2JT8A

Solution structure of the f153-to-5-flurotryptophan mutant of human cardiac troponin c
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
161
structure length
160
Chain Sequence
b'MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRSMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDELEFMKGVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Troponin C, slow skeletal and cardiac muscles
publication title Effects of Phe-to-Trp mutation and fluorotryptophan incorporation on the solution structure of cardiac troponin C, and analysis of its suitability as a potential probe for in situ NMR studies
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 28
structure length 160
sequence length 161
ec nomenclature
pdb deposition date 2007-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2jt8A00
3BXKA 1YRTB 4L9MA 2AMIA 4MSPA 2M1UA 1DGVA 1OMDA 2ZFDA 1RJVA 2JNFA 2NXQA 4JWQA 5FYXA 1A4PA 1MXLC 2KGRA 2Q91A 4USLA 5ER4X 1YVHA 3OX6A 3AAJA 1NWDA 4MLWA 1EG3A 1RECA 1OZSA 1UURA 1YUSA 1XK4A 3ZNIA 3DVEA 3D10A 3GK2A 4ETOA 1G8IA 1QATA 1CTRA 2Y1NA 2JC2A 1Q80A 4WRIA 2JTZA 2KAXA 5ER5A 1YRUB 1WRZA 1A03A 1CNPA 4C0KA 4CIDA 3PALA 5BPJA 4GGNA 4CLNA 1MXEA 1KFUL 2AAOA 2BCAA 5HLVA 2NCPA 4PHJA 3WXAA 1OMRA 2WCFA 1RTP1 1S1EA 1UHIA 4N1FA 3SG5A 4QJ3B 3GK1A 2L51A 4QJ4B 2H61C 5HKZA 1S36A 4ZCUA 3PLFB 5AFPA 5IBWA 4GGFA 1XO5A 1KSMA 4HRGA 1AK8A 3KHEA 2DOQA 2Y4QA 3RLZA 2BKIB 5I8NA 1DJHA 3TS5C 1JF2A 1CLBA 1Y0VH 1SNLA 1XFUO 1XYDA 1R2UA 1SKTA 1WRKA 2LHIA 4OCIA 1JC2A 4XYNA 1W7JB 5J3XA 1SBJA 1S6JA 1M63B 4MZLA 3IQOA 1CMFA 5HKWA 1TIZA 1UUSA 3DF0B 4A4CA 2FJUB 3TUYB 1DJYA 2CBLA 3BUWB 4FQOA 5KU1A 2HQ8A 3NXAA 4BY5A 2HQWA 1YUTA 3HX4A 3D0YB 1A75B 4NQGA 1QXPA 3H4SE 5AANA 4DUQA 3TUYC 1DJGA 2MJWB 1K2HA 3BQ3A 1B8RA 1FW4A 2MHHA 1D1OA 2ZRTA 1DF0A 1LVCD 1YURA 2LC5A 2MRDA 2BBMA 3O4YA 1K9UA 2M8UA 1TRFA 5JOLA 1KK7Z 2OTGB 2K2FA 4MN0A 2RGIA 4NDBA 1K90D 2JULA 1BF5A 1B4CA 1CDLA 1CM4A 1OZOA 1QVIY 4P2YB 1TNPA 3PSRA 1CDPA 2OTGC 1SR6B 2LLSA 1M31A 2ZN9A 5B8IB 1IRJA 1ZMZA 2LM5A 1SL9A 1SR6C 1F71A 2K7OA 1NX1A 1TCOB 2LNKA 4YI9A 5D69A 2PALA 1CFCA 3DVKA 3FS7A 2I2RE 2LLUA 1MF8B 3F45A 1J1DA 3BOWA 2KFGA 3I5HB 1EXRA 1J55A 3DD4A 1BLQA 3A8RA 4WQ3A 1NP8A 3I5HC 1PVAA 2KBIA 1BU3A 3KEVA 1RFJA 5DKNA 2MA2A 1JF0A 1K95A 4M2PA 1IJ6A 3SG3A 1QX5B 2PMYA 3TDUA 1PK0D 2JOJA 1WDCB 1XFZO 1PRWA 3AKAA 3CLNA 3CZTX 1KK7Y 1WY9A 4WQ2A 1CFDA 1NYAA 1EL4A 1WDCC 4CPVA 1LA0A 4PE4A 5CSJA 1QS7A 3VROA 2PSRA 1PSBA 2VRGA 2FOTA 4I5KA 3NSOA 4MEWA 2BBNA 1IWQA 1RROA 1NUBA 2I7AA 2ZNDA 4U8DA 2M7LA 1C7WA 2G9BA 4YGDB 1UHHA 1Y1AA 1FF1A 1DJZA 1H8BA 2M29A 2KDHA 4I5JA 1TOPA 1ZFSA 2H61A 5F6TA 2MAZA 3SG2A 1K94A 2JQ6A 1TN4A 2LMTA 1S6CA 4C0LA 2K7CA 3AAKA 4PDZA 3FWBA 2LP2A 2LV7A 1IKUA 1IQ5A 2KYFA 1WLZA 2HETA 3EVUA 2F33A 1AUIB 1KSOA 2KHNA 3KF9A 2JNXA 2O5GA 5KTYA 1F4QA 2F2PA 4OKHA 1CKKA 2NCOA 3TDIA 1R6PA 1OQPA 1N2DA 1A29A 3PATA 3ZWHA 2O60A 1N65A 4PHKA 4D1EA 1DTLA 2JRFA 2GGMA 1BG1A 2EGDA 1F54A 4ICBA 1QLKA 1B9AA 1Y1XA 4HRHA 1F4OA 3SIAA 1CFFA 1PULA 3DF0A 3I5GB 2KQYA 3KPXA 2P6BB 3M0WA 3TS5B 4PHNA 1B7TZ 1QVIZ 4XJKB 3D0YA 1A75A 3I5GC 1B1GA 1GGWA 4HSZA 2M3WA 3DVJA 4YGAA 1OSAA 1V1FA 2FCDA 1NIWA 5DKRA 5HKYA 3HCMA 1SY9A 2BKHB 1JFKA 1MUXA 1ALWA 4NDCA 3SG4A 5AERA 3MSEB 1CDNA 1QV0A 1TTXA 2JU0A 2G2BA 1MQ1A 1XFXO 1GGZA 4M2QA 4DS7A 2KGBC 3OP0A 2CTNA 1ALVA 3JTDB 2KI6D 1YVLA 2Y5IA 1X02A 1S5GZ 1KQVA 2L0PA 2E6WA 1IH0A 2CCMA 4CFQA 5TNCA 4MRXA 3JTDC 1LA3A 1SW8A 3BUNB 1JFJA 1JWDA 3OX5A 1FBVA 4E68A 2JT8A 3KO0A 4OVNF 2H2KA 1KQMB 1YTZC 2KQ6A 1NX3A 1KWOB 3EKJA 1KQMC 2I18A 1J7OA 2L4IA 4UPGA 2PVBA 1CMGA 2OPOA 1KWOC 1KFUS 3WHUB 2KI4C 1H4BA 4YGEB 1KFXL 1G4YR 3BUOB 3OB1B 5GQQC 1B7TY 3PFVA 1J7PA 2L98A 5CSNA 2LE9B 5CSIA 2E30A 1UHNA 2JT3A 4DIRA 1Y1UA 3EK8A 4GGFC 2Y1MA 4AOMA 4F0ZB 1NX2A 2LUCA 1BJFA 1K9PA 1PSRA 5G08A 1S5GY 2JWWA 2KFFA 1M39A 3CWGA 1F55A 1MHOA 4YBHB 2LHLA 2JT0A 2LCPA 1XFWO 1KK8B 4ORCB 2MBXA 4OR9B 2L50A 3PN7B 2CXJA 4DRWA 2NLNA 3LCPC 1U5IB 1KK8C 1B8LA 2CT9A 1B47A 1TNXA 3PN7C 1B8CA 4OV2A 3PM8A 3SIBA 3VRNA 2MLFC 1EJ3A 5CSFA 1QTXA 1BR1B 2JXCA 3NSKA 4M2OA 1DF0B 1EG4A 4R1EA 1S26D 4IL1A 1TCFA 5I2LA 1DJWA 2KBMA 4HREE 1KCYA 2WNDA 3EK7A 4NDDA 1IJ5A 1NSHA 4PALA 1QX7A 1CB1A 4P5OE 4A4BA 4GFTA 3EVVA 3FIAA 1VRKA 2LANA 3VGOA 1UP5A 2EC6B 4ORAB 2K8MB 2I94A 1UHJA 1YUUA 1RWYA 2LVKA 3EK4A 2EC6C 1Y6WA 1ODBA 1BR4B 1XA5A 2BL0B 2L4HA 4GBAA 1GQMA 3O78A 3LL8B 2L5XB 4AQJA 2CNPA 1UWOA 3ICBA 2BL0C 4XJKA 1QIWA 2OS8B 1FPWA 2EHBA 2LVJA 3GK4X 1SCMB 1K9KA 4I5NB 4MVFA 2BCXA 3GOFA 2JTTA 1DMOA 2OS8C 4JPZB 2KAYA 2M0RA 1BT6A 3OHMB 1M46A 1BMOA 3DVMA 1SCMC 2LUXA 3EKHA 1SL8A 1L2OB 2JXLA 1QJTA 3BYAA 5D7FA 3CR2A 4QJ5B 2WORA 3AKBA 3A4UB 1ZACA 1L2OC 1CM1A 2BE6A 1AVSA 2L2EA 3LLEA 3CR4X 1DT7B 4GNKB 2K7DA 1JUOA 3CR5X 4I5LB 2M97A 5DKQA 1J7RA 1XFVO 2R2IA 3CTNA 1PVBA 1HQVA 1SMGA 1UHKA 3IQQA 1L7ZA 3TZ1A 1XFYO 4MZKA 4PE1A 3VRRA 2Q4UA 2WC8A 3WHTB 4MZJA 1LKJA 1OMVA 2M7NA 2AUCA 1SCVA 1YX7A 2F3ZA 5AXIA 2BECA 1FI5A 2BE4A 2K61A 1SL7A 2V53A 1JBAA 4YI8A 2WCEA 3RM1A 2JZIA 5CPVA 1QX2A 1AJ5A 2LMVA 1NX0A 1DJXA 3WNXB 1ZOTB 3LK0A 4GAOA 3I5FB 1F8HA 1XK4C 2GV5A 5I2QA 2SCPA 3OB2B 4PE0A 2KI4B 1S6IA 2PRUA 3I5FC 4MBEA 2ISDA 4ZCVA 1M45A 1BODA 3EVRA 1DVIA 1LXFC 2A4JA 2K0JA 1HT9A 2KOTA 1CFPA 2D8NA 4YRUA 5HYDA 5HLOA 1J1EA 2ZRSA 2ZKMX 5PALA 1NCXA 1QV1A 1MWNA 4TNCA 1CDMA 1U5IA 1GJYA 1QLSA 3VRQA 3BUXB 5K89A 1C07A 1K96A 1YR5A 3NSIA 3NSLA 1AHRA 2KYCA 2LP3A 1AJ4A 2KAVA 2BCBA 2WOSA 1FI6A 1K93D 1OE9B 2F3YA 2NZ0A 4DCKA 1G33A 1N0YA 2FCEA 1DJIA 2LVVA 1W7IB 1SRAA 5I2OA 1ZUZA 3TDZA 2K2AA 1WRLA 5JJGA 1MR8A 1QIVA 1V1GA 1BOCA 4GPLB 4PE7A 1NPQA 4FTGA 1RK9A 1LINA 1IGVA 2KSPA 1SYMA 1AP4A 4BY4A 1C7VA 3CS1A 2QACA 5AEQA 2HPSA 2F8PA 1K8UA 3SG7A 1QASA 2M1KB 2LMUA 3VRPA 1IG5A 1NCZA 1EH2A 4JQ0D 2IS9A 3O6BA 4N5XA 3JVTB 1TNQA 4YGCB 1JSAA 1IQ3A 1KFXS 2PASA 1WLMA 2WCBA 3JVTC 2HF5A 3LK1A 3C1VA 3I5IB 4CFRA 2ZNEA 2GGZA 2M9GA 4N1GA 1CLMA 2F2OA 3IF7A 2MLEC 1J7QA 1SPYA 2LVIA 1DGUA 2KNEA 1PALA 3I5IC 3E3RA 2B1UA 2COLB 4PHMA 1NCYA 1SK6D 2KFHA 2LAPA 3BOWB 4AQIA 2LLTA 2KI6C 2QPTA 4MRYA 4C0JA 1TNWA 2JPTA 1A2XA 3K21A 5KSZA 3SG6A 2K7BA 3SJSA 3CGAA 3FWCA 4GUKA 1E8AA 2M49B 2TN4A 1OOJA 1F70A 2ZN8A 3BUMB 3QRXA 4Q04A 2SASA 1YX8A 3O2PA 1S3PA 1XVJA 4PCWA 4ORBB 1CLLA 4YGBB
chains in the Genus database with same CATH superfamily
1T14A 3BXKA 1YRTB 4L9MA 2AMIA 4MSPA 2M1UA 1DGVA 3D77A 1OMDA 2ZFDA 1RJVA 2JNFA 2NXQA 4JWQA 5FYXA 1A4PA 1MXLC 2KGRA 3S0DA 1IIOA 2Q91A 4USLA 5ER4X 1YVHA 3OX6A 3AAJA 1NWDA 4MLWA 1EG3A 1OOIX 1RECA 1OZSA 1UURA 1YUSA 1XK4A 3DYEA 3DVEA 3D10A 3GK2A 3ZNIA 4ETOA 1G8IA 1QATA 1CTRA 2Y1NA 2JC2A 1Q80A 4WRIA 2JTZA 1GM0A 2KAXA 5ER5A 1YRUB 1WRZA 1DC1A 1A03A 1CNPA 4C0KA 4CIDA 3PALA 3CYZA 5BPJA 4GGNA 4CLNA 1MXEA 1KFUL 2AAOA 2BCAA 1Z4HA 2KLDA 5HLVA 2NCPA 4PHJA 3WXAA 3S0GA 1OMRA 2WCFA 1RTP1 1S1EA 1UHIA 3NHIA 4N1FA 3SG5A 4QJ3B 3GK1A 2L51A 3PM2A 1TUZA 4QJ4B 2H61C 5HKZA 1S36A 4ZCUA 3PLFB 5AFPA 5IBWA 4GGFA 1Z2CB 1XO5A 1KSMA 4HRGA 1AK8A 3KHEA 3BJHA 2DOQA 2Y4QA 3RLZA 2BKIB 5I8NA 1DJHA 2QEBA 1JF2A 3TS5C 1CLBA 1Y0VH 3UNWA 1SNLA 1XFUO 1XYDA 1R2UA 1SKTA 1WRKA 2LHIA 4OCIA 1JC2A 2BNXA 4XYNA 1W7JB 3UO9A 5J3XA 1SBJA 1S6JA 1M63B 4MZLA 3IQOA 1CMFA 5HKWA 1TIZA 1UUSA 3DF0B 4A4CA 2FJUB 3TUYB 1DJYA 1OOHA 2CBLA 3BUWB 4FQOA 5KU1A 2HQ8A 3NXAA 4BY5A 2HQWA 1YUTA 3HX4A 3D0YB 1A75B 4NQGA 1QXPA 3H4SE 5AANA 3D78A 4DUQA 3TUYC 1DJGA 2MJWB 1K2HA 3BQ3A 1B8RA 1FW4A 2MHHA 1D1OA 2ZRTA 1DF0A 1LVCD 1YURA 3D76A 2LC5A 2MRDA 2BBMA 3O4YA 1K9UA 2M8UA 1TRFA 5JOLA 1KK7Z 1OOGA 2K2FA 1OOFA 2OTGB 2RGIA 4MN0A 4NDBA 1K90D 2JULA 1BF5A 1B4CA 3K1EA 1CDLA 1CM4A 4INXA 1OZOA 1QVIY 4P2YB 1TNPA 3B7AA 3PSRA 1CDPA 2OTGC 2WCLA 1SR6B 2LLSA 1M31A 2ZN9A 3D74A 5B8IB 1IRJA 1ZMZA 2LM5A 1SL9A 1SR6C 1F71A 2K7OA 3FE8A 1NX1A 1TCOB 2H8VA 2LNKA 4YI9A 2PALA 5D69A 1CFCA 3DVKA 3FS7A 2I2RE 1W9ZA 2LLUA 3CABA 1MF8B 3F45A 3O4XA 1J1DA 3BOWA 2KFGA 3I5HB 1EXRA 1J55A 3DD4A 1BLQA 3A8RA 4WQ3A 1NP8A 3I5HC 1PVAA 2KBIA 1BU3A 3KEVA 1SSEB 1RFJA 5DKNA 2MA2A 1JF0A 1K95A 4M2PA 1IJ6A 3SG3A 1QX5B 2PMYA 3TDUA 1PK0D 2JOJA 1WDCB 1XFZO 1PRWA 3AKAA 3BFAA 3CLNA 3CZTX 1KK7Y 1WY9A 4WQ2A 1CFDA 1NYAA 1EL4A 1XFRA 1WDCC 2FJYA 1LA0A 4FQTA 4CPVA 4PE4A 5CSJA 1QS7A 3VROA 2PSRA 1PSBA 2VRGA 2FOTA 4I5KA 3NSOA 2PQLA 2BBNA 1IWQA 1RROA 1NUBA 2I7AA 2ZNDA 4MEWA 4U8DA 1C7WA 2M7LA 2G9BA 4YGDB 1UHHA 2WCMA 1Y1AA 1FF1A 1DJZA 1H8BA 2M29A 2KDHA 4I5JA 1TOPA 1ZFSA 2H61A 5F6TA 2MAZA 3SG2A 1K94A 2JQ6A 1TN4A 2LMTA 5I94A 1S6CA 4C0LA 2K7CA 3AAKA 4PDZA 3FWBA 2LP2A 2LV7A 1IKUA 1IQ5A 2KYFA 1WLZA 2HETA 3EVUA 2F33A 1AUIB 1KSOA 2KHNA 3KF9A 2JNXA 2O5GA 5KTYA 1F4QA 2F2PA 4OKHA 1CKKA 2NCOA 3TDIA 1R6PA 1OQPA 1N2DA 1A29A 3PATA 3ZWHA 2O60A 1N65A 4PHKA 4D1EA 4JD9A 1DTLA 3S0EA 2JRFA 2PYQA 2GGMA 1BG1A 2EGDA 1F54A 4ICBA 5FI6A 1QLKA 1B9AA 1Y1XA 4HRHA 1F4OA 3SIAA 3RZSA 1CFFA 1PULA 3DF0A 3I5GB 2KQYA 4IJ7A 3KPXA 3B86A 2P6BB 3M0WA 5FI2A 4PHNA 1B7TZ 1QVIZ 4XJKB 3TS5B 3B6XA 3D0YA 1A75A 3N7HA 3I5GC 1B1GA 1GGWA 4HSZA 2M3WA 3DVJA 4INWA 1OSAA 1V1FA 2FCDA 4YGAA 1NIWA 5DKRA 5HKYA 3HCMA 1SY9A 2BKHB 1JFKA 1MUXA 1ALWA 4NDCA 5EL2A 3SG4A 3MSEB 5AERA 1TUJA 1TTXA 1QV0A 2JU0A 2G2BA 1MQ1A 1XFXO 1GGZA 4M2QA 4DS7A 2KGBC 1DQEA 2CTNA 1ALVA 3JTDB 3OP0A 2KI6D 1YVLA 2Y5IA 1X02A 1S5GZ 1KQVA 2L0PA 2E6WA 1IH0A 2CCMA 3SS3A 1TWOA 2YGUA 4CFQA 3FE9A 5TNCA 3OGNA 3JTDC 4MRXA 1LA3A 1SW8A 3BUNB 1JFJA 1JWDA 3OX5A 1FBVA 3R1OA 4E68A 3EG5B 2JT8A 3KO0A 4OVNF 2H2KA 1KQMB 1YTZC 4PT1A 2KQ6A 1NX3A 1KWOB 3EKJA 1KQMC 2I18A 3R1PA 1J7OA 2L4IA 4UPGA 2PVBA 1CMGA 2OPOA 1KWOC 1KFUS 3WHUB 2KI4C 1H4BA 4YGEB 1C3ZA 1KFXL 1G4YR 3BUOB 3OB1B 5GQQC 3S0BA 1B7TY 3PFVA 1J7PA 2L98A 5CSNA 2LE9B 5CSIA 3NGVA 2E30A 1UHNA 2JT3A 4DIRA 5DICA 1Y1UA 3EK8A 4GGFC 3D73A 2Y1MA 4AOMA 4F0ZB 1NX2A 2LUCA 1BJFA 1K9PA 1PSRA 5G08A 1S5GY 2JWWA 2KFFA 1M39A 3CWGA 1F55A 1MHOA 4YBHB 2LHLA 2JT0A 2LCPA 1XFWO 2WCHA 1KK8B 4ORCB 2MBXA 3SS5A 4OR9B 2L50A 3PN7B 2CXJA 4DRWA 2NLNA 3LCPC 1U5IB 1KK8C 1B8LA 2CT9A 1B47A 3Q8IA 1TNXA 3PN7C 1B8CA 4OV2A 3PM8A 3SIBA 3VRNA 2MLFC 1EJ3A 5CSFA 1QTXA 1BR1B 2JXCA 3NSKA 4M2OA 1DF0B 1EG4A 4R1EA 1S26D 4IL1A 1TCFA 3IVTA 5I2LA 1DJWA 2KBMA 4HREE 3B88A 2WNDA 1KCYA 3EK7A 4NDDA 1IJ5A 1NSHA 4PALA 1QWVA 1QX7A 1CB1A 2P70A 4P5OE 3DY9A 3L4LA 4A4BA 4GFTA 3EVVA 3FIAA 1VRKA 2LANA 2JPOA 3VGOA 1UP5A 2EC6B 2WCJA 4ORAB 3L4AA 2K8MB 2I94A 1UHJA 1YUUA 2WC5A 3CZ2A 1LS8A 1RWYA 2LVKA 3EK4A 2EC6C 4KYNA 1Y6WA 1ODBA 1BR4B 1XA5A 2BL0B 2L4HA 4GBAA 1GQMA 3CDNA 3O78A 3LL8B 2L5XB 4AQJA 2CNPA 1UWOA 3ICBA 2BL0C 4XJKA 1QIWA 2OS8B 1FPWA 2EHBA 2LVJA 3GK4X 1CDNA 1SCMB 1K9KA 4I5NB 4MVFA 2BCXA 3GOFA 2JTTA 1DMOA 2OS8C 2QDIA 2KAYA 4JPZB 2M0RA 1BT6A 3OHMB 1M46A 1BMOA 3DVMA 1SCMC 2LUXA 3EKHA 1SL8A 1L2OB 2JXLA 1QJTA 3B87A 4F7FA 3BYAA 3OBVA 5D7FA 3CR2A 4QJ5B 2WORA 3AKBA 3A4UB 1ZACA 1L2OC 3FE6A 1CM1A 2BE6A 1AVSA 1P28A 2L2EA 3LLEA 3CR4X 1DT7B 4GNKB 2K7DA 1JUOA 3CR5X 4I5LB 2M97A 5DKQA 2QEHA 1J7RA 1XFVO 2R2IA 3CTNA 1PVBA 2GTEA 3DZTA 1HQVA 1SMGA 1UHKA 3IQQA 1L7ZA 3TZ1A 1XFYO 4MZKA 4PE1A 5HL1A 3VRRA 2Q4UA 2WC8A 3WHTB 4MZJA 1LKJA 1OMVA 2M7NA 2AUCA 1SCVA 1YX7A 2F3ZA 5AXIA 2BECA 1FI5A 2BE4A 3D75A 2K61A 1SL7A 2V53A 1JBAA 4YI8A 2WCEA 3RM1A 2JZIA 5CPVA 1QX2A 1AJ5A 2LMVA 1NX0A 1DJXA 1ORGA 3WNXB 1ZOTB 2WC6A 3LK0A 4GAOA 3I5FB 1F8HA 1XK4C 3SS4A 2GV5A 3BFHA 1C3YA 5I2QA 2SCPA 3OB2B 2L2CA 4PE0A 2KI4B 1S6IA 2PRUA 3I5FC 4MBEA 2ISDA 4ZCVA 1M45A 3BFBA 3EVRA 1DVIA 1LXFC 2A4JA 3R72A 1BODA 4OZDA 1OW4A 2K0JA 1HT9A 2KOTA 1CFPA 2D8NA 3CZ0A 4YRUA 5HYDA 5HLOA 1J1EA 2ZRSA 2ZKMX 5PALA 1NCXA 1QV1A 1MWNA 4TNCA 1CDMA 1U5IA 1GJYA 1QLSA 3VRQA 3PJIA 2BAPA 3BUXB 5K89A 3S0AA 1K96A 1C07A 1YR5A 3NSIA 3NSLA 1AHRA 2KYCA 2LP3A 1AJ4A 2KAVA 2BCBA 2WCKA 2WOSA 1FI6A 1K93D 1OE9B 2F3YA 2NZ0A 4DCKA 1G33A 1N0YA 2FCEA 2KLEA 3R1VA 1DJIA 2LVVA 1W7IB 1SRAA 2QEOA 5I2OA 1ZUZA 3TDZA 2K2AA 1WRLA 2K60A 5JJGA 1MR8A 1QIVA 1V1GA 1BOCA 1DELA 4GPLB 4PE7A 1NPQA 4FTGA 1RK9A 1LINA 1IGVA 2KSPA 1SYMA 1AP4A 4BY4A 1C7VA 3CS1A 2QACA 5AEQA 2HPSA 2F8PA 1K8UA 3SG7A 1QASA 2M1KB 2LMUA 3VRPA 1IG5A 1NCZA 1EH2A 4JQ0D 2IS9A 2ERBA 3O6BA 4JKTA 4N5XA 3JVTB 3S0FA 1TNQA 4YGCB 3V2LA 2L5YA 1DEKA 1JSAA 1IQ3A 1KFXS 2PASA 1WLMA 2WCBA 3JVTC 2HF5A 3LK1A 3L47A 3C1VA 3I5IB 4CFRA 2ZNEA 2GGZA 2M9GA 4N1GA 1CLMA 2F2OA 3IF7A 2MLEC 1J7QA 1SPYA 2LVIA 1DGUA 5FI7A 2KNEA 3VB1A 1PALA 3I5IC 3E3RA 2B1UA 2COLB 4PHMA 1NCYA 3NHTA 1SK6D 2KFHA 2LAPA 3QMEA 3BOWB 4AQIA 2LLTA 2KI6C 5D3OA 2QPTA 3CZ1A 4MRYA 4C0JA 1TNWA 2JPTA 1A2XA 3K21A 5KSZA 2P71A 3SG6A 2K7BA 3DXLA 3SJSA 3CGAA 3FWCA 4GUKA 1E8AA 2M49B 2TN4A 1OOJA 1F70A 2ZN8A 3BUMB 3QRXA 4Q04A 2SASA 1YX8A 3O2PA 1S3PA 1XVJA 4PCWA 2KPHA 4ORBB 2QEVA 1CLLA 4YGBB
chains in the Genus database with same CATH topology
3BXKA 1YRTB 4L9MA 2AMIA 4MSPA 2M1UA 1DGVA 1OMDA 2ZFDA 1RJVA 2JNFA 2NXQA 4JWQA 5FYXA 1A4PA 1MXLC 2KGRA 2Q91A 4USLA 5ER4X 1YVHA 3OX6A 3AAJA 1NWDA 4MLWA 1EG3A 1RECA 1OZSA 1UURA 1YUSA 1XK4A 3ZNIA 3DVEA 3D10A 3GK2A 4ETOA 1G8IA 1QATA 1CTRA 2Y1NA 2JC2A 1Q80A 4WRIA 2JTZA 2KAXA 5ER5A 1YRUB 1WRZA 1A03A 1CNPA 4C0KA 4CIDA 3PALA 5BPJA 4GGNA 4CLNA 1MXEA 1KFUL 2AAOA 2BCAA 5HLVA 2NCPA 4PHJA 3WXAA 1OMRA 2WCFA 1RTP1 1S1EA 1UHIA 4N1FA 3SG5A 4QJ3B 3GK1A 2L51A 4QJ4B 2H61C 5HKZA 1S36A 4ZCUA 3PLFB 5AFPA 5IBWA 4GGFA 1XO5A 1KSMA 4HRGA 1AK8A 3KHEA 2DOQA 2Y4QA 3RLZA 2BKIB 5I8NA 1DJHA 3TS5C 1JF2A 1CLBA 1Y0VH 1SNLA 1XFUO 1XYDA 1R2UA 1SKTA 1WRKA 2LHIA 4OCIA 1JC2A 4XYNA 1W7JB 5J3XA 1SBJA 1S6JA 1M63B 4MZLA 3IQOA 1CMFA 5HKWA 1TIZA 1UUSA 3DF0B 4A4CA 2FJUB 3TUYB 1DJYA 2CBLA 3BUWB 4FQOA 5KU1A 2HQ8A 3NXAA 4BY5A 2HQWA 1YUTA 3HX4A 3D0YB 1A75B 4NQGA 1QXPA 3H4SE 5AANA 4DUQA 3TUYC 1DJGA 2MJWB 1K2HA 3BQ3A 1B8RA 1FW4A 2MHHA 1D1OA 2ZRTA 1DF0A 1LVCD 1YURA 2LC5A 2MRDA 2BBMA 3O4YA 1K9UA 2M8UA 1TRFA 5JOLA 1KK7Z 2OTGB 2K2FA 4MN0A 2RGIA 4NDBA 1K90D 2JULA 1BF5A 1B4CA 1CDLA 1CM4A 1OZOA 1QVIY 4P2YB 1TNPA 3PSRA 1CDPA 2OTGC 1SR6B 2LLSA 1M31A 2ZN9A 5B8IB 1IRJA 1ZMZA 2LM5A 1SL9A 1SR6C 1F71A 2K7OA 1NX1A 1TCOB 2LNKA 4YI9A 5D69A 2PALA 1CFCA 3DVKA 3FS7A 2I2RE 2LLUA 1MF8B 3F45A 1J1DA 3BOWA 2KFGA 3I5HB 1EXRA 1J55A 3DD4A 1BLQA 3A8RA 4WQ3A 1NP8A 3I5HC 1PVAA 2KBIA 1BU3A 3KEVA 1RFJA 5DKNA 2MA2A 1JF0A 1K95A 4M2PA 1IJ6A 3SG3A 1QX5B 2PMYA 3TDUA 1PK0D 2JOJA 1WDCB 1XFZO 1PRWA 3AKAA 3CLNA 3CZTX 1KK7Y 1WY9A 4WQ2A 1CFDA 1NYAA 1EL4A 1WDCC 4CPVA 1LA0A 4PE4A 5CSJA 1QS7A 3VROA 2PSRA 1PSBA 2VRGA 2FOTA 4I5KA 3NSOA 4MEWA 2BBNA 1IWQA 1RROA 1NUBA 2I7AA 2ZNDA 4U8DA 2M7LA 1C7WA 2G9BA 4YGDB 1UHHA 1Y1AA 1FF1A 1DJZA 1H8BA 2M29A 2KDHA 4I5JA 1TOPA 1ZFSA 2H61A 5F6TA 2MAZA 3SG2A 1K94A 2JQ6A 1TN4A 2LMTA 1S6CA 4C0LA 2K7CA 3AAKA 4PDZA 3FWBA 2LP2A 2LV7A 1IKUA 1IQ5A 2KYFA 1WLZA 2HETA 3EVUA 2F33A 1AUIB 1KSOA 2KHNA 3KF9A 2JNXA 2O5GA 5KTYA 1F4QA 2F2PA 4OKHA 1CKKA 2NCOA 3TDIA 1R6PA 1OQPA 1N2DA 1A29A 3PATA 3ZWHA 2O60A 1N65A 4PHKA 4D1EA 1DTLA 2JRFA 2GGMA 1BG1A 2EGDA 1F54A 4ICBA 1QLKA 1B9AA 1Y1XA 4HRHA 1F4OA 3SIAA 1CFFA 1PULA 3DF0A 3I5GB 2KQYA 3KPXA 2P6BB 3M0WA 3TS5B 4PHNA 1B7TZ 1QVIZ 4XJKB 3D0YA 1A75A 3I5GC 1B1GA 1GGWA 4HSZA 2M3WA 3DVJA 4YGAA 1OSAA 1V1FA 2FCDA 1NIWA 5DKRA 5HKYA 3HCMA 1SY9A 2BKHB 1JFKA 1MUXA 1ALWA 4NDCA 3SG4A 5AERA 3MSEB 1CDNA 1QV0A 1TTXA 2JU0A 2G2BA 1MQ1A 1XFXO 1GGZA 4M2QA 4DS7A 2KGBC 3OP0A 2CTNA 1ALVA 3JTDB 2KI6D 1YVLA 2Y5IA 1X02A 1S5GZ 1KQVA 2L0PA 2E6WA 1IH0A 2CCMA 4CFQA 5TNCA 4MRXA 3JTDC 1LA3A 1SW8A 3BUNB 1JFJA 1JWDA 3OX5A 1FBVA 4E68A 2JT8A 3KO0A 4OVNF 2H2KA 1KQMB 1YTZC 2KQ6A 1NX3A 1KWOB 3EKJA 1KQMC 2I18A 1J7OA 2L4IA 4UPGA 2PVBA 1CMGA 2OPOA 1KWOC 1KFUS 3WHUB 2KI4C 1H4BA 4YGEB 1KFXL 1G4YR 3BUOB 3OB1B 5GQQC 1B7TY 3PFVA 1J7PA 2L98A 5CSNA 2LE9B 5CSIA 2E30A 1UHNA 2JT3A 4DIRA 1Y1UA 3EK8A 4GGFC 2Y1MA 4AOMA 4F0ZB 1NX2A 2LUCA 1BJFA 1K9PA 1PSRA 5G08A 1S5GY 2JWWA 2KFFA 1M39A 3CWGA 1F55A 1MHOA 4YBHB 2LHLA 2JT0A 2LCPA 1XFWO 1KK8B 4ORCB 2MBXA 4OR9B 2L50A 3PN7B 2CXJA 4DRWA 2NLNA 3LCPC 1U5IB 1KK8C 1B8LA 2CT9A 1B47A 1TNXA 3PN7C 1B8CA 4OV2A 3PM8A 3SIBA 3VRNA 2MLFC 1EJ3A 5CSFA 1QTXA 1BR1B 2JXCA 3NSKA 4M2OA 1DF0B 1EG4A 4R1EA 1S26D 4IL1A 1TCFA 5I2LA 1DJWA 2KBMA 4HREE 1KCYA 2WNDA 3EK7A 4NDDA 1IJ5A 1NSHA 4PALA 1QX7A 1CB1A 4P5OE 4A4BA 4GFTA 3EVVA 3FIAA 1VRKA 2LANA 3VGOA 1UP5A 2EC6B 4ORAB 2K8MB 2I94A 1UHJA 1YUUA 1RWYA 2LVKA 3EK4A 2EC6C 1Y6WA 1ODBA 1BR4B 1XA5A 2BL0B 2L4HA 4GBAA 1GQMA 3O78A 3LL8B 2L5XB 4AQJA 2CNPA 1UWOA 3ICBA 2BL0C 4XJKA 1QIWA 2OS8B 1FPWA 2EHBA 2LVJA 3GK4X 1SCMB 1K9KA 4I5NB 4MVFA 2BCXA 3GOFA 2JTTA 1DMOA 2OS8C 4JPZB 2KAYA 2M0RA 1BT6A 3OHMB 1M46A 1BMOA 3DVMA 1SCMC 2LUXA 3EKHA 1SL8A 1L2OB 2JXLA 1QJTA 3BYAA 5D7FA 3CR2A 4QJ5B 2WORA 3AKBA 3A4UB 1ZACA 1L2OC 1CM1A 2BE6A 1AVSA 2L2EA 3LLEA 3CR4X 1DT7B 4GNKB 2K7DA 1JUOA 3CR5X 4I5LB 2M97A 5DKQA 1J7RA 1XFVO 2R2IA 3CTNA 1PVBA 1HQVA 1SMGA 1UHKA 3IQQA 1L7ZA 3TZ1A 1XFYO 4MZKA 4PE1A 3VRRA 2Q4UA 2WC8A 3WHTB 4MZJA 1LKJA 1OMVA 2M7NA 2AUCA 1SCVA 1YX7A 2F3ZA 5AXIA 2BECA 1FI5A 2BE4A 2K61A 1SL7A 2V53A 1JBAA 4YI8A 2WCEA 3RM1A 2JZIA 5CPVA 1QX2A 1AJ5A 2LMVA 1NX0A 1DJXA 3WNXB 1ZOTB 3LK0A 4GAOA 3I5FB 1F8HA 1XK4C 2GV5A 5I2QA 2SCPA 3OB2B 4PE0A 2KI4B 1S6IA 2PRUA 3I5FC 4MBEA 2ISDA 4ZCVA 1M45A 1BODA 3EVRA 1DVIA 1LXFC 2A4JA 2K0JA 1HT9A 2KOTA 1CFPA 2D8NA 4YRUA 5HYDA 5HLOA 1J1EA 2ZRSA 2ZKMX 5PALA 1NCXA 1QV1A 1MWNA 4TNCA 1CDMA 1U5IA 1GJYA 1QLSA 3VRQA 3BUXB 5K89A 1C07A 1K96A 1YR5A 3NSIA 3NSLA 1AHRA 2KYCA 2LP3A 1AJ4A 2KAVA 2BCBA 2WOSA 1FI6A 1K93D 1OE9B 2F3YA 2NZ0A 4DCKA 1G33A 1N0YA 2FCEA 1DJIA 2LVVA 1W7IB 1SRAA 5I2OA 1ZUZA 3TDZA 2K2AA 1WRLA 5JJGA 1MR8A 1QIVA 1V1GA 1BOCA 4GPLB 4PE7A 1NPQA 4FTGA 1RK9A 1LINA 1IGVA 2KSPA 1SYMA 1AP4A 4BY4A 1C7VA 3CS1A 2QACA 5AEQA 2HPSA 2F8PA 1K8UA 3SG7A 1QASA 2M1KB 2LMUA 3VRPA 1IG5A 1NCZA 1EH2A 4JQ0D 2IS9A 3O6BA 4N5XA 3JVTB 1TNQA 4YGCB 1JSAA 1IQ3A 1KFXS 2PASA 1WLMA 2WCBA 3JVTC 2HF5A 3LK1A 3C1VA 3I5IB 4CFRA 2ZNEA 2GGZA 2M9GA 4N1GA 1CLMA 2F2OA 3IF7A 2MLEC 1J7QA 1SPYA 2LVIA 1DGUA 2KNEA 1PALA 3I5IC 3E3RA 2B1UA 2COLB 4PHMA 1NCYA 1SK6D 2KFHA 2LAPA 3BOWB 4AQIA 2LLTA 2KI6C 2QPTA 4MRYA 4C0JA 1TNWA 2JPTA 1A2XA 3K21A 5KSZA 3SG6A 2K7BA 3SJSA 3CGAA 3FWCA 4GUKA 1E8AA 2M49B 2TN4A 1OOJA 1F70A 2ZN8A 3BUMB 3QRXA 4Q04A 2SASA 1YX8A 3O2PA 1S3PA 1XVJA 4PCWA 4ORBB 1CLLA 4YGBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BXK A;  1YRT B;  4L9M A;  2AMI A;  4MSP A;  2M1U A;  1DGV A;  1OMD A;  2ZFD A;  1RJV A;  2JNF A;  2NXQ A;  4JWQ A;  5FYX A;  1A4P A;  1MXL C;  2KGR A;  2Q91 A;  4USL A;  5ER4 X;  1YVH A;  3OX6 A;  3AAJ A;  1NWD A;  4MLW A;  1EG3 A;  1REC A;  1OZS A;  1UUR A;  1YUS A;  1XK4 A;  3ZNI A;  3DVE A;  3D10 A;  3GK2 A;  4ETO A;  1G8I A;  1QAT A;  1CTR A;  2Y1N A;  2JC2 A;  1Q80 A;  4WRI A;  2JTZ A;  2KAX A;  5ER5 A;  1YRU B;  1WRZ A;  1A03 A;  1CNP A;  4C0K A;  4CID A;  3PAL A;  5BPJ A;  4GGN A;  4CLN A;  1MXE A;  1KFU L;  2AAO A;  2BCA A;  5HLV A;  2NCP A;  4PHJ A;  3WXA A;  1OMR A;  2WCF A;  1RTP 1;  1S1E A;  1UHI A;  4N1F A;  3SG5 A;  4QJ3 B;  3GK1 A;  2L51 A;  4QJ4 B;  2H61 C;  5HKZ A;  1S36 A;  4ZCU A;  3PLF B;  5AFP A;  5IBW A;  4GGF A;  1XO5 A;  1KSM A;  4HRG A;  1AK8 A;  3KHE A;  2DOQ A;  2Y4Q A;  3RLZ A;  2BKI B;  5I8N A;  1DJH A;  3TS5 C;  1JF2 A;  1CLB A;  1Y0V H;  1SNL A;  1XFU O;  1XYD A;  1R2U A;  1SKT A;  1WRK A;  2LHI A;  4OCI A;  1JC2 A;  4XYN A;  1W7J B;  5J3X A;  1SBJ A;  1S6J A;  1M63 B;  4MZL A;  3IQO A;  1CMF A;  5HKW A;  1TIZ A;  1UUS A;  3DF0 B;  4A4C A;  2FJU B;  3TUY B;  1DJY A;  2CBL A;  3BUW B;  4FQO A;  5KU1 A;  2HQ8 A;  3NXA A;  4BY5 A;  2HQW A;  1YUT A;  3HX4 A;  3D0Y B;  1A75 B;  4NQG A;  1QXP A;  3H4S E;  5AAN A;  4DUQ A;  3TUY C;  1DJG A;  2MJW B;  1K2H A;  3BQ3 A;  1B8R A;  1FW4 A;  2MHH A;  1D1O A;  2ZRT A;  1DF0 A;  1LVC D;  1YUR A;  2LC5 A;  2MRD A;  2BBM A;  3O4Y A;  1K9U A;  2M8U A;  1TRF A;  5JOL A;  1KK7 Z;  2OTG B;  2K2F A;  4MN0 A;  2RGI A;  4NDB A;  1K90 D;  2JUL A;  1BF5 A;  1B4C A;  1CDL A;  1CM4 A;  1OZO A;  1QVI Y;  4P2Y B;  1TNP A;  3PSR A;  1CDP A;  2OTG C;  1SR6 B;  2LLS A;  1M31 A;  2ZN9 A;  5B8I B;  1IRJ A;  1ZMZ A;  2LM5 A;  1SL9 A;  1SR6 C;  1F71 A;  2K7O A;  1NX1 A;  1TCO B;  2LNK A;  4YI9 A;  5D69 A;  2PAL A;  1CFC A;  3DVK A;  3FS7 A;  2I2R E;  2LLU A;  1MF8 B;  3F45 A;  1J1D A;  3BOW A;  2KFG A;  3I5H B;  1EXR A;  1J55 A;  3DD4 A;  1BLQ A;  3A8R A;  4WQ3 A;  1NP8 A;  3I5H C;  1PVA A;  2KBI A;  1BU3 A;  3KEV A;  1RFJ A;  5DKN A;  2MA2 A;  1JF0 A;  1K95 A;  4M2P A;  1IJ6 A;  3SG3 A;  1QX5 B;  2PMY A;  3TDU A;  1PK0 D;  2JOJ A;  1WDC B;  1XFZ O;  1PRW A;  3AKA A;  3CLN A;  3CZT X;  1KK7 Y;  1WY9 A;  4WQ2 A;  1CFD A;  1NYA A;  1EL4 A;  1WDC C;  4CPV A;  1LA0 A;  4PE4 A;  5CSJ A;  1QS7 A;  3VRO A;  2PSR A;  1PSB A;  2VRG A;  2FOT A;  4I5K A;  3NSO A;  4MEW A;  2BBN A;  1IWQ A;  1RRO A;  1NUB A;  2I7A A;  2ZND A;  4U8D A;  2M7L A;  1C7W A;  2G9B A;  4YGD B;  1UHH A;  1Y1A A;  1FF1 A;  1DJZ A;  1H8B A;  2M29 A;  2KDH A;  4I5J A;  1TOP A;  1ZFS A;  2H61 A;  5F6T A;  2MAZ A;  3SG2 A;  1K94 A;  2JQ6 A;  1TN4 A;  2LMT A;  1S6C A;  4C0L A;  2K7C A;  3AAK A;  4PDZ A;  3FWB A;  2LP2 A;  2LV7 A;  1IKU A;  1IQ5 A;  2KYF A;  1WLZ A;  2HET A;  3EVU A;  2F33 A;  1AUI B;  1KSO A;  2KHN A;  3KF9 A;  2JNX A;  2O5G A;  5KTY A;  1F4Q A;  2F2P A;  4OKH A;  1CKK A;  2NCO A;  3TDI A;  1R6P A;  1OQP A;  1N2D A;  1A29 A;  3PAT A;  3ZWH A;  2O60 A;  1N65 A;  4PHK A;  4D1E A;  1DTL A;  2JRF A;  2GGM A;  1BG1 A;  2EGD A;  1F54 A;  4ICB A;  1QLK A;  1B9A A;  1Y1X A;  4HRH A;  1F4O A;  3SIA A;  1CFF A;  1PUL A;  3DF0 A;  3I5G B;  2KQY A;  3KPX A;  2P6B B;  3M0W A;  3TS5 B;  4PHN A;  1B7T Z;  1QVI Z;  4XJK B;  3D0Y A;  1A75 A;  3I5G C;  1B1G A;  1GGW A;  4HSZ A;  2M3W A;  3DVJ A;  4YGA A;  1OSA A;  1V1F A;  2FCD A;  1NIW A;  5DKR A;  5HKY A;  3HCM A;  1SY9 A;  2BKH B;  1JFK A;  1MUX A;  1ALW A;  4NDC A;  3SG4 A;  5AER A;  3MSE B;  1CDN A;  1QV0 A;  1TTX A;  2JU0 A;  2G2B A;  1MQ1 A;  1XFX O;  1GGZ A;  4M2Q A;  4DS7 A;  2KGB C;  3OP0 A;  2CTN A;  1ALV A;  3JTD B;  2KI6 D;  1YVL A;  2Y5I A;  1X02 A;  1S5G Z;  1KQV A;  2L0P A;  2E6W A;  1IH0 A;  2CCM A;  4CFQ A;  5TNC A;  4MRX A;  3JTD C;  1LA3 A;  1SW8 A;  3BUN B;  1JFJ A;  1JWD A;  3OX5 A;  1FBV A;  4E68 A;  2JT8 A;  3KO0 A;  4OVN F;  2H2K A;  1KQM B;  1YTZ C;  2KQ6 A;  1NX3 A;  1KWO B;  3EKJ A;  1KQM C;  2I18 A;  1J7O A;  2L4I A;  4UPG A;  2PVB A;  1CMG A;  2OPO A;  1KWO C;  1KFU S;  3WHU B;  2KI4 C;  1H4B A;  4YGE B;  1KFX L;  1G4Y R;  3BUO B;  3OB1 B;  5GQQ C;  1B7T Y;  3PFV A;  1J7P A;  2L98 A;  5CSN A;  2LE9 B;  5CSI A;  2E30 A;  1UHN A;  2JT3 A;  4DIR A;  1Y1U A;  3EK8 A;  4GGF C;  2Y1M A;  4AOM A;  4F0Z B;  1NX2 A;  2LUC A;  1BJF A;  1K9P A;  1PSR A;  5G08 A;  1S5G Y;  2JWW A;  2KFF A;  1M39 A;  3CWG A;  1F55 A;  1MHO A;  4YBH B;  2LHL A;  2JT0 A;  2LCP A;  1XFW O;  1KK8 B;  4ORC B;  2MBX A;  4OR9 B;  2L50 A;  3PN7 B;  2CXJ A;  4DRW A;  2NLN A;  3LCP C;  1U5I B;  1KK8 C;  1B8L A;  2CT9 A;  1B47 A;  1TNX A;  3PN7 C;  1B8C A;  4OV2 A;  3PM8 A;  3SIB A;  3VRN A;  2MLF C;  1EJ3 A;  5CSF A;  1QTX A;  1BR1 B;  2JXC A;  3NSK A;  4M2O A;  1DF0 B;  1EG4 A;  4R1E A;  1S26 D;  4IL1 A;  1TCF A;  5I2L A;  1DJW A;  2KBM A;  4HRE E;  1KCY A;  2WND A;  3EK7 A;  4NDD A;  1IJ5 A;  1NSH A;  4PAL A;  1QX7 A;  1CB1 A;  4P5O E;  4A4B A;  4GFT A;  3EVV A;  3FIA A;  1VRK A;  2LAN A;  3VGO A;  1UP5 A;  2EC6 B;  4ORA B;  2K8M B;  2I94 A;  1UHJ A;  1YUU A;  1RWY A;  2LVK A;  3EK4 A;  2EC6 C;  1Y6W A;  1ODB A;  1BR4 B;  1XA5 A;  2BL0 B;  2L4H A;  4GBA A;  1GQM A;  3O78 A;  3LL8 B;  2L5X B;  4AQJ A;  2CNP A;  1UWO A;  3ICB A;  2BL0 C;  4XJK A;  1QIW A;  2OS8 B;  1FPW A;  2EHB A;  2LVJ A;  3GK4 X;  1SCM B;  1K9K A;  4I5N B;  4MVF A;  2BCX A;  3GOF A;  2JTT A;  1DMO A;  2OS8 C;  4JPZ B;  2KAY A;  2M0R A;  1BT6 A;  3OHM B;  1M46 A;  1BMO A;  3DVM A;  1SCM C;  2LUX A;  3EKH A;  1SL8 A;  1L2O B;  2JXL A;  1QJT A;  3BYA A;  5D7F A;  3CR2 A;  4QJ5 B;  2WOR A;  3AKB A;  3A4U B;  1ZAC A;  1L2O C;  1CM1 A;  2BE6 A;  1AVS A;  2L2E A;  3LLE A;  3CR4 X;  1DT7 B;  4GNK B;  2K7D A;  1JUO A;  3CR5 X;  4I5L B;  2M97 A;  5DKQ A;  1J7R A;  1XFV O;  2R2I A;  3CTN A;  1PVB A;  1HQV A;  1SMG A;  1UHK A;  3IQQ A;  1L7Z A;  3TZ1 A;  1XFY O;  4MZK A;  4PE1 A;  3VRR A;  2Q4U A;  2WC8 A;  3WHT B;  4MZJ A;  1LKJ A;  1OMV A;  2M7N A;  2AUC A;  1SCV A;  1YX7 A;  2F3Z A;  5AXI A;  2BEC A;  1FI5 A;  2BE4 A;  2K61 A;  1SL7 A;  2V53 A;  1JBA A;  4YI8 A;  2WCE A;  3RM1 A;  2JZI A;  5CPV A;  1QX2 A;  1AJ5 A;  2LMV A;  1NX0 A;  1DJX A;  3WNX B;  1ZOT B;  3LK0 A;  4GAO A;  3I5F B;  1F8H A;  1XK4 C;  2GV5 A;  5I2Q A;  2SCP A;  3OB2 B;  4PE0 A;  2KI4 B;  1S6I A;  2PRU A;  3I5F C;  4MBE A;  2ISD A;  4ZCV A;  1M45 A;  1BOD A;  3EVR A;  1DVI A;  1LXF C;  2A4J A;  2K0J A;  1HT9 A;  2KOT A;  1CFP A;  2D8N A;  4YRU A;  5HYD A;  5HLO A;  1J1E A;  2ZRS A;  2ZKM X;  5PAL A;  1NCX A;  1QV1 A;  1MWN A;  4TNC A;  1CDM A;  1U5I A;  1GJY A;  1QLS A;  3VRQ A;  3BUX B;  5K89 A;  1C07 A;  1K96 A;  1YR5 A;  3NSI A;  3NSL A;  1AHR A;  2KYC A;  2LP3 A;  1AJ4 A;  2KAV A;  2BCB A;  2WOS A;  1FI6 A;  1K93 D;  1OE9 B;  2F3Y A;  2NZ0 A;  4DCK A;  1G33 A;  1N0Y A;  2FCE A;  1DJI A;  2LVV A;  1W7I B;  1SRA A;  5I2O A;  1ZUZ A;  3TDZ A;  2K2A A;  1WRL A;  5JJG A;  1MR8 A;  1QIV A;  1V1G A;  1BOC A;  4GPL B;  4PE7 A;  1NPQ A;  4FTG A;  1RK9 A;  1LIN A;  1IGV A;  2KSP A;  1SYM A;  1AP4 A;  4BY4 A;  1C7V A;  3CS1 A;  2QAC A;  5AEQ A;  2HPS A;  2F8P A;  1K8U A;  3SG7 A;  1QAS A;  2M1K B;  2LMU A;  3VRP A;  1IG5 A;  1NCZ A;  1EH2 A;  4JQ0 D;  2IS9 A;  3O6B A;  4N5X A;  3JVT B;  1TNQ A;  4YGC B;  1JSA A;  1IQ3 A;  1KFX S;  2PAS A;  1WLM A;  2WCB A;  3JVT C;  2HF5 A;  3LK1 A;  3C1V A;  3I5I B;  4CFR A;  2ZNE A;  2GGZ A;  2M9G A;  4N1G A;  1CLM A;  2F2O A;  3IF7 A;  2MLE C;  1J7Q A;  1SPY A;  2LVI A;  1DGU A;  2KNE A;  1PAL A;  3I5I C;  3E3R A;  2B1U A;  2COL B;  4PHM A;  1NCY A;  1SK6 D;  2KFH A;  2LAP A;  3BOW B;  4AQI A;  2LLT A;  2KI6 C;  2QPT A;  4MRY A;  4C0J A;  1TNW A;  2JPT A;  1A2X A;  3K21 A;  5KSZ A;  3SG6 A;  2K7B A;  3SJS A;  3CGA A;  3FWC A;  4GUK A;  1E8A A;  2M49 B;  2TN4 A;  1OOJ A;  1F70 A;  2ZN8 A;  3BUM B;  3QRX A;  4Q04 A;  2SAS A;  1YX8 A;  3O2P A;  1S3P A;  1XVJ A;  4PCW A;  4ORB B;  1CLL A;  4YGB B; 
#chains in the Genus database with same CATH topology
 1T14 A;  3BXK A;  1YRT B;  4L9M A;  2AMI A;  4MSP A;  2M1U A;  1DGV A;  3D77 A;  1OMD A;  2ZFD A;  1RJV A;  2JNF A;  2NXQ A;  4JWQ A;  5FYX A;  1A4P A;  1MXL C;  2KGR A;  3S0D A;  1IIO A;  2Q91 A;  4USL A;  5ER4 X;  1YVH A;  3OX6 A;  3AAJ A;  1NWD A;  4MLW A;  1EG3 A;  1OOI X;  1REC A;  1OZS A;  1UUR A;  1YUS A;  1XK4 A;  3DYE A;  3DVE A;  3D10 A;  3GK2 A;  3ZNI A;  4ETO A;  1G8I A;  1QAT A;  1CTR A;  2Y1N A;  2JC2 A;  1Q80 A;  4WRI A;  2JTZ A;  1GM0 A;  2KAX A;  5ER5 A;  1YRU B;  1WRZ A;  1DC1 A;  1A03 A;  1CNP A;  4C0K A;  4CID A;  3PAL A;  3CYZ A;  5BPJ A;  4GGN A;  4CLN A;  1MXE A;  1KFU L;  2AAO A;  2BCA A;  1Z4H A;  2KLD A;  5HLV A;  2NCP A;  4PHJ A;  3WXA A;  3S0G A;  1OMR A;  2WCF A;  1RTP 1;  1S1E A;  1UHI A;  3NHI A;  4N1F A;  3SG5 A;  4QJ3 B;  3GK1 A;  2L51 A;  3PM2 A;  1TUZ A;  4QJ4 B;  2H61 C;  5HKZ A;  1S36 A;  4ZCU A;  3PLF B;  5AFP A;  5IBW A;  4GGF A;  1Z2C B;  1XO5 A;  1KSM A;  4HRG A;  1AK8 A;  3KHE A;  3BJH A;  2DOQ A;  2Y4Q A;  3RLZ A;  2BKI B;  5I8N A;  1DJH A;  2QEB A;  1JF2 A;  3TS5 C;  1CLB A;  1Y0V H;  3UNW A;  1SNL A;  1XFU O;  1XYD A;  1R2U A;  1SKT A;  1WRK A;  2LHI A;  4OCI A;  1JC2 A;  2BNX A;  4XYN A;  1W7J B;  3UO9 A;  5J3X A;  1SBJ A;  1S6J A;  1M63 B;  4MZL A;  3IQO A;  1CMF A;  5HKW A;  1TIZ A;  1UUS A;  3DF0 B;  4A4C A;  2FJU B;  3TUY B;  1DJY A;  1OOH A;  2CBL A;  3BUW B;  4FQO A;  5KU1 A;  2HQ8 A;  3NXA A;  4BY5 A;  2HQW A;  1YUT A;  3HX4 A;  3D0Y B;  1A75 B;  4NQG A;  1QXP A;  3H4S E;  5AAN A;  3D78 A;  4DUQ A;  3TUY C;  1DJG A;  2MJW B;  1K2H A;  3BQ3 A;  1B8R A;  1FW4 A;  2MHH A;  1D1O A;  2ZRT A;  1DF0 A;  1LVC D;  1YUR A;  3D76 A;  2LC5 A;  2MRD A;  2BBM A;  3O4Y A;  1K9U A;  2M8U A;  1TRF A;  5JOL A;  1KK7 Z;  1OOG A;  2K2F A;  1OOF A;  2OTG B;  2RGI A;  4MN0 A;  4NDB A;  1K90 D;  2JUL A;  1BF5 A;  1B4C A;  3K1E A;  1CDL A;  1CM4 A;  4INX A;  1OZO A;  1QVI Y;  4P2Y B;  1TNP A;  3B7A A;  3PSR A;  1CDP A;  2OTG C;  2WCL A;  1SR6 B;  2LLS A;  1M31 A;  2ZN9 A;  3D74 A;  5B8I B;  1IRJ A;  1ZMZ A;  2LM5 A;  1SL9 A;  1SR6 C;  1F71 A;  2K7O A;  3FE8 A;  1NX1 A;  1TCO B;  2H8V A;  2LNK A;  4YI9 A;  2PAL A;  5D69 A;  1CFC A;  3DVK A;  3FS7 A;  2I2R E;  1W9Z A;  2LLU A;  3CAB A;  1MF8 B;  3F45 A;  3O4X A;  1J1D A;  3BOW A;  2KFG A;  3I5H B;  1EXR A;  1J55 A;  3DD4 A;  1BLQ A;  3A8R A;  4WQ3 A;  1NP8 A;  3I5H C;  1PVA A;  2KBI A;  1BU3 A;  3KEV A;  1SSE B;  1RFJ A;  5DKN A;  2MA2 A;  1JF0 A;  1K95 A;  4M2P A;  1IJ6 A;  3SG3 A;  1QX5 B;  2PMY A;  3TDU A;  1PK0 D;  2JOJ A;  1WDC B;  1XFZ O;  1PRW A;  3AKA A;  3BFA A;  3CLN A;  3CZT X;  1KK7 Y;  1WY9 A;  4WQ2 A;  1CFD A;  1NYA A;  1EL4 A;  1XFR A;  1WDC C;  2FJY A;  1LA0 A;  4FQT A;  4CPV A;  4PE4 A;  5CSJ A;  1QS7 A;  3VRO A;  2PSR A;  1PSB A;  2VRG A;  2FOT A;  4I5K A;  3NSO A;  2PQL A;  2BBN A;  1IWQ A;  1RRO A;  1NUB A;  2I7A A;  2ZND A;  4MEW A;  4U8D A;  1C7W A;  2M7L A;  2G9B A;  4YGD B;  1UHH A;  2WCM A;  1Y1A A;  1FF1 A;  1DJZ A;  1H8B A;  2M29 A;  2KDH A;  4I5J A;  1TOP A;  1ZFS A;  2H61 A;  5F6T A;  2MAZ A;  3SG2 A;  1K94 A;  2JQ6 A;  1TN4 A;  2LMT A;  5I94 A;  1S6C A;  4C0L A;  2K7C A;  3AAK A;  4PDZ A;  3FWB A;  2LP2 A;  2LV7 A;  1IKU A;  1IQ5 A;  2KYF A;  1WLZ A;  2HET A;  3EVU A;  2F33 A;  1AUI B;  1KSO A;  2KHN A;  3KF9 A;  2JNX A;  2O5G A;  5KTY A;  1F4Q A;  2F2P A;  4OKH A;  1CKK A;  2NCO A;  3TDI A;  1R6P A;  1OQP A;  1N2D A;  1A29 A;  3PAT A;  3ZWH A;  2O60 A;  1N65 A;  4PHK A;  4D1E A;  4JD9 A;  1DTL A;  3S0E A;  2JRF A;  2PYQ A;  2GGM A;  1BG1 A;  2EGD A;  1F54 A;  4ICB A;  5FI6 A;  1QLK A;  1B9A A;  1Y1X A;  4HRH A;  1F4O A;  3SIA A;  3RZS A;  1CFF A;  1PUL A;  3DF0 A;  3I5G B;  2KQY A;  4IJ7 A;  3KPX A;  3B86 A;  2P6B B;  3M0W A;  5FI2 A;  4PHN A;  1B7T Z;  1QVI Z;  4XJK B;  3TS5 B;  3B6X A;  3D0Y A;  1A75 A;  3N7H A;  3I5G C;  1B1G A;  1GGW A;  4HSZ A;  2M3W A;  3DVJ A;  4INW A;  1OSA A;  1V1F A;  2FCD A;  4YGA A;  1NIW A;  5DKR A;  5HKY A;  3HCM A;  1SY9 A;  2BKH B;  1JFK A;  1MUX A;  1ALW A;  4NDC A;  5EL2 A;  3SG4 A;  3MSE B;  5AER A;  1TUJ A;  1TTX A;  1QV0 A;  2JU0 A;  2G2B A;  1MQ1 A;  1XFX O;  1GGZ A;  4M2Q A;  4DS7 A;  2KGB C;  1DQE A;  2CTN A;  1ALV A;  3JTD B;  3OP0 A;  2KI6 D;  1YVL A;  2Y5I A;  1X02 A;  1S5G Z;  1KQV A;  2L0P A;  2E6W A;  1IH0 A;  2CCM A;  3SS3 A;  1TWO A;  2YGU A;  4CFQ A;  3FE9 A;  5TNC A;  3OGN A;  3JTD C;  4MRX A;  1LA3 A;  1SW8 A;  3BUN B;  1JFJ A;  1JWD A;  3OX5 A;  1FBV A;  3R1O A;  4E68 A;  3EG5 B;  2JT8 A;  3KO0 A;  4OVN F;  2H2K A;  1KQM B;  1YTZ C;  4PT1 A;  2KQ6 A;  1NX3 A;  1KWO B;  3EKJ A;  1KQM C;  2I18 A;  3R1P A;  1J7O A;  2L4I A;  4UPG A;  2PVB A;  1CMG A;  2OPO A;  1KWO C;  1KFU S;  3WHU B;  2KI4 C;  1H4B A;  4YGE B;  1C3Z A;  1KFX L;  1G4Y R;  3BUO B;  3OB1 B;  5GQQ C;  3S0B A;  1B7T Y;  3PFV A;  1J7P A;  2L98 A;  5CSN A;  2LE9 B;  5CSI A;  3NGV A;  2E30 A;  1UHN A;  2JT3 A;  4DIR A;  5DIC A;  1Y1U A;  3EK8 A;  4GGF C;  3D73 A;  2Y1M A;  4AOM A;  4F0Z B;  1NX2 A;  2LUC A;  1BJF A;  1K9P A;  1PSR A;  5G08 A;  1S5G Y;  2JWW A;  2KFF A;  1M39 A;  3CWG A;  1F55 A;  1MHO A;  4YBH B;  2LHL A;  2JT0 A;  2LCP A;  1XFW O;  2WCH A;  1KK8 B;  4ORC B;  2MBX A;  3SS5 A;  4OR9 B;  2L50 A;  3PN7 B;  2CXJ A;  4DRW A;  2NLN A;  3LCP C;  1U5I B;  1KK8 C;  1B8L A;  2CT9 A;  1B47 A;  3Q8I A;  1TNX A;  3PN7 C;  1B8C A;  4OV2 A;  3PM8 A;  3SIB A;  3VRN A;  2MLF C;  1EJ3 A;  5CSF A;  1QTX A;  1BR1 B;  2JXC A;  3NSK A;  4M2O A;  1DF0 B;  1EG4 A;  4R1E A;  1S26 D;  4IL1 A;  1TCF A;  3IVT A;  5I2L A;  1DJW A;  2KBM A;  4HRE E;  3B88 A;  2WND A;  1KCY A;  3EK7 A;  4NDD A;  1IJ5 A;  1NSH A;  4PAL A;  1QWV A;  1QX7 A;  1CB1 A;  2P70 A;  4P5O E;  3DY9 A;  3L4L A;  4A4B A;  4GFT A;  3EVV A;  3FIA A;  1VRK A;  2LAN A;  2JPO A;  3VGO A;  1UP5 A;  2EC6 B;  2WCJ A;  4ORA B;  3L4A A;  2K8M B;  2I94 A;  1UHJ A;  1YUU A;  2WC5 A;  3CZ2 A;  1LS8 A;  1RWY A;  2LVK A;  3EK4 A;  2EC6 C;  4KYN A;  1Y6W A;  1ODB A;  1BR4 B;  1XA5 A;  2BL0 B;  2L4H A;  4GBA A;  1GQM A;  3CDN A;  3O78 A;  3LL8 B;  2L5X B;  4AQJ A;  2CNP A;  1UWO A;  3ICB A;  2BL0 C;  4XJK A;  1QIW A;  2OS8 B;  1FPW A;  2EHB A;  2LVJ A;  3GK4 X;  1CDN A;  1SCM B;  1K9K A;  4I5N B;  4MVF A;  2BCX A;  3GOF A;  2JTT A;  1DMO A;  2OS8 C;  2QDI A;  2KAY A;  4JPZ B;  2M0R A;  1BT6 A;  3OHM B;  1M46 A;  1BMO A;  3DVM A;  1SCM C;  2LUX A;  3EKH A;  1SL8 A;  1L2O B;  2JXL A;  1QJT A;  3B87 A;  4F7F A;  3BYA A;  3OBV A;  5D7F A;  3CR2 A;  4QJ5 B;  2WOR A;  3AKB A;  3A4U B;  1ZAC A;  1L2O C;  3FE6 A;  1CM1 A;  2BE6 A;  1AVS A;  1P28 A;  2L2E A;  3LLE A;  3CR4 X;  1DT7 B;  4GNK B;  2K7D A;  1JUO A;  3CR5 X;  4I5L B;  2M97 A;  5DKQ A;  2QEH A;  1J7R A;  1XFV O;  2R2I A;  3CTN A;  1PVB A;  2GTE A;  3DZT A;  1HQV A;  1SMG A;  1UHK A;  3IQQ A;  1L7Z A;  3TZ1 A;  1XFY O;  4MZK A;  4PE1 A;  5HL1 A;  3VRR A;  2Q4U A;  2WC8 A;  3WHT B;  4MZJ A;  1LKJ A;  1OMV A;  2M7N A;  2AUC A;  1SCV A;  1YX7 A;  2F3Z A;  5AXI A;  2BEC A;  1FI5 A;  2BE4 A;  3D75 A;  2K61 A;  1SL7 A;  2V53 A;  1JBA A;  4YI8 A;  2WCE A;  3RM1 A;  2JZI A;  5CPV A;  1QX2 A;  1AJ5 A;  2LMV A;  1NX0 A;  1DJX A;  1ORG A;  3WNX B;  1ZOT B;  2WC6 A;  3LK0 A;  4GAO A;  3I5F B;  1F8H A;  1XK4 C;  3SS4 A;  2GV5 A;  3BFH A;  1C3Y A;  5I2Q A;  2SCP A;  3OB2 B;  2L2C A;  4PE0 A;  2KI4 B;  1S6I A;  2PRU A;  3I5F C;  4MBE A;  2ISD A;  4ZCV A;  1M45 A;  3BFB A;  3EVR A;  1DVI A;  1LXF C;  2A4J A;  3R72 A;  1BOD A;  4OZD A;  1OW4 A;  2K0J A;  1HT9 A;  2KOT A;  1CFP A;  2D8N A;  3CZ0 A;  4YRU A;  5HYD A;  5HLO A;  1J1E A;  2ZRS A;  2ZKM X;  5PAL A;  1NCX A;  1QV1 A;  1MWN A;  4TNC A;  1CDM A;  1U5I A;  1GJY A;  1QLS A;  3VRQ A;  3PJI A;  2BAP A;  3BUX B;  5K89 A;  3S0A A;  1K96 A;  1C07 A;  1YR5 A;  3NSI A;  3NSL A;  1AHR A;  2KYC A;  2LP3 A;  1AJ4 A;  2KAV A;  2BCB A;  2WCK A;  2WOS A;  1FI6 A;  1K93 D;  1OE9 B;  2F3Y A;  2NZ0 A;  4DCK A;  1G33 A;  1N0Y A;  2FCE A;  2KLE A;  3R1V A;  1DJI A;  2LVV A;  1W7I B;  1SRA A;  2QEO A;  5I2O A;  1ZUZ A;  3TDZ A;  2K2A A;  1WRL A;  2K60 A;  5JJG A;  1MR8 A;  1QIV A;  1V1G A;  1BOC A;  1DEL A;  4GPL B;  4PE7 A;  1NPQ A;  4FTG A;  1RK9 A;  1LIN A;  1IGV A;  2KSP A;  1SYM A;  1AP4 A;  4BY4 A;  1C7V A;  3CS1 A;  2QAC A;  5AEQ A;  2HPS A;  2F8P A;  1K8U A;  3SG7 A;  1QAS A;  2M1K B;  2LMU A;  3VRP A;  1IG5 A;  1NCZ A;  1EH2 A;  4JQ0 D;  2IS9 A;  2ERB A;  3O6B A;  4JKT A;  4N5X A;  3JVT B;  3S0F A;  1TNQ A;  4YGC B;  3V2L A;  2L5Y A;  1DEK A;  1JSA A;  1IQ3 A;  1KFX S;  2PAS A;  1WLM A;  2WCB A;  3JVT C;  2HF5 A;  3LK1 A;  3L47 A;  3C1V A;  3I5I B;  4CFR A;  2ZNE A;  2GGZ A;  2M9G A;  4N1G A;  1CLM A;  2F2O A;  3IF7 A;  2MLE C;  1J7Q A;  1SPY A;  2LVI A;  1DGU A;  5FI7 A;  2KNE A;  3VB1 A;  1PAL A;  3I5I C;  3E3R A;  2B1U A;  2COL B;  4PHM A;  1NCY A;  3NHT A;  1SK6 D;  2KFH A;  2LAP A;  3QME A;  3BOW B;  4AQI A;  2LLT A;  2KI6 C;  5D3O A;  2QPT A;  3CZ1 A;  4MRY A;  4C0J A;  1TNW A;  2JPT A;  1A2X A;  3K21 A;  5KSZ A;  2P71 A;  3SG6 A;  2K7B A;  3DXL A;  3SJS A;  3CGA A;  3FWC A;  4GUK A;  1E8A A;  2M49 B;  2TN4 A;  1OOJ A;  1F70 A;  2ZN8 A;  3BUM B;  3QRX A;  4Q04 A;  2SAS A;  1YX8 A;  3O2P A;  1S3P A;  1XVJ A;  4PCW A;  2KPH A;  4ORB B;  2QEV A;  1CLL A;  4YGB B; 
#chains in the Genus database with same CATH homology
 3BXK A;  1YRT B;  4L9M A;  2AMI A;  4MSP A;  2M1U A;  1DGV A;  1OMD A;  2ZFD A;  1RJV A;  2JNF A;  2NXQ A;  4JWQ A;  5FYX A;  1A4P A;  1MXL C;  2KGR A;  2Q91 A;  4USL A;  5ER4 X;  1YVH A;  3OX6 A;  3AAJ A;  1NWD A;  4MLW A;  1EG3 A;  1REC A;  1OZS A;  1UUR A;  1YUS A;  1XK4 A;  3ZNI A;  3DVE A;  3D10 A;  3GK2 A;  4ETO A;  1G8I A;  1QAT A;  1CTR A;  2Y1N A;  2JC2 A;  1Q80 A;  4WRI A;  2JTZ A;  2KAX A;  5ER5 A;  1YRU B;  1WRZ A;  1A03 A;  1CNP A;  4C0K A;  4CID A;  3PAL A;  5BPJ A;  4GGN A;  4CLN A;  1MXE A;  1KFU L;  2AAO A;  2BCA A;  5HLV A;  2NCP A;  4PHJ A;  3WXA A;  1OMR A;  2WCF A;  1RTP 1;  1S1E A;  1UHI A;  4N1F A;  3SG5 A;  4QJ3 B;  3GK1 A;  2L51 A;  4QJ4 B;  2H61 C;  5HKZ A;  1S36 A;  4ZCU A;  3PLF B;  5AFP A;  5IBW A;  4GGF A;  1XO5 A;  1KSM A;  4HRG A;  1AK8 A;  3KHE A;  2DOQ A;  2Y4Q A;  3RLZ A;  2BKI B;  5I8N A;  1DJH A;  3TS5 C;  1JF2 A;  1CLB A;  1Y0V H;  1SNL A;  1XFU O;  1XYD A;  1R2U A;  1SKT A;  1WRK A;  2LHI A;  4OCI A;  1JC2 A;  4XYN A;  1W7J B;  5J3X A;  1SBJ A;  1S6J A;  1M63 B;  4MZL A;  3IQO A;  1CMF A;  5HKW A;  1TIZ A;  1UUS A;  3DF0 B;  4A4C A;  2FJU B;  3TUY B;  1DJY A;  2CBL A;  3BUW B;  4FQO A;  5KU1 A;  2HQ8 A;  3NXA A;  4BY5 A;  2HQW A;  1YUT A;  3HX4 A;  3D0Y B;  1A75 B;  4NQG A;  1QXP A;  3H4S E;  5AAN A;  4DUQ A;  3TUY C;  1DJG A;  2MJW B;  1K2H A;  3BQ3 A;  1B8R A;  1FW4 A;  2MHH A;  1D1O A;  2ZRT A;  1DF0 A;  1LVC D;  1YUR A;  2LC5 A;  2MRD A;  2BBM A;  3O4Y A;  1K9U A;  2M8U A;  1TRF A;  5JOL A;  1KK7 Z;  2OTG B;  2K2F A;  4MN0 A;  2RGI A;  4NDB A;  1K90 D;  2JUL A;  1BF5 A;  1B4C A;  1CDL A;  1CM4 A;  1OZO A;  1QVI Y;  4P2Y B;  1TNP A;  3PSR A;  1CDP A;  2OTG C;  1SR6 B;  2LLS A;  1M31 A;  2ZN9 A;  5B8I B;  1IRJ A;  1ZMZ A;  2LM5 A;  1SL9 A;  1SR6 C;  1F71 A;  2K7O A;  1NX1 A;  1TCO B;  2LNK A;  4YI9 A;  5D69 A;  2PAL A;  1CFC A;  3DVK A;  3FS7 A;  2I2R E;  2LLU A;  1MF8 B;  3F45 A;  1J1D A;  3BOW A;  2KFG A;  3I5H B;  1EXR A;  1J55 A;  3DD4 A;  1BLQ A;  3A8R A;  4WQ3 A;  1NP8 A;  3I5H C;  1PVA A;  2KBI A;  1BU3 A;  3KEV A;  1RFJ A;  5DKN A;  2MA2 A;  1JF0 A;  1K95 A;  4M2P A;  1IJ6 A;  3SG3 A;  1QX5 B;  2PMY A;  3TDU A;  1PK0 D;  2JOJ A;  1WDC B;  1XFZ O;  1PRW A;  3AKA A;  3CLN A;  3CZT X;  1KK7 Y;  1WY9 A;  4WQ2 A;  1CFD A;  1NYA A;  1EL4 A;  1WDC C;  4CPV A;  1LA0 A;  4PE4 A;  5CSJ A;  1QS7 A;  3VRO A;  2PSR A;  1PSB A;  2VRG A;  2FOT A;  4I5K A;  3NSO A;  4MEW A;  2BBN A;  1IWQ A;  1RRO A;  1NUB A;  2I7A A;  2ZND A;  4U8D A;  2M7L A;  1C7W A;  2G9B A;  4YGD B;  1UHH A;  1Y1A A;  1FF1 A;  1DJZ A;  1H8B A;  2M29 A;  2KDH A;  4I5J A;  1TOP A;  1ZFS A;  2H61 A;  5F6T A;  2MAZ A;  3SG2 A;  1K94 A;  2JQ6 A;  1TN4 A;  2LMT A;  1S6C A;  4C0L A;  2K7C A;  3AAK A;  4PDZ A;  3FWB A;  2LP2 A;  2LV7 A;  1IKU A;  1IQ5 A;  2KYF A;  1WLZ A;  2HET A;  3EVU A;  2F33 A;  1AUI B;  1KSO A;  2KHN A;  3KF9 A;  2JNX A;  2O5G A;  5KTY A;  1F4Q A;  2F2P A;  4OKH A;  1CKK A;  2NCO A;  3TDI A;  1R6P A;  1OQP A;  1N2D A;  1A29 A;  3PAT A;  3ZWH A;  2O60 A;  1N65 A;  4PHK A;  4D1E A;  1DTL A;  2JRF A;  2GGM A;  1BG1 A;  2EGD A;  1F54 A;  4ICB A;  1QLK A;  1B9A A;  1Y1X A;  4HRH A;  1F4O A;  3SIA A;  1CFF A;  1PUL A;  3DF0 A;  3I5G B;  2KQY A;  3KPX A;  2P6B B;  3M0W A;  3TS5 B;  4PHN A;  1B7T Z;  1QVI Z;  4XJK B;  3D0Y A;  1A75 A;  3I5G C;  1B1G A;  1GGW A;  4HSZ A;  2M3W A;  3DVJ A;  4YGA A;  1OSA A;  1V1F A;  2FCD A;  1NIW A;  5DKR A;  5HKY A;  3HCM A;  1SY9 A;  2BKH B;  1JFK A;  1MUX A;  1ALW A;  4NDC A;  3SG4 A;  5AER A;  3MSE B;  1CDN A;  1QV0 A;  1TTX A;  2JU0 A;  2G2B A;  1MQ1 A;  1XFX O;  1GGZ A;  4M2Q A;  4DS7 A;  2KGB C;  3OP0 A;  2CTN A;  1ALV A;  3JTD B;  2KI6 D;  1YVL A;  2Y5I A;  1X02 A;  1S5G Z;  1KQV A;  2L0P A;  2E6W A;  1IH0 A;  2CCM A;  4CFQ A;  5TNC A;  4MRX A;  3JTD C;  1LA3 A;  1SW8 A;  3BUN B;  1JFJ A;  1JWD A;  3OX5 A;  1FBV A;  4E68 A;  2JT8 A;  3KO0 A;  4OVN F;  2H2K A;  1KQM B;  1YTZ C;  2KQ6 A;  1NX3 A;  1KWO B;  3EKJ A;  1KQM C;  2I18 A;  1J7O A;  2L4I A;  4UPG A;  2PVB A;  1CMG A;  2OPO A;  1KWO C;  1KFU S;  3WHU B;  2KI4 C;  1H4B A;  4YGE B;  1KFX L;  1G4Y R;  3BUO B;  3OB1 B;  5GQQ C;  1B7T Y;  3PFV A;  1J7P A;  2L98 A;  5CSN A;  2LE9 B;  5CSI A;  2E30 A;  1UHN A;  2JT3 A;  4DIR A;  1Y1U A;  3EK8 A;  4GGF C;  2Y1M A;  4AOM A;  4F0Z B;  1NX2 A;  2LUC A;  1BJF A;  1K9P A;  1PSR A;  5G08 A;  1S5G Y;  2JWW A;  2KFF A;  1M39 A;  3CWG A;  1F55 A;  1MHO A;  4YBH B;  2LHL A;  2JT0 A;  2LCP A;  1XFW O;  1KK8 B;  4ORC B;  2MBX A;  4OR9 B;  2L50 A;  3PN7 B;  2CXJ A;  4DRW A;  2NLN A;  3LCP C;  1U5I B;  1KK8 C;  1B8L A;  2CT9 A;  1B47 A;  1TNX A;  3PN7 C;  1B8C A;  4OV2 A;  3PM8 A;  3SIB A;  3VRN A;  2MLF C;  1EJ3 A;  5CSF A;  1QTX A;  1BR1 B;  2JXC A;  3NSK A;  4M2O A;  1DF0 B;  1EG4 A;  4R1E A;  1S26 D;  4IL1 A;  1TCF A;  5I2L A;  1DJW A;  2KBM A;  4HRE E;  1KCY A;  2WND A;  3EK7 A;  4NDD A;  1IJ5 A;  1NSH A;  4PAL A;  1QX7 A;  1CB1 A;  4P5O E;  4A4B A;  4GFT A;  3EVV A;  3FIA A;  1VRK A;  2LAN A;  3VGO A;  1UP5 A;  2EC6 B;  4ORA B;  2K8M B;  2I94 A;  1UHJ A;  1YUU A;  1RWY A;  2LVK A;  3EK4 A;  2EC6 C;  1Y6W A;  1ODB A;  1BR4 B;  1XA5 A;  2BL0 B;  2L4H A;  4GBA A;  1GQM A;  3O78 A;  3LL8 B;  2L5X B;  4AQJ A;  2CNP A;  1UWO A;  3ICB A;  2BL0 C;  4XJK A;  1QIW A;  2OS8 B;  1FPW A;  2EHB A;  2LVJ A;  3GK4 X;  1SCM B;  1K9K A;  4I5N B;  4MVF A;  2BCX A;  3GOF A;  2JTT A;  1DMO A;  2OS8 C;  4JPZ B;  2KAY A;  2M0R A;  1BT6 A;  3OHM B;  1M46 A;  1BMO A;  3DVM A;  1SCM C;  2LUX A;  3EKH A;  1SL8 A;  1L2O B;  2JXL A;  1QJT A;  3BYA A;  5D7F A;  3CR2 A;  4QJ5 B;  2WOR A;  3AKB A;  3A4U B;  1ZAC A;  1L2O C;  1CM1 A;  2BE6 A;  1AVS A;  2L2E A;  3LLE A;  3CR4 X;  1DT7 B;  4GNK B;  2K7D A;  1JUO A;  3CR5 X;  4I5L B;  2M97 A;  5DKQ A;  1J7R A;  1XFV O;  2R2I A;  3CTN A;  1PVB A;  1HQV A;  1SMG A;  1UHK A;  3IQQ A;  1L7Z A;  3TZ1 A;  1XFY O;  4MZK A;  4PE1 A;  3VRR A;  2Q4U A;  2WC8 A;  3WHT B;  4MZJ A;  1LKJ A;  1OMV A;  2M7N A;  2AUC A;  1SCV A;  1YX7 A;  2F3Z A;  5AXI A;  2BEC A;  1FI5 A;  2BE4 A;  2K61 A;  1SL7 A;  2V53 A;  1JBA A;  4YI8 A;  2WCE A;  3RM1 A;  2JZI A;  5CPV A;  1QX2 A;  1AJ5 A;  2LMV A;  1NX0 A;  1DJX A;  3WNX B;  1ZOT B;  3LK0 A;  4GAO A;  3I5F B;  1F8H A;  1XK4 C;  2GV5 A;  5I2Q A;  2SCP A;  3OB2 B;  4PE0 A;  2KI4 B;  1S6I A;  2PRU A;  3I5F C;  4MBE A;  2ISD A;  4ZCV A;  1M45 A;  1BOD A;  3EVR A;  1DVI A;  1LXF C;  2A4J A;  2K0J A;  1HT9 A;  2KOT A;  1CFP A;  2D8N A;  4YRU A;  5HYD A;  5HLO A;  1J1E A;  2ZRS A;  2ZKM X;  5PAL A;  1NCX A;  1QV1 A;  1MWN A;  4TNC A;  1CDM A;  1U5I A;  1GJY A;  1QLS A;  3VRQ A;  3BUX B;  5K89 A;  1C07 A;  1K96 A;  1YR5 A;  3NSI A;  3NSL A;  1AHR A;  2KYC A;  2LP3 A;  1AJ4 A;  2KAV A;  2BCB A;  2WOS A;  1FI6 A;  1K93 D;  1OE9 B;  2F3Y A;  2NZ0 A;  4DCK A;  1G33 A;  1N0Y A;  2FCE A;  1DJI A;  2LVV A;  1W7I B;  1SRA A;  5I2O A;  1ZUZ A;  3TDZ A;  2K2A A;  1WRL A;  5JJG A;  1MR8 A;  1QIV A;  1V1G A;  1BOC A;  4GPL B;  4PE7 A;  1NPQ A;  4FTG A;  1RK9 A;  1LIN A;  1IGV A;  2KSP A;  1SYM A;  1AP4 A;  4BY4 A;  1C7V A;  3CS1 A;  2QAC A;  5AEQ A;  2HPS A;  2F8P A;  1K8U A;  3SG7 A;  1QAS A;  2M1K B;  2LMU A;  3VRP A;  1IG5 A;  1NCZ A;  1EH2 A;  4JQ0 D;  2IS9 A;  3O6B A;  4N5X A;  3JVT B;  1TNQ A;  4YGC B;  1JSA A;  1IQ3 A;  1KFX S;  2PAS A;  1WLM A;  2WCB A;  3JVT C;  2HF5 A;  3LK1 A;  3C1V A;  3I5I B;  4CFR A;  2ZNE A;  2GGZ A;  2M9G A;  4N1G A;  1CLM A;  2F2O A;  3IF7 A;  2MLE C;  1J7Q A;  1SPY A;  2LVI A;  1DGU A;  2KNE A;  1PAL A;  3I5I C;  3E3R A;  2B1U A;  2COL B;  4PHM A;  1NCY A;  1SK6 D;  2KFH A;  2LAP A;  3BOW B;  4AQI A;  2LLT A;  2KI6 C;  2QPT A;  4MRY A;  4C0J A;  1TNW A;  2JPT A;  1A2X A;  3K21 A;  5KSZ A;  3SG6 A;  2K7B A;  3SJS A;  3CGA A;  3FWC A;  4GUK A;  1E8A A;  2M49 B;  2TN4 A;  1OOJ A;  1F70 A;  2ZN8 A;  3BUM B;  3QRX A;  4Q04 A;  2SAS A;  1YX8 A;  3O2P A;  1S3P A;  1XVJ A;  4PCW A;  4ORB B;  1CLL A;  4YGB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...