2JT8A

Solution structure of the f153-to-5-flurotryptophan mutant of human cardiac troponin c
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
161
structure length
160
Chain Sequence
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRSMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDELEFMKGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Troponin C, slow skeletal and cardiac muscles
publication title Effects of Phe-to-Trp mutation and fluorotryptophan incorporation on the solution structure of cardiac troponin C, and analysis of its suitability as a potential probe for in situ NMR studies
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 28
structure length 160
sequence length 161
ec nomenclature
pdb deposition date 2007-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2jt8A00
3SJSA 2KFFA 3BYAA 1CM4A 1V1GA 3TZ1A 1BR4B 2HETA 2JXLA 4MEWA 1DJGA 4Q04A 1DF0A 5AANA 1M63B 2PALA 4QJ3B 3SG4A 1ZFSA 2NLNA 3IQQA 2JTTA 4ETOA 1CMFA 2BCXA 2LHIA 4A4BA 1WRZA 3VRRA 1BLQA 2A4JA 2OTGC 2B1UA 1OMVA 2KAYA 4QJ4B 2L51A 3BOWB 2OTGB 4D1EA 1SKTA 1FW4A 2JWWA 1XFWO 1Y1UA 3OX5A 1F4OA 1PVBA 1VRKA 4GAOA 4MRYA 1L2OB 1DJIA 3ZWHA 2Y1MA 4C0JA 3NSOA 5HKYA 3O6BA 1CFFA 4YGDB 3BUXB 3ZNIA 2CCMA 3DD4A 1PVAA 2AMIA 3TDIA 2WCBA 1RTP1 1YVHA 3EVVA 2LHLA 3CTNA 4PDZA 5ER4X 1OMDA 4MZLA 1ZMZA 1CDPA 4PHJA 1Q80A 1UURA 3MSEB 1KWOC 4OR9B 2JULA 1G4YR 1TNQA 1XK4C 1KFUS 2E30A 1YUTA 2LNKA 2KHNA 3HCMA 1KWOB 4WQ3A 3PATA 1KQMC 1WLZA 4YGAA 1AK8A 1KCYA 1K90D 4CFQA 2KFHA 2LVKA 3EKHA 1EG4A 4FQOA 1WDCC 3SG2A 1EXRA 2MAZA 1AJ4A 1CNPA 2HQ8A 2CTNA 3PFVA 1BOCA 1S6JA 4ORAB 1F55A 2M97A 1J1EA 2KBIA 1S26D 4BY5A 1IQ3A 4N5XA 3DVEA 1DGUA 1EL4A 1M39A 3TDUA 5D7FA 1KFXL 1N2DA 1UUSA 2MBXA 5KU1A 2M3WA 2V53A 1BU3A 1IGVA 3TS5C 1JWDA 3IQOA 2PMYA 3CZTX 1M45A 2PVBA 1S5GY 1W7IB 2F3ZA 1W7JB 3KHEA 1SRAA 3TS5B 2NZ0A 3I5HC 4OKHA 2Y4QA 2JNXA 1QX2A 1K94A 2M1UA 5CPVA 1JUOA 3I5HB 2JT0A 1RROA 2LC5A 2K61A 1KK7Y 3IF7A 1QIWA 1CDNA 1ZACA 2KAVA 4DRWA 1SMGA 4MZKA 1MR8A 1S5GZ 3BUOB 3O2PA 2H2KA 2ZN8A 1YX8A 1YVLA 2G9BA 2PSRA 4HSZA 1SYMA 3BXKA 2K7OA 3JVTC 2LVVA 1TN4A 1RWYA 1QS7A 1MXLC 1QV1A 1KK7Z 3O4YA 1YUSA 2BKHB 1IKUA 3JVTB 3RM1A 2KQ6A 2L4IA 4AQIA 2AUCA 1F71A 4OVNF 2ZRTA 3BOWA 1JBAA 2G2BA 5AERA 1J7PA 1TRFA 2BKIB 1HQVA 3VGOA 1SL7A 2KAXA 1LA3A 2KOTA 5GQQC 1B47A 4MLWA 4MRXA 2BCBA 4YI9A 1QIVA 1HT9A 1F70A 3CWGA 4MZJA 3K21A 1PRWA 5HLOA 3SG5A 1NX0A 4I5JA 2ZRSA 4PE1A 3OB2B 3DVJA 2K2AA 3DVMA 2KDHA 3PN7C 3WXAA 1UHNA 1A03A 2JXCA 1ZUZA 3OB1B 2KQYA 2VRGA 2LAPA 3EVUA 3NSKA 4WQ2A 3LL8B 2KYFA 3PN7B 1F8HA 2KI6C 1M31A 3TUYB 2KBMA 2LANA 2M7NA 1RK9A 3GK4X 4PE0A 1L2OC 3EK4A 2LP3A 1YURA 4P5OE 1RFJA 2KYCA 4CLNA 2I7AA 1UP5A 1J55A 4N1GA 2WC8A 2JZIA 2GV5A 2LMVA 4ZCVA 1JC2A 2NCPA 1TCOB 2LLTA 1R2UA 1XK4A 3NSIA 3AAJA 2QACA 5CSNA 2K0JA 4YBHB 2I94A 2F2OA 4XYNA 1MUXA 3VRPA 2L0PA 1FI6A 1EG3A 3ICBA 1LVCD 4OCIA 1DJYA 1CKKA 4GGFA 1JSAA 1KSOA 2LMUA 3FWCA 1ZOTB 2FCEA 3I5IB 4I5LB 3VRQA 1NX2A 4F0ZB 4M2OA 1NUBA 1MXEA 5KSZA 1RJVA 1IWQA 1G8IA 2KI6D 1YRTB 2WNDA 4CPVA 1OOJA 2MLFC 1QLKA 2NXQA 5CSIA 1X02A 4DS7A 1TTXA 1B9AA 3FWBA 3BUMB 2P6BB 1ALVA 1MF8B 1XFUO 2AAOA 4R1EA 1Y0VH 3KEVA 2MJWB 1DVIA 1CFCA 1NX3A 2MLEC 4MVFA 2WCFA 4IL1A 1BG1A 4PHNA 1QX7A 3KO0A 1Y1AA 4GGFC 3PLFB 1QVIY 4A4CA 4MN0A 5HKWA 1JFJA 3AKBA 1TNWA 3FIAA 4DCKA 1JFKA 3PM8A 3WNXB 1CFPA 1QX5B 2F33A 2Q91A 1KFXS 1CMGA 1YRUB 1MWNA 2L5XB 2Q4UA 3H4SE 3TDZA 1PULA 1GQMA 2JRFA 1GJYA 1AP4A 2M49B 4N1FA 2TN4A 5K89A 4PE7A 4NDDA 5HKZA 1QVIZ 1R6PA 2MA2A 4JPZB 2LE9B 1SCVA 1H8BA 1JF2A 2BBMA 2I2RE 1U5IB 2BCAA 2CBLA 2QPTA 3EK7A 2JU0A 1TNXA 4USLA 4YGEB 1ODBA 4BY4A 1B8CA 5I8NA 4HRHA 1KFUL 1XA5A 1EJ3A 4HRGA 1A2XA 1CDLA 5CSFA 1DTLA 2LUXA 4GGNA 5BPJA 2LLUA 2M1KB 1XFYO 3GK1A 1KSMA 3BQ3A 2WORA 3I5FC 4GFTA 3I5GB 5IBWA 1DGVA 3BUNB 2M29A 1DJHA 1UHHA 1OZSA 3PSRA 3WHTB 1IJ6A 3I5FB 1XFXO 3D10A 5KTYA 1PSRA 3OHMB 2Y1NA 2FOTA 2K7CA 4CFRA 4M2QA 4L9MA 1QASA 5D69A 3SG7A 2M8UA 4ORBB 2H61A 1S6CA 2KI4B 5DKRA 4CIDA 2KGBC 1NYAA 2L4HA 4C0LA 1L7ZA 1SNLA 3SIBA 1SW8A 4XJKB 1B7TY 1E8AA 2KNEA 2SCPA 3LK1A 1C07A 4P2YB 3KPXA 3OP0A 1EH2A 2HQWA 2K2FA 5DKNA 1NX1A 2LV7A 1LKJA 1NIWA 1NCXA 4OV2A 1NPQA 1MHOA 1B4CA 5AXIA 1XO5A 1QJTA 5PALA 3LK0A 1KQVA 1J7QA 1PK0D 4MBEA 1B7TZ 2M9GA 1SY9A 2H61C 2BBNA 4YI8A 1MQ1A 1GGWA 4AQJA 1TIZA 1SK6D 2F8PA 2CXJA 2M7LA 1AUIB 3DVKA 2PRUA 3JTDB 4UPGA 1PALA 1CDMA 4TNCA 4DIRA 1UHKA 2K7BA 2LP2A 5G08A 2EHBA 2JT8A 3GOFA 1K2HA 3TUYC 3SIAA 2WCEA 1DJWA 1S3PA 3CR5X 1CLBA 1UWOA 1H4BA 2WOSA 2DOQA 4JWQA 3AKAA 1K9PA 1SR6B 1M46A 1OZOA 2I18A 2BL0B 1XFVO 2LMTA 3GK2A 5AEQA 1C7WA 2GGMA 2CT9A 2FCDA 1QXPA 2K8MB 1BODA 4YGCB 1J1DA 1SBJA 3F45A 1YTZC 1A75A 1A29A 1K95A 2FJUB 3BUWB 4I5KA 1YR5A 1CTRA 4JQ0D 1XFZO 3I5IC 4QJ5B 2D8NA 1A4PA 3WHUB 1TCFA 2JC2A 3VROA 5ER5A 4I5NB 1BJFA 3CLNA 4HREE 1AVSA 3VRNA 1F54A 1S1EA 2ZN9A 1AHRA 4FTGA 1K9KA 2M0RA 1D1OA 1YX7A 2ZNEA 1WRLA 2LM5A 2IS9A 3SG3A 5B8IB 3RLZA 1DF0B 2LVJA 1LXFC 1U5IA 5F6TA 1FF1A 1WLMA 1A75B 2BE6A 2HF5A 3CR2A 1CLLA 2OPOA 3CS1A 3DF0A 2L50A 2PASA 1J7OA 1OSAA 4ICBA 1BT6A 4E68A 1QLSA 2JT3A 1DT7B 2L98A 2L2EA 5HLVA 1SL9A 1Y1XA 3A4UB 2MRDA 1J7RA 3O78A 2KSPA 2ZKMX 2ZNDA 4GNKB 1OE9B 2O5GA 5DKQA 1N0YA 1IRJA 1BR1B 1DJXA 1SL8A 1C7VA 5AFPA 1TOPA 1LA0A 1Y6WA 5TNCA 1OMRA 1IJ5A 1UHIA 2BE4A 3M0WA 4ZCUA 4ORCB 1S36A 4XJKA 1XYDA 4WRIA 2O60A 2OS8C 2COLB 1KQMB 4PE4A 1IG5A 1K96A 3DF0B 1WRKA 1DJZA 2JQ6A 2NCOA 3I5GC 2OS8B 3CGAA 1B1GA 3D0YA 1BF5A 2LLSA 2Y5IA 1BMOA 1CFDA 1WDCB 5I2OA 3NSLA 3EKJA 4NDBA 4GBAA 4GPLB 1F4QA 1B8RA 1V1FA 2HPSA 3E3RA 4AOMA 2CNPA 2ISDA 1NSHA 2KI4C 1CLMA 1B8LA 5JOLA 1K8UA 1S6IA 1SCMC 1G33A 3C1VA 1AJ5A 5JJGA 2JNFA 1WY9A 1N65A 2E6WA 4GUKA 2KFGA 5I2LA 1PSBA 1OQPA 1RECA 3NXAA 1SCMB 1FBVA 4NQGA 4PHKA 4U8DA 4C0KA 3FS7A 1CM1A 5CSJA 1IQ5A 1QV0A 3SG6A 1NWDA 4YRUA 3EK8A 1CB1A 1DMOA 1FI5A 4PCWA 3D0YB 1XVJA 5HYDA 1TNPA 2LVIA 3PALA 1KK8C 2R2IA 4NDCA 4YGBB 5J3XA 1LINA 2LUCA 3EVRA 2EC6C 1GGZA 2ZFDA 4DUQA 3JTDC 1JF0A 1SPYA 1KK8B 3AAKA 3A8RA 2F2PA 2KGRA 1NCZA 1QATA 2JOJA 2EC6B 2JTZA 1FPWA 1K93D 2BECA 4MSPA 1ALWA 3OX6A 1YUUA 1K9UA 2F3YA 2EGDA 4PALA 2GGZA 3QRXA 1NP8A 2K7DA 2MHHA 4PHMA 5FYXA 1QTXA 2LCPA 3KF9A 5I2QA 1IH0A 3LLEA 1SR6C 3HX4A 4M2PA 1UHJA 2JPTA 2RGIA 3CR4X 2BL0C 2SASA 1NCYA 3LCPC
chains in the Genus database with same CATH superfamily
3SJSA 2KFFA 3PJIA 2QEBA 3BYAA 1CM4A 3V2LA 1V1GA 3TZ1A 1BR4B 2HETA 2JXLA 4MEWA 2WCMA 1DJGA 4Q04A 1DF0A 5AANA 2WCJA 1M63B 2PALA 4QJ3B 3SG4A 1ZFSA 2NLNA 1OW4A 2JTTA 3IQQA 4ETOA 1CMFA 2BCXA 2LHIA 4A4BA 1WRZA 3D73A 3VRRA 1BLQA 2A4JA 2OTGC 2B1UA 1OMVA 3CYZA 2KAYA 4QJ4B 2L51A 3BOWB 3CZ2A 2OTGB 4D1EA 1SKTA 2KLDA 1FW4A 2JWWA 1XFWO 1Y1UA 3OX5A 1F4OA 1PVBA 1VRKA 4GAOA 1C3ZA 4MRYA 1L2OB 1DJIA 3ZWHA 2Y1MA 4C0JA 3NSOA 5HKYA 3O6BA 1CFFA 4YGDB 3BUXB 3ZNIA 2CCMA 3DD4A 4OZDA 1PVAA 2AMIA 3TDIA 2WCBA 1RTP1 1YVHA 2H8VA 3EVVA 2LHLA 3CTNA 4PDZA 5ER4X 1OMDA 4MZLA 1ZMZA 1CDPA 4PHJA 1LS8A 3K1EA 1Q80A 1UURA 1W9ZA 3MSEB 1KWOC 4OR9B 2JULA 1G4YR 1TNQA 3CDNA 1XK4C 1KFUS 2E30A 1YUTA 2LNKA 2KHNA 3HCMA 1KWOB 3OBVA 4WQ3A 3PATA 1KQMC 1WLZA 1OOFA 4YGAA 3R72A 1AK8A 1KCYA 1K90D 4CFQA 2KFHA 2LVKA 3EKHA 1EG4A 4FQOA 1WDCC 3SG2A 1EXRA 2MAZA 1AJ4A 1CNPA 2PYQA 2HQ8A 2CTNA 3PFVA 1BOCA 1S6JA 4ORAB 1F55A 2M97A 1J1EA 2KBIA 1S26D 4BY5A 1IQ3A 4N5XA 3N7HA 3DVEA 1DGUA 1EL4A 1M39A 3TDUA 5D7FA 1KFXL 1N2DA 1UUSA 2MBXA 5KU1A 2M3WA 2V53A 1BU3A 1IGVA 3TS5C 3BFHA 3IQOA 2PMYA 3CZTX 1JWDA 1M45A 2PVBA 5FI2A 1S5GY 1W7IB 2F3ZA 1W7JB 3KHEA 3VB1A 1SRAA 2KPHA 3D76A 3TS5B 2NZ0A 3I5HC 4OKHA 2Y4QA 1XFRA 2JNXA 1QX2A 1K94A 2M1UA 5CPVA 1JUOA 3I5HB 2JT0A 1RROA 2LC5A 2K61A 3R1OA 1KK7Y 3IF7A 1QIWA 1CDNA 1ZACA 3IVTA 2KAVA 4DRWA 1SMGA 4MZKA 2WCKA 1MR8A 1S5GZ 3BUOB 3CABA 1OOGA 3O2PA 2H2KA 2ZN8A 1YX8A 1YVLA 2G9BA 2PSRA 4HSZA 1SYMA 3BXKA 2K7OA 3JVTC 2LVVA 1TN4A 1RWYA 1QS7A 1MXLC 1QV1A 1KK7Z 3O4YA 1YUSA 2BKHB 3O4XA 1IKUA 3JVTB 3RM1A 2KQ6A 2L4IA 4AQIA 2AUCA 1F71A 4OVNF 2YGUA 3CZ0A 2ZRTA 3BOWA 5HL1A 1JBAA 2G2BA 5AERA 1J7PA 1TRFA 2BKIB 1HQVA 3VGOA 1SL7A 2KAXA 1LA3A 2KOTA 5GQQC 1B47A 4MLWA 4MRXA 2BCBA 4YI9A 1QIVA 1HT9A 1F70A 3CWGA 4MZJA 3K21A 1PRWA 4FQTA 5D3OA 5HLOA 3SG5A 4F7FA 1QWVA 1NX0A 3FE9A 4I5JA 2ZRSA 4PE1A 3OB2B 3DVJA 2K2AA 3DVMA 2L5YA 2KDHA 3PN7C 3WXAA 1UHNA 1A03A 2JXCA 1ZUZA 3OB1B 2KQYA 2VRGA 4IJ7A 2LAPA 3EVUA 2PQLA 3NSKA 4WQ2A 3LL8B 2KYFA 3PN7B 1F8HA 2KI6C 1M31A 4JD9A 3TUYB 2KBMA 2LANA 2M7NA 1RK9A 3GK4X 4PE0A 1L2OC 3EK4A 2LP3A 1YURA 4P5OE 1RFJA 2KYCA 4CLNA 2I7AA 1UP5A 1J55A 4N1GA 2WC8A 2JZIA 2GV5A 3BJHA 3FE8A 2LMVA 2K60A 3UO9A 2JPOA 4ZCVA 1JC2A 2NCPA 1TCOB 2LLTA 1R2UA 1XK4A 3NSIA 3AAJA 2QACA 5CSNA 2K0JA 4YBHB 2WCHA 2I94A 2F2OA 4XYNA 1MUXA 3VRPA 2L0PA 1FI6A 2QDIA 1EG3A 3ICBA 1LVCD 4OCIA 1DJYA 1CKKA 2WC5A 4GGFA 1JSAA 1KSOA 3NHTA 2LMUA 3FWCA 1ZOTB 2FCEA 3I5IB 4I5LB 3VRQA 1NX2A 4F0ZB 4M2OA 1NUBA 1MXEA 5KSZA 1RJVA 1IWQA 1G8IA 2KI6D 1YRTB 2WNDA 4CPVA 1OOJA 2MLFC 4JKTA 1QLKA 2NXQA 5CSIA 1X02A 4DS7A 1TTXA 1B9AA 3FWBA 3BUMB 2P6BB 1ALVA 1MF8B 1XFUO 2AAOA 4R1EA 1Y0VH 3KEVA 2MJWB 1DVIA 1CFCA 1NX3A 2MLEC 4MVFA 2WCFA 4IL1A 1BG1A 4PHNA 1QX7A 3R1VA 3KO0A 1Y1AA 4GGFC 3PLFB 1QVIY 4A4CA 3B7AA 4MN0A 5HKWA 1JFJA 3AKBA 1TNWA 3FIAA 4DCKA 1JFKA 3PM8A 3WNXB 1CFPA 1QX5B 2ERBA 2F33A 1KFXS 2Q91A 1CMGA 1TWOA 1MWNA 1YRUB 2L5XB 2Q4UA 3H4SE 3TDZA 1PULA 1GQMA 2JRFA 1GJYA 1AP4A 2M49B 4N1FA 2TN4A 3S0BA 5K89A 4PE7A 4NDDA 5HKZA 2BNXA 1QVIZ 3PM2A 1R6PA 2MA2A 2FJYA 4JPZB 2LE9B 1SCVA 1H8BA 1JF2A 2BBMA 2I2RE 1U5IB 2BCAA 2CBLA 2QPTA 3EK7A 2JU0A 1TNXA 2GTEA 4USLA 4YGEB 1ODBA 4BY4A 1B8CA 5I8NA 4HRHA 1KFUL 1XA5A 1EJ3A 4HRGA 1A2XA 1CDLA 5CSFA 1DTLA 2LUXA 4GGNA 5BPJA 2LLUA 2M1KB 1XFYO 3GK1A 1KSMA 3BQ3A 2WORA 3I5FC 4GFTA 3I5GB 5IBWA 1DGVA 3BUNB 2M29A 1DJHA 1UHHA 1OZSA 1Z4HA 3PSRA 5DICA 3SS5A 3WHTB 1IJ6A 3I5FB 1XFXO 3BFAA 3D10A 1PSRA 3NHIA 3OHMB 3S0EA 5KTYA 2Y1NA 2FOTA 2K7CA 4CFRA 4M2QA 4L9MA 1QASA 5D69A 3SG7A 2M8UA 4ORBB 2H61A 1S6CA 2KI4B 5DKRA 4CIDA 2KGBC 4PT1A 1NYAA 2L4HA 4C0LA 1L7ZA 1SNLA 3SIBA 1SW8A 2KLEA 4XJKB 1B7TY 1E8AA 2KNEA 2SCPA 3LK1A 1C07A 4P2YB 1IIOA 3KPXA 3OP0A 1EH2A 2HQWA 3SS3A 2K2FA 5DKNA 1NX1A 2LV7A 1LKJA 1NIWA 1NCXA 4OV2A 1NPQA 1MHOA 2QEHA 1B4CA 5AXIA 1XO5A 5FI7A 1QJTA 5PALA 3FE6A 3RZSA 3LK0A 1KQVA 1J7QA 1PK0D 4MBEA 1B7TZ 1GM0A 2M9GA 1SY9A 2H61C 2BBNA 4YI8A 1MQ1A 1GGWA 4AQJA 1TIZA 1SK6D 2F8PA 2CXJA 2M7LA 1AUIB 3DVKA 2PRUA 4INWA 3JTDB 4UPGA 1PALA 1CDMA 4TNCA 4DIRA 1UHKA 2K7BA 3DXLA 2LP2A 5G08A 2EHBA 2JT8A 3D75A 3GOFA 1K2HA 3TUYC 3SIAA 2WCEA 1TUJA 1DJWA 1S3PA 3CR5X 4KYNA 1UWOA 3UNWA 1CLBA 1H4BA 2WOSA 2DOQA 4JWQA 1OOHA 3AKAA 3DZTA 1K9PA 2BAPA 3NGVA 1SR6B 1M46A 1OZOA 2I18A 2BL0B 1XFVO 2LMTA 3GK2A 3Q8IA 2WCLA 5AEQA 1C7WA 2GGMA 3D74A 2CT9A 2FCDA 1QXPA 2K8MB 1BODA 4YGCB 1J1DA 1SBJA 3S0AA 3F45A 1YTZC 1A75A 1A29A 1K95A 2FJUB 3BUWB 3D77A 4I5KA 1YR5A 1CTRA 4JQ0D 1XFZO 3I5IC 4QJ5B 2D8NA 1A4PA 2P71A 3WHUB 1TCFA 2JC2A 1OOIX 3VROA 5ER5A 4I5NB 1BJFA 3CLNA 3L4AA 4HREE 1AVSA 1DQEA 3OGNA 3DY9A 3R1PA 3VRNA 3S0FA 1F54A 1S1EA 2ZN9A 1AHRA 4FTGA 1K9KA 1T14A 2M0RA 1D1OA 1SSEB 1YX7A 5FI6A 2ZNEA 1WRLA 2LM5A 2IS9A 3SG3A 5B8IB 3RLZA 1DF0B 2LVJA 1TUZA 1LXFC 2QEOA 1U5IA 5F6TA 1FF1A 2L2CA 1WLMA 5I94A 1A75B 2BE6A 2HF5A 3CR2A 1CLLA 2OPOA 3CS1A 3DF0A 2L50A 3B87A 2PASA 1J7OA 1OSAA 4ICBA 1BT6A 4E68A 2WC6A 3L4LA 1QLSA 2JT3A 1DT7B 2L98A 2L2EA 5HLVA 1SL9A 1Y1XA 3A4UB 2MRDA 1J7RA 2QEVA 3O78A 3S0DA 2KSPA 2ZKMX 2ZNDA 3S0GA 4GNKB 1OE9B 2O5GA 5DKQA 1N0YA 1IRJA 1BR1B 1DJXA 1SL8A 1C7VA 5AFPA 1TOPA 1LA0A 1Y6WA 5TNCA 1OMRA 1IJ5A 1UHIA 3SS4A 2BE4A 3M0WA 4ZCUA 4ORCB 1S36A 3BFBA 1XYDA 4XJKA 4WRIA 2O60A 2OS8C 2COLB 1KQMB 4PE4A 1IG5A 3EG5B 1Z2CB 1K96A 3DF0B 1WRKA 1DJZA 2JQ6A 2NCOA 3I5GC 2OS8B 3CGAA 3CZ1A 3D0YA 3L47A 2LLSA 1BF5A 1B1GA 2Y5IA 1BMOA 1CFDA 1WDCB 5I2OA 3NSLA 3EKJA 4NDBA 4GBAA 1P28A 4GPLB 1F4QA 1B8RA 1V1FA 2HPSA 3E3RA 4AOMA 2CNPA 2ISDA 1NSHA 2KI4C 1CLMA 1B8LA 5JOLA 1K8UA 1S6IA 1SCMC 1G33A 3C1VA 1AJ5A 5JJGA 2JNFA 1WY9A 1N65A 2E6WA 4GUKA 2KFGA 5I2LA 1PSBA 1DELA 1OQPA 1RECA 3NXAA 1ORGA 1SCMB 1FBVA 4NQGA 1DEKA 4PHKA 4U8DA 2P70A 4C0KA 3FS7A 1CM1A 5CSJA 1IQ5A 1QV0A 3SG6A 1NWDA 4YRUA 3EK8A 1C3YA 1CB1A 1DMOA 1FI5A 4PCWA 3D0YB 1XVJA 4INXA 5HYDA 1TNPA 2LVIA 1DC1A 3PALA 1KK8C 2R2IA 4NDCA 4YGBB 3DYEA 5J3XA 1LINA 2LUCA 3B6XA 2EC6C 3B86A 1GGZA 2ZFDA 3EVRA 4DUQA 3JTDC 1JF0A 1SPYA 1KK8B 3QMEA 3AAKA 3A8RA 2F2PA 2KGRA 1NCZA 1QATA 2JOJA 2EC6B 2JTZA 1FPWA 1K93D 2BECA 4MSPA 1ALWA 5EL2A 3OX6A 1YUUA 1K9UA 2F3YA 2EGDA 3D78A 3B88A 4PALA 2GGZA 3QRXA 1NP8A 2K7DA 2MHHA 4PHMA 5FYXA 1QTXA 2LCPA 3KF9A 5I2QA 1IH0A 3LLEA 1SR6C 3HX4A 4M2PA 1UHJA 2JPTA 2RGIA 3CR4X 2BL0C 2SASA 1NCYA 3LCPC
chains in the Genus database with same CATH topology
3SJSA 2KFFA 3BYAA 1CM4A 1V1GA 3TZ1A 1BR4B 2HETA 2JXLA 4MEWA 1DJGA 4Q04A 1DF0A 5AANA 1M63B 2PALA 4QJ3B 3SG4A 1ZFSA 2NLNA 3IQQA 2JTTA 4ETOA 1CMFA 2BCXA 2LHIA 4A4BA 1WRZA 3VRRA 1BLQA 2A4JA 2OTGC 2B1UA 1OMVA 2KAYA 4QJ4B 2L51A 3BOWB 2OTGB 4D1EA 1SKTA 1FW4A 2JWWA 1XFWO 1Y1UA 3OX5A 1F4OA 1PVBA 1VRKA 4GAOA 4MRYA 1L2OB 1DJIA 3ZWHA 2Y1MA 4C0JA 3NSOA 5HKYA 3O6BA 1CFFA 4YGDB 3BUXB 3ZNIA 2CCMA 3DD4A 1PVAA 2AMIA 3TDIA 2WCBA 1RTP1 1YVHA 3EVVA 2LHLA 3CTNA 4PDZA 5ER4X 1OMDA 4MZLA 1ZMZA 1CDPA 4PHJA 1Q80A 1UURA 3MSEB 1KWOC 4OR9B 2JULA 1G4YR 1TNQA 1XK4C 1KFUS 2E30A 1YUTA 2LNKA 2KHNA 3HCMA 1KWOB 4WQ3A 3PATA 1KQMC 1WLZA 4YGAA 1AK8A 1KCYA 1K90D 4CFQA 2KFHA 2LVKA 3EKHA 1EG4A 4FQOA 1WDCC 3SG2A 1EXRA 2MAZA 1AJ4A 1CNPA 2HQ8A 2CTNA 3PFVA 1BOCA 1S6JA 4ORAB 1F55A 2M97A 1J1EA 2KBIA 1S26D 4BY5A 1IQ3A 4N5XA 3DVEA 1DGUA 1EL4A 1M39A 3TDUA 5D7FA 1KFXL 1N2DA 1UUSA 2MBXA 5KU1A 2M3WA 2V53A 1BU3A 1IGVA 3TS5C 1JWDA 3IQOA 2PMYA 3CZTX 1M45A 2PVBA 1S5GY 1W7IB 2F3ZA 1W7JB 3KHEA 1SRAA 3TS5B 2NZ0A 3I5HC 4OKHA 2Y4QA 2JNXA 1QX2A 1K94A 2M1UA 5CPVA 1JUOA 3I5HB 2JT0A 1RROA 2LC5A 2K61A 1KK7Y 3IF7A 1QIWA 1CDNA 1ZACA 2KAVA 4DRWA 1SMGA 4MZKA 1MR8A 1S5GZ 3BUOB 3O2PA 2H2KA 2ZN8A 1YX8A 1YVLA 2G9BA 2PSRA 4HSZA 1SYMA 3BXKA 2K7OA 3JVTC 2LVVA 1TN4A 1RWYA 1QS7A 1MXLC 1QV1A 1KK7Z 3O4YA 1YUSA 2BKHB 1IKUA 3JVTB 3RM1A 2KQ6A 2L4IA 4AQIA 2AUCA 1F71A 4OVNF 2ZRTA 3BOWA 1JBAA 2G2BA 5AERA 1J7PA 1TRFA 2BKIB 1HQVA 3VGOA 1SL7A 2KAXA 1LA3A 2KOTA 5GQQC 1B47A 4MLWA 4MRXA 2BCBA 4YI9A 1QIVA 1HT9A 1F70A 3CWGA 4MZJA 3K21A 1PRWA 5HLOA 3SG5A 1NX0A 4I5JA 2ZRSA 4PE1A 3OB2B 3DVJA 2K2AA 3DVMA 2KDHA 3PN7C 3WXAA 1UHNA 1A03A 2JXCA 1ZUZA 3OB1B 2KQYA 2VRGA 2LAPA 3EVUA 3NSKA 4WQ2A 3LL8B 2KYFA 3PN7B 1F8HA 2KI6C 1M31A 3TUYB 2KBMA 2LANA 2M7NA 1RK9A 3GK4X 4PE0A 1L2OC 3EK4A 2LP3A 1YURA 4P5OE 1RFJA 2KYCA 4CLNA 2I7AA 1UP5A 1J55A 4N1GA 2WC8A 2JZIA 2GV5A 2LMVA 4ZCVA 1JC2A 2NCPA 1TCOB 2LLTA 1R2UA 1XK4A 3NSIA 3AAJA 2QACA 5CSNA 2K0JA 4YBHB 2I94A 2F2OA 4XYNA 1MUXA 3VRPA 2L0PA 1FI6A 1EG3A 3ICBA 1LVCD 4OCIA 1DJYA 1CKKA 4GGFA 1JSAA 1KSOA 2LMUA 3FWCA 1ZOTB 2FCEA 3I5IB 4I5LB 3VRQA 1NX2A 4F0ZB 4M2OA 1NUBA 1MXEA 5KSZA 1RJVA 1IWQA 1G8IA 2KI6D 1YRTB 2WNDA 4CPVA 1OOJA 2MLFC 1QLKA 2NXQA 5CSIA 1X02A 4DS7A 1TTXA 1B9AA 3FWBA 3BUMB 2P6BB 1ALVA 1MF8B 1XFUO 2AAOA 4R1EA 1Y0VH 3KEVA 2MJWB 1DVIA 1CFCA 1NX3A 2MLEC 4MVFA 2WCFA 4IL1A 1BG1A 4PHNA 1QX7A 3KO0A 1Y1AA 4GGFC 3PLFB 1QVIY 4A4CA 4MN0A 5HKWA 1JFJA 3AKBA 1TNWA 3FIAA 4DCKA 1JFKA 3PM8A 3WNXB 1CFPA 1QX5B 2F33A 2Q91A 1KFXS 1CMGA 1YRUB 1MWNA 2L5XB 2Q4UA 3H4SE 3TDZA 1PULA 1GQMA 2JRFA 1GJYA 1AP4A 2M49B 4N1FA 2TN4A 5K89A 4PE7A 4NDDA 5HKZA 1QVIZ 1R6PA 2MA2A 4JPZB 2LE9B 1SCVA 1H8BA 1JF2A 2BBMA 2I2RE 1U5IB 2BCAA 2CBLA 2QPTA 3EK7A 2JU0A 1TNXA 4USLA 4YGEB 1ODBA 4BY4A 1B8CA 5I8NA 4HRHA 1KFUL 1XA5A 1EJ3A 4HRGA 1A2XA 1CDLA 5CSFA 1DTLA 2LUXA 4GGNA 5BPJA 2LLUA 2M1KB 1XFYO 3GK1A 1KSMA 3BQ3A 2WORA 3I5FC 4GFTA 3I5GB 5IBWA 1DGVA 3BUNB 2M29A 1DJHA 1UHHA 1OZSA 3PSRA 3WHTB 1IJ6A 3I5FB 1XFXO 3D10A 5KTYA 1PSRA 3OHMB 2Y1NA 2FOTA 2K7CA 4CFRA 4M2QA 4L9MA 1QASA 5D69A 3SG7A 2M8UA 4ORBB 2H61A 1S6CA 2KI4B 5DKRA 4CIDA 2KGBC 1NYAA 2L4HA 4C0LA 1L7ZA 1SNLA 3SIBA 1SW8A 4XJKB 1B7TY 1E8AA 2KNEA 2SCPA 3LK1A 1C07A 4P2YB 3KPXA 3OP0A 1EH2A 2HQWA 2K2FA 5DKNA 1NX1A 2LV7A 1LKJA 1NIWA 1NCXA 4OV2A 1NPQA 1MHOA 1B4CA 5AXIA 1XO5A 1QJTA 5PALA 3LK0A 1KQVA 1J7QA 1PK0D 4MBEA 1B7TZ 2M9GA 1SY9A 2H61C 2BBNA 4YI8A 1MQ1A 1GGWA 4AQJA 1TIZA 1SK6D 2F8PA 2CXJA 2M7LA 1AUIB 3DVKA 2PRUA 3JTDB 4UPGA 1PALA 1CDMA 4TNCA 4DIRA 1UHKA 2K7BA 2LP2A 5G08A 2EHBA 2JT8A 3GOFA 1K2HA 3TUYC 3SIAA 2WCEA 1DJWA 1S3PA 3CR5X 1CLBA 1UWOA 1H4BA 2WOSA 2DOQA 4JWQA 3AKAA 1K9PA 1SR6B 1M46A 1OZOA 2I18A 2BL0B 1XFVO 2LMTA 3GK2A 5AEQA 1C7WA 2GGMA 2CT9A 2FCDA 1QXPA 2K8MB 1BODA 4YGCB 1J1DA 1SBJA 3F45A 1YTZC 1A75A 1A29A 1K95A 2FJUB 3BUWB 4I5KA 1YR5A 1CTRA 4JQ0D 1XFZO 3I5IC 4QJ5B 2D8NA 1A4PA 3WHUB 1TCFA 2JC2A 3VROA 5ER5A 4I5NB 1BJFA 3CLNA 4HREE 1AVSA 3VRNA 1F54A 1S1EA 2ZN9A 1AHRA 4FTGA 1K9KA 2M0RA 1D1OA 1YX7A 2ZNEA 1WRLA 2LM5A 2IS9A 3SG3A 5B8IB 3RLZA 1DF0B 2LVJA 1LXFC 1U5IA 5F6TA 1FF1A 1WLMA 1A75B 2BE6A 2HF5A 3CR2A 1CLLA 2OPOA 3CS1A 3DF0A 2L50A 2PASA 1J7OA 1OSAA 4ICBA 1BT6A 4E68A 1QLSA 2JT3A 1DT7B 2L98A 2L2EA 5HLVA 1SL9A 1Y1XA 3A4UB 2MRDA 1J7RA 3O78A 2KSPA 2ZKMX 2ZNDA 4GNKB 1OE9B 2O5GA 5DKQA 1N0YA 1IRJA 1BR1B 1DJXA 1SL8A 1C7VA 5AFPA 1TOPA 1LA0A 1Y6WA 5TNCA 1OMRA 1IJ5A 1UHIA 2BE4A 3M0WA 4ZCUA 4ORCB 1S36A 4XJKA 1XYDA 4WRIA 2O60A 2OS8C 2COLB 1KQMB 4PE4A 1IG5A 1K96A 3DF0B 1WRKA 1DJZA 2JQ6A 2NCOA 3I5GC 2OS8B 3CGAA 1B1GA 3D0YA 1BF5A 2LLSA 2Y5IA 1BMOA 1CFDA 1WDCB 5I2OA 3NSLA 3EKJA 4NDBA 4GBAA 4GPLB 1F4QA 1B8RA 1V1FA 2HPSA 3E3RA 4AOMA 2CNPA 2ISDA 1NSHA 2KI4C 1CLMA 1B8LA 5JOLA 1K8UA 1S6IA 1SCMC 1G33A 3C1VA 1AJ5A 5JJGA 2JNFA 1WY9A 1N65A 2E6WA 4GUKA 2KFGA 5I2LA 1PSBA 1OQPA 1RECA 3NXAA 1SCMB 1FBVA 4NQGA 4PHKA 4U8DA 4C0KA 3FS7A 1CM1A 5CSJA 1IQ5A 1QV0A 3SG6A 1NWDA 4YRUA 3EK8A 1CB1A 1DMOA 1FI5A 4PCWA 3D0YB 1XVJA 5HYDA 1TNPA 2LVIA 3PALA 1KK8C 2R2IA 4NDCA 4YGBB 5J3XA 1LINA 2LUCA 3EVRA 2EC6C 1GGZA 2ZFDA 4DUQA 3JTDC 1JF0A 1SPYA 1KK8B 3AAKA 3A8RA 2F2PA 2KGRA 1NCZA 1QATA 2JOJA 2EC6B 2JTZA 1FPWA 1K93D 2BECA 4MSPA 1ALWA 3OX6A 1YUUA 1K9UA 2F3YA 2EGDA 4PALA 2GGZA 3QRXA 1NP8A 2K7DA 2MHHA 4PHMA 5FYXA 1QTXA 2LCPA 3KF9A 5I2QA 1IH0A 3LLEA 1SR6C 3HX4A 4M2PA 1UHJA 2JPTA 2RGIA 3CR4X 2BL0C 2SASA 1NCYA 3LCPC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SJS A;  2KFF A;  3BYA A;  1CM4 A;  1V1G A;  3TZ1 A;  1BR4 B;  2HET A;  2JXL A;  4MEW A;  1DJG A;  4Q04 A;  1DF0 A;  5AAN A;  1M63 B;  2PAL A;  4QJ3 B;  3SG4 A;  1ZFS A;  2NLN A;  3IQQ A;  2JTT A;  4ETO A;  1CMF A;  2BCX A;  2LHI A;  4A4B A;  1WRZ A;  3VRR A;  1BLQ A;  2A4J A;  2OTG C;  2B1U A;  1OMV A;  2KAY A;  4QJ4 B;  2L51 A;  3BOW B;  2OTG B;  4D1E A;  1SKT A;  1FW4 A;  2JWW A;  1XFW O;  1Y1U A;  3OX5 A;  1F4O A;  1PVB A;  1VRK A;  4GAO A;  4MRY A;  1L2O B;  1DJI A;  3ZWH A;  2Y1M A;  4C0J A;  3NSO A;  5HKY A;  3O6B A;  1CFF A;  4YGD B;  3BUX B;  3ZNI A;  2CCM A;  3DD4 A;  1PVA A;  2AMI A;  3TDI A;  2WCB A;  1RTP 1;  1YVH A;  3EVV A;  2LHL A;  3CTN A;  4PDZ A;  5ER4 X;  1OMD A;  4MZL A;  1ZMZ A;  1CDP A;  4PHJ A;  1Q80 A;  1UUR A;  3MSE B;  1KWO C;  4OR9 B;  2JUL A;  1G4Y R;  1TNQ A;  1XK4 C;  1KFU S;  2E30 A;  1YUT A;  2LNK A;  2KHN A;  3HCM A;  1KWO B;  4WQ3 A;  3PAT A;  1KQM C;  1WLZ A;  4YGA A;  1AK8 A;  1KCY A;  1K90 D;  4CFQ A;  2KFH A;  2LVK A;  3EKH A;  1EG4 A;  4FQO A;  1WDC C;  3SG2 A;  1EXR A;  2MAZ A;  1AJ4 A;  1CNP A;  2HQ8 A;  2CTN A;  3PFV A;  1BOC A;  1S6J A;  4ORA B;  1F55 A;  2M97 A;  1J1E A;  2KBI A;  1S26 D;  4BY5 A;  1IQ3 A;  4N5X A;  3DVE A;  1DGU A;  1EL4 A;  1M39 A;  3TDU A;  5D7F A;  1KFX L;  1N2D A;  1UUS A;  2MBX A;  5KU1 A;  2M3W A;  2V53 A;  1BU3 A;  1IGV A;  3TS5 C;  1JWD A;  3IQO A;  2PMY A;  3CZT X;  1M45 A;  2PVB A;  1S5G Y;  1W7I B;  2F3Z A;  1W7J B;  3KHE A;  1SRA A;  3TS5 B;  2NZ0 A;  3I5H C;  4OKH A;  2Y4Q A;  2JNX A;  1QX2 A;  1K94 A;  2M1U A;  5CPV A;  1JUO A;  3I5H B;  2JT0 A;  1RRO A;  2LC5 A;  2K61 A;  1KK7 Y;  3IF7 A;  1QIW A;  1CDN A;  1ZAC A;  2KAV A;  4DRW A;  1SMG A;  4MZK A;  1MR8 A;  1S5G Z;  3BUO B;  3O2P A;  2H2K A;  2ZN8 A;  1YX8 A;  1YVL A;  2G9B A;  2PSR A;  4HSZ A;  1SYM A;  3BXK A;  2K7O A;  3JVT C;  2LVV A;  1TN4 A;  1RWY A;  1QS7 A;  1MXL C;  1QV1 A;  1KK7 Z;  3O4Y A;  1YUS A;  2BKH B;  1IKU A;  3JVT B;  3RM1 A;  2KQ6 A;  2L4I A;  4AQI A;  2AUC A;  1F71 A;  4OVN F;  2ZRT A;  3BOW A;  1JBA A;  2G2B A;  5AER A;  1J7P A;  1TRF A;  2BKI B;  1HQV A;  3VGO A;  1SL7 A;  2KAX A;  1LA3 A;  2KOT A;  5GQQ C;  1B47 A;  4MLW A;  4MRX A;  2BCB A;  4YI9 A;  1QIV A;  1HT9 A;  1F70 A;  3CWG A;  4MZJ A;  3K21 A;  1PRW A;  5HLO A;  3SG5 A;  1NX0 A;  4I5J A;  2ZRS A;  4PE1 A;  3OB2 B;  3DVJ A;  2K2A A;  3DVM A;  2KDH A;  3PN7 C;  3WXA A;  1UHN A;  1A03 A;  2JXC A;  1ZUZ A;  3OB1 B;  2KQY A;  2VRG A;  2LAP A;  3EVU A;  3NSK A;  4WQ2 A;  3LL8 B;  2KYF A;  3PN7 B;  1F8H A;  2KI6 C;  1M31 A;  3TUY B;  2KBM A;  2LAN A;  2M7N A;  1RK9 A;  3GK4 X;  4PE0 A;  1L2O C;  3EK4 A;  2LP3 A;  1YUR A;  4P5O E;  1RFJ A;  2KYC A;  4CLN A;  2I7A A;  1UP5 A;  1J55 A;  4N1G A;  2WC8 A;  2JZI A;  2GV5 A;  2LMV A;  4ZCV A;  1JC2 A;  2NCP A;  1TCO B;  2LLT A;  1R2U A;  1XK4 A;  3NSI A;  3AAJ A;  2QAC A;  5CSN A;  2K0J A;  4YBH B;  2I94 A;  2F2O A;  4XYN A;  1MUX A;  3VRP A;  2L0P A;  1FI6 A;  1EG3 A;  3ICB A;  1LVC D;  4OCI A;  1DJY A;  1CKK A;  4GGF A;  1JSA A;  1KSO A;  2LMU A;  3FWC A;  1ZOT B;  2FCE A;  3I5I B;  4I5L B;  3VRQ A;  1NX2 A;  4F0Z B;  4M2O A;  1NUB A;  1MXE A;  5KSZ A;  1RJV A;  1IWQ A;  1G8I A;  2KI6 D;  1YRT B;  2WND A;  4CPV A;  1OOJ A;  2MLF C;  1QLK A;  2NXQ A;  5CSI A;  1X02 A;  4DS7 A;  1TTX A;  1B9A A;  3FWB A;  3BUM B;  2P6B B;  1ALV A;  1MF8 B;  1XFU O;  2AAO A;  4R1E A;  1Y0V H;  3KEV A;  2MJW B;  1DVI A;  1CFC A;  1NX3 A;  2MLE C;  4MVF A;  2WCF A;  4IL1 A;  1BG1 A;  4PHN A;  1QX7 A;  3KO0 A;  1Y1A A;  4GGF C;  3PLF B;  1QVI Y;  4A4C A;  4MN0 A;  5HKW A;  1JFJ A;  3AKB A;  1TNW A;  3FIA A;  4DCK A;  1JFK A;  3PM8 A;  3WNX B;  1CFP A;  1QX5 B;  2F33 A;  2Q91 A;  1KFX S;  1CMG A;  1YRU B;  1MWN A;  2L5X B;  2Q4U A;  3H4S E;  3TDZ A;  1PUL A;  1GQM A;  2JRF A;  1GJY A;  1AP4 A;  2M49 B;  4N1F A;  2TN4 A;  5K89 A;  4PE7 A;  4NDD A;  5HKZ A;  1QVI Z;  1R6P A;  2MA2 A;  4JPZ B;  2LE9 B;  1SCV A;  1H8B A;  1JF2 A;  2BBM A;  2I2R E;  1U5I B;  2BCA A;  2CBL A;  2QPT A;  3EK7 A;  2JU0 A;  1TNX A;  4USL A;  4YGE B;  1ODB A;  4BY4 A;  1B8C A;  5I8N A;  4HRH A;  1KFU L;  1XA5 A;  1EJ3 A;  4HRG A;  1A2X A;  1CDL A;  5CSF A;  1DTL A;  2LUX A;  4GGN A;  5BPJ A;  2LLU A;  2M1K B;  1XFY O;  3GK1 A;  1KSM A;  3BQ3 A;  2WOR A;  3I5F C;  4GFT A;  3I5G B;  5IBW A;  1DGV A;  3BUN B;  2M29 A;  1DJH A;  1UHH A;  1OZS A;  3PSR A;  3WHT B;  1IJ6 A;  3I5F B;  1XFX O;  3D10 A;  5KTY A;  1PSR A;  3OHM B;  2Y1N A;  2FOT A;  2K7C A;  4CFR A;  4M2Q A;  4L9M A;  1QAS A;  5D69 A;  3SG7 A;  2M8U A;  4ORB B;  2H61 A;  1S6C A;  2KI4 B;  5DKR A;  4CID A;  2KGB C;  1NYA A;  2L4H A;  4C0L A;  1L7Z A;  1SNL A;  3SIB A;  1SW8 A;  4XJK B;  1B7T Y;  1E8A A;  2KNE A;  2SCP A;  3LK1 A;  1C07 A;  4P2Y B;  3KPX A;  3OP0 A;  1EH2 A;  2HQW A;  2K2F A;  5DKN A;  1NX1 A;  2LV7 A;  1LKJ A;  1NIW A;  1NCX A;  4OV2 A;  1NPQ A;  1MHO A;  1B4C A;  5AXI A;  1XO5 A;  1QJT A;  5PAL A;  3LK0 A;  1KQV A;  1J7Q A;  1PK0 D;  4MBE A;  1B7T Z;  2M9G A;  1SY9 A;  2H61 C;  2BBN A;  4YI8 A;  1MQ1 A;  1GGW A;  4AQJ A;  1TIZ A;  1SK6 D;  2F8P A;  2CXJ A;  2M7L A;  1AUI B;  3DVK A;  2PRU A;  3JTD B;  4UPG A;  1PAL A;  1CDM A;  4TNC A;  4DIR A;  1UHK A;  2K7B A;  2LP2 A;  5G08 A;  2EHB A;  2JT8 A;  3GOF A;  1K2H A;  3TUY C;  3SIA A;  2WCE A;  1DJW A;  1S3P A;  3CR5 X;  1CLB A;  1UWO A;  1H4B A;  2WOS A;  2DOQ A;  4JWQ A;  3AKA A;  1K9P A;  1SR6 B;  1M46 A;  1OZO A;  2I18 A;  2BL0 B;  1XFV O;  2LMT A;  3GK2 A;  5AEQ A;  1C7W A;  2GGM A;  2CT9 A;  2FCD A;  1QXP A;  2K8M B;  1BOD A;  4YGC B;  1J1D A;  1SBJ A;  3F45 A;  1YTZ C;  1A75 A;  1A29 A;  1K95 A;  2FJU B;  3BUW B;  4I5K A;  1YR5 A;  1CTR A;  4JQ0 D;  1XFZ O;  3I5I C;  4QJ5 B;  2D8N A;  1A4P A;  3WHU B;  1TCF A;  2JC2 A;  3VRO A;  5ER5 A;  4I5N B;  1BJF A;  3CLN A;  4HRE E;  1AVS A;  3VRN A;  1F54 A;  1S1E A;  2ZN9 A;  1AHR A;  4FTG A;  1K9K A;  2M0R A;  1D1O A;  1YX7 A;  2ZNE A;  1WRL A;  2LM5 A;  2IS9 A;  3SG3 A;  5B8I B;  3RLZ A;  1DF0 B;  2LVJ A;  1LXF C;  1U5I A;  5F6T A;  1FF1 A;  1WLM A;  1A75 B;  2BE6 A;  2HF5 A;  3CR2 A;  1CLL A;  2OPO A;  3CS1 A;  3DF0 A;  2L50 A;  2PAS A;  1J7O A;  1OSA A;  4ICB A;  1BT6 A;  4E68 A;  1QLS A;  2JT3 A;  1DT7 B;  2L98 A;  2L2E A;  5HLV A;  1SL9 A;  1Y1X A;  3A4U B;  2MRD A;  1J7R A;  3O78 A;  2KSP A;  2ZKM X;  2ZND A;  4GNK B;  1OE9 B;  2O5G A;  5DKQ A;  1N0Y A;  1IRJ A;  1BR1 B;  1DJX A;  1SL8 A;  1C7V A;  5AFP A;  1TOP A;  1LA0 A;  1Y6W A;  5TNC A;  1OMR A;  1IJ5 A;  1UHI A;  2BE4 A;  3M0W A;  4ZCU A;  4ORC B;  1S36 A;  4XJK A;  1XYD A;  4WRI A;  2O60 A;  2OS8 C;  2COL B;  1KQM B;  4PE4 A;  1IG5 A;  1K96 A;  3DF0 B;  1WRK A;  1DJZ A;  2JQ6 A;  2NCO A;  3I5G C;  2OS8 B;  3CGA A;  1B1G A;  3D0Y A;  1BF5 A;  2LLS A;  2Y5I A;  1BMO A;  1CFD A;  1WDC B;  5I2O A;  3NSL A;  3EKJ A;  4NDB A;  4GBA A;  4GPL B;  1F4Q A;  1B8R A;  1V1F A;  2HPS A;  3E3R A;  4AOM A;  2CNP A;  2ISD A;  1NSH A;  2KI4 C;  1CLM A;  1B8L A;  5JOL A;  1K8U A;  1S6I A;  1SCM C;  1G33 A;  3C1V A;  1AJ5 A;  5JJG A;  2JNF A;  1WY9 A;  1N65 A;  2E6W A;  4GUK A;  2KFG A;  5I2L A;  1PSB A;  1OQP A;  1REC A;  3NXA A;  1SCM B;  1FBV A;  4NQG A;  4PHK A;  4U8D A;  4C0K A;  3FS7 A;  1CM1 A;  5CSJ A;  1IQ5 A;  1QV0 A;  3SG6 A;  1NWD A;  4YRU A;  3EK8 A;  1CB1 A;  1DMO A;  1FI5 A;  4PCW A;  3D0Y B;  1XVJ A;  5HYD A;  1TNP A;  2LVI A;  3PAL A;  1KK8 C;  2R2I A;  4NDC A;  4YGB B;  5J3X A;  1LIN A;  2LUC A;  3EVR A;  2EC6 C;  1GGZ A;  2ZFD A;  4DUQ A;  3JTD C;  1JF0 A;  1SPY A;  1KK8 B;  3AAK A;  3A8R A;  2F2P A;  2KGR A;  1NCZ A;  1QAT A;  2JOJ A;  2EC6 B;  2JTZ A;  1FPW A;  1K93 D;  2BEC A;  4MSP A;  1ALW A;  3OX6 A;  1YUU A;  1K9U A;  2F3Y A;  2EGD A;  4PAL A;  2GGZ A;  3QRX A;  1NP8 A;  2K7D A;  2MHH A;  4PHM A;  5FYX A;  1QTX A;  2LCP A;  3KF9 A;  5I2Q A;  1IH0 A;  3LLE A;  1SR6 C;  3HX4 A;  4M2P A;  1UHJ A;  2JPT A;  2RGI A;  3CR4 X;  2BL0 C;  2SAS A;  1NCY A;  3LCP C; 
#chains in the Genus database with same CATH topology
 3SJS A;  2KFF A;  3PJI A;  2QEB A;  3BYA A;  1CM4 A;  3V2L A;  1V1G A;  3TZ1 A;  1BR4 B;  2HET A;  2JXL A;  4MEW A;  2WCM A;  1DJG A;  4Q04 A;  1DF0 A;  5AAN A;  2WCJ A;  1M63 B;  2PAL A;  4QJ3 B;  3SG4 A;  1ZFS A;  2NLN A;  1OW4 A;  2JTT A;  3IQQ A;  4ETO A;  1CMF A;  2BCX A;  2LHI A;  4A4B A;  1WRZ A;  3D73 A;  3VRR A;  1BLQ A;  2A4J A;  2OTG C;  2B1U A;  1OMV A;  3CYZ A;  2KAY A;  4QJ4 B;  2L51 A;  3BOW B;  3CZ2 A;  2OTG B;  4D1E A;  1SKT A;  2KLD A;  1FW4 A;  2JWW A;  1XFW O;  1Y1U A;  3OX5 A;  1F4O A;  1PVB A;  1VRK A;  4GAO A;  1C3Z A;  4MRY A;  1L2O B;  1DJI A;  3ZWH A;  2Y1M A;  4C0J A;  3NSO A;  5HKY A;  3O6B A;  1CFF A;  4YGD B;  3BUX B;  3ZNI A;  2CCM A;  3DD4 A;  4OZD A;  1PVA A;  2AMI A;  3TDI A;  2WCB A;  1RTP 1;  1YVH A;  2H8V A;  3EVV A;  2LHL A;  3CTN A;  4PDZ A;  5ER4 X;  1OMD A;  4MZL A;  1ZMZ A;  1CDP A;  4PHJ A;  1LS8 A;  3K1E A;  1Q80 A;  1UUR A;  1W9Z A;  3MSE B;  1KWO C;  4OR9 B;  2JUL A;  1G4Y R;  1TNQ A;  3CDN A;  1XK4 C;  1KFU S;  2E30 A;  1YUT A;  2LNK A;  2KHN A;  3HCM A;  1KWO B;  3OBV A;  4WQ3 A;  3PAT A;  1KQM C;  1WLZ A;  1OOF A;  4YGA A;  3R72 A;  1AK8 A;  1KCY A;  1K90 D;  4CFQ A;  2KFH A;  2LVK A;  3EKH A;  1EG4 A;  4FQO A;  1WDC C;  3SG2 A;  1EXR A;  2MAZ A;  1AJ4 A;  1CNP A;  2PYQ A;  2HQ8 A;  2CTN A;  3PFV A;  1BOC A;  1S6J A;  4ORA B;  1F55 A;  2M97 A;  1J1E A;  2KBI A;  1S26 D;  4BY5 A;  1IQ3 A;  4N5X A;  3N7H A;  3DVE A;  1DGU A;  1EL4 A;  1M39 A;  3TDU A;  5D7F A;  1KFX L;  1N2D A;  1UUS A;  2MBX A;  5KU1 A;  2M3W A;  2V53 A;  1BU3 A;  1IGV A;  3TS5 C;  3BFH A;  3IQO A;  2PMY A;  3CZT X;  1JWD A;  1M45 A;  2PVB A;  5FI2 A;  1S5G Y;  1W7I B;  2F3Z A;  1W7J B;  3KHE A;  3VB1 A;  1SRA A;  2KPH A;  3D76 A;  3TS5 B;  2NZ0 A;  3I5H C;  4OKH A;  2Y4Q A;  1XFR A;  2JNX A;  1QX2 A;  1K94 A;  2M1U A;  5CPV A;  1JUO A;  3I5H B;  2JT0 A;  1RRO A;  2LC5 A;  2K61 A;  3R1O A;  1KK7 Y;  3IF7 A;  1QIW A;  1CDN A;  1ZAC A;  3IVT A;  2KAV A;  4DRW A;  1SMG A;  4MZK A;  2WCK A;  1MR8 A;  1S5G Z;  3BUO B;  3CAB A;  1OOG A;  3O2P A;  2H2K A;  2ZN8 A;  1YX8 A;  1YVL A;  2G9B A;  2PSR A;  4HSZ A;  1SYM A;  3BXK A;  2K7O A;  3JVT C;  2LVV A;  1TN4 A;  1RWY A;  1QS7 A;  1MXL C;  1QV1 A;  1KK7 Z;  3O4Y A;  1YUS A;  2BKH B;  3O4X A;  1IKU A;  3JVT B;  3RM1 A;  2KQ6 A;  2L4I A;  4AQI A;  2AUC A;  1F71 A;  4OVN F;  2YGU A;  3CZ0 A;  2ZRT A;  3BOW A;  5HL1 A;  1JBA A;  2G2B A;  5AER A;  1J7P A;  1TRF A;  2BKI B;  1HQV A;  3VGO A;  1SL7 A;  2KAX A;  1LA3 A;  2KOT A;  5GQQ C;  1B47 A;  4MLW A;  4MRX A;  2BCB A;  4YI9 A;  1QIV A;  1HT9 A;  1F70 A;  3CWG A;  4MZJ A;  3K21 A;  1PRW A;  4FQT A;  5D3O A;  5HLO A;  3SG5 A;  4F7F A;  1QWV A;  1NX0 A;  3FE9 A;  4I5J A;  2ZRS A;  4PE1 A;  3OB2 B;  3DVJ A;  2K2A A;  3DVM A;  2L5Y A;  2KDH A;  3PN7 C;  3WXA A;  1UHN A;  1A03 A;  2JXC A;  1ZUZ A;  3OB1 B;  2KQY A;  2VRG A;  4IJ7 A;  2LAP A;  3EVU A;  2PQL A;  3NSK A;  4WQ2 A;  3LL8 B;  2KYF A;  3PN7 B;  1F8H A;  2KI6 C;  1M31 A;  4JD9 A;  3TUY B;  2KBM A;  2LAN A;  2M7N A;  1RK9 A;  3GK4 X;  4PE0 A;  1L2O C;  3EK4 A;  2LP3 A;  1YUR A;  4P5O E;  1RFJ A;  2KYC A;  4CLN A;  2I7A A;  1UP5 A;  1J55 A;  4N1G A;  2WC8 A;  2JZI A;  2GV5 A;  3BJH A;  3FE8 A;  2LMV A;  2K60 A;  3UO9 A;  2JPO A;  4ZCV A;  1JC2 A;  2NCP A;  1TCO B;  2LLT A;  1R2U A;  1XK4 A;  3NSI A;  3AAJ A;  2QAC A;  5CSN A;  2K0J A;  4YBH B;  2WCH A;  2I94 A;  2F2O A;  4XYN A;  1MUX A;  3VRP A;  2L0P A;  1FI6 A;  2QDI A;  1EG3 A;  3ICB A;  1LVC D;  4OCI A;  1DJY A;  1CKK A;  2WC5 A;  4GGF A;  1JSA A;  1KSO A;  3NHT A;  2LMU A;  3FWC A;  1ZOT B;  2FCE A;  3I5I B;  4I5L B;  3VRQ A;  1NX2 A;  4F0Z B;  4M2O A;  1NUB A;  1MXE A;  5KSZ A;  1RJV A;  1IWQ A;  1G8I A;  2KI6 D;  1YRT B;  2WND A;  4CPV A;  1OOJ A;  2MLF C;  4JKT A;  1QLK A;  2NXQ A;  5CSI A;  1X02 A;  4DS7 A;  1TTX A;  1B9A A;  3FWB A;  3BUM B;  2P6B B;  1ALV A;  1MF8 B;  1XFU O;  2AAO A;  4R1E A;  1Y0V H;  3KEV A;  2MJW B;  1DVI A;  1CFC A;  1NX3 A;  2MLE C;  4MVF A;  2WCF A;  4IL1 A;  1BG1 A;  4PHN A;  1QX7 A;  3R1V A;  3KO0 A;  1Y1A A;  4GGF C;  3PLF B;  1QVI Y;  4A4C A;  3B7A A;  4MN0 A;  5HKW A;  1JFJ A;  3AKB A;  1TNW A;  3FIA A;  4DCK A;  1JFK A;  3PM8 A;  3WNX B;  1CFP A;  1QX5 B;  2ERB A;  2F33 A;  1KFX S;  2Q91 A;  1CMG A;  1TWO A;  1MWN A;  1YRU B;  2L5X B;  2Q4U A;  3H4S E;  3TDZ A;  1PUL A;  1GQM A;  2JRF A;  1GJY A;  1AP4 A;  2M49 B;  4N1F A;  2TN4 A;  3S0B A;  5K89 A;  4PE7 A;  4NDD A;  5HKZ A;  2BNX A;  1QVI Z;  3PM2 A;  1R6P A;  2MA2 A;  2FJY A;  4JPZ B;  2LE9 B;  1SCV A;  1H8B A;  1JF2 A;  2BBM A;  2I2R E;  1U5I B;  2BCA A;  2CBL A;  2QPT A;  3EK7 A;  2JU0 A;  1TNX A;  2GTE A;  4USL A;  4YGE B;  1ODB A;  4BY4 A;  1B8C A;  5I8N A;  4HRH A;  1KFU L;  1XA5 A;  1EJ3 A;  4HRG A;  1A2X A;  1CDL A;  5CSF A;  1DTL A;  2LUX A;  4GGN A;  5BPJ A;  2LLU A;  2M1K B;  1XFY O;  3GK1 A;  1KSM A;  3BQ3 A;  2WOR A;  3I5F C;  4GFT A;  3I5G B;  5IBW A;  1DGV A;  3BUN B;  2M29 A;  1DJH A;  1UHH A;  1OZS A;  1Z4H A;  3PSR A;  5DIC A;  3SS5 A;  3WHT B;  1IJ6 A;  3I5F B;  1XFX O;  3BFA A;  3D10 A;  1PSR A;  3NHI A;  3OHM B;  3S0E A;  5KTY A;  2Y1N A;  2FOT A;  2K7C A;  4CFR A;  4M2Q A;  4L9M A;  1QAS A;  5D69 A;  3SG7 A;  2M8U A;  4ORB B;  2H61 A;  1S6C A;  2KI4 B;  5DKR A;  4CID A;  2KGB C;  4PT1 A;  1NYA A;  2L4H A;  4C0L A;  1L7Z A;  1SNL A;  3SIB A;  1SW8 A;  2KLE A;  4XJK B;  1B7T Y;  1E8A A;  2KNE A;  2SCP A;  3LK1 A;  1C07 A;  4P2Y B;  1IIO A;  3KPX A;  3OP0 A;  1EH2 A;  2HQW A;  3SS3 A;  2K2F A;  5DKN A;  1NX1 A;  2LV7 A;  1LKJ A;  1NIW A;  1NCX A;  4OV2 A;  1NPQ A;  1MHO A;  2QEH A;  1B4C A;  5AXI A;  1XO5 A;  5FI7 A;  1QJT A;  5PAL A;  3FE6 A;  3RZS A;  3LK0 A;  1KQV A;  1J7Q A;  1PK0 D;  4MBE A;  1B7T Z;  1GM0 A;  2M9G A;  1SY9 A;  2H61 C;  2BBN A;  4YI8 A;  1MQ1 A;  1GGW A;  4AQJ A;  1TIZ A;  1SK6 D;  2F8P A;  2CXJ A;  2M7L A;  1AUI B;  3DVK A;  2PRU A;  4INW A;  3JTD B;  4UPG A;  1PAL A;  1CDM A;  4TNC A;  4DIR A;  1UHK A;  2K7B A;  3DXL A;  2LP2 A;  5G08 A;  2EHB A;  2JT8 A;  3D75 A;  3GOF A;  1K2H A;  3TUY C;  3SIA A;  2WCE A;  1TUJ A;  1DJW A;  1S3P A;  3CR5 X;  4KYN A;  1UWO A;  3UNW A;  1CLB A;  1H4B A;  2WOS A;  2DOQ A;  4JWQ A;  1OOH A;  3AKA A;  3DZT A;  1K9P A;  2BAP A;  3NGV A;  1SR6 B;  1M46 A;  1OZO A;  2I18 A;  2BL0 B;  1XFV O;  2LMT A;  3GK2 A;  3Q8I A;  2WCL A;  5AEQ A;  1C7W A;  2GGM A;  3D74 A;  2CT9 A;  2FCD A;  1QXP A;  2K8M B;  1BOD A;  4YGC B;  1J1D A;  1SBJ A;  3S0A A;  3F45 A;  1YTZ C;  1A75 A;  1A29 A;  1K95 A;  2FJU B;  3BUW B;  3D77 A;  4I5K A;  1YR5 A;  1CTR A;  4JQ0 D;  1XFZ O;  3I5I C;  4QJ5 B;  2D8N A;  1A4P A;  2P71 A;  3WHU B;  1TCF A;  2JC2 A;  1OOI X;  3VRO A;  5ER5 A;  4I5N B;  1BJF A;  3CLN A;  3L4A A;  4HRE E;  1AVS A;  1DQE A;  3OGN A;  3DY9 A;  3R1P A;  3VRN A;  3S0F A;  1F54 A;  1S1E A;  2ZN9 A;  1AHR A;  4FTG A;  1K9K A;  1T14 A;  2M0R A;  1D1O A;  1SSE B;  1YX7 A;  5FI6 A;  2ZNE A;  1WRL A;  2LM5 A;  2IS9 A;  3SG3 A;  5B8I B;  3RLZ A;  1DF0 B;  2LVJ A;  1TUZ A;  1LXF C;  2QEO A;  1U5I A;  5F6T A;  1FF1 A;  2L2C A;  1WLM A;  5I94 A;  1A75 B;  2BE6 A;  2HF5 A;  3CR2 A;  1CLL A;  2OPO A;  3CS1 A;  3DF0 A;  2L50 A;  3B87 A;  2PAS A;  1J7O A;  1OSA A;  4ICB A;  1BT6 A;  4E68 A;  2WC6 A;  3L4L A;  1QLS A;  2JT3 A;  1DT7 B;  2L98 A;  2L2E A;  5HLV A;  1SL9 A;  1Y1X A;  3A4U B;  2MRD A;  1J7R A;  2QEV A;  3O78 A;  3S0D A;  2KSP A;  2ZKM X;  2ZND A;  3S0G A;  4GNK B;  1OE9 B;  2O5G A;  5DKQ A;  1N0Y A;  1IRJ A;  1BR1 B;  1DJX A;  1SL8 A;  1C7V A;  5AFP A;  1TOP A;  1LA0 A;  1Y6W A;  5TNC A;  1OMR A;  1IJ5 A;  1UHI A;  3SS4 A;  2BE4 A;  3M0W A;  4ZCU A;  4ORC B;  1S36 A;  3BFB A;  1XYD A;  4XJK A;  4WRI A;  2O60 A;  2OS8 C;  2COL B;  1KQM B;  4PE4 A;  1IG5 A;  3EG5 B;  1Z2C B;  1K96 A;  3DF0 B;  1WRK A;  1DJZ A;  2JQ6 A;  2NCO A;  3I5G C;  2OS8 B;  3CGA A;  3CZ1 A;  3D0Y A;  3L47 A;  2LLS A;  1BF5 A;  1B1G A;  2Y5I A;  1BMO A;  1CFD A;  1WDC B;  5I2O A;  3NSL A;  3EKJ A;  4NDB A;  4GBA A;  1P28 A;  4GPL B;  1F4Q A;  1B8R A;  1V1F A;  2HPS A;  3E3R A;  4AOM A;  2CNP A;  2ISD A;  1NSH A;  2KI4 C;  1CLM A;  1B8L A;  5JOL A;  1K8U A;  1S6I A;  1SCM C;  1G33 A;  3C1V A;  1AJ5 A;  5JJG A;  2JNF A;  1WY9 A;  1N65 A;  2E6W A;  4GUK A;  2KFG A;  5I2L A;  1PSB A;  1DEL A;  1OQP A;  1REC A;  3NXA A;  1ORG A;  1SCM B;  1FBV A;  4NQG A;  1DEK A;  4PHK A;  4U8D A;  2P70 A;  4C0K A;  3FS7 A;  1CM1 A;  5CSJ A;  1IQ5 A;  1QV0 A;  3SG6 A;  1NWD A;  4YRU A;  3EK8 A;  1C3Y A;  1CB1 A;  1DMO A;  1FI5 A;  4PCW A;  3D0Y B;  1XVJ A;  4INX A;  5HYD A;  1TNP A;  2LVI A;  1DC1 A;  3PAL A;  1KK8 C;  2R2I A;  4NDC A;  4YGB B;  3DYE A;  5J3X A;  1LIN A;  2LUC A;  3B6X A;  2EC6 C;  3B86 A;  1GGZ A;  2ZFD A;  3EVR A;  4DUQ A;  3JTD C;  1JF0 A;  1SPY A;  1KK8 B;  3QME A;  3AAK A;  3A8R A;  2F2P A;  2KGR A;  1NCZ A;  1QAT A;  2JOJ A;  2EC6 B;  2JTZ A;  1FPW A;  1K93 D;  2BEC A;  4MSP A;  1ALW A;  5EL2 A;  3OX6 A;  1YUU A;  1K9U A;  2F3Y A;  2EGD A;  3D78 A;  3B88 A;  4PAL A;  2GGZ A;  3QRX A;  1NP8 A;  2K7D A;  2MHH A;  4PHM A;  5FYX A;  1QTX A;  2LCP A;  3KF9 A;  5I2Q A;  1IH0 A;  3LLE A;  1SR6 C;  3HX4 A;  4M2P A;  1UHJ A;  2JPT A;  2RGI A;  3CR4 X;  2BL0 C;  2SAS A;  1NCY A;  3LCP C; 
#chains in the Genus database with same CATH homology
 3SJS A;  2KFF A;  3BYA A;  1CM4 A;  1V1G A;  3TZ1 A;  1BR4 B;  2HET A;  2JXL A;  4MEW A;  1DJG A;  4Q04 A;  1DF0 A;  5AAN A;  1M63 B;  2PAL A;  4QJ3 B;  3SG4 A;  1ZFS A;  2NLN A;  3IQQ A;  2JTT A;  4ETO A;  1CMF A;  2BCX A;  2LHI A;  4A4B A;  1WRZ A;  3VRR A;  1BLQ A;  2A4J A;  2OTG C;  2B1U A;  1OMV A;  2KAY A;  4QJ4 B;  2L51 A;  3BOW B;  2OTG B;  4D1E A;  1SKT A;  1FW4 A;  2JWW A;  1XFW O;  1Y1U A;  3OX5 A;  1F4O A;  1PVB A;  1VRK A;  4GAO A;  4MRY A;  1L2O B;  1DJI A;  3ZWH A;  2Y1M A;  4C0J A;  3NSO A;  5HKY A;  3O6B A;  1CFF A;  4YGD B;  3BUX B;  3ZNI A;  2CCM A;  3DD4 A;  1PVA A;  2AMI A;  3TDI A;  2WCB A;  1RTP 1;  1YVH A;  3EVV A;  2LHL A;  3CTN A;  4PDZ A;  5ER4 X;  1OMD A;  4MZL A;  1ZMZ A;  1CDP A;  4PHJ A;  1Q80 A;  1UUR A;  3MSE B;  1KWO C;  4OR9 B;  2JUL A;  1G4Y R;  1TNQ A;  1XK4 C;  1KFU S;  2E30 A;  1YUT A;  2LNK A;  2KHN A;  3HCM A;  1KWO B;  4WQ3 A;  3PAT A;  1KQM C;  1WLZ A;  4YGA A;  1AK8 A;  1KCY A;  1K90 D;  4CFQ A;  2KFH A;  2LVK A;  3EKH A;  1EG4 A;  4FQO A;  1WDC C;  3SG2 A;  1EXR A;  2MAZ A;  1AJ4 A;  1CNP A;  2HQ8 A;  2CTN A;  3PFV A;  1BOC A;  1S6J A;  4ORA B;  1F55 A;  2M97 A;  1J1E A;  2KBI A;  1S26 D;  4BY5 A;  1IQ3 A;  4N5X A;  3DVE A;  1DGU A;  1EL4 A;  1M39 A;  3TDU A;  5D7F A;  1KFX L;  1N2D A;  1UUS A;  2MBX A;  5KU1 A;  2M3W A;  2V53 A;  1BU3 A;  1IGV A;  3TS5 C;  1JWD A;  3IQO A;  2PMY A;  3CZT X;  1M45 A;  2PVB A;  1S5G Y;  1W7I B;  2F3Z A;  1W7J B;  3KHE A;  1SRA A;  3TS5 B;  2NZ0 A;  3I5H C;  4OKH A;  2Y4Q A;  2JNX A;  1QX2 A;  1K94 A;  2M1U A;  5CPV A;  1JUO A;  3I5H B;  2JT0 A;  1RRO A;  2LC5 A;  2K61 A;  1KK7 Y;  3IF7 A;  1QIW A;  1CDN A;  1ZAC A;  2KAV A;  4DRW A;  1SMG A;  4MZK A;  1MR8 A;  1S5G Z;  3BUO B;  3O2P A;  2H2K A;  2ZN8 A;  1YX8 A;  1YVL A;  2G9B A;  2PSR A;  4HSZ A;  1SYM A;  3BXK A;  2K7O A;  3JVT C;  2LVV A;  1TN4 A;  1RWY A;  1QS7 A;  1MXL C;  1QV1 A;  1KK7 Z;  3O4Y A;  1YUS A;  2BKH B;  1IKU A;  3JVT B;  3RM1 A;  2KQ6 A;  2L4I A;  4AQI A;  2AUC A;  1F71 A;  4OVN F;  2ZRT A;  3BOW A;  1JBA A;  2G2B A;  5AER A;  1J7P A;  1TRF A;  2BKI B;  1HQV A;  3VGO A;  1SL7 A;  2KAX A;  1LA3 A;  2KOT A;  5GQQ C;  1B47 A;  4MLW A;  4MRX A;  2BCB A;  4YI9 A;  1QIV A;  1HT9 A;  1F70 A;  3CWG A;  4MZJ A;  3K21 A;  1PRW A;  5HLO A;  3SG5 A;  1NX0 A;  4I5J A;  2ZRS A;  4PE1 A;  3OB2 B;  3DVJ A;  2K2A A;  3DVM A;  2KDH A;  3PN7 C;  3WXA A;  1UHN A;  1A03 A;  2JXC A;  1ZUZ A;  3OB1 B;  2KQY A;  2VRG A;  2LAP A;  3EVU A;  3NSK A;  4WQ2 A;  3LL8 B;  2KYF A;  3PN7 B;  1F8H A;  2KI6 C;  1M31 A;  3TUY B;  2KBM A;  2LAN A;  2M7N A;  1RK9 A;  3GK4 X;  4PE0 A;  1L2O C;  3EK4 A;  2LP3 A;  1YUR A;  4P5O E;  1RFJ A;  2KYC A;  4CLN A;  2I7A A;  1UP5 A;  1J55 A;  4N1G A;  2WC8 A;  2JZI A;  2GV5 A;  2LMV A;  4ZCV A;  1JC2 A;  2NCP A;  1TCO B;  2LLT A;  1R2U A;  1XK4 A;  3NSI A;  3AAJ A;  2QAC A;  5CSN A;  2K0J A;  4YBH B;  2I94 A;  2F2O A;  4XYN A;  1MUX A;  3VRP A;  2L0P A;  1FI6 A;  1EG3 A;  3ICB A;  1LVC D;  4OCI A;  1DJY A;  1CKK A;  4GGF A;  1JSA A;  1KSO A;  2LMU A;  3FWC A;  1ZOT B;  2FCE A;  3I5I B;  4I5L B;  3VRQ A;  1NX2 A;  4F0Z B;  4M2O A;  1NUB A;  1MXE A;  5KSZ A;  1RJV A;  1IWQ A;  1G8I A;  2KI6 D;  1YRT B;  2WND A;  4CPV A;  1OOJ A;  2MLF C;  1QLK A;  2NXQ A;  5CSI A;  1X02 A;  4DS7 A;  1TTX A;  1B9A A;  3FWB A;  3BUM B;  2P6B B;  1ALV A;  1MF8 B;  1XFU O;  2AAO A;  4R1E A;  1Y0V H;  3KEV A;  2MJW B;  1DVI A;  1CFC A;  1NX3 A;  2MLE C;  4MVF A;  2WCF A;  4IL1 A;  1BG1 A;  4PHN A;  1QX7 A;  3KO0 A;  1Y1A A;  4GGF C;  3PLF B;  1QVI Y;  4A4C A;  4MN0 A;  5HKW A;  1JFJ A;  3AKB A;  1TNW A;  3FIA A;  4DCK A;  1JFK A;  3PM8 A;  3WNX B;  1CFP A;  1QX5 B;  2F33 A;  2Q91 A;  1KFX S;  1CMG A;  1YRU B;  1MWN A;  2L5X B;  2Q4U A;  3H4S E;  3TDZ A;  1PUL A;  1GQM A;  2JRF A;  1GJY A;  1AP4 A;  2M49 B;  4N1F A;  2TN4 A;  5K89 A;  4PE7 A;  4NDD A;  5HKZ A;  1QVI Z;  1R6P A;  2MA2 A;  4JPZ B;  2LE9 B;  1SCV A;  1H8B A;  1JF2 A;  2BBM A;  2I2R E;  1U5I B;  2BCA A;  2CBL A;  2QPT A;  3EK7 A;  2JU0 A;  1TNX A;  4USL A;  4YGE B;  1ODB A;  4BY4 A;  1B8C A;  5I8N A;  4HRH A;  1KFU L;  1XA5 A;  1EJ3 A;  4HRG A;  1A2X A;  1CDL A;  5CSF A;  1DTL A;  2LUX A;  4GGN A;  5BPJ A;  2LLU A;  2M1K B;  1XFY O;  3GK1 A;  1KSM A;  3BQ3 A;  2WOR A;  3I5F C;  4GFT A;  3I5G B;  5IBW A;  1DGV A;  3BUN B;  2M29 A;  1DJH A;  1UHH A;  1OZS A;  3PSR A;  3WHT B;  1IJ6 A;  3I5F B;  1XFX O;  3D10 A;  5KTY A;  1PSR A;  3OHM B;  2Y1N A;  2FOT A;  2K7C A;  4CFR A;  4M2Q A;  4L9M A;  1QAS A;  5D69 A;  3SG7 A;  2M8U A;  4ORB B;  2H61 A;  1S6C A;  2KI4 B;  5DKR A;  4CID A;  2KGB C;  1NYA A;  2L4H A;  4C0L A;  1L7Z A;  1SNL A;  3SIB A;  1SW8 A;  4XJK B;  1B7T Y;  1E8A A;  2KNE A;  2SCP A;  3LK1 A;  1C07 A;  4P2Y B;  3KPX A;  3OP0 A;  1EH2 A;  2HQW A;  2K2F A;  5DKN A;  1NX1 A;  2LV7 A;  1LKJ A;  1NIW A;  1NCX A;  4OV2 A;  1NPQ A;  1MHO A;  1B4C A;  5AXI A;  1XO5 A;  1QJT A;  5PAL A;  3LK0 A;  1KQV A;  1J7Q A;  1PK0 D;  4MBE A;  1B7T Z;  2M9G A;  1SY9 A;  2H61 C;  2BBN A;  4YI8 A;  1MQ1 A;  1GGW A;  4AQJ A;  1TIZ A;  1SK6 D;  2F8P A;  2CXJ A;  2M7L A;  1AUI B;  3DVK A;  2PRU A;  3JTD B;  4UPG A;  1PAL A;  1CDM A;  4TNC A;  4DIR A;  1UHK A;  2K7B A;  2LP2 A;  5G08 A;  2EHB A;  2JT8 A;  3GOF A;  1K2H A;  3TUY C;  3SIA A;  2WCE A;  1DJW A;  1S3P A;  3CR5 X;  1CLB A;  1UWO A;  1H4B A;  2WOS A;  2DOQ A;  4JWQ A;  3AKA A;  1K9P A;  1SR6 B;  1M46 A;  1OZO A;  2I18 A;  2BL0 B;  1XFV O;  2LMT A;  3GK2 A;  5AEQ A;  1C7W A;  2GGM A;  2CT9 A;  2FCD A;  1QXP A;  2K8M B;  1BOD A;  4YGC B;  1J1D A;  1SBJ A;  3F45 A;  1YTZ C;  1A75 A;  1A29 A;  1K95 A;  2FJU B;  3BUW B;  4I5K A;  1YR5 A;  1CTR A;  4JQ0 D;  1XFZ O;  3I5I C;  4QJ5 B;  2D8N A;  1A4P A;  3WHU B;  1TCF A;  2JC2 A;  3VRO A;  5ER5 A;  4I5N B;  1BJF A;  3CLN A;  4HRE E;  1AVS A;  3VRN A;  1F54 A;  1S1E A;  2ZN9 A;  1AHR A;  4FTG A;  1K9K A;  2M0R A;  1D1O A;  1YX7 A;  2ZNE A;  1WRL A;  2LM5 A;  2IS9 A;  3SG3 A;  5B8I B;  3RLZ A;  1DF0 B;  2LVJ A;  1LXF C;  1U5I A;  5F6T A;  1FF1 A;  1WLM A;  1A75 B;  2BE6 A;  2HF5 A;  3CR2 A;  1CLL A;  2OPO A;  3CS1 A;  3DF0 A;  2L50 A;  2PAS A;  1J7O A;  1OSA A;  4ICB A;  1BT6 A;  4E68 A;  1QLS A;  2JT3 A;  1DT7 B;  2L98 A;  2L2E A;  5HLV A;  1SL9 A;  1Y1X A;  3A4U B;  2MRD A;  1J7R A;  3O78 A;  2KSP A;  2ZKM X;  2ZND A;  4GNK B;  1OE9 B;  2O5G A;  5DKQ A;  1N0Y A;  1IRJ A;  1BR1 B;  1DJX A;  1SL8 A;  1C7V A;  5AFP A;  1TOP A;  1LA0 A;  1Y6W A;  5TNC A;  1OMR A;  1IJ5 A;  1UHI A;  2BE4 A;  3M0W A;  4ZCU A;  4ORC B;  1S36 A;  4XJK A;  1XYD A;  4WRI A;  2O60 A;  2OS8 C;  2COL B;  1KQM B;  4PE4 A;  1IG5 A;  1K96 A;  3DF0 B;  1WRK A;  1DJZ A;  2JQ6 A;  2NCO A;  3I5G C;  2OS8 B;  3CGA A;  1B1G A;  3D0Y A;  1BF5 A;  2LLS A;  2Y5I A;  1BMO A;  1CFD A;  1WDC B;  5I2O A;  3NSL A;  3EKJ A;  4NDB A;  4GBA A;  4GPL B;  1F4Q A;  1B8R A;  1V1F A;  2HPS A;  3E3R A;  4AOM A;  2CNP A;  2ISD A;  1NSH A;  2KI4 C;  1CLM A;  1B8L A;  5JOL A;  1K8U A;  1S6I A;  1SCM C;  1G33 A;  3C1V A;  1AJ5 A;  5JJG A;  2JNF A;  1WY9 A;  1N65 A;  2E6W A;  4GUK A;  2KFG A;  5I2L A;  1PSB A;  1OQP A;  1REC A;  3NXA A;  1SCM B;  1FBV A;  4NQG A;  4PHK A;  4U8D A;  4C0K A;  3FS7 A;  1CM1 A;  5CSJ A;  1IQ5 A;  1QV0 A;  3SG6 A;  1NWD A;  4YRU A;  3EK8 A;  1CB1 A;  1DMO A;  1FI5 A;  4PCW A;  3D0Y B;  1XVJ A;  5HYD A;  1TNP A;  2LVI A;  3PAL A;  1KK8 C;  2R2I A;  4NDC A;  4YGB B;  5J3X A;  1LIN A;  2LUC A;  3EVR A;  2EC6 C;  1GGZ A;  2ZFD A;  4DUQ A;  3JTD C;  1JF0 A;  1SPY A;  1KK8 B;  3AAK A;  3A8R A;  2F2P A;  2KGR A;  1NCZ A;  1QAT A;  2JOJ A;  2EC6 B;  2JTZ A;  1FPW A;  1K93 D;  2BEC A;  4MSP A;  1ALW A;  3OX6 A;  1YUU A;  1K9U A;  2F3Y A;  2EGD A;  4PAL A;  2GGZ A;  3QRX A;  1NP8 A;  2K7D A;  2MHH A;  4PHM A;  5FYX A;  1QTX A;  2LCP A;  3KF9 A;  5I2Q A;  1IH0 A;  3LLE A;  1SR6 C;  3HX4 A;  4M2P A;  1UHJ A;  2JPT A;  2RGI A;  3CR4 X;  2BL0 C;  2SAS A;  1NCY A;  3LCP C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...