4WQ3A

Human calpain pef(s) with (2z,2z')-2,2'-disulfanediylbis(3-(6-bromoindol-3-yl)acrylic acid) bound
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
173
structure length
173
Chain Sequence
EEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Calpain small subunit 1
publication title Conformationally restricted calpain inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 65
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4wq3A00
1GGWA 2MAZA 4YI8A 2NXQA 4CFQA 1QJTA 2WCEA 1DTLA 2NCOA 1WLMA 1CFPA 1SBJA 1CM1A 1K9KA 1J7RA 1S5GZ 3AAKA 4OKHA 4C0LA 5JOLA 1BT6A 1PK0D 1EJ3A 4PALA 3EK7A 1TCFA 2L4HA 1KFXS 5CSNA 2CCMA 4WQ2A 1UWOA 3SG6A 1K90D 1GQMA 3PALA 1CFFA 1F70A 2K7CA 2M3WA 1JFKA 3LLEA 4MEWA 3VRNA 1MR8A 1CM4A 2LCPA 4DCKA 3OHMB 2HQ8A 3WHTB 4GAOA 1CDPA 2G9BA 1KK8B 2I7AA 4USLA 3QRXA 4GGFA 1XFYO 1X02A 1VRKA 2KI4B 2LM5A 3VRRA 1J1DA 2HF5A 1B4CA 2MLFC 1MF8B 1NCXA 1M63B 1WDCC 1QASA 2LP2A 1DJHA 5ER5A 1Y1XA 5KU1A 5KTYA 3I5GC 1RTP1 2BL0B 1PRWA 2LHIA 3DVEA 1WLZA 1QX7A 1XFWO 4HRHA 4ORBB 2FCEA 4DUQA 2LVKA 3I5IB 1LA0A 1LVCD 1JC2A 5BPJA 2MA2A 2IS9A 3TUYB 3DVJA 3EVVA 1CTRA 2KSPA 3SG3A 1D1OA 1KFUL 4D1EA 1JF0A 1KQVA 1JFJA 1DJXA 3HCMA 3AKBA 1DJGA 5KSZA 2OTGC 2QPTA 4ORAB 3D10A 2CT9A 3CS1A 1TN4A 3SG4A 2LNKA 4CFRA 1CKKA 1S6CA 4ICBA 5DKNA 2BL0C 1OE9B 2KAVA 4QJ4B 3K21A 3TS5B 3A4UB 4FTGA 5PALA 3VROA 1W7JB 1QLSA 1BMOA 1KSMA 1JWDA 1DJZA 4PHKA 4YI9A 3F45A 3WNXB 1A75A 1SK6D 1A2XA 3AKAA 1QXPA 4OVNF 1EG4A 2LMVA 3BUWB 3IQOA 3PM8A 1NIWA 1KFXL 1NCZA 1YVHA 4WQ3A 2M7LA 3I5FB 2B1UA 2WORA 1TTXA 2AUCA 1UHIA 1NUBA 2KFGA 4YBHB 3LL8B 3JTDC 2JXCA 2MBXA 4GGFC 2CTNA 5K89A 3EKJA 2BCBA 3ZNIA 1MXLC 3OX6A 1NX0A 1OSAA 1F55A 2L5XB 1QV0A 4PHMA 2COLB 2JNFA 4ORCB 2LC5A 1FI5A 1XK4C 2WOSA 3SG2A 1F4QA 4N5XA 2QACA 2K7BA 2K7DA 2KFFA 4AOMA 1AK8A 2M9GA 2K2FA 4YGEB 1JF2A 4FQOA 1PSBA 3D0YA 3A8RA 3SG5A 1TNQA 1DVIA 1YRTB 2BE4A 2JC2A 4R1EA 2CBLA 5DKRA 1A75B 1RK9A 3BQ3A 2LV7A 5ER4X 2JT8A 4AQIA 2JU0A 1Y0VH 1TCOB 5AANA 4PDZA 1KFUS 1BR4B 2MLEC 5G08A 3TDZA 2FJUB 3DVMA 1CLMA 1LINA 2M7NA 3BUMB 3CTNA 2KBIA 1F8HA 3DD4A 2BBNA 2MHHA 1HQVA 1YR5A 2KNEA 2F33A 1OZOA 1TNPA 2A4JA 2LAPA 4M2OA 1B7TY 3CZTX 3O2PA 1FBVA 5HKWA 5CPVA 2AAOA 4ZCVA 1GJYA 1YUSA 1CLLA 1K9UA 1S6IA 1SKTA 2H2KA 1MWNA 4NQGA 1ZACA 3WXAA 4GUKA 1M45A 1WDCB 3LK1A 1SL7A 2WC8A 2M49B 1DJYA 2BBMA 2G2BA 2HQWA 3D0YB 2ZRSA 4N1FA 4MRXA 3SIBA 2E6WA 4JPZB 3I5GB 5FYXA 1MXEA 3RLZA 2ZKMX 3BXKA 3VGOA 4IL1A 1B8CA 1YX7A 3M0WA 4CLNA 1Q80A 2PMYA 2H61C 5DKQA 3LCPC 1S36A 4MZKA 3CGAA 2EGDA 2L0PA 3GK2A 4NDCA 4PE7A 2V53A 1EXRA 1N0YA 2LLTA 4GNKB 1CDNA 4HREE 3FIAA 2FCDA 1DF0A 2ZNEA 2M29A 1IKUA 1B8RA 2OTGB 3EK4A 1G4YR 5CSFA 1DMOA 1UP5A 4AQJA 1XK4A 2KYFA 1K94A 1KK7Y 5I2LA 2GV5A 1XVJA 2ZN9A 3VRPA 1KWOC 4MZJA 1UHHA 1K95A 2F2PA 1A29A 2ZFDA 2JWWA 2LUXA 1BLQA 1K96A 2K2AA 2L98A 1XYDA 3O4YA 2EC6C 1G33A 4L9MA 2EHBA 4E68A 1W7IB 1U5IA 2L4IA 3JVTC 1NWDA 2AMIA 2F2OA 3SIAA 3NSIA 1OQPA 1S5GY 1H4BA 1S1EA 2I94A 3JTDB 1TOPA 1SY9A 5TNCA 1OZSA 4I5JA 5AFPA 1OMRA 5HYDA 1NX3A 4XJKA 2L51A 2JULA 3PFVA 5JJGA 1DF0B 2JT3A 4I5KA 5HKZA 1QTXA 1SL9A 1BODA 4C0JA 3KO0A 2L50A 1OMDA 2I2RE 2PVBA 1A03A 2D8NA 3PLFB 4NDBA 1NPQA 1N2DA 2MJWB 2ZRTA 4DIRA 3DVKA 4F0ZB 4BY5A 2E30A 4OV2A 2KI6D 2LMTA 3VRQA 1WY9A 2KOTA 2KI6C 1J55A 1OOJA 3ICBA 3PSRA 1A4PA 1U5IB 4MRYA 4I5LB 5HLOA 2H61A 4YGCB 1DJWA 2F8PA 3OP0A 1K9PA 1RROA 1YVLA 1QVIZ 5GQQC 1G8IA 4CIDA 4N1GA 4PCWA 2LVJA 3C1VA 2Q4UA 2Y1MA 1HT9A 2Y5IA 2BE6A 1SL8A 2KFHA 1XFUO 4YGDB 1RJVA 4GGNA 1IG5A 1PALA 3NSLA 1SPYA 1M31A 1PVAA 1IQ3A 1SCVA 1UUSA 4XJKB 2KAYA 3GK4X 2LVVA 4MBEA 3CR4X 1N65A 3HX4A 1UHKA 1XFZO 4PHNA 4XYNA 2MRDA 4CPVA 1K2HA 1DGUA 2K8MB 1MUXA 2NLNA 2M97A 3GOFA 1B47A 1YTZC 3O78A 5D7FA 2GGMA 5AERA 3BUNB 1NX1A 5B8IB 3NSOA 4BY4A 2JTTA 1BOCA 1TNWA 1AVSA 1MQ1A 1ODBA 1TIZA 3KEVA 1KQMC 1XA5A 2OS8B 1L2OB 1FW4A 4C0KA 2BKHB 5CSIA 4UPGA 1BJFA 3PN7C 3TDUA 1JBAA 1CB1A 2VRGA 4P5OE 1YURA 2HETA 4PE0A 1SNLA 3CWGA 1V1FA 4DS7A 2HPSA 3FWBA 4M2QA 2KGRA 1QATA 1RECA 4GFTA 1SCMC 3CR2A 2K61A 1JUOA 2PSRA 3EKHA 1IJ5A 1DJIA 2BECA 1QX5B 1ZMZA 2M8UA 2GGZA 3OB2B 1CMFA 1SR6C 1QIWA 5I2QA 4QJ5B 1FI6A 2OS8C 1V1GA 3AAJA 3BUXB 1L2OC 1J1EA 1KWOB 3IF7A 4A4BA 1CLBA 1KCYA 1NSHA 1UURA 5J3XA 2DOQA 3TDIA 1OMVA 4A4CA 1FPWA 1RFJA 1LXFC 2JNXA 1YRUB 2EC6B 4P2YB 1B1GA 1IH0A 2LUCA 2O5GA 3JVTB 2FOTA 1GGZA 3MSEB 1F4OA 1SYMA 4GPLB 3DF0A 1Y1AA 1EG3A 1YUUA 2K0JA 2SASA 3GK1A 1Y1UA 2LP3A 3SJSA 1ALWA 4YRUA 4Q04A 2CNPA 3I5HC 1CFDA 2ZNDA 1M39A 3CR5X 1C7WA 1WRZA 2NCPA 1BR1B 4WRIA 1TRFA 4PE1A 3RM1A 1PVBA 3KF9A 3BYAA 2BCAA 2ISDA 1S3PA 4M2PA 2M1UA 1XO5A 2Q91A 3FWCA 1IGVA 3BOWA 1KSOA 2P6BB 1LA3A 1ZUZA 2JZIA 1C07A 2ZN8A 1QX2A 4MLWA 2BCXA 4U8DA 1YUTA 1ZOTB 1JSAA 1NP8A 1QIVA 2L2EA 1EH2A 2JQ6A 1BG1A 2JXLA 3O6BA 5HLVA 5I8NA 4MN0A 2KQ6A 1NX2A 1QS7A 1B8LA 1LKJA 5AXIA 2JRFA 1FF1A 4ZCUA 4HSZA 2LANA 1BU3A 1KK8C 2OPOA 3DF0B 1AJ4A 1RWYA 1F71A 2KDHA 1DGVA 2KYCA 1E8AA 2KI4C 2M0RA 2SCPA 2KGBC 1H8BA 2PRUA 1AHRA 5D69A 1IRJA 2JT0A 2LLSA 1CMGA 3EVUA 4DRWA 1J7PA 4NDDA 1BF5A 3LK0A 3OB1B 1EL4A 4OCIA 1NCYA 3TZ1A 2BKIB 2Y4QA 2M1KB 1S26D 3SG7A 3BOWB 3OX5A 1F54A 1B9AA 4YGBB 3FS7A 3ZWHA 2KHNA 1SMGA 1R6PA 2WCBA 4I5NB 2LMUA 2PASA 1B7TZ 3I5IC 1ZFSA 4MSPA 5AEQA 1NYAA 2LVIA 3TUYC 1C7VA 4PE4A 1TNXA 4TNCA 5IBWA 1AJ5A 1AUIB 1KQMB 1SW8A 1K8UA 1PSRA 2PALA 1IWQA 1AP4A 5I2OA 1IQ5A 1J7QA 3PN7B 2JOJA 2LLUA 2LE9B 3EK8A 4MZLA 2KBMA 1UHJA 2WCFA 2Y1NA 3KHEA 1SRAA 1ALVA 1L7ZA 2LHLA 4YGAA 3TS5C 1CDMA 3E3RA 1CFCA 4MVFA 1SCMB 4GBAA 4QJ3B 3EVRA 2K7OA 2WNDA 1DT7B 1R2UA 4ETOA 5CSJA 1SR6B 1Y6WA 4OR9B 1QV1A 1CNPA 4JQ0D 3I5FC 2O60A 2RGIA 4PHJA 2I18A 3WHUB 3NSKA 1J7OA 2JTZA 1PULA 1K93D 3PATA 2KQYA 2KAXA 2R2IA 2NZ0A 1IJ6A 1XFVO 3NXAA 3IQQA 1XFXO 3BUOB 1UHNA 1M46A 2F3YA 1S6JA 5F6TA 1YX8A 1QLKA 1KK7Z 1WRLA 3KPXA 4JWQA 1MHOA 1CDLA 2CXJA 3H4SE 4HRGA 1WRKA 2TN4A 5HKYA 3CLNA 2JPTA 3I5HB 1QVIY 2F3ZA
chains in the Genus database with same CATH superfamily
1GGWA 2MAZA 4YI8A 2NXQA 3D73A 4CFQA 1QJTA 2WCEA 1DTLA 2NCOA 1WLMA 1CFPA 2WCKA 1SBJA 1CM1A 1K9KA 1J7RA 1S5GZ 3AAKA 3D74A 3D75A 3PJIA 4OKHA 1OOGA 4C0LA 5JOLA 1BT6A 4PT1A 1PK0D 1EJ3A 4PALA 3EK7A 3PM2A 1TCFA 2ERBA 1KFXS 2L4HA 5CSNA 3BFAA 1W9ZA 2CCMA 3R72A 4WQ2A 1UWOA 3SG6A 1K90D 1GQMA 3PALA 1CFFA 1F70A 2K7CA 2M3WA 1JFKA 3D76A 3LLEA 4MEWA 3VRNA 1MR8A 1CM4A 2LCPA 4DCKA 3D77A 3OHMB 3RZSA 2HQ8A 3WHTB 4GAOA 1CDPA 1T14A 2G9BA 1KK8B 2I7AA 4USLA 3QRXA 4GGFA 1XFYO 1X02A 1VRKA 2KI4B 2LM5A 3VRRA 1J1DA 2HF5A 2QDIA 3CDNA 1B4CA 2MLFC 1MF8B 1NCXA 1M63B 1WDCC 1QASA 2LP2A 1DJHA 5ER5A 3DYEA 1Y1XA 5KU1A 5KTYA 3I5GC 1RTP1 2BL0B 1PRWA 2LHIA 2PQLA 3DVEA 1WLZA 1OW4A 5I94A 1QX7A 1XFWO 4HRHA 4ORBB 2FCEA 2QEHA 4DUQA 2LVKA 3I5IB 1IIOA 1LA0A 1LVCD 1JC2A 5BPJA 2MA2A 2IS9A 3TUYB 3DVJA 3EVVA 1CTRA 2KSPA 3SG3A 1D1OA 1KFUL 4D1EA 1JF0A 5EL2A 2JPOA 1KQVA 1JFJA 1DJXA 3HCMA 3AKBA 1DJGA 5KSZA 2OTGC 2QPTA 4ORAB 3D10A 2CT9A 3CS1A 1TN4A 3SG4A 2LNKA 3B7AA 4CFRA 1CKKA 1S6CA 4ICBA 5DKNA 2BL0C 1OE9B 1TWOA 2KAVA 3K21A 4QJ4B 3TS5B 2FJYA 3A4UB 4FTGA 5PALA 3VROA 1W7JB 1QLSA 1BMOA 1KSMA 1JWDA 1DJZA 1P28A 4PHKA 3F45A 4YI9A 3S0DA 3WNXB 1A75A 1SK6D 1A2XA 3B87A 3UNWA 3AKAA 1QXPA 4OVNF 1EG4A 2LMVA 3BUWB 3IQOA 3PM8A 1ORGA 1NIWA 1KFXL 1NCZA 1YVHA 4WQ3A 2M7LA 3UO9A 3I5FB 3S0AA 2B1UA 2K60A 2PYQA 2WORA 1TTXA 2AUCA 1UHIA 1NUBA 2KFGA 4YBHB 3LL8B 3JTDC 2JXCA 2MBXA 4GGFC 2CTNA 5K89A 3EKJA 2BCBA 3ZNIA 1MXLC 3OX6A 1NX0A 1OSAA 1F55A 2L5XB 2WCJA 1QV0A 4PHMA 2COLB 2JNFA 1DC1A 4ORCB 2LC5A 1FI5A 1XK4C 2WOSA 3SG2A 1F4QA 4N5XA 2QACA 2K7BA 2K7DA 2KFFA 4AOMA 1AK8A 2M9GA 2K2FA 4YGEB 1JF2A 4FQOA 1SSEB 1PSBA 3D0YA 3A8RA 3SG5A 1TNQA 1DVIA 1YRTB 2BE4A 2JC2A 4R1EA 2CBLA 5DKRA 1A75B 1RK9A 2KPHA 2LV7A 3BQ3A 5ER4X 2JT8A 4AQIA 2JU0A 1Y0VH 1TCOB 5AANA 4PDZA 1KFUS 1BR4B 2MLEC 5G08A 3TDZA 2FJUB 1LS8A 3DVMA 1CLMA 1LINA 2M7NA 3BUMB 3CTNA 2KBIA 1F8HA 3DD4A 2BBNA 2MHHA 3IVTA 1HQVA 1YR5A 2QEOA 2KNEA 2F33A 1OZOA 1TNPA 2A4JA 2LAPA 2P70A 1B7TY 3CZTX 3O2PA 1FBVA 4M2OA 4KYNA 5CPVA 2AAOA 4ZCVA 1GJYA 1YUSA 1CLLA 1K9UA 1S6IA 1SKTA 2H2KA 1MWNA 3QMEA 4NQGA 1ZACA 3WXAA 2BNXA 4GUKA 1M45A 2WC5A 1WDCB 3VB1A 3LK1A 3R1VA 1SL7A 2WC8A 2M49B 1DJYA 2BBMA 2G2BA 2HQWA 3D0YB 2ZRSA 4N1FA 3DZTA 4MRXA 2E6WA 4JPZB 3SIBA 3S0FA 3I5GB 5FYXA 1MXEA 3RLZA 2ZKMX 3BXKA 3VGOA 4IL1A 3SS4A 1B8CA 1YX7A 3M0WA 4CLNA 1Q80A 2PMYA 2H61C 5DKQA 3LCPC 1S36A 2WC6A 4MZKA 3CGAA 2EGDA 2L0PA 3GK2A 4NDCA 4PE7A 3EG5B 2V53A 1EXRA 1N0YA 2LLTA 4GNKB 1CDNA 4HREE 3FIAA 2FCDA 1DF0A 2ZNEA 2M29A 1IKUA 1B8RA 2OTGB 3EK4A 3BFBA 1G4YR 5CSFA 5HKWA 1DMOA 1UP5A 4AQJA 1XK4A 2KYFA 1K94A 1KK7Y 5I2LA 2GV5A 1XVJA 2ZN9A 3VRPA 1KWOC 2QEVA 4MZJA 1UHHA 1K95A 2F2PA 1A29A 2ZFDA 2JWWA 2LUXA 1BLQA 1K96A 2K2AA 2L98A 1XYDA 4F7FA 2WCMA 3O4YA 2EC6C 1G33A 4L9MA 2EHBA 4E68A 1W7IB 1U5IA 3OBVA 2L4IA 3JVTC 1NWDA 2AMIA 2F2OA 3SIAA 3NSIA 1OQPA 1S5GY 1H4BA 1Z2CB 1S1EA 2I94A 3JTDB 1TOPA 1SY9A 5TNCA 2YGUA 1OZSA 4I5JA 5AFPA 1OMRA 3B86A 1C3YA 5HYDA 1NX3A 4XJKA 2L51A 2JULA 3PFVA 5JJGA 1DF0B 5D3OA 2JT3A 2GTEA 3Q8IA 3NHTA 4I5KA 5HKZA 1TUJA 2P71A 1DQEA 1QTXA 1SL9A 4C0JA 1BODA 3KO0A 2L50A 2KLDA 1OMDA 2WCLA 2I2RE 2PVBA 1A03A 2D8NA 3PLFB 3K1EA 4NDBA 1NPQA 1N2DA 2MJWB 2ZRTA 4DIRA 3DVKA 4F0ZB 4BY5A 2E30A 4OV2A 2KI6D 2LMTA 2WCHA 3O4XA 1WY9A 3VRQA 2KOTA 2KI6C 1J55A 1OOJA 3ICBA 3PSRA 1A4PA 1U5IB 4MRYA 4I5LB 5HLOA 2H61A 4YGCB 1DJWA 2F8PA 3OP0A 1K9PA 1RROA 1YVLA 1QVIZ 5GQQC 1G8IA 4CIDA 4N1GA 4PCWA 2LVJA 3C1VA 2Q4UA 2Y1MA 1HT9A 2Y5IA 2BE6A 3SS3A 1SL8A 2KFHA 1XFUO 4JKTA 4YGDB 1RJVA 4GGNA 1IG5A 1PALA 3NSLA 1SPYA 1M31A 1PVAA 3NHIA 1IQ3A 1SCVA 1UUSA 1XFRA 4XJKB 2KAYA 3GK4X 2LVVA 4MBEA 3BFHA 3CR4X 1N65A 3HX4A 3B88A 1UHKA 1XFZO 4PHNA 4XYNA 2MRDA 4CPVA 1K2HA 1DGUA 2K8MB 1MUXA 2NLNA 2M97A 3GOFA 1B47A 1YTZC 3O78A 5D7FA 2GGMA 4OZDA 5AERA 3BUNB 1NX1A 5B8IB 3NSOA 4BY4A 2JTTA 1BOCA 1TNWA 1AVSA 2L5YA 1MQ1A 1ODBA 1TIZA 3KEVA 1KQMC 1XA5A 2OS8B 4IJ7A 1L2OB 1FW4A 4C0KA 2BKHB 5CSIA 4UPGA 5FI7A 1BJFA 3PN7C 3TDUA 1JBAA 1CB1A 2VRGA 4P5OE 1YURA 2HETA 4PE0A 1SNLA 3CWGA 1V1FA 4DS7A 2HPSA 3FWBA 4M2QA 2KGRA 1QATA 1RECA 4GFTA 1SCMC 3DY9A 3CR2A 2K61A 1JUOA 2PSRA 3EKHA 3SS5A 1IJ5A 1DJIA 2BECA 1QX5B 1ZMZA 1C3ZA 3D78A 2M8UA 2GGZA 3OB2B 1CMFA 1SR6C 1QIWA 5I2QA 4QJ5B 1FI6A 2OS8C 1V1GA 3AAJA 3BUXB 3S0BA 1L2OC 1J1EA 3L4AA 1KWOB 3IF7A 4A4BA 1CLBA 1KCYA 1NSHA 1UURA 5J3XA 1OOHA 1OOIX 2DOQA 3TDIA 1OMVA 4A4CA 1FPWA 1RFJA 1LXFC 2JNXA 1DELA 1YRUB 2EC6B 4P2YB 1B1GA 1IH0A 2LUCA 2O5GA 2QEBA 2FOTA 1GGZA 3CYZA 3JVTB 3MSEB 1F4OA 1SYMA 4GPLB 3DF0A 3L4LA 1Y1AA 1EG3A 1YUUA 2K0JA 2SASA 3GK1A 1Y1UA 2LP3A 3SJSA 1ALWA 4YRUA 4Q04A 2CNPA 3I5HC 1CFDA 2ZNDA 1M39A 3CR5X 1C7WA 5FI2A 1WRZA 3DXLA 2NCPA 1BR1B 4WRIA 1TRFA 4PE1A 3RM1A 1PVBA 3KF9A 3BYAA 2BCAA 2ISDA 1S3PA 4M2PA 4INXA 2M1UA 1XO5A 2Q91A 3FE8A 3FWCA 1IGVA 3BOWA 1KSOA 2P6BB 1LA3A 1ZUZA 2JZIA 1C07A 2ZN8A 1QX2A 4MLWA 2BCXA 4U8DA 1YUTA 1ZOTB 1JSAA 1NP8A 1QIVA 2L2EA 1EH2A 2H8VA 2JQ6A 1BG1A 2JXLA 3O6BA 1DEKA 5HLVA 5I8NA 3R1PA 4MN0A 2KQ6A 1NX2A 1QS7A 1B8LA 1LKJA 5AXIA 2JRFA 1FF1A 4ZCUA 4HSZA 5FI6A 3R1OA 3S0EA 2LANA 1BU3A 1KK8C 2OPOA 3DF0B 1AJ4A 1RWYA 1F71A 2KDHA 1DGVA 2KYCA 1E8AA 2KI4C 2M0RA 2SCPA 2KGBC 3S0GA 1H8BA 3V2LA 2PRUA 1AHRA 5D69A 1IRJA 2JT0A 2LLSA 3CZ0A 1OOFA 1CMGA 3EVUA 4DRWA 1J7PA 4NDDA 1BF5A 3LK0A 3OB1B 1EL4A 4OCIA 1NCYA 3TZ1A 2BKIB 2Y4QA 2M1KB 1S26D 3SG7A 1QWVA 3BOWB 3OX5A 1B9AA 4YGBB 1F54A 1GM0A 3FS7A 3ZWHA 2KHNA 1SMGA 1R6PA 2WCBA 4I5NB 2LMUA 2PASA 5DICA 1B7TZ 3I5IC 5HL1A 1ZFSA 4MSPA 5AEQA 1NYAA 2LVIA 3TUYC 1C7VA 4PE4A 1TNXA 4TNCA 5IBWA 1AJ5A 1AUIB 1KQMB 1SW8A 1K8UA 1PSRA 2PALA 1IWQA 2KLEA 1AP4A 5I2OA 1IQ5A 1J7QA 3PN7B 2JOJA 2LLUA 2LE9B 3EK8A 4MZLA 2KBMA 1UHJA 2WCFA 2Y1NA 3KHEA 1SRAA 3N7HA 4JD9A 1ALVA 1L7ZA 2LHLA 4YGAA 3TS5C 1CDMA 3E3RA 1CFCA 4MVFA 1SCMB 4GBAA 4QJ3B 3EVRA 2K7OA 2L2CA 2WNDA 1DT7B 1R2UA 4FQTA 4ETOA 5CSJA 1SR6B 1Y6WA 2BAPA 4OR9B 3NGVA 4INWA 1QV1A 1CNPA 4JQ0D 1Z4HA 3I5FC 2O60A 2RGIA 3CZ2A 2I18A 4PHJA 3NSKA 3WHUB 1J7OA 2JTZA 1PULA 1K93D 3FE9A 3PATA 2KQYA 3CABA 2KAXA 2R2IA 2NZ0A 3FE6A 1IJ6A 1XFVO 3NXAA 3IQQA 1XFXO 3BUOB 3CZ1A 1UHNA 1M46A 3BJHA 3OGNA 1TUZA 1S6JA 2F3YA 1YX8A 1QLKA 1KK7Z 1WRLA 3KPXA 5F6TA 3L47A 4JWQA 3B6XA 1MHOA 1CDLA 2CXJA 3H4SE 4HRGA 1WRKA 2TN4A 5HKYA 3CLNA 2JPTA 3I5HB 1QVIY 2F3ZA
chains in the Genus database with same CATH topology
1GGWA 2MAZA 4YI8A 2NXQA 4CFQA 1QJTA 2WCEA 1DTLA 2NCOA 1WLMA 1CFPA 1SBJA 1CM1A 1K9KA 1J7RA 1S5GZ 3AAKA 4OKHA 4C0LA 5JOLA 1BT6A 1PK0D 1EJ3A 4PALA 3EK7A 1TCFA 2L4HA 1KFXS 5CSNA 2CCMA 4WQ2A 1UWOA 3SG6A 1K90D 1GQMA 3PALA 1CFFA 1F70A 2K7CA 2M3WA 1JFKA 3LLEA 4MEWA 3VRNA 1MR8A 1CM4A 2LCPA 4DCKA 3OHMB 2HQ8A 3WHTB 4GAOA 1CDPA 2G9BA 1KK8B 2I7AA 4USLA 3QRXA 4GGFA 1XFYO 1X02A 1VRKA 2KI4B 2LM5A 3VRRA 1J1DA 2HF5A 1B4CA 2MLFC 1MF8B 1NCXA 1M63B 1WDCC 1QASA 2LP2A 1DJHA 5ER5A 1Y1XA 5KU1A 5KTYA 3I5GC 1RTP1 2BL0B 1PRWA 2LHIA 3DVEA 1WLZA 1QX7A 1XFWO 4HRHA 4ORBB 2FCEA 4DUQA 2LVKA 3I5IB 1LA0A 1LVCD 1JC2A 5BPJA 2MA2A 2IS9A 3TUYB 3DVJA 3EVVA 1CTRA 2KSPA 3SG3A 1D1OA 1KFUL 4D1EA 1JF0A 1KQVA 1JFJA 1DJXA 3HCMA 3AKBA 1DJGA 5KSZA 2OTGC 2QPTA 4ORAB 3D10A 2CT9A 3CS1A 1TN4A 3SG4A 2LNKA 4CFRA 1CKKA 1S6CA 4ICBA 5DKNA 2BL0C 1OE9B 2KAVA 4QJ4B 3K21A 3TS5B 3A4UB 4FTGA 5PALA 3VROA 1W7JB 1QLSA 1BMOA 1KSMA 1JWDA 1DJZA 4PHKA 4YI9A 3F45A 3WNXB 1A75A 1SK6D 1A2XA 3AKAA 1QXPA 4OVNF 1EG4A 2LMVA 3BUWB 3IQOA 3PM8A 1NIWA 1KFXL 1NCZA 1YVHA 4WQ3A 2M7LA 3I5FB 2B1UA 2WORA 1TTXA 2AUCA 1UHIA 1NUBA 2KFGA 4YBHB 3LL8B 3JTDC 2JXCA 2MBXA 4GGFC 2CTNA 5K89A 3EKJA 2BCBA 3ZNIA 1MXLC 3OX6A 1NX0A 1OSAA 1F55A 2L5XB 1QV0A 4PHMA 2COLB 2JNFA 4ORCB 2LC5A 1FI5A 1XK4C 2WOSA 3SG2A 1F4QA 4N5XA 2QACA 2K7BA 2K7DA 2KFFA 4AOMA 1AK8A 2M9GA 2K2FA 4YGEB 1JF2A 4FQOA 1PSBA 3D0YA 3A8RA 3SG5A 1TNQA 1DVIA 1YRTB 2BE4A 2JC2A 4R1EA 2CBLA 5DKRA 1A75B 1RK9A 3BQ3A 2LV7A 5ER4X 2JT8A 4AQIA 2JU0A 1Y0VH 1TCOB 5AANA 4PDZA 1KFUS 1BR4B 2MLEC 5G08A 3TDZA 2FJUB 3DVMA 1CLMA 1LINA 2M7NA 3BUMB 3CTNA 2KBIA 1F8HA 3DD4A 2BBNA 2MHHA 1HQVA 1YR5A 2KNEA 2F33A 1OZOA 1TNPA 2A4JA 2LAPA 4M2OA 1B7TY 3CZTX 3O2PA 1FBVA 5HKWA 5CPVA 2AAOA 4ZCVA 1GJYA 1YUSA 1CLLA 1K9UA 1S6IA 1SKTA 2H2KA 1MWNA 4NQGA 1ZACA 3WXAA 4GUKA 1M45A 1WDCB 3LK1A 1SL7A 2WC8A 2M49B 1DJYA 2BBMA 2G2BA 2HQWA 3D0YB 2ZRSA 4N1FA 4MRXA 3SIBA 2E6WA 4JPZB 3I5GB 5FYXA 1MXEA 3RLZA 2ZKMX 3BXKA 3VGOA 4IL1A 1B8CA 1YX7A 3M0WA 4CLNA 1Q80A 2PMYA 2H61C 5DKQA 3LCPC 1S36A 4MZKA 3CGAA 2EGDA 2L0PA 3GK2A 4NDCA 4PE7A 2V53A 1EXRA 1N0YA 2LLTA 4GNKB 1CDNA 4HREE 3FIAA 2FCDA 1DF0A 2ZNEA 2M29A 1IKUA 1B8RA 2OTGB 3EK4A 1G4YR 5CSFA 1DMOA 1UP5A 4AQJA 1XK4A 2KYFA 1K94A 1KK7Y 5I2LA 2GV5A 1XVJA 2ZN9A 3VRPA 1KWOC 4MZJA 1UHHA 1K95A 2F2PA 1A29A 2ZFDA 2JWWA 2LUXA 1BLQA 1K96A 2K2AA 2L98A 1XYDA 3O4YA 2EC6C 1G33A 4L9MA 2EHBA 4E68A 1W7IB 1U5IA 2L4IA 3JVTC 1NWDA 2AMIA 2F2OA 3SIAA 3NSIA 1OQPA 1S5GY 1H4BA 1S1EA 2I94A 3JTDB 1TOPA 1SY9A 5TNCA 1OZSA 4I5JA 5AFPA 1OMRA 5HYDA 1NX3A 4XJKA 2L51A 2JULA 3PFVA 5JJGA 1DF0B 2JT3A 4I5KA 5HKZA 1QTXA 1SL9A 1BODA 4C0JA 3KO0A 2L50A 1OMDA 2I2RE 2PVBA 1A03A 2D8NA 3PLFB 4NDBA 1NPQA 1N2DA 2MJWB 2ZRTA 4DIRA 3DVKA 4F0ZB 4BY5A 2E30A 4OV2A 2KI6D 2LMTA 3VRQA 1WY9A 2KOTA 2KI6C 1J55A 1OOJA 3ICBA 3PSRA 1A4PA 1U5IB 4MRYA 4I5LB 5HLOA 2H61A 4YGCB 1DJWA 2F8PA 3OP0A 1K9PA 1RROA 1YVLA 1QVIZ 5GQQC 1G8IA 4CIDA 4N1GA 4PCWA 2LVJA 3C1VA 2Q4UA 2Y1MA 1HT9A 2Y5IA 2BE6A 1SL8A 2KFHA 1XFUO 4YGDB 1RJVA 4GGNA 1IG5A 1PALA 3NSLA 1SPYA 1M31A 1PVAA 1IQ3A 1SCVA 1UUSA 4XJKB 2KAYA 3GK4X 2LVVA 4MBEA 3CR4X 1N65A 3HX4A 1UHKA 1XFZO 4PHNA 4XYNA 2MRDA 4CPVA 1K2HA 1DGUA 2K8MB 1MUXA 2NLNA 2M97A 3GOFA 1B47A 1YTZC 3O78A 5D7FA 2GGMA 5AERA 3BUNB 1NX1A 5B8IB 3NSOA 4BY4A 2JTTA 1BOCA 1TNWA 1AVSA 1MQ1A 1ODBA 1TIZA 3KEVA 1KQMC 1XA5A 2OS8B 1L2OB 1FW4A 4C0KA 2BKHB 5CSIA 4UPGA 1BJFA 3PN7C 3TDUA 1JBAA 1CB1A 2VRGA 4P5OE 1YURA 2HETA 4PE0A 1SNLA 3CWGA 1V1FA 4DS7A 2HPSA 3FWBA 4M2QA 2KGRA 1QATA 1RECA 4GFTA 1SCMC 3CR2A 2K61A 1JUOA 2PSRA 3EKHA 1IJ5A 1DJIA 2BECA 1QX5B 1ZMZA 2M8UA 2GGZA 3OB2B 1CMFA 1SR6C 1QIWA 5I2QA 4QJ5B 1FI6A 2OS8C 1V1GA 3AAJA 3BUXB 1L2OC 1J1EA 1KWOB 3IF7A 4A4BA 1CLBA 1KCYA 1NSHA 1UURA 5J3XA 2DOQA 3TDIA 1OMVA 4A4CA 1FPWA 1RFJA 1LXFC 2JNXA 1YRUB 2EC6B 4P2YB 1B1GA 1IH0A 2LUCA 2O5GA 3JVTB 2FOTA 1GGZA 3MSEB 1F4OA 1SYMA 4GPLB 3DF0A 1Y1AA 1EG3A 1YUUA 2K0JA 2SASA 3GK1A 1Y1UA 2LP3A 3SJSA 1ALWA 4YRUA 4Q04A 2CNPA 3I5HC 1CFDA 2ZNDA 1M39A 3CR5X 1C7WA 1WRZA 2NCPA 1BR1B 4WRIA 1TRFA 4PE1A 3RM1A 1PVBA 3KF9A 3BYAA 2BCAA 2ISDA 1S3PA 4M2PA 2M1UA 1XO5A 2Q91A 3FWCA 1IGVA 3BOWA 1KSOA 2P6BB 1LA3A 1ZUZA 2JZIA 1C07A 2ZN8A 1QX2A 4MLWA 2BCXA 4U8DA 1YUTA 1ZOTB 1JSAA 1NP8A 1QIVA 2L2EA 1EH2A 2JQ6A 1BG1A 2JXLA 3O6BA 5HLVA 5I8NA 4MN0A 2KQ6A 1NX2A 1QS7A 1B8LA 1LKJA 5AXIA 2JRFA 1FF1A 4ZCUA 4HSZA 2LANA 1BU3A 1KK8C 2OPOA 3DF0B 1AJ4A 1RWYA 1F71A 2KDHA 1DGVA 2KYCA 1E8AA 2KI4C 2M0RA 2SCPA 2KGBC 1H8BA 2PRUA 1AHRA 5D69A 1IRJA 2JT0A 2LLSA 1CMGA 3EVUA 4DRWA 1J7PA 4NDDA 1BF5A 3LK0A 3OB1B 1EL4A 4OCIA 1NCYA 3TZ1A 2BKIB 2Y4QA 2M1KB 1S26D 3SG7A 3BOWB 3OX5A 1F54A 1B9AA 4YGBB 3FS7A 3ZWHA 2KHNA 1SMGA 1R6PA 2WCBA 4I5NB 2LMUA 2PASA 1B7TZ 3I5IC 1ZFSA 4MSPA 5AEQA 1NYAA 2LVIA 3TUYC 1C7VA 4PE4A 1TNXA 4TNCA 5IBWA 1AJ5A 1AUIB 1KQMB 1SW8A 1K8UA 1PSRA 2PALA 1IWQA 1AP4A 5I2OA 1IQ5A 1J7QA 3PN7B 2JOJA 2LLUA 2LE9B 3EK8A 4MZLA 2KBMA 1UHJA 2WCFA 2Y1NA 3KHEA 1SRAA 1ALVA 1L7ZA 2LHLA 4YGAA 3TS5C 1CDMA 3E3RA 1CFCA 4MVFA 1SCMB 4GBAA 4QJ3B 3EVRA 2K7OA 2WNDA 1DT7B 1R2UA 4ETOA 5CSJA 1SR6B 1Y6WA 4OR9B 1QV1A 1CNPA 4JQ0D 3I5FC 2O60A 2RGIA 4PHJA 2I18A 3WHUB 3NSKA 1J7OA 2JTZA 1PULA 1K93D 3PATA 2KQYA 2KAXA 2R2IA 2NZ0A 1IJ6A 1XFVO 3NXAA 3IQQA 1XFXO 3BUOB 1UHNA 1M46A 2F3YA 1S6JA 5F6TA 1YX8A 1QLKA 1KK7Z 1WRLA 3KPXA 4JWQA 1MHOA 1CDLA 2CXJA 3H4SE 4HRGA 1WRKA 2TN4A 5HKYA 3CLNA 2JPTA 3I5HB 1QVIY 2F3ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GGW A;  2MAZ A;  4YI8 A;  2NXQ A;  4CFQ A;  1QJT A;  2WCE A;  1DTL A;  2NCO A;  1WLM A;  1CFP A;  1SBJ A;  1CM1 A;  1K9K A;  1J7R A;  1S5G Z;  3AAK A;  4OKH A;  4C0L A;  5JOL A;  1BT6 A;  1PK0 D;  1EJ3 A;  4PAL A;  3EK7 A;  1TCF A;  2L4H A;  1KFX S;  5CSN A;  2CCM A;  4WQ2 A;  1UWO A;  3SG6 A;  1K90 D;  1GQM A;  3PAL A;  1CFF A;  1F70 A;  2K7C A;  2M3W A;  1JFK A;  3LLE A;  4MEW A;  3VRN A;  1MR8 A;  1CM4 A;  2LCP A;  4DCK A;  3OHM B;  2HQ8 A;  3WHT B;  4GAO A;  1CDP A;  2G9B A;  1KK8 B;  2I7A A;  4USL A;  3QRX A;  4GGF A;  1XFY O;  1X02 A;  1VRK A;  2KI4 B;  2LM5 A;  3VRR A;  1J1D A;  2HF5 A;  1B4C A;  2MLF C;  1MF8 B;  1NCX A;  1M63 B;  1WDC C;  1QAS A;  2LP2 A;  1DJH A;  5ER5 A;  1Y1X A;  5KU1 A;  5KTY A;  3I5G C;  1RTP 1;  2BL0 B;  1PRW A;  2LHI A;  3DVE A;  1WLZ A;  1QX7 A;  1XFW O;  4HRH A;  4ORB B;  2FCE A;  4DUQ A;  2LVK A;  3I5I B;  1LA0 A;  1LVC D;  1JC2 A;  5BPJ A;  2MA2 A;  2IS9 A;  3TUY B;  3DVJ A;  3EVV A;  1CTR A;  2KSP A;  3SG3 A;  1D1O A;  1KFU L;  4D1E A;  1JF0 A;  1KQV A;  1JFJ A;  1DJX A;  3HCM A;  3AKB A;  1DJG A;  5KSZ A;  2OTG C;  2QPT A;  4ORA B;  3D10 A;  2CT9 A;  3CS1 A;  1TN4 A;  3SG4 A;  2LNK A;  4CFR A;  1CKK A;  1S6C A;  4ICB A;  5DKN A;  2BL0 C;  1OE9 B;  2KAV A;  4QJ4 B;  3K21 A;  3TS5 B;  3A4U B;  4FTG A;  5PAL A;  3VRO A;  1W7J B;  1QLS A;  1BMO A;  1KSM A;  1JWD A;  1DJZ A;  4PHK A;  4YI9 A;  3F45 A;  3WNX B;  1A75 A;  1SK6 D;  1A2X A;  3AKA A;  1QXP A;  4OVN F;  1EG4 A;  2LMV A;  3BUW B;  3IQO A;  3PM8 A;  1NIW A;  1KFX L;  1NCZ A;  1YVH A;  4WQ3 A;  2M7L A;  3I5F B;  2B1U A;  2WOR A;  1TTX A;  2AUC A;  1UHI A;  1NUB A;  2KFG A;  4YBH B;  3LL8 B;  3JTD C;  2JXC A;  2MBX A;  4GGF C;  2CTN A;  5K89 A;  3EKJ A;  2BCB A;  3ZNI A;  1MXL C;  3OX6 A;  1NX0 A;  1OSA A;  1F55 A;  2L5X B;  1QV0 A;  4PHM A;  2COL B;  2JNF A;  4ORC B;  2LC5 A;  1FI5 A;  1XK4 C;  2WOS A;  3SG2 A;  1F4Q A;  4N5X A;  2QAC A;  2K7B A;  2K7D A;  2KFF A;  4AOM A;  1AK8 A;  2M9G A;  2K2F A;  4YGE B;  1JF2 A;  4FQO A;  1PSB A;  3D0Y A;  3A8R A;  3SG5 A;  1TNQ A;  1DVI A;  1YRT B;  2BE4 A;  2JC2 A;  4R1E A;  2CBL A;  5DKR A;  1A75 B;  1RK9 A;  3BQ3 A;  2LV7 A;  5ER4 X;  2JT8 A;  4AQI A;  2JU0 A;  1Y0V H;  1TCO B;  5AAN A;  4PDZ A;  1KFU S;  1BR4 B;  2MLE C;  5G08 A;  3TDZ A;  2FJU B;  3DVM A;  1CLM A;  1LIN A;  2M7N A;  3BUM B;  3CTN A;  2KBI A;  1F8H A;  3DD4 A;  2BBN A;  2MHH A;  1HQV A;  1YR5 A;  2KNE A;  2F33 A;  1OZO A;  1TNP A;  2A4J A;  2LAP A;  4M2O A;  1B7T Y;  3CZT X;  3O2P A;  1FBV A;  5HKW A;  5CPV A;  2AAO A;  4ZCV A;  1GJY A;  1YUS A;  1CLL A;  1K9U A;  1S6I A;  1SKT A;  2H2K A;  1MWN A;  4NQG A;  1ZAC A;  3WXA A;  4GUK A;  1M45 A;  1WDC B;  3LK1 A;  1SL7 A;  2WC8 A;  2M49 B;  1DJY A;  2BBM A;  2G2B A;  2HQW A;  3D0Y B;  2ZRS A;  4N1F A;  4MRX A;  3SIB A;  2E6W A;  4JPZ B;  3I5G B;  5FYX A;  1MXE A;  3RLZ A;  2ZKM X;  3BXK A;  3VGO A;  4IL1 A;  1B8C A;  1YX7 A;  3M0W A;  4CLN A;  1Q80 A;  2PMY A;  2H61 C;  5DKQ A;  3LCP C;  1S36 A;  4MZK A;  3CGA A;  2EGD A;  2L0P A;  3GK2 A;  4NDC A;  4PE7 A;  2V53 A;  1EXR A;  1N0Y A;  2LLT A;  4GNK B;  1CDN A;  4HRE E;  3FIA A;  2FCD A;  1DF0 A;  2ZNE A;  2M29 A;  1IKU A;  1B8R A;  2OTG B;  3EK4 A;  1G4Y R;  5CSF A;  1DMO A;  1UP5 A;  4AQJ A;  1XK4 A;  2KYF A;  1K94 A;  1KK7 Y;  5I2L A;  2GV5 A;  1XVJ A;  2ZN9 A;  3VRP A;  1KWO C;  4MZJ A;  1UHH A;  1K95 A;  2F2P A;  1A29 A;  2ZFD A;  2JWW A;  2LUX A;  1BLQ A;  1K96 A;  2K2A A;  2L98 A;  1XYD A;  3O4Y A;  2EC6 C;  1G33 A;  4L9M A;  2EHB A;  4E68 A;  1W7I B;  1U5I A;  2L4I A;  3JVT C;  1NWD A;  2AMI A;  2F2O A;  3SIA A;  3NSI A;  1OQP A;  1S5G Y;  1H4B A;  1S1E A;  2I94 A;  3JTD B;  1TOP A;  1SY9 A;  5TNC A;  1OZS A;  4I5J A;  5AFP A;  1OMR A;  5HYD A;  1NX3 A;  4XJK A;  2L51 A;  2JUL A;  3PFV A;  5JJG A;  1DF0 B;  2JT3 A;  4I5K A;  5HKZ A;  1QTX A;  1SL9 A;  1BOD A;  4C0J A;  3KO0 A;  2L50 A;  1OMD A;  2I2R E;  2PVB A;  1A03 A;  2D8N A;  3PLF B;  4NDB A;  1NPQ A;  1N2D A;  2MJW B;  2ZRT A;  4DIR A;  3DVK A;  4F0Z B;  4BY5 A;  2E30 A;  4OV2 A;  2KI6 D;  2LMT A;  3VRQ A;  1WY9 A;  2KOT A;  2KI6 C;  1J55 A;  1OOJ A;  3ICB A;  3PSR A;  1A4P A;  1U5I B;  4MRY A;  4I5L B;  5HLO A;  2H61 A;  4YGC B;  1DJW A;  2F8P A;  3OP0 A;  1K9P A;  1RRO A;  1YVL A;  1QVI Z;  5GQQ C;  1G8I A;  4CID A;  4N1G A;  4PCW A;  2LVJ A;  3C1V A;  2Q4U A;  2Y1M A;  1HT9 A;  2Y5I A;  2BE6 A;  1SL8 A;  2KFH A;  1XFU O;  4YGD B;  1RJV A;  4GGN A;  1IG5 A;  1PAL A;  3NSL A;  1SPY A;  1M31 A;  1PVA A;  1IQ3 A;  1SCV A;  1UUS A;  4XJK B;  2KAY A;  3GK4 X;  2LVV A;  4MBE A;  3CR4 X;  1N65 A;  3HX4 A;  1UHK A;  1XFZ O;  4PHN A;  4XYN A;  2MRD A;  4CPV A;  1K2H A;  1DGU A;  2K8M B;  1MUX A;  2NLN A;  2M97 A;  3GOF A;  1B47 A;  1YTZ C;  3O78 A;  5D7F A;  2GGM A;  5AER A;  3BUN B;  1NX1 A;  5B8I B;  3NSO A;  4BY4 A;  2JTT A;  1BOC A;  1TNW A;  1AVS A;  1MQ1 A;  1ODB A;  1TIZ A;  3KEV A;  1KQM C;  1XA5 A;  2OS8 B;  1L2O B;  1FW4 A;  4C0K A;  2BKH B;  5CSI A;  4UPG A;  1BJF A;  3PN7 C;  3TDU A;  1JBA A;  1CB1 A;  2VRG A;  4P5O E;  1YUR A;  2HET A;  4PE0 A;  1SNL A;  3CWG A;  1V1F A;  4DS7 A;  2HPS A;  3FWB A;  4M2Q A;  2KGR A;  1QAT A;  1REC A;  4GFT A;  1SCM C;  3CR2 A;  2K61 A;  1JUO A;  2PSR A;  3EKH A;  1IJ5 A;  1DJI A;  2BEC A;  1QX5 B;  1ZMZ A;  2M8U A;  2GGZ A;  3OB2 B;  1CMF A;  1SR6 C;  1QIW A;  5I2Q A;  4QJ5 B;  1FI6 A;  2OS8 C;  1V1G A;  3AAJ A;  3BUX B;  1L2O C;  1J1E A;  1KWO B;  3IF7 A;  4A4B A;  1CLB A;  1KCY A;  1NSH A;  1UUR A;  5J3X A;  2DOQ A;  3TDI A;  1OMV A;  4A4C A;  1FPW A;  1RFJ A;  1LXF C;  2JNX A;  1YRU B;  2EC6 B;  4P2Y B;  1B1G A;  1IH0 A;  2LUC A;  2O5G A;  3JVT B;  2FOT A;  1GGZ A;  3MSE B;  1F4O A;  1SYM A;  4GPL B;  3DF0 A;  1Y1A A;  1EG3 A;  1YUU A;  2K0J A;  2SAS A;  3GK1 A;  1Y1U A;  2LP3 A;  3SJS A;  1ALW A;  4YRU A;  4Q04 A;  2CNP A;  3I5H C;  1CFD A;  2ZND A;  1M39 A;  3CR5 X;  1C7W A;  1WRZ A;  2NCP A;  1BR1 B;  4WRI A;  1TRF A;  4PE1 A;  3RM1 A;  1PVB A;  3KF9 A;  3BYA A;  2BCA A;  2ISD A;  1S3P A;  4M2P A;  2M1U A;  1XO5 A;  2Q91 A;  3FWC A;  1IGV A;  3BOW A;  1KSO A;  2P6B B;  1LA3 A;  1ZUZ A;  2JZI A;  1C07 A;  2ZN8 A;  1QX2 A;  4MLW A;  2BCX A;  4U8D A;  1YUT A;  1ZOT B;  1JSA A;  1NP8 A;  1QIV A;  2L2E A;  1EH2 A;  2JQ6 A;  1BG1 A;  2JXL A;  3O6B A;  5HLV A;  5I8N A;  4MN0 A;  2KQ6 A;  1NX2 A;  1QS7 A;  1B8L A;  1LKJ A;  5AXI A;  2JRF A;  1FF1 A;  4ZCU A;  4HSZ A;  2LAN A;  1BU3 A;  1KK8 C;  2OPO A;  3DF0 B;  1AJ4 A;  1RWY A;  1F71 A;  2KDH A;  1DGV A;  2KYC A;  1E8A A;  2KI4 C;  2M0R A;  2SCP A;  2KGB C;  1H8B A;  2PRU A;  1AHR A;  5D69 A;  1IRJ A;  2JT0 A;  2LLS A;  1CMG A;  3EVU A;  4DRW A;  1J7P A;  4NDD A;  1BF5 A;  3LK0 A;  3OB1 B;  1EL4 A;  4OCI A;  1NCY A;  3TZ1 A;  2BKI B;  2Y4Q A;  2M1K B;  1S26 D;  3SG7 A;  3BOW B;  3OX5 A;  1F54 A;  1B9A A;  4YGB B;  3FS7 A;  3ZWH A;  2KHN A;  1SMG A;  1R6P A;  2WCB A;  4I5N B;  2LMU A;  2PAS A;  1B7T Z;  3I5I C;  1ZFS A;  4MSP A;  5AEQ A;  1NYA A;  2LVI A;  3TUY C;  1C7V A;  4PE4 A;  1TNX A;  4TNC A;  5IBW A;  1AJ5 A;  1AUI B;  1KQM B;  1SW8 A;  1K8U A;  1PSR A;  2PAL A;  1IWQ A;  1AP4 A;  5I2O A;  1IQ5 A;  1J7Q A;  3PN7 B;  2JOJ A;  2LLU A;  2LE9 B;  3EK8 A;  4MZL A;  2KBM A;  1UHJ A;  2WCF A;  2Y1N A;  3KHE A;  1SRA A;  1ALV A;  1L7Z A;  2LHL A;  4YGA A;  3TS5 C;  1CDM A;  3E3R A;  1CFC A;  4MVF A;  1SCM B;  4GBA A;  4QJ3 B;  3EVR A;  2K7O A;  2WND A;  1DT7 B;  1R2U A;  4ETO A;  5CSJ A;  1SR6 B;  1Y6W A;  4OR9 B;  1QV1 A;  1CNP A;  4JQ0 D;  3I5F C;  2O60 A;  2RGI A;  4PHJ A;  2I18 A;  3WHU B;  3NSK A;  1J7O A;  2JTZ A;  1PUL A;  1K93 D;  3PAT A;  2KQY A;  2KAX A;  2R2I A;  2NZ0 A;  1IJ6 A;  1XFV O;  3NXA A;  3IQQ A;  1XFX O;  3BUO B;  1UHN A;  1M46 A;  2F3Y A;  1S6J A;  5F6T A;  1YX8 A;  1QLK A;  1KK7 Z;  1WRL A;  3KPX A;  4JWQ A;  1MHO A;  1CDL A;  2CXJ A;  3H4S E;  4HRG A;  1WRK A;  2TN4 A;  5HKY A;  3CLN A;  2JPT A;  3I5H B;  1QVI Y;  2F3Z A; 
#chains in the Genus database with same CATH topology
 1GGW A;  2MAZ A;  4YI8 A;  2NXQ A;  3D73 A;  4CFQ A;  1QJT A;  2WCE A;  1DTL A;  2NCO A;  1WLM A;  1CFP A;  2WCK A;  1SBJ A;  1CM1 A;  1K9K A;  1J7R A;  1S5G Z;  3AAK A;  3D74 A;  3D75 A;  3PJI A;  4OKH A;  1OOG A;  4C0L A;  5JOL A;  1BT6 A;  4PT1 A;  1PK0 D;  1EJ3 A;  4PAL A;  3EK7 A;  3PM2 A;  1TCF A;  2ERB A;  1KFX S;  2L4H A;  5CSN A;  3BFA A;  1W9Z A;  2CCM A;  3R72 A;  4WQ2 A;  1UWO A;  3SG6 A;  1K90 D;  1GQM A;  3PAL A;  1CFF A;  1F70 A;  2K7C A;  2M3W A;  1JFK A;  3D76 A;  3LLE A;  4MEW A;  3VRN A;  1MR8 A;  1CM4 A;  2LCP A;  4DCK A;  3D77 A;  3OHM B;  3RZS A;  2HQ8 A;  3WHT B;  4GAO A;  1CDP A;  1T14 A;  2G9B A;  1KK8 B;  2I7A A;  4USL A;  3QRX A;  4GGF A;  1XFY O;  1X02 A;  1VRK A;  2KI4 B;  2LM5 A;  3VRR A;  1J1D A;  2HF5 A;  2QDI A;  3CDN A;  1B4C A;  2MLF C;  1MF8 B;  1NCX A;  1M63 B;  1WDC C;  1QAS A;  2LP2 A;  1DJH A;  5ER5 A;  3DYE A;  1Y1X A;  5KU1 A;  5KTY A;  3I5G C;  1RTP 1;  2BL0 B;  1PRW A;  2LHI A;  2PQL A;  3DVE A;  1WLZ A;  1OW4 A;  5I94 A;  1QX7 A;  1XFW O;  4HRH A;  4ORB B;  2FCE A;  2QEH A;  4DUQ A;  2LVK A;  3I5I B;  1IIO A;  1LA0 A;  1LVC D;  1JC2 A;  5BPJ A;  2MA2 A;  2IS9 A;  3TUY B;  3DVJ A;  3EVV A;  1CTR A;  2KSP A;  3SG3 A;  1D1O A;  1KFU L;  4D1E A;  1JF0 A;  5EL2 A;  2JPO A;  1KQV A;  1JFJ A;  1DJX A;  3HCM A;  3AKB A;  1DJG A;  5KSZ A;  2OTG C;  2QPT A;  4ORA B;  3D10 A;  2CT9 A;  3CS1 A;  1TN4 A;  3SG4 A;  2LNK A;  3B7A A;  4CFR A;  1CKK A;  1S6C A;  4ICB A;  5DKN A;  2BL0 C;  1OE9 B;  1TWO A;  2KAV A;  3K21 A;  4QJ4 B;  3TS5 B;  2FJY A;  3A4U B;  4FTG A;  5PAL A;  3VRO A;  1W7J B;  1QLS A;  1BMO A;  1KSM A;  1JWD A;  1DJZ A;  1P28 A;  4PHK A;  3F45 A;  4YI9 A;  3S0D A;  3WNX B;  1A75 A;  1SK6 D;  1A2X A;  3B87 A;  3UNW A;  3AKA A;  1QXP A;  4OVN F;  1EG4 A;  2LMV A;  3BUW B;  3IQO A;  3PM8 A;  1ORG A;  1NIW A;  1KFX L;  1NCZ A;  1YVH A;  4WQ3 A;  2M7L A;  3UO9 A;  3I5F B;  3S0A A;  2B1U A;  2K60 A;  2PYQ A;  2WOR A;  1TTX A;  2AUC A;  1UHI A;  1NUB A;  2KFG A;  4YBH B;  3LL8 B;  3JTD C;  2JXC A;  2MBX A;  4GGF C;  2CTN A;  5K89 A;  3EKJ A;  2BCB A;  3ZNI A;  1MXL C;  3OX6 A;  1NX0 A;  1OSA A;  1F55 A;  2L5X B;  2WCJ A;  1QV0 A;  4PHM A;  2COL B;  2JNF A;  1DC1 A;  4ORC B;  2LC5 A;  1FI5 A;  1XK4 C;  2WOS A;  3SG2 A;  1F4Q A;  4N5X A;  2QAC A;  2K7B A;  2K7D A;  2KFF A;  4AOM A;  1AK8 A;  2M9G A;  2K2F A;  4YGE B;  1JF2 A;  4FQO A;  1SSE B;  1PSB A;  3D0Y A;  3A8R A;  3SG5 A;  1TNQ A;  1DVI A;  1YRT B;  2BE4 A;  2JC2 A;  4R1E A;  2CBL A;  5DKR A;  1A75 B;  1RK9 A;  2KPH A;  2LV7 A;  3BQ3 A;  5ER4 X;  2JT8 A;  4AQI A;  2JU0 A;  1Y0V H;  1TCO B;  5AAN A;  4PDZ A;  1KFU S;  1BR4 B;  2MLE C;  5G08 A;  3TDZ A;  2FJU B;  1LS8 A;  3DVM A;  1CLM A;  1LIN A;  2M7N A;  3BUM B;  3CTN A;  2KBI A;  1F8H A;  3DD4 A;  2BBN A;  2MHH A;  3IVT A;  1HQV A;  1YR5 A;  2QEO A;  2KNE A;  2F33 A;  1OZO A;  1TNP A;  2A4J A;  2LAP A;  2P70 A;  1B7T Y;  3CZT X;  3O2P A;  1FBV A;  4M2O A;  4KYN A;  5CPV A;  2AAO A;  4ZCV A;  1GJY A;  1YUS A;  1CLL A;  1K9U A;  1S6I A;  1SKT A;  2H2K A;  1MWN A;  3QME A;  4NQG A;  1ZAC A;  3WXA A;  2BNX A;  4GUK A;  1M45 A;  2WC5 A;  1WDC B;  3VB1 A;  3LK1 A;  3R1V A;  1SL7 A;  2WC8 A;  2M49 B;  1DJY A;  2BBM A;  2G2B A;  2HQW A;  3D0Y B;  2ZRS A;  4N1F A;  3DZT A;  4MRX A;  2E6W A;  4JPZ B;  3SIB A;  3S0F A;  3I5G B;  5FYX A;  1MXE A;  3RLZ A;  2ZKM X;  3BXK A;  3VGO A;  4IL1 A;  3SS4 A;  1B8C A;  1YX7 A;  3M0W A;  4CLN A;  1Q80 A;  2PMY A;  2H61 C;  5DKQ A;  3LCP C;  1S36 A;  2WC6 A;  4MZK A;  3CGA A;  2EGD A;  2L0P A;  3GK2 A;  4NDC A;  4PE7 A;  3EG5 B;  2V53 A;  1EXR A;  1N0Y A;  2LLT A;  4GNK B;  1CDN A;  4HRE E;  3FIA A;  2FCD A;  1DF0 A;  2ZNE A;  2M29 A;  1IKU A;  1B8R A;  2OTG B;  3EK4 A;  3BFB A;  1G4Y R;  5CSF A;  5HKW A;  1DMO A;  1UP5 A;  4AQJ A;  1XK4 A;  2KYF A;  1K94 A;  1KK7 Y;  5I2L A;  2GV5 A;  1XVJ A;  2ZN9 A;  3VRP A;  1KWO C;  2QEV A;  4MZJ A;  1UHH A;  1K95 A;  2F2P A;  1A29 A;  2ZFD A;  2JWW A;  2LUX A;  1BLQ A;  1K96 A;  2K2A A;  2L98 A;  1XYD A;  4F7F A;  2WCM A;  3O4Y A;  2EC6 C;  1G33 A;  4L9M A;  2EHB A;  4E68 A;  1W7I B;  1U5I A;  3OBV A;  2L4I A;  3JVT C;  1NWD A;  2AMI A;  2F2O A;  3SIA A;  3NSI A;  1OQP A;  1S5G Y;  1H4B A;  1Z2C B;  1S1E A;  2I94 A;  3JTD B;  1TOP A;  1SY9 A;  5TNC A;  2YGU A;  1OZS A;  4I5J A;  5AFP A;  1OMR A;  3B86 A;  1C3Y A;  5HYD A;  1NX3 A;  4XJK A;  2L51 A;  2JUL A;  3PFV A;  5JJG A;  1DF0 B;  5D3O A;  2JT3 A;  2GTE A;  3Q8I A;  3NHT A;  4I5K A;  5HKZ A;  1TUJ A;  2P71 A;  1DQE A;  1QTX A;  1SL9 A;  4C0J A;  1BOD A;  3KO0 A;  2L50 A;  2KLD A;  1OMD A;  2WCL A;  2I2R E;  2PVB A;  1A03 A;  2D8N A;  3PLF B;  3K1E A;  4NDB A;  1NPQ A;  1N2D A;  2MJW B;  2ZRT A;  4DIR A;  3DVK A;  4F0Z B;  4BY5 A;  2E30 A;  4OV2 A;  2KI6 D;  2LMT A;  2WCH A;  3O4X A;  1WY9 A;  3VRQ A;  2KOT A;  2KI6 C;  1J55 A;  1OOJ A;  3ICB A;  3PSR A;  1A4P A;  1U5I B;  4MRY A;  4I5L B;  5HLO A;  2H61 A;  4YGC B;  1DJW A;  2F8P A;  3OP0 A;  1K9P A;  1RRO A;  1YVL A;  1QVI Z;  5GQQ C;  1G8I A;  4CID A;  4N1G A;  4PCW A;  2LVJ A;  3C1V A;  2Q4U A;  2Y1M A;  1HT9 A;  2Y5I A;  2BE6 A;  3SS3 A;  1SL8 A;  2KFH A;  1XFU O;  4JKT A;  4YGD B;  1RJV A;  4GGN A;  1IG5 A;  1PAL A;  3NSL A;  1SPY A;  1M31 A;  1PVA A;  3NHI A;  1IQ3 A;  1SCV A;  1UUS A;  1XFR A;  4XJK B;  2KAY A;  3GK4 X;  2LVV A;  4MBE A;  3BFH A;  3CR4 X;  1N65 A;  3HX4 A;  3B88 A;  1UHK A;  1XFZ O;  4PHN A;  4XYN A;  2MRD A;  4CPV A;  1K2H A;  1DGU A;  2K8M B;  1MUX A;  2NLN A;  2M97 A;  3GOF A;  1B47 A;  1YTZ C;  3O78 A;  5D7F A;  2GGM A;  4OZD A;  5AER A;  3BUN B;  1NX1 A;  5B8I B;  3NSO A;  4BY4 A;  2JTT A;  1BOC A;  1TNW A;  1AVS A;  2L5Y A;  1MQ1 A;  1ODB A;  1TIZ A;  3KEV A;  1KQM C;  1XA5 A;  2OS8 B;  4IJ7 A;  1L2O B;  1FW4 A;  4C0K A;  2BKH B;  5CSI A;  4UPG A;  5FI7 A;  1BJF A;  3PN7 C;  3TDU A;  1JBA A;  1CB1 A;  2VRG A;  4P5O E;  1YUR A;  2HET A;  4PE0 A;  1SNL A;  3CWG A;  1V1F A;  4DS7 A;  2HPS A;  3FWB A;  4M2Q A;  2KGR A;  1QAT A;  1REC A;  4GFT A;  1SCM C;  3DY9 A;  3CR2 A;  2K61 A;  1JUO A;  2PSR A;  3EKH A;  3SS5 A;  1IJ5 A;  1DJI A;  2BEC A;  1QX5 B;  1ZMZ A;  1C3Z A;  3D78 A;  2M8U A;  2GGZ A;  3OB2 B;  1CMF A;  1SR6 C;  1QIW A;  5I2Q A;  4QJ5 B;  1FI6 A;  2OS8 C;  1V1G A;  3AAJ A;  3BUX B;  3S0B A;  1L2O C;  1J1E A;  3L4A A;  1KWO B;  3IF7 A;  4A4B A;  1CLB A;  1KCY A;  1NSH A;  1UUR A;  5J3X A;  1OOH A;  1OOI X;  2DOQ A;  3TDI A;  1OMV A;  4A4C A;  1FPW A;  1RFJ A;  1LXF C;  2JNX A;  1DEL A;  1YRU B;  2EC6 B;  4P2Y B;  1B1G A;  1IH0 A;  2LUC A;  2O5G A;  2QEB A;  2FOT A;  1GGZ A;  3CYZ A;  3JVT B;  3MSE B;  1F4O A;  1SYM A;  4GPL B;  3DF0 A;  3L4L A;  1Y1A A;  1EG3 A;  1YUU A;  2K0J A;  2SAS A;  3GK1 A;  1Y1U A;  2LP3 A;  3SJS A;  1ALW A;  4YRU A;  4Q04 A;  2CNP A;  3I5H C;  1CFD A;  2ZND A;  1M39 A;  3CR5 X;  1C7W A;  5FI2 A;  1WRZ A;  3DXL A;  2NCP A;  1BR1 B;  4WRI A;  1TRF A;  4PE1 A;  3RM1 A;  1PVB A;  3KF9 A;  3BYA A;  2BCA A;  2ISD A;  1S3P A;  4M2P A;  4INX A;  2M1U A;  1XO5 A;  2Q91 A;  3FE8 A;  3FWC A;  1IGV A;  3BOW A;  1KSO A;  2P6B B;  1LA3 A;  1ZUZ A;  2JZI A;  1C07 A;  2ZN8 A;  1QX2 A;  4MLW A;  2BCX A;  4U8D A;  1YUT A;  1ZOT B;  1JSA A;  1NP8 A;  1QIV A;  2L2E A;  1EH2 A;  2H8V A;  2JQ6 A;  1BG1 A;  2JXL A;  3O6B A;  1DEK A;  5HLV A;  5I8N A;  3R1P A;  4MN0 A;  2KQ6 A;  1NX2 A;  1QS7 A;  1B8L A;  1LKJ A;  5AXI A;  2JRF A;  1FF1 A;  4ZCU A;  4HSZ A;  5FI6 A;  3R1O A;  3S0E A;  2LAN A;  1BU3 A;  1KK8 C;  2OPO A;  3DF0 B;  1AJ4 A;  1RWY A;  1F71 A;  2KDH A;  1DGV A;  2KYC A;  1E8A A;  2KI4 C;  2M0R A;  2SCP A;  2KGB C;  3S0G A;  1H8B A;  3V2L A;  2PRU A;  1AHR A;  5D69 A;  1IRJ A;  2JT0 A;  2LLS A;  3CZ0 A;  1OOF A;  1CMG A;  3EVU A;  4DRW A;  1J7P A;  4NDD A;  1BF5 A;  3LK0 A;  3OB1 B;  1EL4 A;  4OCI A;  1NCY A;  3TZ1 A;  2BKI B;  2Y4Q A;  2M1K B;  1S26 D;  3SG7 A;  1QWV A;  3BOW B;  3OX5 A;  1B9A A;  4YGB B;  1F54 A;  1GM0 A;  3FS7 A;  3ZWH A;  2KHN A;  1SMG A;  1R6P A;  2WCB A;  4I5N B;  2LMU A;  2PAS A;  5DIC A;  1B7T Z;  3I5I C;  5HL1 A;  1ZFS A;  4MSP A;  5AEQ A;  1NYA A;  2LVI A;  3TUY C;  1C7V A;  4PE4 A;  1TNX A;  4TNC A;  5IBW A;  1AJ5 A;  1AUI B;  1KQM B;  1SW8 A;  1K8U A;  1PSR A;  2PAL A;  1IWQ A;  2KLE A;  1AP4 A;  5I2O A;  1IQ5 A;  1J7Q A;  3PN7 B;  2JOJ A;  2LLU A;  2LE9 B;  3EK8 A;  4MZL A;  2KBM A;  1UHJ A;  2WCF A;  2Y1N A;  3KHE A;  1SRA A;  3N7H A;  4JD9 A;  1ALV A;  1L7Z A;  2LHL A;  4YGA A;  3TS5 C;  1CDM A;  3E3R A;  1CFC A;  4MVF A;  1SCM B;  4GBA A;  4QJ3 B;  3EVR A;  2K7O A;  2L2C A;  2WND A;  1DT7 B;  1R2U A;  4FQT A;  4ETO A;  5CSJ A;  1SR6 B;  1Y6W A;  2BAP A;  4OR9 B;  3NGV A;  4INW A;  1QV1 A;  1CNP A;  4JQ0 D;  1Z4H A;  3I5F C;  2O60 A;  2RGI A;  3CZ2 A;  2I18 A;  4PHJ A;  3NSK A;  3WHU B;  1J7O A;  2JTZ A;  1PUL A;  1K93 D;  3FE9 A;  3PAT A;  2KQY A;  3CAB A;  2KAX A;  2R2I A;  2NZ0 A;  3FE6 A;  1IJ6 A;  1XFV O;  3NXA A;  3IQQ A;  1XFX O;  3BUO B;  3CZ1 A;  1UHN A;  1M46 A;  3BJH A;  3OGN A;  1TUZ A;  1S6J A;  2F3Y A;  1YX8 A;  1QLK A;  1KK7 Z;  1WRL A;  3KPX A;  5F6T A;  3L47 A;  4JWQ A;  3B6X A;  1MHO A;  1CDL A;  2CXJ A;  3H4S E;  4HRG A;  1WRK A;  2TN4 A;  5HKY A;  3CLN A;  2JPT A;  3I5H B;  1QVI Y;  2F3Z A; 
#chains in the Genus database with same CATH homology
 1GGW A;  2MAZ A;  4YI8 A;  2NXQ A;  4CFQ A;  1QJT A;  2WCE A;  1DTL A;  2NCO A;  1WLM A;  1CFP A;  1SBJ A;  1CM1 A;  1K9K A;  1J7R A;  1S5G Z;  3AAK A;  4OKH A;  4C0L A;  5JOL A;  1BT6 A;  1PK0 D;  1EJ3 A;  4PAL A;  3EK7 A;  1TCF A;  2L4H A;  1KFX S;  5CSN A;  2CCM A;  4WQ2 A;  1UWO A;  3SG6 A;  1K90 D;  1GQM A;  3PAL A;  1CFF A;  1F70 A;  2K7C A;  2M3W A;  1JFK A;  3LLE A;  4MEW A;  3VRN A;  1MR8 A;  1CM4 A;  2LCP A;  4DCK A;  3OHM B;  2HQ8 A;  3WHT B;  4GAO A;  1CDP A;  2G9B A;  1KK8 B;  2I7A A;  4USL A;  3QRX A;  4GGF A;  1XFY O;  1X02 A;  1VRK A;  2KI4 B;  2LM5 A;  3VRR A;  1J1D A;  2HF5 A;  1B4C A;  2MLF C;  1MF8 B;  1NCX A;  1M63 B;  1WDC C;  1QAS A;  2LP2 A;  1DJH A;  5ER5 A;  1Y1X A;  5KU1 A;  5KTY A;  3I5G C;  1RTP 1;  2BL0 B;  1PRW A;  2LHI A;  3DVE A;  1WLZ A;  1QX7 A;  1XFW O;  4HRH A;  4ORB B;  2FCE A;  4DUQ A;  2LVK A;  3I5I B;  1LA0 A;  1LVC D;  1JC2 A;  5BPJ A;  2MA2 A;  2IS9 A;  3TUY B;  3DVJ A;  3EVV A;  1CTR A;  2KSP A;  3SG3 A;  1D1O A;  1KFU L;  4D1E A;  1JF0 A;  1KQV A;  1JFJ A;  1DJX A;  3HCM A;  3AKB A;  1DJG A;  5KSZ A;  2OTG C;  2QPT A;  4ORA B;  3D10 A;  2CT9 A;  3CS1 A;  1TN4 A;  3SG4 A;  2LNK A;  4CFR A;  1CKK A;  1S6C A;  4ICB A;  5DKN A;  2BL0 C;  1OE9 B;  2KAV A;  4QJ4 B;  3K21 A;  3TS5 B;  3A4U B;  4FTG A;  5PAL A;  3VRO A;  1W7J B;  1QLS A;  1BMO A;  1KSM A;  1JWD A;  1DJZ A;  4PHK A;  4YI9 A;  3F45 A;  3WNX B;  1A75 A;  1SK6 D;  1A2X A;  3AKA A;  1QXP A;  4OVN F;  1EG4 A;  2LMV A;  3BUW B;  3IQO A;  3PM8 A;  1NIW A;  1KFX L;  1NCZ A;  1YVH A;  4WQ3 A;  2M7L A;  3I5F B;  2B1U A;  2WOR A;  1TTX A;  2AUC A;  1UHI A;  1NUB A;  2KFG A;  4YBH B;  3LL8 B;  3JTD C;  2JXC A;  2MBX A;  4GGF C;  2CTN A;  5K89 A;  3EKJ A;  2BCB A;  3ZNI A;  1MXL C;  3OX6 A;  1NX0 A;  1OSA A;  1F55 A;  2L5X B;  1QV0 A;  4PHM A;  2COL B;  2JNF A;  4ORC B;  2LC5 A;  1FI5 A;  1XK4 C;  2WOS A;  3SG2 A;  1F4Q A;  4N5X A;  2QAC A;  2K7B A;  2K7D A;  2KFF A;  4AOM A;  1AK8 A;  2M9G A;  2K2F A;  4YGE B;  1JF2 A;  4FQO A;  1PSB A;  3D0Y A;  3A8R A;  3SG5 A;  1TNQ A;  1DVI A;  1YRT B;  2BE4 A;  2JC2 A;  4R1E A;  2CBL A;  5DKR A;  1A75 B;  1RK9 A;  3BQ3 A;  2LV7 A;  5ER4 X;  2JT8 A;  4AQI A;  2JU0 A;  1Y0V H;  1TCO B;  5AAN A;  4PDZ A;  1KFU S;  1BR4 B;  2MLE C;  5G08 A;  3TDZ A;  2FJU B;  3DVM A;  1CLM A;  1LIN A;  2M7N A;  3BUM B;  3CTN A;  2KBI A;  1F8H A;  3DD4 A;  2BBN A;  2MHH A;  1HQV A;  1YR5 A;  2KNE A;  2F33 A;  1OZO A;  1TNP A;  2A4J A;  2LAP A;  4M2O A;  1B7T Y;  3CZT X;  3O2P A;  1FBV A;  5HKW A;  5CPV A;  2AAO A;  4ZCV A;  1GJY A;  1YUS A;  1CLL A;  1K9U A;  1S6I A;  1SKT A;  2H2K A;  1MWN A;  4NQG A;  1ZAC A;  3WXA A;  4GUK A;  1M45 A;  1WDC B;  3LK1 A;  1SL7 A;  2WC8 A;  2M49 B;  1DJY A;  2BBM A;  2G2B A;  2HQW A;  3D0Y B;  2ZRS A;  4N1F A;  4MRX A;  3SIB A;  2E6W A;  4JPZ B;  3I5G B;  5FYX A;  1MXE A;  3RLZ A;  2ZKM X;  3BXK A;  3VGO A;  4IL1 A;  1B8C A;  1YX7 A;  3M0W A;  4CLN A;  1Q80 A;  2PMY A;  2H61 C;  5DKQ A;  3LCP C;  1S36 A;  4MZK A;  3CGA A;  2EGD A;  2L0P A;  3GK2 A;  4NDC A;  4PE7 A;  2V53 A;  1EXR A;  1N0Y A;  2LLT A;  4GNK B;  1CDN A;  4HRE E;  3FIA A;  2FCD A;  1DF0 A;  2ZNE A;  2M29 A;  1IKU A;  1B8R A;  2OTG B;  3EK4 A;  1G4Y R;  5CSF A;  1DMO A;  1UP5 A;  4AQJ A;  1XK4 A;  2KYF A;  1K94 A;  1KK7 Y;  5I2L A;  2GV5 A;  1XVJ A;  2ZN9 A;  3VRP A;  1KWO C;  4MZJ A;  1UHH A;  1K95 A;  2F2P A;  1A29 A;  2ZFD A;  2JWW A;  2LUX A;  1BLQ A;  1K96 A;  2K2A A;  2L98 A;  1XYD A;  3O4Y A;  2EC6 C;  1G33 A;  4L9M A;  2EHB A;  4E68 A;  1W7I B;  1U5I A;  2L4I A;  3JVT C;  1NWD A;  2AMI A;  2F2O A;  3SIA A;  3NSI A;  1OQP A;  1S5G Y;  1H4B A;  1S1E A;  2I94 A;  3JTD B;  1TOP A;  1SY9 A;  5TNC A;  1OZS A;  4I5J A;  5AFP A;  1OMR A;  5HYD A;  1NX3 A;  4XJK A;  2L51 A;  2JUL A;  3PFV A;  5JJG A;  1DF0 B;  2JT3 A;  4I5K A;  5HKZ A;  1QTX A;  1SL9 A;  1BOD A;  4C0J A;  3KO0 A;  2L50 A;  1OMD A;  2I2R E;  2PVB A;  1A03 A;  2D8N A;  3PLF B;  4NDB A;  1NPQ A;  1N2D A;  2MJW B;  2ZRT A;  4DIR A;  3DVK A;  4F0Z B;  4BY5 A;  2E30 A;  4OV2 A;  2KI6 D;  2LMT A;  3VRQ A;  1WY9 A;  2KOT A;  2KI6 C;  1J55 A;  1OOJ A;  3ICB A;  3PSR A;  1A4P A;  1U5I B;  4MRY A;  4I5L B;  5HLO A;  2H61 A;  4YGC B;  1DJW A;  2F8P A;  3OP0 A;  1K9P A;  1RRO A;  1YVL A;  1QVI Z;  5GQQ C;  1G8I A;  4CID A;  4N1G A;  4PCW A;  2LVJ A;  3C1V A;  2Q4U A;  2Y1M A;  1HT9 A;  2Y5I A;  2BE6 A;  1SL8 A;  2KFH A;  1XFU O;  4YGD B;  1RJV A;  4GGN A;  1IG5 A;  1PAL A;  3NSL A;  1SPY A;  1M31 A;  1PVA A;  1IQ3 A;  1SCV A;  1UUS A;  4XJK B;  2KAY A;  3GK4 X;  2LVV A;  4MBE A;  3CR4 X;  1N65 A;  3HX4 A;  1UHK A;  1XFZ O;  4PHN A;  4XYN A;  2MRD A;  4CPV A;  1K2H A;  1DGU A;  2K8M B;  1MUX A;  2NLN A;  2M97 A;  3GOF A;  1B47 A;  1YTZ C;  3O78 A;  5D7F A;  2GGM A;  5AER A;  3BUN B;  1NX1 A;  5B8I B;  3NSO A;  4BY4 A;  2JTT A;  1BOC A;  1TNW A;  1AVS A;  1MQ1 A;  1ODB A;  1TIZ A;  3KEV A;  1KQM C;  1XA5 A;  2OS8 B;  1L2O B;  1FW4 A;  4C0K A;  2BKH B;  5CSI A;  4UPG A;  1BJF A;  3PN7 C;  3TDU A;  1JBA A;  1CB1 A;  2VRG A;  4P5O E;  1YUR A;  2HET A;  4PE0 A;  1SNL A;  3CWG A;  1V1F A;  4DS7 A;  2HPS A;  3FWB A;  4M2Q A;  2KGR A;  1QAT A;  1REC A;  4GFT A;  1SCM C;  3CR2 A;  2K61 A;  1JUO A;  2PSR A;  3EKH A;  1IJ5 A;  1DJI A;  2BEC A;  1QX5 B;  1ZMZ A;  2M8U A;  2GGZ A;  3OB2 B;  1CMF A;  1SR6 C;  1QIW A;  5I2Q A;  4QJ5 B;  1FI6 A;  2OS8 C;  1V1G A;  3AAJ A;  3BUX B;  1L2O C;  1J1E A;  1KWO B;  3IF7 A;  4A4B A;  1CLB A;  1KCY A;  1NSH A;  1UUR A;  5J3X A;  2DOQ A;  3TDI A;  1OMV A;  4A4C A;  1FPW A;  1RFJ A;  1LXF C;  2JNX A;  1YRU B;  2EC6 B;  4P2Y B;  1B1G A;  1IH0 A;  2LUC A;  2O5G A;  3JVT B;  2FOT A;  1GGZ A;  3MSE B;  1F4O A;  1SYM A;  4GPL B;  3DF0 A;  1Y1A A;  1EG3 A;  1YUU A;  2K0J A;  2SAS A;  3GK1 A;  1Y1U A;  2LP3 A;  3SJS A;  1ALW A;  4YRU A;  4Q04 A;  2CNP A;  3I5H C;  1CFD A;  2ZND A;  1M39 A;  3CR5 X;  1C7W A;  1WRZ A;  2NCP A;  1BR1 B;  4WRI A;  1TRF A;  4PE1 A;  3RM1 A;  1PVB A;  3KF9 A;  3BYA A;  2BCA A;  2ISD A;  1S3P A;  4M2P A;  2M1U A;  1XO5 A;  2Q91 A;  3FWC A;  1IGV A;  3BOW A;  1KSO A;  2P6B B;  1LA3 A;  1ZUZ A;  2JZI A;  1C07 A;  2ZN8 A;  1QX2 A;  4MLW A;  2BCX A;  4U8D A;  1YUT A;  1ZOT B;  1JSA A;  1NP8 A;  1QIV A;  2L2E A;  1EH2 A;  2JQ6 A;  1BG1 A;  2JXL A;  3O6B A;  5HLV A;  5I8N A;  4MN0 A;  2KQ6 A;  1NX2 A;  1QS7 A;  1B8L A;  1LKJ A;  5AXI A;  2JRF A;  1FF1 A;  4ZCU A;  4HSZ A;  2LAN A;  1BU3 A;  1KK8 C;  2OPO A;  3DF0 B;  1AJ4 A;  1RWY A;  1F71 A;  2KDH A;  1DGV A;  2KYC A;  1E8A A;  2KI4 C;  2M0R A;  2SCP A;  2KGB C;  1H8B A;  2PRU A;  1AHR A;  5D69 A;  1IRJ A;  2JT0 A;  2LLS A;  1CMG A;  3EVU A;  4DRW A;  1J7P A;  4NDD A;  1BF5 A;  3LK0 A;  3OB1 B;  1EL4 A;  4OCI A;  1NCY A;  3TZ1 A;  2BKI B;  2Y4Q A;  2M1K B;  1S26 D;  3SG7 A;  3BOW B;  3OX5 A;  1F54 A;  1B9A A;  4YGB B;  3FS7 A;  3ZWH A;  2KHN A;  1SMG A;  1R6P A;  2WCB A;  4I5N B;  2LMU A;  2PAS A;  1B7T Z;  3I5I C;  1ZFS A;  4MSP A;  5AEQ A;  1NYA A;  2LVI A;  3TUY C;  1C7V A;  4PE4 A;  1TNX A;  4TNC A;  5IBW A;  1AJ5 A;  1AUI B;  1KQM B;  1SW8 A;  1K8U A;  1PSR A;  2PAL A;  1IWQ A;  1AP4 A;  5I2O A;  1IQ5 A;  1J7Q A;  3PN7 B;  2JOJ A;  2LLU A;  2LE9 B;  3EK8 A;  4MZL A;  2KBM A;  1UHJ A;  2WCF A;  2Y1N A;  3KHE A;  1SRA A;  1ALV A;  1L7Z A;  2LHL A;  4YGA A;  3TS5 C;  1CDM A;  3E3R A;  1CFC A;  4MVF A;  1SCM B;  4GBA A;  4QJ3 B;  3EVR A;  2K7O A;  2WND A;  1DT7 B;  1R2U A;  4ETO A;  5CSJ A;  1SR6 B;  1Y6W A;  4OR9 B;  1QV1 A;  1CNP A;  4JQ0 D;  3I5F C;  2O60 A;  2RGI A;  4PHJ A;  2I18 A;  3WHU B;  3NSK A;  1J7O A;  2JTZ A;  1PUL A;  1K93 D;  3PAT A;  2KQY A;  2KAX A;  2R2I A;  2NZ0 A;  1IJ6 A;  1XFV O;  3NXA A;  3IQQ A;  1XFX O;  3BUO B;  1UHN A;  1M46 A;  2F3Y A;  1S6J A;  5F6T A;  1YX8 A;  1QLK A;  1KK7 Z;  1WRL A;  3KPX A;  4JWQ A;  1MHO A;  1CDL A;  2CXJ A;  3H4S E;  4HRG A;  1WRK A;  2TN4 A;  5HKY A;  3CLN A;  2JPT A;  3I5H B;  1QVI Y;  2F3Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...