 A;  2OPO A;  1F8H A;  2JPT A;  2LLT A;  1M63 B;  1NX0 A;  2BEC A;  1PSR A;  2KFG A;  2MHH A;  1DJY A;  3F45 A;  2MLF C;  1JC2 A;  1DGV A;  3CR2 A;  4I5K A;  2LVJ A;  3SG7 A;  2ZRS A;  3LK1 A;  2I94 A;  2PVB A;  1J7P A;  1DT7 B;  2CXJ A;  1KSO A;  3JTD B;  1D1O A;  1B7T Z;  1V1F A;  1YRT B;  2PAL A;  3IQO A;  1NCY A;  3KF9 A;  1A29 A;  2LM5 A;  2D8N A;  2LV7 A;  4BY4 A;  4A4C A;  1SMG A;  2L98 A;  3PSR A;  2LUX A;  1R6P A;  2NZ0 A;  4MZK A;  1J7Q A;  1IQ3 A;  3PAL A;  4R1E A;  2PRU A;  4USL A;  2G2B A;  3LLE A;  1LKJ A;  5CSF A;  2JOJ A;  1B7T Y;  2EHB A;  1M31 A;  1AHR A;  4CFQ A;  2ZFD A;  3CR4 X;  3BUM B;  4I5J A;  3SIB A;  4XJK A;  1KCY A;  2CBL A;  1DJZ A;  1UUS A;  1QIV A;  2L2E A;  1YRU B;  4OCI A;  1TNQ A;  1K95 A;  4YRU A;  5KU1 A;  2HPS A;  1PSB A;  1QXP A;  3I5H C;  2HF5 A;  2SAS A;  1JSA A;  3OP0 A;  3KHE A;  2MJW B;  2WCB A;  1J7R A;  3TUY B;  4PE0 A;  1JUO A;  3WHT B;  1SNL A;  4CPV A;  2FCE A;  1WDC B;  2BE6 A;  2LC5 A;  3DF0 A;  1CFC A;  5ER5 A;  4FTG A;  4XJK B;  4YI9 A;  3TDU A;  3OHM B;  1B47 A;  4GPL B;  4MLW A;  1A75 B;  2Q4U A;  1HQV A;  3CGA A;  3EKH A;  1JF2 A;  1UHK A;  2KQ6 A;  2KGB C;  3BUX B;  1IQ5 A;  1M46 A;  2COL B;  1EXR A;  3EKJ A;  4M2Q A;  1S5G Z;  2WCE A;  3DVE A;  4C0K A;  4E68 A;  3VRP A;  4MRY A;  1CDN A;  2AAO A;  5IBW A;  1FI6 A;  3I5I C;  4MRX A;  3WXA A;  1IRJ A;  1XO5 A;  4IL1 A;  2NLN A;  1IJ6 A;  3TUY C;  1TCF A;  2MAZ A;  2MRD A;  4N5X A;  2KFH A;  3QRX A;  2LAP A;  4I5L B;  1CM4 A;  4MZL A;  2FJU B;  3KEV A;  4YGA A;  1J55 A;  5CPV A;  2K7C A;  1NUB A;  1DJX A;  1MWN A;  2HQ8 A;  3I5F C;  4DS7 A;  1KWO B;  2OS8 C;  1OZS A;  2O60 A;  1CLM A;  1WLM A;  2KFF A;  2WC8 A;  5HLV A;  1WRK A;  1UHN A;  5DKR A;  5AAN A;  1B1G A;  1QS7 A;  1RTP 1;  4YGC B;  1SL9 A;  1YVH A;  2OS8 B;  4PAL A;  2K0J A;  1YTZ C;  1NPQ A;  1S1E A;  2FOT A;  4TNC A;  2JUL A;  2ZNE A;  1M39 A;  3VRQ A;  1A03 A;  5CSI A;  1BOC A;  4JPZ B;  1DF0 A;  1BMO A;  1ZMZ A;  1NP8 A;  3TDI A;  1QAS A;  3CTN A;  2QAC A;  3IQQ A;  4NQG A;  1KFU L;  4ZCU A;  2KDH A;  1IWQ A;  5DKQ A;  3CWG A;  2ZN8 A;  5PAL A;  3I5H B;  4WQ3 A;  1XFX O;  3FIA A;  2KGR A;  4WRI A;  5HLO A;  4CLN A;  3RM1 A;  1TCO B;  1BLQ A;  1F70 A;  1W7I B;  2FCD A;  2F2P A;  3NSK A;  1ZFS A;  3FWB A;  4JWQ A;  2ISD A;  1SY9 A;  1QV0 A;  4PCW A;  3SG3 A;  1S6C A;  2KI6 C;  1GGZ A;  1IKU A;  5GQQ C;  3HX4 A;  4ORA B;  1K8U A;  2M3W A;  1A4P A;  1K2H A;  1HT9 A;  3AAK A;  2JZI A;  1AK8 A;  1G8I A;  1KFX S;  1XK4 C;  2BBN A;  2K61 A;  3CLN A;  2ZND A;  2LLU A;  1MQ1 A;  1UHJ A;  1OMD A;  3JVT C;  1EG4 A;  1M45 A;  1LIN A;  5CSJ A;  1SCV A;  1YUT A;  5KSZ A;  1CFD A;  1YVL A;  2M49 B;  3HCM A;  1IH0 A;  4ORC B;  1G4Y R;  3BQ3 A;  4YGD B;  2MA2 A;  2LVK A;  4MBE A;  1LVC D;  4C0L A;  3BOW B;  5CSN A;  5HKZ A;  2K2A A;  1SCM B;  1KK8 B;  3OB1 B;  3OX6 A;  4JQ0 D;  1MUX A;  1YUU A;  2K7B A;  1XK4 A;  4QJ3 B;  5KTY A;  1EG3 A;  2KNE A;  1UWO A;  2Q91 A;  3DD4 A;  2MLE C;  3RLZ A;  1LA3 A;  1QX2 A;  1X02 A;  1J1D A;  2AMI A;  1WY9 A;  3JVT B;  2JRF A;  2RGI A;  4Q04 A;  1Y1A A;  1XFW O;  1QAT A;  1PK0 D;  3CS1 A;  4PHK A;  4ICB A;  1NX3 A;  1FI5 A;  1UHI A;  2M8U A;  2LVI A;  3GK2 A;  2NXQ A;  3KPX A;  5AXI A;  2JT3 A;  1XFY O;  4WQ2 A;  2B1U A;  1WRZ A;  1N0Y A;  2L50 A;  3BUO B;  5J3X A;  4AQI A;  1C07 A;  1F71 A;  1DF0 B;  1RRO A;  1BOD A;  1TRF A;  1DMO A;  2JT0 A;  4NDB A;  1ZUZ A;  1F54 A;  4GGF C;  3BYA A;  2KYC A;  3EVR A;  2KOT A;  4HRE E;  1NIW A;  1KQM C;  2M0R A;  1CLB A;  3NSL A;  2LMU A;  1MHO A;  1SL8 A;  3OB2 B;  2KQY A;  1S5G Y;  3K21 A;  5I2Q A;  1AJ4 A;  2LUC A;  4M2P A;  2LMT A;  1CDP A;  1EH2 A;  1L2O C;  1PAL A;  2JWW A;  2KAY A;  2K7O A;  2R2I A;  1MXE A;  1TOP A;  3BUW B;  2E30 A;  4PE4 A;  1QLS A;  3SG5 A;  4QJ5 B;  1B4C A;  1UP5 A;  1AVS A;  1IG5 A;  3SG6 A;  2IS9 A;  1QX7 A;  3PM8 A;  5HKW A;  1IGV A;  4DCK A;  1QJT A;  2Y5I A;  2BKI B;  2L0P A;  1TNP A;  1K93 D;  2JC2 A;  3I5F B;  1S36 A;  1KWO C;  3ZNI A;  2K7D A;  2NCP A;  1BG1 A;  1SR6 C;  4PHM A;  3SIA A;  1OZO A;  2PAS A;  1J7O A;  3DVJ A;  1F55 A;  1JFK A;  4YI8 A;  1L2O B;  2F33 A;  1JBA A;  2JNF A;  2NCO A;  1EL4 A;  3AKB A;  1ALV A;  1RFJ A;  4GGF A;  3BXK A;  2Y1N A;  2BCX A;  2M97 A;  1N2D A;  2H2K A;  1TTX A;  2JXC A;  3A8R A;  1OQP A;  3EK7 A;  5AFP A;  1CMG A;  2BBM A;  2K2F A;  1NCZ A;  2KHN A;  2M9G A;  2O5G A;  1WRL A;  1A2X A;  3OX5 A;  1KK7 Z;  1NX2 A;  2Y4Q A;  3D10 A;  3PN7 C;  1TNW A;  3VRO A;  1KSM A;  2BCB A;  4AOM A;  2A4J A;  1BF5 A;  1L7Z A;  1FBV A;  3ICB A;  3GK1 A;  3DVM A;  1NCX A;  3WHU B;  2LNK A;  2JQ6 A;  1PRW A;  3AKA A;  1B8R A;  1SR6 B;  1OE9 B;  2BL0 C;  1CMF A;  2HQW A;  4YGB B;  1CKK A;  3D0Y A;  2BE4 A;  1XFU O;  1XFV O;  1XA5 A;  2L51 A;  1AP4 A;  3EK8 A;  1MXL C;  1JFJ A;  4DRW A;  4F0Z B;  1DJG A;  1Y6W A;  1W7J B;  4FQO A;  1JF0 A;  1REC A;  2H61 C;  2BL0 B;  2LAN A;  4MZJ A;  3GOF A;  2LP3 A;  2JXL A;  2DOQ A;  1AUI B;  1CNP A;  1PUL A;  1SCM C;  3FS7 A;  3PAT A;  4L9M A;  1V1G A;  5AER A;  1J1E A;  3PN7 B;  4OR9 B;  2WOR A;  3O78 A;  2KYF A;  3FWC A;  4DUQ A;  1SPY A;  2V53 A;  2JT8 A;  3TDZ A;  2BKH B;  4UPG A;  2M1U A;  1OMV A;  3PFV A;  2JTZ A;  1Y1U A;  1TIZ A;  1MF8 B;  4PE7 A;  1YX7 A;  3VGO A;  1ALW A;  1K90 D;  1KK7 Y;  2GGM A;  1RWY A;  3JTD C;  1SRA A;  5JOL A;  1SYM A;  1BT6 A;  2G9B A;  2L5X B;  4GFT A;  1BR4 B;  5K89 A;  3C1V A;  1C7W A;  5DKN A;  2CT9 A;  2CCM A;  1BR1 B;  2L4H A;  2E6W A;  3AAJ A;  2GGZ A;  4CFR A;  1K9K A;  4N1G A;  3DF0 B;  5I2L A;  4MVF A;  2M7L A;  3VRN A;  1CDM A;  1LXF C;  1KQM B;  3PLF B;  4OKH A;  1UHH A;  1NYA A;  1ODB A;  1PVB A;  3SG4 A;  2PMY A;  4GAO A;  1YUS A;  1CDL A;  1GQM A;  2LVV A;  2EGD A;  2OTG C;  1KFU S;  2Y1M A;  1BU3 A;  3MSE B;  3NXA A;  2EC6 C;  3E3R A;  4CID A;  4ETO A;  3IF7 A;  3ZWH A;  1OOJ A;  1EJ3 A;  2SCP A;  4PDZ A;  1SKT A;  1WDC C;  1CB1 A;  4GUK A;  4M2O A;  1KK8 C;  1YUR A;  3EVU A;  1H4B A;  1CFF A;  5BPJ A;  1DJH A;  1OSA A;  1S6I A;  1ZOT B;  4DIR A;  1NSH A;  3DVK A;  5D7F A;  1XFZ O;  3LL8 B;  4HRH A;  5B8I B;  1G33 A;  1RJV A;  2KBI A;  2ZRT A;  3SG2 A;  4PE1 A;  1Y0V H;  3I5I B;  3CZT X;  4GNK B;  4HSZ A;  5I8N A;  4BY5 A;  4OVN F;  1BJF A;  2KBM A;  1E8A A;  4HRG A;  2KSP A;  4ORB B;  1SL7 A;  1GGW A;  2JTT A;  3BOW A;  1QLK A;  2LE9 B;  3WNX B;  1GJY A;  1CLL A;  1DJW A;  1AJ5 A;  2JU0 A;  3NSI A;  4GGN A;  1DGU A;  1S26 D;  1S6J A;  4MN0 A;  4PHJ A;  1VRK A;  1C7V A;  3CR5 X;  4GBA A;  1K9P A;  3NSO A;  2P6B B;  1B9A A;  1XVJ A;  1QIW A;  2TN4 A;  2LHI A;  1FPW A;  1Y1X A;  5G08 A;  2KAV A;  3H4S E;  5HYD A;  2L4I A;  1SBJ A;  2F2O A;  3SJS A;  1FW4 A;  4ZCV A;  2CTN A;  2BCA A;  1B8C A;  1SK6 D;  2KI4 C;  2ZKM X;  5FYX A;  1H8B A;  3D0Y B;  5JJG A;  3KO0 A;  4N1F A;  4OV2 A;  1F4Q A;  1QVI Y;  4MEW A;  1RK9 A;  2LCP A;  5ER4 X;  1LA0 A;  4U8D A;  1DTL A;  2PSR A;  4P5O E;  1TN4 A;  1WLZ A;  5TNC A;  5I2O A;  2LP2 A;  1IJ5 A;  1XYD A;  1DVI A;  1QX5 B;  3GK4 X;  1B8L A;  4A4B A;  3LK0 A;  3I5G C;  4XYN A;  1UUR A;  2QPT A;  2CNP A;  3O6B A;  1DJI A;  2F8P A;  1NX1 A;  5HKY A;  1CFP A;  3EVV A;  3VRR A;  2WND A;  1YX8 A;  2LHL A;  2WCF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...