2JT8A

Solution structure of the f153-to-5-flurotryptophan mutant of human cardiac troponin c
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
161
structure length
160
Chain Sequence
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRSMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDELEFMKGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Effects of Phe-to-Trp mutation and fluorotryptophan incorporation on the solution structure of cardiac troponin C, and analysis of its suitability as a potential probe for in situ NMR studies
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Troponin C, slow skeletal and cardiac muscles
total genus 28
structure length 160
sequence length 161
ec nomenclature
pdb deposition date 2007-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2jt8A00
1UURA 2IS9A 1YUSA 1JC2A 2CNPA 1XFZO 2BL0C 1K93D 2M1KB 3CGAA 3SG3A 5HYDA 2M49B 2I7AA 1MXEA 2LLTA 3OB1B 1TNXA 1XK4C 5ER4X 1BF5A 1FW4A 3BUWB 2I94A 2LCPA 5AEQA 3TDZA 1NCYA 1WLZA 2M3WA 1K90D 2MHHA 1DJHA 2ZRTA 2LVVA 3RLZA 3WNXB 1J7QA 4YGAA 2RGIA 1KQMB 4WQ3A 2BL0B 1CDNA 4I5JA 3I5FB 4CLNA 3EK7A 2I18A 4GGFA 4HREE 4MN0A 3AKAA 3CR5X 3OB2B 1AUIB 5FYXA 1MWNA 1OMVA 2LMTA 3CR4X 4A4BA 1CFDA 1PRWA 3I5FC 1ZOTB 2H61C 2JC2A 5AERA 2P6BB 2K0JA 4MVFA 3OHMB 4M2PA 1DMOA 2BCXA 2JPTA 5KSZA 1FF1A 1LKJA 2PVBA 2E6WA 1L2OC 1QATA 1QIVA 2FCDA 4OR9B 1H8BA 1K8UA 2KNEA 1NIWA 2KI6D 1F4QA 2LUXA 1Y1XA 1SW8A 1SRAA 1KK8B 1M45A 3DD4A 5G08A 1CM1A 5CPVA 5I2OA 1J7RA 1S5GY 4NDDA 1ODBA 4DS7A 5JJGA 3TDIA 1WLMA 2HQ8A 1KWOB 2LP3A 1QX2A 3LCPC 2K7DA 3M0WA 3WHTB 5BPJA 2O5GA 1SBJA 2JWWA 5HKYA 2HF5A 3IQQA 2LVKA 1MUXA 2LVIA 2WCBA 3D10A 4JQ0D 4OCIA 1CFCA 2M1UA 2D8NA 4C0JA 1G8IA 1NP8A 1PVAA 1CDLA 3VRNA 1JFKA 3TUYB 1DGUA 4OKHA 2A4JA 2QACA 2JZIA 3ZNIA 1CFPA 1B7TY 4P2YB 4JPZB 1BOCA 1KFUL 2OS8B 3I5IB 2M7LA 3TS5C 1DJWA 5D69A 1J1EA 4GGFC 4FQOA 1N2DA 4ICBA 1E8AA 1TNQA 2GV5A 1Y1AA 4ZCUA 4GGNA 2NCOA 3DVJA 2L4HA 1MQ1A 4HRGA 3LL8B 1BMOA 1F55A 1LA0A 2LMUA 4MLWA 5IBWA 1IG5A 3BYAA 1YVHA 2L98A 1XK4A 2HPSA 1CLLA 3TS5B 1TTXA 1VRKA 2PMYA 1UHJA 1NCXA 2LLSA 2BE4A 2I2RE 3BOWB 3E3RA 1RWYA 2M29A 4YGCB 1TNPA 5I2QA 1FI5A 1DGVA 1L2OB 5ER5A 4MBEA 2V53A 2O60A 1DJXA 1NCZA 2CTNA 3SG4A 1R6PA 1YRUB 1MF8B 1LINA 2AAOA 1NX3A 2KQYA 3LLEA 3TDUA 5I8NA 2QPTA 1F4OA 2E30A 1U5IA 2OPOA 1WDCB 1F8HA 1IJ6A 1OE9B 2M0RA 3GK4X 1AJ4A 4D1EA 1FPWA 3H4SE 2Q4UA 3CWGA 1EG4A 2CCMA 3HCMA 1UP5A 1QXPA 2M8UA 1TOPA 4PE4A 1C7WA 1OZOA 2MAZA 4BY4A 3EVUA 4DUQA 4ORBB 1IKUA 4YGEB 1X02A 3JTDB 1KCYA 1XFXO 2LANA 3DF0A 3CZTX 3SIAA 1CTRA 1RK9A 2LHIA 3D0YA 3O4YA 3BUMB 3I5GC 1B8CA 1IGVA 1KSMA 1A75B 2NZ0A 1WRLA 4XJKB 4YGDB 2MBXA 1XO5A 4GUKA 2Y1MA 4NDBA 2MA2A 2LM5A 5F6TA 2F3ZA 2Y5IA 3EVVA 1CKKA 1TNWA 1XA5A 2JOJA 2KGBC 2FOTA 1ZACA 2AMIA 2JULA 1MR8A 5DKNA 1EH2A 1KWOC 2TN4A 1CM4A 4YI9A 4QJ4B 4YRUA 5K89A 3PN7C 2L5XB 1YVLA 1U5IB 3GOFA 4ZCVA 1HQVA 1NPQA 4DCKA 1DJZA 3VROA 1AP4A 5AFPA 2JT8A 4NQGA 1RECA 5DKQA 4AQIA 5CSJA 1JBAA 2F3YA 2Q91A 3AAJA 2BKHB 1KFXL 2K2FA 2F8PA 1M31A 2JXLA 1AK8A 2LMVA 4HRHA 1SCMC 1GQMA 3O6BA 1EL4A 2JNXA 3A8RA 4NDCA 2M97A 1J7OA 5HLOA 1QASA 1DT7B 2KFGA 3HX4A 1Q80A 4YGBB 2BKIB 1SKTA 2KHNA 3SG7A 5J3XA 1M63B 1YTZC 4JWQA 2KQ6A 4U8DA 4DRWA 1NUBA 2MRDA 1SCVA 1DJIA 2ZNEA 1K9PA 5B8IB 1PSBA 1R2UA 2JT0A 3FWCA 2JRFA 4MEWA 1M39A 1K94A 1YURA 2FJUB 2NXQA 3PALA 1ALVA 2JNFA 3WXAA 1SL9A 1NX2A 3I5HC 1GGWA 4MRXA 1SR6B 2BCBA 1OSAA 2LP2A 1RROA 2WOSA 2ZN8A 1S1EA 3JVTB 1AJ5A 2JQ6A 1Y0VH 2KGRA 4GNKB 3PM8A 2ZNDA 1V1GA 1YRTB 2HQWA 1S6JA 1AVSA 1ZFSA 1Y1UA 1MXLC 1K96A 4ORCB 1W7JB 3FIAA 2KFHA 1NX1A 1YX7A 4C0KA 2F33A 2F2PA 1SR6C 3O78A 5D7FA 2H2KA 1S6IA 1BT6A 5CSIA 1K95A 1QVIZ 2PSRA 1S36A 1TCOB 1PALA 3JVTC 3CTNA 1JSAA 1IQ3A 1UWOA 3BUNB 2OTGB 2WC8A 1DJYA 1Y6WA 1DF0B 2L50A 2NLNA 5TNCA 1TCFA 2VRGA 2LVJA 3SIBA 1B1GA 4PE7A 4GFTA 4I5LB 2DOQA 1K2HA 1ALWA 2R2IA 1SY9A 3EK8A 4A4CA 4UPGA 1WDCC 1DTLA 1FI6A 1QIWA 1OMDA 1YR5A 3BUXB 1DVIA 4E68A 1G4YR 4GBAA 4XYNA 4PHMA 2ZRSA 1WRKA 1KSOA 4PHNA 3GK2A 3AKBA 1BJFA 5JOLA 1KFUS 3KEVA 2KYFA 2BECA 2KI6C 1CFFA 2SCPA 3FS7A 1EG3A 1NYAA 1S3PA 3PLFB 5AXIA 1A75A 2EGDA 4FTGA 4XJKA 1LVCD 5HKZA 3ZWHA 1JWDA 4CFQA 1S5GZ 2COLB 1OMRA 1B8LA 1QS7A 1QV0A 1HT9A 2BCAA 3D0YB 2JTTA 3DF0B 1IJ5A 2KYCA 4P5OE 1KFXS 1PVBA 3BUOB 4AQJA 2MLEC 2CT9A 2KAVA 1NSHA 4GPLB 2LLUA 2LUCA 3GK1A 4PHKA 3OP0A 4IL1A 2ZN9A 2LAPA 1KK8C 5CSNA 4WRIA 2KOTA 5CSFA 1M46A 1QX7A 1F70A 1KK7Y 3NXAA 1BLQA 2KDHA 2M7NA 1RTP1 1N0YA 2NCPA 1B4CA 1L7ZA 1MHOA 2PASA 2GGMA 1UUSA 3BOWA 3PFVA 4PE1A 5GQQC 2L2EA 1F54A 2WCFA 2Y1NA 4QJ3B 1N65A 3DVEA 1UHNA 5AANA 4GAOA 4N1GA 1F71A 1BR4B 1A4PA 1CMGA 1XFWO 3QRXA 1KQMC 4MRYA 1BU3A 2BBMA 2FCEA 1XFVO 2L4IA 4MZKA 3SG6A 2BBNA 4YBHB 2KAXA 1CNPA 1K9UA 3O2PA 1C07A 3EVRA 1B7TZ 3NSLA 2MLFC 1CMFA 3VRPA 2LV7A 4N5XA 1CLMA 2ZKMX 2K61A 1SMGA 4OV2A 1WRZA 1OQPA 1A29A 1NX0A 3C1VA 4DIRA 1J7PA 2M9GA 2LHLA 1CB1A 1KQVA 1YUTA 2K7CA 1D1OA 1QVIY 1LA3A 3FWBA 2KAYA 1GGZA 3I5HB 1QJTA 1YX8A 2L51A 2PRUA 5KU1A 1JFJA 1SYMA 1QX5B 4R1EA 1ZUZA 2ISDA 4PDZA 5HKWA 4F0ZB 1JUOA 1UHHA 3SG2A 2JXCA 2L0PA 1SPYA 4M2QA 4MZJA 2JT3A 2LC5A 3CS1A 3I5IC 1B8RA 2OS8C 3LK1A 5DKRA 3IQOA 1SL7A 3TZ1A 2WNDA 4QJ5B 1OZSA 3VRQA 1UHKA 4I5NB 4ETOA 1EXRA 2CBLA 3BXKA 1SK6D 3KPXA 4WQ2A 4BY5A 3DVKA 1SCMB 3F45A 3TUYC 1CDPA 1IRJA 2GGZA 1XVJA 4Q04A 4CIDA 3WHUB 4L9MA 2KSPA 5HLVA 1TRFA 1PK0D 2WCEA 1S26D 3PATA 2PALA 1FBVA 3CLNA 2KI4B 2KBMA 4C0LA 3DVMA 1PULA 3EKJA 2MJWB 1BG1A 1XYDA 2EHBA 1S6CA 4MZLA 3NSKA 1NWDA 3RM1A 1A03A 1RJVA 1UHIA 4AOMA 1YUUA 2EC6B 1QV1A 1BODA 1TIZA 4TNCA 2LNKA 5PALA 1J55A 3I5GB 3PSRA 3BQ3A 2K7BA 3A4UB 3LK0A 2EC6C 1EJ3A 1RFJA 4MSPA 1DF0A 3MSEB 2H61A 3KF9A 4ORAB 4PALA 1QTXA 4YI8A 4I5KA 2G2BA 1WY9A 3KO0A 1SNLA 2G9BA 1DJGA 1QLSA 1B9AA 1B47A 1V1FA 1XFYO 2AUCA 1JF0A 3EKHA 2LE9B 3OX5A 3VRRA 3JTDC 3IF7A 3ICBA 4HSZA 4PE0A 1W7IB 1OOJA 2ZFDA 3VGOA 1SL8A 2JU0A 2OTGC 1XFUO 5KTYA 1QLKA 1TN4A 1J1DA 1GJYA 2WORA 2CXJA 1CLBA 3OX6A 2K7OA 2KBIA 1IH0A 1KK7Z 2Y4QA 3KHEA 4PCWA 1IQ5A 4USLA 1H4BA 1G33A 3NSOA 1LXFC 1CDMA 2KFFA 1C7VA 1AHRA 3SJSA 4CPVA 4M2OA 2B1UA 2F2OA 5I2LA 1K9KA 4N1FA 1PSRA 1JF2A 3NSIA 4OVNF 3SG5A 1ZMZA 2SASA 2K8MB 3K21A 3PN7B 3AAKA 3CR2A 2K2AA 2HETA 4CFRA 2JTZA 1A2XA 1IWQA 1BR1B 2BE6A 2KI4C 3EK4A 4PHJA
chains in the Genus database with same CATH superfamily
1UURA 2IS9A 1YUSA 1JC2A 2CNPA 1XFZO 3B86A 2BL0C 3D78A 1K93D 2M1KB 3CGAA 3SG3A 5HYDA 2M49B 2I7AA 1MXEA 2LLTA 3OB1B 1TNXA 1XK4C 4JD9A 3BFAA 5ER4X 1BF5A 1FW4A 3BUWB 2I94A 2LCPA 5AEQA 3TDZA 1NCYA 1WLZA 2M3WA 1K90D 2MHHA 1DJHA 2ZRTA 2LVVA 3RLZA 3WNXB 3CDNA 1J7QA 4YGAA 2RGIA 1KQMB 4WQ3A 2BL0B 1CDNA 4I5JA 3I5FB 3VB1A 4CLNA 3EK7A 2I18A 4GGFA 4HREE 4MN0A 3R1OA 3AKAA 3CR5X 3OB2B 1AUIB 5FYXA 1MWNA 1OMVA 2LMTA 2PYQA 3CR4X 4A4BA 1CFDA 5HL1A 3S0BA 1PRWA 3I5FC 1ZOTB 2H61C 2JC2A 3S0GA 5AERA 2P6BB 2K0JA 4MVFA 3OHMB 4M2PA 1DMOA 2BCXA 2JPTA 5KSZA 1FF1A 1LKJA 2PVBA 2E6WA 1L2OC 1QATA 1QIVA 2FCDA 2QEHA 4OR9B 1H8BA 1K8UA 2KNEA 1NIWA 3L4AA 2KI6D 1F4QA 2LUXA 2QEBA 1Y1XA 1SW8A 1SRAA 1KK8B 1M45A 2JPOA 3DD4A 1CM1A 5G08A 5CPVA 5I2OA 1J7RA 1S5GY 4NDDA 1ODBA 3L47A 4DS7A 5JJGA 3TDIA 1WLMA 2HQ8A 1KWOB 3DZTA 2LP3A 1QX2A 3LCPC 2K7DA 3M0WA 3Q8IA 3WHTB 5BPJA 2O5GA 2H8VA 1SBJA 2JWWA 5HKYA 2HF5A 3IQQA 2LVKA 1MUXA 2LVIA 2WCBA 3D10A 4JQ0D 1Z4HA 4OCIA 1CFCA 2M1UA 1LS8A 2D8NA 4C0JA 3S0EA 1G8IA 1NP8A 1PVAA 1CDLA 3VRNA 1JFKA 3FE8A 1DGUA 3TUYB 4OKHA 2A4JA 3DYEA 3BFBA 1SSEB 2QACA 2JZIA 3ZNIA 1CFPA 1B7TY 4P2YB 5FI6A 4JPZB 1BOCA 3FE6A 1KFUL 2OS8B 3I5IB 2M7LA 3TS5C 1DJWA 1TUJA 5D69A 1J1EA 4GGFC 4FQOA 1N2DA 4ICBA 1E8AA 1TNQA 2GV5A 1Y1AA 4ZCUA 4GGNA 2NCOA 3DVJA 2GTEA 2L4HA 1MQ1A 1T14A 3LL8B 4HRGA 1BMOA 1F55A 1LA0A 2LMUA 4MLWA 5IBWA 1IG5A 3BYAA 3L4LA 1YVHA 3SS3A 2L98A 1XK4A 1CLLA 2HPSA 3TS5B 1TTXA 1VRKA 2PMYA 1UHJA 1NCXA 2LLSA 2BE4A 2I2RE 3BOWB 1DQEA 3E3RA 1RWYA 2M29A 4YGCB 1TNPA 5I2QA 3R1VA 1FI5A 1DGVA 2KLDA 1L2OB 5ER5A 4MBEA 2V53A 2O60A 1DJXA 1NCZA 2CTNA 3SG4A 1R6PA 1YRUB 1MF8B 1LINA 2AAOA 1NX3A 2KQYA 3LLEA 3TDUA 5I8NA 5EL2A 2QPTA 3B88A 1F4OA 2E30A 1U5IA 2OPOA 1WDCB 1F8HA 1IJ6A 1OE9B 2M0RA 3GK4X 1AJ4A 4D1EA 1FPWA 3H4SE 2Q4UA 3CWGA 1EG4A 2CCMA 1DEKA 3HCMA 3V2LA 1UP5A 1QXPA 2M8UA 1TOPA 4PE4A 1C7WA 1OZOA 2MAZA 2QDIA 3EVUA 4BY4A 4ORBB 4DUQA 4YGEB 1IKUA 1X02A 3JTDB 1KCYA 1XFXO 2LANA 3DF0A 3CZTX 3SIAA 3FE9A 1CTRA 1RK9A 2LHIA 3D0YA 3O4YA 3BUMB 3D77A 3I5GC 4OZDA 1B8CA 1Z2CB 1OW4A 1IGVA 1KSMA 1A75B 1OOHA 1WRLA 2NZ0A 4XJKB 4YGDB 1XO5A 2MBXA 4GUKA 2Y1MA 4NDBA 3RZSA 2MA2A 2LM5A 5F6TA 2F3ZA 3S0FA 2Y5IA 3EVVA 3EG5B 1GM0A 1CKKA 1TNWA 1XA5A 2JOJA 2KGBC 2FOTA 1ZACA 2AMIA 2JULA 1MR8A 5DKNA 1EH2A 1KWOC 2TN4A 1CM4A 4YI9A 4QJ4B 4YRUA 5K89A 3PN7C 2L5XB 1YVLA 1U5IB 3GOFA 3CZ0A 4ZCVA 1HQVA 1NPQA 4DCKA 1DJZA 3SS5A 3VROA 1AP4A 5AFPA 2JT8A 4NQGA 1RECA 5DKQA 4AQIA 5CSJA 1JBAA 2F3YA 2Q91A 3S0AA 3AAJA 2BKHB 1KFXL 2K2FA 2F8PA 1M31A 2JXLA 1AK8A 2LMVA 4HRHA 1SCMC 1GQMA 3O6BA 1EL4A 2JNXA 3A8RA 4NDCA 2M97A 1J7OA 5HLOA 1QASA 1DT7B 2KFGA 3HX4A 1Q80A 4YGBB 3NHTA 2BKIB 1SKTA 2KHNA 2KPHA 5J3XA 1M63B 3SG7A 1YTZC 4JWQA 2KQ6A 2QEVA 4U8DA 4DRWA 1NUBA 2PQLA 2MRDA 1SCVA 3O4XA 1DJIA 2ZNEA 3D76A 1K9PA 5B8IB 1PSBA 1R2UA 2JT0A 3FWCA 2JRFA 4MEWA 1M39A 3D75A 3UO9A 2WC6A 1K94A 1YURA 2FJUB 2NXQA 3PALA 1ALVA 2JNFA 1IIOA 3WXAA 1SL9A 1NX2A 3I5HC 1GGWA 4MRXA 1SR6B 1C3ZA 2BCBA 1OSAA 2LP2A 1RROA 2WCJA 2WOSA 2ZN8A 1S1EA 3JVTB 1AJ5A 2JQ6A 3OBVA 1Y0VH 2KGRA 4GNKB 1OOFA 3OGNA 3PM8A 2ZNDA 1V1GA 1YRTB 2HQWA 1S6JA 1AVSA 1ZFSA 1Y1UA 1MXLC 1K96A 4ORCB 1W7JB 3FIAA 2KFHA 2WCMA 1NX1A 3B87A 1YX7A 4C0KA 1DC1A 2F33A 2F2PA 1SR6C 3O78A 5D7FA 2H2KA 1S6IA 1BT6A 5CSIA 1K95A 1QVIZ 2PSRA 1S36A 1TCOB 1PALA 3JVTC 3CTNA 1JSAA 1IQ3A 1UWOA 3BUNB 2OTGB 2WC8A 1DJYA 1Y6WA 1DF0B 4YI8A 2ERBA 2L50A 2NLNA 5TNCA 1TCFA 2VRGA 2LVJA 3SIBA 1B1GA 4PE7A 4GFTA 4I5LB 2DOQA 1K2HA 1ALWA 2R2IA 3CABA 1SY9A 3EK8A 4A4CA 4UPGA 1WDCC 1DTLA 1FI6A 1QIWA 1OMDA 1YR5A 2L5YA 3BUXB 1DVIA 4E68A 1G4YR 4GBAA 4XYNA 4PHMA 2ZRSA 1WRKA 1KSOA 1W9ZA 4PHNA 3D73A 3GK2A 3AKBA 1BJFA 5JOLA 1KFUS 3CZ2A 2KYFA 3KEVA 2BECA 2KI6C 1CFFA 2SCPA 3FS7A 1EG3A 1NYAA 1S3PA 3PLFB 5AXIA 1A75A 2EGDA 4FTGA 3BFHA 1LVCD 4XJKA 5HKZA 3ZWHA 1JWDA 4CFQA 1S5GZ 2COLB 1OMRA 1B8LA 1QS7A 3B7AA 1QV0A 1HT9A 1TUZA 2BCAA 2JTTA 3D0YB 3DF0B 1IJ5A 2KYCA 4P5OE 1KFXS 1PVBA 3BUOB 4AQJA 2MLEC 2CT9A 2KAVA 1NSHA 4GPLB 2LLUA 2LUCA 3GK1A 4PHKA 3OP0A 4IL1A 2ZN9A 2LAPA 3PM2A 1KK8C 5CSNA 4WRIA 2KOTA 5CSFA 1M46A 1QX7A 3R72A 1F70A 1KK7Y 3NXAA 1BLQA 3B6XA 2KDHA 2M7NA 1RTP1 1N0YA 2NCPA 1B4CA 1L7ZA 1MHOA 3K1EA 2PASA 2GGMA 1UUSA 3BOWA 3PFVA 4PE1A 5GQQC 2L2EA 1F54A 2WCFA 2Y1NA 4QJ3B 1N65A 3DVEA 1UHNA 5AANA 4GAOA 3IVTA 4N1GA 1F71A 1BR4B 5D3OA 1A4PA 1CMGA 1XFWO 3QRXA 1KQMC 4MRYA 1BU3A 2BBMA 1P28A 1XFVO 2FCEA 2L4IA 4MZKA 5FI7A 3SG6A 2BBNA 4YBHB 2KAXA 1DELA 3D74A 1CNPA 1K9UA 3O2PA 1C07A 3EVRA 3NGVA 1B7TZ 3NSLA 2MLFC 1CMFA 3VRPA 4PT1A 2LV7A 4N5XA 1CLMA 2P70A 2ZKMX 2K61A 1TWOA 1SMGA 4OV2A 2WCKA 1WRZA 3QMEA 1OQPA 1A29A 4JKTA 3S0DA 1NX0A 3UNWA 3C1VA 2P71A 4DIRA 1J7PA 2M9GA 2LHLA 4F7FA 1CB1A 1KQVA 1YUTA 2K7CA 1D1OA 1QVIY 1QWVA 1LA3A 3FWBA 2KAYA 1GGZA 3I5HB 2KLEA 5DICA 1QJTA 1YX8A 2L51A 2PRUA 5KU1A 1JFJA 1SYMA 1QX5B 4R1EA 1ZUZA 2ISDA 1XFRA 4PDZA 3BJHA 2BNXA 5HKWA 4F0ZB 1JUOA 1UHHA 3SG2A 2JXCA 2L0PA 1SPYA 4M2QA 4MZJA 4FQTA 2JT3A 2LC5A 3CS1A 3I5IC 1B8RA 1ORGA 2OS8C 3LK1A 5DKRA 3IQOA 1SL7A 3TZ1A 2WNDA 4QJ5B 1OZSA 3VRQA 1UHKA 4I5NB 4ETOA 1EXRA 2K60A 2CBLA 3BXKA 1SK6D 3KPXA 4WQ2A 4BY5A 4INXA 3DVKA 1SCMB 3F45A 3TUYC 1CDPA 1IRJA 2GGZA 1XVJA 4Q04A 4CIDA 3WHUB 4L9MA 2KSPA 5HLVA 1TRFA 1PK0D 2WCEA 1S26D 3PATA 2PALA 1FBVA 2WC5A 2KI4B 3CLNA 2KBMA 5FI2A 4C0LA 3DVMA 1PULA 3EKJA 2MJWB 1BG1A 4INWA 1XYDA 2EHBA 1S6CA 4MZLA 3NSKA 1NWDA 3RM1A 1A03A 2L2CA 1RJVA 4KYNA 1UHIA 4AOMA 1YUUA 2EC6B 3DXLA 1QV1A 2BAPA 1BODA 2QEOA 1TIZA 4TNCA 2LNKA 5PALA 1J55A 3I5GB 3PSRA 3BQ3A 2K7BA 3A4UB 3LK0A 2EC6C 1EJ3A 1RFJA 4MSPA 1DF0A 3CYZA 2H61A 3KF9A 3MSEB 4ORAB 1QTXA 4PALA 4I5KA 2G2BA 3NHIA 1WY9A 3KO0A 1SNLA 2G9BA 3DY9A 1DJGA 1QLSA 1B9AA 1B47A 1V1FA 1XFYO 2AUCA 1JF0A 3EKHA 2LE9B 3OX5A 3VRRA 3JTDC 3IF7A 3ICBA 4HSZA 4PE0A 1W7IB 2WCHA 1OOIX 1OOJA 2ZFDA 3VGOA 1SL8A 2WCLA 2JU0A 2OTGC 1XFUO 5KTYA 1QLKA 1TN4A 1J1DA 1GJYA 2WORA 2CXJA 1CLBA 3OX6A 2K7OA 2KBIA 1IH0A 1KK7Z 2Y4QA 3KHEA 4PCWA 1IQ5A 4USLA 3N7HA 5I94A 1H4BA 2FJYA 1G33A 3NSOA 1LXFC 1CDMA 3SS4A 2KFFA 1C7VA 1AHRA 3SJSA 4CPVA 4M2OA 2B1UA 2F2OA 5I2LA 1K9KA 4N1FA 1PSRA 1JF2A 3NSIA 4IJ7A 4OVNF 3SG5A 1ZMZA 3R1PA 2SASA 2K8MB 3K21A 1C3YA 3PN7B 3AAKA 1OOGA 3CR2A 2K2AA 2HETA 3PJIA 3CZ1A 2JTZA 4CFRA 1A2XA 1IWQA 1BR1B 2BE6A 2YGUA 2KI4C 3EK4A 4PHJA
chains in the Genus database with same CATH topology
1UURA 2IS9A 1YUSA 1JC2A 2CNPA 1XFZO 2BL0C 1K93D 2M1KB 3CGAA 3SG3A 5HYDA 2M49B 2I7AA 1MXEA 2LLTA 3OB1B 1TNXA 1XK4C 5ER4X 1BF5A 1FW4A 3BUWB 2I94A 2LCPA 5AEQA 3TDZA 1NCYA 1WLZA 2M3WA 1K90D 2MHHA 1DJHA 2ZRTA 2LVVA 3RLZA 3WNXB 1J7QA 4YGAA 2RGIA 1KQMB 4WQ3A 2BL0B 1CDNA 4I5JA 3I5FB 4CLNA 3EK7A 2I18A 4GGFA 4HREE 4MN0A 3AKAA 3CR5X 3OB2B 1AUIB 5FYXA 1MWNA 1OMVA 2LMTA 3CR4X 4A4BA 1CFDA 1PRWA 3I5FC 1ZOTB 2H61C 2JC2A 5AERA 2P6BB 2K0JA 4MVFA 3OHMB 4M2PA 1DMOA 2BCXA 2JPTA 5KSZA 1FF1A 1LKJA 2PVBA 2E6WA 1L2OC 1QATA 1QIVA 2FCDA 4OR9B 1H8BA 1K8UA 2KNEA 1NIWA 2KI6D 1F4QA 2LUXA 1Y1XA 1SW8A 1SRAA 1KK8B 1M45A 3DD4A 5G08A 1CM1A 5CPVA 5I2OA 1J7RA 1S5GY 4NDDA 1ODBA 4DS7A 5JJGA 3TDIA 1WLMA 2HQ8A 1KWOB 2LP3A 1QX2A 3LCPC 2K7DA 3M0WA 3WHTB 5BPJA 2O5GA 1SBJA 2JWWA 5HKYA 2HF5A 3IQQA 2LVKA 1MUXA 2LVIA 2WCBA 3D10A 4JQ0D 4OCIA 1CFCA 2M1UA 2D8NA 4C0JA 1G8IA 1NP8A 1PVAA 1CDLA 3VRNA 1JFKA 3TUYB 1DGUA 4OKHA 2A4JA 2QACA 2JZIA 3ZNIA 1CFPA 1B7TY 4P2YB 4JPZB 1BOCA 1KFUL 2OS8B 3I5IB 2M7LA 3TS5C 1DJWA 5D69A 1J1EA 4GGFC 4FQOA 1N2DA 4ICBA 1E8AA 1TNQA 2GV5A 1Y1AA 4ZCUA 4GGNA 2NCOA 3DVJA 2L4HA 1MQ1A 4HRGA 3LL8B 1BMOA 1F55A 1LA0A 2LMUA 4MLWA 5IBWA 1IG5A 3BYAA 1YVHA 2L98A 1XK4A 2HPSA 1CLLA 3TS5B 1TTXA 1VRKA 2PMYA 1UHJA 1NCXA 2LLSA 2BE4A 2I2RE 3BOWB 3E3RA 1RWYA 2M29A 4YGCB 1TNPA 5I2QA 1FI5A 1DGVA 1L2OB 5ER5A 4MBEA 2V53A 2O60A 1DJXA 1NCZA 2CTNA 3SG4A 1R6PA 1YRUB 1MF8B 1LINA 2AAOA 1NX3A 2KQYA 3LLEA 3TDUA 5I8NA 2QPTA 1F4OA 2E30A 1U5IA 2OPOA 1WDCB 1F8HA 1IJ6A 1OE9B 2M0RA 3GK4X 1AJ4A 4D1EA 1FPWA 3H4SE 2Q4UA 3CWGA 1EG4A 2CCMA 3HCMA 1UP5A 1QXPA 2M8UA 1TOPA 4PE4A 1C7WA 1OZOA 2MAZA 4BY4A 3EVUA 4DUQA 4ORBB 1IKUA 4YGEB 1X02A 3JTDB 1KCYA 1XFXO 2LANA 3DF0A 3CZTX 3SIAA 1CTRA 1RK9A 2LHIA 3D0YA 3O4YA 3BUMB 3I5GC 1B8CA 1IGVA 1KSMA 1A75B 2NZ0A 1WRLA 4XJKB 4YGDB 2MBXA 1XO5A 4GUKA 2Y1MA 4NDBA 2MA2A 2LM5A 5F6TA 2F3ZA 2Y5IA 3EVVA 1CKKA 1TNWA 1XA5A 2JOJA 2KGBC 2FOTA 1ZACA 2AMIA 2JULA 1MR8A 5DKNA 1EH2A 1KWOC 2TN4A 1CM4A 4YI9A 4QJ4B 4YRUA 5K89A 3PN7C 2L5XB 1YVLA 1U5IB 3GOFA 4ZCVA 1HQVA 1NPQA 4DCKA 1DJZA 3VROA 1AP4A 5AFPA 2JT8A 4NQGA 1RECA 5DKQA 4AQIA 5CSJA 1JBAA 2F3YA 2Q91A 3AAJA 2BKHB 1KFXL 2K2FA 2F8PA 1M31A 2JXLA 1AK8A 2LMVA 4HRHA 1SCMC 1GQMA 3O6BA 1EL4A 2JNXA 3A8RA 4NDCA 2M97A 1J7OA 5HLOA 1QASA 1DT7B 2KFGA 3HX4A 1Q80A 4YGBB 2BKIB 1SKTA 2KHNA 3SG7A 5J3XA 1M63B 1YTZC 4JWQA 2KQ6A 4U8DA 4DRWA 1NUBA 2MRDA 1SCVA 1DJIA 2ZNEA 1K9PA 5B8IB 1PSBA 1R2UA 2JT0A 3FWCA 2JRFA 4MEWA 1M39A 1K94A 1YURA 2FJUB 2NXQA 3PALA 1ALVA 2JNFA 3WXAA 1SL9A 1NX2A 3I5HC 1GGWA 4MRXA 1SR6B 2BCBA 1OSAA 2LP2A 1RROA 2WOSA 2ZN8A 1S1EA 3JVTB 1AJ5A 2JQ6A 1Y0VH 2KGRA 4GNKB 3PM8A 2ZNDA 1V1GA 1YRTB 2HQWA 1S6JA 1AVSA 1ZFSA 1Y1UA 1MXLC 1K96A 4ORCB 1W7JB 3FIAA 2KFHA 1NX1A 1YX7A 4C0KA 2F33A 2F2PA 1SR6C 3O78A 5D7FA 2H2KA 1S6IA 1BT6A 5CSIA 1K95A 1QVIZ 2PSRA 1S36A 1TCOB 1PALA 3JVTC 3CTNA 1JSAA 1IQ3A 1UWOA 3BUNB 2OTGB 2WC8A 1DJYA 1Y6WA 1DF0B 2L50A 2NLNA 5TNCA 1TCFA 2VRGA 2LVJA 3SIBA 1B1GA 4PE7A 4GFTA 4I5LB 2DOQA 1K2HA 1ALWA 2R2IA 1SY9A 3EK8A 4A4CA 4UPGA 1WDCC 1DTLA 1FI6A 1QIWA 1OMDA 1YR5A 3BUXB 1DVIA 4E68A 1G4YR 4GBAA 4XYNA 4PHMA 2ZRSA 1WRKA 1KSOA 4PHNA 3GK2A 3AKBA 1BJFA 5JOLA 1KFUS 3KEVA 2KYFA 2BECA 2KI6C 1CFFA 2SCPA 3FS7A 1EG3A 1NYAA 1S3PA 3PLFB 5AXIA 1A75A 2EGDA 4FTGA 4XJKA 1LVCD 5HKZA 3ZWHA 1JWDA 4CFQA 1S5GZ 2COLB 1OMRA 1B8LA 1QS7A 1QV0A 1HT9A 2BCAA 3D0YB 2JTTA 3DF0B 1IJ5A 2KYCA 4P5OE 1KFXS 1PVBA 3BUOB 4AQJA 2MLEC 2CT9A 2KAVA 1NSHA 4GPLB 2LLUA 2LUCA 3GK1A 4PHKA 3OP0A 4IL1A 2ZN9A 2LAPA 1KK8C 5CSNA 4WRIA 2KOTA 5CSFA 1M46A 1QX7A 1F70A 1KK7Y 3NXAA 1BLQA 2KDHA 2M7NA 1RTP1 1N0YA 2NCPA 1B4CA 1L7ZA 1MHOA 2PASA 2GGMA 1UUSA 3BOWA 3PFVA 4PE1A 5GQQC 2L2EA 1F54A 2WCFA 2Y1NA 4QJ3B 1N65A 3DVEA 1UHNA 5AANA 4GAOA 4N1GA 1F71A 1BR4B 1A4PA 1CMGA 1XFWO 3QRXA 1KQMC 4MRYA 1BU3A 2BBMA 2FCEA 1XFVO 2L4IA 4MZKA 3SG6A 2BBNA 4YBHB 2KAXA 1CNPA 1K9UA 3O2PA 1C07A 3EVRA 1B7TZ 3NSLA 2MLFC 1CMFA 3VRPA 2LV7A 4N5XA 1CLMA 2ZKMX 2K61A 1SMGA 4OV2A 1WRZA 1OQPA 1A29A 1NX0A 3C1VA 4DIRA 1J7PA 2M9GA 2LHLA 1CB1A 1KQVA 1YUTA 2K7CA 1D1OA 1QVIY 1LA3A 3FWBA 2KAYA 1GGZA 3I5HB 1QJTA 1YX8A 2L51A 2PRUA 5KU1A 1JFJA 1SYMA 1QX5B 4R1EA 1ZUZA 2ISDA 4PDZA 5HKWA 4F0ZB 1JUOA 1UHHA 3SG2A 2JXCA 2L0PA 1SPYA 4M2QA 4MZJA 2JT3A 2LC5A 3CS1A 3I5IC 1B8RA 2OS8C 3LK1A 5DKRA 3IQOA 1SL7A 3TZ1A 2WNDA 4QJ5B 1OZSA 3VRQA 1UHKA 4I5NB 4ETOA 1EXRA 2CBLA 3BXKA 1SK6D 3KPXA 4WQ2A 4BY5A 3DVKA 1SCMB 3F45A 3TUYC 1CDPA 1IRJA 2GGZA 1XVJA 4Q04A 4CIDA 3WHUB 4L9MA 2KSPA 5HLVA 1TRFA 1PK0D 2WCEA 1S26D 3PATA 2PALA 1FBVA 3CLNA 2KI4B 2KBMA 4C0LA 3DVMA 1PULA 3EKJA 2MJWB 1BG1A 1XYDA 2EHBA 1S6CA 4MZLA 3NSKA 1NWDA 3RM1A 1A03A 1RJVA 1UHIA 4AOMA 1YUUA 2EC6B 1QV1A 1BODA 1TIZA 4TNCA 2LNKA 5PALA 1J55A 3I5GB 3PSRA 3BQ3A 2K7BA 3A4UB 3LK0A 2EC6C 1EJ3A 1RFJA 4MSPA 1DF0A 3MSEB 2H61A 3KF9A 4ORAB 4PALA 1QTXA 4YI8A 4I5KA 2G2BA 1WY9A 3KO0A 1SNLA 2G9BA 1DJGA 1QLSA 1B9AA 1B47A 1V1FA 1XFYO 2AUCA 1JF0A 3EKHA 2LE9B 3OX5A 3VRRA 3JTDC 3IF7A 3ICBA 4HSZA 4PE0A 1W7IB 1OOJA 2ZFDA 3VGOA 1SL8A 2JU0A 2OTGC 1XFUO 5KTYA 1QLKA 1TN4A 1J1DA 1GJYA 2WORA 2CXJA 1CLBA 3OX6A 2K7OA 2KBIA 1IH0A 1KK7Z 2Y4QA 3KHEA 4PCWA 1IQ5A 4USLA 1H4BA 1G33A 3NSOA 1LXFC 1CDMA 2KFFA 1C7VA 1AHRA 3SJSA 4CPVA 4M2OA 2B1UA 2F2OA 5I2LA 1K9KA 4N1FA 1PSRA 1JF2A 3NSIA 4OVNF 3SG5A 1ZMZA 2SASA 2K8MB 3K21A 3PN7B 3AAKA 3CR2A 2K2AA 2HETA 4CFRA 2JTZA 1A2XA 1IWQA 1BR1B 2BE6A 2KI4C 3EK4A 4PHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UUR A;  2IS9 A;  1YUS A;  1JC2 A;  2CNP A;  1XFZ O;  2BL0 C;  1K93 D;  2M1K B;  3CGA A;  3SG3 A;  5HYD A;  2M49 B;  2I7A A;  1MXE A;  2LLT A;  3OB1 B;  1TNX A;  1XK4 C;  5ER4 X;  1BF5 A;  1FW4 A;  3BUW B;  2I94 A;  2LCP A;  5AEQ A;  3TDZ A;  1NCY A;  1WLZ A;  2M3W A;  1K90 D;  2MHH A;  1DJH A;  2ZRT A;  2LVV A;  3RLZ A;  3WNX B;  1J7Q A;  4YGA A;  2RGI A;  1KQM B;  4WQ3 A;  2BL0 B;  1CDN A;  4I5J A;  3I5F B;  4CLN A;  3EK7 A;  2I18 A;  4GGF A;  4HRE E;  4MN0 A;  3AKA A;  3CR5 X;  3OB2 B;  1AUI B;  5FYX A;  1MWN A;  1OMV A;  2LMT A;  3CR4 X;  4A4B A;  1CFD A;  1PRW A;  3I5F C;  1ZOT B;  2H61 C;  2JC2 A;  5AER A;  2P6B B;  2K0J A;  4MVF A;  3OHM B;  4M2P A;  1DMO A;  2BCX A;  2JPT A;  5KSZ A;  1FF1 A;  1LKJ A;  2PVB A;  2E6W A;  1L2O C;  1QAT A;  1QIV A;  2FCD A;  4OR9 B;  1H8B A;  1K8U A;  2KNE A;  1NIW A;  2KI6 D;  1F4Q A;  2LUX A;  1Y1X A;  1SW8 A;  1SRA A;  1KK8 B;  1M45 A;  3DD4 A;  5G08 A;  1CM1 A;  5CPV A;  5I2O A;  1J7R A;  1S5G Y;  4NDD A;  1ODB A;  4DS7 A;  5JJG A;  3TDI A;  1WLM A;  2HQ8 A;  1KWO B;  2LP3 A;  1QX2 A;  3LCP C;  2K7D A;  3M0W A;  3WHT B;  5BPJ A;  2O5G A;  1SBJ A;  2JWW A;  5HKY A;  2HF5 A;  3IQQ A;  2LVK A;  1MUX A;  2LVI A;  2WCB A;  3D10 A;  4JQ0 D;  4OCI A;  1CFC A;  2M1U A;  2D8N A;  4C0J A;  1G8I A;  1NP8 A;  1PVA A;  1CDL A;  3VRN A;  1JFK A;  3TUY B;  1DGU A;  4OKH A;  2A4J A;  2QAC A;  2JZI A;  3ZNI A;  1CFP A;  1B7T Y;  4P2Y B;  4JPZ B;  1BOC A;  1KFU L;  2OS8 B;  3I5I B;  2M7L A;  3TS5 C;  1DJW A;  5D69 A;  1J1E A;  4GGF C;  4FQO A;  1N2D A;  4ICB A;  1E8A A;  1TNQ A;  2GV5 A;  1Y1A A;  4ZCU A;  4GGN A;  2NCO A;  3DVJ A;  2L4H A;  1MQ1 A;  4HRG A;  3LL8 B;  1BMO A;  1F55 A;  1LA0 A;  2LMU A;  4MLW A;  5IBW A;  1IG5 A;  3BYA A;  1YVH A;  2L98 A;  1XK4 A;  2HPS A;  1CLL A;  3TS5 B;  1TTX A;  1VRK A;  2PMY A;  1UHJ A;  1NCX A;  2LLS A;  2BE4 A;  2I2R E;  3BOW B;  3E3R A;  1RWY A;  2M29 A;  4YGC B;  1TNP A;  5I2Q A;  1FI5 A;  1DGV A;  1L2O B;  5ER5 A;  4MBE A;  2V53 A;  2O60 A;  1DJX A;  1NCZ A;  2CTN A;  3SG4 A;  1R6P A;  1YRU B;  1MF8 B;  1LIN A;  2AAO A;  1NX3 A;  2KQY A;  3LLE A;  3TDU A;  5I8N A;  2QPT A;  1F4O A;  2E30 A;  1U5I A;  2OPO A;  1WDC B;  1F8H A;  1IJ6 A;  1OE9 B;  2M0R A;  3GK4 X;  1AJ4 A;  4D1E A;  1FPW A;  3H4S E;  2Q4U A;  3CWG A;  1EG4 A;  2CCM A;  3HCM A;  1UP5 A;  1QXP A;  2M8U A;  1TOP A;  4PE4 A;  1C7W A;  1OZO A;  2MAZ A;  4BY4 A;  3EVU A;  4DUQ A;  4ORB B;  1IKU A;  4YGE B;  1X02 A;  3JTD B;  1KCY A;  1XFX O;  2LAN A;  3DF0 A;  3CZT X;  3SIA A;  1CTR A;  1RK9 A;  2LHI A;  3D0Y A;  3O4Y A;  3BUM B;  3I5G C;  1B8C A;  1IGV A;  1KSM A;  1A75 B;  2NZ0 A;  1WRL A;  4XJK B;  4YGD B;  2MBX A;  1XO5 A;  4GUK A;  2Y1M A;  4NDB A;  2MA2 A;  2LM5 A;  5F6T A;  2F3Z A;  2Y5I A;  3EVV A;  1CKK A;  1TNW A;  1XA5 A;  2JOJ A;  2KGB C;  2FOT A;  1ZAC A;  2AMI A;  2JUL A;  1MR8 A;  5DKN A;  1EH2 A;  1KWO C;  2TN4 A;  1CM4 A;  4YI9 A;  4QJ4 B;  4YRU A;  5K89 A;  3PN7 C;  2L5X B;  1YVL A;  1U5I B;  3GOF A;  4ZCV A;  1HQV A;  1NPQ A;  4DCK A;  1DJZ A;  3VRO A;  1AP4 A;  5AFP A;  2JT8 A;  4NQG A;  1REC A;  5DKQ A;  4AQI A;  5CSJ A;  1JBA A;  2F3Y A;  2Q91 A;  3AAJ A;  2BKH B;  1KFX L;  2K2F A;  2F8P A;  1M31 A;  2JXL A;  1AK8 A;  2LMV A;  4HRH A;  1SCM C;  1GQM A;  3O6B A;  1EL4 A;  2JNX A;  3A8R A;  4NDC A;  2M97 A;  1J7O A;  5HLO A;  1QAS A;  1DT7 B;  2KFG A;  3HX4 A;  1Q80 A;  4YGB B;  2BKI B;  1SKT A;  2KHN A;  3SG7 A;  5J3X A;  1M63 B;  1YTZ C;  4JWQ A;  2KQ6 A;  4U8D A;  4DRW A;  1NUB A;  2MRD A;  1SCV A;  1DJI A;  2ZNE A;  1K9P A;  5B8I B;  1PSB A;  1R2U A;  2JT0 A;  3FWC A;  2JRF A;  4MEW A;  1M39 A;  1K94 A;  1YUR A;  2FJU B;  2NXQ A;  3PAL A;  1ALV A;  2JNF A;  3WXA A;  1SL9 A;  1NX2 A;  3I5H C;  1GGW A;  4MRX A;  1SR6 B;  2BCB A;  1OSA A;  2LP2 A;  1RRO A;  2WOS A;  2ZN8 A;  1S1E A;  3JVT B;  1AJ5 A;  2JQ6 A;  1Y0V H;  2KGR A;  4GNK B;  3PM8 A;  2ZND A;  1V1G A;  1YRT B;  2HQW A;  1S6J A;  1AVS A;  1ZFS A;  1Y1U A;  1MXL C;  1K96 A;  4ORC B;  1W7J B;  3FIA A;  2KFH A;  1NX1 A;  1YX7 A;  4C0K A;  2F33 A;  2F2P A;  1SR6 C;  3O78 A;  5D7F A;  2H2K A;  1S6I A;  1BT6 A;  5CSI A;  1K95 A;  1QVI Z;  2PSR A;  1S36 A;  1TCO B;  1PAL A;  3JVT C;  3CTN A;  1JSA A;  1IQ3 A;  1UWO A;  3BUN B;  2OTG B;  2WC8 A;  1DJY A;  1Y6W A;  1DF0 B;  2L50 A;  2NLN A;  5TNC A;  1TCF A;  2VRG A;  2LVJ A;  3SIB A;  1B1G A;  4PE7 A;  4GFT A;  4I5L B;  2DOQ A;  1K2H A;  1ALW A;  2R2I A;  1SY9 A;  3EK8 A;  4A4C A;  4UPG A;  1WDC C;  1DTL A;  1FI6 A;  1QIW A;  1OMD A;  1YR5 A;  3BUX B;  1DVI A;  4E68 A;  1G4Y R;  4GBA A;  4XYN A;  4PHM A;  2ZRS A;  1WRK A;  1KSO A;  4PHN A;  3GK2 A;  3AKB A;  1BJF A;  5JOL A;  1KFU S;  3KEV A;  2KYF A;  2BEC A;  2KI6 C;  1CFF A;  2SCP A;  3FS7 A;  1EG3 A;  1NYA A;  1S3P A;  3PLF B;  5AXI A;  1A75 A;  2EGD A;  4FTG A;  4XJK A;  1LVC D;  5HKZ A;  3ZWH A;  1JWD A;  4CFQ A;  1S5G Z;  2COL B;  1OMR A;  1B8L A;  1QS7 A;  1QV0 A;  1HT9 A;  2BCA A;  3D0Y B;  2JTT A;  3DF0 B;  1IJ5 A;  2KYC A;  4P5O E;  1KFX S;  1PVB A;  3BUO B;  4AQJ A;  2MLE C;  2CT9 A;  2KAV A;  1NSH A;  4GPL B;  2LLU A;  2LUC A;  3GK1 A;  4PHK A;  3OP0 A;  4IL1 A;  2ZN9 A;  2LAP A;  1KK8 C;  5CSN A;  4WRI A;  2KOT A;  5CSF A;  1M46 A;  1QX7 A;  1F70 A;  1KK7 Y;  3NXA A;  1BLQ A;  2KDH A;  2M7N A;  1RTP 1;  1N0Y A;  2NCP A;  1B4C A;  1L7Z A;  1MHO A;  2PAS A;  2GGM A;  1UUS A;  3BOW A;  3PFV A;  4PE1 A;  5GQQ C;  2L2E A;  1F54 A;  2WCF A;  2Y1N A;  4QJ3 B;  1N65 A;  3DVE A;  1UHN A;  5AAN A;  4GAO A;  4N1G A;  1F71 A;  1BR4 B;  1A4P A;  1CMG A;  1XFW O;  3QRX A;  1KQM C;  4MRY A;  1BU3 A;  2BBM A;  2FCE A;  1XFV O;  2L4I A;  4MZK A;  3SG6 A;  2BBN A;  4YBH B;  2KAX A;  1CNP A;  1K9U A;  3O2P A;  1C07 A;  3EVR A;  1B7T Z;  3NSL A;  2MLF C;  1CMF A;  3VRP A;  2LV7 A;  4N5X A;  1CLM A;  2ZKM X;  2K61 A;  1SMG A;  4OV2 A;  1WRZ A;  1OQP A;  1A29 A;  1NX0 A;  3C1V A;  4DIR A;  1J7P A;  2M9G A;  2LHL A;  1CB1 A;  1KQV A;  1YUT A;  2K7C A;  1D1O A;  1QVI Y;  1LA3 A;  3FWB A;  2KAY A;  1GGZ A;  3I5H B;  1QJT A;  1YX8 A;  2L51 A;  2PRU A;  5KU1 A;  1JFJ A;  1SYM A;  1QX5 B;  4R1E A;  1ZUZ A;  2ISD A;  4PDZ A;  5HKW A;  4F0Z B;  1JUO A;  1UHH A;  3SG2 A;  2JXC A;  2L0P A;  1SPY A;  4M2Q A;  4MZJ A;  2JT3 A;  2LC5 A;  3CS1 A;  3I5I C;  1B8R A;  2OS8 C;  3LK1 A;  5DKR A;  3IQO A;  1SL7 A;  3TZ1 A;  2WND A;  4QJ5 B;  1OZS A;  3VRQ A;  1UHK A;  4I5N B;  4ETO A;  1EXR A;  2CBL A;  3BXK A;  1SK6 D;  3KPX A;  4WQ2 A;  4BY5 A;  3DVK A;  1SCM B;  3F45 A;  3TUY C;  1CDP A;  1IRJ A;  2GGZ A;  1XVJ A;  4Q04 A;  4CID A;  3WHU B;  4L9M A;  2KSP A;  5HLV A;  1TRF A;  1PK0 D;  2WCE A;  1S26 D;  3PAT A;  2PAL A;  1FBV A;  3CLN A;  2KI4 B;  2KBM A;  4C0L A;  3DVM A;  1PUL A;  3EKJ A;  2MJW B;  1BG1 A;  1XYD A;  2EHB A;  1S6C A;  4MZL A;  3NSK A;  1NWD A;  3RM1 A;  1A03 A;  1RJV A;  1UHI A;  4AOM A;  1YUU A;  2EC6 B;  1QV1 A;  1BOD A;  1TIZ A;  4TNC A;  2LNK A;  5PAL A;  1J55 A;  3I5G B;  3PSR A;  3BQ3 A;  2K7B A;  3A4U B;  3LK0 A;  2EC6 C;  1EJ3 A;  1RFJ A;  4MSP A;  1DF0 A;  3MSE B;  2H61 A;  3KF9 A;  4ORA B;  4PAL A;  1QTX A;  4YI8 A;  4I5K A;  2G2B A;  1WY9 A;  3KO0 A;  1SNL A;  2G9B A;  1DJG A;  1QLS A;  1B9A A;  1B47 A;  1V1F A;  1XFY O;  2AUC A;  1JF0 A;  3EKH A;  2LE9 B;  3OX5 A;  3VRR A;  3JTD C;  3IF7 A;  3ICB A;  4HSZ A;  4PE0 A;  1W7I B;  1OOJ A;  2ZFD A;  3VGO A;  1SL8 A;  2JU0 A;  2OTG C;  1XFU O;  5KTY A;  1QLK A;  1TN4 A;  1J1D A;  1GJY A;  2WOR A;  2CXJ A;  1CLB A;  3OX6 A;  2K7O A;  2KBI A;  1IH0 A;  1KK7 Z;  2Y4Q A;  3KHE A;  4PCW A;  1IQ5 A;  4USL A;  1H4B A;  1G33 A;  3NSO A;  1LXF C;  1CDM A;  2KFF A;  1C7V A;  1AHR A;  3SJS A;  4CPV A;  4M2O A;  2B1U A;  2F2O A;  5I2L A;  1K9K A;  4N1F A;  1PSR A;  1JF2 A;  3NSI A;  4OVN F;  3SG5 A;  1ZMZ A;  2SAS A;  2K8M B;  3K21 A;  3PN7 B;  3AAK A;  3CR2 A;  2K2A A;  2HET A;  4CFR A;  2JTZ A;  1A2X A;  1IWQ A;  1BR1 B;  2BE6 A;  2KI4 C;  3EK4 A;  4PHJ A; 
#chains in the Genus database with same CATH topology
 1UUR A;  2IS9 A;  1YUS A;  1JC2 A;  2CNP A;  1XFZ O;  3B86 A;  2BL0 C;  3D78 A;  1K93 D;  2M1K B;  3CGA A;  3SG3 A;  5HYD A;  2M49 B;  2I7A A;  1MXE A;  2LLT A;  3OB1 B;  1TNX A;  1XK4 C;  4JD9 A;  3BFA A;  5ER4 X;  1BF5 A;  1FW4 A;  3BUW B;  2I94 A;  2LCP A;  5AEQ A;  3TDZ A;  1NCY A;  1WLZ A;  2M3W A;  1K90 D;  2MHH A;  1DJH A;  2ZRT A;  2LVV A;  3RLZ A;  3WNX B;  3CDN A;  1J7Q A;  4YGA A;  2RGI A;  1KQM B;  4WQ3 A;  2BL0 B;  1CDN A;  4I5J A;  3I5F B;  3VB1 A;  4CLN A;  3EK7 A;  2I18 A;  4GGF A;  4HRE E;  4MN0 A;  3R1O A;  3AKA A;  3CR5 X;  3OB2 B;  1AUI B;  5FYX A;  1MWN A;  1OMV A;  2LMT A;  2PYQ A;  3CR4 X;  4A4B A;  1CFD A;  5HL1 A;  3S0B A;  1PRW A;  3I5F C;  1ZOT B;  2H61 C;  2JC2 A;  3S0G A;  5AER A;  2P6B B;  2K0J A;  4MVF A;  3OHM B;  4M2P A;  1DMO A;  2BCX A;  2JPT A;  5KSZ A;  1FF1 A;  1LKJ A;  2PVB A;  2E6W A;  1L2O C;  1QAT A;  1QIV A;  2FCD A;  2QEH A;  4OR9 B;  1H8B A;  1K8U A;  2KNE A;  1NIW A;  3L4A A;  2KI6 D;  1F4Q A;  2LUX A;  2QEB A;  1Y1X A;  1SW8 A;  1SRA A;  1KK8 B;  1M45 A;  2JPO A;  3DD4 A;  1CM1 A;  5G08 A;  5CPV A;  5I2O A;  1J7R A;  1S5G Y;  4NDD A;  1ODB A;  3L47 A;  4DS7 A;  5JJG A;  3TDI A;  1WLM A;  2HQ8 A;  1KWO B;  3DZT A;  2LP3 A;  1QX2 A;  3LCP C;  2K7D A;  3M0W A;  3Q8I A;  3WHT B;  5BPJ A;  2O5G A;  2H8V A;  1SBJ A;  2JWW A;  5HKY A;  2HF5 A;  3IQQ A;  2LVK A;  1MUX A;  2LVI A;  2WCB A;  3D10 A;  4JQ0 D;  1Z4H A;  4OCI A;  1CFC A;  2M1U A;  1LS8 A;  2D8N A;  4C0J A;  3S0E A;  1G8I A;  1NP8 A;  1PVA A;  1CDL A;  3VRN A;  1JFK A;  3FE8 A;  1DGU A;  3TUY B;  4OKH A;  2A4J A;  3DYE A;  3BFB A;  1SSE B;  2QAC A;  2JZI A;  3ZNI A;  1CFP A;  1B7T Y;  4P2Y B;  5FI6 A;  4JPZ B;  1BOC A;  3FE6 A;  1KFU L;  2OS8 B;  3I5I B;  2M7L A;  3TS5 C;  1DJW A;  1TUJ A;  5D69 A;  1J1E A;  4GGF C;  4FQO A;  1N2D A;  4ICB A;  1E8A A;  1TNQ A;  2GV5 A;  1Y1A A;  4ZCU A;  4GGN A;  2NCO A;  3DVJ A;  2GTE A;  2L4H A;  1MQ1 A;  1T14 A;  3LL8 B;  4HRG A;  1BMO A;  1F55 A;  1LA0 A;  2LMU A;  4MLW A;  5IBW A;  1IG5 A;  3BYA A;  3L4L A;  1YVH A;  3SS3 A;  2L98 A;  1XK4 A;  1CLL A;  2HPS A;  3TS5 B;  1TTX A;  1VRK A;  2PMY A;  1UHJ A;  1NCX A;  2LLS A;  2BE4 A;  2I2R E;  3BOW B;  1DQE A;  3E3R A;  1RWY A;  2M29 A;  4YGC B;  1TNP A;  5I2Q A;  3R1V A;  1FI5 A;  1DGV A;  2KLD A;  1L2O B;  5ER5 A;  4MBE A;  2V53 A;  2O60 A;  1DJX A;  1NCZ A;  2CTN A;  3SG4 A;  1R6P A;  1YRU B;  1MF8 B;  1LIN A;  2AAO A;  1NX3 A;  2KQY A;  3LLE A;  3TDU A;  5I8N A;  5EL2 A;  2QPT A;  3B88 A;  1F4O A;  2E30 A;  1U5I A;  2OPO A;  1WDC B;  1F8H A;  1IJ6 A;  1OE9 B;  2M0R A;  3GK4 X;  1AJ4 A;  4D1E A;  1FPW A;  3H4S E;  2Q4U A;  3CWG A;  1EG4 A;  2CCM A;  1DEK A;  3HCM A;  3V2L A;  1UP5 A;  1QXP A;  2M8U A;  1TOP A;  4PE4 A;  1C7W A;  1OZO A;  2MAZ A;  2QDI A;  3EVU A;  4BY4 A;  4ORB B;  4DUQ A;  4YGE B;  1IKU A;  1X02 A;  3JTD B;  1KCY A;  1XFX O;  2LAN A;  3DF0 A;  3CZT X;  3SIA A;  3FE9 A;  1CTR A;  1RK9 A;  2LHI A;  3D0Y A;  3O4Y A;  3BUM B;  3D77 A;  3I5G C;  4OZD A;  1B8C A;  1Z2C B;  1OW4 A;  1IGV A;  1KSM A;  1A75 B;  1OOH A;  1WRL A;  2NZ0 A;  4XJK B;  4YGD B;  1XO5 A;  2MBX A;  4GUK A;  2Y1M A;  4NDB A;  3RZS A;  2MA2 A;  2LM5 A;  5F6T A;  2F3Z A;  3S0F A;  2Y5I A;  3EVV A;  3EG5 B;  1GM0 A;  1CKK A;  1TNW A;  1XA5 A;  2JOJ A;  2KGB C;  2FOT A;  1ZAC A;  2AMI A;  2JUL A;  1MR8 A;  5DKN A;  1EH2 A;  1KWO C;  2TN4 A;  1CM4 A;  4YI9 A;  4QJ4 B;  4YRU A;  5K89 A;  3PN7 C;  2L5X B;  1YVL A;  1U5I B;  3GOF A;  3CZ0 A;  4ZCV A;  1HQV A;  1NPQ A;  4DCK A;  1DJZ A;  3SS5 A;  3VRO A;  1AP4 A;  5AFP A;  2JT8 A;  4NQG A;  1REC A;  5DKQ A;  4AQI A;  5CSJ A;  1JBA A;  2F3Y A;  2Q91 A;  3S0A A;  3AAJ A;  2BKH B;  1KFX L;  2K2F A;  2F8P A;  1M31 A;  2JXL A;  1AK8 A;  2LMV A;  4HRH A;  1SCM C;  1GQM A;  3O6B A;  1EL4 A;  2JNX A;  3A8R A;  4NDC A;  2M97 A;  1J7O A;  5HLO A;  1QAS A;  1DT7 B;  2KFG A;  3HX4 A;  1Q80 A;  4YGB B;  3NHT A;  2BKI B;  1SKT A;  2KHN A;  2KPH A;  5J3X A;  1M63 B;  3SG7 A;  1YTZ C;  4JWQ A;  2KQ6 A;  2QEV A;  4U8D A;  4DRW A;  1NUB A;  2PQL A;  2MRD A;  1SCV A;  3O4X A;  1DJI A;  2ZNE A;  3D76 A;  1K9P A;  5B8I B;  1PSB A;  1R2U A;  2JT0 A;  3FWC A;  2JRF A;  4MEW A;  1M39 A;  3D75 A;  3UO9 A;  2WC6 A;  1K94 A;  1YUR A;  2FJU B;  2NXQ A;  3PAL A;  1ALV A;  2JNF A;  1IIO A;  3WXA A;  1SL9 A;  1NX2 A;  3I5H C;  1GGW A;  4MRX A;  1SR6 B;  1C3Z A;  2BCB A;  1OSA A;  2LP2 A;  1RRO A;  2WCJ A;  2WOS A;  2ZN8 A;  1S1E A;  3JVT B;  1AJ5 A;  2JQ6 A;  3OBV A;  1Y0V H;  2KGR A;  4GNK B;  1OOF A;  3OGN A;  3PM8 A;  2ZND A;  1V1G A;  1YRT B;  2HQW A;  1S6J A;  1AVS A;  1ZFS A;  1Y1U A;  1MXL C;  1K96 A;  4ORC B;  1W7J B;  3FIA A;  2KFH A;  2WCM A;  1NX1 A;  3B87 A;  1YX7 A;  4C0K A;  1DC1 A;  2F33 A;  2F2P A;  1SR6 C;  3O78 A;  5D7F A;  2H2K A;  1S6I A;  1BT6 A;  5CSI A;  1K95 A;  1QVI Z;  2PSR A;  1S36 A;  1TCO B;  1PAL A;  3JVT C;  3CTN A;  1JSA A;  1IQ3 A;  1UWO A;  3BUN B;  2OTG B;  2WC8 A;  1DJY A;  1Y6W A;  1DF0 B;  4YI8 A;  2ERB A;  2L50 A;  2NLN A;  5TNC A;  1TCF A;  2VRG A;  2LVJ A;  3SIB A;  1B1G A;  4PE7 A;  4GFT A;  4I5L B;  2DOQ A;  1K2H A;  1ALW A;  2R2I A;  3CAB A;  1SY9 A;  3EK8 A;  4A4C A;  4UPG A;  1WDC C;  1DTL A;  1FI6 A;  1QIW A;  1OMD A;  1YR5 A;  2L5Y A;  3BUX B;  1DVI A;  4E68 A;  1G4Y R;  4GBA A;  4XYN A;  4PHM A;  2ZRS A;  1WRK A;  1KSO A;  1W9Z A;  4PHN A;  3D73 A;  3GK2 A;  3AKB A;  1BJF A;  5JOL A;  1KFU S;  3CZ2 A;  2KYF A;  3KEV A;  2BEC A;  2KI6 C;  1CFF A;  2SCP A;  3FS7 A;  1EG3 A;  1NYA A;  1S3P A;  3PLF B;  5AXI A;  1A75 A;  2EGD A;  4FTG A;  3BFH A;  1LVC D;  4XJK A;  5HKZ A;  3ZWH A;  1JWD A;  4CFQ A;  1S5G Z;  2COL B;  1OMR A;  1B8L A;  1QS7 A;  3B7A A;  1QV0 A;  1HT9 A;  1TUZ A;  2BCA A;  2JTT A;  3D0Y B;  3DF0 B;  1IJ5 A;  2KYC A;  4P5O E;  1KFX S;  1PVB A;  3BUO B;  4AQJ A;  2MLE C;  2CT9 A;  2KAV A;  1NSH A;  4GPL B;  2LLU A;  2LUC A;  3GK1 A;  4PHK A;  3OP0 A;  4IL1 A;  2ZN9 A;  2LAP A;  3PM2 A;  1KK8 C;  5CSN A;  4WRI A;  2KOT A;  5CSF A;  1M46 A;  1QX7 A;  3R72 A;  1F70 A;  1KK7 Y;  3NXA A;  1BLQ A;  3B6X A;  2KDH A;  2M7N A;  1RTP 1;  1N0Y A;  2NCP A;  1B4C A;  1L7Z A;  1MHO A;  3K1E A;  2PAS A;  2GGM A;  1UUS A;  3BOW A;  3PFV A;  4PE1 A;  5GQQ C;  2L2E A;  1F54 A;  2WCF A;  2Y1N A;  4QJ3 B;  1N65 A;  3DVE A;  1UHN A;  5AAN A;  4GAO A;  3IVT A;  4N1G A;  1F71 A;  1BR4 B;  5D3O A;  1A4P A;  1CMG A;  1XFW O;  3QRX A;  1KQM C;  4MRY A;  1BU3 A;  2BBM A;  1P28 A;  1XFV O;  2FCE A;  2L4I A;  4MZK A;  5FI7 A;  3SG6 A;  2BBN A;  4YBH B;  2KAX A;  1DEL A;  3D74 A;  1CNP A;  1K9U A;  3O2P A;  1C07 A;  3EVR A;  3NGV A;  1B7T Z;  3NSL A;  2MLF C;  1CMF A;  3VRP A;  4PT1 A;  2LV7 A;  4N5X A;  1CLM A;  2P70 A;  2ZKM X;  2K61 A;  1TWO A;  1SMG A;  4OV2 A;  2WCK A;  1WRZ A;  3QME A;  1OQP A;  1A29 A;  4JKT A;  3S0D A;  1NX0 A;  3UNW A;  3C1V A;  2P71 A;  4DIR A;  1J7P A;  2M9G A;  2LHL A;  4F7F A;  1CB1 A;  1KQV A;  1YUT A;  2K7C A;  1D1O A;  1QVI Y;  1QWV A;  1LA3 A;  3FWB A;  2KAY A;  1GGZ A;  3I5H B;  2KLE A;  5DIC A;  1QJT A;  1YX8 A;  2L51 A;  2PRU A;  5KU1 A;  1JFJ A;  1SYM A;  1QX5 B;  4R1E A;  1ZUZ A;  2ISD A;  1XFR A;  4PDZ A;  3BJH A;  2BNX A;  5HKW A;  4F0Z B;  1JUO A;  1UHH A;  3SG2 A;  2JXC A;  2L0P A;  1SPY A;  4M2Q A;  4MZJ A;  4FQT A;  2JT3 A;  2LC5 A;  3CS1 A;  3I5I C;  1B8R A;  1ORG A;  2OS8 C;  3LK1 A;  5DKR A;  3IQO A;  1SL7 A;  3TZ1 A;  2WND A;  4QJ5 B;  1OZS A;  3VRQ A;  1UHK A;  4I5N B;  4ETO A;  1EXR A;  2K60 A;  2CBL A;  3BXK A;  1SK6 D;  3KPX A;  4WQ2 A;  4BY5 A;  4INX A;  3DVK A;  1SCM B;  3F45 A;  3TUY C;  1CDP A;  1IRJ A;  2GGZ A;  1XVJ A;  4Q04 A;  4CID A;  3WHU B;  4L9M A;  2KSP A;  5HLV A;  1TRF A;  1PK0 D;  2WCE A;  1S26 D;  3PAT A;  2PAL A;  1FBV A;  2WC5 A;  2KI4 B;  3CLN A;  2KBM A;  5FI2 A;  4C0L A;  3DVM A;  1PUL A;  3EKJ A;  2MJW B;  1BG1 A;  4INW A;  1XYD A;  2EHB A;  1S6C A;  4MZL A;  3NSK A;  1NWD A;  3RM1 A;  1A03 A;  2L2C A;  1RJV A;  4KYN A;  1UHI A;  4AOM A;  1YUU A;  2EC6 B;  3DXL A;  1QV1 A;  2BAP A;  1BOD A;  2QEO A;  1TIZ A;  4TNC A;  2LNK A;  5PAL A;  1J55 A;  3I5G B;  3PSR A;  3BQ3 A;  2K7B A;  3A4U B;  3LK0 A;  2EC6 C;  1EJ3 A;  1RFJ A;  4MSP A;  1DF0 A;  3CYZ A;  2H61 A;  3KF9 A;  3MSE B;  4ORA B;  1QTX A;  4PAL A;  4I5K A;  2G2B A;  3NHI A;  1WY9 A;  3KO0 A;  1SNL A;  2G9B A;  3DY9 A;  1DJG A;  1QLS A;  1B9A A;  1B47 A;  1V1F A;  1XFY O;  2AUC A;  1JF0 A;  3EKH A;  2LE9 B;  3OX5 A;  3VRR A;  3JTD C;  3IF7 A;  3ICB A;  4HSZ A;  4PE0 A;  1W7I B;  2WCH A;  1OOI X;  1OOJ A;  2ZFD A;  3VGO A;  1SL8 A;  2WCL A;  2JU0 A;  2OTG C;  1XFU O;  5KTY A;  1QLK A;  1TN4 A;  1J1D A;  1GJY A;  2WOR A;  2CXJ A;  1CLB A;  3OX6 A;  2K7O A;  2KBI A;  1IH0 A;  1KK7 Z;  2Y4Q A;  3KHE A;  4PCW A;  1IQ5 A;  4USL A;  3N7H A;  5I94 A;  1H4B A;  2FJY A;  1G33 A;  3NSO A;  1LXF C;  1CDM A;  3SS4 A;  2KFF A;  1C7V A;  1AHR A;  3SJS A;  4CPV A;  4M2O A;  2B1U A;  2F2O A;  5I2L A;  1K9K A;  4N1F A;  1PSR A;  1JF2 A;  3NSI A;  4IJ7 A;  4OVN F;  3SG5 A;  1ZMZ A;  3R1P A;  2SAS A;  2K8M B;  3K21 A;  1C3Y A;  3PN7 B;  3AAK A;  1OOG A;  3CR2 A;  2K2A A;  2HET A;  3PJI A;  3CZ1 A;  2JTZ A;  4CFR A;  1A2X A;  1IWQ A;  1BR1 B;  2BE6 A;  2YGU A;  2KI4 C;  3EK4 A;  4PHJ A; 
#chains in the Genus database with same CATH homology
 1UUR A;  2IS9 A;  1YUS A;  1JC2 A;  2CNP A;  1XFZ O;  2BL0 C;  1K93 D;  2M1K B;  3CGA A;  3SG3 A;  5HYD A;  2M49 B;  2I7A A;  1MXE A;  2LLT A;  3OB1 B;  1TNX A;  1XK4 C;  5ER4 X;  1BF5 A;  1FW4 A;  3BUW B;  2I94 A;  2LCP A;  5AEQ A;  3TDZ A;  1NCY A;  1WLZ A;  2M3W A;  1K90 D;  2MHH A;  1DJH A;  2ZRT A;  2LVV A;  3RLZ A;  3WNX B;  1J7Q A;  4YGA A;  2RGI A;  1KQM B;  4WQ3 A;  2BL0 B;  1CDN A;  4I5J A;  3I5F B;  4CLN A;  3EK7 A;  2I18 A;  4GGF A;  4HRE E;  4MN0 A;  3AKA A;  3CR5 X;  3OB2 B;  1AUI B;  5FYX A;  1MWN A;  1OMV A;  2LMT A;  3CR4 X;  4A4B A;  1CFD A;  1PRW A;  3I5F C;  1ZOT B;  2H61 C;  2JC2 A;  5AER A;  2P6B B;  2K0J A;  4MVF A;  3OHM B;  4M2P A;  1DMO A;  2BCX A;  2JPT A;  5KSZ A;  1FF1 A;  1LKJ A;  2PVB A;  2E6W A;  1L2O C;  1QAT A;  1QIV A;  2FCD A;  4OR9 B;  1H8B A;  1K8U A;  2KNE A;  1NIW A;  2KI6 D;  1F4Q A;  2LUX A;  1Y1X A;  1SW8 A;  1SRA A;  1KK8 B;  1M45 A;  3DD4 A;  5G08 A;  1CM1 A;  5CPV A;  5I2O A;  1J7R A;  1S5G Y;  4NDD A;  1ODB A;  4DS7 A;  5JJG A;  3TDI A;  1WLM A;  2HQ8 A;  1KWO B;  2LP3 A;  1QX2 A;  3LCP C;  2K7D A;  3M0W A;  3WHT B;  5BPJ A;  2O5G A;  1SBJ A;  2JWW A;  5HKY A;  2HF5 A;  3IQQ A;  2LVK A;  1MUX A;  2LVI A;  2WCB A;  3D10 A;  4JQ0 D;  4OCI A;  1CFC A;  2M1U A;  2D8N A;  4C0J A;  1G8I A;  1NP8 A;  1PVA A;  1CDL A;  3VRN A;  1JFK A;  3TUY B;  1DGU A;  4OKH A;  2A4J A;  2QAC A;  2JZI A;  3ZNI A;  1CFP A;  1B7T Y;  4P2Y B;  4JPZ B;  1BOC A;  1KFU L;  2OS8 B;  3I5I B;  2M7L A;  3TS5 C;  1DJW A;  5D69 A;  1J1E A;  4GGF C;  4FQO A;  1N2D A;  4ICB A;  1E8A A;  1TNQ A;  2GV5 A;  1Y1A A;  4ZCU A;  4GGN A;  2NCO A;  3DVJ A;  2L4H A;  1MQ1 A;  4HRG A;  3LL8 B;  1BMO A;  1F55 A;  1LA0 A;  2LMU A;  4MLW A;  5IBW A;  1IG5 A;  3BYA A;  1YVH A;  2L98 A;  1XK4 A;  2HPS A;  1CLL A;  3TS5 B;  1TTX A;  1VRK A;  2PMY A;  1UHJ A;  1NCX A;  2LLS A;  2BE4 A;  2I2R E;  3BOW B;  3E3R A;  1RWY A;  2M29 A;  4YGC B;  1TNP A;  5I2Q A;  1FI5 A;  1DGV A;  1L2O B;  5ER5 A;  4MBE A;  2V53 A;  2O60 A;  1DJX A;  1NCZ A;  2CTN A;  3SG4 A;  1R6P A;  1YRU B;  1MF8 B;  1LIN A;  2AAO A;  1NX3 A;  2KQY A;  3LLE A;  3TDU A;  5I8N A;  2QPT A;  1F4O A;  2E30 A;  1U5I A;  2OPO A;  1WDC B;  1F8H A;  1IJ6 A;  1OE9 B;  2M0R A;  3GK4 X;  1AJ4 A;  4D1E A;  1FPW A;  3H4S E;  2Q4U A;  3CWG A;  1EG4 A;  2CCM A;  3HCM A;  1UP5 A;  1QXP A;  2M8U A;  1TOP A;  4PE4 A;  1C7W A;  1OZO A;  2MAZ A;  4BY4 A;  3EVU A;  4DUQ A;  4ORB B;  1IKU A;  4YGE B;  1X02 A;  3JTD B;  1KCY A;  1XFX O;  2LAN A;  3DF0 A;  3CZT X;  3SIA A;  1CTR A;  1RK9 A;  2LHI A;  3D0Y A;  3O4Y A;  3BUM B;  3I5G C;  1B8C A;  1IGV A;  1KSM A;  1A75 B;  2NZ0 A;  1WRL A;  4XJK B;  4YGD B;  2MBX A;  1XO5 A;  4GUK A;  2Y1M A;  4NDB A;  2MA2 A;  2LM5 A;  5F6T A;  2F3Z A;  2Y5I A;  3EVV A;  1CKK A;  1TNW A;  1XA5 A;  2JOJ A;  2KGB C;  2FOT A;  1ZAC A;  2AMI A;  2JUL A;  1MR8 A;  5DKN A;  1EH2 A;  1KWO C;  2TN4 A;  1CM4 A;  4YI9 A;  4QJ4 B;  4YRU A;  5K89 A;  3PN7 C;  2L5X B;  1YVL A;  1U5I B;  3GOF A;  4ZCV A;  1HQV A;  1NPQ A;  4DCK A;  1DJZ A;  3VRO A;  1AP4 A;  5AFP A;  2JT8 A;  4NQG A;  1REC A;  5DKQ A;  4AQI A;  5CSJ A;  1JBA A;  2F3Y A;  2Q91 A;  3AAJ A;  2BKH B;  1KFX L;  2K2F A;  2F8P A;  1M31 A;  2JXL A;  1AK8 A;  2LMV A;  4HRH A;  1SCM C;  1GQM A;  3O6B A;  1EL4 A;  2JNX A;  3A8R A;  4NDC A;  2M97 A;  1J7O A;  5HLO A;  1QAS A;  1DT7 B;  2KFG A;  3HX4 A;  1Q80 A;  4YGB B;  2BKI B;  1SKT A;  2KHN A;  3SG7 A;  5J3X A;  1M63 B;  1YTZ C;  4JWQ A;  2KQ6 A;  4U8D A;  4DRW A;  1NUB A;  2MRD A;  1SCV A;  1DJI A;  2ZNE A;  1K9P A;  5B8I B;  1PSB A;  1R2U A;  2JT0 A;  3FWC A;  2JRF A;  4MEW A;  1M39 A;  1K94 A;  1YUR A;  2FJU B;  2NXQ A;  3PAL A;  1ALV A;  2JNF A;  3WXA A;  1SL9 A;  1NX2 A;  3I5H C;  1GGW A;  4MRX A;  1SR6 B;  2BCB A;  1OSA A;  2LP2 A;  1RRO A;  2WOS A;  2ZN8 A;  1S1E A;  3JVT B;  1AJ5 A;  2JQ6 A;  1Y0V H;  2KGR A;  4GNK B;  3PM8 A;  2ZND A;  1V1G A;  1YRT B;  2HQW A;  1S6J A;  1AVS A;  1ZFS A;  1Y1U A;  1MXL C;  1K96 A;  4ORC B;  1W7J B;  3FIA A;  2KFH A;  1NX1 A;  1YX7 A;  4C0K A;  2F33 A;  2F2P A;  1SR6 C;  3O78 A;  5D7F A;  2H2K A;  1S6I A;  1BT6 A;  5CSI A;  1K95 A;  1QVI Z;  2PSR A;  1S36 A;  1TCO B;  1PAL A;  3JVT C;  3CTN A;  1JSA A;  1IQ3 A;  1UWO A;  3BUN B;  2OTG B;  2WC8 A;  1DJY A;  1Y6W A;  1DF0 B;  2L50 A;  2NLN A;  5TNC A;  1TCF A;  2VRG A;  2LVJ A;  3SIB A;  1B1G A;  4PE7 A;  4GFT A;  4I5L B;  2DOQ A;  1K2H A;  1ALW A;  2R2I A;  1SY9 A;  3EK8 A;  4A4C A;  4UPG A;  1WDC C;  1DTL A;  1FI6 A;  1QIW A;  1OMD A;  1YR5 A;  3BUX B;  1DVI A;  4E68 A;  1G4Y R;  4GBA A;  4XYN A;  4PHM A;  2ZRS A;  1WRK A;  1KSO A;  4PHN A;  3GK2 A;  3AKB A;  1BJF A;  5JOL A;  1KFU S;  3KEV A;  2KYF A;  2BEC A;  2KI6 C;  1CFF A;  2SCP A;  3FS7 A;  1EG3 A;  1NYA A;  1S3P A;  3PLF B;  5AXI A;  1A75 A;  2EGD A;  4FTG A;  4XJK A;  1LVC D;  5HKZ A;  3ZWH A;  1JWD A;  4CFQ A;  1S5G Z;  2COL B;  1OMR A;  1B8L A;  1QS7 A;  1QV0 A;  1HT9 A;  2BCA A;  3D0Y B;  2JTT A;  3DF0 B;  1IJ5 A;  2KYC A;  4P5O E;  1KFX S;  1PVB A;  3BUO B;  4AQJ A;  2MLE C;  2CT9 A;  2KAV A;  1NSH A;  4GPL B;  2LLU A;  2LUC A;  3GK1 A;  4PHK A;  3OP0 A;  4IL1 A;  2ZN9 A;  2LAP A;  1KK8 C;  5CSN A;  4WRI A;  2KOT A;  5CSF A;  1M46 A;  1QX7 A;  1F70 A;  1KK7 Y;  3NXA A;  1BLQ A;  2KDH A;  2M7N A;  1RTP 1;  1N0Y A;  2NCP A;  1B4C A;  1L7Z A;  1MHO A;  2PAS A;  2GGM A;  1UUS A;  3BOW A;  3PFV A;  4PE1 A;  5GQQ C;  2L2E A;  1F54 A;  2WCF A;  2Y1N A;  4QJ3 B;  1N65 A;  3DVE A;  1UHN A;  5AAN A;  4GAO A;  4N1G A;  1F71 A;  1BR4 B;  1A4P A;  1CMG A;  1XFW O;  3QRX A;  1KQM C;  4MRY A;  1BU3 A;  2BBM A;  2FCE A;  1XFV O;  2L4I A;  4MZK A;  3SG6 A;  2BBN A;  4YBH B;  2KAX A;  1CNP A;  1K9U A;  3O2P A;  1C07 A;  3EVR A;  1B7T Z;  3NSL A;  2MLF C;  1CMF A;  3VRP A;  2LV7 A;  4N5X A;  1CLM A;  2ZKM X;  2K61 A;  1SMG A;  4OV2 A;  1WRZ A;  1OQP A;  1A29 A;  1NX0 A;  3C1V A;  4DIR A;  1J7P A;  2M9G A;  2LHL A;  1CB1 A;  1KQV A;  1YUT A;  2K7C A;  1D1O A;  1QVI Y;  1LA3 A;  3FWB A;  2KAY A;  1GGZ A;  3I5H B;  1QJT A;  1YX8 A;  2L51 A;  2PRU A;  5KU1 A;  1JFJ A;  1SYM A;  1QX5 B;  4R1E A;  1ZUZ A;  2ISD A;  4PDZ A;  5HKW A;  4F0Z B;  1JUO A;  1UHH A;  3SG2 A;  2JXC A;  2L0P A;  1SPY A;  4M2Q A;  4MZJ A;  2JT3 A;  2LC5 A;  3CS1 A;  3I5I C;  1B8R A;  2OS8 C;  3LK1 A;  5DKR A;  3IQO A;  1SL7 A;  3TZ1 A;  2WND A;  4QJ5 B;  1OZS A;  3VRQ A;  1UHK A;  4I5N B;  4ETO A;  1EXR A;  2CBL A;  3BXK A;  1SK6 D;  3KPX A;  4WQ2 A;  4BY5 A;  3DVK A;  1SCM B;  3F45 A;  3TUY C;  1CDP A;  1IRJ A;  2GGZ A;  1XVJ A;  4Q04 A;  4CID A;  3WHU B;  4L9M A;  2KSP A;  5HLV A;  1TRF A;  1PK0 D;  2WCE A;  1S26 D;  3PAT A;  2PAL A;  1FBV A;  3CLN A;  2KI4 B;  2KBM A;  4C0L A;  3DVM A;  1PUL A;  3EKJ A;  2MJW B;  1BG1 A;  1XYD A;  2EHB A;  1S6C A;  4MZL A;  3NSK A;  1NWD A;  3RM1 A;  1A03 A;  1RJV A;  1UHI A;  4AOM A;  1YUU A;  2EC6 B;  1QV1 A;  1BOD A;  1TIZ A;  4TNC A;  2LNK A;  5PAL A;  1J55 A;  3I5G B;  3PSR A;  3BQ3 A;  2K7B A;  3A4U B;  3LK0 A;  2EC6 C;  1EJ3 A;  1RFJ A;  4MSP A;  1DF0 A;  3MSE B;  2H61 A;  3KF9 A;  4ORA B;  4PAL A;  1QTX A;  4YI8 A;  4I5K A;  2G2B A;  1WY9 A;  3KO0 A;  1SNL A;  2G9B A;  1DJG A;  1QLS A;  1B9A A;  1B47 A;  1V1F A;  1XFY O;  2AUC A;  1JF0 A;  3EKH A;  2LE9 B;  3OX5 A;  3VRR A;  3JTD C;  3IF7 A;  3ICB A;  4HSZ A;  4PE0 A;  1W7I B;  1OOJ A;  2ZFD A;  3VGO A;  1SL8 A;  2JU0 A;  2OTG C;  1XFU O;  5KTY A;  1QLK A;  1TN4 A;  1J1D A;  1GJY A;  2WOR A;  2CXJ A;  1CLB A;  3OX6 A;  2K7O A;  2KBI A;  1IH0 A;  1KK7 Z;  2Y4Q A;  3KHE A;  4PCW A;  1IQ5 A;  4USL A;  1H4B A;  1G33 A;  3NSO A;  1LXF C;  1CDM A;  2KFF A;  1C7V A;  1AHR A;  3SJS A;  4CPV A;  4M2O A;  2B1U A;  2F2O A;  5I2L A;  1K9K A;  4N1F A;  1PSR A;  1JF2 A;  3NSI A;  4OVN F;  3SG5 A;  1ZMZ A;  2SAS A;  2K8M B;  3K21 A;  3PN7 B;  3AAK A;  3CR2 A;  2K2A A;  2HET A;  4CFR A;  2JTZ A;  1A2X A;  1IWQ A;  1BR1 B;  2BE6 A;  2KI4 C;  3EK4 A;  4PHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...