2JT8A

Solution structure of the f153-to-5-flurotryptophan mutant of human cardiac troponin c
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
161
structure length
160
Chain Sequence
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRSMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDELEFMKGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Troponin C, slow skeletal and cardiac muscles
publication title Effects of Phe-to-Trp mutation and fluorotryptophan incorporation on the solution structure of cardiac troponin C, and analysis of its suitability as a potential probe for in situ NMR studies
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 28
structure length 160
sequence length 161
ec nomenclature
pdb deposition date 2007-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2jt8A00
2JTTA 1DGUA 1UP5A 3QRXA 1IJ6A 1KK7Y 2F3YA 2LVKA 5BPJA 3VROA 1PVAA 3AKAA 2H61A 1DT7B 2JULA 4E68A 1JUOA 1K96A 2Q91A 3SIAA 3SIBA 4I5KA 1NX1A 2AAOA 1N0YA 3I5HB 2BE4A 4YI9A 3LLEA 3O2PA 3EK8A 4OKHA 2KI4B 3D0YB 5KTYA 1S36A 3OX6A 1BT6A 1TNXA 4MZJA 1QXPA 4JPZB 2LUXA 1NCZA 1U5IB 1RECA 1A03A 1SBJA 4CLNA 1YVLA 1LKJA 3NXAA 3PLFB 1PSBA 1NX0A 1JFKA 2G9BA 2BKIB 2CBLA 1F71A 3LK1A 2KFFA 1QVIZ 2OS8C 1XFWO 1FI6A 4GGFC 3SG5A 1SW8A 4MRYA 1KQMB 3LCPC 1BJFA 2JRFA 2JTZA 4DIRA 1PK0D 2LVJA 1OE9B 1M46A 3BOWA 4GFTA 3O78A 1DJZA 2ISDA 2PSRA 1XFXO 1QATA 2KFHA 1OOJA 4PHNA 4GGFA 2F33A 5HLVA 2KDHA 2MBXA 1SL7A 1EXRA 2M1KB 3CGAA 3TS5C 4F0ZB 1EJ3A 5HLOA 1MF8B 4ORCB 2E30A 3HCMA 1H4BA 1MQ1A 1KQMC 1YUUA 2JQ6A 2K0JA 1JSAA 1XFYO 2K61A 3VRRA 1IG5A 1WRZA 2K7DA 5B8IB 3SG2A 1MR8A 1K9KA 2HPSA 2BCAA 1TCFA 5I2QA 2R2IA 1RTP1 1F70A 1V1GA 2LP3A 1JF2A 3CR4X 1M31A 1J7OA 4BY4A 4MN0A 1IGVA 2M97A 4XJKA 2Q4UA 2JNXA 2KBIA 1DF0A 1TRFA 2QACA 3DD4A 5HKWA 1NPQA 5JJGA 1ALWA 4N1FA 1BR1B 3VRPA 2M7NA 3CLNA 2KGBC 3TUYB 4R1EA 1DJWA 2OTGC 1C07A 1Y0VH 4UPGA 1C7VA 2JNFA 4M2OA 1KCYA 1RK9A 1UHIA 1TTXA 1YRUB 1S1EA 4CFRA 1QVIY 4QJ3B 1B8CA 2LHIA 2GGZA 1B7TZ 1F4OA 2L0PA 3AAJA 3O6BA 1K2HA 1HT9A 4PHKA 2D8NA 3PATA 4U8DA 3BUNB 3EVRA 1QJTA 5F6TA 5AXIA 3PSRA 4USLA 2K2AA 1TNPA 1G33A 3NSLA 2EGDA 3DVEA 2WCBA 1GJYA 2LUCA 1A75A 4QJ4B 1SR6B 1J55A 1SK6D 2CXJA 1PULA 3TDIA 2I94A 1L2OB 2JXCA 1XYDA 1QV0A 4OR9B 2JXLA 2KSPA 5KU1A 4M2PA 1IWQA 1XA5A 1S5GZ 3FIAA 1F55A 2CNPA 1UUSA 5PALA 2BECA 3SG4A 4DRWA 1FI5A 3KPXA 1SY9A 1CLBA 1QS7A 2L5XB 1EH2A 1KSOA 1YUTA 3A4UB 5CPVA 1MXEA 2LCPA 3I5GC 2F8PA 1ZMZA 3SG3A 2Y1NA 3GK1A 1WY9A 1KFXL 1S6JA 2M3WA 3DF0B 1B1GA 1SR6C 2LVIA 2K2FA 4IL1A 1L2OC 1R2UA 2I7AA 3TDUA 3KHEA 3A8RA 1ZOTB 1J7PA 3FWBA 1CDLA 2LLUA 4CFQA 5AFPA 1CNPA 1UHJA 1FF1A 2MHHA 2RGIA 1NWDA 4JWQA 2QPTA 1KK8B 2O5GA 2DOQA 1NX3A 1B8LA 1DJGA 3CR5X 1OZSA 3DVMA 4PE0A 1AUIB 1XFUO 2M29A 4PHMA 1QASA 3GK2A 1CDMA 1B9AA 5JOLA 1CB1A 2A4JA 2BL0B 3PM8A 1KFXS 4ZCVA 1SL8A 1TN4A 2Y5IA 1TCOB 4WQ2A 1Y1AA 1B7TY 2LM5A 5D7FA 1JWDA 1NSHA 3OP0A 2SCPA 2SASA 4YGAA 2FJUB 3D10A 1CMGA 3I5HC 1NCYA 1DMOA 2MAZA 2I18A 1YVHA 1BR4B 2KI4C 3KEVA 4NDBA 1A4PA 2LC5A 4QJ5B 1KK8C 2GV5A 3DF0A 1K9PA 1TIZA 3NSIA 2K7OA 4P5OE 1NX2A 3WHTB 1F8HA 2M1UA 1N2DA 3AKBA 4C0KA 3D0YA 1EG3A 5IBWA 2L4HA 3IF7A 3JVTB 3CR2A 4I5LB 3JTDB 4PE4A 1ZFSA 2VRGA 5K89A 1S5GY 1SCVA 2L98A 2MRDA 1U5IA 4YBHB 5DKRA 5DKQA 1XFVO 2KFGA 2L51A 5CSFA 1BG1A 4GUKA 4MEWA 1A29A 1NYAA 2LLSA 4PE7A 1LA0A 2AUCA 2M0RA 3EVVA 1DGVA 2NCPA 2NZ0A 3AAKA 3CTNA 4GGNA 4HRGA 1BOCA 4ICBA 1IJ5A 2WNDA 1AJ5A 1H8BA 1XFZO 3CS1A 1CFDA 1OMVA 1G4YR 2F3ZA 5CSNA 1MUXA 3M0WA 1Q80A 4CIDA 3VGOA 1PSRA 3JVTC 5TNCA 1ZACA 2LHLA 4WQ3A 2LP2A 2LVVA 3BUMB 2PVBA 4NDDA 4D1EA 4PALA 1S3PA 3BYAA 5DKNA 1CFFA 1K9UA 1S6CA 1K90D 1XK4C 1QLSA 2ZNEA 2BCXA 3TDZA 1ZUZA 2JT0A 2E6WA 1JBAA 4FTGA 2CTNA 1QTXA 1MHOA 5G08A 1FPWA 5I8NA 1XK4A 3TZ1A 3EK4A 3RM1A 2F2PA 4MZKA 1X02A 1YURA 1AVSA 1TOPA 1TNWA 2BE6A 2IS9A 3IQOA 3SG6A 3WXAA 4I5JA 1V1FA 4ETOA 1OQPA 1UWOA 2B1UA 1J7QA 1J7RA 4MVFA 3OB1B 2BCBA 3KF9A 2G2BA 1OMDA 1QIVA 1K8UA 1SRAA 2ZFDA 1PRWA 4GPLB 1Y1XA 2I2RE 4JQ0D 2L50A 1CDNA 3ZNIA 1XO5A 2JU0A 3TUYC 4AQIA 5I2LA 2COLB 1WLZA 3EVUA 1WDCB 1SCMB 1ALVA 1UHHA 3O4YA 4MSPA 2LNKA 1EG4A 2PALA 2BKHB 2NCOA 2LAPA 2MJWB 1IH0A 1FBVA 3GOFA 1JFJA 2KAYA 3WHUB 1BF5A 3EKHA 1QX2A 1DJIA 1UHNA 3EK7A 1EL4A 5CSIA 1FW4A 4CPVA 2WCFA 2M49B 4A4BA 4AOMA 1OMRA 4OV2A 2BBMA 3OX5A 1F4QA 1LA3A 1CLMA 3MSEB 5CSJA 3ZWHA 1AHRA 1YR5A 4WRIA 3LK0A 5GQQC 3C1VA 1GQMA 2KI6C 1XVJA 2L4IA 3KO0A 2PASA 2WORA 3SG7A 1E8AA 1IRJA 1AJ4A 1W7JB 2LMUA 1CKKA 4YGEB 4DS7A 4HRHA 1CM4A 3PN7B 1UHKA 3NSKA 1CFCA 1CFPA 3GK4X 3PFVA 1B8RA 3EKJA 1SMGA 4Q04A 2L2EA 4ZCUA 1CMFA 4XYNA 1B4CA 3CZTX 3ICBA 3BOWB 2MLFC 1CLLA 2OS8B 1B47A 2ZRSA 4PHJA 2NLNA 1M63B 1HQVA 1NUBA 3OB2B 1Y6WA 5ER5A 2LLTA 3VRQA 3HX4A 2KQYA 1RFJA 1F54A 2KNEA 5KSZA 1IKUA 4HSZA 4FQOA 5AERA 1SYMA 2P6BB 2EC6B 1YX7A 3PN7C 5I2OA 4YGCB 1KFUL 4P2YB 1D1OA 3K21A 1J1DA 4BY5A 4PCWA 2FOTA 4TNCA 1RJVA 3TS5B 1IQ3A 2BL0C 2JT8A 1YTZC 3BXKA 1ODBA 5HKYA 1C7WA 1DTLA 2ZKMX 3BUWB 1CTRA 2FCDA 2LE9B 1NIWA 5FYXA 2KAXA 2KI6D 1BMOA 1S26D 2MA2A 1BODA 2PRUA 1SL9A 1OSAA 2LV7A 1DJYA 1Y1UA 2KBMA 4YI8A 2JZIA 1RROA 3SJSA 5ER4X 4PDZA 5J3XA 2JPTA 2EC6C 2HETA 1M45A 4PE1A 4YGBB 4XJKB 1M39A 2LMVA 4MZLA 1KFUS 1DF0B 4ORAB 1RWYA 3F45A 3H4SE 1QIWA 1YRTB 4M2QA 1VRKA 3JTDC 1IQ5A 1QV1A 2M9GA 1SKTA 2GGMA 2LANA 3BQ3A 1WRLA 1J1EA 2KAVA 1K94A 2F2OA 3I5IB 2OPOA 4NQGA 4C0LA 4OCIA 1K93D 5HYDA 1OZOA 4ORBB 4DUQA 1NP8A 2K7BA 2FCEA 2O60A 2MLEC 2TN4A 1AP4A 4C0JA 1QX5B 2OTGB 3VRNA 1QLKA 2LMTA 3OHMB 1KK7Z 3E3RA 4GAOA 2H2KA 1WLMA 4DCKA 1MWNA 2CCMA 1GGWA 3I5FB 1N65A 2K7CA 2KHNA 2WCEA 4MBEA 2M7LA 1KWOB 3FWCA 2Y1MA 2EHBA 3FS7A 3IQQA 1A75B 4YRUA 1GGZA 2JOJA 4MLWA 2M8UA 2HQWA 2PMYA 1R6PA 3WNXB 1PALA 3I5IC 1TNQA 2WC8A 1NCXA 2V53A 3PALA 2KGRA 2HQ8A 2ZN9A 4L9MA 2KYFA 1A2XA 5D69A 5HKZA 2HF5A 1SPYA 4HREE 1MXLC 3BUOB 4GBAA 2Y4QA 1DJHA 3I5FC 4MRXA 2KQ6A 5AEQA 1BLQA 1KWOC 1BU3A 2K8MB 5AANA 1JC2A 2BBNA 3DVJA 4YGDB 2WOSA 2JWWA 2AMIA 3NSOA 2ZN8A 1KSMA 4N1GA 1LINA 1LVCD 1SNLA 3I5GB 4GNKB 3DVKA 1LXFC 2JC2A 2KYCA 1DVIA 2CT9A 4OVNF 1G8IA 1W7IB 4N5XA 3BUXB 2JT3A 1WDCC 1SCMC 2NXQA 1UURA 1L7ZA 1PVBA 3RLZA 4AQJA 1YUSA 1DJXA 3LL8B 4NDCA 1KQVA 1CDPA 1CM1A 1YX8A 3CWGA 2ZRTA 1AK8A 1JF0A 2H61C 2KOTA 4I5NB 1K95A 1QX7A 1WRKA 2ZNDA 4A4CA 1S6IA
chains in the Genus database with same CATH superfamily
2JTTA 1DGUA 1UP5A 3QRXA 1IJ6A 1KK7Y 2F3YA 2LVKA 5BPJA 3VROA 1PVAA 2QEBA 3AKAA 2H61A 3DYEA 2JULA 4E68A 1DT7B 1JUOA 1K96A 2Q91A 3SIAA 3SIBA 3R72A 4I5KA 1C3ZA 1NX1A 2AAOA 1N0YA 3I5HB 2BE4A 4YI9A 3LLEA 3O2PA 3EK8A 4OKHA 2KI4B 3D0YB 5KTYA 1S36A 3OX6A 1BOCA 1BT6A 1TNXA 2PYQA 3K1EA 4MZJA 2H8VA 1QXPA 4JPZB 2LUXA 1NCZA 1U5IB 1RECA 1A03A 1SBJA 4CLNA 1YVLA 4FQTA 1LKJA 3NXAA 3PLFB 1PSBA 1NX0A 1JFKA 2G9BA 2BKIB 2CBLA 1F71A 3D76A 3LK1A 1GM0A 2KFFA 1QVIZ 2OS8C 1XFWO 1FI6A 4GGFC 3SG5A 1SW8A 4MRYA 1KQMB 3BFHA 3LCPC 1BJFA 2JRFA 2QDIA 1TUJA 2JTZA 4DIRA 2KLDA 1PK0D 4INXA 2LVJA 1OE9B 1M46A 3BOWA 4GFTA 3O78A 1DJZA 2ISDA 2PSRA 1XFXO 1QATA 2KFHA 1OOJA 4PHNA 4GGFA 2F33A 5HLVA 2KDHA 2MBXA 1SL7A 1EXRA 2M1KB 3CGAA 3TS5C 4F0ZB 1EJ3A 5HLOA 3B6XA 1MF8B 2QEVA 4ORCB 2E30A 3HCMA 1H4BA 1MQ1A 1KQMC 1YUUA 2JQ6A 2K0JA 1JSAA 1XFYO 1TUZA 2K61A 3D78A 3VRRA 1C3YA 3UO9A 1IG5A 1WRZA 2K7DA 3Q8IA 5B8IB 3SG2A 1MR8A 3L47A 1OOHA 5FI7A 1K9KA 2HPSA 2BCAA 1TCFA 5I2QA 2R2IA 1RTP1 1F70A 1TWOA 1V1GA 2LP3A 2WCHA 5D3OA 4IJ7A 1JF2A 3CR4X 1M31A 1J7OA 4BY4A 4MN0A 1IGVA 2M97A 4XJKA 2Q4UA 2JNXA 2KBIA 3S0AA 1DF0A 1TRFA 2QACA 3DD4A 4KYNA 5HKWA 1NPQA 5JJGA 1ALWA 4N1FA 1BR1B 3VRPA 2M7NA 3CLNA 2KGBC 3TUYB 4R1EA 1DJWA 2OTGC 1C07A 1Y0VH 1OOFA 4UPGA 1C7VA 2JNFA 4M2OA 1KCYA 1RK9A 1UHIA 1TTXA 1YRUB 1S1EA 4CFRA 1QVIY 4QJ3B 1B8CA 4PT1A 2LHIA 2GGZA 2JPOA 1B7TZ 1F4OA 2L0PA 3AAJA 3O6BA 1K2HA 1HT9A 4PHKA 2D8NA 3PATA 4U8DA 2KPHA 3BUNB 3EVRA 1QJTA 5F6TA 5AXIA 3PSRA 4USLA 2K2AA 1TNPA 1G33A 3NSLA 2EGDA 3DVEA 2WCBA 1GJYA 2LUCA 1A75A 4QJ4B 5FI2A 1SR6B 1J55A 1SK6D 2CXJA 1PULA 3TDIA 2I94A 1L2OB 2JXCA 1XYDA 1QV0A 2BAPA 3L4LA 4OR9B 1DELA 2JXLA 2KSPA 5KU1A 4M2PA 1IWQA 3OGNA 1XA5A 3QMEA 1S5GZ 3FIAA 1F55A 2CNPA 1OW4A 1UUSA 3CZ1A 5PALA 2BECA 3SG4A 4DRWA 2P71A 1FI5A 3KPXA 1SY9A 2WCMA 1QS7A 2L5XB 1CLBA 1EH2A 1KSOA 1YUTA 3A4UB 3D74A 5CPVA 1MXEA 2LCPA 3I5GC 3BJHA 2F8PA 1ORGA 1ZMZA 3SG3A 1LS8A 3VB1A 2Y1NA 3GK1A 1WY9A 1KFXL 1S6JA 2M3WA 3DF0B 3EG5B 1SR6C 1B1GA 2LVIA 2K2FA 4IL1A 1L2OC 2WC5A 1R2UA 2I7AA 3TDUA 3KHEA 3A8RA 1ZOTB 1J7PA 3FWBA 1CDLA 2LLUA 4CFQA 5AFPA 1CNPA 1UHJA 1FF1A 2MHHA 2RGIA 1NWDA 4JWQA 2QPTA 1KK8B 2O5GA 2DOQA 3V2LA 1NX3A 1B8LA 1DJGA 5EL2A 3CR5X 1OZSA 3DVMA 4PE0A 1AUIB 1XFUO 2M29A 3PJIA 4PHMA 1QASA 4JD9A 3GK2A 1CDMA 1B9AA 5JOLA 1CB1A 2A4JA 2BL0B 3PM8A 1KFXS 4ZCVA 1SL8A 1TN4A 2Y5IA 1TCOB 4WQ2A 1Y1AA 1B7TY 2LM5A 2QEOA 4OZDA 5D7FA 1NSHA 1JWDA 3OP0A 2SCPA 2SASA 4YGAA 2FJUB 3D10A 3SS3A 3I5HC 1NCYA 1CMGA 2MAZA 2I18A 1DMOA 1YVHA 1BR4B 2KI4C 3B87A 3BFAA 3KEVA 4NDBA 1A4PA 2LC5A 4QJ5B 1KK8C 2GV5A 3DF0A 1K9PA 3FE9A 1TIZA 5I94A 3NSIA 2K7OA 4P5OE 1NX2A 3WHTB 1F8HA 2M1UA 1N2DA 3AKBA 5DICA 3D0YA 1EG3A 4C0KA 5IBWA 2L4HA 3IF7A 3JVTB 3CR2A 4I5LB 3JTDB 4PE4A 1ZFSA 2VRGA 5K89A 1S5GY 1SCVA 2L98A 2MRDA 1U5IA 4YBHB 5DKRA 3S0DA 5DKQA 1QWVA 1XFVO 2KFGA 2L51A 5CSFA 1BG1A 4GUKA 1SSEB 4MEWA 1A29A 1NYAA 2LLSA 4PE7A 1LA0A 2AUCA 2M0RA 3EVVA 1DGVA 2NCPA 2NZ0A 3AAKA 3CTNA 4GGNA 2L5YA 4HRGA 4ICBA 1IJ5A 2WNDA 1AJ5A 1H8BA 1XFZO 3CS1A 5HL1A 1CFDA 1OMVA 3SS5A 1G4YR 2F3ZA 5CSNA 1MUXA 3M0WA 1Q80A 4CIDA 3VGOA 1PSRA 3JVTC 5TNCA 1ZACA 2LHLA 4WQ3A 2LP2A 2LVVA 3BUMB 2PVBA 4NDDA 4D1EA 1W9ZA 4PALA 1S3PA 3BYAA 5DKNA 1CFFA 2WCJA 1K9UA 1Z4HA 1S6CA 1K90D 1XK4C 3IVTA 1QLSA 3DXLA 2ZNEA 2BCXA 3TDZA 2WC6A 1ZUZA 2JT0A 2E6WA 1JBAA 1T14A 4FTGA 1DEKA 2CTNA 1QTXA 1MHOA 5G08A 3S0FA 1FPWA 5I8NA 1OOIX 3DY9A 1XK4A 3D75A 3TZ1A 3EK4A 3RM1A 2F2PA 4MZKA 1X02A 1YURA 1AVSA 1TOPA 1TNWA 2BE6A 2IS9A 3IQOA 3SG6A 3WXAA 4I5JA 3CDNA 1V1FA 4ETOA 1OQPA 1UWOA 2B1UA 1J7QA 1J7RA 4MVFA 3OB1B 2BCBA 3KF9A 2G2BA 1OMDA 1QIVA 1K8UA 1SRAA 2ZFDA 1PRWA 4GPLB 1Y1XA 2I2RE 1P28A 4JQ0D 2KLEA 2L50A 3D77A 1CDNA 3ZNIA 1XO5A 2JU0A 3SS4A 3B88A 3TUYC 4AQIA 3BFBA 5I2LA 2COLB 3S0GA 1WLZA 3EVUA 1WDCB 1SCMB 1ALVA 1UHHA 3O4YA 4MSPA 2LNKA 1EG4A 2YGUA 2PALA 2BKHB 2NCOA 2LAPA 2MJWB 1IH0A 1FBVA 3GOFA 1JFJA 2KAYA 3WHUB 1BF5A 3EKHA 1QX2A 1DJIA 1UHNA 3D73A 1EL4A 3EK7A 1FW4A 5CSIA 4CPVA 2WCFA 2M49B 4A4BA 4AOMA 1OMRA 5FI6A 4OV2A 2BBMA 2WCLA 3OX5A 1F4QA 1LA3A 1CLMA 3MSEB 5CSJA 3ZWHA 1AHRA 1YR5A 4WRIA 3LK0A 3PM2A 5GQQC 3C1VA 1GQMA 2KI6C 1XVJA 2L4IA 3KO0A 3N7HA 2PASA 2WORA 3CZ2A 3SG7A 1E8AA 1IRJA 1AJ4A 1W7JB 2GTEA 2P70A 2LMUA 3UNWA 3CYZA 1CKKA 4YGEB 4DS7A 4HRHA 1CM4A 3PN7B 1UHKA 3NSKA 1CFCA 1CFPA 3GK4X 3PFVA 1B8RA 3EKJA 1SMGA 4Q04A 2L2EA 4ZCUA 1CMFA 4XYNA 1B4CA 3CZTX 3ICBA 3BOWB 2MLFC 1CLLA 2OS8B 1B47A 2QEHA 2ZRSA 3NHIA 4PHJA 2NLNA 1M63B 1HQVA 1NUBA 3OB2B 1Y6WA 5ER5A 2LLTA 3VRQA 3HX4A 2KQYA 1XFRA 1RFJA 1F54A 2KNEA 5KSZA 1IKUA 4HSZA 4FQOA 5AERA 1SYMA 2P6BB 2EC6B 1YX7A 3PN7C 5I2OA 3O4XA 4YGCB 4F7FA 1KFUL 4P2YB 2PQLA 3K21A 1J1DA 3OBVA 4PCWA 3R1PA 4BY5A 1D1OA 1DQEA 2FOTA 4TNCA 1RJVA 2FJYA 3TS5B 2BL0C 1IQ3A 2JT8A 1YTZC 3BXKA 1ODBA 5HKYA 1C7WA 1DTLA 2ZKMX 3BUWB 1CTRA 2FCDA 3B7AA 2LE9B 1NIWA 5FYXA 2KAXA 2KI6D 1DC1A 1BMOA 1S26D 2MA2A 1BODA 2PRUA 1SL9A 1OSAA 2LV7A 1DJYA 1Y1UA 2KBMA 4YI8A 2JZIA 1RROA 2ERBA 3SJSA 5ER4X 4PDZA 5J3XA 2JPTA 2EC6C 2HETA 1M45A 3FE8A 4PE1A 4XJKB 1M39A 4YGBB 2LMVA 4MZLA 4JKTA 1KFUS 1DF0B 1OOGA 4ORAB 1RWYA 3F45A 3H4SE 1QIWA 1YRTB 4M2QA 1VRKA 3JTDC 1IQ5A 1QV1A 2M9GA 1SKTA 2GGMA 2LANA 3BQ3A 1WRLA 1J1EA 2KAVA 1K94A 2F2OA 3I5IB 2OPOA 4NQGA 4C0LA 4OCIA 1K93D 5HYDA 1OZOA 4ORBB 4DUQA 1NP8A 2K7BA 2FCEA 2O60A 2MLEC 2TN4A 3S0EA 1AP4A 1Z2CB 4C0JA 1QX5B 2OTGB 3VRNA 1QLKA 2LMTA 3OHMB 1KK7Z 3E3RA 4GAOA 2H2KA 1WLMA 4DCKA 1MWNA 2CCMA 1GGWA 2WCKA 3I5FB 1N65A 2K7CA 2KHNA 2WCEA 4INWA 4MBEA 2M7LA 1KWOB 3FWCA 3NHTA 2Y1MA 2EHBA 3FS7A 3FE6A 3IQQA 1A75B 4YRUA 1GGZA 2JOJA 4MLWA 2M8UA 2HQWA 2PMYA 1R6PA 3WNXB 1IIOA 1PALA 3I5IC 3DZTA 1TNQA 2WC8A 1NCXA 2V53A 3PALA 2KGRA 2HQ8A 2ZN9A 4L9MA 2BNXA 2KYFA 1A2XA 3B86A 5D69A 5HKZA 2HF5A 1SPYA 4HREE 1MXLC 3BUOB 4GBAA 2Y4QA 1DJHA 3I5FC 4MRXA 2KQ6A 5AEQA 1BLQA 3NGVA 1KWOC 1BU3A 2K8MB 5AANA 3CZ0A 1JC2A 2BBNA 3DVJA 4YGDB 3S0BA 2WOSA 2JWWA 2AMIA 3NSOA 2ZN8A 1KSMA 4N1GA 1LINA 1LVCD 1SNLA 3I5GB 4GNKB 3RZSA 2L2CA 3DVKA 1LXFC 2JC2A 2KYCA 1DVIA 2CT9A 4OVNF 1G8IA 1W7IB 3L4AA 4N5XA 3BUXB 2JT3A 2K60A 1WDCC 1SCMC 2NXQA 1UURA 1L7ZA 1PVBA 3RLZA 3CABA 4AQJA 1YUSA 1DJXA 3LL8B 4NDCA 1KQVA 1CDPA 1CM1A 1YX8A 3R1VA 3CWGA 2ZRTA 1AK8A 1JF0A 2H61C 2KOTA 4I5NB 1K95A 1QX7A 1WRKA 2ZNDA 4A4CA 3R1OA 1S6IA
chains in the Genus database with same CATH topology
2JTTA 1DGUA 1UP5A 3QRXA 1IJ6A 1KK7Y 2F3YA 2LVKA 5BPJA 3VROA 1PVAA 3AKAA 2H61A 1DT7B 2JULA 4E68A 1JUOA 1K96A 2Q91A 3SIAA 3SIBA 4I5KA 1NX1A 2AAOA 1N0YA 3I5HB 2BE4A 4YI9A 3LLEA 3O2PA 3EK8A 4OKHA 2KI4B 3D0YB 5KTYA 1S36A 3OX6A 1BT6A 1TNXA 4MZJA 1QXPA 4JPZB 2LUXA 1NCZA 1U5IB 1RECA 1A03A 1SBJA 4CLNA 1YVLA 1LKJA 3NXAA 3PLFB 1PSBA 1NX0A 1JFKA 2G9BA 2BKIB 2CBLA 1F71A 3LK1A 2KFFA 1QVIZ 2OS8C 1XFWO 1FI6A 4GGFC 3SG5A 1SW8A 4MRYA 1KQMB 3LCPC 1BJFA 2JRFA 2JTZA 4DIRA 1PK0D 2LVJA 1OE9B 1M46A 3BOWA 4GFTA 3O78A 1DJZA 2ISDA 2PSRA 1XFXO 1QATA 2KFHA 1OOJA 4PHNA 4GGFA 2F33A 5HLVA 2KDHA 2MBXA 1SL7A 1EXRA 2M1KB 3CGAA 3TS5C 4F0ZB 1EJ3A 5HLOA 1MF8B 4ORCB 2E30A 3HCMA 1H4BA 1MQ1A 1KQMC 1YUUA 2JQ6A 2K0JA 1JSAA 1XFYO 2K61A 3VRRA 1IG5A 1WRZA 2K7DA 5B8IB 3SG2A 1MR8A 1K9KA 2HPSA 2BCAA 1TCFA 5I2QA 2R2IA 1RTP1 1F70A 1V1GA 2LP3A 1JF2A 3CR4X 1M31A 1J7OA 4BY4A 4MN0A 1IGVA 2M97A 4XJKA 2Q4UA 2JNXA 2KBIA 1DF0A 1TRFA 2QACA 3DD4A 5HKWA 1NPQA 5JJGA 1ALWA 4N1FA 1BR1B 3VRPA 2M7NA 3CLNA 2KGBC 3TUYB 4R1EA 1DJWA 2OTGC 1C07A 1Y0VH 4UPGA 1C7VA 2JNFA 4M2OA 1KCYA 1RK9A 1UHIA 1TTXA 1YRUB 1S1EA 4CFRA 1QVIY 4QJ3B 1B8CA 2LHIA 2GGZA 1B7TZ 1F4OA 2L0PA 3AAJA 3O6BA 1K2HA 1HT9A 4PHKA 2D8NA 3PATA 4U8DA 3BUNB 3EVRA 1QJTA 5F6TA 5AXIA 3PSRA 4USLA 2K2AA 1TNPA 1G33A 3NSLA 2EGDA 3DVEA 2WCBA 1GJYA 2LUCA 1A75A 4QJ4B 1SR6B 1J55A 1SK6D 2CXJA 1PULA 3TDIA 2I94A 1L2OB 2JXCA 1XYDA 1QV0A 4OR9B 2JXLA 2KSPA 5KU1A 4M2PA 1IWQA 1XA5A 1S5GZ 3FIAA 1F55A 2CNPA 1UUSA 5PALA 2BECA 3SG4A 4DRWA 1FI5A 3KPXA 1SY9A 1CLBA 1QS7A 2L5XB 1EH2A 1KSOA 1YUTA 3A4UB 5CPVA 1MXEA 2LCPA 3I5GC 2F8PA 1ZMZA 3SG3A 2Y1NA 3GK1A 1WY9A 1KFXL 1S6JA 2M3WA 3DF0B 1B1GA 1SR6C 2LVIA 2K2FA 4IL1A 1L2OC 1R2UA 2I7AA 3TDUA 3KHEA 3A8RA 1ZOTB 1J7PA 3FWBA 1CDLA 2LLUA 4CFQA 5AFPA 1CNPA 1UHJA 1FF1A 2MHHA 2RGIA 1NWDA 4JWQA 2QPTA 1KK8B 2O5GA 2DOQA 1NX3A 1B8LA 1DJGA 3CR5X 1OZSA 3DVMA 4PE0A 1AUIB 1XFUO 2M29A 4PHMA 1QASA 3GK2A 1CDMA 1B9AA 5JOLA 1CB1A 2A4JA 2BL0B 3PM8A 1KFXS 4ZCVA 1SL8A 1TN4A 2Y5IA 1TCOB 4WQ2A 1Y1AA 1B7TY 2LM5A 5D7FA 1JWDA 1NSHA 3OP0A 2SCPA 2SASA 4YGAA 2FJUB 3D10A 1CMGA 3I5HC 1NCYA 1DMOA 2MAZA 2I18A 1YVHA 1BR4B 2KI4C 3KEVA 4NDBA 1A4PA 2LC5A 4QJ5B 1KK8C 2GV5A 3DF0A 1K9PA 1TIZA 3NSIA 2K7OA 4P5OE 1NX2A 3WHTB 1F8HA 2M1UA 1N2DA 3AKBA 4C0KA 3D0YA 1EG3A 5IBWA 2L4HA 3IF7A 3JVTB 3CR2A 4I5LB 3JTDB 4PE4A 1ZFSA 2VRGA 5K89A 1S5GY 1SCVA 2L98A 2MRDA 1U5IA 4YBHB 5DKRA 5DKQA 1XFVO 2KFGA 2L51A 5CSFA 1BG1A 4GUKA 4MEWA 1A29A 1NYAA 2LLSA 4PE7A 1LA0A 2AUCA 2M0RA 3EVVA 1DGVA 2NCPA 2NZ0A 3AAKA 3CTNA 4GGNA 4HRGA 1BOCA 4ICBA 1IJ5A 2WNDA 1AJ5A 1H8BA 1XFZO 3CS1A 1CFDA 1OMVA 1G4YR 2F3ZA 5CSNA 1MUXA 3M0WA 1Q80A 4CIDA 3VGOA 1PSRA 3JVTC 5TNCA 1ZACA 2LHLA 4WQ3A 2LP2A 2LVVA 3BUMB 2PVBA 4NDDA 4D1EA 4PALA 1S3PA 3BYAA 5DKNA 1CFFA 1K9UA 1S6CA 1K90D 1XK4C 1QLSA 2ZNEA 2BCXA 3TDZA 1ZUZA 2JT0A 2E6WA 1JBAA 4FTGA 2CTNA 1QTXA 1MHOA 5G08A 1FPWA 5I8NA 1XK4A 3TZ1A 3EK4A 3RM1A 2F2PA 4MZKA 1X02A 1YURA 1AVSA 1TOPA 1TNWA 2BE6A 2IS9A 3IQOA 3SG6A 3WXAA 4I5JA 1V1FA 4ETOA 1OQPA 1UWOA 2B1UA 1J7QA 1J7RA 4MVFA 3OB1B 2BCBA 3KF9A 2G2BA 1OMDA 1QIVA 1K8UA 1SRAA 2ZFDA 1PRWA 4GPLB 1Y1XA 2I2RE 4JQ0D 2L50A 1CDNA 3ZNIA 1XO5A 2JU0A 3TUYC 4AQIA 5I2LA 2COLB 1WLZA 3EVUA 1WDCB 1SCMB 1ALVA 1UHHA 3O4YA 4MSPA 2LNKA 1EG4A 2PALA 2BKHB 2NCOA 2LAPA 2MJWB 1IH0A 1FBVA 3GOFA 1JFJA 2KAYA 3WHUB 1BF5A 3EKHA 1QX2A 1DJIA 1UHNA 3EK7A 1EL4A 5CSIA 1FW4A 4CPVA 2WCFA 2M49B 4A4BA 4AOMA 1OMRA 4OV2A 2BBMA 3OX5A 1F4QA 1LA3A 1CLMA 3MSEB 5CSJA 3ZWHA 1AHRA 1YR5A 4WRIA 3LK0A 5GQQC 3C1VA 1GQMA 2KI6C 1XVJA 2L4IA 3KO0A 2PASA 2WORA 3SG7A 1E8AA 1IRJA 1AJ4A 1W7JB 2LMUA 1CKKA 4YGEB 4DS7A 4HRHA 1CM4A 3PN7B 1UHKA 3NSKA 1CFCA 1CFPA 3GK4X 3PFVA 1B8RA 3EKJA 1SMGA 4Q04A 2L2EA 4ZCUA 1CMFA 4XYNA 1B4CA 3CZTX 3ICBA 3BOWB 2MLFC 1CLLA 2OS8B 1B47A 2ZRSA 4PHJA 2NLNA 1M63B 1HQVA 1NUBA 3OB2B 1Y6WA 5ER5A 2LLTA 3VRQA 3HX4A 2KQYA 1RFJA 1F54A 2KNEA 5KSZA 1IKUA 4HSZA 4FQOA 5AERA 1SYMA 2P6BB 2EC6B 1YX7A 3PN7C 5I2OA 4YGCB 1KFUL 4P2YB 1D1OA 3K21A 1J1DA 4BY5A 4PCWA 2FOTA 4TNCA 1RJVA 3TS5B 1IQ3A 2BL0C 2JT8A 1YTZC 3BXKA 1ODBA 5HKYA 1C7WA 1DTLA 2ZKMX 3BUWB 1CTRA 2FCDA 2LE9B 1NIWA 5FYXA 2KAXA 2KI6D 1BMOA 1S26D 2MA2A 1BODA 2PRUA 1SL9A 1OSAA 2LV7A 1DJYA 1Y1UA 2KBMA 4YI8A 2JZIA 1RROA 3SJSA 5ER4X 4PDZA 5J3XA 2JPTA 2EC6C 2HETA 1M45A 4PE1A 4YGBB 4XJKB 1M39A 2LMVA 4MZLA 1KFUS 1DF0B 4ORAB 1RWYA 3F45A 3H4SE 1QIWA 1YRTB 4M2QA 1VRKA 3JTDC 1IQ5A 1QV1A 2M9GA 1SKTA 2GGMA 2LANA 3BQ3A 1WRLA 1J1EA 2KAVA 1K94A 2F2OA 3I5IB 2OPOA 4NQGA 4C0LA 4OCIA 1K93D 5HYDA 1OZOA 4ORBB 4DUQA 1NP8A 2K7BA 2FCEA 2O60A 2MLEC 2TN4A 1AP4A 4C0JA 1QX5B 2OTGB 3VRNA 1QLKA 2LMTA 3OHMB 1KK7Z 3E3RA 4GAOA 2H2KA 1WLMA 4DCKA 1MWNA 2CCMA 1GGWA 3I5FB 1N65A 2K7CA 2KHNA 2WCEA 4MBEA 2M7LA 1KWOB 3FWCA 2Y1MA 2EHBA 3FS7A 3IQQA 1A75B 4YRUA 1GGZA 2JOJA 4MLWA 2M8UA 2HQWA 2PMYA 1R6PA 3WNXB 1PALA 3I5IC 1TNQA 2WC8A 1NCXA 2V53A 3PALA 2KGRA 2HQ8A 2ZN9A 4L9MA 2KYFA 1A2XA 5D69A 5HKZA 2HF5A 1SPYA 4HREE 1MXLC 3BUOB 4GBAA 2Y4QA 1DJHA 3I5FC 4MRXA 2KQ6A 5AEQA 1BLQA 1KWOC 1BU3A 2K8MB 5AANA 1JC2A 2BBNA 3DVJA 4YGDB 2WOSA 2JWWA 2AMIA 3NSOA 2ZN8A 1KSMA 4N1GA 1LINA 1LVCD 1SNLA 3I5GB 4GNKB 3DVKA 1LXFC 2JC2A 2KYCA 1DVIA 2CT9A 4OVNF 1G8IA 1W7IB 4N5XA 3BUXB 2JT3A 1WDCC 1SCMC 2NXQA 1UURA 1L7ZA 1PVBA 3RLZA 4AQJA 1YUSA 1DJXA 3LL8B 4NDCA 1KQVA 1CDPA 1CM1A 1YX8A 3CWGA 2ZRTA 1AK8A 1JF0A 2H61C 2KOTA 4I5NB 1K95A 1QX7A 1WRKA 2ZNDA 4A4CA 1S6IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JTT A;  1DGU A;  1UP5 A;  3QRX A;  1IJ6 A;  1KK7 Y;  2F3Y A;  2LVK A;  5BPJ A;  3VRO A;  1PVA A;  3AKA A;  2H61 A;  1DT7 B;  2JUL A;  4E68 A;  1JUO A;  1K96 A;  2Q91 A;  3SIA A;  3SIB A;  4I5K A;  1NX1 A;  2AAO A;  1N0Y A;  3I5H B;  2BE4 A;  4YI9 A;  3LLE A;  3O2P A;  3EK8 A;  4OKH A;  2KI4 B;  3D0Y B;  5KTY A;  1S36 A;  3OX6 A;  1BT6 A;  1TNX A;  4MZJ A;  1QXP A;  4JPZ B;  2LUX A;  1NCZ A;  1U5I B;  1REC A;  1A03 A;  1SBJ A;  4CLN A;  1YVL A;  1LKJ A;  3NXA A;  3PLF B;  1PSB A;  1NX0 A;  1JFK A;  2G9B A;  2BKI B;  2CBL A;  1F71 A;  3LK1 A;  2KFF A;  1QVI Z;  2OS8 C;  1XFW O;  1FI6 A;  4GGF C;  3SG5 A;  1SW8 A;  4MRY A;  1KQM B;  3LCP C;  1BJF A;  2JRF A;  2JTZ A;  4DIR A;  1PK0 D;  2LVJ A;  1OE9 B;  1M46 A;  3BOW A;  4GFT A;  3O78 A;  1DJZ A;  2ISD A;  2PSR A;  1XFX O;  1QAT A;  2KFH A;  1OOJ A;  4PHN A;  4GGF A;  2F33 A;  5HLV A;  2KDH A;  2MBX A;  1SL7 A;  1EXR A;  2M1K B;  3CGA A;  3TS5 C;  4F0Z B;  1EJ3 A;  5HLO A;  1MF8 B;  4ORC B;  2E30 A;  3HCM A;  1H4B A;  1MQ1 A;  1KQM C;  1YUU A;  2JQ6 A;  2K0J A;  1JSA A;  1XFY O;  2K61 A;  3VRR A;  1IG5 A;  1WRZ A;  2K7D A;  5B8I B;  3SG2 A;  1MR8 A;  1K9K A;  2HPS A;  2BCA A;  1TCF A;  5I2Q A;  2R2I A;  1RTP 1;  1F70 A;  1V1G A;  2LP3 A;  1JF2 A;  3CR4 X;  1M31 A;  1J7O A;  4BY4 A;  4MN0 A;  1IGV A;  2M97 A;  4XJK A;  2Q4U A;  2JNX A;  2KBI A;  1DF0 A;  1TRF A;  2QAC A;  3DD4 A;  5HKW A;  1NPQ A;  5JJG A;  1ALW A;  4N1F A;  1BR1 B;  3VRP A;  2M7N A;  3CLN A;  2KGB C;  3TUY B;  4R1E A;  1DJW A;  2OTG C;  1C07 A;  1Y0V H;  4UPG A;  1C7V A;  2JNF A;  4M2O A;  1KCY A;  1RK9 A;  1UHI A;  1TTX A;  1YRU B;  1S1E A;  4CFR A;  1QVI Y;  4QJ3 B;  1B8C A;  2LHI A;  2GGZ A;  1B7T Z;  1F4O A;  2L0P A;  3AAJ A;  3O6B A;  1K2H A;  1HT9 A;  4PHK A;  2D8N A;  3PAT A;  4U8D A;  3BUN B;  3EVR A;  1QJT A;  5F6T A;  5AXI A;  3PSR A;  4USL A;  2K2A A;  1TNP A;  1G33 A;  3NSL A;  2EGD A;  3DVE A;  2WCB A;  1GJY A;  2LUC A;  1A75 A;  4QJ4 B;  1SR6 B;  1J55 A;  1SK6 D;  2CXJ A;  1PUL A;  3TDI A;  2I94 A;  1L2O B;  2JXC A;  1XYD A;  1QV0 A;  4OR9 B;  2JXL A;  2KSP A;  5KU1 A;  4M2P A;  1IWQ A;  1XA5 A;  1S5G Z;  3FIA A;  1F55 A;  2CNP A;  1UUS A;  5PAL A;  2BEC A;  3SG4 A;  4DRW A;  1FI5 A;  3KPX A;  1SY9 A;  1CLB A;  1QS7 A;  2L5X B;  1EH2 A;  1KSO A;  1YUT A;  3A4U B;  5CPV A;  1MXE A;  2LCP A;  3I5G C;  2F8P A;  1ZMZ A;  3SG3 A;  2Y1N A;  3GK1 A;  1WY9 A;  1KFX L;  1S6J A;  2M3W A;  3DF0 B;  1B1G A;  1SR6 C;  2LVI A;  2K2F A;  4IL1 A;  1L2O C;  1R2U A;  2I7A A;  3TDU A;  3KHE A;  3A8R A;  1ZOT B;  1J7P A;  3FWB A;  1CDL A;  2LLU A;  4CFQ A;  5AFP A;  1CNP A;  1UHJ A;  1FF1 A;  2MHH A;  2RGI A;  1NWD A;  4JWQ A;  2QPT A;  1KK8 B;  2O5G A;  2DOQ A;  1NX3 A;  1B8L A;  1DJG A;  3CR5 X;  1OZS A;  3DVM A;  4PE0 A;  1AUI B;  1XFU O;  2M29 A;  4PHM A;  1QAS A;  3GK2 A;  1CDM A;  1B9A A;  5JOL A;  1CB1 A;  2A4J A;  2BL0 B;  3PM8 A;  1KFX S;  4ZCV A;  1SL8 A;  1TN4 A;  2Y5I A;  1TCO B;  4WQ2 A;  1Y1A A;  1B7T Y;  2LM5 A;  5D7F A;  1JWD A;  1NSH A;  3OP0 A;  2SCP A;  2SAS A;  4YGA A;  2FJU B;  3D10 A;  1CMG A;  3I5H C;  1NCY A;  1DMO A;  2MAZ A;  2I18 A;  1YVH A;  1BR4 B;  2KI4 C;  3KEV A;  4NDB A;  1A4P A;  2LC5 A;  4QJ5 B;  1KK8 C;  2GV5 A;  3DF0 A;  1K9P A;  1TIZ A;  3NSI A;  2K7O A;  4P5O E;  1NX2 A;  3WHT B;  1F8H A;  2M1U A;  1N2D A;  3AKB A;  4C0K A;  3D0Y A;  1EG3 A;  5IBW A;  2L4H A;  3IF7 A;  3JVT B;  3CR2 A;  4I5L B;  3JTD B;  4PE4 A;  1ZFS A;  2VRG A;  5K89 A;  1S5G Y;  1SCV A;  2L98 A;  2MRD A;  1U5I A;  4YBH B;  5DKR A;  5DKQ A;  1XFV O;  2KFG A;  2L51 A;  5CSF A;  1BG1 A;  4GUK A;  4MEW A;  1A29 A;  1NYA A;  2LLS A;  4PE7 A;  1LA0 A;  2AUC A;  2M0R A;  3EVV A;  1DGV A;  2NCP A;  2NZ0 A;  3AAK A;  3CTN A;  4GGN A;  4HRG A;  1BOC A;  4ICB A;  1IJ5 A;  2WND A;  1AJ5 A;  1H8B A;  1XFZ O;  3CS1 A;  1CFD A;  1OMV A;  1G4Y R;  2F3Z A;  5CSN A;  1MUX A;  3M0W A;  1Q80 A;  4CID A;  3VGO A;  1PSR A;  3JVT C;  5TNC A;  1ZAC A;  2LHL A;  4WQ3 A;  2LP2 A;  2LVV A;  3BUM B;  2PVB A;  4NDD A;  4D1E A;  4PAL A;  1S3P A;  3BYA A;  5DKN A;  1CFF A;  1K9U A;  1S6C A;  1K90 D;  1XK4 C;  1QLS A;  2ZNE A;  2BCX A;  3TDZ A;  1ZUZ A;  2JT0 A;  2E6W A;  1JBA A;  4FTG A;  2CTN A;  1QTX A;  1MHO A;  5G08 A;  1FPW A;  5I8N A;  1XK4 A;  3TZ1 A;  3EK4 A;  3RM1 A;  2F2P A;  4MZK A;  1X02 A;  1YUR A;  1AVS A;  1TOP A;  1TNW A;  2BE6 A;  2IS9 A;  3IQO A;  3SG6 A;  3WXA A;  4I5J A;  1V1F A;  4ETO A;  1OQP A;  1UWO A;  2B1U A;  1J7Q A;  1J7R A;  4MVF A;  3OB1 B;  2BCB A;  3KF9 A;  2G2B A;  1OMD A;  1QIV A;  1K8U A;  1SRA A;  2ZFD A;  1PRW A;  4GPL B;  1Y1X A;  2I2R E;  4JQ0 D;  2L50 A;  1CDN A;  3ZNI A;  1XO5 A;  2JU0 A;  3TUY C;  4AQI A;  5I2L A;  2COL B;  1WLZ A;  3EVU A;  1WDC B;  1SCM B;  1ALV A;  1UHH A;  3O4Y A;  4MSP A;  2LNK A;  1EG4 A;  2PAL A;  2BKH B;  2NCO A;  2LAP A;  2MJW B;  1IH0 A;  1FBV A;  3GOF A;  1JFJ A;  2KAY A;  3WHU B;  1BF5 A;  3EKH A;  1QX2 A;  1DJI A;  1UHN A;  3EK7 A;  1EL4 A;  5CSI A;  1FW4 A;  4CPV A;  2WCF A;  2M49 B;  4A4B A;  4AOM A;  1OMR A;  4OV2 A;  2BBM A;  3OX5 A;  1F4Q A;  1LA3 A;  1CLM A;  3MSE B;  5CSJ A;  3ZWH A;  1AHR A;  1YR5 A;  4WRI A;  3LK0 A;  5GQQ C;  3C1V A;  1GQM A;  2KI6 C;  1XVJ A;  2L4I A;  3KO0 A;  2PAS A;  2WOR A;  3SG7 A;  1E8A A;  1IRJ A;  1AJ4 A;  1W7J B;  2LMU A;  1CKK A;  4YGE B;  4DS7 A;  4HRH A;  1CM4 A;  3PN7 B;  1UHK A;  3NSK A;  1CFC A;  1CFP A;  3GK4 X;  3PFV A;  1B8R A;  3EKJ A;  1SMG A;  4Q04 A;  2L2E A;  4ZCU A;  1CMF A;  4XYN A;  1B4C A;  3CZT X;  3ICB A;  3BOW B;  2MLF C;  1CLL A;  2OS8 B;  1B47 A;  2ZRS A;  4PHJ A;  2NLN A;  1M63 B;  1HQV A;  1NUB A;  3OB2 B;  1Y6W A;  5ER5 A;  2LLT A;  3VRQ A;  3HX4 A;  2KQY A;  1RFJ A;  1F54 A;  2KNE A;  5KSZ A;  1IKU A;  4HSZ A;  4FQO A;  5AER A;  1SYM A;  2P6B B;  2EC6 B;  1YX7 A;  3PN7 C;  5I2O A;  4YGC B;  1KFU L;  4P2Y B;  1D1O A;  3K21 A;  1J1D A;  4BY5 A;  4PCW A;  2FOT A;  4TNC A;  1RJV A;  3TS5 B;  1IQ3 A;  2BL0 C;  2JT8 A;  1YTZ C;  3BXK A;  1ODB A;  5HKY A;  1C7W A;  1DTL A;  2ZKM X;  3BUW B;  1CTR A;  2FCD A;  2LE9 B;  1NIW A;  5FYX A;  2KAX A;  2KI6 D;  1BMO A;  1S26 D;  2MA2 A;  1BOD A;  2PRU A;  1SL9 A;  1OSA A;  2LV7 A;  1DJY A;  1Y1U A;  2KBM A;  4YI8 A;  2JZI A;  1RRO A;  3SJS A;  5ER4 X;  4PDZ A;  5J3X A;  2JPT A;  2EC6 C;  2HET A;  1M45 A;  4PE1 A;  4YGB B;  4XJK B;  1M39 A;  2LMV A;  4MZL A;  1KFU S;  1DF0 B;  4ORA B;  1RWY A;  3F45 A;  3H4S E;  1QIW A;  1YRT B;  4M2Q A;  1VRK A;  3JTD C;  1IQ5 A;  1QV1 A;  2M9G A;  1SKT A;  2GGM A;  2LAN A;  3BQ3 A;  1WRL A;  1J1E A;  2KAV A;  1K94 A;  2F2O A;  3I5I B;  2OPO A;  4NQG A;  4C0L A;  4OCI A;  1K93 D;  5HYD A;  1OZO A;  4ORB B;  4DUQ A;  1NP8 A;  2K7B A;  2FCE A;  2O60 A;  2MLE C;  2TN4 A;  1AP4 A;  4C0J A;  1QX5 B;  2OTG B;  3VRN A;  1QLK A;  2LMT A;  3OHM B;  1KK7 Z;  3E3R A;  4GAO A;  2H2K A;  1WLM A;  4DCK A;  1MWN A;  2CCM A;  1GGW A;  3I5F B;  1N65 A;  2K7C A;  2KHN A;  2WCE A;  4MBE A;  2M7L A;  1KWO B;  3FWC A;  2Y1M A;  2EHB A;  3FS7 A;  3IQQ A;  1A75 B;  4YRU A;  1GGZ A;  2JOJ A;  4MLW A;  2M8U A;  2HQW A;  2PMY A;  1R6P A;  3WNX B;  1PAL A;  3I5I C;  1TNQ A;  2WC8 A;  1NCX A;  2V53 A;  3PAL A;  2KGR A;  2HQ8 A;  2ZN9 A;  4L9M A;  2KYF A;  1A2X A;  5D69 A;  5HKZ A;  2HF5 A;  1SPY A;  4HRE E;  1MXL C;  3BUO B;  4GBA A;  2Y4Q A;  1DJH A;  3I5F C;  4MRX A;  2KQ6 A;  5AEQ A;  1BLQ A;  1KWO C;  1BU3 A;  2K8M B;  5AAN A;  1JC2 A;  2BBN A;  3DVJ A;  4YGD B;  2WOS A;  2JWW A;  2AMI A;  3NSO A;  2ZN8 A;  1KSM A;  4N1G A;  1LIN A;  1LVC D;  1SNL A;  3I5G B;  4GNK B;  3DVK A;  1LXF C;  2JC2 A;  2KYC A;  1DVI A;  2CT9 A;  4OVN F;  1G8I A;  1W7I B;  4N5X A;  3BUX B;  2JT3 A;  1WDC C;  1SCM C;  2NXQ A;  1UUR A;  1L7Z A;  1PVB A;  3RLZ A;  4AQJ A;  1YUS A;  1DJX A;  3LL8 B;  4NDC A;  1KQV A;  1CDP A;  1CM1 A;  1YX8 A;  3CWG A;  2ZRT A;  1AK8 A;  1JF0 A;  2H61 C;  2KOT A;  4I5N B;  1K95 A;  1QX7 A;  1WRK A;  2ZND A;  4A4C A;  1S6I A; 
#chains in the Genus database with same CATH topology
 2JTT A;  1DGU A;  1UP5 A;  3QRX A;  1IJ6 A;  1KK7 Y;  2F3Y A;  2LVK A;  5BPJ A;  3VRO A;  1PVA A;  2QEB A;  3AKA A;  2H61 A;  3DYE A;  2JUL A;  4E68 A;  1DT7 B;  1JUO A;  1K96 A;  2Q91 A;  3SIA A;  3SIB A;  3R72 A;  4I5K A;  1C3Z A;  1NX1 A;  2AAO A;  1N0Y A;  3I5H B;  2BE4 A;  4YI9 A;  3LLE A;  3O2P A;  3EK8 A;  4OKH A;  2KI4 B;  3D0Y B;  5KTY A;  1S36 A;  3OX6 A;  1BOC A;  1BT6 A;  1TNX A;  2PYQ A;  3K1E A;  4MZJ A;  2H8V A;  1QXP A;  4JPZ B;  2LUX A;  1NCZ A;  1U5I B;  1REC A;  1A03 A;  1SBJ A;  4CLN A;  1YVL A;  4FQT A;  1LKJ A;  3NXA A;  3PLF B;  1PSB A;  1NX0 A;  1JFK A;  2G9B A;  2BKI B;  2CBL A;  1F71 A;  3D76 A;  3LK1 A;  1GM0 A;  2KFF A;  1QVI Z;  2OS8 C;  1XFW O;  1FI6 A;  4GGF C;  3SG5 A;  1SW8 A;  4MRY A;  1KQM B;  3BFH A;  3LCP C;  1BJF A;  2JRF A;  2QDI A;  1TUJ A;  2JTZ A;  4DIR A;  2KLD A;  1PK0 D;  4INX A;  2LVJ A;  1OE9 B;  1M46 A;  3BOW A;  4GFT A;  3O78 A;  1DJZ A;  2ISD A;  2PSR A;  1XFX O;  1QAT A;  2KFH A;  1OOJ A;  4PHN A;  4GGF A;  2F33 A;  5HLV A;  2KDH A;  2MBX A;  1SL7 A;  1EXR A;  2M1K B;  3CGA A;  3TS5 C;  4F0Z B;  1EJ3 A;  5HLO A;  3B6X A;  1MF8 B;  2QEV A;  4ORC B;  2E30 A;  3HCM A;  1H4B A;  1MQ1 A;  1KQM C;  1YUU A;  2JQ6 A;  2K0J A;  1JSA A;  1XFY O;  1TUZ A;  2K61 A;  3D78 A;  3VRR A;  1C3Y A;  3UO9 A;  1IG5 A;  1WRZ A;  2K7D A;  3Q8I A;  5B8I B;  3SG2 A;  1MR8 A;  3L47 A;  1OOH A;  5FI7 A;  1K9K A;  2HPS A;  2BCA A;  1TCF A;  5I2Q A;  2R2I A;  1RTP 1;  1F70 A;  1TWO A;  1V1G A;  2LP3 A;  2WCH A;  5D3O A;  4IJ7 A;  1JF2 A;  3CR4 X;  1M31 A;  1J7O A;  4BY4 A;  4MN0 A;  1IGV A;  2M97 A;  4XJK A;  2Q4U A;  2JNX A;  2KBI A;  3S0A A;  1DF0 A;  1TRF A;  2QAC A;  3DD4 A;  4KYN A;  5HKW A;  1NPQ A;  5JJG A;  1ALW A;  4N1F A;  1BR1 B;  3VRP A;  2M7N A;  3CLN A;  2KGB C;  3TUY B;  4R1E A;  1DJW A;  2OTG C;  1C07 A;  1Y0V H;  1OOF A;  4UPG A;  1C7V A;  2JNF A;  4M2O A;  1KCY A;  1RK9 A;  1UHI A;  1TTX A;  1YRU B;  1S1E A;  4CFR A;  1QVI Y;  4QJ3 B;  1B8C A;  4PT1 A;  2LHI A;  2GGZ A;  2JPO A;  1B7T Z;  1F4O A;  2L0P A;  3AAJ A;  3O6B A;  1K2H A;  1HT9 A;  4PHK A;  2D8N A;  3PAT A;  4U8D A;  2KPH A;  3BUN B;  3EVR A;  1QJT A;  5F6T A;  5AXI A;  3PSR A;  4USL A;  2K2A A;  1TNP A;  1G33 A;  3NSL A;  2EGD A;  3DVE A;  2WCB A;  1GJY A;  2LUC A;  1A75 A;  4QJ4 B;  5FI2 A;  1SR6 B;  1J55 A;  1SK6 D;  2CXJ A;  1PUL A;  3TDI A;  2I94 A;  1L2O B;  2JXC A;  1XYD A;  1QV0 A;  2BAP A;  3L4L A;  4OR9 B;  1DEL A;  2JXL A;  2KSP A;  5KU1 A;  4M2P A;  1IWQ A;  3OGN A;  1XA5 A;  3QME A;  1S5G Z;  3FIA A;  1F55 A;  2CNP A;  1OW4 A;  1UUS A;  3CZ1 A;  5PAL A;  2BEC A;  3SG4 A;  4DRW A;  2P71 A;  1FI5 A;  3KPX A;  1SY9 A;  2WCM A;  1QS7 A;  2L5X B;  1CLB A;  1EH2 A;  1KSO A;  1YUT A;  3A4U B;  3D74 A;  5CPV A;  1MXE A;  2LCP A;  3I5G C;  3BJH A;  2F8P A;  1ORG A;  1ZMZ A;  3SG3 A;  1LS8 A;  3VB1 A;  2Y1N A;  3GK1 A;  1WY9 A;  1KFX L;  1S6J A;  2M3W A;  3DF0 B;  3EG5 B;  1SR6 C;  1B1G A;  2LVI A;  2K2F A;  4IL1 A;  1L2O C;  2WC5 A;  1R2U A;  2I7A A;  3TDU A;  3KHE A;  3A8R A;  1ZOT B;  1J7P A;  3FWB A;  1CDL A;  2LLU A;  4CFQ A;  5AFP A;  1CNP A;  1UHJ A;  1FF1 A;  2MHH A;  2RGI A;  1NWD A;  4JWQ A;  2QPT A;  1KK8 B;  2O5G A;  2DOQ A;  3V2L A;  1NX3 A;  1B8L A;  1DJG A;  5EL2 A;  3CR5 X;  1OZS A;  3DVM A;  4PE0 A;  1AUI B;  1XFU O;  2M29 A;  3PJI A;  4PHM A;  1QAS A;  4JD9 A;  3GK2 A;  1CDM A;  1B9A A;  5JOL A;  1CB1 A;  2A4J A;  2BL0 B;  3PM8 A;  1KFX S;  4ZCV A;  1SL8 A;  1TN4 A;  2Y5I A;  1TCO B;  4WQ2 A;  1Y1A A;  1B7T Y;  2LM5 A;  2QEO A;  4OZD A;  5D7F A;  1NSH A;  1JWD A;  3OP0 A;  2SCP A;  2SAS A;  4YGA A;  2FJU B;  3D10 A;  3SS3 A;  3I5H C;  1NCY A;  1CMG A;  2MAZ A;  2I18 A;  1DMO A;  1YVH A;  1BR4 B;  2KI4 C;  3B87 A;  3BFA A;  3KEV A;  4NDB A;  1A4P A;  2LC5 A;  4QJ5 B;  1KK8 C;  2GV5 A;  3DF0 A;  1K9P A;  3FE9 A;  1TIZ A;  5I94 A;  3NSI A;  2K7O A;  4P5O E;  1NX2 A;  3WHT B;  1F8H A;  2M1U A;  1N2D A;  3AKB A;  5DIC A;  3D0Y A;  1EG3 A;  4C0K A;  5IBW A;  2L4H A;  3IF7 A;  3JVT B;  3CR2 A;  4I5L B;  3JTD B;  4PE4 A;  1ZFS A;  2VRG A;  5K89 A;  1S5G Y;  1SCV A;  2L98 A;  2MRD A;  1U5I A;  4YBH B;  5DKR A;  3S0D A;  5DKQ A;  1QWV A;  1XFV O;  2KFG A;  2L51 A;  5CSF A;  1BG1 A;  4GUK A;  1SSE B;  4MEW A;  1A29 A;  1NYA A;  2LLS A;  4PE7 A;  1LA0 A;  2AUC A;  2M0R A;  3EVV A;  1DGV A;  2NCP A;  2NZ0 A;  3AAK A;  3CTN A;  4GGN A;  2L5Y A;  4HRG A;  4ICB A;  1IJ5 A;  2WND A;  1AJ5 A;  1H8B A;  1XFZ O;  3CS1 A;  5HL1 A;  1CFD A;  1OMV A;  3SS5 A;  1G4Y R;  2F3Z A;  5CSN A;  1MUX A;  3M0W A;  1Q80 A;  4CID A;  3VGO A;  1PSR A;  3JVT C;  5TNC A;  1ZAC A;  2LHL A;  4WQ3 A;  2LP2 A;  2LVV A;  3BUM B;  2PVB A;  4NDD A;  4D1E A;  1W9Z A;  4PAL A;  1S3P A;  3BYA A;  5DKN A;  1CFF A;  2WCJ A;  1K9U A;  1Z4H A;  1S6C A;  1K90 D;  1XK4 C;  3IVT A;  1QLS A;  3DXL A;  2ZNE A;  2BCX A;  3TDZ A;  2WC6 A;  1ZUZ A;  2JT0 A;  2E6W A;  1JBA A;  1T14 A;  4FTG A;  1DEK A;  2CTN A;  1QTX A;  1MHO A;  5G08 A;  3S0F A;  1FPW A;  5I8N A;  1OOI X;  3DY9 A;  1XK4 A;  3D75 A;  3TZ1 A;  3EK4 A;  3RM1 A;  2F2P A;  4MZK A;  1X02 A;  1YUR A;  1AVS A;  1TOP A;  1TNW A;  2BE6 A;  2IS9 A;  3IQO A;  3SG6 A;  3WXA A;  4I5J A;  3CDN A;  1V1F A;  4ETO A;  1OQP A;  1UWO A;  2B1U A;  1J7Q A;  1J7R A;  4MVF A;  3OB1 B;  2BCB A;  3KF9 A;  2G2B A;  1OMD A;  1QIV A;  1K8U A;  1SRA A;  2ZFD A;  1PRW A;  4GPL B;  1Y1X A;  2I2R E;  1P28 A;  4JQ0 D;  2KLE A;  2L50 A;  3D77 A;  1CDN A;  3ZNI A;  1XO5 A;  2JU0 A;  3SS4 A;  3B88 A;  3TUY C;  4AQI A;  3BFB A;  5I2L A;  2COL B;  3S0G A;  1WLZ A;  3EVU A;  1WDC B;  1SCM B;  1ALV A;  1UHH A;  3O4Y A;  4MSP A;  2LNK A;  1EG4 A;  2YGU A;  2PAL A;  2BKH B;  2NCO A;  2LAP A;  2MJW B;  1IH0 A;  1FBV A;  3GOF A;  1JFJ A;  2KAY A;  3WHU B;  1BF5 A;  3EKH A;  1QX2 A;  1DJI A;  1UHN A;  3D73 A;  1EL4 A;  3EK7 A;  1FW4 A;  5CSI A;  4CPV A;  2WCF A;  2M49 B;  4A4B A;  4AOM A;  1OMR A;  5FI6 A;  4OV2 A;  2BBM A;  2WCL A;  3OX5 A;  1F4Q A;  1LA3 A;  1CLM A;  3MSE B;  5CSJ A;  3ZWH A;  1AHR A;  1YR5 A;  4WRI A;  3LK0 A;  3PM2 A;  5GQQ C;  3C1V A;  1GQM A;  2KI6 C;  1XVJ A;  2L4I A;  3KO0 A;  3N7H A;  2PAS A;  2WOR A;  3CZ2 A;  3SG7 A;  1E8A A;  1IRJ A;  1AJ4 A;  1W7J B;  2GTE A;  2P70 A;  2LMU A;  3UNW A;  3CYZ A;  1CKK A;  4YGE B;  4DS7 A;  4HRH A;  1CM4 A;  3PN7 B;  1UHK A;  3NSK A;  1CFC A;  1CFP A;  3GK4 X;  3PFV A;  1B8R A;  3EKJ A;  1SMG A;  4Q04 A;  2L2E A;  4ZCU A;  1CMF A;  4XYN A;  1B4C A;  3CZT X;  3ICB A;  3BOW B;  2MLF C;  1CLL A;  2OS8 B;  1B47 A;  2QEH A;  2ZRS A;  3NHI A;  4PHJ A;  2NLN A;  1M63 B;  1HQV A;  1NUB A;  3OB2 B;  1Y6W A;  5ER5 A;  2LLT A;  3VRQ A;  3HX4 A;  2KQY A;  1XFR A;  1RFJ A;  1F54 A;  2KNE A;  5KSZ A;  1IKU A;  4HSZ A;  4FQO A;  5AER A;  1SYM A;  2P6B B;  2EC6 B;  1YX7 A;  3PN7 C;  5I2O A;  3O4X A;  4YGC B;  4F7F A;  1KFU L;  4P2Y B;  2PQL A;  3K21 A;  1J1D A;  3OBV A;  4PCW A;  3R1P A;  4BY5 A;  1D1O A;  1DQE A;  2FOT A;  4TNC A;  1RJV A;  2FJY A;  3TS5 B;  2BL0 C;  1IQ3 A;  2JT8 A;  1YTZ C;  3BXK A;  1ODB A;  5HKY A;  1C7W A;  1DTL A;  2ZKM X;  3BUW B;  1CTR A;  2FCD A;  3B7A A;  2LE9 B;  1NIW A;  5FYX A;  2KAX A;  2KI6 D;  1DC1 A;  1BMO A;  1S26 D;  2MA2 A;  1BOD A;  2PRU A;  1SL9 A;  1OSA A;  2LV7 A;  1DJY A;  1Y1U A;  2KBM A;  4YI8 A;  2JZI A;  1RRO A;  2ERB A;  3SJS A;  5ER4 X;  4PDZ A;  5J3X A;  2JPT A;  2EC6 C;  2HET A;  1M45 A;  3FE8 A;  4PE1 A;  4XJK B;  1M39 A;  4YGB B;  2LMV A;  4MZL A;  4JKT A;  1KFU S;  1DF0 B;  1OOG A;  4ORA B;  1RWY A;  3F45 A;  3H4S E;  1QIW A;  1YRT B;  4M2Q A;  1VRK A;  3JTD C;  1IQ5 A;  1QV1 A;  2M9G A;  1SKT A;  2GGM A;  2LAN A;  3BQ3 A;  1WRL A;  1J1E A;  2KAV A;  1K94 A;  2F2O A;  3I5I B;  2OPO A;  4NQG A;  4C0L A;  4OCI A;  1K93 D;  5HYD A;  1OZO A;  4ORB B;  4DUQ A;  1NP8 A;  2K7B A;  2FCE A;  2O60 A;  2MLE C;  2TN4 A;  3S0E A;  1AP4 A;  1Z2C B;  4C0J A;  1QX5 B;  2OTG B;  3VRN A;  1QLK A;  2LMT A;  3OHM B;  1KK7 Z;  3E3R A;  4GAO A;  2H2K A;  1WLM A;  4DCK A;  1MWN A;  2CCM A;  1GGW A;  2WCK A;  3I5F B;  1N65 A;  2K7C A;  2KHN A;  2WCE A;  4INW A;  4MBE A;  2M7L A;  1KWO B;  3FWC A;  3NHT A;  2Y1M A;  2EHB A;  3FS7 A;  3FE6 A;  3IQQ A;  1A75 B;  4YRU A;  1GGZ A;  2JOJ A;  4MLW A;  2M8U A;  2HQW A;  2PMY A;  1R6P A;  3WNX B;  1IIO A;  1PAL A;  3I5I C;  3DZT A;  1TNQ A;  2WC8 A;  1NCX A;  2V53 A;  3PAL A;  2KGR A;  2HQ8 A;  2ZN9 A;  4L9M A;  2BNX A;  2KYF A;  1A2X A;  3B86 A;  5D69 A;  5HKZ A;  2HF5 A;  1SPY A;  4HRE E;  1MXL C;  3BUO B;  4GBA A;  2Y4Q A;  1DJH A;  3I5F C;  4MRX A;  2KQ6 A;  5AEQ A;  1BLQ A;  3NGV A;  1KWO C;  1BU3 A;  2K8M B;  5AAN A;  3CZ0 A;  1JC2 A;  2BBN A;  3DVJ A;  4YGD B;  3S0B A;  2WOS A;  2JWW A;  2AMI A;  3NSO A;  2ZN8 A;  1KSM A;  4N1G A;  1LIN A;  1LVC D;  1SNL A;  3I5G B;  4GNK B;  3RZS A;  2L2C A;  3DVK A;  1LXF C;  2JC2 A;  2KYC A;  1DVI A;  2CT9 A;  4OVN F;  1G8I A;  1W7I B;  3L4A A;  4N5X A;  3BUX B;  2JT3 A;  2K60 A;  1WDC C;  1SCM C;  2NXQ A;  1UUR A;  1L7Z A;  1PVB A;  3RLZ A;  3CAB A;  4AQJ A;  1YUS A;  1DJX A;  3LL8 B;  4NDC A;  1KQV A;  1CDP A;  1CM1 A;  1YX8 A;  3R1V A;  3CWG A;  2ZRT A;  1AK8 A;  1JF0 A;  2H61 C;  2KOT A;  4I5N B;  1K95 A;  1QX7 A;  1WRK A;  2ZND A;  4A4C A;  3R1O A;  1S6I A; 
#chains in the Genus database with same CATH homology
 2JTT A;  1DGU A;  1UP5 A;  3QRX A;  1IJ6 A;  1KK7 Y;  2F3Y A;  2LVK A;  5BPJ A;  3VRO A;  1PVA A;  3AKA A;  2H61 A;  1DT7 B;  2JUL A;  4E68 A;  1JUO A;  1K96 A;  2Q91 A;  3SIA A;  3SIB A;  4I5K A;  1NX1 A;  2AAO A;  1N0Y A;  3I5H B;  2BE4 A;  4YI9 A;  3LLE A;  3O2P A;  3EK8 A;  4OKH A;  2KI4 B;  3D0Y B;  5KTY A;  1S36 A;  3OX6 A;  1BT6 A;  1TNX A;  4MZJ A;  1QXP A;  4JPZ B;  2LUX A;  1NCZ A;  1U5I B;  1REC A;  1A03 A;  1SBJ A;  4CLN A;  1YVL A;  1LKJ A;  3NXA A;  3PLF B;  1PSB A;  1NX0 A;  1JFK A;  2G9B A;  2BKI B;  2CBL A;  1F71 A;  3LK1 A;  2KFF A;  1QVI Z;  2OS8 C;  1XFW O;  1FI6 A;  4GGF C;  3SG5 A;  1SW8 A;  4MRY A;  1KQM B;  3LCP C;  1BJF A;  2JRF A;  2JTZ A;  4DIR A;  1PK0 D;  2LVJ A;  1OE9 B;  1M46 A;  3BOW A;  4GFT A;  3O78 A;  1DJZ A;  2ISD A;  2PSR A;  1XFX O;  1QAT A;  2KFH A;  1OOJ A;  4PHN A;  4GGF A;  2F33 A;  5HLV A;  2KDH A;  2MBX A;  1SL7 A;  1EXR A;  2M1K B;  3CGA A;  3TS5 C;  4F0Z B;  1EJ3 A;  5HLO A;  1MF8 B;  4ORC B;  2E30 A;  3HCM A;  1H4B A;  1MQ1 A;  1KQM C;  1YUU A;  2JQ6 A;  2K0J A;  1JSA A;  1XFY O;  2K61 A;  3VRR A;  1IG5 A;  1WRZ A;  2K7D A;  5B8I B;  3SG2 A;  1MR8 A;  1K9K A;  2HPS A;  2BCA A;  1TCF A;  5I2Q A;  2R2I A;  1RTP 1;  1F70 A;  1V1G A;  2LP3 A;  1JF2 A;  3CR4 X;  1M31 A;  1J7O A;  4BY4 A;  4MN0 A;  1IGV A;  2M97 A;  4XJK A;  2Q4U A;  2JNX A;  2KBI A;  1DF0 A;  1TRF A;  2QAC A;  3DD4 A;  5HKW A;  1NPQ A;  5JJG A;  1ALW A;  4N1F A;  1BR1 B;  3VRP A;  2M7N A;  3CLN A;  2KGB C;  3TUY B;  4R1E A;  1DJW A;  2OTG C;  1C07 A;  1Y0V H;  4UPG A;  1C7V A;  2JNF A;  4M2O A;  1KCY A;  1RK9 A;  1UHI A;  1TTX A;  1YRU B;  1S1E A;  4CFR A;  1QVI Y;  4QJ3 B;  1B8C A;  2LHI A;  2GGZ A;  1B7T Z;  1F4O A;  2L0P A;  3AAJ A;  3O6B A;  1K2H A;  1HT9 A;  4PHK A;  2D8N A;  3PAT A;  4U8D A;  3BUN B;  3EVR A;  1QJT A;  5F6T A;  5AXI A;  3PSR A;  4USL A;  2K2A A;  1TNP A;  1G33 A;  3NSL A;  2EGD A;  3DVE A;  2WCB A;  1GJY A;  2LUC A;  1A75 A;  4QJ4 B;  1SR6 B;  1J55 A;  1SK6 D;  2CXJ A;  1PUL A;  3TDI A;  2I94 A;  1L2O B;  2JXC A;  1XYD A;  1QV0 A;  4OR9 B;  2JXL A;  2KSP A;  5KU1 A;  4M2P A;  1IWQ A;  1XA5 A;  1S5G Z;  3FIA A;  1F55 A;  2CNP A;  1UUS A;  5PAL A;  2BEC A;  3SG4 A;  4DRW A;  1FI5 A;  3KPX A;  1SY9 A;  1CLB A;  1QS7 A;  2L5X B;  1EH2 A;  1KSO A;  1YUT A;  3A4U B;  5CPV A;  1MXE A;  2LCP A;  3I5G C;  2F8P A;  1ZMZ A;  3SG3 A;  2Y1N A;  3GK1 A;  1WY9 A;  1KFX L;  1S6J A;  2M3W A;  3DF0 B;  1B1G A;  1SR6 C;  2LVI A;  2K2F A;  4IL1 A;  1L2O C;  1R2U A;  2I7A A;  3TDU A;  3KHE A;  3A8R A;  1ZOT B;  1J7P A;  3FWB A;  1CDL A;  2LLU A;  4CFQ A;  5AFP A;  1CNP A;  1UHJ A;  1FF1 A;  2MHH A;  2RGI A;  1NWD A;  4JWQ A;  2QPT A;  1KK8 B;  2O5G A;  2DOQ A;  1NX3 A;  1B8L A;  1DJG A;  3CR5 X;  1OZS A;  3DVM A;  4PE0 A;  1AUI B;  1XFU O;  2M29 A;  4PHM A;  1QAS A;  3GK2 A;  1CDM A;  1B9A A;  5JOL A;  1CB1 A;  2A4J A;  2BL0 B;  3PM8 A;  1KFX S;  4ZCV A;  1SL8 A;  1TN4 A;  2Y5I A;  1TCO B;  4WQ2 A;  1Y1A A;  1B7T Y;  2LM5 A;  5D7F A;  1JWD A;  1NSH A;  3OP0 A;  2SCP A;  2SAS A;  4YGA A;  2FJU B;  3D10 A;  1CMG A;  3I5H C;  1NCY A;  1DMO A;  2MAZ A;  2I18 A;  1YVH A;  1BR4 B;  2KI4 C;  3KEV A;  4NDB A;  1A4P A;  2LC5 A;  4QJ5 B;  1KK8 C;  2GV5 A;  3DF0 A;  1K9P A;  1TIZ A;  3NSI A;  2K7O A;  4P5O E;  1NX2 A;  3WHT B;  1F8H A;  2M1U A;  1N2D A;  3AKB A;  4C0K A;  3D0Y A;  1EG3 A;  5IBW A;  2L4H A;  3IF7 A;  3JVT B;  3CR2 A;  4I5L B;  3JTD B;  4PE4 A;  1ZFS A;  2VRG A;  5K89 A;  1S5G Y;  1SCV A;  2L98 A;  2MRD A;  1U5I A;  4YBH B;  5DKR A;  5DKQ A;  1XFV O;  2KFG A;  2L51 A;  5CSF A;  1BG1 A;  4GUK A;  4MEW A;  1A29 A;  1NYA A;  2LLS A;  4PE7 A;  1LA0 A;  2AUC A;  2M0R A;  3EVV A;  1DGV A;  2NCP A;  2NZ0 A;  3AAK A;  3CTN A;  4GGN A;  4HRG A;  1BOC A;  4ICB A;  1IJ5 A;  2WND A;  1AJ5 A;  1H8B A;  1XFZ O;  3CS1 A;  1CFD A;  1OMV A;  1G4Y R;  2F3Z A;  5CSN A;  1MUX A;  3M0W A;  1Q80 A;  4CID A;  3VGO A;  1PSR A;  3JVT C;  5TNC A;  1ZAC A;  2LHL A;  4WQ3 A;  2LP2 A;  2LVV A;  3BUM B;  2PVB A;  4NDD A;  4D1E A;  4PAL A;  1S3P A;  3BYA A;  5DKN A;  1CFF A;  1K9U A;  1S6C A;  1K90 D;  1XK4 C;  1QLS A;  2ZNE A;  2BCX A;  3TDZ A;  1ZUZ A;  2JT0 A;  2E6W A;  1JBA A;  4FTG A;  2CTN A;  1QTX A;  1MHO A;  5G08 A;  1FPW A;  5I8N A;  1XK4 A;  3TZ1 A;  3EK4 A;  3RM1 A;  2F2P A;  4MZK A;  1X02 A;  1YUR A;  1AVS A;  1TOP A;  1TNW A;  2BE6 A;  2IS9 A;  3IQO A;  3SG6 A;  3WXA A;  4I5J A;  1V1F A;  4ETO A;  1OQP A;  1UWO A;  2B1U A;  1J7Q A;  1J7R A;  4MVF A;  3OB1 B;  2BCB A;  3KF9 A;  2G2B A;  1OMD A;  1QIV A;  1K8U A;  1SRA A;  2ZFD A;  1PRW A;  4GPL B;  1Y1X A;  2I2R E;  4JQ0 D;  2L50 A;  1CDN A;  3ZNI A;  1XO5 A;  2JU0 A;  3TUY C;  4AQI A;  5I2L A;  2COL B;  1WLZ A;  3EVU A;  1WDC B;  1SCM B;  1ALV A;  1UHH A;  3O4Y A;  4MSP A;  2LNK A;  1EG4 A;  2PAL A;  2BKH B;  2NCO A;  2LAP A;  2MJW B;  1IH0 A;  1FBV A;  3GOF A;  1JFJ A;  2KAY A;  3WHU B;  1BF5 A;  3EKH A;  1QX2 A;  1DJI A;  1UHN A;  3EK7 A;  1EL4 A;  5CSI A;  1FW4 A;  4CPV A;  2WCF A;  2M49 B;  4A4B A;  4AOM A;  1OMR A;  4OV2 A;  2BBM A;  3OX5 A;  1F4Q A;  1LA3 A;  1CLM A;  3MSE B;  5CSJ A;  3ZWH A;  1AHR A;  1YR5 A;  4WRI A;  3LK0 A;  5GQQ C;  3C1V A;  1GQM A;  2KI6 C;  1XVJ A;  2L4I A;  3KO0 A;  2PAS A;  2WOR A;  3SG7 A;  1E8A A;  1IRJ A;  1AJ4 A;  1W7J B;  2LMU A;  1CKK A;  4YGE B;  4DS7 A;  4HRH A;  1CM4 A;  3PN7 B;  1UHK A;  3NSK A;  1CFC A;  1CFP A;  3GK4 X;  3PFV A;  1B8R A;  3EKJ A;  1SMG A;  4Q04 A;  2L2E A;  4ZCU A;  1CMF A;  4XYN A;  1B4C A;  3CZT X;  3ICB A;  3BOW B;  2MLF C;  1CLL A;  2OS8 B;  1B47 A;  2ZRS A;  4PHJ A;  2NLN A;  1M63 B;  1HQV A;  1NUB A;  3OB2 B;  1Y6W A;  5ER5 A;  2LLT A;  3VRQ A;  3HX4 A;  2KQY A;  1RFJ A;  1F54 A;  2KNE A;  5KSZ A;  1IKU A;  4HSZ A;  4FQO A;  5AER A;  1SYM A;  2P6B B;  2EC6 B;  1YX7 A;  3PN7 C;  5I2O A;  4YGC B;  1KFU L;  4P2Y B;  1D1O A;  3K21 A;  1J1D A;  4BY5 A;  4PCW A;  2FOT A;  4TNC A;  1RJV A;  3TS5 B;  1IQ3 A;  2BL0 C;  2JT8 A;  1YTZ C;  3BXK A;  1ODB A;  5HKY A;  1C7W A;  1DTL A;  2ZKM X;  3BUW B;  1CTR A;  2FCD A;  2LE9 B;  1NIW A;  5FYX A;  2KAX A;  2KI6 D;  1BMO A;  1S26 D;  2MA2 A;  1BOD A;  2PRU A;  1SL9 A;  1OSA A;  2LV7 A;  1DJY A;  1Y1U A;  2KBM A;  4YI8 A;  2JZI A;  1RRO A;  3SJS A;  5ER4 X;  4PDZ A;  5J3X A;  2JPT A;  2EC6 C;  2HET A;  1M45 A;  4PE1 A;  4YGB B;  4XJK B;  1M39 A;  2LMV A;  4MZL A;  1KFU S;  1DF0 B;  4ORA B;  1RWY A;  3F45 A;  3H4S E;  1QIW A;  1YRT B;  4M2Q A;  1VRK A;  3JTD C;  1IQ5 A;  1QV1 A;  2M9G A;  1SKT A;  2GGM A;  2LAN A;  3BQ3 A;  1WRL A;  1J1E A;  2KAV A;  1K94 A;  2F2O A;  3I5I B;  2OPO A;  4NQG A;  4C0L A;  4OCI A;  1K93 D;  5HYD A;  1OZO A;  4ORB B;  4DUQ A;  1NP8 A;  2K7B A;  2FCE A;  2O60 A;  2MLE C;  2TN4 A;  1AP4 A;  4C0J A;  1QX5 B;  2OTG B;  3VRN A;  1QLK A;  2LMT A;  3OHM B;  1KK7 Z;  3E3R A;  4GAO A;  2H2K A;  1WLM A;  4DCK A;  1MWN A;  2CCM A;  1GGW A;  3I5F B;  1N65 A;  2K7C A;  2KHN A;  2WCE A;  4MBE A;  2M7L A;  1KWO B;  3FWC A;  2Y1M A;  2EHB A;  3FS7 A;  3IQQ A;  1A75 B;  4YRU A;  1GGZ A;  2JOJ A;  4MLW A;  2M8U A;  2HQW A;  2PMY A;  1R6P A;  3WNX B;  1PAL A;  3I5I C;  1TNQ A;  2WC8 A;  1NCX A;  2V53 A;  3PAL A;  2KGR A;  2HQ8 A;  2ZN9 A;  4L9M A;  2KYF A;  1A2X A;  5D69 A;  5HKZ A;  2HF5 A;  1SPY A;  4HRE E;  1MXL C;  3BUO B;  4GBA A;  2Y4Q A;  1DJH A;  3I5F C;  4MRX A;  2KQ6 A;  5AEQ A;  1BLQ A;  1KWO C;  1BU3 A;  2K8M B;  5AAN A;  1JC2 A;  2BBN A;  3DVJ A;  4YGD B;  2WOS A;  2JWW A;  2AMI A;  3NSO A;  2ZN8 A;  1KSM A;  4N1G A;  1LIN A;  1LVC D;  1SNL A;  3I5G B;  4GNK B;  3DVK A;  1LXF C;  2JC2 A;  2KYC A;  1DVI A;  2CT9 A;  4OVN F;  1G8I A;  1W7I B;  4N5X A;  3BUX B;  2JT3 A;  1WDC C;  1SCM C;  2NXQ A;  1UUR A;  1L7Z A;  1PVB A;  3RLZ A;  4AQJ A;  1YUS A;  1DJX A;  3LL8 B;  4NDC A;  1KQV A;  1CDP A;  1CM1 A;  1YX8 A;  3CWG A;  2ZRT A;  1AK8 A;  1JF0 A;  2H61 C;  2KOT A;  4I5N B;  1K95 A;  1QX7 A;  1WRK A;  2ZND A;  4A4C A;  1S6I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...