4WQ3A

Human calpain pef(s) with (2z,2z')-2,2'-disulfanediylbis(3-(6-bromoindol-3-yl)acrylic acid) bound
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
173
structure length
173
Chain Sequence
EEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calpain small subunit 1
publication title Conformationally restricted calpain inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 65
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4wq3A00
1J55A 1M46A 1RJVA 4U8DA 1CKKA 1LVCD 4YGAA 1IG5A 1B7TY 2L4IA 1LXFC 2JNXA 1B47A 2NCOA 3SG2A 3EVVA 4NDCA 2M97A 1SMGA 2FJUB 2KFGA 3CZTX 1SRAA 1DJWA 4PE1A 2KHNA 2M7NA 4BY5A 1M63B 4R1EA 1QLKA 2ZNDA 3I5IC 1UUSA 2AAOA 2MRDA 2PRUA 1CDMA 1IGVA 1XFYO 1QS7A 1KK7Z 3WHUB 1M39A 1K9KA 1L2OB 4IL1A 2RGIA 2AUCA 4GBAA 2K61A 1KSMA 5AEQA 1F4OA 2I2RE 2MLFC 4QJ4B 4GAOA 1B8CA 4MSPA 1RTP1 2K7CA 2BKIB 4GGFC 2LMUA 4GNKB 1KFXS 1YX7A 2TN4A 1ALVA 1MUXA 2KFFA 1JFKA 2PVBA 5AANA 3BQ3A 2ZNEA 2OS8B 3WXAA 2CNPA 1S6IA 2JXLA 1JFJA 1BJFA 2NLNA 1QV1A 1GQMA 1YUTA 2EC6B 4AQIA 2K2FA 4M2OA 1YVHA 3RM1A 4XYNA 2I7AA 3AKAA 1DJIA 2HQWA 1M31A 3OX6A 2JQ6A 1TNPA 2F3ZA 1CLMA 3EK4A 3DVMA 3I5HB 4GGNA 5DKNA 2L98A 4HRGA 5J3XA 1YURA 2M1KB 2M8UA 1B7TZ 1Y1AA 2O5GA 2LAPA 1XA5A 5CSNA 3I5GC 1K93D 2M3WA 2VRGA 5CPVA 1KFUS 1TOPA 4YGBB 5D7FA 1K8UA 5CSIA 2A4JA 3VRQA 1XK4C 3TS5B 1K96A 1AJ4A 4DCKA 1Y1XA 5HKWA 2OS8C 4PE4A 1SCVA 2LLSA 3D0YB 4MRXA 3DVKA 1XFXO 1WDCB 2GV5A 2V53A 2EC6C 1CFCA 1CM1A 4MRYA 2M29A 3VRRA 3GK2A 1SL9A 1NX1A 1F55A 3ZNIA 1LKJA 1BG1A 3PALA 1TTXA 2LVKA 3PM8A 3AAKA 3KF9A 2BCBA 3I5HC 1DJHA 4PHJA 2MJWB 2BKHB 4A4CA 2LE9B 3GK4X 4MZJA 1FI6A 3HX4A 4MBEA 1RWYA 3A8RA 2M1UA 4ICBA 1SL8A 1J7PA 2LV7A 1CB1A 1DF0B 1RECA 2KOTA 1ZMZA 3TS5C 2K7OA 1JC2A 2JT3A 2L4HA 5AFPA 1DJZA 2L5XB 1OE9B 2KFHA 2LHLA 1WDCC 2WCEA 1CMGA 4OVNF 4YGDB 1OZSA 2Y5IA 4FQOA 4PHMA 2EHBA 3NXAA 2HETA 1YX8A 3KEVA 4N1GA 3TUYB 2G9BA 1J7OA 3NSOA 1N65A 2LVJA 2HF5A 2H61A 1OMRA 3H4SE 1EG4A 5KTYA 1S5GZ 2BECA 1CNPA 3OX5A 1BT6A 1J1EA 2JC2A 1PVAA 1B8LA 1SL7A 1C7VA 3FS7A 1CMFA 3E3RA 3EK8A 1ALWA 4C0KA 4WRIA 1YUSA 5B8IB 4I5KA 2D8NA 1WLZA 2KQ6A 3CS1A 2JT0A 1DGUA 1J1DA 3D10A 1CM4A 1KQMB 1ZOTB 1J7QA 1F71A 1NWDA 2KAXA 1ODBA 1YRUB 2JXCA 3SG6A 4GPLB 3TUYC 1TNQA 2L0PA 3ICBA 1BODA 5I2LA 1SR6B 2BE4A 4JQ0D 1OOJA 4MN0A 2K7DA 4OCIA 1KCYA 5AERA 3ZWHA 1S36A 5BPJA 1UURA 4OV2A 1IQ3A 3MSEB 1BMOA 3BUMB 3K21A 1NCZA 2LHIA 1S6CA 3FWCA 2LMTA 1BLQA 2QACA 1NUBA 3CR2A 3BUWB 1HT9A 1TNWA 1SPYA 2Y1MA 1DGVA 4NQGA 4HRHA 4YI9A 4DUQA 5KSZA 3PATA 3OB1B 1MXEA 2M9GA 3AKBA 3KHEA 3O4YA 5GQQC 1UHHA 1KQMC 1NCXA 1MQ1A 2KNEA 2LM5A 2CXJA 2NCPA 1AHRA 4UPGA 4C0JA 2JWWA 3PN7B 1V1FA 1A29A 3O78A 2EGDA 1H4BA 4P5OE 1RFJA 2KAYA 2Y1NA 3NSIA 3BYAA 4MEWA 2HQ8A 2PMYA 2JTTA 3JTDB 1SK6D 1XYDA 4OR9B 1FF1A 2LUXA 2WNDA 2GGZA 1NX0A 2JNFA 4Q04A 1L2OC 1SW8A 2LP3A 1MF8B 3SIAA 1WY9A 1BR4B 4QJ5B 5HKYA 1JWDA 3HCMA 3OHMB 3LK1A 1MHOA 1MXLC 3GK1A 1JSAA 1E8AA 2IS9A 3SG4A 2KYFA 3TDZA 1A75A 2M7LA 2OTGB 1YTZC 2ZN8A 1IQ5A 1C7WA 4L9MA 4PDZA 1F54A 1LA3A 3PN7C 1DJYA 1PSBA 2PSRA 1NX3A 1QV0A 1XVJA 4N5XA 5CSFA 1K9UA 1M45A 2JTZA 1TN4A 4YGCB 2M0RA 3JTDC 2LLTA 3PSRA 3KO0A 5IBWA 1HQVA 1AP4A 1L7ZA 5I2OA 1G4YR 1YR5A 1CLLA 1QVIY 4CLNA 1IH0A 2JULA 2GGMA 1WLMA 1XFVO 2CTNA 3PFVA 4DS7A 1JBAA 4E68A 5I8NA 2Y4QA 1FI5A 1CFFA 1IKUA 1K90D 1PULA 1CFPA 1WRZA 2OTGC 1J7RA 1N0YA 4WQ3A 1R2UA 2K0JA 2QPTA 1FPWA 1IJ5A 2O60A 2BBMA 1G8IA 1QASA 2CT9A 2KGBC 2M49B 4PCWA 5F6TA 2JPTA 3TDUA 1TNXA 1OZOA 1YRTB 1CFDA 2K7BA 4PE0A 4WQ2A 5ER5A 2BCXA 4JPZB 1A4PA 1B4CA 2KBMA 4MLWA 1RROA 1K2HA 1N2DA 2F3YA 1OQPA 3CLNA 2F8PA 5TNCA 3DF0A 4MZLA 1S6JA 4DIRA 2B1UA 3NSKA 4HSZA 4YGEB 3VROA 5G08A 2MBXA 2FCDA 3NSLA 5ER4X 2FCEA 4ZCVA 5HLOA 1JUOA 1EG3A 3EKHA 4F0ZB 2L50A 3CR5X 1CLBA 3LK0A 3DVEA 1PK0D 2H61C 1R6PA 2KI4B 1UHJA 1U5IB 1SKTA 2H2KA 4DRWA 1K9PA 3TDIA 3CWGA 1RK9A 1GGWA 2I94A 2COLB 4ZCUA 1K95A 2F2OA 3IQOA 3CGAA 3OB2B 4BY4A 1S1EA 1XFUO 3M0WA 1BOCA 1QVIZ 1KFUL 2L51A 3PLFB 1CTRA 2KQYA 1IRJA 5HLVA 1BR1B 1QX2A 1IJ6A 3EVUA 1YVLA 4CFRA 4XJKB 1AVSA 2KGRA 3VGOA 1FBVA 2BL0B 1YUUA 5DKQA 1A2XA 1B8RA 5DKRA 1U5IA 2E30A 1B1GA 2L2EA 2MA2A 2Q91A 3EKJA 1WRKA 2LMVA 4N1FA 1CDLA 4PHKA 3OP0A 2KI4C 2F33A 1G33A 1OMVA 1Y1UA 3BUNB 1QXPA 2ZRTA 3WNXB 1F70A 2K2AA 2JOJA 3LL8B 4GUKA 1BF5A 4AQJA 2NZ0A 1UP5A 4ETOA 1SBJA 3SJSA 2BBNA 4YBHB 4XJKA 3FIAA 3SG7A 4I5JA 4P2YB 1PALA 1DJGA 1QX7A 5I2QA 1MWNA 2MAZA 1A75B 1DJXA 1K94A 1PRWA 1SR6C 3CTNA 2KI6C 3CR4X 3KPXA 1OSAA 1UHNA 5JOLA 4GGFA 1AJ5A 1C07A 2LVVA 2BL0C 1Y6WA 1EL4A 1SNLA 2FOTA 2WC8A 3DVJA 2LNKA 2G2BA 3SG5A 4CIDA 1SY9A 3BUOB 2F2PA 4CPVA 1VRKA 2PASA 4HREE 3I5GB 5JJGA 3EVRA 1TCOB 1GGZA 1KQVA 1NSHA 4MZKA 1TIZA 5FYXA 1OMDA 3I5FB 1JF2A 1V1GA 3SIBA 2LP2A 2LVIA 2JRFA 4A4BA 4OKHA 1A03A 1PSRA 1QX5B 1B9AA 1W7IB 3GOFA 4I5LB 4ORAB 1QJTA 2ZN9A 3DD4A 5HKZA 2DOQA 3VRNA 1WRLA 4YI8A 4GFTA 1LINA 2KSPA 2JU0A 1QIWA 2BE6A 1D1OA 2CCMA 5KU1A 2E6WA 3IQQA 4PE7A 1AUIB 5K89A 1JF0A 1ZFSA 4D1EA 1KWOB 3BOWB 1PVBA 1XK4A 3AAJA 4C0LA 3LLEA 1QTXA 2KYCA 2SCPA 3SG3A 3DF0B 4MVFA 1CDPA 1S5GY 2SASA 1LA0A 1BU3A 4CFQA 4AOMA 3I5FC 1S3PA 4NDBA 1DTLA 3IF7A 1EXRA 2LUCA 2AMIA 2Q4UA 1W7JB 4FTGA 1Q80A 1ZUZA 1SCMB 3EK7A 3FWBA 1NX2A 3BOWA 1TRFA 2JT8A 1S26D 1UHKA 3O6BA 3O2PA 4QJ3B 2P6BB 1KFXL 1QLSA 1KWOC 5CSJA 1XFZO 1ZACA 1CDNA 2JZIA 1NYAA 1X02A 1NP8A 4M2PA 1SYMA 1XO5A 2LCPA 3D0YA 3JVTB 1UWOA 3BUXB 1IWQA 2CBLA 4PHNA 2WCBA 1KK8B 1KK7Y 3VRPA 1QATA 2WORA 2WCFA 2ZKMX 4TNCA 2KAVA 5HYDA 4PALA 1Y0VH 2BCAA 2MHHA 2HPSA 2ZFDA 4JWQA 1NPQA 3TZ1A 1NCYA 4M2QA 4NDDA 4ORBB 1KSOA 2NXQA 3RLZA 1QIVA 1SCMC 2MLEC 2WOSA 3QRXA 1EJ3A 2KI6D 2PALA 5D69A 1H8BA 5PALA 1DVIA 1NIWA 1FW4A 1XFWO 3I5IB 1F4QA 1DF0A 2KDHA 1MR8A 1AK8A 1UHIA 4ORCB 1DT7B 3A4UB 2ISDA 4YRUA 3C1VA 2KBIA 2LANA 3BXKA 1TCFA 3JVTC 1EH2A 2ZRSA 3LCPC 4USLA 3WHTB 3F45A 2OPOA 1GJYA 1KK8C 1F8HA 2LC5A 5AXIA 1DMOA 2R2IA 2K8MB 2LLUA 2I18A 4I5NB
chains in the Genus database with same CATH superfamily
1J55A 1M46A 1RJVA 4U8DA 3RZSA 1LVCD 1CKKA 4YGAA 2PYQA 1IG5A 1B7TY 3B6XA 3L47A 2L4IA 1LXFC 2JNXA 1B47A 2NCOA 3R1VA 3SG2A 2GTEA 3EVVA 4NDCA 2M97A 1SMGA 2FJUB 2KFGA 3CZTX 1SRAA 1DJWA 4PE1A 2KHNA 2M7NA 2P71A 1M63B 3DZTA 4BY5A 4R1EA 1QLKA 2ZNDA 3I5IC 1UUSA 2AAOA 2MRDA 2PRUA 1CDMA 1IGVA 1XFYO 1QS7A 1KK7Z 3FE8A 3WHUB 1IIOA 1M39A 1K9KA 4INXA 1L2OB 4IL1A 2RGIA 2AUCA 4GBAA 2K61A 1KSMA 5AEQA 1F4OA 2I2RE 2MLFC 3BJHA 4QJ4B 4GAOA 1B8CA 4MSPA 1RTP1 2K7CA 2BKIB 4GGFC 2LMUA 4GNKB 1KFXS 1YX7A 2PQLA 2TN4A 3VB1A 2BNXA 1ALVA 1MUXA 2KFFA 1JFKA 2PVBA 5AANA 3BQ3A 2ZNEA 2OS8B 3WXAA 2CNPA 1S6IA 2JXLA 1JFJA 1BJFA 1TWOA 2NLNA 1QV1A 1GQMA 1YUTA 2EC6B 4AQIA 2K2FA 5DICA 3QMEA 4M2OA 1YVHA 3RM1A 4XYNA 2I7AA 3AKAA 1DJIA 2HQWA 1M31A 3OX6A 2JQ6A 1TNPA 2F3ZA 1CLMA 3EK4A 3DVMA 3I5HB 4GGNA 5DKNA 2L98A 3EG5B 4HRGA 1YURA 5J3XA 2M1KB 2M8UA 1B7TZ 1Y1AA 2O5GA 2LAPA 1XA5A 5CSNA 3I5GC 1K93D 2M3WA 2VRGA 5CPVA 1KFUS 1TOPA 4YGBB 5D7FA 5FI7A 1K8UA 5CSIA 2A4JA 5HL1A 3VRQA 1XK4C 3TS5B 1K96A 1AJ4A 4DCKA 1Y1XA 5HKWA 1SSEB 2OS8C 4PE4A 1SCVA 2LLSA 3D0YB 4MRXA 3DVKA 1XFXO 1WDCB 2GV5A 2V53A 3B7AA 2EC6C 2WCMA 3D77A 1CFCA 1CM1A 4MRYA 2M29A 3VRRA 2ERBA 3GK2A 1SL9A 1NX1A 1F55A 3ZNIA 1LKJA 1BG1A 3PALA 1TTXA 2LVKA 1OW4A 3PM8A 3AAKA 3KF9A 2BCBA 3I5HC 1DJHA 2WCKA 3R1PA 4PHJA 2MJWB 2BKHB 4A4CA 2LE9B 1W9ZA 3GK4X 4MZJA 1FI6A 3HX4A 3V2LA 4MBEA 1RWYA 3A8RA 2M1UA 4ICBA 1SL8A 1J7PA 2LV7A 1CB1A 3PM2A 1DF0B 1RECA 2KOTA 1OOIX 1ZMZA 3TS5C 2K7OA 1JC2A 2JT3A 2L4HA 1DEKA 5AFPA 1DJZA 3SS4A 2L5XB 1OE9B 2KFHA 2LHLA 1WDCC 2WCEA 5D3OA 1CMGA 4FQTA 4OVNF 4YGDB 1OZSA 2Y5IA 4FQOA 4PHMA 4JKTA 2EHBA 3NXAA 2HETA 1YX8A 3KEVA 4N1GA 3TUYB 1DELA 2G9BA 1TUJA 1J7OA 3NSOA 1N65A 2LVJA 2HF5A 4IJ7A 4KYNA 2H61A 1OMRA 3H4SE 1EG4A 5KTYA 1S5GZ 3DYEA 2BECA 1CNPA 3OX5A 1BT6A 1J1EA 2JC2A 1PVAA 1B8LA 1SL7A 1C7VA 3FS7A 1CMFA 3E3RA 3EK8A 1ALWA 4C0KA 4WRIA 1YUSA 5B8IB 4I5KA 2D8NA 1WLZA 2KQ6A 3CS1A 4F7FA 2JT0A 1DGUA 1J1DA 3D10A 1CM4A 1KQMB 1ZOTB 1J7QA 1F71A 1NWDA 2BAPA 2KAXA 1ODBA 1YRUB 2JXCA 3SG6A 4GPLB 3TUYC 1TNQA 2L0PA 2QEBA 3ICBA 1BODA 5I2LA 3CZ2A 1SR6B 2BE4A 4JQ0D 1OOJA 4MN0A 2K7DA 1OOHA 4OCIA 1KCYA 2WC5A 5AERA 3ZWHA 4INWA 1S36A 4PT1A 5BPJA 1UURA 4OV2A 1IQ3A 3S0DA 3MSEB 1BMOA 3BUMB 3K21A 1NCZA 2LHIA 1S6CA 3FWCA 2LMTA 1BLQA 2QACA 1OOFA 1NUBA 3CR2A 3BUWB 1HT9A 1TNWA 1SPYA 2Y1MA 1DGVA 4NQGA 4HRHA 4YI9A 4DUQA 5KSZA 3PATA 1OOGA 3OB1B 1MXEA 2M9GA 3AKBA 3KHEA 3R1OA 3O4YA 3CYZA 5GQQC 1UHHA 5FI2A 1KQMC 1NCXA 1MQ1A 2KNEA 2LM5A 2CXJA 2NCPA 1AHRA 2YGUA 4UPGA 4C0JA 2JWWA 3PN7B 1V1FA 1A29A 3O78A 2EGDA 1H4BA 1TUZA 4P5OE 1RFJA 2KAYA 2Y1NA 3NSIA 3BYAA 1LS8A 4MEWA 5I94A 2HQ8A 2PMYA 2JTTA 3JTDB 1SK6D 1XYDA 3DXLA 4OR9B 2LUXA 1FF1A 2WNDA 2GGZA 1NX0A 2JNFA 4Q04A 1L2OC 1SW8A 2LP3A 1MF8B 3SIAA 1WY9A 1BR4B 4QJ5B 5HKYA 3S0AA 1JWDA 3HCMA 3OHMB 3LK1A 1MHOA 1MXLC 3GK1A 1JSAA 1E8AA 2IS9A 2L5YA 3SG4A 2KYFA 3TDZA 1A75A 2M7LA 2OTGB 1YTZC 2ZN8A 5FI6A 1IQ5A 1C7WA 4L9MA 4PDZA 3D74A 1F54A 1LA3A 3PN7C 1DJYA 1PSBA 2PSRA 1NX3A 1QV0A 1XVJA 3S0GA 4N5XA 5CSFA 1K9UA 1M45A 2JTZA 1TN4A 4YGCB 2M0RA 3JTDC 2LLTA 3PSRA 3KO0A 5IBWA 3B86A 2K60A 1HQVA 1AP4A 1L7ZA 5I2OA 1T14A 1G4YR 1YR5A 1CLLA 1QVIY 4CLNA 1IH0A 2JULA 2GGMA 1WLMA 1XFVO 2CTNA 3PFVA 4DS7A 1JBAA 4E68A 5I8NA 2Y4QA 1FI5A 1CFFA 1IKUA 1K90D 1PULA 1CFPA 1WRZA 2OTGC 1J7RA 1N0YA 4WQ3A 1R2UA 2K0JA 2QPTA 1FPWA 1IJ5A 1ORGA 1Z4HA 1G8IA 1QASA 2BBMA 2CT9A 2KGBC 2M49B 2O60A 2JPTA 4PCWA 5F6TA 1TNXA 3TDUA 1XFRA 1OZOA 1YRTB 1CFDA 2K7BA 4PE0A 4WQ2A 5ER5A 2WCJA 2BCXA 4JPZB 1A4PA 1B4CA 2KBMA 4MLWA 1RROA 1K2HA 1N2DA 2F3YA 1OQPA 3CLNA 2F8PA 5TNCA 3DF0A 4MZLA 1S6JA 4DIRA 2B1UA 3NSKA 4HSZA 2WCHA 3CZ0A 4YGEB 5G08A 2MBXA 3VROA 2FCDA 3NSLA 5ER4X 2FCEA 4ZCVA 5HLOA 1JUOA 1EG3A 3EKHA 3BFAA 4F0ZB 3CABA 2L50A 4JD9A 3CR5X 1CLBA 2QEVA 3LK0A 3DVEA 1PK0D 2H61C 3FE6A 3L4LA 1R6PA 2KI4B 1UHJA 3PJIA 1U5IB 1SKTA 2H2KA 4DRWA 1K9PA 3TDIA 3CWGA 1QWVA 1RK9A 1GGWA 2I94A 2COLB 4ZCUA 1K95A 2F2OA 3IQOA 3CGAA 3OB2B 4BY4A 1S1EA 1XFUO 3M0WA 2QEHA 3SS5A 1BOCA 1QVIZ 1KFUL 2L51A 3PLFB 1CTRA 2KQYA 1IRJA 5HLVA 1BR1B 1QX2A 1IJ6A 3EVUA 1YVLA 4CFRA 4XJKB 1C3YA 1AVSA 2KGRA 3VGOA 1FBVA 2BL0B 1YUUA 5DKQA 1A2XA 1B8RA 5DKRA 1U5IA 2E30A 1B1GA 2L2EA 2MA2A 2Q91A 3EKJA 1WRKA 2LMVA 4N1FA 1CDLA 4PHKA 1C3ZA 3KPXA 3OP0A 2KI4C 2F33A 1G33A 1OMVA 1Y1UA 3BUNB 1QXPA 2ZRTA 3UO9A 3WNXB 2K2AA 1F70A 2JOJA 3LL8B 3R72A 4GUKA 1BF5A 4AQJA 2NZ0A 1UP5A 4ETOA 1SBJA 3SJSA 2BBNA 4YBHB 4XJKA 3FIAA 3SG7A 4I5JA 4P2YB 1PALA 1DJGA 1QX7A 5I2QA 1MWNA 2MAZA 1A75B 1DJXA 1K94A 1PRWA 1SR6C 2P70A 2KI6C 3CR4X 3CDNA 1OSAA 3CTNA 1UHNA 5JOLA 3OBVA 4GGFA 1AJ5A 1C07A 3IVTA 2LVVA 2BL0C 1Y6WA 1EL4A 1SNLA 2FOTA 2WC8A 3DVJA 2LNKA 2G2BA 3SG5A 4CIDA 1SY9A 3BUOB 3FE9A 2F2PA 4CPVA 1VRKA 2PASA 3B88A 4HREE 3I5GB 5JJGA 3EVRA 1TCOB 2WCLA 1GGZA 1KQVA 1NSHA 3NHTA 4MZKA 1TIZA 5FYXA 1OMDA 3S0BA 3I5FB 1JF2A 1V1GA 3SIBA 2LP2A 2LVIA 2JRFA 4A4BA 4OKHA 1A03A 1PSRA 1QX5B 1B9AA 3L4AA 1W7IB 3GOFA 4I5LB 4ORAB 1QJTA 2ZN9A 3DD4A 5HKZA 2DOQA 3D76A 3VRNA 1WRLA 4YI8A 4GFTA 1Z2CB 3D73A 1LINA 2KSPA 2JU0A 1QIWA 2BE6A 1D1OA 2CCMA 5KU1A 3S0FA 2E6WA 3IQQA 3BFBA 1AUIB 3Q8IA 4PE7A 1JF0A 1ZFSA 4D1EA 5K89A 1KWOB 3BOWB 1PVBA 1XK4A 3AAJA 3B87A 3UNWA 4C0LA 3LLEA 1QTXA 2KLEA 2KYCA 2SCPA 3SG3A 2KPHA 3DF0B 4MVFA 1CDPA 1S5GY 2SASA 1LA0A 3D78A 1BU3A 4CFQA 4AOMA 3I5FC 1S3PA 4NDBA 1DTLA 3IF7A 1EXRA 2KLDA 2LUCA 2AMIA 2Q4UA 1W7JB 4FTGA 1Q80A 1ZUZA 1SCMB 3EK7A 3FWBA 1NX2A 3BOWA 1TRFA 2JT8A 3N7HA 1S26D 1UHKA 3O6BA 3O2PA 4QJ3B 1DQEA 2FJYA 2P6BB 1KFXL 1QLSA 1KWOC 5CSJA 1XFZO 1ZACA 1CDNA 2H8VA 2JZIA 1NYAA 1X02A 3D75A 1NP8A 4M2PA 1SYMA 1XO5A 2LCPA 3DY9A 3NHIA 3D0YA 3JVTB 1UWOA 2QEOA 3BUXB 1IWQA 2CBLA 4PHNA 2WCBA 1KK8B 1KK7Y 2JPOA 3VRPA 3O4XA 1QATA 2WORA 2WCFA 2ZKMX 4TNCA 4OZDA 3S0EA 2KAVA 5HYDA 4PALA 1Y0VH 2BCAA 2MHHA 3NGVA 2HPSA 2ZFDA 4JWQA 1NPQA 1P28A 3CZ1A 1NCYA 4M2QA 4NDDA 3TZ1A 4ORBB 1KSOA 2NXQA 3RLZA 1GM0A 1QIVA 1SCMC 2MLEC 2WOSA 5EL2A 3QRXA 3SS3A 1EJ3A 2KI6D 2PALA 5D69A 1H8BA 5PALA 1DVIA 3K1EA 1NIWA 1FW4A 1XFWO 3I5IB 1F4QA 1DF0A 2KDHA 1MR8A 1AK8A 1UHIA 3BFHA 4ORCB 2WC6A 1DT7B 3A4UB 2ISDA 4YRUA 2L2CA 2KBIA 3C1VA 2LANA 3BXKA 1TCFA 3JVTC 1EH2A 2ZRSA 3LCPC 4USLA 3WHTB 3F45A 2OPOA 1DC1A 1GJYA 1KK8C 3OGNA 2LC5A 5AXIA 1DMOA 1F8HA 2R2IA 2K8MB 2LLUA 2QDIA 2I18A 4I5NB
chains in the Genus database with same CATH topology
1J55A 1M46A 1RJVA 4U8DA 1CKKA 1LVCD 4YGAA 1IG5A 1B7TY 2L4IA 1LXFC 2JNXA 1B47A 2NCOA 3SG2A 3EVVA 4NDCA 2M97A 1SMGA 2FJUB 2KFGA 3CZTX 1SRAA 1DJWA 4PE1A 2KHNA 2M7NA 4BY5A 1M63B 4R1EA 1QLKA 2ZNDA 3I5IC 1UUSA 2AAOA 2MRDA 2PRUA 1CDMA 1IGVA 1XFYO 1QS7A 1KK7Z 3WHUB 1M39A 1K9KA 1L2OB 4IL1A 2RGIA 2AUCA 4GBAA 2K61A 1KSMA 5AEQA 1F4OA 2I2RE 2MLFC 4QJ4B 4GAOA 1B8CA 4MSPA 1RTP1 2K7CA 2BKIB 4GGFC 2LMUA 4GNKB 1KFXS 1YX7A 2TN4A 1ALVA 1MUXA 2KFFA 1JFKA 2PVBA 5AANA 3BQ3A 2ZNEA 2OS8B 3WXAA 2CNPA 1S6IA 2JXLA 1JFJA 1BJFA 2NLNA 1QV1A 1GQMA 1YUTA 2EC6B 4AQIA 2K2FA 4M2OA 1YVHA 3RM1A 4XYNA 2I7AA 3AKAA 1DJIA 2HQWA 1M31A 3OX6A 2JQ6A 1TNPA 2F3ZA 1CLMA 3EK4A 3DVMA 3I5HB 4GGNA 5DKNA 2L98A 4HRGA 5J3XA 1YURA 2M1KB 2M8UA 1B7TZ 1Y1AA 2O5GA 2LAPA 1XA5A 5CSNA 3I5GC 1K93D 2M3WA 2VRGA 5CPVA 1KFUS 1TOPA 4YGBB 5D7FA 1K8UA 5CSIA 2A4JA 3VRQA 1XK4C 3TS5B 1K96A 1AJ4A 4DCKA 1Y1XA 5HKWA 2OS8C 4PE4A 1SCVA 2LLSA 3D0YB 4MRXA 3DVKA 1XFXO 1WDCB 2GV5A 2V53A 2EC6C 1CFCA 1CM1A 4MRYA 2M29A 3VRRA 3GK2A 1SL9A 1NX1A 1F55A 3ZNIA 1LKJA 1BG1A 3PALA 1TTXA 2LVKA 3PM8A 3AAKA 3KF9A 2BCBA 3I5HC 1DJHA 4PHJA 2MJWB 2BKHB 4A4CA 2LE9B 3GK4X 4MZJA 1FI6A 3HX4A 4MBEA 1RWYA 3A8RA 2M1UA 4ICBA 1SL8A 1J7PA 2LV7A 1CB1A 1DF0B 1RECA 2KOTA 1ZMZA 3TS5C 2K7OA 1JC2A 2JT3A 2L4HA 5AFPA 1DJZA 2L5XB 1OE9B 2KFHA 2LHLA 1WDCC 2WCEA 1CMGA 4OVNF 4YGDB 1OZSA 2Y5IA 4FQOA 4PHMA 2EHBA 3NXAA 2HETA 1YX8A 3KEVA 4N1GA 3TUYB 2G9BA 1J7OA 3NSOA 1N65A 2LVJA 2HF5A 2H61A 1OMRA 3H4SE 1EG4A 5KTYA 1S5GZ 2BECA 1CNPA 3OX5A 1BT6A 1J1EA 2JC2A 1PVAA 1B8LA 1SL7A 1C7VA 3FS7A 1CMFA 3E3RA 3EK8A 1ALWA 4C0KA 4WRIA 1YUSA 5B8IB 4I5KA 2D8NA 1WLZA 2KQ6A 3CS1A 2JT0A 1DGUA 1J1DA 3D10A 1CM4A 1KQMB 1ZOTB 1J7QA 1F71A 1NWDA 2KAXA 1ODBA 1YRUB 2JXCA 3SG6A 4GPLB 3TUYC 1TNQA 2L0PA 3ICBA 1BODA 5I2LA 1SR6B 2BE4A 4JQ0D 1OOJA 4MN0A 2K7DA 4OCIA 1KCYA 5AERA 3ZWHA 1S36A 5BPJA 1UURA 4OV2A 1IQ3A 3MSEB 1BMOA 3BUMB 3K21A 1NCZA 2LHIA 1S6CA 3FWCA 2LMTA 1BLQA 2QACA 1NUBA 3CR2A 3BUWB 1HT9A 1TNWA 1SPYA 2Y1MA 1DGVA 4NQGA 4HRHA 4YI9A 4DUQA 5KSZA 3PATA 3OB1B 1MXEA 2M9GA 3AKBA 3KHEA 3O4YA 5GQQC 1UHHA 1KQMC 1NCXA 1MQ1A 2KNEA 2LM5A 2CXJA 2NCPA 1AHRA 4UPGA 4C0JA 2JWWA 3PN7B 1V1FA 1A29A 3O78A 2EGDA 1H4BA 4P5OE 1RFJA 2KAYA 2Y1NA 3NSIA 3BYAA 4MEWA 2HQ8A 2PMYA 2JTTA 3JTDB 1SK6D 1XYDA 4OR9B 1FF1A 2LUXA 2WNDA 2GGZA 1NX0A 2JNFA 4Q04A 1L2OC 1SW8A 2LP3A 1MF8B 3SIAA 1WY9A 1BR4B 4QJ5B 5HKYA 1JWDA 3HCMA 3OHMB 3LK1A 1MHOA 1MXLC 3GK1A 1JSAA 1E8AA 2IS9A 3SG4A 2KYFA 3TDZA 1A75A 2M7LA 2OTGB 1YTZC 2ZN8A 1IQ5A 1C7WA 4L9MA 4PDZA 1F54A 1LA3A 3PN7C 1DJYA 1PSBA 2PSRA 1NX3A 1QV0A 1XVJA 4N5XA 5CSFA 1K9UA 1M45A 2JTZA 1TN4A 4YGCB 2M0RA 3JTDC 2LLTA 3PSRA 3KO0A 5IBWA 1HQVA 1AP4A 1L7ZA 5I2OA 1G4YR 1YR5A 1CLLA 1QVIY 4CLNA 1IH0A 2JULA 2GGMA 1WLMA 1XFVO 2CTNA 3PFVA 4DS7A 1JBAA 4E68A 5I8NA 2Y4QA 1FI5A 1CFFA 1IKUA 1K90D 1PULA 1CFPA 1WRZA 2OTGC 1J7RA 1N0YA 4WQ3A 1R2UA 2K0JA 2QPTA 1FPWA 1IJ5A 2O60A 2BBMA 1G8IA 1QASA 2CT9A 2KGBC 2M49B 4PCWA 5F6TA 2JPTA 3TDUA 1TNXA 1OZOA 1YRTB 1CFDA 2K7BA 4PE0A 4WQ2A 5ER5A 2BCXA 4JPZB 1A4PA 1B4CA 2KBMA 4MLWA 1RROA 1K2HA 1N2DA 2F3YA 1OQPA 3CLNA 2F8PA 5TNCA 3DF0A 4MZLA 1S6JA 4DIRA 2B1UA 3NSKA 4HSZA 4YGEB 3VROA 5G08A 2MBXA 2FCDA 3NSLA 5ER4X 2FCEA 4ZCVA 5HLOA 1JUOA 1EG3A 3EKHA 4F0ZB 2L50A 3CR5X 1CLBA 3LK0A 3DVEA 1PK0D 2H61C 1R6PA 2KI4B 1UHJA 1U5IB 1SKTA 2H2KA 4DRWA 1K9PA 3TDIA 3CWGA 1RK9A 1GGWA 2I94A 2COLB 4ZCUA 1K95A 2F2OA 3IQOA 3CGAA 3OB2B 4BY4A 1S1EA 1XFUO 3M0WA 1BOCA 1QVIZ 1KFUL 2L51A 3PLFB 1CTRA 2KQYA 1IRJA 5HLVA 1BR1B 1QX2A 1IJ6A 3EVUA 1YVLA 4CFRA 4XJKB 1AVSA 2KGRA 3VGOA 1FBVA 2BL0B 1YUUA 5DKQA 1A2XA 1B8RA 5DKRA 1U5IA 2E30A 1B1GA 2L2EA 2MA2A 2Q91A 3EKJA 1WRKA 2LMVA 4N1FA 1CDLA 4PHKA 3OP0A 2KI4C 2F33A 1G33A 1OMVA 1Y1UA 3BUNB 1QXPA 2ZRTA 3WNXB 1F70A 2K2AA 2JOJA 3LL8B 4GUKA 1BF5A 4AQJA 2NZ0A 1UP5A 4ETOA 1SBJA 3SJSA 2BBNA 4YBHB 4XJKA 3FIAA 3SG7A 4I5JA 4P2YB 1PALA 1DJGA 1QX7A 5I2QA 1MWNA 2MAZA 1A75B 1DJXA 1K94A 1PRWA 1SR6C 3CTNA 2KI6C 3CR4X 3KPXA 1OSAA 1UHNA 5JOLA 4GGFA 1AJ5A 1C07A 2LVVA 2BL0C 1Y6WA 1EL4A 1SNLA 2FOTA 2WC8A 3DVJA 2LNKA 2G2BA 3SG5A 4CIDA 1SY9A 3BUOB 2F2PA 4CPVA 1VRKA 2PASA 4HREE 3I5GB 5JJGA 3EVRA 1TCOB 1GGZA 1KQVA 1NSHA 4MZKA 1TIZA 5FYXA 1OMDA 3I5FB 1JF2A 1V1GA 3SIBA 2LP2A 2LVIA 2JRFA 4A4BA 4OKHA 1A03A 1PSRA 1QX5B 1B9AA 1W7IB 3GOFA 4I5LB 4ORAB 1QJTA 2ZN9A 3DD4A 5HKZA 2DOQA 3VRNA 1WRLA 4YI8A 4GFTA 1LINA 2KSPA 2JU0A 1QIWA 2BE6A 1D1OA 2CCMA 5KU1A 2E6WA 3IQQA 4PE7A 1AUIB 5K89A 1JF0A 1ZFSA 4D1EA 1KWOB 3BOWB 1PVBA 1XK4A 3AAJA 4C0LA 3LLEA 1QTXA 2KYCA 2SCPA 3SG3A 3DF0B 4MVFA 1CDPA 1S5GY 2SASA 1LA0A 1BU3A 4CFQA 4AOMA 3I5FC 1S3PA 4NDBA 1DTLA 3IF7A 1EXRA 2LUCA 2AMIA 2Q4UA 1W7JB 4FTGA 1Q80A 1ZUZA 1SCMB 3EK7A 3FWBA 1NX2A 3BOWA 1TRFA 2JT8A 1S26D 1UHKA 3O6BA 3O2PA 4QJ3B 2P6BB 1KFXL 1QLSA 1KWOC 5CSJA 1XFZO 1ZACA 1CDNA 2JZIA 1NYAA 1X02A 1NP8A 4M2PA 1SYMA 1XO5A 2LCPA 3D0YA 3JVTB 1UWOA 3BUXB 1IWQA 2CBLA 4PHNA 2WCBA 1KK8B 1KK7Y 3VRPA 1QATA 2WORA 2WCFA 2ZKMX 4TNCA 2KAVA 5HYDA 4PALA 1Y0VH 2BCAA 2MHHA 2HPSA 2ZFDA 4JWQA 1NPQA 3TZ1A 1NCYA 4M2QA 4NDDA 4ORBB 1KSOA 2NXQA 3RLZA 1QIVA 1SCMC 2MLEC 2WOSA 3QRXA 1EJ3A 2KI6D 2PALA 5D69A 1H8BA 5PALA 1DVIA 1NIWA 1FW4A 1XFWO 3I5IB 1F4QA 1DF0A 2KDHA 1MR8A 1AK8A 1UHIA 4ORCB 1DT7B 3A4UB 2ISDA 4YRUA 3C1VA 2KBIA 2LANA 3BXKA 1TCFA 3JVTC 1EH2A 2ZRSA 3LCPC 4USLA 3WHTB 3F45A 2OPOA 1GJYA 1KK8C 1F8HA 2LC5A 5AXIA 1DMOA 2R2IA 2K8MB 2LLUA 2I18A 4I5NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J55 A;  1M46 A;  1RJV A;  4U8D A;  1CKK A;  1LVC D;  4YGA A;  1IG5 A;  1B7T Y;  2L4I A;  1LXF C;  2JNX A;  1B47 A;  2NCO A;  3SG2 A;  3EVV A;  4NDC A;  2M97 A;  1SMG A;  2FJU B;  2KFG A;  3CZT X;  1SRA A;  1DJW A;  4PE1 A;  2KHN A;  2M7N A;  4BY5 A;  1M63 B;  4R1E A;  1QLK A;  2ZND A;  3I5I C;  1UUS A;  2AAO A;  2MRD A;  2PRU A;  1CDM A;  1IGV A;  1XFY O;  1QS7 A;  1KK7 Z;  3WHU B;  1M39 A;  1K9K A;  1L2O B;  4IL1 A;  2RGI A;  2AUC A;  4GBA A;  2K61 A;  1KSM A;  5AEQ A;  1F4O A;  2I2R E;  2MLF C;  4QJ4 B;  4GAO A;  1B8C A;  4MSP A;  1RTP 1;  2K7C A;  2BKI B;  4GGF C;  2LMU A;  4GNK B;  1KFX S;  1YX7 A;  2TN4 A;  1ALV A;  1MUX A;  2KFF A;  1JFK A;  2PVB A;  5AAN A;  3BQ3 A;  2ZNE A;  2OS8 B;  3WXA A;  2CNP A;  1S6I A;  2JXL A;  1JFJ A;  1BJF A;  2NLN A;  1QV1 A;  1GQM A;  1YUT A;  2EC6 B;  4AQI A;  2K2F A;  4M2O A;  1YVH A;  3RM1 A;  4XYN A;  2I7A A;  3AKA A;  1DJI A;  2HQW A;  1M31 A;  3OX6 A;  2JQ6 A;  1TNP A;  2F3Z A;  1CLM A;  3EK4 A;  3DVM A;  3I5H B;  4GGN A;  5DKN A;  2L98 A;  4HRG A;  5J3X A;  1YUR A;  2M1K B;  2M8U A;  1B7T Z;  1Y1A A;  2O5G A;  2LAP A;  1XA5 A;  5CSN A;  3I5G C;  1K93 D;  2M3W A;  2VRG A;  5CPV A;  1KFU S;  1TOP A;  4YGB B;  5D7F A;  1K8U A;  5CSI A;  2A4J A;  3VRQ A;  1XK4 C;  3TS5 B;  1K96 A;  1AJ4 A;  4DCK A;  1Y1X A;  5HKW A;  2OS8 C;  4PE4 A;  1SCV A;  2LLS A;  3D0Y B;  4MRX A;  3DVK A;  1XFX O;  1WDC B;  2GV5 A;  2V53 A;  2EC6 C;  1CFC A;  1CM1 A;  4MRY A;  2M29 A;  3VRR A;  3GK2 A;  1SL9 A;  1NX1 A;  1F55 A;  3ZNI A;  1LKJ A;  1BG1 A;  3PAL A;  1TTX A;  2LVK A;  3PM8 A;  3AAK A;  3KF9 A;  2BCB A;  3I5H C;  1DJH A;  4PHJ A;  2MJW B;  2BKH B;  4A4C A;  2LE9 B;  3GK4 X;  4MZJ A;  1FI6 A;  3HX4 A;  4MBE A;  1RWY A;  3A8R A;  2M1U A;  4ICB A;  1SL8 A;  1J7P A;  2LV7 A;  1CB1 A;  1DF0 B;  1REC A;  2KOT A;  1ZMZ A;  3TS5 C;  2K7O A;  1JC2 A;  2JT3 A;  2L4H A;  5AFP A;  1DJZ A;  2L5X B;  1OE9 B;  2KFH A;  2LHL A;  1WDC C;  2WCE A;  1CMG A;  4OVN F;  4YGD B;  1OZS A;  2Y5I A;  4FQO A;  4PHM A;  2EHB A;  3NXA A;  2HET A;  1YX8 A;  3KEV A;  4N1G A;  3TUY B;  2G9B A;  1J7O A;  3NSO A;  1N65 A;  2LVJ A;  2HF5 A;  2H61 A;  1OMR A;  3H4S E;  1EG4 A;  5KTY A;  1S5G Z;  2BEC A;  1CNP A;  3OX5 A;  1BT6 A;  1J1E A;  2JC2 A;  1PVA A;  1B8L A;  1SL7 A;  1C7V A;  3FS7 A;  1CMF A;  3E3R A;  3EK8 A;  1ALW A;  4C0K A;  4WRI A;  1YUS A;  5B8I B;  4I5K A;  2D8N A;  1WLZ A;  2KQ6 A;  3CS1 A;  2JT0 A;  1DGU A;  1J1D A;  3D10 A;  1CM4 A;  1KQM B;  1ZOT B;  1J7Q A;  1F71 A;  1NWD A;  2KAX A;  1ODB A;  1YRU B;  2JXC A;  3SG6 A;  4GPL B;  3TUY C;  1TNQ A;  2L0P A;  3ICB A;  1BOD A;  5I2L A;  1SR6 B;  2BE4 A;  4JQ0 D;  1OOJ A;  4MN0 A;  2K7D A;  4OCI A;  1KCY A;  5AER A;  3ZWH A;  1S36 A;  5BPJ A;  1UUR A;  4OV2 A;  1IQ3 A;  3MSE B;  1BMO A;  3BUM B;  3K21 A;  1NCZ A;  2LHI A;  1S6C A;  3FWC A;  2LMT A;  1BLQ A;  2QAC A;  1NUB A;  3CR2 A;  3BUW B;  1HT9 A;  1TNW A;  1SPY A;  2Y1M A;  1DGV A;  4NQG A;  4HRH A;  4YI9 A;  4DUQ A;  5KSZ A;  3PAT A;  3OB1 B;  1MXE A;  2M9G A;  3AKB A;  3KHE A;  3O4Y A;  5GQQ C;  1UHH A;  1KQM C;  1NCX A;  1MQ1 A;  2KNE A;  2LM5 A;  2CXJ A;  2NCP A;  1AHR A;  4UPG A;  4C0J A;  2JWW A;  3PN7 B;  1V1F A;  1A29 A;  3O78 A;  2EGD A;  1H4B A;  4P5O E;  1RFJ A;  2KAY A;  2Y1N A;  3NSI A;  3BYA A;  4MEW A;  2HQ8 A;  2PMY A;  2JTT A;  3JTD B;  1SK6 D;  1XYD A;  4OR9 B;  1FF1 A;  2LUX A;  2WND A;  2GGZ A;  1NX0 A;  2JNF A;  4Q04 A;  1L2O C;  1SW8 A;  2LP3 A;  1MF8 B;  3SIA A;  1WY9 A;  1BR4 B;  4QJ5 B;  5HKY A;  1JWD A;  3HCM A;  3OHM B;  3LK1 A;  1MHO A;  1MXL C;  3GK1 A;  1JSA A;  1E8A A;  2IS9 A;  3SG4 A;  2KYF A;  3TDZ A;  1A75 A;  2M7L A;  2OTG B;  1YTZ C;  2ZN8 A;  1IQ5 A;  1C7W A;  4L9M A;  4PDZ A;  1F54 A;  1LA3 A;  3PN7 C;  1DJY A;  1PSB A;  2PSR A;  1NX3 A;  1QV0 A;  1XVJ A;  4N5X A;  5CSF A;  1K9U A;  1M45 A;  2JTZ A;  1TN4 A;  4YGC B;  2M0R A;  3JTD C;  2LLT A;  3PSR A;  3KO0 A;  5IBW A;  1HQV A;  1AP4 A;  1L7Z A;  5I2O A;  1G4Y R;  1YR5 A;  1CLL A;  1QVI Y;  4CLN A;  1IH0 A;  2JUL A;  2GGM A;  1WLM A;  1XFV O;  2CTN A;  3PFV A;  4DS7 A;  1JBA A;  4E68 A;  5I8N A;  2Y4Q A;  1FI5 A;  1CFF A;  1IKU A;  1K90 D;  1PUL A;  1CFP A;  1WRZ A;  2OTG C;  1J7R A;  1N0Y A;  4WQ3 A;  1R2U A;  2K0J A;  2QPT A;  1FPW A;  1IJ5 A;  2O60 A;  2BBM A;  1G8I A;  1QAS A;  2CT9 A;  2KGB C;  2M49 B;  4PCW A;  5F6T A;  2JPT A;  3TDU A;  1TNX A;  1OZO A;  1YRT B;  1CFD A;  2K7B A;  4PE0 A;  4WQ2 A;  5ER5 A;  2BCX A;  4JPZ B;  1A4P A;  1B4C A;  2KBM A;  4MLW A;  1RRO A;  1K2H A;  1N2D A;  2F3Y A;  1OQP A;  3CLN A;  2F8P A;  5TNC A;  3DF0 A;  4MZL A;  1S6J A;  4DIR A;  2B1U A;  3NSK A;  4HSZ A;  4YGE B;  3VRO A;  5G08 A;  2MBX A;  2FCD A;  3NSL A;  5ER4 X;  2FCE A;  4ZCV A;  5HLO A;  1JUO A;  1EG3 A;  3EKH A;  4F0Z B;  2L50 A;  3CR5 X;  1CLB A;  3LK0 A;  3DVE A;  1PK0 D;  2H61 C;  1R6P A;  2KI4 B;  1UHJ A;  1U5I B;  1SKT A;  2H2K A;  4DRW A;  1K9P A;  3TDI A;  3CWG A;  1RK9 A;  1GGW A;  2I94 A;  2COL B;  4ZCU A;  1K95 A;  2F2O A;  3IQO A;  3CGA A;  3OB2 B;  4BY4 A;  1S1E A;  1XFU O;  3M0W A;  1BOC A;  1QVI Z;  1KFU L;  2L51 A;  3PLF B;  1CTR A;  2KQY A;  1IRJ A;  5HLV A;  1BR1 B;  1QX2 A;  1IJ6 A;  3EVU A;  1YVL A;  4CFR A;  4XJK B;  1AVS A;  2KGR A;  3VGO A;  1FBV A;  2BL0 B;  1YUU A;  5DKQ A;  1A2X A;  1B8R A;  5DKR A;  1U5I A;  2E30 A;  1B1G A;  2L2E A;  2MA2 A;  2Q91 A;  3EKJ A;  1WRK A;  2LMV A;  4N1F A;  1CDL A;  4PHK A;  3OP0 A;  2KI4 C;  2F33 A;  1G33 A;  1OMV A;  1Y1U A;  3BUN B;  1QXP A;  2ZRT A;  3WNX B;  1F70 A;  2K2A A;  2JOJ A;  3LL8 B;  4GUK A;  1BF5 A;  4AQJ A;  2NZ0 A;  1UP5 A;  4ETO A;  1SBJ A;  3SJS A;  2BBN A;  4YBH B;  4XJK A;  3FIA A;  3SG7 A;  4I5J A;  4P2Y B;  1PAL A;  1DJG A;  1QX7 A;  5I2Q A;  1MWN A;  2MAZ A;  1A75 B;  1DJX A;  1K94 A;  1PRW A;  1SR6 C;  3CTN A;  2KI6 C;  3CR4 X;  3KPX A;  1OSA A;  1UHN A;  5JOL A;  4GGF A;  1AJ5 A;  1C07 A;  2LVV A;  2BL0 C;  1Y6W A;  1EL4 A;  1SNL A;  2FOT A;  2WC8 A;  3DVJ A;  2LNK A;  2G2B A;  3SG5 A;  4CID A;  1SY9 A;  3BUO B;  2F2P A;  4CPV A;  1VRK A;  2PAS A;  4HRE E;  3I5G B;  5JJG A;  3EVR A;  1TCO B;  1GGZ A;  1KQV A;  1NSH A;  4MZK A;  1TIZ A;  5FYX A;  1OMD A;  3I5F B;  1JF2 A;  1V1G A;  3SIB A;  2LP2 A;  2LVI A;  2JRF A;  4A4B A;  4OKH A;  1A03 A;  1PSR A;  1QX5 B;  1B9A A;  1W7I B;  3GOF A;  4I5L B;  4ORA B;  1QJT A;  2ZN9 A;  3DD4 A;  5HKZ A;  2DOQ A;  3VRN A;  1WRL A;  4YI8 A;  4GFT A;  1LIN A;  2KSP A;  2JU0 A;  1QIW A;  2BE6 A;  1D1O A;  2CCM A;  5KU1 A;  2E6W A;  3IQQ A;  4PE7 A;  1AUI B;  5K89 A;  1JF0 A;  1ZFS A;  4D1E A;  1KWO B;  3BOW B;  1PVB A;  1XK4 A;  3AAJ A;  4C0L A;  3LLE A;  1QTX A;  2KYC A;  2SCP A;  3SG3 A;  3DF0 B;  4MVF A;  1CDP A;  1S5G Y;  2SAS A;  1LA0 A;  1BU3 A;  4CFQ A;  4AOM A;  3I5F C;  1S3P A;  4NDB A;  1DTL A;  3IF7 A;  1EXR A;  2LUC A;  2AMI A;  2Q4U A;  1W7J B;  4FTG A;  1Q80 A;  1ZUZ A;  1SCM B;  3EK7 A;  3FWB A;  1NX2 A;  3BOW A;  1TRF A;  2JT8 A;  1S26 D;  1UHK A;  3O6B A;  3O2P A;  4QJ3 B;  2P6B B;  1KFX L;  1QLS A;  1KWO C;  5CSJ A;  1XFZ O;  1ZAC A;  1CDN A;  2JZI A;  1NYA A;  1X02 A;  1NP8 A;  4M2P A;  1SYM A;  1XO5 A;  2LCP A;  3D0Y A;  3JVT B;  1UWO A;  3BUX B;  1IWQ A;  2CBL A;  4PHN A;  2WCB A;  1KK8 B;  1KK7 Y;  3VRP A;  1QAT A;  2WOR A;  2WCF A;  2ZKM X;  4TNC A;  2KAV A;  5HYD A;  4PAL A;  1Y0V H;  2BCA A;  2MHH A;  2HPS A;  2ZFD A;  4JWQ A;  1NPQ A;  3TZ1 A;  1NCY A;  4M2Q A;  4NDD A;  4ORB B;  1KSO A;  2NXQ A;  3RLZ A;  1QIV A;  1SCM C;  2MLE C;  2WOS A;  3QRX A;  1EJ3 A;  2KI6 D;  2PAL A;  5D69 A;  1H8B A;  5PAL A;  1DVI A;  1NIW A;  1FW4 A;  1XFW O;  3I5I B;  1F4Q A;  1DF0 A;  2KDH A;  1MR8 A;  1AK8 A;  1UHI A;  4ORC B;  1DT7 B;  3A4U B;  2ISD A;  4YRU A;  3C1V A;  2KBI A;  2LAN A;  3BXK A;  1TCF A;  3JVT C;  1EH2 A;  2ZRS A;  3LCP C;  4USL A;  3WHT B;  3F45 A;  2OPO A;  1GJY A;  1KK8 C;  1F8H A;  2LC5 A;  5AXI A;  1DMO A;  2R2I A;  2K8M B;  2LLU A;  2I18 A;  4I5N B; 
#chains in the Genus database with same CATH topology
 1J55 A;  1M46 A;  1RJV A;  4U8D A;  3RZS A;  1LVC D;  1CKK A;  4YGA A;  2PYQ A;  1IG5 A;  1B7T Y;  3B6X A;  3L47 A;  2L4I A;  1LXF C;  2JNX A;  1B47 A;  2NCO A;  3R1V A;  3SG2 A;  2GTE A;  3EVV A;  4NDC A;  2M97 A;  1SMG A;  2FJU B;  2KFG A;  3CZT X;  1SRA A;  1DJW A;  4PE1 A;  2KHN A;  2M7N A;  2P71 A;  1M63 B;  3DZT A;  4BY5 A;  4R1E A;  1QLK A;  2ZND A;  3I5I C;  1UUS A;  2AAO A;  2MRD A;  2PRU A;  1CDM A;  1IGV A;  1XFY O;  1QS7 A;  1KK7 Z;  3FE8 A;  3WHU B;  1IIO A;  1M39 A;  1K9K A;  4INX A;  1L2O B;  4IL1 A;  2RGI A;  2AUC A;  4GBA A;  2K61 A;  1KSM A;  5AEQ A;  1F4O A;  2I2R E;  2MLF C;  3BJH A;  4QJ4 B;  4GAO A;  1B8C A;  4MSP A;  1RTP 1;  2K7C A;  2BKI B;  4GGF C;  2LMU A;  4GNK B;  1KFX S;  1YX7 A;  2PQL A;  2TN4 A;  3VB1 A;  2BNX A;  1ALV A;  1MUX A;  2KFF A;  1JFK A;  2PVB A;  5AAN A;  3BQ3 A;  2ZNE A;  2OS8 B;  3WXA A;  2CNP A;  1S6I A;  2JXL A;  1JFJ A;  1BJF A;  1TWO A;  2NLN A;  1QV1 A;  1GQM A;  1YUT A;  2EC6 B;  4AQI A;  2K2F A;  5DIC A;  3QME A;  4M2O A;  1YVH A;  3RM1 A;  4XYN A;  2I7A A;  3AKA A;  1DJI A;  2HQW A;  1M31 A;  3OX6 A;  2JQ6 A;  1TNP A;  2F3Z A;  1CLM A;  3EK4 A;  3DVM A;  3I5H B;  4GGN A;  5DKN A;  2L98 A;  3EG5 B;  4HRG A;  1YUR A;  5J3X A;  2M1K B;  2M8U A;  1B7T Z;  1Y1A A;  2O5G A;  2LAP A;  1XA5 A;  5CSN A;  3I5G C;  1K93 D;  2M3W A;  2VRG A;  5CPV A;  1KFU S;  1TOP A;  4YGB B;  5D7F A;  5FI7 A;  1K8U A;  5CSI A;  2A4J A;  5HL1 A;  3VRQ A;  1XK4 C;  3TS5 B;  1K96 A;  1AJ4 A;  4DCK A;  1Y1X A;  5HKW A;  1SSE B;  2OS8 C;  4PE4 A;  1SCV A;  2LLS A;  3D0Y B;  4MRX A;  3DVK A;  1XFX O;  1WDC B;  2GV5 A;  2V53 A;  3B7A A;  2EC6 C;  2WCM A;  3D77 A;  1CFC A;  1CM1 A;  4MRY A;  2M29 A;  3VRR A;  2ERB A;  3GK2 A;  1SL9 A;  1NX1 A;  1F55 A;  3ZNI A;  1LKJ A;  1BG1 A;  3PAL A;  1TTX A;  2LVK A;  1OW4 A;  3PM8 A;  3AAK A;  3KF9 A;  2BCB A;  3I5H C;  1DJH A;  2WCK A;  3R1P A;  4PHJ A;  2MJW B;  2BKH B;  4A4C A;  2LE9 B;  1W9Z A;  3GK4 X;  4MZJ A;  1FI6 A;  3HX4 A;  3V2L A;  4MBE A;  1RWY A;  3A8R A;  2M1U A;  4ICB A;  1SL8 A;  1J7P A;  2LV7 A;  1CB1 A;  3PM2 A;  1DF0 B;  1REC A;  2KOT A;  1OOI X;  1ZMZ A;  3TS5 C;  2K7O A;  1JC2 A;  2JT3 A;  2L4H A;  1DEK A;  5AFP A;  1DJZ A;  3SS4 A;  2L5X B;  1OE9 B;  2KFH A;  2LHL A;  1WDC C;  2WCE A;  5D3O A;  1CMG A;  4FQT A;  4OVN F;  4YGD B;  1OZS A;  2Y5I A;  4FQO A;  4PHM A;  4JKT A;  2EHB A;  3NXA A;  2HET A;  1YX8 A;  3KEV A;  4N1G A;  3TUY B;  1DEL A;  2G9B A;  1TUJ A;  1J7O A;  3NSO A;  1N65 A;  2LVJ A;  2HF5 A;  4IJ7 A;  4KYN A;  2H61 A;  1OMR A;  3H4S E;  1EG4 A;  5KTY A;  1S5G Z;  3DYE A;  2BEC A;  1CNP A;  3OX5 A;  1BT6 A;  1J1E A;  2JC2 A;  1PVA A;  1B8L A;  1SL7 A;  1C7V A;  3FS7 A;  1CMF A;  3E3R A;  3EK8 A;  1ALW A;  4C0K A;  4WRI A;  1YUS A;  5B8I B;  4I5K A;  2D8N A;  1WLZ A;  2KQ6 A;  3CS1 A;  4F7F A;  2JT0 A;  1DGU A;  1J1D A;  3D10 A;  1CM4 A;  1KQM B;  1ZOT B;  1J7Q A;  1F71 A;  1NWD A;  2BAP A;  2KAX A;  1ODB A;  1YRU B;  2JXC A;  3SG6 A;  4GPL B;  3TUY C;  1TNQ A;  2L0P A;  2QEB A;  3ICB A;  1BOD A;  5I2L A;  3CZ2 A;  1SR6 B;  2BE4 A;  4JQ0 D;  1OOJ A;  4MN0 A;  2K7D A;  1OOH A;  4OCI A;  1KCY A;  2WC5 A;  5AER A;  3ZWH A;  4INW A;  1S36 A;  4PT1 A;  5BPJ A;  1UUR A;  4OV2 A;  1IQ3 A;  3S0D A;  3MSE B;  1BMO A;  3BUM B;  3K21 A;  1NCZ A;  2LHI A;  1S6C A;  3FWC A;  2LMT A;  1BLQ A;  2QAC A;  1OOF A;  1NUB A;  3CR2 A;  3BUW B;  1HT9 A;  1TNW A;  1SPY A;  2Y1M A;  1DGV A;  4NQG A;  4HRH A;  4YI9 A;  4DUQ A;  5KSZ A;  3PAT A;  1OOG A;  3OB1 B;  1MXE A;  2M9G A;  3AKB A;  3KHE A;  3R1O A;  3O4Y A;  3CYZ A;  5GQQ C;  1UHH A;  5FI2 A;  1KQM C;  1NCX A;  1MQ1 A;  2KNE A;  2LM5 A;  2CXJ A;  2NCP A;  1AHR A;  2YGU A;  4UPG A;  4C0J A;  2JWW A;  3PN7 B;  1V1F A;  1A29 A;  3O78 A;  2EGD A;  1H4B A;  1TUZ A;  4P5O E;  1RFJ A;  2KAY A;  2Y1N A;  3NSI A;  3BYA A;  1LS8 A;  4MEW A;  5I94 A;  2HQ8 A;  2PMY A;  2JTT A;  3JTD B;  1SK6 D;  1XYD A;  3DXL A;  4OR9 B;  2LUX A;  1FF1 A;  2WND A;  2GGZ A;  1NX0 A;  2JNF A;  4Q04 A;  1L2O C;  1SW8 A;  2LP3 A;  1MF8 B;  3SIA A;  1WY9 A;  1BR4 B;  4QJ5 B;  5HKY A;  3S0A A;  1JWD A;  3HCM A;  3OHM B;  3LK1 A;  1MHO A;  1MXL C;  3GK1 A;  1JSA A;  1E8A A;  2IS9 A;  2L5Y A;  3SG4 A;  2KYF A;  3TDZ A;  1A75 A;  2M7L A;  2OTG B;  1YTZ C;  2ZN8 A;  5FI6 A;  1IQ5 A;  1C7W A;  4L9M A;  4PDZ A;  3D74 A;  1F54 A;  1LA3 A;  3PN7 C;  1DJY A;  1PSB A;  2PSR A;  1NX3 A;  1QV0 A;  1XVJ A;  3S0G A;  4N5X A;  5CSF A;  1K9U A;  1M45 A;  2JTZ A;  1TN4 A;  4YGC B;  2M0R A;  3JTD C;  2LLT A;  3PSR A;  3KO0 A;  5IBW A;  3B86 A;  2K60 A;  1HQV A;  1AP4 A;  1L7Z A;  5I2O A;  1T14 A;  1G4Y R;  1YR5 A;  1CLL A;  1QVI Y;  4CLN A;  1IH0 A;  2JUL A;  2GGM A;  1WLM A;  1XFV O;  2CTN A;  3PFV A;  4DS7 A;  1JBA A;  4E68 A;  5I8N A;  2Y4Q A;  1FI5 A;  1CFF A;  1IKU A;  1K90 D;  1PUL A;  1CFP A;  1WRZ A;  2OTG C;  1J7R A;  1N0Y A;  4WQ3 A;  1R2U A;  2K0J A;  2QPT A;  1FPW A;  1IJ5 A;  1ORG A;  1Z4H A;  1G8I A;  1QAS A;  2BBM A;  2CT9 A;  2KGB C;  2M49 B;  2O60 A;  2JPT A;  4PCW A;  5F6T A;  1TNX A;  3TDU A;  1XFR A;  1OZO A;  1YRT B;  1CFD A;  2K7B A;  4PE0 A;  4WQ2 A;  5ER5 A;  2WCJ A;  2BCX A;  4JPZ B;  1A4P A;  1B4C A;  2KBM A;  4MLW A;  1RRO A;  1K2H A;  1N2D A;  2F3Y A;  1OQP A;  3CLN A;  2F8P A;  5TNC A;  3DF0 A;  4MZL A;  1S6J A;  4DIR A;  2B1U A;  3NSK A;  4HSZ A;  2WCH A;  3CZ0 A;  4YGE B;  5G08 A;  2MBX A;  3VRO A;  2FCD A;  3NSL A;  5ER4 X;  2FCE A;  4ZCV A;  5HLO A;  1JUO A;  1EG3 A;  3EKH A;  3BFA A;  4F0Z B;  3CAB A;  2L50 A;  4JD9 A;  3CR5 X;  1CLB A;  2QEV A;  3LK0 A;  3DVE A;  1PK0 D;  2H61 C;  3FE6 A;  3L4L A;  1R6P A;  2KI4 B;  1UHJ A;  3PJI A;  1U5I B;  1SKT A;  2H2K A;  4DRW A;  1K9P A;  3TDI A;  3CWG A;  1QWV A;  1RK9 A;  1GGW A;  2I94 A;  2COL B;  4ZCU A;  1K95 A;  2F2O A;  3IQO A;  3CGA A;  3OB2 B;  4BY4 A;  1S1E A;  1XFU O;  3M0W A;  2QEH A;  3SS5 A;  1BOC A;  1QVI Z;  1KFU L;  2L51 A;  3PLF B;  1CTR A;  2KQY A;  1IRJ A;  5HLV A;  1BR1 B;  1QX2 A;  1IJ6 A;  3EVU A;  1YVL A;  4CFR A;  4XJK B;  1C3Y A;  1AVS A;  2KGR A;  3VGO A;  1FBV A;  2BL0 B;  1YUU A;  5DKQ A;  1A2X A;  1B8R A;  5DKR A;  1U5I A;  2E30 A;  1B1G A;  2L2E A;  2MA2 A;  2Q91 A;  3EKJ A;  1WRK A;  2LMV A;  4N1F A;  1CDL A;  4PHK A;  1C3Z A;  3KPX A;  3OP0 A;  2KI4 C;  2F33 A;  1G33 A;  1OMV A;  1Y1U A;  3BUN B;  1QXP A;  2ZRT A;  3UO9 A;  3WNX B;  2K2A A;  1F70 A;  2JOJ A;  3LL8 B;  3R72 A;  4GUK A;  1BF5 A;  4AQJ A;  2NZ0 A;  1UP5 A;  4ETO A;  1SBJ A;  3SJS A;  2BBN A;  4YBH B;  4XJK A;  3FIA A;  3SG7 A;  4I5J A;  4P2Y B;  1PAL A;  1DJG A;  1QX7 A;  5I2Q A;  1MWN A;  2MAZ A;  1A75 B;  1DJX A;  1K94 A;  1PRW A;  1SR6 C;  2P70 A;  2KI6 C;  3CR4 X;  3CDN A;  1OSA A;  3CTN A;  1UHN A;  5JOL A;  3OBV A;  4GGF A;  1AJ5 A;  1C07 A;  3IVT A;  2LVV A;  2BL0 C;  1Y6W A;  1EL4 A;  1SNL A;  2FOT A;  2WC8 A;  3DVJ A;  2LNK A;  2G2B A;  3SG5 A;  4CID A;  1SY9 A;  3BUO B;  3FE9 A;  2F2P A;  4CPV A;  1VRK A;  2PAS A;  3B88 A;  4HRE E;  3I5G B;  5JJG A;  3EVR A;  1TCO B;  2WCL A;  1GGZ A;  1KQV A;  1NSH A;  3NHT A;  4MZK A;  1TIZ A;  5FYX A;  1OMD A;  3S0B A;  3I5F B;  1JF2 A;  1V1G A;  3SIB A;  2LP2 A;  2LVI A;  2JRF A;  4A4B A;  4OKH A;  1A03 A;  1PSR A;  1QX5 B;  1B9A A;  3L4A A;  1W7I B;  3GOF A;  4I5L B;  4ORA B;  1QJT A;  2ZN9 A;  3DD4 A;  5HKZ A;  2DOQ A;  3D76 A;  3VRN A;  1WRL A;  4YI8 A;  4GFT A;  1Z2C B;  3D73 A;  1LIN A;  2KSP A;  2JU0 A;  1QIW A;  2BE6 A;  1D1O A;  2CCM A;  5KU1 A;  3S0F A;  2E6W A;  3IQQ A;  3BFB A;  1AUI B;  3Q8I A;  4PE7 A;  1JF0 A;  1ZFS A;  4D1E A;  5K89 A;  1KWO B;  3BOW B;  1PVB A;  1XK4 A;  3AAJ A;  3B87 A;  3UNW A;  4C0L A;  3LLE A;  1QTX A;  2KLE A;  2KYC A;  2SCP A;  3SG3 A;  2KPH A;  3DF0 B;  4MVF A;  1CDP A;  1S5G Y;  2SAS A;  1LA0 A;  3D78 A;  1BU3 A;  4CFQ A;  4AOM A;  3I5F C;  1S3P A;  4NDB A;  1DTL A;  3IF7 A;  1EXR A;  2KLD A;  2LUC A;  2AMI A;  2Q4U A;  1W7J B;  4FTG A;  1Q80 A;  1ZUZ A;  1SCM B;  3EK7 A;  3FWB A;  1NX2 A;  3BOW A;  1TRF A;  2JT8 A;  3N7H A;  1S26 D;  1UHK A;  3O6B A;  3O2P A;  4QJ3 B;  1DQE A;  2FJY A;  2P6B B;  1KFX L;  1QLS A;  1KWO C;  5CSJ A;  1XFZ O;  1ZAC A;  1CDN A;  2H8V A;  2JZI A;  1NYA A;  1X02 A;  3D75 A;  1NP8 A;  4M2P A;  1SYM A;  1XO5 A;  2LCP A;  3DY9 A;  3NHI A;  3D0Y A;  3JVT B;  1UWO A;  2QEO A;  3BUX B;  1IWQ A;  2CBL A;  4PHN A;  2WCB A;  1KK8 B;  1KK7 Y;  2JPO A;  3VRP A;  3O4X A;  1QAT A;  2WOR A;  2WCF A;  2ZKM X;  4TNC A;  4OZD A;  3S0E A;  2KAV A;  5HYD A;  4PAL A;  1Y0V H;  2BCA A;  2MHH A;  3NGV A;  2HPS A;  2ZFD A;  4JWQ A;  1NPQ A;  1P28 A;  3CZ1 A;  1NCY A;  4M2Q A;  4NDD A;  3TZ1 A;  4ORB B;  1KSO A;  2NXQ A;  3RLZ A;  1GM0 A;  1QIV A;  1SCM C;  2MLE C;  2WOS A;  5EL2 A;  3QRX A;  3SS3 A;  1EJ3 A;  2KI6 D;  2PAL A;  5D69 A;  1H8B A;  5PAL A;  1DVI A;  3K1E A;  1NIW A;  1FW4 A;  1XFW O;  3I5I B;  1F4Q A;  1DF0 A;  2KDH A;  1MR8 A;  1AK8 A;  1UHI A;  3BFH A;  4ORC B;  2WC6 A;  1DT7 B;  3A4U B;  2ISD A;  4YRU A;  2L2C A;  2KBI A;  3C1V A;  2LAN A;  3BXK A;  1TCF A;  3JVT C;  1EH2 A;  2ZRS A;  3LCP C;  4USL A;  3WHT B;  3F45 A;  2OPO A;  1DC1 A;  1GJY A;  1KK8 C;  3OGN A;  2LC5 A;  5AXI A;  1DMO A;  1F8H A;  2R2I A;  2K8M B;  2LLU A;  2QDI A;  2I18 A;  4I5N B; 
#chains in the Genus database with same CATH homology
 1J55 A;  1M46 A;  1RJV A;  4U8D A;  1CKK A;  1LVC D;  4YGA A;  1IG5 A;  1B7T Y;  2L4I A;  1LXF C;  2JNX A;  1B47 A;  2NCO A;  3SG2 A;  3EVV A;  4NDC A;  2M97 A;  1SMG A;  2FJU B;  2KFG A;  3CZT X;  1SRA A;  1DJW A;  4PE1 A;  2KHN A;  2M7N A;  4BY5 A;  1M63 B;  4R1E A;  1QLK A;  2ZND A;  3I5I C;  1UUS A;  2AAO A;  2MRD A;  2PRU A;  1CDM A;  1IGV A;  1XFY O;  1QS7 A;  1KK7 Z;  3WHU B;  1M39 A;  1K9K A;  1L2O B;  4IL1 A;  2RGI A;  2AUC A;  4GBA A;  2K61 A;  1KSM A;  5AEQ A;  1F4O A;  2I2R E;  2MLF C;  4QJ4 B;  4GAO A;  1B8C A;  4MSP A;  1RTP 1;  2K7C A;  2BKI B;  4GGF C;  2LMU A;  4GNK B;  1KFX S;  1YX7 A;  2TN4 A;  1ALV A;  1MUX A;  2KFF A;  1JFK A;  2PVB A;  5AAN A;  3BQ3 A;  2ZNE A;  2OS8 B;  3WXA A;  2CNP A;  1S6I A;  2JXL A;  1JFJ A;  1BJF A;  2NLN A;  1QV1 A;  1GQM A;  1YUT A;  2EC6 B;  4AQI A;  2K2F A;  4M2O A;  1YVH A;  3RM1 A;  4XYN A;  2I7A A;  3AKA A;  1DJI A;  2HQW A;  1M31 A;  3OX6 A;  2JQ6 A;  1TNP A;  2F3Z A;  1CLM A;  3EK4 A;  3DVM A;  3I5H B;  4GGN A;  5DKN A;  2L98 A;  4HRG A;  5J3X A;  1YUR A;  2M1K B;  2M8U A;  1B7T Z;  1Y1A A;  2O5G A;  2LAP A;  1XA5 A;  5CSN A;  3I5G C;  1K93 D;  2M3W A;  2VRG A;  5CPV A;  1KFU S;  1TOP A;  4YGB B;  5D7F A;  1K8U A;  5CSI A;  2A4J A;  3VRQ A;  1XK4 C;  3TS5 B;  1K96 A;  1AJ4 A;  4DCK A;  1Y1X A;  5HKW A;  2OS8 C;  4PE4 A;  1SCV A;  2LLS A;  3D0Y B;  4MRX A;  3DVK A;  1XFX O;  1WDC B;  2GV5 A;  2V53 A;  2EC6 C;  1CFC A;  1CM1 A;  4MRY A;  2M29 A;  3VRR A;  3GK2 A;  1SL9 A;  1NX1 A;  1F55 A;  3ZNI A;  1LKJ A;  1BG1 A;  3PAL A;  1TTX A;  2LVK A;  3PM8 A;  3AAK A;  3KF9 A;  2BCB A;  3I5H C;  1DJH A;  4PHJ A;  2MJW B;  2BKH B;  4A4C A;  2LE9 B;  3GK4 X;  4MZJ A;  1FI6 A;  3HX4 A;  4MBE A;  1RWY A;  3A8R A;  2M1U A;  4ICB A;  1SL8 A;  1J7P A;  2LV7 A;  1CB1 A;  1DF0 B;  1REC A;  2KOT A;  1ZMZ A;  3TS5 C;  2K7O A;  1JC2 A;  2JT3 A;  2L4H A;  5AFP A;  1DJZ A;  2L5X B;  1OE9 B;  2KFH A;  2LHL A;  1WDC C;  2WCE A;  1CMG A;  4OVN F;  4YGD B;  1OZS A;  2Y5I A;  4FQO A;  4PHM A;  2EHB A;  3NXA A;  2HET A;  1YX8 A;  3KEV A;  4N1G A;  3TUY B;  2G9B A;  1J7O A;  3NSO A;  1N65 A;  2LVJ A;  2HF5 A;  2H61 A;  1OMR A;  3H4S E;  1EG4 A;  5KTY A;  1S5G Z;  2BEC A;  1CNP A;  3OX5 A;  1BT6 A;  1J1E A;  2JC2 A;  1PVA A;  1B8L A;  1SL7 A;  1C7V A;  3FS7 A;  1CMF A;  3E3R A;  3EK8 A;  1ALW A;  4C0K A;  4WRI A;  1YUS A;  5B8I B;  4I5K A;  2D8N A;  1WLZ A;  2KQ6 A;  3CS1 A;  2JT0 A;  1DGU A;  1J1D A;  3D10 A;  1CM4 A;  1KQM B;  1ZOT B;  1J7Q A;  1F71 A;  1NWD A;  2KAX A;  1ODB A;  1YRU B;  2JXC A;  3SG6 A;  4GPL B;  3TUY C;  1TNQ A;  2L0P A;  3ICB A;  1BOD A;  5I2L A;  1SR6 B;  2BE4 A;  4JQ0 D;  1OOJ A;  4MN0 A;  2K7D A;  4OCI A;  1KCY A;  5AER A;  3ZWH A;  1S36 A;  5BPJ A;  1UUR A;  4OV2 A;  1IQ3 A;  3MSE B;  1BMO A;  3BUM B;  3K21 A;  1NCZ A;  2LHI A;  1S6C A;  3FWC A;  2LMT A;  1BLQ A;  2QAC A;  1NUB A;  3CR2 A;  3BUW B;  1HT9 A;  1TNW A;  1SPY A;  2Y1M A;  1DGV A;  4NQG A;  4HRH A;  4YI9 A;  4DUQ A;  5KSZ A;  3PAT A;  3OB1 B;  1MXE A;  2M9G A;  3AKB A;  3KHE A;  3O4Y A;  5GQQ C;  1UHH A;  1KQM C;  1NCX A;  1MQ1 A;  2KNE A;  2LM5 A;  2CXJ A;  2NCP A;  1AHR A;  4UPG A;  4C0J A;  2JWW A;  3PN7 B;  1V1F A;  1A29 A;  3O78 A;  2EGD A;  1H4B A;  4P5O E;  1RFJ A;  2KAY A;  2Y1N A;  3NSI A;  3BYA A;  4MEW A;  2HQ8 A;  2PMY A;  2JTT A;  3JTD B;  1SK6 D;  1XYD A;  4OR9 B;  1FF1 A;  2LUX A;  2WND A;  2GGZ A;  1NX0 A;  2JNF A;  4Q04 A;  1L2O C;  1SW8 A;  2LP3 A;  1MF8 B;  3SIA A;  1WY9 A;  1BR4 B;  4QJ5 B;  5HKY A;  1JWD A;  3HCM A;  3OHM B;  3LK1 A;  1MHO A;  1MXL C;  3GK1 A;  1JSA A;  1E8A A;  2IS9 A;  3SG4 A;  2KYF A;  3TDZ A;  1A75 A;  2M7L A;  2OTG B;  1YTZ C;  2ZN8 A;  1IQ5 A;  1C7W A;  4L9M A;  4PDZ A;  1F54 A;  1LA3 A;  3PN7 C;  1DJY A;  1PSB A;  2PSR A;  1NX3 A;  1QV0 A;  1XVJ A;  4N5X A;  5CSF A;  1K9U A;  1M45 A;  2JTZ A;  1TN4 A;  4YGC B;  2M0R A;  3JTD C;  2LLT A;  3PSR A;  3KO0 A;  5IBW A;  1HQV A;  1AP4 A;  1L7Z A;  5I2O A;  1G4Y R;  1YR5 A;  1CLL A;  1QVI Y;  4CLN A;  1IH0 A;  2JUL A;  2GGM A;  1WLM A;  1XFV O;  2CTN A;  3PFV A;  4DS7 A;  1JBA A;  4E68 A;  5I8N A;  2Y4Q A;  1FI5 A;  1CFF A;  1IKU A;  1K90 D;  1PUL A;  1CFP A;  1WRZ A;  2OTG C;  1J7R A;  1N0Y A;  4WQ3 A;  1R2U A;  2K0J A;  2QPT A;  1FPW A;  1IJ5 A;  2O60 A;  2BBM A;  1G8I A;  1QAS A;  2CT9 A;  2KGB C;  2M49 B;  4PCW A;  5F6T A;  2JPT A;  3TDU A;  1TNX A;  1OZO A;  1YRT B;  1CFD A;  2K7B A;  4PE0 A;  4WQ2 A;  5ER5 A;  2BCX A;  4JPZ B;  1A4P A;  1B4C A;  2KBM A;  4MLW A;  1RRO A;  1K2H A;  1N2D A;  2F3Y A;  1OQP A;  3CLN A;  2F8P A;  5TNC A;  3DF0 A;  4MZL A;  1S6J A;  4DIR A;  2B1U A;  3NSK A;  4HSZ A;  4YGE B;  3VRO A;  5G08 A;  2MBX A;  2FCD A;  3NSL A;  5ER4 X;  2FCE A;  4ZCV A;  5HLO A;  1JUO A;  1EG3 A;  3EKH A;  4F0Z B;  2L50 A;  3CR5 X;  1CLB A;  3LK0 A;  3DVE A;  1PK0 D;  2H61 C;  1R6P A;  2KI4 B;  1UHJ A;  1U5I B;  1SKT A;  2H2K A;  4DRW A;  1K9P A;  3TDI A;  3CWG A;  1RK9 A;  1GGW A;  2I94 A;  2COL B;  4ZCU A;  1K95 A;  2F2O A;  3IQO A;  3CGA A;  3OB2 B;  4BY4 A;  1S1E A;  1XFU O;  3M0W A;  1BOC A;  1QVI Z;  1KFU L;  2L51 A;  3PLF B;  1CTR A;  2KQY A;  1IRJ A;  5HLV A;  1BR1 B;  1QX2 A;  1IJ6 A;  3EVU A;  1YVL A;  4CFR A;  4XJK B;  1AVS A;  2KGR A;  3VGO A;  1FBV A;  2BL0 B;  1YUU A;  5DKQ A;  1A2X A;  1B8R A;  5DKR A;  1U5I A;  2E30 A;  1B1G A;  2L2E A;  2MA2 A;  2Q91 A;  3EKJ A;  1WRK A;  2LMV A;  4N1F A;  1CDL A;  4PHK A;  3OP0 A;  2KI4 C;  2F33 A;  1G33 A;  1OMV A;  1Y1U A;  3BUN B;  1QXP A;  2ZRT A;  3WNX B;  1F70 A;  2K2A A;  2JOJ A;  3LL8 B;  4GUK A;  1BF5 A;  4AQJ A;  2NZ0 A;  1UP5 A;  4ETO A;  1SBJ A;  3SJS A;  2BBN A;  4YBH B;  4XJK A;  3FIA A;  3SG7 A;  4I5J A;  4P2Y B;  1PAL A;  1DJG A;  1QX7 A;  5I2Q A;  1MWN A;  2MAZ A;  1A75 B;  1DJX A;  1K94 A;  1PRW A;  1SR6 C;  3CTN A;  2KI6 C;  3CR4 X;  3KPX A;  1OSA A;  1UHN A;  5JOL A;  4GGF A;  1AJ5 A;  1C07 A;  2LVV A;  2BL0 C;  1Y6W A;  1EL4 A;  1SNL A;  2FOT A;  2WC8 A;  3DVJ A;  2LNK A;  2G2B A;  3SG5 A;  4CID A;  1SY9 A;  3BUO B;  2F2P A;  4CPV A;  1VRK A;  2PAS A;  4HRE E;  3I5G B;  5JJG A;  3EVR A;  1TCO B;  1GGZ A;  1KQV A;  1NSH A;  4MZK A;  1TIZ A;  5FYX A;  1OMD A;  3I5F B;  1JF2 A;  1V1G A;  3SIB A;  2LP2 A;  2LVI A;  2JRF A;  4A4B A;  4OKH A;  1A03 A;  1PSR A;  1QX5 B;  1B9A A;  1W7I B;  3GOF A;  4I5L B;  4ORA B;  1QJT A;  2ZN9 A;  3DD4 A;  5HKZ A;  2DOQ A;  3VRN A;  1WRL A;  4YI8 A;  4GFT A;  1LIN A;  2KSP A;  2JU0 A;  1QIW A;  2BE6 A;  1D1O A;  2CCM A;  5KU1 A;  2E6W A;  3IQQ A;  4PE7 A;  1AUI B;  5K89 A;  1JF0 A;  1ZFS A;  4D1E A;  1KWO B;  3BOW B;  1PVB A;  1XK4 A;  3AAJ A;  4C0L A;  3LLE A;  1QTX A;  2KYC A;  2SCP A;  3SG3 A;  3DF0 B;  4MVF A;  1CDP A;  1S5G Y;  2SAS A;  1LA0 A;  1BU3 A;  4CFQ A;  4AOM A;  3I5F C;  1S3P A;  4NDB A;  1DTL A;  3IF7 A;  1EXR A;  2LUC A;  2AMI A;  2Q4U A;  1W7J B;  4FTG A;  1Q80 A;  1ZUZ A;  1SCM B;  3EK7 A;  3FWB A;  1NX2 A;  3BOW A;  1TRF A;  2JT8 A;  1S26 D;  1UHK A;  3O6B A;  3O2P A;  4QJ3 B;  2P6B B;  1KFX L;  1QLS A;  1KWO C;  5CSJ A;  1XFZ O;  1ZAC A;  1CDN A;  2JZI A;  1NYA A;  1X02 A;  1NP8 A;  4M2P A;  1SYM A;  1XO5 A;  2LCP A;  3D0Y A;  3JVT B;  1UWO A;  3BUX B;  1IWQ A;  2CBL A;  4PHN A;  2WCB A;  1KK8 B;  1KK7 Y;  3VRP A;  1QAT A;  2WOR A;  2WCF A;  2ZKM X;  4TNC A;  2KAV A;  5HYD A;  4PAL A;  1Y0V H;  2BCA A;  2MHH A;  2HPS A;  2ZFD A;  4JWQ A;  1NPQ A;  3TZ1 A;  1NCY A;  4M2Q A;  4NDD A;  4ORB B;  1KSO A;  2NXQ A;  3RLZ A;  1QIV A;  1SCM C;  2MLE C;  2WOS A;  3QRX A;  1EJ3 A;  2KI6 D;  2PAL A;  5D69 A;  1H8B A;  5PAL A;  1DVI A;  1NIW A;  1FW4 A;  1XFW O;  3I5I B;  1F4Q A;  1DF0 A;  2KDH A;  1MR8 A;  1AK8 A;  1UHI A;  4ORC B;  1DT7 B;  3A4U B;  2ISD A;  4YRU A;  3C1V A;  2KBI A;  2LAN A;  3BXK A;  1TCF A;  3JVT C;  1EH2 A;  2ZRS A;  3LCP C;  4USL A;  3WHT B;  3F45 A;  2OPO A;  1GJY A;  1KK8 C;  1F8H A;  2LC5 A;  5AXI A;  1DMO A;  2R2I A;  2K8M B;  2LLU A;  2I18 A;  4I5N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...