1UHNA

The crystal structure of the calcium binding protein atcbl2 from arabidopsis thaliana
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
189
structure length
189
Chain Sequence
b'DPELLARDTVFSVSEIEALYELFKKISSAVIDDGLINKEEFQLALFKTNKKESLFADRVFDLFDTKHNGILGFEEFARALSVFHPNAPIDDKIHFSFQLYDLKQQGFIERQEVKQMVVATLAESGMNLKDTVIEDIIDKTFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords calcineurin B-like protein 2
publication title The Crystal Structure of the Novel Calcium-binding Protein AtCBL2 from Arabidopsis thaliana
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Metal binding protein
total genus 63
structure length 189
sequence length 189
ec nomenclature
pdb deposition date 2003-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1uhnA00
3FWCA 5FYXA 1C07A 1IQ5A 3GOFA 5CSJA 3GK2A 2K7DA 1C7WA 1OOJA 2NXQA 2EC6C 3BQ3A 4MLWA 3ZWHA 5F6TA 3OB2B 4PCWA 2D8NA 3VGOA 4QJ5B 1JSAA 4C0JA 1IJ6A 1K90D 3OX5A 1OMVA 1XA5A 3GK1A 2BBMA 1CNPA 4NDDA 4QJ3B 1AJ5A 1KK7Z 4GGNA 4OCIA 5DKNA 1CDMA 4N1GA 4WQ3A 4CLNA 1B1GA 1PULA 1WY9A 2MAZA 3SG7A 4D1EA 1SYMA 3SG6A 5HKYA 1CDNA 1GJYA 1M46A 1KSOA 1EG3A 5ER4X 3SIAA 2I94A 1SCVA 2TN4A 1WDCB 1RECA 3SG4A 3TDUA 2OTGB 1CFFA 1YTZC 3EKHA 1UHNA 3JVTC 2ZRSA 4YGAA 2L51A 1FI6A 2K61A 4ORBB 2OS8B 2Y4QA 1RROA 1YVHA 1IJ5A 2KHNA 3H4SE 3MSEB 4CIDA 4ETOA 3AAJA 2KFFA 2KQ6A 1F54A 2BL0C 4PE1A 3DVEA 1TOPA 2IS9A 2F33A 2JQ6A 2JZIA 3FIAA 4YBHB 4YGEB 1QLKA 3OB1B 5K89A 1F70A 1A75B 3BOWA 4MRXA 2PMYA 4ORAB 1IG5A 4P2YB 1GGWA 1NPQA 2LMUA 2LE9B 2CCMA 1XFZO 2I2RE 1QATA 5HLVA 1DGVA 3NSLA 1OE9B 5JOLA 1MUXA 1DJYA 2MA2A 1D1OA 1DJWA 4YGDB 1XFWO 1PVAA 2F3ZA 2M3WA 1XK4A 4Q04A 2LM5A 2VRGA 5I8NA 4PHJA 3PM8A 4DS7A 1QS7A 1A4PA 5AEQA 1U5IB 1PK0D 1JF2A 1K9PA 1SBJA 2I7AA 2LV7A 3BYAA 5DKQA 1CMGA 1RFJA 1MHOA 3PATA 1B8RA 1AVSA 5AANA 3IQQA 1MXEA 3AKBA 2PRUA 1E8AA 3WHUB 2LLTA 1CDLA 5HLOA 1BR1B 2K8MB 1XO5A 1KQMC 4MBEA 3TDIA 1SR6B 1PALA 3I5GB 1TNPA 1EJ3A 2PVBA 4PDZA 4XYNA 1OSAA 1XYDA 1YRTB 2K2AA 3QRXA 4WRIA 3SG5A 1KFXS 5G08A 1NYAA 1B47A 1TCFA 2FCDA 1KK8C 1VRKA 3TS5C 2LP3A 1NIWA 3CLNA 4PE4A 1XFUO 1KFUL 1B9AA 4P5OE 4GAOA 1YUTA 1M39A 2KDHA 2F3YA 2QPTA 1NX1A 1V1FA 3CR4X 5HKWA 2LLUA 2JT8A 2MBXA 3TUYB 3SJSA 1UWOA 4CFRA 3PALA 1ZMZA 1S6IA 2O5GA 4YGCB 3ZNIA 1BODA 3LCPC 4TNCA 3NSIA 1JUOA 2GV5A 2PALA 4PALA 1RTP1 2WCFA 2KBMA 3SG2A 4OV2A 4F0ZB 2EGDA 2NLNA 1N0YA 1QLSA 3IF7A 1UURA 2Y5IA 2JU0A 2A4JA 2KI4C 1IKUA 1N2DA 2JXLA 1NSHA 1TTXA 2JT0A 3CR5X 1YUSA 4I5LB 5J3XA 1LA0A 1TRFA 4MZLA 1S1EA 2K7OA 2FOTA 3O6BA 1R2UA 4OVNF 3OX6A 4YI8A 3PLFB 2M97A 1LINA 1L2OC 2WC8A 3NXAA 4ZCUA 2H61A 3CTNA 1KCYA 4XJKA 4N5XA 3O78A 4MZJA 1NCXA 3DF0A 1J7RA 1DMOA 1J7QA 3BUOB 1HT9A 4M2PA 2GGMA 1TN4A 1MQ1A 3FWBA 1BR4B 2LHIA 4GNKB 5JJGA 1CLLA 1YR5A 2ZRTA 4N1FA 1SW8A 2JNXA 2KAYA 1C7VA 1KWOB 1RJVA 1YRUB 1AK8A 2BCAA 4CFQA 2HQ8A 2KOTA 1S6CA 2ZN8A 3NSOA 4C0LA 4FQOA 1H4BA 2ZNEA 3DVJA 1SK6D 4AQJA 2JPTA 1Y1AA 2KSPA 2K7BA 1F71A 2MLFC 1UHIA 2L0PA 4ICBA 2M1KB 2LLSA 2MRDA 4MEWA 3LK0A 2LUXA 1QV0A 3PN7B 4NQGA 2H61C 1EL4A 3DD4A 4HSZA 4MZKA 1OZOA 1CFPA 1DJXA 1K9UA 3I5FC 3JTDB 4IL1A 5CSFA 4BY4A 3PSRA 2NCPA 1K95A 3LK1A 2KBIA 2MJWB 4GFTA 3VRRA 3D0YB 1SCMB 2COLB 3I5HB 1H8BA 2JRFA 1LVCD 1S5GZ 1QVIY 2KGRA 4E68A 1CM4A 4HRHA 4PHKA 1EH2A 4PHNA 1RK9A 2F8PA 2JULA 1TNQA 2ZN9A 2KQYA 2LNKA 2EC6B 3I5IB 3SG3A 3TDZA 1JF0A 1B8LA 4OKHA 1PRWA 1QIWA 1MF8B 2M8UA 3CS1A 2L4HA 1DF0B 1QX5B 1B8CA 3LLEA 4R1EA 1DT7B 1QX7A 1L7ZA 4JPZB 4PE0A 4L9MA 1Y1XA 2H2KA 5D7FA 5IBWA 1DVIA 3VRNA 3FS7A 1GQMA 1WRKA 1NCZA 2O60A 2SASA 4HRGA 3A8RA 1CLBA 3BUMB 3CR2A 2PSRA 1YX7A 1G33A 1YX8A 2E30A 2LANA 1OMDA 4YI9A 3KEVA 3WHTB 1UUSA 1B4CA 2WCEA 4MRYA 4A4CA 3ICBA 1KK7Y 1S36A 5HKZA 2LC5A 4I5KA 3WXAA 5KU1A 3PFVA 1WRLA 1A75A 1Y1UA 5BPJA 3HX4A 1WLZA 1QX2A 2KFHA 2M29A 1SY9A 2BL0B 3OHMB 2F2OA 1OMRA 4ORCB 4YGBB 2R2IA 4XJKB 5I2LA 1SMGA 1JFJA 2BKHB 1K9KA 2KAXA 5AXIA 5D69A 3DF0B 1JWDA 1KSMA 1UHHA 3O4YA 2ISDA 1ALVA 3IQOA 2NZ0A 2K2FA 4GBAA 4MSPA 4FTGA 1QV1A 1LA3A 4USLA 3AKAA 2P6BB 2SCPA 1WDCC 2HETA 3DVMA 1GGZA 1K8UA 5ER5A 1U5IA 5I2QA 2OTGC 1Y6WA 4U8DA 1ALWA 1SL8A 1FI5A 2LAPA 1J55A 4ZCVA 2OS8C 1LKJA 1M31A 1M45A 1KQVA 2JOJA 3HCMA 2E6WA 2GGZA 2M1UA 1YVLA 1FF1A 1CFDA 3EKJA 4YRUA 3O2PA 1HQVA 1AJ4A 1F8HA 2LUCA 1A2XA 1ZOTB 1DJHA 1IWQA 1CLMA 1JC2A 2PASA 3EK7A 2HF5A 3DVKA 1F4QA 1N65A 1SL7A 1KQMB 4GPLB 4MVFA 4DRWA 1NP8A 2BCBA 3VRPA 2LVJA 3CZTX 3KF9A 2DOQA 3BOWB 4PHMA 2LVVA 4AOMA 2F2PA 3BUWB 1JBAA 1DGUA 1KK8B 2Q4UA 3TS5B 2L4IA 2LVIA 3I5IC 1CDPA 1FW4A 2FJUB 1J7OA 1CTRA 2KYFA 2AMIA 1A29A 4UPGA 2LCPA 2L2EA 1QIVA 1UHKA 1XFXO 2Y1NA 2BE6A 4I5JA 3KO0A 4AQIA 1KFUS 1UHJA 2KI6C 4GUKA 1F55A 2M0RA 5DKRA 1B7TZ 1UP5A 2G9BA 3RLZA 1NX2A 2M49B 1K96A 1BJFA 1CKKA 4GGFA 1PSRA 1EG4A 3BXKA 1J1EA 2CNPA 1G4YR 2JXCA 2V53A 3C1VA 1CMFA 1MR8A 2ZFDA 2KI4B 3OP0A 2KAVA 4OR9B 5GQQC 1NUBA 1MXLC 1BT6A 2Y1MA 1CB1A 1SR6C 1KFXL 2NCOA 3I5GC 2LMVA 1J1DA 1NWDA 2G2BA 1PVBA 2ZNDA 5AFPA 1W7IB 1OZSA 2MHHA 1V1GA 5TNCA 2LP2A 2M7NA 3VRQA 2L50A 2JWWA 2QACA 2L98A 3EVVA 1SRAA 2KYCA 4DCKA 3BUNB 1L2OB 2HPSA 1CFCA 1BOCA 5KSZA 1BMOA 2RGIA 2B1UA 2FCEA 3TZ1A 2JTTA 2KI6D 3M0WA 2BCXA 1SNLA 3TUYC 2ZKMX 1QTXA 1XVJA 3EVUA 5KTYA 1SPYA 2LMTA 3EVRA 1SKTA 1IH0A 2HQWA 3KPXA 1YURA 4QJ4B 1J7PA 2CT9A 4PE7A 4I5NB 5AERA 2KNEA 1IRJA 1DJZA 1QASA 3CWGA 4GGFC 5I2OA 1BG1A 1LXFC 2JT3A 2WORA 3SIBA 1A03A 1K2HA 2WCBA 1W7JB 2WNDA 1QJTA 1FBVA 1TCOB 1Q80A 1ZACA 2BE4A 2M7LA 1ZFSA 1EXRA 4M2OA 2L5XB 4C0KA 1IQ3A 3JVTB 4JQ0D 3RM1A 3K21A 3EK8A 3GK4X 2JC2A 3WNXB 1CM1A 1TIZA 3CGAA 4NDCA 5PALA 4A4BA 2BECA 1NX3A 1Y0VH 2M9GA 2Q91A 1ZUZA 3D0YA 1DTLA 2I18A 4MN0A 3I5FB 3VROA 1DJIA 1ODBA 2BKIB 5HYDA 1BF5A 2JNFA 3EK4A 1QXPA 1IGVA 1F4OA 1G8IA 4M2QA 5B8IB 1S3PA 2K0JA 3BUXB 3NSKA 1TNWA 2WOSA 1WLMA 1B7TY 1WRZA 1M63B 1KWOC 2AAOA 1MWNA 2BBNA 3F45A 4CPVA 3A4UB 4NDBA 4JWQA 5CPVA 3AAKA 1K94A 1BLQA 1DF0A 1DJGA 1NX0A 1XFYO 2CXJA 4BY5A 2MLEC 1FPWA 1AHRA 2KFGA 1XK4C 1BU3A 1JFKA 1QVIZ 5CSNA 5CSIA 2CTNA 1S5GY 2KGBC 2OPOA 1YUUA 2K7CA 3PN7C 1XFVO 1NCYA 1TNXA 4DIRA 2EHBA 1AUIB 1S26D 3JTDC 4DUQA 3KHEA 1AP4A 1OQPA 3LL8B 2LHLA 4WQ2A 2LVKA 1PSBA 1SCMC 3D10A 2AUCA 2CBLA 3I5HC 1R6PA 1X02A 4HREE 3E3RA 2JTZA 1RWYA 1K93D 1SL9A 1S6JA
chains in the Genus database with same CATH superfamily
3FWCA 5FYXA 1C07A 1IQ5A 2BNXA 3GOFA 5CSJA 3FE8A 2K7DA 1C7WA 1OOJA 3GK2A 1GM0A 2NXQA 2EC6C 3BQ3A 4MLWA 3ZWHA 2WCHA 5F6TA 3OB2B 4PCWA 2D8NA 3VGOA 4QJ5B 1JSAA 4C0JA 1TUZA 1IJ6A 1K90D 3OX5A 1OMVA 1XA5A 3GK1A 2BBMA 1CNPA 4NDDA 3L47A 4QJ3B 1AJ5A 3R1VA 1KK7Z 4GGNA 4OCIA 5DKNA 1CDMA 4N1GA 4WQ3A 4CLNA 1B1GA 1SSEB 1PULA 1WY9A 2MAZA 3SG7A 4D1EA 1SYMA 3SG6A 5HKYA 1CDNA 1GJYA 1M46A 1KSOA 1EG3A 5ER4X 3SIAA 2I94A 1SCVA 2TN4A 1WDCB 1C3ZA 1RECA 3SG4A 3TDUA 2OTGB 1CFFA 1YTZC 3EKHA 1UHNA 3JVTC 2ZRSA 4YGAA 2L51A 1FI6A 2K61A 4ORBB 2OS8B 2Y4QA 1RROA 1YVHA 1IJ5A 2KHNA 3H4SE 3MSEB 3S0BA 4CIDA 4ETOA 3AAJA 2KFFA 3B86A 2KQ6A 3D74A 1F54A 2BL0C 4PE1A 3DVEA 1TOPA 2IS9A 2F33A 2JQ6A 2JZIA 3FIAA 4YBHB 4YGEB 1QLKA 3OB1B 5K89A 1F70A 1A75B 2JPOA 3BOWA 3D75A 2PMYA 4MRXA 4ORAB 3IVTA 1IG5A 4P2YB 1GGWA 1DC1A 1NPQA 2LMUA 2LE9B 2CCMA 2WCLA 1XFZO 2I2RE 1QATA 5HLVA 1DGVA 3NSLA 1OE9B 5JOLA 1MUXA 1DJYA 2MA2A 3BFHA 1D1OA 1DJWA 4YGDB 1XFWO 1PVAA 2F3ZA 2M3WA 1XK4A 1P28A 2LM5A 2VRGA 4Q04A 5I8NA 4PHJA 3PM8A 4DS7A 1QS7A 1A4PA 5AEQA 1U5IB 1PK0D 1JF2A 1K9PA 1SBJA 2I7AA 2LV7A 2P70A 3BYAA 2ERBA 5DKQA 1CMGA 1RFJA 1MHOA 3PATA 1B8RA 1AVSA 5AANA 3IQQA 1MXEA 3AKBA 4JKTA 2PRUA 1E8AA 3WHUB 2LLTA 1CDLA 5HL1A 2BAPA 3B6XA 5HLOA 1BR1B 2K8MB 1XO5A 1KQMC 4MBEA 3TDIA 1SR6B 1PALA 3I5GB 1TNPA 1EJ3A 2PVBA 4PDZA 4XYNA 1OSAA 1XYDA 1YRTB 2K2AA 2P71A 3QRXA 4WRIA 3SG5A 1KFXS 5G08A 1NYAA 1B47A 1TCFA 2FCDA 3PJIA 1KK8C 1VRKA 3TS5C 4JD9A 2LP3A 1NIWA 3CLNA 4PE4A 1XFUO 3NGVA 1KFUL 1B9AA 4P5OE 4GAOA 1YUTA 1M39A 2KDHA 2F3YA 3CZ0A 2QPTA 1NX1A 1V1FA 1T14A 3CR4X 5HKWA 2LLUA 2JT8A 2MBXA 3TUYB 3SJSA 3K1EA 2L5YA 1UWOA 4CFRA 3PALA 1ZMZA 1S6IA 2O5GA 4YGCB 3ZNIA 1BODA 3LCPC 4TNCA 3NSIA 1JUOA 2GV5A 2PALA 4PALA 1RTP1 2WCFA 2KBMA 3SG2A 4OV2A 4F0ZB 2EGDA 2NLNA 1N0YA 1QLSA 3IF7A 1UURA 2Y5IA 2JU0A 2A4JA 1OOHA 2KI4C 5EL2A 1N2DA 3O4XA 2JXLA 1IKUA 1NSHA 1TTXA 2JT0A 3CR5X 1YUSA 4I5LB 5J3XA 4F7FA 1LA0A 1TRFA 3D77A 3SS3A 2WC6A 4MZLA 1S1EA 2K7OA 2FOTA 3O6BA 1R2UA 4OVNF 3OX6A 4YI8A 3PLFB 3R1OA 2M97A 1LINA 1L2OC 2WC8A 3NXAA 4ZCUA 2H61A 2K60A 3CTNA 1KCYA 4IJ7A 2KLEA 4XJKA 4N5XA 3O78A 4MZJA 1NCXA 3DF0A 5FI7A 1J7RA 1DMOA 1J7QA 3BUOB 1HT9A 4M2PA 3DYEA 2GGMA 1TN4A 1MQ1A 3FWBA 1BR4B 2LHIA 4GNKB 5JJGA 1CLLA 1YR5A 2ZRTA 4N1FA 1SW8A 2JNXA 2KAYA 1C7VA 1KWOB 1RJVA 1YRUB 1AK8A 2BCAA 4CFQA 2HQ8A 1TWOA 3NHIA 2KOTA 1S6CA 2ZN8A 3NSOA 4C0LA 2WCKA 3V2LA 4FQOA 1H4BA 2ZNEA 3DVJA 1SK6D 4AQJA 2FJYA 2JPTA 1Y1AA 2KSPA 2K7BA 1F71A 3L4AA 2MLFC 3B88A 1UHIA 2L0PA 3FE9A 4ICBA 2M1KB 2LLSA 2MRDA 4MEWA 3S0AA 3LK0A 2LUXA 1QV0A 3PN7B 4NQGA 2H61C 1EL4A 3DD4A 4HSZA 3VB1A 4MZKA 1OZOA 1CFPA 1DJXA 1K9UA 3I5FC 3JTDB 4IL1A 5CSFA 4BY4A 3PSRA 2NCPA 1K95A 3LK1A 2KBIA 3OGNA 2MJWB 4GFTA 3VRRA 3D0YB 1SCMB 2COLB 3I5HB 3UNWA 5FI2A 1H8BA 2JRFA 1LVCD 1S5GZ 1QVIY 2KGRA 4E68A 1CM4A 1XFRA 4HRHA 4PHKA 1EH2A 4PHNA 1RK9A 2F8PA 2JULA 2PQLA 1TNQA 2ZN9A 2KQYA 2LNKA 2EC6B 3BFAA 3PM2A 3I5IB 3SG3A 3TDZA 1JF0A 1B8LA 4OKHA 1PRWA 1QIWA 1DQEA 1MF8B 3S0EA 2M8UA 3CS1A 2L4HA 1DF0B 1QX5B 1B8CA 3RZSA 3SS4A 3LLEA 4R1EA 1DT7B 1QX7A 1L7ZA 4JPZB 4PE0A 4L9MA 1Y1XA 2H2KA 5D7FA 5IBWA 1DVIA 3B87A 1Z4HA 3VRNA 1C3YA 3FS7A 1OOIX 1GQMA 1WRKA 1NCZA 2O60A 2SASA 3CYZA 3A8RA 4HRGA 1CLBA 3BUMB 3CR2A 2KPHA 1YX7A 1G33A 1YX8A 2PSRA 2E30A 2LANA 1OMDA 4YI9A 3KEVA 3WHTB 1UUSA 1B4CA 2WCEA 4MRYA 4A4CA 3ICBA 1KK7Y 1S36A 5HKZA 2LC5A 4I5KA 3B7AA 3WXAA 5KU1A 3PFVA 3CZ1A 1WRLA 1A75A 1Y1UA 5BPJA 3HX4A 1WLZA 1QX2A 2KFHA 2M29A 1SY9A 2BL0B 3OHMB 2F2OA 1OMRA 4ORCB 4YGBB 2R2IA 4XJKB 5I2LA 1SMGA 1JFJA 2BKHB 1K9KA 2KAXA 5AXIA 5D69A 3DF0B 3S0GA 1JWDA 1KSMA 1UHHA 3O4YA 2ISDA 1ALVA 5DICA 4KYNA 2QEBA 3IQOA 1DELA 2NZ0A 2K2FA 4GBAA 2PYQA 2WCMA 1QV1A 4FTGA 4MSPA 1LA3A 4USLA 3AKAA 2KLDA 2P6BB 2SCPA 1WDCC 2HETA 3DVMA 1GGZA 1K8UA 1ORGA 5ER5A 1U5IA 5I2QA 4OZDA 2OTGC 1Y6WA 4U8DA 1ALWA 1SL8A 3R72A 3L4LA 1W9ZA 1FI5A 2LAPA 1J55A 4ZCVA 2OS8C 1LKJA 1M31A 1M45A 1KQVA 2JOJA 3HCMA 2E6WA 2GGZA 2M1UA 1YVLA 1FF1A 1CFDA 3EKJA 4YRUA 4PT1A 3DXLA 3O2PA 1HQVA 1AJ4A 1F8HA 2LUCA 3EG5B 1IIOA 3CDNA 1A2XA 1ZOTB 1LS8A 1DJHA 1IWQA 1CLMA 1JC2A 2PASA 3EK7A 2HF5A 3DVKA 1F4QA 1N65A 1SL7A 1KQMB 4GPLB 4MVFA 3SS5A 4DRWA 1NP8A 2BCBA 3VRPA 2LVJA 3CZTX 3KF9A 2WCJA 2DOQA 3BOWB 4PHMA 2LVVA 4AOMA 2F2PA 3BUWB 1JBAA 1DGUA 1KK8B 2Q4UA 3TS5B 2L4IA 2LVIA 3I5IC 1CDPA 1FW4A 2FJUB 3S0FA 1CTRA 2KYFA 1J7OA 2AMIA 1A29A 4UPGA 2LCPA 2L2EA 2QEHA 1QIVA 1UHKA 1XFXO 2Y1NA 4FQTA 2BE6A 4I5JA 3KO0A 4AQIA 1KFUS 1UHJA 2KI6C 4GUKA 1F55A 3FE6A 2M0RA 5DKRA 1B7TZ 1UP5A 2G9BA 3UO9A 3RLZA 1NX2A 2M49B 1K96A 1BJFA 1CKKA 4GGFA 1PSRA 1EG4A 3BXKA 1J1EA 2CNPA 1G4YR 2JXCA 3CZ2A 2V53A 3C1VA 5I94A 1MR8A 1CMFA 3D76A 2ZFDA 3D78A 2KI4B 3OP0A 2KAVA 4OR9B 5GQQC 1NUBA 1MXLC 1BT6A 2Y1MA 3DY9A 1CB1A 1SR6C 1KFXL 2NCOA 3I5GC 2LMVA 1J1DA 1NWDA 2G2BA 1PVBA 2ZNDA 5AFPA 1W7IB 1OZSA 2MHHA 1V1GA 5TNCA 2LP2A 2M7NA 3VRQA 2L50A 2JWWA 2QACA 2L98A 3EVVA 1SRAA 2KYCA 4DCKA 3BUNB 1L2OB 2HPSA 1CFCA 1BOCA 5KSZA 3BFBA 1BMOA 2RGIA 2B1UA 2FCEA 3TZ1A 3NHTA 2JTTA 2KI6D 3M0WA 2BCXA 1DEKA 1SNLA 3TUYC 2ZKMX 1QTXA 1XVJA 3EVUA 5KTYA 1SPYA 3S0DA 2LMTA 3EVRA 1SKTA 1IH0A 2HQWA 3KPXA 1YURA 4QJ4B 1J7PA 2CT9A 1OOFA 4I5NB 4PE7A 5AERA 2KNEA 1IRJA 1DJZA 1QASA 3CWGA 4GGFC 5I2OA 1BG1A 1LXFC 2JT3A 2WC5A 2WORA 3SIBA 1A03A 1Z2CB 2WCBA 1W7JB 1K2HA 2WNDA 1QJTA 4INXA 1FBVA 1TCOB 3D73A 1Q80A 3CABA 1ZACA 2BE4A 2M7LA 1ZFSA 1EXRA 4M2OA 2L5XB 4C0KA 1IQ3A 1OOGA 3JVTB 4JQ0D 3RM1A 3K21A 1OW4A 3EK8A 3GK4X 2JC2A 3WNXB 1CM1A 1TIZA 3CGAA 4NDCA 5PALA 4A4BA 2BECA 1NX3A 1Y0VH 2M9GA 2Q91A 1ZUZA 3D0YA 1DTLA 2I18A 4MN0A 5D3OA 3I5FB 3VROA 1DJIA 1ODBA 2BKIB 5HYDA 1BF5A 2JNFA 3EK4A 1QXPA 1IGVA 2H8VA 1F4OA 1G8IA 4M2QA 5B8IB 1S3PA 2K0JA 3BUXB 3NSKA 1TNWA 1QWVA 2WOSA 1WLMA 1B7TY 3R1PA 1WRZA 1M63B 1KWOC 2AAOA 1MWNA 3OBVA 2BBNA 3F45A 3BJHA 4CPVA 2QEVA 3A4UB 4NDBA 2GTEA 2L2CA 4JWQA 5CPVA 3AAKA 1K94A 1BLQA 1DF0A 1DJGA 1NX0A 1XFYO 2CXJA 2YGUA 3DZTA 2MLEC 4BY5A 1FPWA 1AHRA 2KFGA 1TUJA 5FI6A 1XK4C 3QMEA 1BU3A 1JFKA 1QVIZ 5CSNA 5CSIA 3Q8IA 2CTNA 1S5GY 2KGBC 2OPOA 2QDIA 1YUUA 2K7CA 3PN7C 1XFVO 1NCYA 1TNXA 4DIRA 2EHBA 4INWA 1AUIB 1S26D 2QEOA 3JTDC 4DUQA 3KHEA 1AP4A 1OQPA 3LL8B 2LHLA 4WQ2A 2LVKA 1PSBA 1SCMC 3D10A 2AUCA 2CBLA 3I5HC 1R6PA 1X02A 3N7HA 3E3RA 4HREE 2JTZA 1RWYA 1K93D 1SL9A 1S6JA
chains in the Genus database with same CATH topology
3FWCA 5FYXA 1C07A 1IQ5A 3GOFA 5CSJA 3GK2A 2K7DA 1C7WA 1OOJA 2NXQA 2EC6C 3BQ3A 4MLWA 3ZWHA 5F6TA 3OB2B 4PCWA 2D8NA 3VGOA 4QJ5B 1JSAA 4C0JA 1IJ6A 1K90D 3OX5A 1OMVA 1XA5A 3GK1A 2BBMA 1CNPA 4NDDA 4QJ3B 1AJ5A 1KK7Z 4GGNA 4OCIA 5DKNA 1CDMA 4N1GA 4WQ3A 4CLNA 1B1GA 1PULA 1WY9A 2MAZA 3SG7A 4D1EA 1SYMA 3SG6A 5HKYA 1CDNA 1GJYA 1M46A 1KSOA 1EG3A 5ER4X 3SIAA 2I94A 1SCVA 2TN4A 1WDCB 1RECA 3SG4A 3TDUA 2OTGB 1CFFA 1YTZC 3EKHA 1UHNA 3JVTC 2ZRSA 4YGAA 2L51A 1FI6A 2K61A 4ORBB 2OS8B 2Y4QA 1RROA 1YVHA 1IJ5A 2KHNA 3H4SE 3MSEB 4CIDA 4ETOA 3AAJA 2KFFA 2KQ6A 1F54A 2BL0C 4PE1A 3DVEA 1TOPA 2IS9A 2F33A 2JQ6A 2JZIA 3FIAA 4YBHB 4YGEB 1QLKA 3OB1B 5K89A 1F70A 1A75B 3BOWA 4MRXA 2PMYA 4ORAB 1IG5A 4P2YB 1GGWA 1NPQA 2LMUA 2LE9B 2CCMA 1XFZO 2I2RE 1QATA 5HLVA 1DGVA 3NSLA 1OE9B 5JOLA 1MUXA 1DJYA 2MA2A 1D1OA 1DJWA 4YGDB 1XFWO 1PVAA 2F3ZA 2M3WA 1XK4A 4Q04A 2LM5A 2VRGA 5I8NA 4PHJA 3PM8A 4DS7A 1QS7A 1A4PA 5AEQA 1U5IB 1PK0D 1JF2A 1K9PA 1SBJA 2I7AA 2LV7A 3BYAA 5DKQA 1CMGA 1RFJA 1MHOA 3PATA 1B8RA 1AVSA 5AANA 3IQQA 1MXEA 3AKBA 2PRUA 1E8AA 3WHUB 2LLTA 1CDLA 5HLOA 1BR1B 2K8MB 1XO5A 1KQMC 4MBEA 3TDIA 1SR6B 1PALA 3I5GB 1TNPA 1EJ3A 2PVBA 4PDZA 4XYNA 1OSAA 1XYDA 1YRTB 2K2AA 3QRXA 4WRIA 3SG5A 1KFXS 5G08A 1NYAA 1B47A 1TCFA 2FCDA 1KK8C 1VRKA 3TS5C 2LP3A 1NIWA 3CLNA 4PE4A 1XFUO 1KFUL 1B9AA 4P5OE 4GAOA 1YUTA 1M39A 2KDHA 2F3YA 2QPTA 1NX1A 1V1FA 3CR4X 5HKWA 2LLUA 2JT8A 2MBXA 3TUYB 3SJSA 1UWOA 4CFRA 3PALA 1ZMZA 1S6IA 2O5GA 4YGCB 3ZNIA 1BODA 3LCPC 4TNCA 3NSIA 1JUOA 2GV5A 2PALA 4PALA 1RTP1 2WCFA 2KBMA 3SG2A 4OV2A 4F0ZB 2EGDA 2NLNA 1N0YA 1QLSA 3IF7A 1UURA 2Y5IA 2JU0A 2A4JA 2KI4C 1IKUA 1N2DA 2JXLA 1NSHA 1TTXA 2JT0A 3CR5X 1YUSA 4I5LB 5J3XA 1LA0A 1TRFA 4MZLA 1S1EA 2K7OA 2FOTA 3O6BA 1R2UA 4OVNF 3OX6A 4YI8A 3PLFB 2M97A 1LINA 1L2OC 2WC8A 3NXAA 4ZCUA 2H61A 3CTNA 1KCYA 4XJKA 4N5XA 3O78A 4MZJA 1NCXA 3DF0A 1J7RA 1DMOA 1J7QA 3BUOB 1HT9A 4M2PA 2GGMA 1TN4A 1MQ1A 3FWBA 1BR4B 2LHIA 4GNKB 5JJGA 1CLLA 1YR5A 2ZRTA 4N1FA 1SW8A 2JNXA 2KAYA 1C7VA 1KWOB 1RJVA 1YRUB 1AK8A 2BCAA 4CFQA 2HQ8A 2KOTA 1S6CA 2ZN8A 3NSOA 4C0LA 4FQOA 1H4BA 2ZNEA 3DVJA 1SK6D 4AQJA 2JPTA 1Y1AA 2KSPA 2K7BA 1F71A 2MLFC 1UHIA 2L0PA 4ICBA 2M1KB 2LLSA 2MRDA 4MEWA 3LK0A 2LUXA 1QV0A 3PN7B 4NQGA 2H61C 1EL4A 3DD4A 4HSZA 4MZKA 1OZOA 1CFPA 1DJXA 1K9UA 3I5FC 3JTDB 4IL1A 5CSFA 4BY4A 3PSRA 2NCPA 1K95A 3LK1A 2KBIA 2MJWB 4GFTA 3VRRA 3D0YB 1SCMB 2COLB 3I5HB 1H8BA 2JRFA 1LVCD 1S5GZ 1QVIY 2KGRA 4E68A 1CM4A 4HRHA 4PHKA 1EH2A 4PHNA 1RK9A 2F8PA 2JULA 1TNQA 2ZN9A 2KQYA 2LNKA 2EC6B 3I5IB 3SG3A 3TDZA 1JF0A 1B8LA 4OKHA 1PRWA 1QIWA 1MF8B 2M8UA 3CS1A 2L4HA 1DF0B 1QX5B 1B8CA 3LLEA 4R1EA 1DT7B 1QX7A 1L7ZA 4JPZB 4PE0A 4L9MA 1Y1XA 2H2KA 5D7FA 5IBWA 1DVIA 3VRNA 3FS7A 1GQMA 1WRKA 1NCZA 2O60A 2SASA 4HRGA 3A8RA 1CLBA 3BUMB 3CR2A 2PSRA 1YX7A 1G33A 1YX8A 2E30A 2LANA 1OMDA 4YI9A 3KEVA 3WHTB 1UUSA 1B4CA 2WCEA 4MRYA 4A4CA 3ICBA 1KK7Y 1S36A 5HKZA 2LC5A 4I5KA 3WXAA 5KU1A 3PFVA 1WRLA 1A75A 1Y1UA 5BPJA 3HX4A 1WLZA 1QX2A 2KFHA 2M29A 1SY9A 2BL0B 3OHMB 2F2OA 1OMRA 4ORCB 4YGBB 2R2IA 4XJKB 5I2LA 1SMGA 1JFJA 2BKHB 1K9KA 2KAXA 5AXIA 5D69A 3DF0B 1JWDA 1KSMA 1UHHA 3O4YA 2ISDA 1ALVA 3IQOA 2NZ0A 2K2FA 4GBAA 4MSPA 4FTGA 1QV1A 1LA3A 4USLA 3AKAA 2P6BB 2SCPA 1WDCC 2HETA 3DVMA 1GGZA 1K8UA 5ER5A 1U5IA 5I2QA 2OTGC 1Y6WA 4U8DA 1ALWA 1SL8A 1FI5A 2LAPA 1J55A 4ZCVA 2OS8C 1LKJA 1M31A 1M45A 1KQVA 2JOJA 3HCMA 2E6WA 2GGZA 2M1UA 1YVLA 1FF1A 1CFDA 3EKJA 4YRUA 3O2PA 1HQVA 1AJ4A 1F8HA 2LUCA 1A2XA 1ZOTB 1DJHA 1IWQA 1CLMA 1JC2A 2PASA 3EK7A 2HF5A 3DVKA 1F4QA 1N65A 1SL7A 1KQMB 4GPLB 4MVFA 4DRWA 1NP8A 2BCBA 3VRPA 2LVJA 3CZTX 3KF9A 2DOQA 3BOWB 4PHMA 2LVVA 4AOMA 2F2PA 3BUWB 1JBAA 1DGUA 1KK8B 2Q4UA 3TS5B 2L4IA 2LVIA 3I5IC 1CDPA 1FW4A 2FJUB 1J7OA 1CTRA 2KYFA 2AMIA 1A29A 4UPGA 2LCPA 2L2EA 1QIVA 1UHKA 1XFXO 2Y1NA 2BE6A 4I5JA 3KO0A 4AQIA 1KFUS 1UHJA 2KI6C 4GUKA 1F55A 2M0RA 5DKRA 1B7TZ 1UP5A 2G9BA 3RLZA 1NX2A 2M49B 1K96A 1BJFA 1CKKA 4GGFA 1PSRA 1EG4A 3BXKA 1J1EA 2CNPA 1G4YR 2JXCA 2V53A 3C1VA 1CMFA 1MR8A 2ZFDA 2KI4B 3OP0A 2KAVA 4OR9B 5GQQC 1NUBA 1MXLC 1BT6A 2Y1MA 1CB1A 1SR6C 1KFXL 2NCOA 3I5GC 2LMVA 1J1DA 1NWDA 2G2BA 1PVBA 2ZNDA 5AFPA 1W7IB 1OZSA 2MHHA 1V1GA 5TNCA 2LP2A 2M7NA 3VRQA 2L50A 2JWWA 2QACA 2L98A 3EVVA 1SRAA 2KYCA 4DCKA 3BUNB 1L2OB 2HPSA 1CFCA 1BOCA 5KSZA 1BMOA 2RGIA 2B1UA 2FCEA 3TZ1A 2JTTA 2KI6D 3M0WA 2BCXA 1SNLA 3TUYC 2ZKMX 1QTXA 1XVJA 3EVUA 5KTYA 1SPYA 2LMTA 3EVRA 1SKTA 1IH0A 2HQWA 3KPXA 1YURA 4QJ4B 1J7PA 2CT9A 4PE7A 4I5NB 5AERA 2KNEA 1IRJA 1DJZA 1QASA 3CWGA 4GGFC 5I2OA 1BG1A 1LXFC 2JT3A 2WORA 3SIBA 1A03A 1K2HA 2WCBA 1W7JB 2WNDA 1QJTA 1FBVA 1TCOB 1Q80A 1ZACA 2BE4A 2M7LA 1ZFSA 1EXRA 4M2OA 2L5XB 4C0KA 1IQ3A 3JVTB 4JQ0D 3RM1A 3K21A 3EK8A 3GK4X 2JC2A 3WNXB 1CM1A 1TIZA 3CGAA 4NDCA 5PALA 4A4BA 2BECA 1NX3A 1Y0VH 2M9GA 2Q91A 1ZUZA 3D0YA 1DTLA 2I18A 4MN0A 3I5FB 3VROA 1DJIA 1ODBA 2BKIB 5HYDA 1BF5A 2JNFA 3EK4A 1QXPA 1IGVA 1F4OA 1G8IA 4M2QA 5B8IB 1S3PA 2K0JA 3BUXB 3NSKA 1TNWA 2WOSA 1WLMA 1B7TY 1WRZA 1M63B 1KWOC 2AAOA 1MWNA 2BBNA 3F45A 4CPVA 3A4UB 4NDBA 4JWQA 5CPVA 3AAKA 1K94A 1BLQA 1DF0A 1DJGA 1NX0A 1XFYO 2CXJA 4BY5A 2MLEC 1FPWA 1AHRA 2KFGA 1XK4C 1BU3A 1JFKA 1QVIZ 5CSNA 5CSIA 2CTNA 1S5GY 2KGBC 2OPOA 1YUUA 2K7CA 3PN7C 1XFVO 1NCYA 1TNXA 4DIRA 2EHBA 1AUIB 1S26D 3JTDC 4DUQA 3KHEA 1AP4A 1OQPA 3LL8B 2LHLA 4WQ2A 2LVKA 1PSBA 1SCMC 3D10A 2AUCA 2CBLA 3I5HC 1R6PA 1X02A 4HREE 3E3RA 2JTZA 1RWYA 1K93D 1SL9A 1S6JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FWC A;  5FYX A;  1C07 A;  1IQ5 A;  3GOF A;  5CSJ A;  3GK2 A;  2K7D A;  1C7W A;  1OOJ A;  2NXQ A;  2EC6 C;  3BQ3 A;  4MLW A;  3ZWH A;  5F6T A;  3OB2 B;  4PCW A;  2D8N A;  3VGO A;  4QJ5 B;  1JSA A;  4C0J A;  1IJ6 A;  1K90 D;  3OX5 A;  1OMV A;  1XA5 A;  3GK1 A;  2BBM A;  1CNP A;  4NDD A;  4QJ3 B;  1AJ5 A;  1KK7 Z;  4GGN A;  4OCI A;  5DKN A;  1CDM A;  4N1G A;  4WQ3 A;  4CLN A;  1B1G A;  1PUL A;  1WY9 A;  2MAZ A;  3SG7 A;  4D1E A;  1SYM A;  3SG6 A;  5HKY A;  1CDN A;  1GJY A;  1M46 A;  1KSO A;  1EG3 A;  5ER4 X;  3SIA A;  2I94 A;  1SCV A;  2TN4 A;  1WDC B;  1REC A;  3SG4 A;  3TDU A;  2OTG B;  1CFF A;  1YTZ C;  3EKH A;  1UHN A;  3JVT C;  2ZRS A;  4YGA A;  2L51 A;  1FI6 A;  2K61 A;  4ORB B;  2OS8 B;  2Y4Q A;  1RRO A;  1YVH A;  1IJ5 A;  2KHN A;  3H4S E;  3MSE B;  4CID A;  4ETO A;  3AAJ A;  2KFF A;  2KQ6 A;  1F54 A;  2BL0 C;  4PE1 A;  3DVE A;  1TOP A;  2IS9 A;  2F33 A;  2JQ6 A;  2JZI A;  3FIA A;  4YBH B;  4YGE B;  1QLK A;  3OB1 B;  5K89 A;  1F70 A;  1A75 B;  3BOW A;  4MRX A;  2PMY A;  4ORA B;  1IG5 A;  4P2Y B;  1GGW A;  1NPQ A;  2LMU A;  2LE9 B;  2CCM A;  1XFZ O;  2I2R E;  1QAT A;  5HLV A;  1DGV A;  3NSL A;  1OE9 B;  5JOL A;  1MUX A;  1DJY A;  2MA2 A;  1D1O A;  1DJW A;  4YGD B;  1XFW O;  1PVA A;  2F3Z A;  2M3W A;  1XK4 A;  4Q04 A;  2LM5 A;  2VRG A;  5I8N A;  4PHJ A;  3PM8 A;  4DS7 A;  1QS7 A;  1A4P A;  5AEQ A;  1U5I B;  1PK0 D;  1JF2 A;  1K9P A;  1SBJ A;  2I7A A;  2LV7 A;  3BYA A;  5DKQ A;  1CMG A;  1RFJ A;  1MHO A;  3PAT A;  1B8R A;  1AVS A;  5AAN A;  3IQQ A;  1MXE A;  3AKB A;  2PRU A;  1E8A A;  3WHU B;  2LLT A;  1CDL A;  5HLO A;  1BR1 B;  2K8M B;  1XO5 A;  1KQM C;  4MBE A;  3TDI A;  1SR6 B;  1PAL A;  3I5G B;  1TNP A;  1EJ3 A;  2PVB A;  4PDZ A;  4XYN A;  1OSA A;  1XYD A;  1YRT B;  2K2A A;  3QRX A;  4WRI A;  3SG5 A;  1KFX S;  5G08 A;  1NYA A;  1B47 A;  1TCF A;  2FCD A;  1KK8 C;  1VRK A;  3TS5 C;  2LP3 A;  1NIW A;  3CLN A;  4PE4 A;  1XFU O;  1KFU L;  1B9A A;  4P5O E;  4GAO A;  1YUT A;  1M39 A;  2KDH A;  2F3Y A;  2QPT A;  1NX1 A;  1V1F A;  3CR4 X;  5HKW A;  2LLU A;  2JT8 A;  2MBX A;  3TUY B;  3SJS A;  1UWO A;  4CFR A;  3PAL A;  1ZMZ A;  1S6I A;  2O5G A;  4YGC B;  3ZNI A;  1BOD A;  3LCP C;  4TNC A;  3NSI A;  1JUO A;  2GV5 A;  2PAL A;  4PAL A;  1RTP 1;  2WCF A;  2KBM A;  3SG2 A;  4OV2 A;  4F0Z B;  2EGD A;  2NLN A;  1N0Y A;  1QLS A;  3IF7 A;  1UUR A;  2Y5I A;  2JU0 A;  2A4J A;  2KI4 C;  1IKU A;  1N2D A;  2JXL A;  1NSH A;  1TTX A;  2JT0 A;  3CR5 X;  1YUS A;  4I5L B;  5J3X A;  1LA0 A;  1TRF A;  4MZL A;  1S1E A;  2K7O A;  2FOT A;  3O6B A;  1R2U A;  4OVN F;  3OX6 A;  4YI8 A;  3PLF B;  2M97 A;  1LIN A;  1L2O C;  2WC8 A;  3NXA A;  4ZCU A;  2H61 A;  3CTN A;  1KCY A;  4XJK A;  4N5X A;  3O78 A;  4MZJ A;  1NCX A;  3DF0 A;  1J7R A;  1DMO A;  1J7Q A;  3BUO B;  1HT9 A;  4M2P A;  2GGM A;  1TN4 A;  1MQ1 A;  3FWB A;  1BR4 B;  2LHI A;  4GNK B;  5JJG A;  1CLL A;  1YR5 A;  2ZRT A;  4N1F A;  1SW8 A;  2JNX A;  2KAY A;  1C7V A;  1KWO B;  1RJV A;  1YRU B;  1AK8 A;  2BCA A;  4CFQ A;  2HQ8 A;  2KOT A;  1S6C A;  2ZN8 A;  3NSO A;  4C0L A;  4FQO A;  1H4B A;  2ZNE A;  3DVJ A;  1SK6 D;  4AQJ A;  2JPT A;  1Y1A A;  2KSP A;  2K7B A;  1F71 A;  2MLF C;  1UHI A;  2L0P A;  4ICB A;  2M1K B;  2LLS A;  2MRD A;  4MEW A;  3LK0 A;  2LUX A;  1QV0 A;  3PN7 B;  4NQG A;  2H61 C;  1EL4 A;  3DD4 A;  4HSZ A;  4MZK A;  1OZO A;  1CFP A;  1DJX A;  1K9U A;  3I5F C;  3JTD B;  4IL1 A;  5CSF A;  4BY4 A;  3PSR A;  2NCP A;  1K95 A;  3LK1 A;  2KBI A;  2MJW B;  4GFT A;  3VRR A;  3D0Y B;  1SCM B;  2COL B;  3I5H B;  1H8B A;  2JRF A;  1LVC D;  1S5G Z;  1QVI Y;  2KGR A;  4E68 A;  1CM4 A;  4HRH A;  4PHK A;  1EH2 A;  4PHN A;  1RK9 A;  2F8P A;  2JUL A;  1TNQ A;  2ZN9 A;  2KQY A;  2LNK A;  2EC6 B;  3I5I B;  3SG3 A;  3TDZ A;  1JF0 A;  1B8L A;  4OKH A;  1PRW A;  1QIW A;  1MF8 B;  2M8U A;  3CS1 A;  2L4H A;  1DF0 B;  1QX5 B;  1B8C A;  3LLE A;  4R1E A;  1DT7 B;  1QX7 A;  1L7Z A;  4JPZ B;  4PE0 A;  4L9M A;  1Y1X A;  2H2K A;  5D7F A;  5IBW A;  1DVI A;  3VRN A;  3FS7 A;  1GQM A;  1WRK A;  1NCZ A;  2O60 A;  2SAS A;  4HRG A;  3A8R A;  1CLB A;  3BUM B;  3CR2 A;  2PSR A;  1YX7 A;  1G33 A;  1YX8 A;  2E30 A;  2LAN A;  1OMD A;  4YI9 A;  3KEV A;  3WHT B;  1UUS A;  1B4C A;  2WCE A;  4MRY A;  4A4C A;  3ICB A;  1KK7 Y;  1S36 A;  5HKZ A;  2LC5 A;  4I5K A;  3WXA A;  5KU1 A;  3PFV A;  1WRL A;  1A75 A;  1Y1U A;  5BPJ A;  3HX4 A;  1WLZ A;  1QX2 A;  2KFH A;  2M29 A;  1SY9 A;  2BL0 B;  3OHM B;  2F2O A;  1OMR A;  4ORC B;  4YGB B;  2R2I A;  4XJK B;  5I2L A;  1SMG A;  1JFJ A;  2BKH B;  1K9K A;  2KAX A;  5AXI A;  5D69 A;  3DF0 B;  1JWD A;  1KSM A;  1UHH A;  3O4Y A;  2ISD A;  1ALV A;  3IQO A;  2NZ0 A;  2K2F A;  4GBA A;  4MSP A;  4FTG A;  1QV1 A;  1LA3 A;  4USL A;  3AKA A;  2P6B B;  2SCP A;  1WDC C;  2HET A;  3DVM A;  1GGZ A;  1K8U A;  5ER5 A;  1U5I A;  5I2Q A;  2OTG C;  1Y6W A;  4U8D A;  1ALW A;  1SL8 A;  1FI5 A;  2LAP A;  1J55 A;  4ZCV A;  2OS8 C;  1LKJ A;  1M31 A;  1M45 A;  1KQV A;  2JOJ A;  3HCM A;  2E6W A;  2GGZ A;  2M1U A;  1YVL A;  1FF1 A;  1CFD A;  3EKJ A;  4YRU A;  3O2P A;  1HQV A;  1AJ4 A;  1F8H A;  2LUC A;  1A2X A;  1ZOT B;  1DJH A;  1IWQ A;  1CLM A;  1JC2 A;  2PAS A;  3EK7 A;  2HF5 A;  3DVK A;  1F4Q A;  1N65 A;  1SL7 A;  1KQM B;  4GPL B;  4MVF A;  4DRW A;  1NP8 A;  2BCB A;  3VRP A;  2LVJ A;  3CZT X;  3KF9 A;  2DOQ A;  3BOW B;  4PHM A;  2LVV A;  4AOM A;  2F2P A;  3BUW B;  1JBA A;  1DGU A;  1KK8 B;  2Q4U A;  3TS5 B;  2L4I A;  2LVI A;  3I5I C;  1CDP A;  1FW4 A;  2FJU B;  1J7O A;  1CTR A;  2KYF A;  2AMI A;  1A29 A;  4UPG A;  2LCP A;  2L2E A;  1QIV A;  1UHK A;  1XFX O;  2Y1N A;  2BE6 A;  4I5J A;  3KO0 A;  4AQI A;  1KFU S;  1UHJ A;  2KI6 C;  4GUK A;  1F55 A;  2M0R A;  5DKR A;  1B7T Z;  1UP5 A;  2G9B A;  3RLZ A;  1NX2 A;  2M49 B;  1K96 A;  1BJF A;  1CKK A;  4GGF A;  1PSR A;  1EG4 A;  3BXK A;  1J1E A;  2CNP A;  1G4Y R;  2JXC A;  2V53 A;  3C1V A;  1CMF A;  1MR8 A;  2ZFD A;  2KI4 B;  3OP0 A;  2KAV A;  4OR9 B;  5GQQ C;  1NUB A;  1MXL C;  1BT6 A;  2Y1M A;  1CB1 A;  1SR6 C;  1KFX L;  2NCO A;  3I5G C;  2LMV A;  1J1D A;  1NWD A;  2G2B A;  1PVB A;  2ZND A;  5AFP A;  1W7I B;  1OZS A;  2MHH A;  1V1G A;  5TNC A;  2LP2 A;  2M7N A;  3VRQ A;  2L50 A;  2JWW A;  2QAC A;  2L98 A;  3EVV A;  1SRA A;  2KYC A;  4DCK A;  3BUN B;  1L2O B;  2HPS A;  1CFC A;  1BOC A;  5KSZ A;  1BMO A;  2RGI A;  2B1U A;  2FCE A;  3TZ1 A;  2JTT A;  2KI6 D;  3M0W A;  2BCX A;  1SNL A;  3TUY C;  2ZKM X;  1QTX A;  1XVJ A;  3EVU A;  5KTY A;  1SPY A;  2LMT A;  3EVR A;  1SKT A;  1IH0 A;  2HQW A;  3KPX A;  1YUR A;  4QJ4 B;  1J7P A;  2CT9 A;  4PE7 A;  4I5N B;  5AER A;  2KNE A;  1IRJ A;  1DJZ A;  1QAS A;  3CWG A;  4GGF C;  5I2O A;  1BG1 A;  1LXF C;  2JT3 A;  2WOR A;  3SIB A;  1A03 A;  1K2H A;  2WCB A;  1W7J B;  2WND A;  1QJT A;  1FBV A;  1TCO B;  1Q80 A;  1ZAC A;  2BE4 A;  2M7L A;  1ZFS A;  1EXR A;  4M2O A;  2L5X B;  4C0K A;  1IQ3 A;  3JVT B;  4JQ0 D;  3RM1 A;  3K21 A;  3EK8 A;  3GK4 X;  2JC2 A;  3WNX B;  1CM1 A;  1TIZ A;  3CGA A;  4NDC A;  5PAL A;  4A4B A;  2BEC A;  1NX3 A;  1Y0V H;  2M9G A;  2Q91 A;  1ZUZ A;  3D0Y A;  1DTL A;  2I18 A;  4MN0 A;  3I5F B;  3VRO A;  1DJI A;  1ODB A;  2BKI B;  5HYD A;  1BF5 A;  2JNF A;  3EK4 A;  1QXP A;  1IGV A;  1F4O A;  1G8I A;  4M2Q A;  5B8I B;  1S3P A;  2K0J A;  3BUX B;  3NSK A;  1TNW A;  2WOS A;  1WLM A;  1B7T Y;  1WRZ A;  1M63 B;  1KWO C;  2AAO A;  1MWN A;  2BBN A;  3F45 A;  4CPV A;  3A4U B;  4NDB A;  4JWQ A;  5CPV A;  3AAK A;  1K94 A;  1BLQ A;  1DF0 A;  1DJG A;  1NX0 A;  1XFY O;  2CXJ A;  4BY5 A;  2MLE C;  1FPW A;  1AHR A;  2KFG A;  1XK4 C;  1BU3 A;  1JFK A;  1QVI Z;  5CSN A;  5CSI A;  2CTN A;  1S5G Y;  2KGB C;  2OPO A;  1YUU A;  2K7C A;  3PN7 C;  1XFV O;  1NCY A;  1TNX A;  4DIR A;  2EHB A;  1AUI B;  1S26 D;  3JTD C;  4DUQ A;  3KHE A;  1AP4 A;  1OQP A;  3LL8 B;  2LHL A;  4WQ2 A;  2LVK A;  1PSB A;  1SCM C;  3D10 A;  2AUC A;  2CBL A;  3I5H C;  1R6P A;  1X02 A;  4HRE E;  3E3R A;  2JTZ A;  1RWY A;  1K93 D;  1SL9 A;  1S6J A; 
#chains in the Genus database with same CATH topology
 3FWC A;  5FYX A;  1C07 A;  1IQ5 A;  2BNX A;  3GOF A;  5CSJ A;  3FE8 A;  2K7D A;  1C7W A;  1OOJ A;  3GK2 A;  1GM0 A;  2NXQ A;  2EC6 C;  3BQ3 A;  4MLW A;  3ZWH A;  2WCH A;  5F6T A;  3OB2 B;  4PCW A;  2D8N A;  3VGO A;  4QJ5 B;  1JSA A;  4C0J A;  1TUZ A;  1IJ6 A;  1K90 D;  3OX5 A;  1OMV A;  1XA5 A;  3GK1 A;  2BBM A;  1CNP A;  4NDD A;  3L47 A;  4QJ3 B;  1AJ5 A;  3R1V A;  1KK7 Z;  4GGN A;  4OCI A;  5DKN A;  1CDM A;  4N1G A;  4WQ3 A;  4CLN A;  1B1G A;  1SSE B;  1PUL A;  1WY9 A;  2MAZ A;  3SG7 A;  4D1E A;  1SYM A;  3SG6 A;  5HKY A;  1CDN A;  1GJY A;  1M46 A;  1KSO A;  1EG3 A;  5ER4 X;  3SIA A;  2I94 A;  1SCV A;  2TN4 A;  1WDC B;  1C3Z A;  1REC A;  3SG4 A;  3TDU A;  2OTG B;  1CFF A;  1YTZ C;  3EKH A;  1UHN A;  3JVT C;  2ZRS A;  4YGA A;  2L51 A;  1FI6 A;  2K61 A;  4ORB B;  2OS8 B;  2Y4Q A;  1RRO A;  1YVH A;  1IJ5 A;  2KHN A;  3H4S E;  3MSE B;  3S0B A;  4CID A;  4ETO A;  3AAJ A;  2KFF A;  3B86 A;  2KQ6 A;  3D74 A;  1F54 A;  2BL0 C;  4PE1 A;  3DVE A;  1TOP A;  2IS9 A;  2F33 A;  2JQ6 A;  2JZI A;  3FIA A;  4YBH B;  4YGE B;  1QLK A;  3OB1 B;  5K89 A;  1F70 A;  1A75 B;  2JPO A;  3BOW A;  3D75 A;  2PMY A;  4MRX A;  4ORA B;  3IVT A;  1IG5 A;  4P2Y B;  1GGW A;  1DC1 A;  1NPQ A;  2LMU A;  2LE9 B;  2CCM A;  2WCL A;  1XFZ O;  2I2R E;  1QAT A;  5HLV A;  1DGV A;  3NSL A;  1OE9 B;  5JOL A;  1MUX A;  1DJY A;  2MA2 A;  3BFH A;  1D1O A;  1DJW A;  4YGD B;  1XFW O;  1PVA A;  2F3Z A;  2M3W A;  1XK4 A;  1P28 A;  2LM5 A;  2VRG A;  4Q04 A;  5I8N A;  4PHJ A;  3PM8 A;  4DS7 A;  1QS7 A;  1A4P A;  5AEQ A;  1U5I B;  1PK0 D;  1JF2 A;  1K9P A;  1SBJ A;  2I7A A;  2LV7 A;  2P70 A;  3BYA A;  2ERB A;  5DKQ A;  1CMG A;  1RFJ A;  1MHO A;  3PAT A;  1B8R A;  1AVS A;  5AAN A;  3IQQ A;  1MXE A;  3AKB A;  4JKT A;  2PRU A;  1E8A A;  3WHU B;  2LLT A;  1CDL A;  5HL1 A;  2BAP A;  3B6X A;  5HLO A;  1BR1 B;  2K8M B;  1XO5 A;  1KQM C;  4MBE A;  3TDI A;  1SR6 B;  1PAL A;  3I5G B;  1TNP A;  1EJ3 A;  2PVB A;  4PDZ A;  4XYN A;  1OSA A;  1XYD A;  1YRT B;  2K2A A;  2P71 A;  3QRX A;  4WRI A;  3SG5 A;  1KFX S;  5G08 A;  1NYA A;  1B47 A;  1TCF A;  2FCD A;  3PJI A;  1KK8 C;  1VRK A;  3TS5 C;  4JD9 A;  2LP3 A;  1NIW A;  3CLN A;  4PE4 A;  1XFU O;  3NGV A;  1KFU L;  1B9A A;  4P5O E;  4GAO A;  1YUT A;  1M39 A;  2KDH A;  2F3Y A;  3CZ0 A;  2QPT A;  1NX1 A;  1V1F A;  1T14 A;  3CR4 X;  5HKW A;  2LLU A;  2JT8 A;  2MBX A;  3TUY B;  3SJS A;  3K1E A;  2L5Y A;  1UWO A;  4CFR A;  3PAL A;  1ZMZ A;  1S6I A;  2O5G A;  4YGC B;  3ZNI A;  1BOD A;  3LCP C;  4TNC A;  3NSI A;  1JUO A;  2GV5 A;  2PAL A;  4PAL A;  1RTP 1;  2WCF A;  2KBM A;  3SG2 A;  4OV2 A;  4F0Z B;  2EGD A;  2NLN A;  1N0Y A;  1QLS A;  3IF7 A;  1UUR A;  2Y5I A;  2JU0 A;  2A4J A;  1OOH A;  2KI4 C;  5EL2 A;  1N2D A;  3O4X A;  2JXL A;  1IKU A;  1NSH A;  1TTX A;  2JT0 A;  3CR5 X;  1YUS A;  4I5L B;  5J3X A;  4F7F A;  1LA0 A;  1TRF A;  3D77 A;  3SS3 A;  2WC6 A;  4MZL A;  1S1E A;  2K7O A;  2FOT A;  3O6B A;  1R2U A;  4OVN F;  3OX6 A;  4YI8 A;  3PLF B;  3R1O A;  2M97 A;  1LIN A;  1L2O C;  2WC8 A;  3NXA A;  4ZCU A;  2H61 A;  2K60 A;  3CTN A;  1KCY A;  4IJ7 A;  2KLE A;  4XJK A;  4N5X A;  3O78 A;  4MZJ A;  1NCX A;  3DF0 A;  5FI7 A;  1J7R A;  1DMO A;  1J7Q A;  3BUO B;  1HT9 A;  4M2P A;  3DYE A;  2GGM A;  1TN4 A;  1MQ1 A;  3FWB A;  1BR4 B;  2LHI A;  4GNK B;  5JJG A;  1CLL A;  1YR5 A;  2ZRT A;  4N1F A;  1SW8 A;  2JNX A;  2KAY A;  1C7V A;  1KWO B;  1RJV A;  1YRU B;  1AK8 A;  2BCA A;  4CFQ A;  2HQ8 A;  1TWO A;  3NHI A;  2KOT A;  1S6C A;  2ZN8 A;  3NSO A;  4C0L A;  2WCK A;  3V2L A;  4FQO A;  1H4B A;  2ZNE A;  3DVJ A;  1SK6 D;  4AQJ A;  2FJY A;  2JPT A;  1Y1A A;  2KSP A;  2K7B A;  1F71 A;  3L4A A;  2MLF C;  3B88 A;  1UHI A;  2L0P A;  3FE9 A;  4ICB A;  2M1K B;  2LLS A;  2MRD A;  4MEW A;  3S0A A;  3LK0 A;  2LUX A;  1QV0 A;  3PN7 B;  4NQG A;  2H61 C;  1EL4 A;  3DD4 A;  4HSZ A;  3VB1 A;  4MZK A;  1OZO A;  1CFP A;  1DJX A;  1K9U A;  3I5F C;  3JTD B;  4IL1 A;  5CSF A;  4BY4 A;  3PSR A;  2NCP A;  1K95 A;  3LK1 A;  2KBI A;  3OGN A;  2MJW B;  4GFT A;  3VRR A;  3D0Y B;  1SCM B;  2COL B;  3I5H B;  3UNW A;  5FI2 A;  1H8B A;  2JRF A;  1LVC D;  1S5G Z;  1QVI Y;  2KGR A;  4E68 A;  1CM4 A;  1XFR A;  4HRH A;  4PHK A;  1EH2 A;  4PHN A;  1RK9 A;  2F8P A;  2JUL A;  2PQL A;  1TNQ A;  2ZN9 A;  2KQY A;  2LNK A;  2EC6 B;  3BFA A;  3PM2 A;  3I5I B;  3SG3 A;  3TDZ A;  1JF0 A;  1B8L A;  4OKH A;  1PRW A;  1QIW A;  1DQE A;  1MF8 B;  3S0E A;  2M8U A;  3CS1 A;  2L4H A;  1DF0 B;  1QX5 B;  1B8C A;  3RZS A;  3SS4 A;  3LLE A;  4R1E A;  1DT7 B;  1QX7 A;  1L7Z A;  4JPZ B;  4PE0 A;  4L9M A;  1Y1X A;  2H2K A;  5D7F A;  5IBW A;  1DVI A;  3B87 A;  1Z4H A;  3VRN A;  1C3Y A;  3FS7 A;  1OOI X;  1GQM A;  1WRK A;  1NCZ A;  2O60 A;  2SAS A;  3CYZ A;  3A8R A;  4HRG A;  1CLB A;  3BUM B;  3CR2 A;  2KPH A;  1YX7 A;  1G33 A;  1YX8 A;  2PSR A;  2E30 A;  2LAN A;  1OMD A;  4YI9 A;  3KEV A;  3WHT B;  1UUS A;  1B4C A;  2WCE A;  4MRY A;  4A4C A;  3ICB A;  1KK7 Y;  1S36 A;  5HKZ A;  2LC5 A;  4I5K A;  3B7A A;  3WXA A;  5KU1 A;  3PFV A;  3CZ1 A;  1WRL A;  1A75 A;  1Y1U A;  5BPJ A;  3HX4 A;  1WLZ A;  1QX2 A;  2KFH A;  2M29 A;  1SY9 A;  2BL0 B;  3OHM B;  2F2O A;  1OMR A;  4ORC B;  4YGB B;  2R2I A;  4XJK B;  5I2L A;  1SMG A;  1JFJ A;  2BKH B;  1K9K A;  2KAX A;  5AXI A;  5D69 A;  3DF0 B;  3S0G A;  1JWD A;  1KSM A;  1UHH A;  3O4Y A;  2ISD A;  1ALV A;  5DIC A;  4KYN A;  2QEB A;  3IQO A;  1DEL A;  2NZ0 A;  2K2F A;  4GBA A;  2PYQ A;  2WCM A;  1QV1 A;  4FTG A;  4MSP A;  1LA3 A;  4USL A;  3AKA A;  2KLD A;  2P6B B;  2SCP A;  1WDC C;  2HET A;  3DVM A;  1GGZ A;  1K8U A;  1ORG A;  5ER5 A;  1U5I A;  5I2Q A;  4OZD A;  2OTG C;  1Y6W A;  4U8D A;  1ALW A;  1SL8 A;  3R72 A;  3L4L A;  1W9Z A;  1FI5 A;  2LAP A;  1J55 A;  4ZCV A;  2OS8 C;  1LKJ A;  1M31 A;  1M45 A;  1KQV A;  2JOJ A;  3HCM A;  2E6W A;  2GGZ A;  2M1U A;  1YVL A;  1FF1 A;  1CFD A;  3EKJ A;  4YRU A;  4PT1 A;  3DXL A;  3O2P A;  1HQV A;  1AJ4 A;  1F8H A;  2LUC A;  3EG5 B;  1IIO A;  3CDN A;  1A2X A;  1ZOT B;  1LS8 A;  1DJH A;  1IWQ A;  1CLM A;  1JC2 A;  2PAS A;  3EK7 A;  2HF5 A;  3DVK A;  1F4Q A;  1N65 A;  1SL7 A;  1KQM B;  4GPL B;  4MVF A;  3SS5 A;  4DRW A;  1NP8 A;  2BCB A;  3VRP A;  2LVJ A;  3CZT X;  3KF9 A;  2WCJ A;  2DOQ A;  3BOW B;  4PHM A;  2LVV A;  4AOM A;  2F2P A;  3BUW B;  1JBA A;  1DGU A;  1KK8 B;  2Q4U A;  3TS5 B;  2L4I A;  2LVI A;  3I5I C;  1CDP A;  1FW4 A;  2FJU B;  3S0F A;  1CTR A;  2KYF A;  1J7O A;  2AMI A;  1A29 A;  4UPG A;  2LCP A;  2L2E A;  2QEH A;  1QIV A;  1UHK A;  1XFX O;  2Y1N A;  4FQT A;  2BE6 A;  4I5J A;  3KO0 A;  4AQI A;  1KFU S;  1UHJ A;  2KI6 C;  4GUK A;  1F55 A;  3FE6 A;  2M0R A;  5DKR A;  1B7T Z;  1UP5 A;  2G9B A;  3UO9 A;  3RLZ A;  1NX2 A;  2M49 B;  1K96 A;  1BJF A;  1CKK A;  4GGF A;  1PSR A;  1EG4 A;  3BXK A;  1J1E A;  2CNP A;  1G4Y R;  2JXC A;  3CZ2 A;  2V53 A;  3C1V A;  5I94 A;  1MR8 A;  1CMF A;  3D76 A;  2ZFD A;  3D78 A;  2KI4 B;  3OP0 A;  2KAV A;  4OR9 B;  5GQQ C;  1NUB A;  1MXL C;  1BT6 A;  2Y1M A;  3DY9 A;  1CB1 A;  1SR6 C;  1KFX L;  2NCO A;  3I5G C;  2LMV A;  1J1D A;  1NWD A;  2G2B A;  1PVB A;  2ZND A;  5AFP A;  1W7I B;  1OZS A;  2MHH A;  1V1G A;  5TNC A;  2LP2 A;  2M7N A;  3VRQ A;  2L50 A;  2JWW A;  2QAC A;  2L98 A;  3EVV A;  1SRA A;  2KYC A;  4DCK A;  3BUN B;  1L2O B;  2HPS A;  1CFC A;  1BOC A;  5KSZ A;  3BFB A;  1BMO A;  2RGI A;  2B1U A;  2FCE A;  3TZ1 A;  3NHT A;  2JTT A;  2KI6 D;  3M0W A;  2BCX A;  1DEK A;  1SNL A;  3TUY C;  2ZKM X;  1QTX A;  1XVJ A;  3EVU A;  5KTY A;  1SPY A;  3S0D A;  2LMT A;  3EVR A;  1SKT A;  1IH0 A;  2HQW A;  3KPX A;  1YUR A;  4QJ4 B;  1J7P A;  2CT9 A;  1OOF A;  4I5N B;  4PE7 A;  5AER A;  2KNE A;  1IRJ A;  1DJZ A;  1QAS A;  3CWG A;  4GGF C;  5I2O A;  1BG1 A;  1LXF C;  2JT3 A;  2WC5 A;  2WOR A;  3SIB A;  1A03 A;  1Z2C B;  2WCB A;  1W7J B;  1K2H A;  2WND A;  1QJT A;  4INX A;  1FBV A;  1TCO B;  3D73 A;  1Q80 A;  3CAB A;  1ZAC A;  2BE4 A;  2M7L A;  1ZFS A;  1EXR A;  4M2O A;  2L5X B;  4C0K A;  1IQ3 A;  1OOG A;  3JVT B;  4JQ0 D;  3RM1 A;  3K21 A;  1OW4 A;  3EK8 A;  3GK4 X;  2JC2 A;  3WNX B;  1CM1 A;  1TIZ A;  3CGA A;  4NDC A;  5PAL A;  4A4B A;  2BEC A;  1NX3 A;  1Y0V H;  2M9G A;  2Q91 A;  1ZUZ A;  3D0Y A;  1DTL A;  2I18 A;  4MN0 A;  5D3O A;  3I5F B;  3VRO A;  1DJI A;  1ODB A;  2BKI B;  5HYD A;  1BF5 A;  2JNF A;  3EK4 A;  1QXP A;  1IGV A;  2H8V A;  1F4O A;  1G8I A;  4M2Q A;  5B8I B;  1S3P A;  2K0J A;  3BUX B;  3NSK A;  1TNW A;  1QWV A;  2WOS A;  1WLM A;  1B7T Y;  3R1P A;  1WRZ A;  1M63 B;  1KWO C;  2AAO A;  1MWN A;  3OBV A;  2BBN A;  3F45 A;  3BJH A;  4CPV A;  2QEV A;  3A4U B;  4NDB A;  2GTE A;  2L2C A;  4JWQ A;  5CPV A;  3AAK A;  1K94 A;  1BLQ A;  1DF0 A;  1DJG A;  1NX0 A;  1XFY O;  2CXJ A;  2YGU A;  3DZT A;  2MLE C;  4BY5 A;  1FPW A;  1AHR A;  2KFG A;  1TUJ A;  5FI6 A;  1XK4 C;  3QME A;  1BU3 A;  1JFK A;  1QVI Z;  5CSN A;  5CSI A;  3Q8I A;  2CTN A;  1S5G Y;  2KGB C;  2OPO A;  2QDI A;  1YUU A;  2K7C A;  3PN7 C;  1XFV O;  1NCY A;  1TNX A;  4DIR A;  2EHB A;  4INW A;  1AUI B;  1S26 D;  2QEO A;  3JTD C;  4DUQ A;  3KHE A;  1AP4 A;  1OQP A;  3LL8 B;  2LHL A;  4WQ2 A;  2LVK A;  1PSB A;  1SCM C;  3D10 A;  2AUC A;  2CBL A;  3I5H C;  1R6P A;  1X02 A;  3N7H A;  3E3R A;  4HRE E;  2JTZ A;  1RWY A;  1K93 D;  1SL9 A;  1S6J A; 
#chains in the Genus database with same CATH homology
 3FWC A;  5FYX A;  1C07 A;  1IQ5 A;  3GOF A;  5CSJ A;  3GK2 A;  2K7D A;  1C7W A;  1OOJ A;  2NXQ A;  2EC6 C;  3BQ3 A;  4MLW A;  3ZWH A;  5F6T A;  3OB2 B;  4PCW A;  2D8N A;  3VGO A;  4QJ5 B;  1JSA A;  4C0J A;  1IJ6 A;  1K90 D;  3OX5 A;  1OMV A;  1XA5 A;  3GK1 A;  2BBM A;  1CNP A;  4NDD A;  4QJ3 B;  1AJ5 A;  1KK7 Z;  4GGN A;  4OCI A;  5DKN A;  1CDM A;  4N1G A;  4WQ3 A;  4CLN A;  1B1G A;  1PUL A;  1WY9 A;  2MAZ A;  3SG7 A;  4D1E A;  1SYM A;  3SG6 A;  5HKY A;  1CDN A;  1GJY A;  1M46 A;  1KSO A;  1EG3 A;  5ER4 X;  3SIA A;  2I94 A;  1SCV A;  2TN4 A;  1WDC B;  1REC A;  3SG4 A;  3TDU A;  2OTG B;  1CFF A;  1YTZ C;  3EKH A;  1UHN A;  3JVT C;  2ZRS A;  4YGA A;  2L51 A;  1FI6 A;  2K61 A;  4ORB B;  2OS8 B;  2Y4Q A;  1RRO A;  1YVH A;  1IJ5 A;  2KHN A;  3H4S E;  3MSE B;  4CID A;  4ETO A;  3AAJ A;  2KFF A;  2KQ6 A;  1F54 A;  2BL0 C;  4PE1 A;  3DVE A;  1TOP A;  2IS9 A;  2F33 A;  2JQ6 A;  2JZI A;  3FIA A;  4YBH B;  4YGE B;  1QLK A;  3OB1 B;  5K89 A;  1F70 A;  1A75 B;  3BOW A;  4MRX A;  2PMY A;  4ORA B;  1IG5 A;  4P2Y B;  1GGW A;  1NPQ A;  2LMU A;  2LE9 B;  2CCM A;  1XFZ O;  2I2R E;  1QAT A;  5HLV A;  1DGV A;  3NSL A;  1OE9 B;  5JOL A;  1MUX A;  1DJY A;  2MA2 A;  1D1O A;  1DJW A;  4YGD B;  1XFW O;  1PVA A;  2F3Z A;  2M3W A;  1XK4 A;  4Q04 A;  2LM5 A;  2VRG A;  5I8N A;  4PHJ A;  3PM8 A;  4DS7 A;  1QS7 A;  1A4P A;  5AEQ A;  1U5I B;  1PK0 D;  1JF2 A;  1K9P A;  1SBJ A;  2I7A A;  2LV7 A;  3BYA A;  5DKQ A;  1CMG A;  1RFJ A;  1MHO A;  3PAT A;  1B8R A;  1AVS A;  5AAN A;  3IQQ A;  1MXE A;  3AKB A;  2PRU A;  1E8A A;  3WHU B;  2LLT A;  1CDL A;  5HLO A;  1BR1 B;  2K8M B;  1XO5 A;  1KQM C;  4MBE A;  3TDI A;  1SR6 B;  1PAL A;  3I5G B;  1TNP A;  1EJ3 A;  2PVB A;  4PDZ A;  4XYN A;  1OSA A;  1XYD A;  1YRT B;  2K2A A;  3QRX A;  4WRI A;  3SG5 A;  1KFX S;  5G08 A;  1NYA A;  1B47 A;  1TCF A;  2FCD A;  1KK8 C;  1VRK A;  3TS5 C;  2LP3 A;  1NIW A;  3CLN A;  4PE4 A;  1XFU O;  1KFU L;  1B9A A;  4P5O E;  4GAO A;  1YUT A;  1M39 A;  2KDH A;  2F3Y A;  2QPT A;  1NX1 A;  1V1F A;  3CR4 X;  5HKW A;  2LLU A;  2JT8 A;  2MBX A;  3TUY B;  3SJS A;  1UWO A;  4CFR A;  3PAL A;  1ZMZ A;  1S6I A;  2O5G A;  4YGC B;  3ZNI A;  1BOD A;  3LCP C;  4TNC A;  3NSI A;  1JUO A;  2GV5 A;  2PAL A;  4PAL A;  1RTP 1;  2WCF A;  2KBM A;  3SG2 A;  4OV2 A;  4F0Z B;  2EGD A;  2NLN A;  1N0Y A;  1QLS A;  3IF7 A;  1UUR A;  2Y5I A;  2JU0 A;  2A4J A;  2KI4 C;  1IKU A;  1N2D A;  2JXL A;  1NSH A;  1TTX A;  2JT0 A;  3CR5 X;  1YUS A;  4I5L B;  5J3X A;  1LA0 A;  1TRF A;  4MZL A;  1S1E A;  2K7O A;  2FOT A;  3O6B A;  1R2U A;  4OVN F;  3OX6 A;  4YI8 A;  3PLF B;  2M97 A;  1LIN A;  1L2O C;  2WC8 A;  3NXA A;  4ZCU A;  2H61 A;  3CTN A;  1KCY A;  4XJK A;  4N5X A;  3O78 A;  4MZJ A;  1NCX A;  3DF0 A;  1J7R A;  1DMO A;  1J7Q A;  3BUO B;  1HT9 A;  4M2P A;  2GGM A;  1TN4 A;  1MQ1 A;  3FWB A;  1BR4 B;  2LHI A;  4GNK B;  5JJG A;  1CLL A;  1YR5 A;  2ZRT A;  4N1F A;  1SW8 A;  2JNX A;  2KAY A;  1C7V A;  1KWO B;  1RJV A;  1YRU B;  1AK8 A;  2BCA A;  4CFQ A;  2HQ8 A;  2KOT A;  1S6C A;  2ZN8 A;  3NSO A;  4C0L A;  4FQO A;  1H4B A;  2ZNE A;  3DVJ A;  1SK6 D;  4AQJ A;  2JPT A;  1Y1A A;  2KSP A;  2K7B A;  1F71 A;  2MLF C;  1UHI A;  2L0P A;  4ICB A;  2M1K B;  2LLS A;  2MRD A;  4MEW A;  3LK0 A;  2LUX A;  1QV0 A;  3PN7 B;  4NQG A;  2H61 C;  1EL4 A;  3DD4 A;  4HSZ A;  4MZK A;  1OZO A;  1CFP A;  1DJX A;  1K9U A;  3I5F C;  3JTD B;  4IL1 A;  5CSF A;  4BY4 A;  3PSR A;  2NCP A;  1K95 A;  3LK1 A;  2KBI A;  2MJW B;  4GFT A;  3VRR A;  3D0Y B;  1SCM B;  2COL B;  3I5H B;  1H8B A;  2JRF A;  1LVC D;  1S5G Z;  1QVI Y;  2KGR A;  4E68 A;  1CM4 A;  4HRH A;  4PHK A;  1EH2 A;  4PHN A;  1RK9 A;  2F8P A;  2JUL A;  1TNQ A;  2ZN9 A;  2KQY A;  2LNK A;  2EC6 B;  3I5I B;  3SG3 A;  3TDZ A;  1JF0 A;  1B8L A;  4OKH A;  1PRW A;  1QIW A;  1MF8 B;  2M8U A;  3CS1 A;  2L4H A;  1DF0 B;  1QX5 B;  1B8C A;  3LLE A;  4R1E A;  1DT7 B;  1QX7 A;  1L7Z A;  4JPZ B;  4PE0 A;  4L9M A;  1Y1X A;  2H2K A;  5D7F A;  5IBW A;  1DVI A;  3VRN A;  3FS7 A;  1GQM A;  1WRK A;  1NCZ A;  2O60 A;  2SAS A;  4HRG A;  3A8R A;  1CLB A;  3BUM B;  3CR2 A;  2PSR A;  1YX7 A;  1G33 A;  1YX8 A;  2E30 A;  2LAN A;  1OMD A;  4YI9 A;  3KEV A;  3WHT B;  1UUS A;  1B4C A;  2WCE A;  4MRY A;  4A4C A;  3ICB A;  1KK7 Y;  1S36 A;  5HKZ A;  2LC5 A;  4I5K A;  3WXA A;  5KU1 A;  3PFV A;  1WRL A;  1A75 A;  1Y1U A;  5BPJ A;  3HX4 A;  1WLZ A;  1QX2 A;  2KFH A;  2M29 A;  1SY9 A;  2BL0 B;  3OHM B;  2F2O A;  1OMR A;  4ORC B;  4YGB B;  2R2I A;  4XJK B;  5I2L A;  1SMG A;  1JFJ A;  2BKH B;  1K9K A;  2KAX A;  5AXI A;  5D69 A;  3DF0 B;  1JWD A;  1KSM A;  1UHH A;  3O4Y A;  2ISD A;  1ALV A;  3IQO A;  2NZ0 A;  2K2F A;  4GBA A;  4MSP A;  4FTG A;  1QV1 A;  1LA3 A;  4USL A;  3AKA A;  2P6B B;  2SCP A;  1WDC C;  2HET A;  3DVM A;  1GGZ A;  1K8U A;  5ER5 A;  1U5I A;  5I2Q A;  2OTG C;  1Y6W A;  4U8D A;  1ALW A;  1SL8 A;  1FI5 A;  2LAP A;  1J55 A;  4ZCV A;  2OS8 C;  1LKJ A;  1M31 A;  1M45 A;  1KQV A;  2JOJ A;  3HCM A;  2E6W A;  2GGZ A;  2M1U A;  1YVL A;  1FF1 A;  1CFD A;  3EKJ A;  4YRU A;  3O2P A;  1HQV A;  1AJ4 A;  1F8H A;  2LUC A;  1A2X A;  1ZOT B;  1DJH A;  1IWQ A;  1CLM A;  1JC2 A;  2PAS A;  3EK7 A;  2HF5 A;  3DVK A;  1F4Q A;  1N65 A;  1SL7 A;  1KQM B;  4GPL B;  4MVF A;  4DRW A;  1NP8 A;  2BCB A;  3VRP A;  2LVJ A;  3CZT X;  3KF9 A;  2DOQ A;  3BOW B;  4PHM A;  2LVV A;  4AOM A;  2F2P A;  3BUW B;  1JBA A;  1DGU A;  1KK8 B;  2Q4U A;  3TS5 B;  2L4I A;  2LVI A;  3I5I C;  1CDP A;  1FW4 A;  2FJU B;  1J7O A;  1CTR A;  2KYF A;  2AMI A;  1A29 A;  4UPG A;  2LCP A;  2L2E A;  1QIV A;  1UHK A;  1XFX O;  2Y1N A;  2BE6 A;  4I5J A;  3KO0 A;  4AQI A;  1KFU S;  1UHJ A;  2KI6 C;  4GUK A;  1F55 A;  2M0R A;  5DKR A;  1B7T Z;  1UP5 A;  2G9B A;  3RLZ A;  1NX2 A;  2M49 B;  1K96 A;  1BJF A;  1CKK A;  4GGF A;  1PSR A;  1EG4 A;  3BXK A;  1J1E A;  2CNP A;  1G4Y R;  2JXC A;  2V53 A;  3C1V A;  1CMF A;  1MR8 A;  2ZFD A;  2KI4 B;  3OP0 A;  2KAV A;  4OR9 B;  5GQQ C;  1NUB A;  1MXL C;  1BT6 A;  2Y1M A;  1CB1 A;  1SR6 C;  1KFX L;  2NCO A;  3I5G C;  2LMV A;  1J1D A;  1NWD A;  2G2B A;  1PVB A;  2ZND A;  5AFP A;  1W7I B;  1OZS A;  2MHH A;  1V1G A;  5TNC A;  2LP2 A;  2M7N A;  3VRQ A;  2L50 A;  2JWW A;  2QAC A;  2L98 A;  3EVV A;  1SRA A;  2KYC A;  4DCK A;  3BUN B;  1L2O B;  2HPS A;  1CFC A;  1BOC A;  5KSZ A;  1BMO A;  2RGI A;  2B1U A;  2FCE A;  3TZ1 A;  2JTT A;  2KI6 D;  3M0W A;  2BCX A;  1SNL A;  3TUY C;  2ZKM X;  1QTX A;  1XVJ A;  3EVU A;  5KTY A;  1SPY A;  2LMT A;  3EVR A;  1SKT A;  1IH0 A;  2HQW A;  3KPX A;  1YUR A;  4QJ4 B;  1J7P A;  2CT9 A;  4PE7 A;  4I5N B;  5AER A;  2KNE A;  1IRJ A;  1DJZ A;  1QAS A;  3CWG A;  4GGF C;  5I2O A;  1BG1 A;  1LXF C;  2JT3 A;  2WOR A;  3SIB A;  1A03 A;  1K2H A;  2WCB A;  1W7J B;  2WND A;  1QJT A;  1FBV A;  1TCO B;  1Q80 A;  1ZAC A;  2BE4 A;  2M7L A;  1ZFS A;  1EXR A;  4M2O A;  2L5X B;  4C0K A;  1IQ3 A;  3JVT B;  4JQ0 D;  3RM1 A;  3K21 A;  3EK8 A;  3GK4 X;  2JC2 A;  3WNX B;  1CM1 A;  1TIZ A;  3CGA A;  4NDC A;  5PAL A;  4A4B A;  2BEC A;  1NX3 A;  1Y0V H;  2M9G A;  2Q91 A;  1ZUZ A;  3D0Y A;  1DTL A;  2I18 A;  4MN0 A;  3I5F B;  3VRO A;  1DJI A;  1ODB A;  2BKI B;  5HYD A;  1BF5 A;  2JNF A;  3EK4 A;  1QXP A;  1IGV A;  1F4O A;  1G8I A;  4M2Q A;  5B8I B;  1S3P A;  2K0J A;  3BUX B;  3NSK A;  1TNW A;  2WOS A;  1WLM A;  1B7T Y;  1WRZ A;  1M63 B;  1KWO C;  2AAO A;  1MWN A;  2BBN A;  3F45 A;  4CPV A;  3A4U B;  4NDB A;  4JWQ A;  5CPV A;  3AAK A;  1K94 A;  1BLQ A;  1DF0 A;  1DJG A;  1NX0 A;  1XFY O;  2CXJ A;  4BY5 A;  2MLE C;  1FPW A;  1AHR A;  2KFG A;  1XK4 C;  1BU3 A;  1JFK A;  1QVI Z;  5CSN A;  5CSI A;  2CTN A;  1S5G Y;  2KGB C;  2OPO A;  1YUU A;  2K7C A;  3PN7 C;  1XFV O;  1NCY A;  1TNX A;  4DIR A;  2EHB A;  1AUI B;  1S26 D;  3JTD C;  4DUQ A;  3KHE A;  1AP4 A;  1OQP A;  3LL8 B;  2LHL A;  4WQ2 A;  2LVK A;  1PSB A;  1SCM C;  3D10 A;  2AUC A;  2CBL A;  3I5H C;  1R6P A;  1X02 A;  4HRE E;  3E3R A;  2JTZ A;  1RWY A;  1K93 D;  1SL9 A;  1S6J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...