2JT8A

Solution structure of the f153-to-5-flurotryptophan mutant of human cardiac troponin c
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
161
structure length
160
Chain Sequence
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRSMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDELEFMKGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Effects of Phe-to-Trp mutation and fluorotryptophan incorporation on the solution structure of cardiac troponin C, and analysis of its suitability as a potential probe for in situ NMR studies
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Troponin C, slow skeletal and cardiac muscles
total genus 28
structure length 160
sequence length 161
ec nomenclature
pdb deposition date 2007-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2jt8A00
4MZKA 1TNPA 2Y4QA 1WLZA 1S3PA 4MRXA 4FQOA 4YBHB 2KYCA 3H4SE 2NCPA 1IWQA 1S6IA 3OB1B 1S26D 3BOWB 2JU0A 4M2PA 5ER5A 1BODA 1G8IA 1D1OA 3SG7A 2BE6A 2HF5A 3E3RA 1J7PA 1DVIA 2PALA 1S6CA 1JF2A 3I5IB 4DUQA 2G2BA 2SCPA 5HKWA 2VRGA 3BUOB 3BUMB 4I5JA 3MSEB 1SL8A 3BXKA 2CBLA 1M39A 1CM1A 1SL9A 5I2OA 2SASA 5CPVA 4DRWA 3K21A 1UHIA 3EKHA 1H4BA 2BL0C 1YTZC 2PMYA 4JPZB 3CWGA 2GGMA 2FJUB 2LM5A 3CR5X 3WNXB 1HQVA 5IBWA 2BCBA 4AQJA 2HPSA 1JC2A 4A4CA 1GGZA 1RECA 1TRFA 5G08A 1QIVA 2K7DA 1NYAA 3EVRA 3O6BA 2OPOA 4CLNA 1V1FA 5HYDA 3TDZA 4AQIA 1QASA 3PALA 4MN0A 4MZLA 2WC8A 1IQ3A 2M49B 2L51A 1UHJA 2ZRTA 1QLSA 3QRXA 4GPLB 1SK6D 2K61A 4GUKA 2WCFA 4E68A 1AUIB 4HSZA 1K94A 3PATA 1FPWA 3CZTX 1JUOA 3DVKA 2F33A 4M2OA 1YRUB 5I8NA 1WDCB 5KU1A 1BU3A 3SJSA 4PHMA 1YRTB 1Y1XA 1MWNA 2E30A 2FOTA 3IF7A 1Y6WA 1PVAA 2D8NA 2Y1NA 4JQ0D 1H8BA 1DJGA 2KAYA 2MLFC 2JTTA 2TN4A 3EVUA 4DIRA 1FI5A 2MAZA 1DTLA 1WRKA 1NX2A 3SG5A 3TZ1A 3FS7A 2OS8B 5AFPA 1IKUA 4PALA 1PSBA 3AAKA 1CLMA 3PN7B 1GGWA 1PULA 3I5HB 5DKRA 2WOSA 3DVMA 4NDCA 1X02A 2BBNA 5I2QA 1SW8A 2JRFA 3SG2A 3F45A 4N1GA 3WXAA 4XYNA 2M0RA 1LVCD 2LV7A 3D10A 2ZRSA 3DF0B 1BF5A 3BUXB 3GOFA 1DJXA 1K2HA 1KFUS 3KEVA 3EK4A 3EKJA 4U8DA 3JTDB 2R2IA 1EJ3A 1TCOB 1OMDA 1ALWA 1UUSA 1LKJA 3CS1A 2KFHA 1M63B 2M29A 5CSJA 2MBXA 1SCMB 4GGFA 2JQ6A 4TNCA 1B8CA 2LHIA 2K8MB 2JNXA 1KQMC 4WRIA 2P6BB 3VRQA 1RWYA 1QV1A 1NCZA 1L2OB 4GNKB 4WQ3A 1F70A 3CTNA 4A4BA 3HCMA 1J7RA 1BOCA 1K8UA 1DJZA 1S5GZ 2PVBA 2LCPA 1U5IA 1MUXA 2A4JA 1XFXO 4BY4A 1CM4A 1PRWA 1F71A 2KFGA 4MRYA 2L2EA 4ORAB 1RROA 1TCFA 2I7AA 4Q04A 4GFTA 1IH0A 1LA3A 2M1KB 5J3XA 5KTYA 2LMTA 1SYMA 1U5IB 2JTZA 2L98A 1M31A 3I5HC 4PHJA 1OOJA 4WQ2A 1OMRA 1OQPA 1XFZO 1KSMA 2F2OA 4P5OE 1QTXA 2AAOA 1YVLA 3CLNA 4YGEB 1AJ5A 1JFJA 1NCXA 1YX7A 2NCOA 1EH2A 1OMVA 2BCAA 3BOWA 5PALA 4ICBA 5DKQA 4P2YB 1EXRA 2L4HA 1F54A 1JFKA 2COLB 1NX1A 1QV0A 1RK9A 3SG6A 3CGAA 1OE9B 2ZKMX 1CDPA 2ZFDA 2KOTA 1YR5A 2M8UA 3M0WA 1UWOA 4BY5A 2F8PA 1G33A 2HQ8A 3I5FC 3KF9A 1K9UA 2NXQA 1GQMA 1LINA 1XK4C 1RJVA 2KI6D 1PSRA 2M9GA 3AKAA 1B7TZ 1ALVA 3SIAA 2AMIA 2K0JA 3KHEA 1L7ZA 1KFXL 2ZN8A 3VRNA 1A4PA 1NSHA 1QX5B 1SR6C 2JXCA 1UHNA 1SPYA 2I94A 1SNLA 3LK0A 3CR4X 3OX5A 4HRGA 4ZCVA 1B8LA 1OZOA 4PHKA 4DS7A 1MF8B 2OTGC 1VRKA 2KQYA 5JJGA 4JWQA 1PVBA 1C7VA 2JC2A 1S36A 1QS7A 2LUCA 3LK1A 4GGFC 4R1EA 1M45A 1ZMZA 1JWDA 1AVSA 1ZACA 2KBIA 3VGOA 1F8HA 2ZN9A 2ZNEA 1UP5A 4MEWA 2K7OA 4YGDB 3ZWHA 1RTP1 1K90D 4YRUA 3EK8A 1KK8C 3SG4A 4UPGA 3BUWB 4PCWA 2L5XB 2MJWB 3A4UB 1N65A 3LLEA 2JT3A 1KWOC 2EGDA 1IQ5A 2JULA 2LUXA 1KK7Z 1DJYA 2JT8A 3TS5C 2QACA 2FCDA 2I2RE 2JT0A 2ISDA 2KI4B 3KPXA 1J55A 1XFUO 2LLUA 1FBVA 3AAJA 3EK7A 4NDDA 1R2UA 1MHOA 3DVJA 3ICBA 4M2QA 2KAXA 2CCMA 2K7CA 4I5KA 2BL0B 1DJHA 2M97A 2IS9A 1CDNA 1CDMA 4PE0A 4YGCB 1XO5A 2L0PA 1GJYA 2JZIA 3I5GC 1CLBA 4DCKA 1AHRA 2BKIB 1NWDA 4N1FA 2KBMA 2BE4A 1J1EA 3JVTB 1ZUZA 5F6TA 2H61A 3DF0A 4PDZA 2KYFA 5D69A 2ZNDA 3GK1A 2F3ZA 2BCXA 1XFVO 1NCYA 1OSAA 1C07A 3O78A 2H61C 1BR4B 4MSPA 2MLEC 4USLA 4L9MA 2Q4UA 2NZ0A 2K7BA 1SR6B 2CT9A 1TNQA 1Y1UA 1NUBA 2KNEA 4MBEA 1N0YA 5JOLA 1A2XA 2WORA 1JSAA 3OHMB 3IQQA 5BPJA 1B47A 1XK4A 1QVIZ 2WCEA 2O5GA 3JVTC 3HX4A 2M7NA 1TN4A 1SKTA 2I18A 1BMOA 1LXFC 4C0LA 1K95A 1R6PA 4YGAA 1N2DA 1CTRA 1G4YR 1Y0VH 3VRRA 2E6WA 3PN7C 3TDUA 2F2PA 1XYDA 1K96A 1EL4A 2DOQA 1C7WA 2KFFA 2Q91A 1F4QA 3OX6A 5CSNA 1DF0A 3D0YB 5GQQC 1SCMC 3EVVA 1ZOTB 2LANA 1IJ5A 1TOPA 4AOMA 3KO0A 2KI6C 1DJIA 1SBJA 1WLMA 2V53A 2CXJA 2L50A 1TIZA 1YURA 1CFCA 1F4OA 1NP8A 2LLTA 3FWCA 2PRUA 4QJ5B 1MXLC 2WCBA 3WHUB 1SRAA 1QJTA 1B7TY 1NX3A 1EG3A 5I2LA 2RGIA 2HETA 4F0ZB 1IGVA 1DJWA 1S5GY 2M3WA 5TNCA 2LAPA 1CMFA 4ORBB 4GAOA 2BBMA 4IL1A 3TUYC 1BJFA 4HRHA 1MR8A 1RFJA 5HLOA 1LA0A 1B4CA 1PALA 2M1UA 5B8IB 1NX0A 1CNPA 1XVJA 2L4IA 3FWBA 2H2KA 1UHKA 3DD4A 4I5NB 1J7QA 4FTGA 3FIAA 4OV2A 5AEQA 3AKBA 1BR1B 2LVVA 2O60A 1WDCC 2MHHA 3GK4X 3IQOA 2EC6C 1BLQA 2KGBC 1FW4A 1TTXA 3CR2A 4ETOA 2LVIA 1DGVA 4ORCB 1CFPA 2Y5IA 3BUNB 3BYAA 4OKHA 1YUTA 3I5IC 4PE1A 1K93D 4I5LB 2KGRA 1B8RA 4CPVA 2GGZA 1AK8A 1Y1AA 1YX8A 3I5GB 3NSKA 2OS8C 3PM8A 5KSZA 2LVKA 3LL8B 1CDLA 2QPTA 1WY9A 1EG4A 2LP3A 1OZSA 4MZJA 4QJ3B 1YUUA 4PE7A 4YI8A 4N5XA 1V1GA 2LVJA 4QJ4B 1BT6A 3ZNIA 4C0JA 1HT9A 2KHNA 1UHHA 2KI4C 1XFWO 1CLLA 1DMOA 1E8AA 5D7FA 3BQ3A 1DT7B 2KQ6A 1W7IB 2KAVA 4MVFA 1TNXA 5CSFA 3OP0A 2KSPA 4MLWA 1DGUA 5HKYA 3NXAA 1MQ1A 2JWWA 2JPTA 3O2PA 4CFRA 2LHLA 1FF1A 1QIWA 2GV5A 1YVHA 2LNKA 5K89A 4HREE 1ZFSA 1CMGA 5ER4X 1KQMB 2CNPA 1SY9A 2BKHB 3A8RA 1IRJA 4PHNA 4XJKB 2LMUA 1KK7Y 3WHTB 1L2OC 1Q80A 1QATA 5CSIA 2K2AA 2OTGB 2JOJA 1QX7A 1SCVA 2LLSA 1UURA 3JTDC 4OCIA 4YGBB 4OVNF 2F3YA 3OB2B 2JXLA 1A03A 1WRZA 5DKNA 4XJKA 1K9KA 1SL7A 2LC5A 1S1EA 1A29A 1NIWA 1A75B 3PSRA 4NDBA 5AXIA 1IG5A 1MXEA 3I5FB 2KDHA 1M46A 3PLFB 4OR9B 3SIBA 2NLNA 1XFYO 2BECA 3RM1A 1J1DA 2PASA 2Y1MA 1QVIY 3O4YA 4D1EA 1QX2A 3RLZA 2WNDA 1QXPA 1TNWA 1BG1A 1AP4A 1B9AA 5HKZA 1KFUL 1SMGA 2CTNA 3SG3A 4CIDA 2JNFA 2K2FA 1CKKA 2AUCA 3NSIA 4ZCUA 1S6JA 5HLVA 1ODBA 1NPQA 4GGNA 4PE4A 1DF0B 3D0YA 5FYXA 1IJ6A 1B1GA 4YI9A 1YUSA 2LMVA 2PSRA 3TS5B 2G9BA 1A75A 1PK0D 5AANA 3TUYB 1XA5A 4C0KA 1KCYA 1WRLA 2LP2A 1KQVA 3C1VA 1KWOB 1J7OA 2M7LA 3DVEA 2MA2A 3TDIA 3VRPA 5AERA 3PFVA 3VROA 4CFQA 1CFFA 2B1UA 1KFXS 1F55A 2FCEA 3NSOA 1KK8B 1CFDA 2MRDA 1JBAA 4GBAA 2EC6B 4NQGA 3NSLA 2EHBA 1JF0A 1QLKA 3LCPC 1CB1A 2HQWA 1FI6A 1KSOA 3GK2A 1AJ4A 1W7JB 1K9PA 2LE9B
chains in the Genus database with same CATH superfamily
4MZKA 1TNPA 2Y4QA 1WLZA 1S3PA 4MRXA 4FQOA 4YBHB 2KYCA 3H4SE 2NCPA 1IWQA 1S6IA 3OB1B 4JD9A 1S26D 3BOWB 2JU0A 4M2PA 5ER5A 5FI2A 1BODA 1G8IA 1D1OA 3SG7A 2BE6A 4KYNA 2HF5A 3E3RA 1J7PA 1DVIA 2PALA 1S6CA 1JF2A 3I5IB 4DUQA 1DEKA 2G2BA 2KLDA 2SCPA 2QEBA 2VRGA 3BUOB 3BUMB 4I5JA 5HKWA 4JKTA 3MSEB 1SL8A 3BXKA 2CBLA 1M39A 1CM1A 1SL9A 5I2OA 4INWA 2SASA 5CPVA 4DRWA 5FI6A 3K21A 3FE6A 1UHIA 3EKHA 1H4BA 2BL0C 1YTZC 2PMYA 4JPZB 3CWGA 2GGMA 2FJUB 2LM5A 3CR5X 3WNXB 1HQVA 5IBWA 2BCBA 4AQJA 2HPSA 1JC2A 2WCLA 4A4CA 1GGZA 1RECA 1TRFA 5G08A 1QIVA 5I94A 2K7DA 1T14A 1NYAA 3EVRA 3O6BA 2OPOA 4CLNA 3SS3A 1V1FA 5HYDA 1LS8A 3TDZA 4AQIA 1QASA 3PALA 4MN0A 3DZTA 4MZLA 2WC8A 1IQ3A 2M49B 2L51A 1UHJA 2ZRTA 4OZDA 1QLSA 3QRXA 4GPLB 1SK6D 2K61A 4GUKA 1GM0A 2WCFA 4E68A 1AUIB 4HSZA 1K94A 3PATA 1FPWA 3CZTX 1JUOA 3DVKA 2F33A 4M2OA 1YRUB 5I8NA 1XFRA 1WDCB 5KU1A 1BU3A 3SJSA 4PHMA 1YRTB 1Y1XA 1MWNA 2E30A 2FOTA 3IF7A 1Y6WA 1PVAA 2D8NA 2Y1NA 4JQ0D 1H8BA 1DJGA 2KAYA 1Z4HA 2JTTA 2MLFC 2TN4A 3EVUA 4DIRA 1FI5A 2MAZA 1DTLA 1WRKA 1NX2A 3SG5A 3TZ1A 3FS7A 4F7FA 2OS8B 3B87A 5AFPA 1IKUA 4PALA 1PSBA 2PQLA 1CLMA 3AAKA 3PN7B 1GGWA 1PULA 3I5HB 5DKRA 2WOSA 2P71A 1DC1A 3DVMA 4NDCA 1X02A 2BBNA 5I2QA 1SW8A 2JRFA 3SG2A 3F45A 4N1GA 3WXAA 3DY9A 4XYNA 2M0RA 1LVCD 2LV7A 3D10A 3SS5A 2ZRSA 3DF0B 3QMEA 1BF5A 3BUXB 3GOFA 5FI7A 1DJXA 1K2HA 1KFUS 3KEVA 3EK4A 3EKJA 4U8DA 3JTDB 2R2IA 1EJ3A 1TCOB 1OMDA 1ALWA 1UUSA 1LKJA 2ERBA 3CS1A 2KFHA 1M63B 2M29A 5CSJA 2MBXA 1SCMB 4GGFA 2JQ6A 4TNCA 1B8CA 2LHIA 4INXA 2BAPA 2JNXA 2K8MB 1KQMC 4WRIA 2P6BB 3VRQA 1C3ZA 1RWYA 1QV1A 3CDNA 1NCZA 1L2OB 4GNKB 4WQ3A 2FJYA 3CTNA 4A4BA 3HCMA 1F70A 1W9ZA 1J7RA 1BOCA 3BFAA 1K8UA 1DJZA 1S5GZ 2PVBA 2LCPA 1U5IA 1MUXA 2A4JA 1XFXO 4BY4A 1CM4A 1PRWA 1F71A 2KFGA 4MRYA 2L2EA 4ORAB 1RROA 1TCFA 2I7AA 4Q04A 4GFTA 1IH0A 1LA3A 2M1KB 5J3XA 5KTYA 2LMTA 1SYMA 1U5IB 2JTZA 2L98A 1M31A 3I5HC 3R1OA 2H8VA 4PHJA 1OOJA 4WQ2A 1OMRA 1OQPA 1XFZO 1KSMA 2F2OA 4P5OE 1QTXA 2AAOA 1YVLA 3CLNA 4YGEB 1AJ5A 3D75A 1NCXA 1YX7A 2NCOA 1EH2A 1JFJA 3FE8A 1OMVA 2BCAA 3BOWA 3DYEA 5PALA 4ICBA 5DKQA 4P2YB 1EXRA 2L4HA 1F54A 1JFKA 2COLB 1NX1A 1QV0A 1RK9A 2GTEA 3SG6A 3CGAA 1OE9B 2ZKMX 1CDPA 2ZFDA 2KOTA 1YR5A 2M8UA 3M0WA 4IJ7A 1UWOA 3B7AA 2F8PA 1G33A 4BY5A 2HQ8A 3I5FC 3KF9A 4XJKB 1K9UA 2NXQA 1GQMA 1Z2CB 1LINA 1XK4C 1RJVA 2KI6D 1PSRA 2M9GA 3S0BA 3AKAA 1B7TZ 3EG5B 1ALVA 3SIAA 2AMIA 2K0JA 3NHTA 3KHEA 1L7ZA 1KFXL 2ZN8A 2K60A 3VRNA 1A4PA 1NSHA 1QX5B 1SR6C 3S0GA 2JXCA 1UHNA 1SPYA 2I94A 1SNLA 3LK0A 3CR4X 3OX5A 4HRGA 4ZCVA 1B8LA 1OZOA 4PHKA 4DS7A 3R72A 1MF8B 2OTGC 1VRKA 2KQYA 5JJGA 4JWQA 1PVBA 3NGVA 1C7VA 2JC2A 1S36A 1QS7A 2LUCA 3LK1A 4GGFC 4R1EA 1M45A 1ZMZA 1JWDA 1AVSA 1ZACA 2KBIA 3VGOA 1F8HA 2ZN9A 2ZNEA 1UP5A 4MEWA 2K7OA 4YGDB 1OOGA 3ZWHA 1RTP1 1K90D 4YRUA 3EK8A 1KK8C 3SG4A 4UPGA 3BUWB 4PCWA 2KPHA 2L5XB 2MJWB 3VB1A 3A4UB 1N65A 1SSEB 2JT3A 3LLEA 1KWOC 2EGDA 1IQ5A 2JULA 2L2CA 2LUXA 1KK7Z 2WC6A 1DJYA 2JT8A 3Q8IA 2QACA 3TS5C 2FCDA 2I2RE 2JT0A 2ISDA 2KI4B 3KPXA 1J55A 1OW4A 1XFUO 2LLUA 1FBVA 3AAJA 3EK7A 4NDDA 1R2UA 1MHOA 3DVJA 3ICBA 4M2QA 2KAXA 2CCMA 2K7CA 4I5KA 2BL0B 1DJHA 2M97A 2IS9A 1CDNA 1CDMA 1P28A 4PE0A 4YGCB 1XO5A 2L0PA 3BFHA 1GJYA 2JZIA 3I5GC 1CLBA 4DCKA 1AHRA 1C3YA 2BKIB 1NWDA 3D73A 2WC5A 4N1FA 2KBMA 2BE4A 1J1EA 3JVTB 1ZUZA 5F6TA 2H61A 3DF0A 4PDZA 2KYFA 5D69A 2ZNDA 3GK1A 2F3ZA 2BCXA 1XFVO 1NCYA 1OSAA 1C07A 3O78A 2H61C 1BR4B 4MSPA 2MLEC 4USLA 4L9MA 2Q4UA 2NZ0A 2K7BA 1SR6B 2CT9A 1TNQA 1Y1UA 3BFBA 1NUBA 2KNEA 4MBEA 1N0YA 3CZ2A 3CZ1A 1A2XA 5JOLA 2WORA 1JSAA 3OHMB 3IQQA 2WCHA 5BPJA 1OOHA 3S0AA 1B47A 1XK4A 1QVIZ 2WCEA 3S0DA 2O5GA 3JVTC 3HX4A 2M7NA 1TN4A 3B6XA 1SKTA 2I18A 1BMOA 1LXFC 4C0LA 1K95A 1R6PA 4YGAA 1N2DA 1CTRA 1G4YR 1Y0VH 3VRRA 2E6WA 1TUZA 3PN7C 3TDUA 2F2PA 1XYDA 3V2LA 1K96A 1EL4A 2DOQA 3IVTA 1C7WA 2KFFA 2Q91A 1F4QA 3OX6A 5CSNA 1DF0A 3D0YB 5GQQC 1SCMC 3EVVA 1ZOTB 2LANA 1IJ5A 1TOPA 4AOMA 3KO0A 2KI6C 3UNWA 1DJIA 1SBJA 1WLMA 3L4LA 2V53A 2CXJA 5EL2A 2L50A 3D77A 3WHTB 1YURA 1TIZA 1CFCA 5D3OA 1F4OA 1NP8A 2LLTA 3FWCA 2PRUA 4QJ5B 1MXLC 1QWVA 2WCBA 3WHUB 1SRAA 1QJTA 1B7TY 1NX3A 1EG3A 5I2LA 2RGIA 2HETA 4F0ZB 1IGVA 1DJWA 1S5GY 2M3WA 2P70A 2LAPA 3R1PA 4ORBB 5TNCA 5HL1A 1CMFA 4GAOA 2BBMA 2QEHA 3BJHA 4IL1A 3TUYC 1BJFA 4HRHA 3CABA 1MR8A 1RFJA 5HLOA 1LA0A 1B4CA 1PALA 2M1UA 5B8IB 1NX0A 1CNPA 1XVJA 2L4IA 3FWBA 3L4AA 2H2KA 1UHKA 3DD4A 4I5NB 1J7QA 4FTGA 3FIAA 2PYQA 4OV2A 5AEQA 3AKBA 1BR1B 2LVVA 2O60A 1WDCC 3L47A 2MHHA 3GK4X 3NHIA 3IQOA 1TWOA 2EC6C 3B86A 2KGBC 4FQTA 1BLQA 1FW4A 1TTXA 3CR2A 4ETOA 2LVIA 1DGVA 4ORCB 1CFPA 2QEVA 2Y5IA 3BUNB 3N7HA 3BYAA 2BNXA 1YUTA 4OKHA 3I5IC 4PE1A 1K93D 4I5LB 2KGRA 1B8RA 3OGNA 2GGZA 4CPVA 1Y1AA 1AK8A 1YX8A 3I5GB 3NSKA 2OS8C 3PM8A 5KSZA 2LVKA 3DXLA 2L5YA 3LL8B 1CDLA 2QPTA 1WY9A 1EG4A 2LP3A 1OZSA 3OBVA 4MZJA 3PJIA 3SS4A 4QJ3B 1YUUA 4PE7A 4YI8A 4N5XA 1V1GA 2LVJA 4QJ4B 1BT6A 3ZNIA 4C0JA 1HT9A 2KHNA 1UHHA 2KI4C 1XFWO 1CLLA 1DMOA 1E8AA 5D7FA 3BQ3A 1DT7B 3PM2A 2KQ6A 1W7IB 2KAVA 4MVFA 1TNXA 5CSFA 3OP0A 2QDIA 1IIOA 3S0EA 3D74A 2KSPA 4MLWA 1DGUA 2KLEA 5HKYA 3NXAA 1MQ1A 2JWWA 2JPTA 3O2PA 3O4XA 4CFRA 2LHLA 1FF1A 1QIWA 2GV5A 1YVHA 2LNKA 5K89A 4HREE 1ZFSA 1TUJA 1CMGA 5ER4X 3D76A 1KQMB 2CNPA 1SY9A 2BKHB 1OOIX 1IRJA 2YGUA 3A8RA 2LMUA 1KK7Y 4PHNA 1L2OC 1Q80A 1QATA 5CSIA 2K2AA 2OTGB 2JOJA 1QX7A 1SCVA 2LLSA 5DICA 2WCJA 1UURA 2WCKA 3JTDC 4OCIA 4OVNF 4YGBB 2F3YA 3UO9A 3OB2B 2JXLA 1A03A 1WRZA 2JPOA 5DKNA 4XJKA 1K9KA 1SL7A 1DELA 2LC5A 1S1EA 1A29A 1NIWA 2WCMA 1A75B 3K1EA 1ORGA 3PSRA 4NDBA 5AXIA 3CYZA 1IG5A 3R1VA 1MXEA 3I5FB 2KDHA 1M46A 3PLFB 4OR9B 3B88A 3SIBA 2NLNA 1XFYO 1DQEA 2BECA 3RM1A 3FE9A 1J1DA 2PASA 2Y1MA 1QVIY 3O4YA 4PT1A 4D1EA 1QX2A 3RLZA 2WNDA 1QXPA 1TNWA 1BG1A 3S0FA 1AP4A 1B9AA 3CZ0A 3D78A 5HKZA 1KFUL 1SMGA 2CTNA 3SG3A 4CIDA 2JNFA 2K2FA 1CKKA 2AUCA 3NSIA 4ZCUA 1S6JA 5HLVA 1ODBA 1NPQA 4GGNA 4PE4A 1DF0B 3D0YA 5FYXA 1IJ6A 1B1GA 4YI9A 1YUSA 2LMVA 2PSRA 3TS5B 2G9BA 1A75A 1PK0D 5AANA 3TUYB 1XA5A 4C0KA 1KCYA 1WRLA 2LP2A 3RZSA 3C1VA 1KWOB 1J7OA 2M7LA 3DVEA 2MA2A 3TDIA 3VRPA 5AERA 3PFVA 3VROA 4CFQA 1CFFA 2B1UA 1KFXS 2QEOA 1F55A 2FCEA 1KQVA 3NSOA 1KK8B 1CFDA 2MRDA 1JBAA 4GBAA 2EC6B 4NQGA 3NSLA 2EHBA 1JF0A 1QLKA 3LCPC 1CB1A 1OOFA 2HQWA 1FI6A 1KSOA 3GK2A 1AJ4A 1W7JB 1K9PA 2LE9B
chains in the Genus database with same CATH topology
4MZKA 1TNPA 2Y4QA 1WLZA 1S3PA 4MRXA 4FQOA 4YBHB 2KYCA 3H4SE 2NCPA 1IWQA 1S6IA 3OB1B 1S26D 3BOWB 2JU0A 4M2PA 5ER5A 1BODA 1G8IA 1D1OA 3SG7A 2BE6A 2HF5A 3E3RA 1J7PA 1DVIA 2PALA 1S6CA 1JF2A 3I5IB 4DUQA 2G2BA 2SCPA 5HKWA 2VRGA 3BUOB 3BUMB 4I5JA 3MSEB 1SL8A 3BXKA 2CBLA 1M39A 1CM1A 1SL9A 5I2OA 2SASA 5CPVA 4DRWA 3K21A 1UHIA 3EKHA 1H4BA 2BL0C 1YTZC 2PMYA 4JPZB 3CWGA 2GGMA 2FJUB 2LM5A 3CR5X 3WNXB 1HQVA 5IBWA 2BCBA 4AQJA 2HPSA 1JC2A 4A4CA 1GGZA 1RECA 1TRFA 5G08A 1QIVA 2K7DA 1NYAA 3EVRA 3O6BA 2OPOA 4CLNA 1V1FA 5HYDA 3TDZA 4AQIA 1QASA 3PALA 4MN0A 4MZLA 2WC8A 1IQ3A 2M49B 2L51A 1UHJA 2ZRTA 1QLSA 3QRXA 4GPLB 1SK6D 2K61A 4GUKA 2WCFA 4E68A 1AUIB 4HSZA 1K94A 3PATA 1FPWA 3CZTX 1JUOA 3DVKA 2F33A 4M2OA 1YRUB 5I8NA 1WDCB 5KU1A 1BU3A 3SJSA 4PHMA 1YRTB 1Y1XA 1MWNA 2E30A 2FOTA 3IF7A 1Y6WA 1PVAA 2D8NA 2Y1NA 4JQ0D 1H8BA 1DJGA 2KAYA 2MLFC 2JTTA 2TN4A 3EVUA 4DIRA 1FI5A 2MAZA 1DTLA 1WRKA 1NX2A 3SG5A 3TZ1A 3FS7A 2OS8B 5AFPA 1IKUA 4PALA 1PSBA 3AAKA 1CLMA 3PN7B 1GGWA 1PULA 3I5HB 5DKRA 2WOSA 3DVMA 4NDCA 1X02A 2BBNA 5I2QA 1SW8A 2JRFA 3SG2A 3F45A 4N1GA 3WXAA 4XYNA 2M0RA 1LVCD 2LV7A 3D10A 2ZRSA 3DF0B 1BF5A 3BUXB 3GOFA 1DJXA 1K2HA 1KFUS 3KEVA 3EK4A 3EKJA 4U8DA 3JTDB 2R2IA 1EJ3A 1TCOB 1OMDA 1ALWA 1UUSA 1LKJA 3CS1A 2KFHA 1M63B 2M29A 5CSJA 2MBXA 1SCMB 4GGFA 2JQ6A 4TNCA 1B8CA 2LHIA 2K8MB 2JNXA 1KQMC 4WRIA 2P6BB 3VRQA 1RWYA 1QV1A 1NCZA 1L2OB 4GNKB 4WQ3A 1F70A 3CTNA 4A4BA 3HCMA 1J7RA 1BOCA 1K8UA 1DJZA 1S5GZ 2PVBA 2LCPA 1U5IA 1MUXA 2A4JA 1XFXO 4BY4A 1CM4A 1PRWA 1F71A 2KFGA 4MRYA 2L2EA 4ORAB 1RROA 1TCFA 2I7AA 4Q04A 4GFTA 1IH0A 1LA3A 2M1KB 5J3XA 5KTYA 2LMTA 1SYMA 1U5IB 2JTZA 2L98A 1M31A 3I5HC 4PHJA 1OOJA 4WQ2A 1OMRA 1OQPA 1XFZO 1KSMA 2F2OA 4P5OE 1QTXA 2AAOA 1YVLA 3CLNA 4YGEB 1AJ5A 1JFJA 1NCXA 1YX7A 2NCOA 1EH2A 1OMVA 2BCAA 3BOWA 5PALA 4ICBA 5DKQA 4P2YB 1EXRA 2L4HA 1F54A 1JFKA 2COLB 1NX1A 1QV0A 1RK9A 3SG6A 3CGAA 1OE9B 2ZKMX 1CDPA 2ZFDA 2KOTA 1YR5A 2M8UA 3M0WA 1UWOA 4BY5A 2F8PA 1G33A 2HQ8A 3I5FC 3KF9A 1K9UA 2NXQA 1GQMA 1LINA 1XK4C 1RJVA 2KI6D 1PSRA 2M9GA 3AKAA 1B7TZ 1ALVA 3SIAA 2AMIA 2K0JA 3KHEA 1L7ZA 1KFXL 2ZN8A 3VRNA 1A4PA 1NSHA 1QX5B 1SR6C 2JXCA 1UHNA 1SPYA 2I94A 1SNLA 3LK0A 3CR4X 3OX5A 4HRGA 4ZCVA 1B8LA 1OZOA 4PHKA 4DS7A 1MF8B 2OTGC 1VRKA 2KQYA 5JJGA 4JWQA 1PVBA 1C7VA 2JC2A 1S36A 1QS7A 2LUCA 3LK1A 4GGFC 4R1EA 1M45A 1ZMZA 1JWDA 1AVSA 1ZACA 2KBIA 3VGOA 1F8HA 2ZN9A 2ZNEA 1UP5A 4MEWA 2K7OA 4YGDB 3ZWHA 1RTP1 1K90D 4YRUA 3EK8A 1KK8C 3SG4A 4UPGA 3BUWB 4PCWA 2L5XB 2MJWB 3A4UB 1N65A 3LLEA 2JT3A 1KWOC 2EGDA 1IQ5A 2JULA 2LUXA 1KK7Z 1DJYA 2JT8A 3TS5C 2QACA 2FCDA 2I2RE 2JT0A 2ISDA 2KI4B 3KPXA 1J55A 1XFUO 2LLUA 1FBVA 3AAJA 3EK7A 4NDDA 1R2UA 1MHOA 3DVJA 3ICBA 4M2QA 2KAXA 2CCMA 2K7CA 4I5KA 2BL0B 1DJHA 2M97A 2IS9A 1CDNA 1CDMA 4PE0A 4YGCB 1XO5A 2L0PA 1GJYA 2JZIA 3I5GC 1CLBA 4DCKA 1AHRA 2BKIB 1NWDA 4N1FA 2KBMA 2BE4A 1J1EA 3JVTB 1ZUZA 5F6TA 2H61A 3DF0A 4PDZA 2KYFA 5D69A 2ZNDA 3GK1A 2F3ZA 2BCXA 1XFVO 1NCYA 1OSAA 1C07A 3O78A 2H61C 1BR4B 4MSPA 2MLEC 4USLA 4L9MA 2Q4UA 2NZ0A 2K7BA 1SR6B 2CT9A 1TNQA 1Y1UA 1NUBA 2KNEA 4MBEA 1N0YA 5JOLA 1A2XA 2WORA 1JSAA 3OHMB 3IQQA 5BPJA 1B47A 1XK4A 1QVIZ 2WCEA 2O5GA 3JVTC 3HX4A 2M7NA 1TN4A 1SKTA 2I18A 1BMOA 1LXFC 4C0LA 1K95A 1R6PA 4YGAA 1N2DA 1CTRA 1G4YR 1Y0VH 3VRRA 2E6WA 3PN7C 3TDUA 2F2PA 1XYDA 1K96A 1EL4A 2DOQA 1C7WA 2KFFA 2Q91A 1F4QA 3OX6A 5CSNA 1DF0A 3D0YB 5GQQC 1SCMC 3EVVA 1ZOTB 2LANA 1IJ5A 1TOPA 4AOMA 3KO0A 2KI6C 1DJIA 1SBJA 1WLMA 2V53A 2CXJA 2L50A 1TIZA 1YURA 1CFCA 1F4OA 1NP8A 2LLTA 3FWCA 2PRUA 4QJ5B 1MXLC 2WCBA 3WHUB 1SRAA 1QJTA 1B7TY 1NX3A 1EG3A 5I2LA 2RGIA 2HETA 4F0ZB 1IGVA 1DJWA 1S5GY 2M3WA 5TNCA 2LAPA 1CMFA 4ORBB 4GAOA 2BBMA 4IL1A 3TUYC 1BJFA 4HRHA 1MR8A 1RFJA 5HLOA 1LA0A 1B4CA 1PALA 2M1UA 5B8IB 1NX0A 1CNPA 1XVJA 2L4IA 3FWBA 2H2KA 1UHKA 3DD4A 4I5NB 1J7QA 4FTGA 3FIAA 4OV2A 5AEQA 3AKBA 1BR1B 2LVVA 2O60A 1WDCC 2MHHA 3GK4X 3IQOA 2EC6C 1BLQA 2KGBC 1FW4A 1TTXA 3CR2A 4ETOA 2LVIA 1DGVA 4ORCB 1CFPA 2Y5IA 3BUNB 3BYAA 4OKHA 1YUTA 3I5IC 4PE1A 1K93D 4I5LB 2KGRA 1B8RA 4CPVA 2GGZA 1AK8A 1Y1AA 1YX8A 3I5GB 3NSKA 2OS8C 3PM8A 5KSZA 2LVKA 3LL8B 1CDLA 2QPTA 1WY9A 1EG4A 2LP3A 1OZSA 4MZJA 4QJ3B 1YUUA 4PE7A 4YI8A 4N5XA 1V1GA 2LVJA 4QJ4B 1BT6A 3ZNIA 4C0JA 1HT9A 2KHNA 1UHHA 2KI4C 1XFWO 1CLLA 1DMOA 1E8AA 5D7FA 3BQ3A 1DT7B 2KQ6A 1W7IB 2KAVA 4MVFA 1TNXA 5CSFA 3OP0A 2KSPA 4MLWA 1DGUA 5HKYA 3NXAA 1MQ1A 2JWWA 2JPTA 3O2PA 4CFRA 2LHLA 1FF1A 1QIWA 2GV5A 1YVHA 2LNKA 5K89A 4HREE 1ZFSA 1CMGA 5ER4X 1KQMB 2CNPA 1SY9A 2BKHB 3A8RA 1IRJA 4PHNA 4XJKB 2LMUA 1KK7Y 3WHTB 1L2OC 1Q80A 1QATA 5CSIA 2K2AA 2OTGB 2JOJA 1QX7A 1SCVA 2LLSA 1UURA 3JTDC 4OCIA 4YGBB 4OVNF 2F3YA 3OB2B 2JXLA 1A03A 1WRZA 5DKNA 4XJKA 1K9KA 1SL7A 2LC5A 1S1EA 1A29A 1NIWA 1A75B 3PSRA 4NDBA 5AXIA 1IG5A 1MXEA 3I5FB 2KDHA 1M46A 3PLFB 4OR9B 3SIBA 2NLNA 1XFYO 2BECA 3RM1A 1J1DA 2PASA 2Y1MA 1QVIY 3O4YA 4D1EA 1QX2A 3RLZA 2WNDA 1QXPA 1TNWA 1BG1A 1AP4A 1B9AA 5HKZA 1KFUL 1SMGA 2CTNA 3SG3A 4CIDA 2JNFA 2K2FA 1CKKA 2AUCA 3NSIA 4ZCUA 1S6JA 5HLVA 1ODBA 1NPQA 4GGNA 4PE4A 1DF0B 3D0YA 5FYXA 1IJ6A 1B1GA 4YI9A 1YUSA 2LMVA 2PSRA 3TS5B 2G9BA 1A75A 1PK0D 5AANA 3TUYB 1XA5A 4C0KA 1KCYA 1WRLA 2LP2A 1KQVA 3C1VA 1KWOB 1J7OA 2M7LA 3DVEA 2MA2A 3TDIA 3VRPA 5AERA 3PFVA 3VROA 4CFQA 1CFFA 2B1UA 1KFXS 1F55A 2FCEA 3NSOA 1KK8B 1CFDA 2MRDA 1JBAA 4GBAA 2EC6B 4NQGA 3NSLA 2EHBA 1JF0A 1QLKA 3LCPC 1CB1A 2HQWA 1FI6A 1KSOA 3GK2A 1AJ4A 1W7JB 1K9PA 2LE9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MZK A;  1TNP A;  2Y4Q A;  1WLZ A;  1S3P A;  4MRX A;  4FQO A;  4YBH B;  2KYC A;  3H4S E;  2NCP A;  1IWQ A;  1S6I A;  3OB1 B;  1S26 D;  3BOW B;  2JU0 A;  4M2P A;  5ER5 A;  1BOD A;  1G8I A;  1D1O A;  3SG7 A;  2BE6 A;  2HF5 A;  3E3R A;  1J7P A;  1DVI A;  2PAL A;  1S6C A;  1JF2 A;  3I5I B;  4DUQ A;  2G2B A;  2SCP A;  5HKW A;  2VRG A;  3BUO B;  3BUM B;  4I5J A;  3MSE B;  1SL8 A;  3BXK A;  2CBL A;  1M39 A;  1CM1 A;  1SL9 A;  5I2O A;  2SAS A;  5CPV A;  4DRW A;  3K21 A;  1UHI A;  3EKH A;  1H4B A;  2BL0 C;  1YTZ C;  2PMY A;  4JPZ B;  3CWG A;  2GGM A;  2FJU B;  2LM5 A;  3CR5 X;  3WNX B;  1HQV A;  5IBW A;  2BCB A;  4AQJ A;  2HPS A;  1JC2 A;  4A4C A;  1GGZ A;  1REC A;  1TRF A;  5G08 A;  1QIV A;  2K7D A;  1NYA A;  3EVR A;  3O6B A;  2OPO A;  4CLN A;  1V1F A;  5HYD A;  3TDZ A;  4AQI A;  1QAS A;  3PAL A;  4MN0 A;  4MZL A;  2WC8 A;  1IQ3 A;  2M49 B;  2L51 A;  1UHJ A;  2ZRT A;  1QLS A;  3QRX A;  4GPL B;  1SK6 D;  2K61 A;  4GUK A;  2WCF A;  4E68 A;  1AUI B;  4HSZ A;  1K94 A;  3PAT A;  1FPW A;  3CZT X;  1JUO A;  3DVK A;  2F33 A;  4M2O A;  1YRU B;  5I8N A;  1WDC B;  5KU1 A;  1BU3 A;  3SJS A;  4PHM A;  1YRT B;  1Y1X A;  1MWN A;  2E30 A;  2FOT A;  3IF7 A;  1Y6W A;  1PVA A;  2D8N A;  2Y1N A;  4JQ0 D;  1H8B A;  1DJG A;  2KAY A;  2MLF C;  2JTT A;  2TN4 A;  3EVU A;  4DIR A;  1FI5 A;  2MAZ A;  1DTL A;  1WRK A;  1NX2 A;  3SG5 A;  3TZ1 A;  3FS7 A;  2OS8 B;  5AFP A;  1IKU A;  4PAL A;  1PSB A;  3AAK A;  1CLM A;  3PN7 B;  1GGW A;  1PUL A;  3I5H B;  5DKR A;  2WOS A;  3DVM A;  4NDC A;  1X02 A;  2BBN A;  5I2Q A;  1SW8 A;  2JRF A;  3SG2 A;  3F45 A;  4N1G A;  3WXA A;  4XYN A;  2M0R A;  1LVC D;  2LV7 A;  3D10 A;  2ZRS A;  3DF0 B;  1BF5 A;  3BUX B;  3GOF A;  1DJX A;  1K2H A;  1KFU S;  3KEV A;  3EK4 A;  3EKJ A;  4U8D A;  3JTD B;  2R2I A;  1EJ3 A;  1TCO B;  1OMD A;  1ALW A;  1UUS A;  1LKJ A;  3CS1 A;  2KFH A;  1M63 B;  2M29 A;  5CSJ A;  2MBX A;  1SCM B;  4GGF A;  2JQ6 A;  4TNC A;  1B8C A;  2LHI A;  2K8M B;  2JNX A;  1KQM C;  4WRI A;  2P6B B;  3VRQ A;  1RWY A;  1QV1 A;  1NCZ A;  1L2O B;  4GNK B;  4WQ3 A;  1F70 A;  3CTN A;  4A4B A;  3HCM A;  1J7R A;  1BOC A;  1K8U A;  1DJZ A;  1S5G Z;  2PVB A;  2LCP A;  1U5I A;  1MUX A;  2A4J A;  1XFX O;  4BY4 A;  1CM4 A;  1PRW A;  1F71 A;  2KFG A;  4MRY A;  2L2E A;  4ORA B;  1RRO A;  1TCF A;  2I7A A;  4Q04 A;  4GFT A;  1IH0 A;  1LA3 A;  2M1K B;  5J3X A;  5KTY A;  2LMT A;  1SYM A;  1U5I B;  2JTZ A;  2L98 A;  1M31 A;  3I5H C;  4PHJ A;  1OOJ A;  4WQ2 A;  1OMR A;  1OQP A;  1XFZ O;  1KSM A;  2F2O A;  4P5O E;  1QTX A;  2AAO A;  1YVL A;  3CLN A;  4YGE B;  1AJ5 A;  1JFJ A;  1NCX A;  1YX7 A;  2NCO A;  1EH2 A;  1OMV A;  2BCA A;  3BOW A;  5PAL A;  4ICB A;  5DKQ A;  4P2Y B;  1EXR A;  2L4H A;  1F54 A;  1JFK A;  2COL B;  1NX1 A;  1QV0 A;  1RK9 A;  3SG6 A;  3CGA A;  1OE9 B;  2ZKM X;  1CDP A;  2ZFD A;  2KOT A;  1YR5 A;  2M8U A;  3M0W A;  1UWO A;  4BY5 A;  2F8P A;  1G33 A;  2HQ8 A;  3I5F C;  3KF9 A;  1K9U A;  2NXQ A;  1GQM A;  1LIN A;  1XK4 C;  1RJV A;  2KI6 D;  1PSR A;  2M9G A;  3AKA A;  1B7T Z;  1ALV A;  3SIA A;  2AMI A;  2K0J A;  3KHE A;  1L7Z A;  1KFX L;  2ZN8 A;  3VRN A;  1A4P A;  1NSH A;  1QX5 B;  1SR6 C;  2JXC A;  1UHN A;  1SPY A;  2I94 A;  1SNL A;  3LK0 A;  3CR4 X;  3OX5 A;  4HRG A;  4ZCV A;  1B8L A;  1OZO A;  4PHK A;  4DS7 A;  1MF8 B;  2OTG C;  1VRK A;  2KQY A;  5JJG A;  4JWQ A;  1PVB A;  1C7V A;  2JC2 A;  1S36 A;  1QS7 A;  2LUC A;  3LK1 A;  4GGF C;  4R1E A;  1M45 A;  1ZMZ A;  1JWD A;  1AVS A;  1ZAC A;  2KBI A;  3VGO A;  1F8H A;  2ZN9 A;  2ZNE A;  1UP5 A;  4MEW A;  2K7O A;  4YGD B;  3ZWH A;  1RTP 1;  1K90 D;  4YRU A;  3EK8 A;  1KK8 C;  3SG4 A;  4UPG A;  3BUW B;  4PCW A;  2L5X B;  2MJW B;  3A4U B;  1N65 A;  3LLE A;  2JT3 A;  1KWO C;  2EGD A;  1IQ5 A;  2JUL A;  2LUX A;  1KK7 Z;  1DJY A;  2JT8 A;  3TS5 C;  2QAC A;  2FCD A;  2I2R E;  2JT0 A;  2ISD A;  2KI4 B;  3KPX A;  1J55 A;  1XFU O;  2LLU A;  1FBV A;  3AAJ A;  3EK7 A;  4NDD A;  1R2U A;  1MHO A;  3DVJ A;  3ICB A;  4M2Q A;  2KAX A;  2CCM A;  2K7C A;  4I5K A;  2BL0 B;  1DJH A;  2M97 A;  2IS9 A;  1CDN A;  1CDM A;  4PE0 A;  4YGC B;  1XO5 A;  2L0P A;  1GJY A;  2JZI A;  3I5G C;  1CLB A;  4DCK A;  1AHR A;  2BKI B;  1NWD A;  4N1F A;  2KBM A;  2BE4 A;  1J1E A;  3JVT B;  1ZUZ A;  5F6T A;  2H61 A;  3DF0 A;  4PDZ A;  2KYF A;  5D69 A;  2ZND A;  3GK1 A;  2F3Z A;  2BCX A;  1XFV O;  1NCY A;  1OSA A;  1C07 A;  3O78 A;  2H61 C;  1BR4 B;  4MSP A;  2MLE C;  4USL A;  4L9M A;  2Q4U A;  2NZ0 A;  2K7B A;  1SR6 B;  2CT9 A;  1TNQ A;  1Y1U A;  1NUB A;  2KNE A;  4MBE A;  1N0Y A;  5JOL A;  1A2X A;  2WOR A;  1JSA A;  3OHM B;  3IQQ A;  5BPJ A;  1B47 A;  1XK4 A;  1QVI Z;  2WCE A;  2O5G A;  3JVT C;  3HX4 A;  2M7N A;  1TN4 A;  1SKT A;  2I18 A;  1BMO A;  1LXF C;  4C0L A;  1K95 A;  1R6P A;  4YGA A;  1N2D A;  1CTR A;  1G4Y R;  1Y0V H;  3VRR A;  2E6W A;  3PN7 C;  3TDU A;  2F2P A;  1XYD A;  1K96 A;  1EL4 A;  2DOQ A;  1C7W A;  2KFF A;  2Q91 A;  1F4Q A;  3OX6 A;  5CSN A;  1DF0 A;  3D0Y B;  5GQQ C;  1SCM C;  3EVV A;  1ZOT B;  2LAN A;  1IJ5 A;  1TOP A;  4AOM A;  3KO0 A;  2KI6 C;  1DJI A;  1SBJ A;  1WLM A;  2V53 A;  2CXJ A;  2L50 A;  1TIZ A;  1YUR A;  1CFC A;  1F4O A;  1NP8 A;  2LLT A;  3FWC A;  2PRU A;  4QJ5 B;  1MXL C;  2WCB A;  3WHU B;  1SRA A;  1QJT A;  1B7T Y;  1NX3 A;  1EG3 A;  5I2L A;  2RGI A;  2HET A;  4F0Z B;  1IGV A;  1DJW A;  1S5G Y;  2M3W A;  5TNC A;  2LAP A;  1CMF A;  4ORB B;  4GAO A;  2BBM A;  4IL1 A;  3TUY C;  1BJF A;  4HRH A;  1MR8 A;  1RFJ A;  5HLO A;  1LA0 A;  1B4C A;  1PAL A;  2M1U A;  5B8I B;  1NX0 A;  1CNP A;  1XVJ A;  2L4I A;  3FWB A;  2H2K A;  1UHK A;  3DD4 A;  4I5N B;  1J7Q A;  4FTG A;  3FIA A;  4OV2 A;  5AEQ A;  3AKB A;  1BR1 B;  2LVV A;  2O60 A;  1WDC C;  2MHH A;  3GK4 X;  3IQO A;  2EC6 C;  1BLQ A;  2KGB C;  1FW4 A;  1TTX A;  3CR2 A;  4ETO A;  2LVI A;  1DGV A;  4ORC B;  1CFP A;  2Y5I A;  3BUN B;  3BYA A;  4OKH A;  1YUT A;  3I5I C;  4PE1 A;  1K93 D;  4I5L B;  2KGR A;  1B8R A;  4CPV A;  2GGZ A;  1AK8 A;  1Y1A A;  1YX8 A;  3I5G B;  3NSK A;  2OS8 C;  3PM8 A;  5KSZ A;  2LVK A;  3LL8 B;  1CDL A;  2QPT A;  1WY9 A;  1EG4 A;  2LP3 A;  1OZS A;  4MZJ A;  4QJ3 B;  1YUU A;  4PE7 A;  4YI8 A;  4N5X A;  1V1G A;  2LVJ A;  4QJ4 B;  1BT6 A;  3ZNI A;  4C0J A;  1HT9 A;  2KHN A;  1UHH A;  2KI4 C;  1XFW O;  1CLL A;  1DMO A;  1E8A A;  5D7F A;  3BQ3 A;  1DT7 B;  2KQ6 A;  1W7I B;  2KAV A;  4MVF A;  1TNX A;  5CSF A;  3OP0 A;  2KSP A;  4MLW A;  1DGU A;  5HKY A;  3NXA A;  1MQ1 A;  2JWW A;  2JPT A;  3O2P A;  4CFR A;  2LHL A;  1FF1 A;  1QIW A;  2GV5 A;  1YVH A;  2LNK A;  5K89 A;  4HRE E;  1ZFS A;  1CMG A;  5ER4 X;  1KQM B;  2CNP A;  1SY9 A;  2BKH B;  3A8R A;  1IRJ A;  4PHN A;  4XJK B;  2LMU A;  1KK7 Y;  3WHT B;  1L2O C;  1Q80 A;  1QAT A;  5CSI A;  2K2A A;  2OTG B;  2JOJ A;  1QX7 A;  1SCV A;  2LLS A;  1UUR A;  3JTD C;  4OCI A;  4YGB B;  4OVN F;  2F3Y A;  3OB2 B;  2JXL A;  1A03 A;  1WRZ A;  5DKN A;  4XJK A;  1K9K A;  1SL7 A;  2LC5 A;  1S1E A;  1A29 A;  1NIW A;  1A75 B;  3PSR A;  4NDB A;  5AXI A;  1IG5 A;  1MXE A;  3I5F B;  2KDH A;  1M46 A;  3PLF B;  4OR9 B;  3SIB A;  2NLN A;  1XFY O;  2BEC A;  3RM1 A;  1J1D A;  2PAS A;  2Y1M A;  1QVI Y;  3O4Y A;  4D1E A;  1QX2 A;  3RLZ A;  2WND A;  1QXP A;  1TNW A;  1BG1 A;  1AP4 A;  1B9A A;  5HKZ A;  1KFU L;  1SMG A;  2CTN A;  3SG3 A;  4CID A;  2JNF A;  2K2F A;  1CKK A;  2AUC A;  3NSI A;  4ZCU A;  1S6J A;  5HLV A;  1ODB A;  1NPQ A;  4GGN A;  4PE4 A;  1DF0 B;  3D0Y A;  5FYX A;  1IJ6 A;  1B1G A;  4YI9 A;  1YUS A;  2LMV A;  2PSR A;  3TS5 B;  2G9B A;  1A75 A;  1PK0 D;  5AAN A;  3TUY B;  1XA5 A;  4C0K A;  1KCY A;  1WRL A;  2LP2 A;  1KQV A;  3C1V A;  1KWO B;  1J7O A;  2M7L A;  3DVE A;  2MA2 A;  3TDI A;  3VRP A;  5AER A;  3PFV A;  3VRO A;  4CFQ A;  1CFF A;  2B1U A;  1KFX S;  1F55 A;  2FCE A;  3NSO A;  1KK8 B;  1CFD A;  2MRD A;  1JBA A;  4GBA A;  2EC6 B;  4NQG A;  3NSL A;  2EHB A;  1JF0 A;  1QLK A;  3LCP C;  1CB1 A;  2HQW A;  1FI6 A;  1KSO A;  3GK2 A;  1AJ4 A;  1W7J B;  1K9P A;  2LE9 B; 
#chains in the Genus database with same CATH topology
 4MZK A;  1TNP A;  2Y4Q A;  1WLZ A;  1S3P A;  4MRX A;  4FQO A;  4YBH B;  2KYC A;  3H4S E;  2NCP A;  1IWQ A;  1S6I A;  3OB1 B;  4JD9 A;  1S26 D;  3BOW B;  2JU0 A;  4M2P A;  5ER5 A;  5FI2 A;  1BOD A;  1G8I A;  1D1O A;  3SG7 A;  2BE6 A;  4KYN A;  2HF5 A;  3E3R A;  1J7P A;  1DVI A;  2PAL A;  1S6C A;  1JF2 A;  3I5I B;  4DUQ A;  1DEK A;  2G2B A;  2KLD A;  2SCP A;  2QEB A;  2VRG A;  3BUO B;  3BUM B;  4I5J A;  5HKW A;  4JKT A;  3MSE B;  1SL8 A;  3BXK A;  2CBL A;  1M39 A;  1CM1 A;  1SL9 A;  5I2O A;  4INW A;  2SAS A;  5CPV A;  4DRW A;  5FI6 A;  3K21 A;  3FE6 A;  1UHI A;  3EKH A;  1H4B A;  2BL0 C;  1YTZ C;  2PMY A;  4JPZ B;  3CWG A;  2GGM A;  2FJU B;  2LM5 A;  3CR5 X;  3WNX B;  1HQV A;  5IBW A;  2BCB A;  4AQJ A;  2HPS A;  1JC2 A;  2WCL A;  4A4C A;  1GGZ A;  1REC A;  1TRF A;  5G08 A;  1QIV A;  5I94 A;  2K7D A;  1T14 A;  1NYA A;  3EVR A;  3O6B A;  2OPO A;  4CLN A;  3SS3 A;  1V1F A;  5HYD A;  1LS8 A;  3TDZ A;  4AQI A;  1QAS A;  3PAL A;  4MN0 A;  3DZT A;  4MZL A;  2WC8 A;  1IQ3 A;  2M49 B;  2L51 A;  1UHJ A;  2ZRT A;  4OZD A;  1QLS A;  3QRX A;  4GPL B;  1SK6 D;  2K61 A;  4GUK A;  1GM0 A;  2WCF A;  4E68 A;  1AUI B;  4HSZ A;  1K94 A;  3PAT A;  1FPW A;  3CZT X;  1JUO A;  3DVK A;  2F33 A;  4M2O A;  1YRU B;  5I8N A;  1XFR A;  1WDC B;  5KU1 A;  1BU3 A;  3SJS A;  4PHM A;  1YRT B;  1Y1X A;  1MWN A;  2E30 A;  2FOT A;  3IF7 A;  1Y6W A;  1PVA A;  2D8N A;  2Y1N A;  4JQ0 D;  1H8B A;  1DJG A;  2KAY A;  1Z4H A;  2JTT A;  2MLF C;  2TN4 A;  3EVU A;  4DIR A;  1FI5 A;  2MAZ A;  1DTL A;  1WRK A;  1NX2 A;  3SG5 A;  3TZ1 A;  3FS7 A;  4F7F A;  2OS8 B;  3B87 A;  5AFP A;  1IKU A;  4PAL A;  1PSB A;  2PQL A;  1CLM A;  3AAK A;  3PN7 B;  1GGW A;  1PUL A;  3I5H B;  5DKR A;  2WOS A;  2P71 A;  1DC1 A;  3DVM A;  4NDC A;  1X02 A;  2BBN A;  5I2Q A;  1SW8 A;  2JRF A;  3SG2 A;  3F45 A;  4N1G A;  3WXA A;  3DY9 A;  4XYN A;  2M0R A;  1LVC D;  2LV7 A;  3D10 A;  3SS5 A;  2ZRS A;  3DF0 B;  3QME A;  1BF5 A;  3BUX B;  3GOF A;  5FI7 A;  1DJX A;  1K2H A;  1KFU S;  3KEV A;  3EK4 A;  3EKJ A;  4U8D A;  3JTD B;  2R2I A;  1EJ3 A;  1TCO B;  1OMD A;  1ALW A;  1UUS A;  1LKJ A;  2ERB A;  3CS1 A;  2KFH A;  1M63 B;  2M29 A;  5CSJ A;  2MBX A;  1SCM B;  4GGF A;  2JQ6 A;  4TNC A;  1B8C A;  2LHI A;  4INX A;  2BAP A;  2JNX A;  2K8M B;  1KQM C;  4WRI A;  2P6B B;  3VRQ A;  1C3Z A;  1RWY A;  1QV1 A;  3CDN A;  1NCZ A;  1L2O B;  4GNK B;  4WQ3 A;  2FJY A;  3CTN A;  4A4B A;  3HCM A;  1F70 A;  1W9Z A;  1J7R A;  1BOC A;  3BFA A;  1K8U A;  1DJZ A;  1S5G Z;  2PVB A;  2LCP A;  1U5I A;  1MUX A;  2A4J A;  1XFX O;  4BY4 A;  1CM4 A;  1PRW A;  1F71 A;  2KFG A;  4MRY A;  2L2E A;  4ORA B;  1RRO A;  1TCF A;  2I7A A;  4Q04 A;  4GFT A;  1IH0 A;  1LA3 A;  2M1K B;  5J3X A;  5KTY A;  2LMT A;  1SYM A;  1U5I B;  2JTZ A;  2L98 A;  1M31 A;  3I5H C;  3R1O A;  2H8V A;  4PHJ A;  1OOJ A;  4WQ2 A;  1OMR A;  1OQP A;  1XFZ O;  1KSM A;  2F2O A;  4P5O E;  1QTX A;  2AAO A;  1YVL A;  3CLN A;  4YGE B;  1AJ5 A;  3D75 A;  1NCX A;  1YX7 A;  2NCO A;  1EH2 A;  1JFJ A;  3FE8 A;  1OMV A;  2BCA A;  3BOW A;  3DYE A;  5PAL A;  4ICB A;  5DKQ A;  4P2Y B;  1EXR A;  2L4H A;  1F54 A;  1JFK A;  2COL B;  1NX1 A;  1QV0 A;  1RK9 A;  2GTE A;  3SG6 A;  3CGA A;  1OE9 B;  2ZKM X;  1CDP A;  2ZFD A;  2KOT A;  1YR5 A;  2M8U A;  3M0W A;  4IJ7 A;  1UWO A;  3B7A A;  2F8P A;  1G33 A;  4BY5 A;  2HQ8 A;  3I5F C;  3KF9 A;  4XJK B;  1K9U A;  2NXQ A;  1GQM A;  1Z2C B;  1LIN A;  1XK4 C;  1RJV A;  2KI6 D;  1PSR A;  2M9G A;  3S0B A;  3AKA A;  1B7T Z;  3EG5 B;  1ALV A;  3SIA A;  2AMI A;  2K0J A;  3NHT A;  3KHE A;  1L7Z A;  1KFX L;  2ZN8 A;  2K60 A;  3VRN A;  1A4P A;  1NSH A;  1QX5 B;  1SR6 C;  3S0G A;  2JXC A;  1UHN A;  1SPY A;  2I94 A;  1SNL A;  3LK0 A;  3CR4 X;  3OX5 A;  4HRG A;  4ZCV A;  1B8L A;  1OZO A;  4PHK A;  4DS7 A;  3R72 A;  1MF8 B;  2OTG C;  1VRK A;  2KQY A;  5JJG A;  4JWQ A;  1PVB A;  3NGV A;  1C7V A;  2JC2 A;  1S36 A;  1QS7 A;  2LUC A;  3LK1 A;  4GGF C;  4R1E A;  1M45 A;  1ZMZ A;  1JWD A;  1AVS A;  1ZAC A;  2KBI A;  3VGO A;  1F8H A;  2ZN9 A;  2ZNE A;  1UP5 A;  4MEW A;  2K7O A;  4YGD B;  1OOG A;  3ZWH A;  1RTP 1;  1K90 D;  4YRU A;  3EK8 A;  1KK8 C;  3SG4 A;  4UPG A;  3BUW B;  4PCW A;  2KPH A;  2L5X B;  2MJW B;  3VB1 A;  3A4U B;  1N65 A;  1SSE B;  2JT3 A;  3LLE A;  1KWO C;  2EGD A;  1IQ5 A;  2JUL A;  2L2C A;  2LUX A;  1KK7 Z;  2WC6 A;  1DJY A;  2JT8 A;  3Q8I A;  2QAC A;  3TS5 C;  2FCD A;  2I2R E;  2JT0 A;  2ISD A;  2KI4 B;  3KPX A;  1J55 A;  1OW4 A;  1XFU O;  2LLU A;  1FBV A;  3AAJ A;  3EK7 A;  4NDD A;  1R2U A;  1MHO A;  3DVJ A;  3ICB A;  4M2Q A;  2KAX A;  2CCM A;  2K7C A;  4I5K A;  2BL0 B;  1DJH A;  2M97 A;  2IS9 A;  1CDN A;  1CDM A;  1P28 A;  4PE0 A;  4YGC B;  1XO5 A;  2L0P A;  3BFH A;  1GJY A;  2JZI A;  3I5G C;  1CLB A;  4DCK A;  1AHR A;  1C3Y A;  2BKI B;  1NWD A;  3D73 A;  2WC5 A;  4N1F A;  2KBM A;  2BE4 A;  1J1E A;  3JVT B;  1ZUZ A;  5F6T A;  2H61 A;  3DF0 A;  4PDZ A;  2KYF A;  5D69 A;  2ZND A;  3GK1 A;  2F3Z A;  2BCX A;  1XFV O;  1NCY A;  1OSA A;  1C07 A;  3O78 A;  2H61 C;  1BR4 B;  4MSP A;  2MLE C;  4USL A;  4L9M A;  2Q4U A;  2NZ0 A;  2K7B A;  1SR6 B;  2CT9 A;  1TNQ A;  1Y1U A;  3BFB A;  1NUB A;  2KNE A;  4MBE A;  1N0Y A;  3CZ2 A;  3CZ1 A;  1A2X A;  5JOL A;  2WOR A;  1JSA A;  3OHM B;  3IQQ A;  2WCH A;  5BPJ A;  1OOH A;  3S0A A;  1B47 A;  1XK4 A;  1QVI Z;  2WCE A;  3S0D A;  2O5G A;  3JVT C;  3HX4 A;  2M7N A;  1TN4 A;  3B6X A;  1SKT A;  2I18 A;  1BMO A;  1LXF C;  4C0L A;  1K95 A;  1R6P A;  4YGA A;  1N2D A;  1CTR A;  1G4Y R;  1Y0V H;  3VRR A;  2E6W A;  1TUZ A;  3PN7 C;  3TDU A;  2F2P A;  1XYD A;  3V2L A;  1K96 A;  1EL4 A;  2DOQ A;  3IVT A;  1C7W A;  2KFF A;  2Q91 A;  1F4Q A;  3OX6 A;  5CSN A;  1DF0 A;  3D0Y B;  5GQQ C;  1SCM C;  3EVV A;  1ZOT B;  2LAN A;  1IJ5 A;  1TOP A;  4AOM A;  3KO0 A;  2KI6 C;  3UNW A;  1DJI A;  1SBJ A;  1WLM A;  3L4L A;  2V53 A;  2CXJ A;  5EL2 A;  2L50 A;  3D77 A;  3WHT B;  1YUR A;  1TIZ A;  1CFC A;  5D3O A;  1F4O A;  1NP8 A;  2LLT A;  3FWC A;  2PRU A;  4QJ5 B;  1MXL C;  1QWV A;  2WCB A;  3WHU B;  1SRA A;  1QJT A;  1B7T Y;  1NX3 A;  1EG3 A;  5I2L A;  2RGI A;  2HET A;  4F0Z B;  1IGV A;  1DJW A;  1S5G Y;  2M3W A;  2P70 A;  2LAP A;  3R1P A;  4ORB B;  5TNC A;  5HL1 A;  1CMF A;  4GAO A;  2BBM A;  2QEH A;  3BJH A;  4IL1 A;  3TUY C;  1BJF A;  4HRH A;  3CAB A;  1MR8 A;  1RFJ A;  5HLO A;  1LA0 A;  1B4C A;  1PAL A;  2M1U A;  5B8I B;  1NX0 A;  1CNP A;  1XVJ A;  2L4I A;  3FWB A;  3L4A A;  2H2K A;  1UHK A;  3DD4 A;  4I5N B;  1J7Q A;  4FTG A;  3FIA A;  2PYQ A;  4OV2 A;  5AEQ A;  3AKB A;  1BR1 B;  2LVV A;  2O60 A;  1WDC C;  3L47 A;  2MHH A;  3GK4 X;  3NHI A;  3IQO A;  1TWO A;  2EC6 C;  3B86 A;  2KGB C;  4FQT A;  1BLQ A;  1FW4 A;  1TTX A;  3CR2 A;  4ETO A;  2LVI A;  1DGV A;  4ORC B;  1CFP A;  2QEV A;  2Y5I A;  3BUN B;  3N7H A;  3BYA A;  2BNX A;  1YUT A;  4OKH A;  3I5I C;  4PE1 A;  1K93 D;  4I5L B;  2KGR A;  1B8R A;  3OGN A;  2GGZ A;  4CPV A;  1Y1A A;  1AK8 A;  1YX8 A;  3I5G B;  3NSK A;  2OS8 C;  3PM8 A;  5KSZ A;  2LVK A;  3DXL A;  2L5Y A;  3LL8 B;  1CDL A;  2QPT A;  1WY9 A;  1EG4 A;  2LP3 A;  1OZS A;  3OBV A;  4MZJ A;  3PJI A;  3SS4 A;  4QJ3 B;  1YUU A;  4PE7 A;  4YI8 A;  4N5X A;  1V1G A;  2LVJ A;  4QJ4 B;  1BT6 A;  3ZNI A;  4C0J A;  1HT9 A;  2KHN A;  1UHH A;  2KI4 C;  1XFW O;  1CLL A;  1DMO A;  1E8A A;  5D7F A;  3BQ3 A;  1DT7 B;  3PM2 A;  2KQ6 A;  1W7I B;  2KAV A;  4MVF A;  1TNX A;  5CSF A;  3OP0 A;  2QDI A;  1IIO A;  3S0E A;  3D74 A;  2KSP A;  4MLW A;  1DGU A;  2KLE A;  5HKY A;  3NXA A;  1MQ1 A;  2JWW A;  2JPT A;  3O2P A;  3O4X A;  4CFR A;  2LHL A;  1FF1 A;  1QIW A;  2GV5 A;  1YVH A;  2LNK A;  5K89 A;  4HRE E;  1ZFS A;  1TUJ A;  1CMG A;  5ER4 X;  3D76 A;  1KQM B;  2CNP A;  1SY9 A;  2BKH B;  1OOI X;  1IRJ A;  2YGU A;  3A8R A;  2LMU A;  1KK7 Y;  4PHN A;  1L2O C;  1Q80 A;  1QAT A;  5CSI A;  2K2A A;  2OTG B;  2JOJ A;  1QX7 A;  1SCV A;  2LLS A;  5DIC A;  2WCJ A;  1UUR A;  2WCK A;  3JTD C;  4OCI A;  4OVN F;  4YGB B;  2F3Y A;  3UO9 A;  3OB2 B;  2JXL A;  1A03 A;  1WRZ A;  2JPO A;  5DKN A;  4XJK A;  1K9K A;  1SL7 A;  1DEL A;  2LC5 A;  1S1E A;  1A29 A;  1NIW A;  2WCM A;  1A75 B;  3K1E A;  1ORG A;  3PSR A;  4NDB A;  5AXI A;  3CYZ A;  1IG5 A;  3R1V A;  1MXE A;  3I5F B;  2KDH A;  1M46 A;  3PLF B;  4OR9 B;  3B88 A;  3SIB A;  2NLN A;  1XFY O;  1DQE A;  2BEC A;  3RM1 A;  3FE9 A;  1J1D A;  2PAS A;  2Y1M A;  1QVI Y;  3O4Y A;  4PT1 A;  4D1E A;  1QX2 A;  3RLZ A;  2WND A;  1QXP A;  1TNW A;  1BG1 A;  3S0F A;  1AP4 A;  1B9A A;  3CZ0 A;  3D78 A;  5HKZ A;  1KFU L;  1SMG A;  2CTN A;  3SG3 A;  4CID A;  2JNF A;  2K2F A;  1CKK A;  2AUC A;  3NSI A;  4ZCU A;  1S6J A;  5HLV A;  1ODB A;  1NPQ A;  4GGN A;  4PE4 A;  1DF0 B;  3D0Y A;  5FYX A;  1IJ6 A;  1B1G A;  4YI9 A;  1YUS A;  2LMV A;  2PSR A;  3TS5 B;  2G9B A;  1A75 A;  1PK0 D;  5AAN A;  3TUY B;  1XA5 A;  4C0K A;  1KCY A;  1WRL A;  2LP2 A;  3RZS A;  3C1V A;  1KWO B;  1J7O A;  2M7L A;  3DVE A;  2MA2 A;  3TDI A;  3VRP A;  5AER A;  3PFV A;  3VRO A;  4CFQ A;  1CFF A;  2B1U A;  1KFX S;  2QEO A;  1F55 A;  2FCE A;  1KQV A;  3NSO A;  1KK8 B;  1CFD A;  2MRD A;  1JBA A;  4GBA A;  2EC6 B;  4NQG A;  3NSL A;  2EHB A;  1JF0 A;  1QLK A;  3LCP C;  1CB1 A;  1OOF A;  2HQW A;  1FI6 A;  1KSO A;  3GK2 A;  1AJ4 A;  1W7J B;  1K9P A;  2LE9 B; 
#chains in the Genus database with same CATH homology
 4MZK A;  1TNP A;  2Y4Q A;  1WLZ A;  1S3P A;  4MRX A;  4FQO A;  4YBH B;  2KYC A;  3H4S E;  2NCP A;  1IWQ A;  1S6I A;  3OB1 B;  1S26 D;  3BOW B;  2JU0 A;  4M2P A;  5ER5 A;  1BOD A;  1G8I A;  1D1O A;  3SG7 A;  2BE6 A;  2HF5 A;  3E3R A;  1J7P A;  1DVI A;  2PAL A;  1S6C A;  1JF2 A;  3I5I B;  4DUQ A;  2G2B A;  2SCP A;  5HKW A;  2VRG A;  3BUO B;  3BUM B;  4I5J A;  3MSE B;  1SL8 A;  3BXK A;  2CBL A;  1M39 A;  1CM1 A;  1SL9 A;  5I2O A;  2SAS A;  5CPV A;  4DRW A;  3K21 A;  1UHI A;  3EKH A;  1H4B A;  2BL0 C;  1YTZ C;  2PMY A;  4JPZ B;  3CWG A;  2GGM A;  2FJU B;  2LM5 A;  3CR5 X;  3WNX B;  1HQV A;  5IBW A;  2BCB A;  4AQJ A;  2HPS A;  1JC2 A;  4A4C A;  1GGZ A;  1REC A;  1TRF A;  5G08 A;  1QIV A;  2K7D A;  1NYA A;  3EVR A;  3O6B A;  2OPO A;  4CLN A;  1V1F A;  5HYD A;  3TDZ A;  4AQI A;  1QAS A;  3PAL A;  4MN0 A;  4MZL A;  2WC8 A;  1IQ3 A;  2M49 B;  2L51 A;  1UHJ A;  2ZRT A;  1QLS A;  3QRX A;  4GPL B;  1SK6 D;  2K61 A;  4GUK A;  2WCF A;  4E68 A;  1AUI B;  4HSZ A;  1K94 A;  3PAT A;  1FPW A;  3CZT X;  1JUO A;  3DVK A;  2F33 A;  4M2O A;  1YRU B;  5I8N A;  1WDC B;  5KU1 A;  1BU3 A;  3SJS A;  4PHM A;  1YRT B;  1Y1X A;  1MWN A;  2E30 A;  2FOT A;  3IF7 A;  1Y6W A;  1PVA A;  2D8N A;  2Y1N A;  4JQ0 D;  1H8B A;  1DJG A;  2KAY A;  2MLF C;  2JTT A;  2TN4 A;  3EVU A;  4DIR A;  1FI5 A;  2MAZ A;  1DTL A;  1WRK A;  1NX2 A;  3SG5 A;  3TZ1 A;  3FS7 A;  2OS8 B;  5AFP A;  1IKU A;  4PAL A;  1PSB A;  3AAK A;  1CLM A;  3PN7 B;  1GGW A;  1PUL A;  3I5H B;  5DKR A;  2WOS A;  3DVM A;  4NDC A;  1X02 A;  2BBN A;  5I2Q A;  1SW8 A;  2JRF A;  3SG2 A;  3F45 A;  4N1G A;  3WXA A;  4XYN A;  2M0R A;  1LVC D;  2LV7 A;  3D10 A;  2ZRS A;  3DF0 B;  1BF5 A;  3BUX B;  3GOF A;  1DJX A;  1K2H A;  1KFU S;  3KEV A;  3EK4 A;  3EKJ A;  4U8D A;  3JTD B;  2R2I A;  1EJ3 A;  1TCO B;  1OMD A;  1ALW A;  1UUS A;  1LKJ A;  3CS1 A;  2KFH A;  1M63 B;  2M29 A;  5CSJ A;  2MBX A;  1SCM B;  4GGF A;  2JQ6 A;  4TNC A;  1B8C A;  2LHI A;  2K8M B;  2JNX A;  1KQM C;  4WRI A;  2P6B B;  3VRQ A;  1RWY A;  1QV1 A;  1NCZ A;  1L2O B;  4GNK B;  4WQ3 A;  1F70 A;  3CTN A;  4A4B A;  3HCM A;  1J7R A;  1BOC A;  1K8U A;  1DJZ A;  1S5G Z;  2PVB A;  2LCP A;  1U5I A;  1MUX A;  2A4J A;  1XFX O;  4BY4 A;  1CM4 A;  1PRW A;  1F71 A;  2KFG A;  4MRY A;  2L2E A;  4ORA B;  1RRO A;  1TCF A;  2I7A A;  4Q04 A;  4GFT A;  1IH0 A;  1LA3 A;  2M1K B;  5J3X A;  5KTY A;  2LMT A;  1SYM A;  1U5I B;  2JTZ A;  2L98 A;  1M31 A;  3I5H C;  4PHJ A;  1OOJ A;  4WQ2 A;  1OMR A;  1OQP A;  1XFZ O;  1KSM A;  2F2O A;  4P5O E;  1QTX A;  2AAO A;  1YVL A;  3CLN A;  4YGE B;  1AJ5 A;  1JFJ A;  1NCX A;  1YX7 A;  2NCO A;  1EH2 A;  1OMV A;  2BCA A;  3BOW A;  5PAL A;  4ICB A;  5DKQ A;  4P2Y B;  1EXR A;  2L4H A;  1F54 A;  1JFK A;  2COL B;  1NX1 A;  1QV0 A;  1RK9 A;  3SG6 A;  3CGA A;  1OE9 B;  2ZKM X;  1CDP A;  2ZFD A;  2KOT A;  1YR5 A;  2M8U A;  3M0W A;  1UWO A;  4BY5 A;  2F8P A;  1G33 A;  2HQ8 A;  3I5F C;  3KF9 A;  1K9U A;  2NXQ A;  1GQM A;  1LIN A;  1XK4 C;  1RJV A;  2KI6 D;  1PSR A;  2M9G A;  3AKA A;  1B7T Z;  1ALV A;  3SIA A;  2AMI A;  2K0J A;  3KHE A;  1L7Z A;  1KFX L;  2ZN8 A;  3VRN A;  1A4P A;  1NSH A;  1QX5 B;  1SR6 C;  2JXC A;  1UHN A;  1SPY A;  2I94 A;  1SNL A;  3LK0 A;  3CR4 X;  3OX5 A;  4HRG A;  4ZCV A;  1B8L A;  1OZO A;  4PHK A;  4DS7 A;  1MF8 B;  2OTG C;  1VRK A;  2KQY A;  5JJG A;  4JWQ A;  1PVB A;  1C7V A;  2JC2 A;  1S36 A;  1QS7 A;  2LUC A;  3LK1 A;  4GGF C;  4R1E A;  1M45 A;  1ZMZ A;  1JWD A;  1AVS A;  1ZAC A;  2KBI A;  3VGO A;  1F8H A;  2ZN9 A;  2ZNE A;  1UP5 A;  4MEW A;  2K7O A;  4YGD B;  3ZWH A;  1RTP 1;  1K90 D;  4YRU A;  3EK8 A;  1KK8 C;  3SG4 A;  4UPG A;  3BUW B;  4PCW A;  2L5X B;  2MJW B;  3A4U B;  1N65 A;  3LLE A;  2JT3 A;  1KWO C;  2EGD A;  1IQ5 A;  2JUL A;  2LUX A;  1KK7 Z;  1DJY A;  2JT8 A;  3TS5 C;  2QAC A;  2FCD A;  2I2R E;  2JT0 A;  2ISD A;  2KI4 B;  3KPX A;  1J55 A;  1XFU O;  2LLU A;  1FBV A;  3AAJ A;  3EK7 A;  4NDD A;  1R2U A;  1MHO A;  3DVJ A;  3ICB A;  4M2Q A;  2KAX A;  2CCM A;  2K7C A;  4I5K A;  2BL0 B;  1DJH A;  2M97 A;  2IS9 A;  1CDN A;  1CDM A;  4PE0 A;  4YGC B;  1XO5 A;  2L0P A;  1GJY A;  2JZI A;  3I5G C;  1CLB A;  4DCK A;  1AHR A;  2BKI B;  1NWD A;  4N1F A;  2KBM A;  2BE4 A;  1J1E A;  3JVT B;  1ZUZ A;  5F6T A;  2H61 A;  3DF0 A;  4PDZ A;  2KYF A;  5D69 A;  2ZND A;  3GK1 A;  2F3Z A;  2BCX A;  1XFV O;  1NCY A;  1OSA A;  1C07 A;  3O78 A;  2H61 C;  1BR4 B;  4MSP A;  2MLE C;  4USL A;  4L9M A;  2Q4U A;  2NZ0 A;  2K7B A;  1SR6 B;  2CT9 A;  1TNQ A;  1Y1U A;  1NUB A;  2KNE A;  4MBE A;  1N0Y A;  5JOL A;  1A2X A;  2WOR A;  1JSA A;  3OHM B;  3IQQ A;  5BPJ A;  1B47 A;  1XK4 A;  1QVI Z;  2WCE A;  2O5G A;  3JVT C;  3HX4 A;  2M7N A;  1TN4 A;  1SKT A;  2I18 A;  1BMO A;  1LXF C;  4C0L A;  1K95 A;  1R6P A;  4YGA A;  1N2D A;  1CTR A;  1G4Y R;  1Y0V H;  3VRR A;  2E6W A;  3PN7 C;  3TDU A;  2F2P A;  1XYD A;  1K96 A;  1EL4 A;  2DOQ A;  1C7W A;  2KFF A;  2Q91 A;  1F4Q A;  3OX6 A;  5CSN A;  1DF0 A;  3D0Y B;  5GQQ C;  1SCM C;  3EVV A;  1ZOT B;  2LAN A;  1IJ5 A;  1TOP A;  4AOM A;  3KO0 A;  2KI6 C;  1DJI A;  1SBJ A;  1WLM A;  2V53 A;  2CXJ A;  2L50 A;  1TIZ A;  1YUR A;  1CFC A;  1F4O A;  1NP8 A;  2LLT A;  3FWC A;  2PRU A;  4QJ5 B;  1MXL C;  2WCB A;  3WHU B;  1SRA A;  1QJT A;  1B7T Y;  1NX3 A;  1EG3 A;  5I2L A;  2RGI A;  2HET A;  4F0Z B;  1IGV A;  1DJW A;  1S5G Y;  2M3W A;  5TNC A;  2LAP A;  1CMF A;  4ORB B;  4GAO A;  2BBM A;  4IL1 A;  3TUY C;  1BJF A;  4HRH A;  1MR8 A;  1RFJ A;  5HLO A;  1LA0 A;  1B4C A;  1PAL A;  2M1U A;  5B8I B;  1NX0 A;  1CNP A;  1XVJ A;  2L4I A;  3FWB A;  2H2K A;  1UHK A;  3DD4 A;  4I5N B;  1J7Q A;  4FTG A;  3FIA A;  4OV2 A;  5AEQ A;  3AKB A;  1BR1 B;  2LVV A;  2O60 A;  1WDC C;  2MHH A;  3GK4 X;  3IQO A;  2EC6 C;  1BLQ A;  2KGB C;  1FW4 A;  1TTX A;  3CR2 A;  4ETO A;  2LVI A;  1DGV A;  4ORC B;  1CFP A;  2Y5I A;  3BUN B;  3BYA A;  4OKH A;  1YUT A;  3I5I C;  4PE1 A;  1K93 D;  4I5L B;  2KGR A;  1B8R A;  4CPV A;  2GGZ A;  1AK8 A;  1Y1A A;  1YX8 A;  3I5G B;  3NSK A;  2OS8 C;  3PM8 A;  5KSZ A;  2LVK A;  3LL8 B;  1CDL A;  2QPT A;  1WY9 A;  1EG4 A;  2LP3 A;  1OZS A;  4MZJ A;  4QJ3 B;  1YUU A;  4PE7 A;  4YI8 A;  4N5X A;  1V1G A;  2LVJ A;  4QJ4 B;  1BT6 A;  3ZNI A;  4C0J A;  1HT9 A;  2KHN A;  1UHH A;  2KI4 C;  1XFW O;  1CLL A;  1DMO A;  1E8A A;  5D7F A;  3BQ3 A;  1DT7 B;  2KQ6 A;  1W7I B;  2KAV A;  4MVF A;  1TNX A;  5CSF A;  3OP0 A;  2KSP A;  4MLW A;  1DGU A;  5HKY A;  3NXA A;  1MQ1 A;  2JWW A;  2JPT A;  3O2P A;  4CFR A;  2LHL A;  1FF1 A;  1QIW A;  2GV5 A;  1YVH A;  2LNK A;  5K89 A;  4HRE E;  1ZFS A;  1CMG A;  5ER4 X;  1KQM B;  2CNP A;  1SY9 A;  2BKH B;  3A8R A;  1IRJ A;  4PHN A;  4XJK B;  2LMU A;  1KK7 Y;  3WHT B;  1L2O C;  1Q80 A;  1QAT A;  5CSI A;  2K2A A;  2OTG B;  2JOJ A;  1QX7 A;  1SCV A;  2LLS A;  1UUR A;  3JTD C;  4OCI A;  4YGB B;  4OVN F;  2F3Y A;  3OB2 B;  2JXL A;  1A03 A;  1WRZ A;  5DKN A;  4XJK A;  1K9K A;  1SL7 A;  2LC5 A;  1S1E A;  1A29 A;  1NIW A;  1A75 B;  3PSR A;  4NDB A;  5AXI A;  1IG5 A;  1MXE A;  3I5F B;  2KDH A;  1M46 A;  3PLF B;  4OR9 B;  3SIB A;  2NLN A;  1XFY O;  2BEC A;  3RM1 A;  1J1D A;  2PAS A;  2Y1M A;  1QVI Y;  3O4Y A;  4D1E A;  1QX2 A;  3RLZ A;  2WND A;  1QXP A;  1TNW A;  1BG1 A;  1AP4 A;  1B9A A;  5HKZ A;  1KFU L;  1SMG A;  2CTN A;  3SG3 A;  4CID A;  2JNF A;  2K2F A;  1CKK A;  2AUC A;  3NSI A;  4ZCU A;  1S6J A;  5HLV A;  1ODB A;  1NPQ A;  4GGN A;  4PE4 A;  1DF0 B;  3D0Y A;  5FYX A;  1IJ6 A;  1B1G A;  4YI9 A;  1YUS A;  2LMV A;  2PSR A;  3TS5 B;  2G9B A;  1A75 A;  1PK0 D;  5AAN A;  3TUY B;  1XA5 A;  4C0K A;  1KCY A;  1WRL A;  2LP2 A;  1KQV A;  3C1V A;  1KWO B;  1J7O A;  2M7L A;  3DVE A;  2MA2 A;  3TDI A;  3VRP A;  5AER A;  3PFV A;  3VRO A;  4CFQ A;  1CFF A;  2B1U A;  1KFX S;  1F55 A;  2FCE A;  3NSO A;  1KK8 B;  1CFD A;  2MRD A;  1JBA A;  4GBA A;  2EC6 B;  4NQG A;  3NSL A;  2EHB A;  1JF0 A;  1QLK A;  3LCP C;  1CB1 A;  2HQW A;  1FI6 A;  1KSO A;  3GK2 A;  1AJ4 A;  1W7J B;  1K9P A;  2LE9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...