4WQ3A

Human calpain pef(s) with (2z,2z')-2,2'-disulfanediylbis(3-(6-bromoindol-3-yl)acrylic acid) bound
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
173
structure length
173
Chain Sequence
b'EEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calpain small subunit 1
publication title Conformationally restricted calpain inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 65
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4wq3A00
1W7IB 2K7BA 5PALA 1BMOA 1SYMA 2L5XB 2NXQA 3EVUA 2M49B 4A4BA 1UHJA 2NLNA 4YI9A 2GV5A 3WHTB 2AAOA 2B1UA 5AANA 3FIAA 3IQQA 2Q91A 4QJ4B 5GQQC 1K95A 3F45A 5I2QA 1SW8A 1A03A 1SRAA 1B1GA 1NCYA 2L4IA 2CNPA 2M9GA 1SKTA 1XK4A 2KI6C 2KSPA 4PHKA 1J1DA 5AXIA 1QX2A 3O2PA 4HREE 4P2YB 3SIBA 1KK8C 2JQ6A 1BT6A 2HPSA 3IF7A 4OVNF 3PN7B 1MF8B 1LA3A 2SASA 1PRWA 2GGZA 1RTP1 1DGUA 1C07A 2AMIA 1JF0A 1CLLA 3OB1B 4I5LB 5HYDA 3I5FC 1TRFA 3JVTB 1OZSA 3AKAA 1UHHA 3FWCA 2M29A 4HRHA 3DF0B 1ZMZA 4ETOA 3PALA 4XJKA 1HT9A 1BLQA 3KPXA 2JT8A 3OB2B 3PM8A 5IBWA 4E68A 3WHUB 1NP8A 2FCDA 4YRUA 1ALWA 2ZN9A 4GGFC 4YGBB 1AUIB 2MHHA 2K0JA 4ORAB 1R6PA 2BE4A 1QATA 1YUTA 4JPZB 4YBHB 1DT7B 2KGBC 2F2PA 2MLEC 2M7LA 2K61A 4GBAA 3FS7A 5HKWA 1NIWA 1KK8B 5CSJA 5DKNA 3TUYC 3CTNA 1SK6D 2ZNDA 2H61C 5CSFA 1UHNA 1SNLA 2BCAA 4YI8A 1CMGA 2A4JA 1IQ5A 4MEWA 3WNXB 3I5FB 2KAYA 3TZ1A 3CZTX 1K9KA 4MZKA 1JWDA 1IQ3A 1Y1XA 2PSRA 4DIRA 1SCVA 1F4QA 2TN4A 1PALA 1JFJA 5KTYA 4YGAA 2KHNA 1YURA 1QV1A 4WQ3A 1LINA 2M0RA 3VROA 1LXFC 2LVVA 4YGCB 4CPVA 4CFRA 5J3XA 2KQYA 1PVAA 1WDCB 2OTGB 1CDLA 1RECA 1QLSA 1DJXA 4AQJA 1DF0B 2QPTA 1V1GA 1XFXO 3BOWB 3LK1A 1EJ3A 4QJ5B 3SG2A 1EH2A 2QACA 4GGNA 1UUSA 3SG5A 1J7PA 1WRKA 4MVFA 1F70A 2GGMA 1QIWA 2JT3A 2MJWB 3AAKA 3TUYB 1VRKA 1S26D 5AERA 1QX7A 1A29A 2CCMA 2L98A 3HCMA 1IG5A 3EK7A 4I5NB 2LE9B 1R2UA 3PLFB 2HQ8A 3NXAA 4PCWA 2I18A 1N65A 2CT9A 5BPJA 2HF5A 1BODA 1GGWA 1H4BA 2F8PA 1TCOB 3BUNB 4A4CA 1DMOA 4BY4A 1QLKA 2P6BB 5ER4X 1FF1A 1CLBA 1F54A 1YRUB 1K9PA 3GK2A 1NWDA 3JVTC 4ORBB 2ZKMX 3OP0A 5HLVA 3K21A 1UP5A 3VRQA 4NDDA 1F8HA 2KDHA 4PALA 2MBXA 1SCMC 4F0ZB 1DJHA 2EC6C 4PHMA 2Y1NA 3DVMA 3VRRA 1G4YR 5I2LA 2LVIA 1K90D 2LNKA 3OX5A 1XYDA 4AQIA 2JPTA 3GK1A 5JJGA 1BU3A 3VRPA 1AJ5A 1NX1A 1SL7A 2KBMA 2L0PA 1QVIZ 4N1GA 4XJKB 1K2HA 2WORA 1QXPA 4HRGA 2D8NA 2LMTA 3ICBA 3BUMB 1DJWA 3NSLA 1AP4A 1QS7A 1TTXA 1YTZC 1YX8A 3I5GC 1F4OA 1UHKA 2KAXA 1CDPA 2LUXA 1FW4A 2LVKA 1DJIA 1HQVA 2JULA 4C0JA 1KQVA 1U5IA 4OCIA 1SR6C 1OZOA 3BQ3A 3CWGA 2LVJA 2LANA 2O60A 2JU0A 1CNPA 3ZNIA 2ZN8A 1H8BA 1NPQA 1S6CA 1XA5A 1KSMA 1SCMB 3SG3A 2EC6B 2OPOA 2LLTA 2JXLA 1YUUA 1Y0VH 2NCPA 4PHJA 1DJYA 2DOQA 4CFQA 1TIZA 1S6IA 1KQMC 3BYAA 1TNQA 2LCPA 1XVJA 2F2OA 1MXLC 2KGRA 1WDCC 2G2BA 2OTGC 1QTXA 2ZRSA 1IJ6A 1DJZA 1WLZA 4M2PA 1CFDA 1OOJA 1QX5B 1OE9B 1S1EA 5CPVA 4L9MA 5D7FA 2Y4QA 3I5HC 1CKKA 2MLFC 4GAOA 4IL1A 1S3PA 1NUBA 2LHLA 4DCKA 1CM1A 4M2OA 5DKQA 1SBJA 2JRFA 1ZFSA 3A8RA 3I5GB 4MLWA 4OKHA 1FI5A 2I7AA 2JNFA 1SR6B 2G9BA 2L4HA 2V53A 4N1FA 1CFPA 4U8DA 1NCXA 1JFKA 3SG4A 3GOFA 2MA2A 2ZFDA 3IQOA 1QV0A 4HSZA 1CTRA 4PHNA 1Y6WA 1M45A 3PFVA 1RFJA 2LMVA 1XFYO 1IRJA 1XO5A 3LLEA 1ALVA 2LM5A 2LP2A 3SG6A 1IJ5A 1XK4C 2PRUA 4ICBA 2K2AA 4OV2A 2L51A 1N0YA 1CLMA 1UURA 1J7RA 2I94A 3D0YB 1KQMB 1WY9A 4D1EA 4I5JA 2SCPA 1DJGA 1GJYA 1V1FA 2MRDA 2OS8B 1TNPA 3CR2A 1RK9A 1A2XA 3CLNA 3E3RA 3OHMB 3CS1A 1SL8A 2F3ZA 2JTTA 3I5HB 1F55A 1XFZO 1JC2A 2JT0A 1QVIY 1KFXS 3AKBA 4PE0A 1EG4A 4DS7A 2WCEA 4MRXA 4AOMA 4OR9B 2PASA 3O78A 1DGVA 1YUSA 5JOLA 1B9AA 2M1KB 2PVBA 1QASA 3KF9A 1XFUO 5CSIA 3PSRA 1RWYA 2KQ6A 1KFUS 3SG7A 1X02A 2JWWA 3O4YA 2KBIA 3LCPC 3NSIA 3TDUA 2LC5A 2KOTA 3PATA 1PULA 5KU1A 3KEVA 2HETA 2M8UA 2I2RE 4GUKA 1OMRA 2WC8A 4JQ0D 4ZCUA 1SPYA 4BY5A 5B8IB 1BG1A 1GGZA 3A4UB 2L50A 1JBAA 1U5IB 4DUQA 1M31A 2K2FA 1K93D 2JOJA 1J55A 2KAVA 2LP3A 4P5OE 2COLB 5F6TA 3H4SE 4ZCVA 2CBLA 1L2OC 1NX2A 3DVJA 1K94A 3MSEB 3BUXB 2WOSA 2E30A 2EGDA 1B4CA 4CIDA 1MR8A 1KCYA 1MWNA 1PSRA 4MZJA 3WXAA 1BR4B 5K89A 1K8UA 5DKRA 3SJSA 1LVCD 1YR5A 2ZNEA 3BOWA 1YVHA 2KFGA 5I8NA 3EVVA 4YGEB 2BKHB 2R2IA 1B8RA 2WNDA 2JXCA 4MBEA 3CGAA 1NX3A 2LAPA 2M97A 1B7TZ 4MZLA 5D69A 1Q80A 3AAJA 3NSOA 4GNKB 3OX6A 1S5GZ 1CDNA 2H61A 2KI4C 2K7OA 1G8IA 1KK7Z 4I5KA 2NZ0A 1K96A 4CLNA 1MUXA 1EXRA 3SIAA 3TS5C 3CR4X 2EHBA 1B8CA 3EK8A 1YRTB 3I5IC 4C0LA 4USLA 1AVSA 1EL4A 2JTZA 1OSAA 2L2EA 4Q04A 2BKIB 4GFTA 4MN0A 1JF2A 1A75A 1L2OB 1WLMA 2FOTA 2JNXA 3DD4A 3C1VA 1JSAA 1FPWA 1YX7A 1KFXL 2BCXA 1NYAA 3NSKA 3EKJA 2OS8C 1TN4A 4MRYA 1WRZA 4QJ3B 1CDMA 4MSPA 2KFHA 2BE6A 1A4PA 2K7CA 1BF5A 1N2DA 1OMDA 2BL0C 5CSNA 4WQ2A 1IKUA 3ZWHA 5FYXA 1SL9A 1M39A 1J7OA 1J1EA 2RGIA 1KFUL 3HX4A 4GPLB 1EG3A 2LMUA 2KI4B 1IGVA 2NCOA 3BUOB 3KHEA 1W7JB 2WCBA 1CFFA 2KFFA 1FI6A 2FCEA 3TS5B 2CTNA 1PSBA 3M0WA 1FBVA 2KNEA 1QJTA 3QRXA 3I5IB 5HKYA 1B47A 4FQOA 3BUWB 1MQ1A 3EKHA 1WRLA 1IH0A 1DTLA 3O6BA 3FWBA 1CFCA 3LK0A 5TNCA 1KSOA 1D1OA 3RM1A 1Y1UA 1DVIA 5HKZA 2VRGA 1M46A 1MHOA 1BOCA 2M7NA 5G08A 1S36A 2F33A 4C0KA 4JWQA 1MXEA 4YGDB 3DF0A 1XFVO 2K8MB 2E6WA 2PMYA 1F71A 1LKJA 1AHRA 1K9UA 2BECA 2BL0B 3RLZA 1L7ZA 1QIVA 5ER5A 1KWOC 3JTDC 3VGOA 3BXKA 3DVKA 1G33A 1TCFA 1B7TY 2JZIA 4ORCB 2FJUB 1LA0A 2CXJA 2KYFA 1OMVA 2LLSA 2ISDA 2Y1MA 1SY9A 3TDIA 1S5GY 4PDZA 4TNCA 1IWQA 2HQWA 3LL8B 1NX0A 2O5GA 1KK7Y 1YVLA 1E8AA 2BCBA 1BR1B 4N5XA 4NQGA 3TDZA 2JC2A 2LV7A 1XFWO 3GK4X 1BJFA 2M1UA 4DRWA 2LHIA 1TNWA 1CM4A 4NDBA 1CMFA 2MAZA 2AUCA 5I2OA 3D10A 1RJVA 2F3YA 5AEQA 2ZRTA 4NDCA 1SMGA 1C7WA 1UWOA 1ZACA 2KI6D 5HLOA 1S6JA 1AK8A 2KYCA 3KO0A 3DVEA 1NSHA 1PVBA 1TOPA 2Y5IA 4UPGA 4FTGA 4PE7A 1ZOTB 5AFPA 1Y1AA 3D0YA 3CR5X 1M63B 2WCFA 2PALA 1KWOB 1AJ4A 3JTDB 2H2KA 3PN7C 4PE4A 3VRNA 1J7QA 2BBMA 3EVRA 2LLUA 4GGFA 1DF0A 1ZUZA 1TNXA 1UHIA 5KSZA 1A75B 1PK0D 4WRIA 1CB1A 1OQPA 4PE1A 4R1EA 2IS9A 1ODBA 1JUOA 2LUCA 1NCZA 2M3WA 2Q4UA 1GQMA 3EK4A 4XYNA 2BBNA 1C7VA 4M2QA 1RROA 2K7DA 1B8LA
chains in the Genus database with same CATH superfamily
1W7IB 2K7BA 5PALA 1BMOA 1SYMA 2L5XB 2NXQA 3EVUA 2M49B 4A4BA 1UHJA 2NLNA 4YI9A 2GV5A 3WHTB 2AAOA 2B1UA 3CZ2A 5FI7A 5AANA 3FIAA 3IQQA 2Q91A 4QJ4B 5GQQC 1K95A 3F45A 5I2QA 1SW8A 1A03A 1SRAA 1B1GA 1NCYA 2L4IA 2CNPA 2M9GA 1SKTA 1XK4A 2KI6C 2KSPA 3QMEA 4PHKA 1J1DA 5AXIA 1QX2A 3O2PA 4HREE 4P2YB 4IJ7A 3SIBA 1SSEB 1KK8C 2JQ6A 1BT6A 2HPSA 3IF7A 4OVNF 3S0FA 3PN7B 1MF8B 1LA3A 2SASA 1PRWA 2K60A 2GGZA 1RTP1 1DGUA 3R1PA 1C07A 3DZTA 2AMIA 1JF0A 1CLLA 3OB1B 1DEKA 4I5LB 5HYDA 3I5FC 1TRFA 3JVTB 1OZSA 3AKAA 1UHHA 3FWCA 2M29A 3D77A 4HRHA 3DF0B 1ZMZA 4ETOA 3PALA 5EL2A 4XJKA 1HT9A 1BLQA 3KPXA 3Q8IA 2JT8A 3OB2B 3PM8A 5IBWA 4E68A 3WHUB 1NP8A 2FCDA 4YRUA 2P71A 1ALWA 2ZN9A 3BFBA 4GGFC 1AUIB 2MHHA 4YGBB 2K0JA 4ORAB 1R6PA 2BE4A 1QATA 1YUTA 4JPZB 4YBHB 2BNXA 1DT7B 2KGBC 2F2PA 2MLEC 2M7LA 2K61A 4GBAA 3FS7A 5HKWA 1NIWA 1KK8B 3CYZA 5CSJA 3CZ1A 5DKNA 3TUYC 3CTNA 1SK6D 2ZNDA 2H61C 5CSFA 3B7AA 1UHNA 1SNLA 2BCAA 4YI8A 1CMGA 2A4JA 1IQ5A 4MEWA 3WNXB 3I5FB 2KAYA 3TZ1A 3CZTX 1K9KA 4MZKA 1JWDA 1IQ3A 1Y1XA 2PSRA 4DIRA 1SCVA 1F4QA 2TN4A 1PALA 1JFJA 5KTYA 1W9ZA 4YGAA 2KHNA 1YURA 1QV1A 4WQ3A 1LINA 2M0RA 3NGVA 1LXFC 2LVVA 4YGCB 3VROA 4CPVA 4CFRA 5J3XA 2KQYA 1PVAA 1WDCB 2OTGB 1CDLA 1RECA 1QLSA 1DJXA 4AQJA 1DF0B 2QPTA 1V1GA 1TWOA 1XFXO 3BOWB 2L5YA 1EJ3A 3LK1A 2QDIA 4QJ5B 3SG2A 1EH2A 2QACA 4GGNA 1UUSA 3SG5A 1J7PA 1WRKA 4MVFA 3D73A 1F70A 2GGMA 2FJYA 1QIWA 2JT3A 2MJWB 3AAKA 3TUYB 1VRKA 1S26D 5AERA 1QX7A 2WC5A 1A29A 2CCMA 2L98A 3BJHA 3HCMA 1IG5A 3EK7A 2GTEA 4I5NB 2LE9B 1R2UA 3PLFB 2HQ8A 3NXAA 2YGUA 4PCWA 4PT1A 2I18A 1N65A 2CT9A 5BPJA 2HF5A 1DELA 3CDNA 1BODA 1GGWA 1H4BA 2F8PA 3SS4A 1TCOB 3BUNB 4A4CA 2ERBA 1DMOA 4BY4A 1QLKA 2P6BB 5ER4X 1FF1A 1CLBA 1F54A 1YRUB 1T14A 1K9PA 1C3ZA 1NWDA 1Z4HA 3FE9A 3GK2A 3JVTC 4JD9A 4ORBB 2ZKMX 3OP0A 3K1EA 5HLVA 3K21A 1UP5A 3VRQA 4NDDA 1F8HA 2KDHA 4PALA 2MBXA 1SCMC 4F0ZB 1DJHA 1Z2CB 3DXLA 2EC6C 4PHMA 2Y1NA 3DVMA 2PYQA 3VRRA 1G4YR 3NHTA 5I2LA 2LVIA 1K90D 2LNKA 3OX5A 1XYDA 4AQIA 2JPTA 3GK1A 5JJGA 1BU3A 3OGNA 3VRPA 1AJ5A 1NX1A 1SL7A 1DQEA 2KBMA 2L0PA 1QVIZ 4N1GA 4XJKB 1K2HA 2WORA 1QXPA 3B87A 4HRGA 3O4XA 2D8NA 2LMTA 3ICBA 3BUMB 1DJWA 3NSLA 1AP4A 1QS7A 1TTXA 1YTZC 1OOIX 1YX8A 3I5GC 1F4OA 1UHKA 2KAXA 1CDPA 2LUXA 1FW4A 2LVKA 1DJIA 1HQVA 2JULA 4C0JA 1KQVA 1U5IA 4OCIA 1SR6C 1OZOA 3BQ3A 3CWGA 2LVJA 3R72A 2LANA 2O60A 2JU0A 3SS3A 1CNPA 3ZNIA 2ZN8A 1H8BA 1NPQA 1S6CA 3VB1A 1XA5A 1KSMA 1SCMB 3SG3A 2EC6B 2OPOA 2LLTA 1ORGA 2JXLA 1YUUA 1Y0VH 2NCPA 4PHJA 1DJYA 2DOQA 4CFQA 1TIZA 1S6IA 5I94A 3B6XA 1KQMC 3S0EA 3BYAA 1TNQA 2LCPA 1XVJA 2F2OA 1MXLC 2KGRA 1WDCC 2G2BA 2OTGC 1QTXA 2ZRSA 1IJ6A 1DJZA 1WLZA 4M2PA 1CFDA 1OOJA 1QX5B 1OE9B 1S1EA 5CPVA 4L9MA 5D7FA 2Y4QA 3I5HC 5HL1A 1CKKA 2MLFC 4GAOA 4IL1A 1S3PA 1NUBA 2LHLA 4KYNA 1CM1A 4M2OA 5DKQA 4DCKA 3FE8A 1SBJA 2JRFA 1ZFSA 3A8RA 3CZ0A 3I5GB 4MLWA 4OKHA 1FI5A 2I7AA 2JNFA 3BFAA 1SR6B 2G9BA 2L4HA 2V53A 3L4AA 4N1FA 1CFPA 4U8DA 1NCXA 1JFKA 3SG4A 3GOFA 2MA2A 2ZFDA 3IQOA 1QV0A 4HSZA 1CTRA 4PHNA 3FE6A 1Y6WA 1M45A 4FQTA 2QEBA 3PFVA 1RFJA 2LMVA 1XFYO 1IRJA 1XO5A 3LLEA 3DY9A 1ALVA 2LM5A 2LP2A 3SG6A 1IJ5A 1XK4C 2PRUA 4ICBA 2K2AA 4OV2A 2L51A 1N0YA 1CLMA 1UURA 1J7RA 2I94A 3D0YB 1KQMB 1WY9A 4OZDA 4I5JA 2SCPA 1DJGA 2BAPA 1GJYA 3SS5A 1V1FA 2MRDA 4D1EA 2OS8B 1TNPA 3CR2A 1RK9A 3R1VA 1A2XA 3CLNA 3E3RA 3OHMB 3CS1A 1SL8A 2F3ZA 2JTTA 3I5HB 1F55A 1XFZO 1JC2A 3D76A 2JT0A 1QVIY 1KFXS 3AKBA 4PE0A 1EG4A 4DS7A 2WCEA 4MRXA 4AOMA 4OR9B 2PASA 3O78A 1DGVA 1YUSA 5JOLA 1B9AA 2WCJA 2M1KB 2PVBA 1DC1A 1QASA 3KF9A 1XFUO 5CSIA 3PSRA 1RWYA 3L47A 3S0DA 2KQ6A 1KFUS 3SG7A 2WCMA 1X02A 3OBVA 2L2CA 2JWWA 3O4YA 2KBIA 3D78A 3LCPC 3NSIA 3TDUA 3EG5B 2LC5A 2KOTA 3PATA 1PULA 5KU1A 3UO9A 3KEVA 2HETA 2M8UA 2I2RE 4GUKA 1OMRA 2WC8A 4JQ0D 4ZCUA 1SPYA 4BY5A 5B8IB 1BG1A 1GGZA 3PJIA 3A4UB 3DYEA 2L50A 1JBAA 1U5IB 4DUQA 1M31A 2K2FA 1K93D 2JOJA 1J55A 2KAVA 2LP3A 4P5OE 2COLB 2KPHA 3H4SE 5F6TA 4ZCVA 2CBLA 1GM0A 1L2OC 1NX2A 3DVJA 1K94A 3MSEB 3BUXB 2WOSA 2E30A 2EGDA 1B4CA 4CIDA 1MR8A 1KCYA 1MWNA 1PSRA 3BFHA 4MZJA 1BR4B 3WXAA 1K8UA 2P70A 5K89A 5DKRA 3SJSA 1LVCD 1YR5A 2ZNEA 3BOWA 1YVHA 2QEVA 2KFGA 5I8NA 3EVVA 4YGEB 2BKHB 2R2IA 1B8RA 2WNDA 2JXCA 4MBEA 3CGAA 3NHIA 1NX3A 1OW4A 2LAPA 2M97A 1B7TZ 2PQLA 4MZLA 5D69A 2H8VA 1Q80A 3AAJA 3NSOA 4GNKB 3S0BA 3OX6A 1IIOA 1S5GZ 4JKTA 1CDNA 2H61A 2KI4C 2K7OA 1G8IA 1KK7Z 4I5KA 2NZ0A 1K96A 4CLNA 1MUXA 1EXRA 3SIAA 3TS5C 3CR4X 2EHBA 1B8CA 3EK8A 3IVTA 1YRTB 1QWVA 3I5IC 4C0LA 4USLA 4F7FA 1AVSA 1EL4A 2WCHA 2WC6A 2JTZA 1OSAA 3CABA 2L2EA 5DICA 4Q04A 2BKIB 4GFTA 4MN0A 1JF2A 1A75A 1L2OB 1WLMA 2FOTA 2JNXA 1OOHA 3B88A 3D75A 3C1VA 3DD4A 3R1OA 4INWA 1JSAA 1FPWA 1YX7A 1KFXL 1NYAA 2BCXA 3NSKA 3B86A 3EKJA 2OS8C 1TN4A 4MRYA 1WRZA 4QJ3B 1CDMA 4MSPA 2KFHA 2BE6A 1A4PA 2KLDA 2K7CA 1BF5A 1N2DA 1OMDA 2BL0C 5CSNA 4WQ2A 1IKUA 1TUJA 3ZWHA 5FYXA 1SL9A 2KLEA 1M39A 1J7OA 1J1EA 2RGIA 1KFUL 3HX4A 4GPLB 1EG3A 2LMUA 2KI4B 1IGVA 2NCOA 3BUOB 3KHEA 1W7JB 2WCBA 1CFFA 2KFFA 1FI6A 2FCEA 3TS5B 2CTNA 1PSBA 3M0WA 1FBVA 2KNEA 1QJTA 3QRXA 3I5IB 5HKYA 1B47A 4FQOA 3BUWB 1MQ1A 3EKHA 1WRLA 1IH0A 1DTLA 3O6BA 3FWBA 1CFCA 3LK0A 5TNCA 1KSOA 2WCKA 2QEHA 1D1OA 4INXA 3RM1A 1Y1UA 1DVIA 5FI2A 5HKZA 2VRGA 1M46A 1MHOA 1BOCA 2M7NA 5G08A 1S36A 2F33A 4C0KA 4JWQA 1MXEA 4YGDB 3DF0A 1XFVO 2K8MB 2E6WA 3RZSA 2PMYA 1F71A 1LKJA 1AHRA 1K9UA 2BECA 2BL0B 3N7HA 3RLZA 1L7ZA 1QIVA 5ER5A 1KWOC 3JTDC 3VGOA 3BXKA 1LS8A 3DVKA 1G33A 1TCFA 1B7TY 2JZIA 4ORCB 2FJUB 1LA0A 2CXJA 2KYFA 1OMVA 2LLSA 2ISDA 2Y1MA 1SY9A 3TDIA 5FI6A 1S5GY 4PDZA 3PM2A 4TNCA 1IWQA 2HQWA 3LL8B 1NX0A 2O5GA 1KK7Y 1YVLA 1XFRA 1E8AA 2BCBA 1BR1B 1P28A 4N5XA 4NQGA 3TDZA 2JC2A 2LV7A 1XFWO 3GK4X 1BJFA 2M1UA 4DRWA 2LHIA 5D3OA 3S0AA 1TNWA 1CM4A 4NDBA 1CMFA 2MAZA 2AUCA 2QEOA 3D74A 5I2OA 3D10A 3V2LA 1RJVA 2F3YA 5AEQA 2ZRTA 4NDCA 1SMGA 1C7WA 1UWOA 1ZACA 3UNWA 2WCLA 2KI6D 5HLOA 1OOGA 1C3YA 1S6JA 1AK8A 2KYCA 3KO0A 3DVEA 1NSHA 1PVBA 1TOPA 2Y5IA 4UPGA 4FTGA 4PE7A 1ZOTB 3L4LA 5AFPA 1Y1AA 3D0YA 3CR5X 1M63B 2WCFA 1OOFA 1KWOB 1AJ4A 1TUZA 2H2KA 2PALA 3JTDB 3PN7C 4PE4A 3VRNA 1J7QA 2BBMA 3EVRA 2LLUA 4GGFA 1DF0A 1ZUZA 1TNXA 1UHIA 5KSZA 1A75B 1PK0D 4WRIA 1CB1A 1OQPA 4PE1A 4R1EA 2IS9A 1ODBA 3S0GA 1JUOA 2LUCA 1NCZA 2M3WA 2Q4UA 1GQMA 3EK4A 2JPOA 2BBNA 4XYNA 1C7VA 4M2QA 1RROA 2K7DA 1B8LA
chains in the Genus database with same CATH topology
1W7IB 2K7BA 5PALA 1BMOA 1SYMA 2L5XB 2NXQA 3EVUA 2M49B 4A4BA 1UHJA 2NLNA 4YI9A 2GV5A 3WHTB 2AAOA 2B1UA 5AANA 3FIAA 3IQQA 2Q91A 4QJ4B 5GQQC 1K95A 3F45A 5I2QA 1SW8A 1A03A 1SRAA 1B1GA 1NCYA 2L4IA 2CNPA 2M9GA 1SKTA 1XK4A 2KI6C 2KSPA 4PHKA 1J1DA 5AXIA 1QX2A 3O2PA 4HREE 4P2YB 3SIBA 1KK8C 2JQ6A 1BT6A 2HPSA 3IF7A 4OVNF 3PN7B 1MF8B 1LA3A 2SASA 1PRWA 2GGZA 1RTP1 1DGUA 1C07A 2AMIA 1JF0A 1CLLA 3OB1B 4I5LB 5HYDA 3I5FC 1TRFA 3JVTB 1OZSA 3AKAA 1UHHA 3FWCA 2M29A 4HRHA 3DF0B 1ZMZA 4ETOA 3PALA 4XJKA 1HT9A 1BLQA 3KPXA 2JT8A 3OB2B 3PM8A 5IBWA 4E68A 3WHUB 1NP8A 2FCDA 4YRUA 1ALWA 2ZN9A 4GGFC 4YGBB 1AUIB 2MHHA 2K0JA 4ORAB 1R6PA 2BE4A 1QATA 1YUTA 4JPZB 4YBHB 1DT7B 2KGBC 2F2PA 2MLEC 2M7LA 2K61A 4GBAA 3FS7A 5HKWA 1NIWA 1KK8B 5CSJA 5DKNA 3TUYC 3CTNA 1SK6D 2ZNDA 2H61C 5CSFA 1UHNA 1SNLA 2BCAA 4YI8A 1CMGA 2A4JA 1IQ5A 4MEWA 3WNXB 3I5FB 2KAYA 3TZ1A 3CZTX 1K9KA 4MZKA 1JWDA 1IQ3A 1Y1XA 2PSRA 4DIRA 1SCVA 1F4QA 2TN4A 1PALA 1JFJA 5KTYA 4YGAA 2KHNA 1YURA 1QV1A 4WQ3A 1LINA 2M0RA 3VROA 1LXFC 2LVVA 4YGCB 4CPVA 4CFRA 5J3XA 2KQYA 1PVAA 1WDCB 2OTGB 1CDLA 1RECA 1QLSA 1DJXA 4AQJA 1DF0B 2QPTA 1V1GA 1XFXO 3BOWB 3LK1A 1EJ3A 4QJ5B 3SG2A 1EH2A 2QACA 4GGNA 1UUSA 3SG5A 1J7PA 1WRKA 4MVFA 1F70A 2GGMA 1QIWA 2JT3A 2MJWB 3AAKA 3TUYB 1VRKA 1S26D 5AERA 1QX7A 1A29A 2CCMA 2L98A 3HCMA 1IG5A 3EK7A 4I5NB 2LE9B 1R2UA 3PLFB 2HQ8A 3NXAA 4PCWA 2I18A 1N65A 2CT9A 5BPJA 2HF5A 1BODA 1GGWA 1H4BA 2F8PA 1TCOB 3BUNB 4A4CA 1DMOA 4BY4A 1QLKA 2P6BB 5ER4X 1FF1A 1CLBA 1F54A 1YRUB 1K9PA 3GK2A 1NWDA 3JVTC 4ORBB 2ZKMX 3OP0A 5HLVA 3K21A 1UP5A 3VRQA 4NDDA 1F8HA 2KDHA 4PALA 2MBXA 1SCMC 4F0ZB 1DJHA 2EC6C 4PHMA 2Y1NA 3DVMA 3VRRA 1G4YR 5I2LA 2LVIA 1K90D 2LNKA 3OX5A 1XYDA 4AQIA 2JPTA 3GK1A 5JJGA 1BU3A 3VRPA 1AJ5A 1NX1A 1SL7A 2KBMA 2L0PA 1QVIZ 4N1GA 4XJKB 1K2HA 2WORA 1QXPA 4HRGA 2D8NA 2LMTA 3ICBA 3BUMB 1DJWA 3NSLA 1AP4A 1QS7A 1TTXA 1YTZC 1YX8A 3I5GC 1F4OA 1UHKA 2KAXA 1CDPA 2LUXA 1FW4A 2LVKA 1DJIA 1HQVA 2JULA 4C0JA 1KQVA 1U5IA 4OCIA 1SR6C 1OZOA 3BQ3A 3CWGA 2LVJA 2LANA 2O60A 2JU0A 1CNPA 3ZNIA 2ZN8A 1H8BA 1NPQA 1S6CA 1XA5A 1KSMA 1SCMB 3SG3A 2EC6B 2OPOA 2LLTA 2JXLA 1YUUA 1Y0VH 2NCPA 4PHJA 1DJYA 2DOQA 4CFQA 1TIZA 1S6IA 1KQMC 3BYAA 1TNQA 2LCPA 1XVJA 2F2OA 1MXLC 2KGRA 1WDCC 2G2BA 2OTGC 1QTXA 2ZRSA 1IJ6A 1DJZA 1WLZA 4M2PA 1CFDA 1OOJA 1QX5B 1OE9B 1S1EA 5CPVA 4L9MA 5D7FA 2Y4QA 3I5HC 1CKKA 2MLFC 4GAOA 4IL1A 1S3PA 1NUBA 2LHLA 4DCKA 1CM1A 4M2OA 5DKQA 1SBJA 2JRFA 1ZFSA 3A8RA 3I5GB 4MLWA 4OKHA 1FI5A 2I7AA 2JNFA 1SR6B 2G9BA 2L4HA 2V53A 4N1FA 1CFPA 4U8DA 1NCXA 1JFKA 3SG4A 3GOFA 2MA2A 2ZFDA 3IQOA 1QV0A 4HSZA 1CTRA 4PHNA 1Y6WA 1M45A 3PFVA 1RFJA 2LMVA 1XFYO 1IRJA 1XO5A 3LLEA 1ALVA 2LM5A 2LP2A 3SG6A 1IJ5A 1XK4C 2PRUA 4ICBA 2K2AA 4OV2A 2L51A 1N0YA 1CLMA 1UURA 1J7RA 2I94A 3D0YB 1KQMB 1WY9A 4D1EA 4I5JA 2SCPA 1DJGA 1GJYA 1V1FA 2MRDA 2OS8B 1TNPA 3CR2A 1RK9A 1A2XA 3CLNA 3E3RA 3OHMB 3CS1A 1SL8A 2F3ZA 2JTTA 3I5HB 1F55A 1XFZO 1JC2A 2JT0A 1QVIY 1KFXS 3AKBA 4PE0A 1EG4A 4DS7A 2WCEA 4MRXA 4AOMA 4OR9B 2PASA 3O78A 1DGVA 1YUSA 5JOLA 1B9AA 2M1KB 2PVBA 1QASA 3KF9A 1XFUO 5CSIA 3PSRA 1RWYA 2KQ6A 1KFUS 3SG7A 1X02A 2JWWA 3O4YA 2KBIA 3LCPC 3NSIA 3TDUA 2LC5A 2KOTA 3PATA 1PULA 5KU1A 3KEVA 2HETA 2M8UA 2I2RE 4GUKA 1OMRA 2WC8A 4JQ0D 4ZCUA 1SPYA 4BY5A 5B8IB 1BG1A 1GGZA 3A4UB 2L50A 1JBAA 1U5IB 4DUQA 1M31A 2K2FA 1K93D 2JOJA 1J55A 2KAVA 2LP3A 4P5OE 2COLB 5F6TA 3H4SE 4ZCVA 2CBLA 1L2OC 1NX2A 3DVJA 1K94A 3MSEB 3BUXB 2WOSA 2E30A 2EGDA 1B4CA 4CIDA 1MR8A 1KCYA 1MWNA 1PSRA 4MZJA 3WXAA 1BR4B 5K89A 1K8UA 5DKRA 3SJSA 1LVCD 1YR5A 2ZNEA 3BOWA 1YVHA 2KFGA 5I8NA 3EVVA 4YGEB 2BKHB 2R2IA 1B8RA 2WNDA 2JXCA 4MBEA 3CGAA 1NX3A 2LAPA 2M97A 1B7TZ 4MZLA 5D69A 1Q80A 3AAJA 3NSOA 4GNKB 3OX6A 1S5GZ 1CDNA 2H61A 2KI4C 2K7OA 1G8IA 1KK7Z 4I5KA 2NZ0A 1K96A 4CLNA 1MUXA 1EXRA 3SIAA 3TS5C 3CR4X 2EHBA 1B8CA 3EK8A 1YRTB 3I5IC 4C0LA 4USLA 1AVSA 1EL4A 2JTZA 1OSAA 2L2EA 4Q04A 2BKIB 4GFTA 4MN0A 1JF2A 1A75A 1L2OB 1WLMA 2FOTA 2JNXA 3DD4A 3C1VA 1JSAA 1FPWA 1YX7A 1KFXL 2BCXA 1NYAA 3NSKA 3EKJA 2OS8C 1TN4A 4MRYA 1WRZA 4QJ3B 1CDMA 4MSPA 2KFHA 2BE6A 1A4PA 2K7CA 1BF5A 1N2DA 1OMDA 2BL0C 5CSNA 4WQ2A 1IKUA 3ZWHA 5FYXA 1SL9A 1M39A 1J7OA 1J1EA 2RGIA 1KFUL 3HX4A 4GPLB 1EG3A 2LMUA 2KI4B 1IGVA 2NCOA 3BUOB 3KHEA 1W7JB 2WCBA 1CFFA 2KFFA 1FI6A 2FCEA 3TS5B 2CTNA 1PSBA 3M0WA 1FBVA 2KNEA 1QJTA 3QRXA 3I5IB 5HKYA 1B47A 4FQOA 3BUWB 1MQ1A 3EKHA 1WRLA 1IH0A 1DTLA 3O6BA 3FWBA 1CFCA 3LK0A 5TNCA 1KSOA 1D1OA 3RM1A 1Y1UA 1DVIA 5HKZA 2VRGA 1M46A 1MHOA 1BOCA 2M7NA 5G08A 1S36A 2F33A 4C0KA 4JWQA 1MXEA 4YGDB 3DF0A 1XFVO 2K8MB 2E6WA 2PMYA 1F71A 1LKJA 1AHRA 1K9UA 2BECA 2BL0B 3RLZA 1L7ZA 1QIVA 5ER5A 1KWOC 3JTDC 3VGOA 3BXKA 3DVKA 1G33A 1TCFA 1B7TY 2JZIA 4ORCB 2FJUB 1LA0A 2CXJA 2KYFA 1OMVA 2LLSA 2ISDA 2Y1MA 1SY9A 3TDIA 1S5GY 4PDZA 4TNCA 1IWQA 2HQWA 3LL8B 1NX0A 2O5GA 1KK7Y 1YVLA 1E8AA 2BCBA 1BR1B 4N5XA 4NQGA 3TDZA 2JC2A 2LV7A 1XFWO 3GK4X 1BJFA 2M1UA 4DRWA 2LHIA 1TNWA 1CM4A 4NDBA 1CMFA 2MAZA 2AUCA 5I2OA 3D10A 1RJVA 2F3YA 5AEQA 2ZRTA 4NDCA 1SMGA 1C7WA 1UWOA 1ZACA 2KI6D 5HLOA 1S6JA 1AK8A 2KYCA 3KO0A 3DVEA 1NSHA 1PVBA 1TOPA 2Y5IA 4UPGA 4FTGA 4PE7A 1ZOTB 5AFPA 1Y1AA 3D0YA 3CR5X 1M63B 2WCFA 2PALA 1KWOB 1AJ4A 3JTDB 2H2KA 3PN7C 4PE4A 3VRNA 1J7QA 2BBMA 3EVRA 2LLUA 4GGFA 1DF0A 1ZUZA 1TNXA 1UHIA 5KSZA 1A75B 1PK0D 4WRIA 1CB1A 1OQPA 4PE1A 4R1EA 2IS9A 1ODBA 1JUOA 2LUCA 1NCZA 2M3WA 2Q4UA 1GQMA 3EK4A 4XYNA 2BBNA 1C7VA 4M2QA 1RROA 2K7DA 1B8LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W7I B;  2K7B A;  5PAL A;  1BMO A;  1SYM A;  2L5X B;  2NXQ A;  3EVU A;  2M49 B;  4A4B A;  1UHJ A;  2NLN A;  4YI9 A;  2GV5 A;  3WHT B;  2AAO A;  2B1U A;  5AAN A;  3FIA A;  3IQQ A;  2Q91 A;  4QJ4 B;  5GQQ C;  1K95 A;  3F45 A;  5I2Q A;  1SW8 A;  1A03 A;  1SRA A;  1B1G A;  1NCY A;  2L4I A;  2CNP A;  2M9G A;  1SKT A;  1XK4 A;  2KI6 C;  2KSP A;  4PHK A;  1J1D A;  5AXI A;  1QX2 A;  3O2P A;  4HRE E;  4P2Y B;  3SIB A;  1KK8 C;  2JQ6 A;  1BT6 A;  2HPS A;  3IF7 A;  4OVN F;  3PN7 B;  1MF8 B;  1LA3 A;  2SAS A;  1PRW A;  2GGZ A;  1RTP 1;  1DGU A;  1C07 A;  2AMI A;  1JF0 A;  1CLL A;  3OB1 B;  4I5L B;  5HYD A;  3I5F C;  1TRF A;  3JVT B;  1OZS A;  3AKA A;  1UHH A;  3FWC A;  2M29 A;  4HRH A;  3DF0 B;  1ZMZ A;  4ETO A;  3PAL A;  4XJK A;  1HT9 A;  1BLQ A;  3KPX A;  2JT8 A;  3OB2 B;  3PM8 A;  5IBW A;  4E68 A;  3WHU B;  1NP8 A;  2FCD A;  4YRU A;  1ALW A;  2ZN9 A;  4GGF C;  4YGB B;  1AUI B;  2MHH A;  2K0J A;  4ORA B;  1R6P A;  2BE4 A;  1QAT A;  1YUT A;  4JPZ B;  4YBH B;  1DT7 B;  2KGB C;  2F2P A;  2MLE C;  2M7L A;  2K61 A;  4GBA A;  3FS7 A;  5HKW A;  1NIW A;  1KK8 B;  5CSJ A;  5DKN A;  3TUY C;  3CTN A;  1SK6 D;  2ZND A;  2H61 C;  5CSF A;  1UHN A;  1SNL A;  2BCA A;  4YI8 A;  1CMG A;  2A4J A;  1IQ5 A;  4MEW A;  3WNX B;  3I5F B;  2KAY A;  3TZ1 A;  3CZT X;  1K9K A;  4MZK A;  1JWD A;  1IQ3 A;  1Y1X A;  2PSR A;  4DIR A;  1SCV A;  1F4Q A;  2TN4 A;  1PAL A;  1JFJ A;  5KTY A;  4YGA A;  2KHN A;  1YUR A;  1QV1 A;  4WQ3 A;  1LIN A;  2M0R A;  3VRO A;  1LXF C;  2LVV A;  4YGC B;  4CPV A;  4CFR A;  5J3X A;  2KQY A;  1PVA A;  1WDC B;  2OTG B;  1CDL A;  1REC A;  1QLS A;  1DJX A;  4AQJ A;  1DF0 B;  2QPT A;  1V1G A;  1XFX O;  3BOW B;  3LK1 A;  1EJ3 A;  4QJ5 B;  3SG2 A;  1EH2 A;  2QAC A;  4GGN A;  1UUS A;  3SG5 A;  1J7P A;  1WRK A;  4MVF A;  1F70 A;  2GGM A;  1QIW A;  2JT3 A;  2MJW B;  3AAK A;  3TUY B;  1VRK A;  1S26 D;  5AER A;  1QX7 A;  1A29 A;  2CCM A;  2L98 A;  3HCM A;  1IG5 A;  3EK7 A;  4I5N B;  2LE9 B;  1R2U A;  3PLF B;  2HQ8 A;  3NXA A;  4PCW A;  2I18 A;  1N65 A;  2CT9 A;  5BPJ A;  2HF5 A;  1BOD A;  1GGW A;  1H4B A;  2F8P A;  1TCO B;  3BUN B;  4A4C A;  1DMO A;  4BY4 A;  1QLK A;  2P6B B;  5ER4 X;  1FF1 A;  1CLB A;  1F54 A;  1YRU B;  1K9P A;  3GK2 A;  1NWD A;  3JVT C;  4ORB B;  2ZKM X;  3OP0 A;  5HLV A;  3K21 A;  1UP5 A;  3VRQ A;  4NDD A;  1F8H A;  2KDH A;  4PAL A;  2MBX A;  1SCM C;  4F0Z B;  1DJH A;  2EC6 C;  4PHM A;  2Y1N A;  3DVM A;  3VRR A;  1G4Y R;  5I2L A;  2LVI A;  1K90 D;  2LNK A;  3OX5 A;  1XYD A;  4AQI A;  2JPT A;  3GK1 A;  5JJG A;  1BU3 A;  3VRP A;  1AJ5 A;  1NX1 A;  1SL7 A;  2KBM A;  2L0P A;  1QVI Z;  4N1G A;  4XJK B;  1K2H A;  2WOR A;  1QXP A;  4HRG A;  2D8N A;  2LMT A;  3ICB A;  3BUM B;  1DJW A;  3NSL A;  1AP4 A;  1QS7 A;  1TTX A;  1YTZ C;  1YX8 A;  3I5G C;  1F4O A;  1UHK A;  2KAX A;  1CDP A;  2LUX A;  1FW4 A;  2LVK A;  1DJI A;  1HQV A;  2JUL A;  4C0J A;  1KQV A;  1U5I A;  4OCI A;  1SR6 C;  1OZO A;  3BQ3 A;  3CWG A;  2LVJ A;  2LAN A;  2O60 A;  2JU0 A;  1CNP A;  3ZNI A;  2ZN8 A;  1H8B A;  1NPQ A;  1S6C A;  1XA5 A;  1KSM A;  1SCM B;  3SG3 A;  2EC6 B;  2OPO A;  2LLT A;  2JXL A;  1YUU A;  1Y0V H;  2NCP A;  4PHJ A;  1DJY A;  2DOQ A;  4CFQ A;  1TIZ A;  1S6I A;  1KQM C;  3BYA A;  1TNQ A;  2LCP A;  1XVJ A;  2F2O A;  1MXL C;  2KGR A;  1WDC C;  2G2B A;  2OTG C;  1QTX A;  2ZRS A;  1IJ6 A;  1DJZ A;  1WLZ A;  4M2P A;  1CFD A;  1OOJ A;  1QX5 B;  1OE9 B;  1S1E A;  5CPV A;  4L9M A;  5D7F A;  2Y4Q A;  3I5H C;  1CKK A;  2MLF C;  4GAO A;  4IL1 A;  1S3P A;  1NUB A;  2LHL A;  4DCK A;  1CM1 A;  4M2O A;  5DKQ A;  1SBJ A;  2JRF A;  1ZFS A;  3A8R A;  3I5G B;  4MLW A;  4OKH A;  1FI5 A;  2I7A A;  2JNF A;  1SR6 B;  2G9B A;  2L4H A;  2V53 A;  4N1F A;  1CFP A;  4U8D A;  1NCX A;  1JFK A;  3SG4 A;  3GOF A;  2MA2 A;  2ZFD A;  3IQO A;  1QV0 A;  4HSZ A;  1CTR A;  4PHN A;  1Y6W A;  1M45 A;  3PFV A;  1RFJ A;  2LMV A;  1XFY O;  1IRJ A;  1XO5 A;  3LLE A;  1ALV A;  2LM5 A;  2LP2 A;  3SG6 A;  1IJ5 A;  1XK4 C;  2PRU A;  4ICB A;  2K2A A;  4OV2 A;  2L51 A;  1N0Y A;  1CLM A;  1UUR A;  1J7R A;  2I94 A;  3D0Y B;  1KQM B;  1WY9 A;  4D1E A;  4I5J A;  2SCP A;  1DJG A;  1GJY A;  1V1F A;  2MRD A;  2OS8 B;  1TNP A;  3CR2 A;  1RK9 A;  1A2X A;  3CLN A;  3E3R A;  3OHM B;  3CS1 A;  1SL8 A;  2F3Z A;  2JTT A;  3I5H B;  1F55 A;  1XFZ O;  1JC2 A;  2JT0 A;  1QVI Y;  1KFX S;  3AKB A;  4PE0 A;  1EG4 A;  4DS7 A;  2WCE A;  4MRX A;  4AOM A;  4OR9 B;  2PAS A;  3O78 A;  1DGV A;  1YUS A;  5JOL A;  1B9A A;  2M1K B;  2PVB A;  1QAS A;  3KF9 A;  1XFU O;  5CSI A;  3PSR A;  1RWY A;  2KQ6 A;  1KFU S;  3SG7 A;  1X02 A;  2JWW A;  3O4Y A;  2KBI A;  3LCP C;  3NSI A;  3TDU A;  2LC5 A;  2KOT A;  3PAT A;  1PUL A;  5KU1 A;  3KEV A;  2HET A;  2M8U A;  2I2R E;  4GUK A;  1OMR A;  2WC8 A;  4JQ0 D;  4ZCU A;  1SPY A;  4BY5 A;  5B8I B;  1BG1 A;  1GGZ A;  3A4U B;  2L50 A;  1JBA A;  1U5I B;  4DUQ A;  1M31 A;  2K2F A;  1K93 D;  2JOJ A;  1J55 A;  2KAV A;  2LP3 A;  4P5O E;  2COL B;  5F6T A;  3H4S E;  4ZCV A;  2CBL A;  1L2O C;  1NX2 A;  3DVJ A;  1K94 A;  3MSE B;  3BUX B;  2WOS A;  2E30 A;  2EGD A;  1B4C A;  4CID A;  1MR8 A;  1KCY A;  1MWN A;  1PSR A;  4MZJ A;  3WXA A;  1BR4 B;  5K89 A;  1K8U A;  5DKR A;  3SJS A;  1LVC D;  1YR5 A;  2ZNE A;  3BOW A;  1YVH A;  2KFG A;  5I8N A;  3EVV A;  4YGE B;  2BKH B;  2R2I A;  1B8R A;  2WND A;  2JXC A;  4MBE A;  3CGA A;  1NX3 A;  2LAP A;  2M97 A;  1B7T Z;  4MZL A;  5D69 A;  1Q80 A;  3AAJ A;  3NSO A;  4GNK B;  3OX6 A;  1S5G Z;  1CDN A;  2H61 A;  2KI4 C;  2K7O A;  1G8I A;  1KK7 Z;  4I5K A;  2NZ0 A;  1K96 A;  4CLN A;  1MUX A;  1EXR A;  3SIA A;  3TS5 C;  3CR4 X;  2EHB A;  1B8C A;  3EK8 A;  1YRT B;  3I5I C;  4C0L A;  4USL A;  1AVS A;  1EL4 A;  2JTZ A;  1OSA A;  2L2E A;  4Q04 A;  2BKI B;  4GFT A;  4MN0 A;  1JF2 A;  1A75 A;  1L2O B;  1WLM A;  2FOT A;  2JNX A;  3DD4 A;  3C1V A;  1JSA A;  1FPW A;  1YX7 A;  1KFX L;  2BCX A;  1NYA A;  3NSK A;  3EKJ A;  2OS8 C;  1TN4 A;  4MRY A;  1WRZ A;  4QJ3 B;  1CDM A;  4MSP A;  2KFH A;  2BE6 A;  1A4P A;  2K7C A;  1BF5 A;  1N2D A;  1OMD A;  2BL0 C;  5CSN A;  4WQ2 A;  1IKU A;  3ZWH A;  5FYX A;  1SL9 A;  1M39 A;  1J7O A;  1J1E A;  2RGI A;  1KFU L;  3HX4 A;  4GPL B;  1EG3 A;  2LMU A;  2KI4 B;  1IGV A;  2NCO A;  3BUO B;  3KHE A;  1W7J B;  2WCB A;  1CFF A;  2KFF A;  1FI6 A;  2FCE A;  3TS5 B;  2CTN A;  1PSB A;  3M0W A;  1FBV A;  2KNE A;  1QJT A;  3QRX A;  3I5I B;  5HKY A;  1B47 A;  4FQO A;  3BUW B;  1MQ1 A;  3EKH A;  1WRL A;  1IH0 A;  1DTL A;  3O6B A;  3FWB A;  1CFC A;  3LK0 A;  5TNC A;  1KSO A;  1D1O A;  3RM1 A;  1Y1U A;  1DVI A;  5HKZ A;  2VRG A;  1M46 A;  1MHO A;  1BOC A;  2M7N A;  5G08 A;  1S36 A;  2F33 A;  4C0K A;  4JWQ A;  1MXE A;  4YGD B;  3DF0 A;  1XFV O;  2K8M B;  2E6W A;  2PMY A;  1F71 A;  1LKJ A;  1AHR A;  1K9U A;  2BEC A;  2BL0 B;  3RLZ A;  1L7Z A;  1QIV A;  5ER5 A;  1KWO C;  3JTD C;  3VGO A;  3BXK A;  3DVK A;  1G33 A;  1TCF A;  1B7T Y;  2JZI A;  4ORC B;  2FJU B;  1LA0 A;  2CXJ A;  2KYF A;  1OMV A;  2LLS A;  2ISD A;  2Y1M A;  1SY9 A;  3TDI A;  1S5G Y;  4PDZ A;  4TNC A;  1IWQ A;  2HQW A;  3LL8 B;  1NX0 A;  2O5G A;  1KK7 Y;  1YVL A;  1E8A A;  2BCB A;  1BR1 B;  4N5X A;  4NQG A;  3TDZ A;  2JC2 A;  2LV7 A;  1XFW O;  3GK4 X;  1BJF A;  2M1U A;  4DRW A;  2LHI A;  1TNW A;  1CM4 A;  4NDB A;  1CMF A;  2MAZ A;  2AUC A;  5I2O A;  3D10 A;  1RJV A;  2F3Y A;  5AEQ A;  2ZRT A;  4NDC A;  1SMG A;  1C7W A;  1UWO A;  1ZAC A;  2KI6 D;  5HLO A;  1S6J A;  1AK8 A;  2KYC A;  3KO0 A;  3DVE A;  1NSH A;  1PVB A;  1TOP A;  2Y5I A;  4UPG A;  4FTG A;  4PE7 A;  1ZOT B;  5AFP A;  1Y1A A;  3D0Y A;  3CR5 X;  1M63 B;  2WCF A;  2PAL A;  1KWO B;  1AJ4 A;  3JTD B;  2H2K A;  3PN7 C;  4PE4 A;  3VRN A;  1J7Q A;  2BBM A;  3EVR A;  2LLU A;  4GGF A;  1DF0 A;  1ZUZ A;  1TNX A;  1UHI A;  5KSZ A;  1A75 B;  1PK0 D;  4WRI A;  1CB1 A;  1OQP A;  4PE1 A;  4R1E A;  2IS9 A;  1ODB A;  1JUO A;  2LUC A;  1NCZ A;  2M3W A;  2Q4U A;  1GQM A;  3EK4 A;  4XYN A;  2BBN A;  1C7V A;  4M2Q A;  1RRO A;  2K7D A;  1B8L A; 
#chains in the Genus database with same CATH topology
 1W7I B;  2K7B A;  5PAL A;  1BMO A;  1SYM A;  2L5X B;  2NXQ A;  3EVU A;  2M49 B;  4A4B A;  1UHJ A;  2NLN A;  4YI9 A;  2GV5 A;  3WHT B;  2AAO A;  2B1U A;  3CZ2 A;  5FI7 A;  5AAN A;  3FIA A;  3IQQ A;  2Q91 A;  4QJ4 B;  5GQQ C;  1K95 A;  3F45 A;  5I2Q A;  1SW8 A;  1A03 A;  1SRA A;  1B1G A;  1NCY A;  2L4I A;  2CNP A;  2M9G A;  1SKT A;  1XK4 A;  2KI6 C;  2KSP A;  3QME A;  4PHK A;  1J1D A;  5AXI A;  1QX2 A;  3O2P A;  4HRE E;  4P2Y B;  4IJ7 A;  3SIB A;  1SSE B;  1KK8 C;  2JQ6 A;  1BT6 A;  2HPS A;  3IF7 A;  4OVN F;  3S0F A;  3PN7 B;  1MF8 B;  1LA3 A;  2SAS A;  1PRW A;  2K60 A;  2GGZ A;  1RTP 1;  1DGU A;  3R1P A;  1C07 A;  3DZT A;  2AMI A;  1JF0 A;  1CLL A;  3OB1 B;  1DEK A;  4I5L B;  5HYD A;  3I5F C;  1TRF A;  3JVT B;  1OZS A;  3AKA A;  1UHH A;  3FWC A;  2M29 A;  3D77 A;  4HRH A;  3DF0 B;  1ZMZ A;  4ETO A;  3PAL A;  5EL2 A;  4XJK A;  1HT9 A;  1BLQ A;  3KPX A;  3Q8I A;  2JT8 A;  3OB2 B;  3PM8 A;  5IBW A;  4E68 A;  3WHU B;  1NP8 A;  2FCD A;  4YRU A;  2P71 A;  1ALW A;  2ZN9 A;  3BFB A;  4GGF C;  1AUI B;  2MHH A;  4YGB B;  2K0J A;  4ORA B;  1R6P A;  2BE4 A;  1QAT A;  1YUT A;  4JPZ B;  4YBH B;  2BNX A;  1DT7 B;  2KGB C;  2F2P A;  2MLE C;  2M7L A;  2K61 A;  4GBA A;  3FS7 A;  5HKW A;  1NIW A;  1KK8 B;  3CYZ A;  5CSJ A;  3CZ1 A;  5DKN A;  3TUY C;  3CTN A;  1SK6 D;  2ZND A;  2H61 C;  5CSF A;  3B7A A;  1UHN A;  1SNL A;  2BCA A;  4YI8 A;  1CMG A;  2A4J A;  1IQ5 A;  4MEW A;  3WNX B;  3I5F B;  2KAY A;  3TZ1 A;  3CZT X;  1K9K A;  4MZK A;  1JWD A;  1IQ3 A;  1Y1X A;  2PSR A;  4DIR A;  1SCV A;  1F4Q A;  2TN4 A;  1PAL A;  1JFJ A;  5KTY A;  1W9Z A;  4YGA A;  2KHN A;  1YUR A;  1QV1 A;  4WQ3 A;  1LIN A;  2M0R A;  3NGV A;  1LXF C;  2LVV A;  4YGC B;  3VRO A;  4CPV A;  4CFR A;  5J3X A;  2KQY A;  1PVA A;  1WDC B;  2OTG B;  1CDL A;  1REC A;  1QLS A;  1DJX A;  4AQJ A;  1DF0 B;  2QPT A;  1V1G A;  1TWO A;  1XFX O;  3BOW B;  2L5Y A;  1EJ3 A;  3LK1 A;  2QDI A;  4QJ5 B;  3SG2 A;  1EH2 A;  2QAC A;  4GGN A;  1UUS A;  3SG5 A;  1J7P A;  1WRK A;  4MVF A;  3D73 A;  1F70 A;  2GGM A;  2FJY A;  1QIW A;  2JT3 A;  2MJW B;  3AAK A;  3TUY B;  1VRK A;  1S26 D;  5AER A;  1QX7 A;  2WC5 A;  1A29 A;  2CCM A;  2L98 A;  3BJH A;  3HCM A;  1IG5 A;  3EK7 A;  2GTE A;  4I5N B;  2LE9 B;  1R2U A;  3PLF B;  2HQ8 A;  3NXA A;  2YGU A;  4PCW A;  4PT1 A;  2I18 A;  1N65 A;  2CT9 A;  5BPJ A;  2HF5 A;  1DEL A;  3CDN A;  1BOD A;  1GGW A;  1H4B A;  2F8P A;  3SS4 A;  1TCO B;  3BUN B;  4A4C A;  2ERB A;  1DMO A;  4BY4 A;  1QLK A;  2P6B B;  5ER4 X;  1FF1 A;  1CLB A;  1F54 A;  1YRU B;  1T14 A;  1K9P A;  1C3Z A;  1NWD A;  1Z4H A;  3FE9 A;  3GK2 A;  3JVT C;  4JD9 A;  4ORB B;  2ZKM X;  3OP0 A;  3K1E A;  5HLV A;  3K21 A;  1UP5 A;  3VRQ A;  4NDD A;  1F8H A;  2KDH A;  4PAL A;  2MBX A;  1SCM C;  4F0Z B;  1DJH A;  1Z2C B;  3DXL A;  2EC6 C;  4PHM A;  2Y1N A;  3DVM A;  2PYQ A;  3VRR A;  1G4Y R;  3NHT A;  5I2L A;  2LVI A;  1K90 D;  2LNK A;  3OX5 A;  1XYD A;  4AQI A;  2JPT A;  3GK1 A;  5JJG A;  1BU3 A;  3OGN A;  3VRP A;  1AJ5 A;  1NX1 A;  1SL7 A;  1DQE A;  2KBM A;  2L0P A;  1QVI Z;  4N1G A;  4XJK B;  1K2H A;  2WOR A;  1QXP A;  3B87 A;  4HRG A;  3O4X A;  2D8N A;  2LMT A;  3ICB A;  3BUM B;  1DJW A;  3NSL A;  1AP4 A;  1QS7 A;  1TTX A;  1YTZ C;  1OOI X;  1YX8 A;  3I5G C;  1F4O A;  1UHK A;  2KAX A;  1CDP A;  2LUX A;  1FW4 A;  2LVK A;  1DJI A;  1HQV A;  2JUL A;  4C0J A;  1KQV A;  1U5I A;  4OCI A;  1SR6 C;  1OZO A;  3BQ3 A;  3CWG A;  2LVJ A;  3R72 A;  2LAN A;  2O60 A;  2JU0 A;  3SS3 A;  1CNP A;  3ZNI A;  2ZN8 A;  1H8B A;  1NPQ A;  1S6C A;  3VB1 A;  1XA5 A;  1KSM A;  1SCM B;  3SG3 A;  2EC6 B;  2OPO A;  2LLT A;  1ORG A;  2JXL A;  1YUU A;  1Y0V H;  2NCP A;  4PHJ A;  1DJY A;  2DOQ A;  4CFQ A;  1TIZ A;  1S6I A;  5I94 A;  3B6X A;  1KQM C;  3S0E A;  3BYA A;  1TNQ A;  2LCP A;  1XVJ A;  2F2O A;  1MXL C;  2KGR A;  1WDC C;  2G2B A;  2OTG C;  1QTX A;  2ZRS A;  1IJ6 A;  1DJZ A;  1WLZ A;  4M2P A;  1CFD A;  1OOJ A;  1QX5 B;  1OE9 B;  1S1E A;  5CPV A;  4L9M A;  5D7F A;  2Y4Q A;  3I5H C;  5HL1 A;  1CKK A;  2MLF C;  4GAO A;  4IL1 A;  1S3P A;  1NUB A;  2LHL A;  4KYN A;  1CM1 A;  4M2O A;  5DKQ A;  4DCK A;  3FE8 A;  1SBJ A;  2JRF A;  1ZFS A;  3A8R A;  3CZ0 A;  3I5G B;  4MLW A;  4OKH A;  1FI5 A;  2I7A A;  2JNF A;  3BFA A;  1SR6 B;  2G9B A;  2L4H A;  2V53 A;  3L4A A;  4N1F A;  1CFP A;  4U8D A;  1NCX A;  1JFK A;  3SG4 A;  3GOF A;  2MA2 A;  2ZFD A;  3IQO A;  1QV0 A;  4HSZ A;  1CTR A;  4PHN A;  3FE6 A;  1Y6W A;  1M45 A;  4FQT A;  2QEB A;  3PFV A;  1RFJ A;  2LMV A;  1XFY O;  1IRJ A;  1XO5 A;  3LLE A;  3DY9 A;  1ALV A;  2LM5 A;  2LP2 A;  3SG6 A;  1IJ5 A;  1XK4 C;  2PRU A;  4ICB A;  2K2A A;  4OV2 A;  2L51 A;  1N0Y A;  1CLM A;  1UUR A;  1J7R A;  2I94 A;  3D0Y B;  1KQM B;  1WY9 A;  4OZD A;  4I5J A;  2SCP A;  1DJG A;  2BAP A;  1GJY A;  3SS5 A;  1V1F A;  2MRD A;  4D1E A;  2OS8 B;  1TNP A;  3CR2 A;  1RK9 A;  3R1V A;  1A2X A;  3CLN A;  3E3R A;  3OHM B;  3CS1 A;  1SL8 A;  2F3Z A;  2JTT A;  3I5H B;  1F55 A;  1XFZ O;  1JC2 A;  3D76 A;  2JT0 A;  1QVI Y;  1KFX S;  3AKB A;  4PE0 A;  1EG4 A;  4DS7 A;  2WCE A;  4MRX A;  4AOM A;  4OR9 B;  2PAS A;  3O78 A;  1DGV A;  1YUS A;  5JOL A;  1B9A A;  2WCJ A;  2M1K B;  2PVB A;  1DC1 A;  1QAS A;  3KF9 A;  1XFU O;  5CSI A;  3PSR A;  1RWY A;  3L47 A;  3S0D A;  2KQ6 A;  1KFU S;  3SG7 A;  2WCM A;  1X02 A;  3OBV A;  2L2C A;  2JWW A;  3O4Y A;  2KBI A;  3D78 A;  3LCP C;  3NSI A;  3TDU A;  3EG5 B;  2LC5 A;  2KOT A;  3PAT A;  1PUL A;  5KU1 A;  3UO9 A;  3KEV A;  2HET A;  2M8U A;  2I2R E;  4GUK A;  1OMR A;  2WC8 A;  4JQ0 D;  4ZCU A;  1SPY A;  4BY5 A;  5B8I B;  1BG1 A;  1GGZ A;  3PJI A;  3A4U B;  3DYE A;  2L50 A;  1JBA A;  1U5I B;  4DUQ A;  1M31 A;  2K2F A;  1K93 D;  2JOJ A;  1J55 A;  2KAV A;  2LP3 A;  4P5O E;  2COL B;  2KPH A;  3H4S E;  5F6T A;  4ZCV A;  2CBL A;  1GM0 A;  1L2O C;  1NX2 A;  3DVJ A;  1K94 A;  3MSE B;  3BUX B;  2WOS A;  2E30 A;  2EGD A;  1B4C A;  4CID A;  1MR8 A;  1KCY A;  1MWN A;  1PSR A;  3BFH A;  4MZJ A;  1BR4 B;  3WXA A;  1K8U A;  2P70 A;  5K89 A;  5DKR A;  3SJS A;  1LVC D;  1YR5 A;  2ZNE A;  3BOW A;  1YVH A;  2QEV A;  2KFG A;  5I8N A;  3EVV A;  4YGE B;  2BKH B;  2R2I A;  1B8R A;  2WND A;  2JXC A;  4MBE A;  3CGA A;  3NHI A;  1NX3 A;  1OW4 A;  2LAP A;  2M97 A;  1B7T Z;  2PQL A;  4MZL A;  5D69 A;  2H8V A;  1Q80 A;  3AAJ A;  3NSO A;  4GNK B;  3S0B A;  3OX6 A;  1IIO A;  1S5G Z;  4JKT A;  1CDN A;  2H61 A;  2KI4 C;  2K7O A;  1G8I A;  1KK7 Z;  4I5K A;  2NZ0 A;  1K96 A;  4CLN A;  1MUX A;  1EXR A;  3SIA A;  3TS5 C;  3CR4 X;  2EHB A;  1B8C A;  3EK8 A;  3IVT A;  1YRT B;  1QWV A;  3I5I C;  4C0L A;  4USL A;  4F7F A;  1AVS A;  1EL4 A;  2WCH A;  2WC6 A;  2JTZ A;  1OSA A;  3CAB A;  2L2E A;  5DIC A;  4Q04 A;  2BKI B;  4GFT A;  4MN0 A;  1JF2 A;  1A75 A;  1L2O B;  1WLM A;  2FOT A;  2JNX A;  1OOH A;  3B88 A;  3D75 A;  3C1V A;  3DD4 A;  3R1O A;  4INW A;  1JSA A;  1FPW A;  1YX7 A;  1KFX L;  1NYA A;  2BCX A;  3NSK A;  3B86 A;  3EKJ A;  2OS8 C;  1TN4 A;  4MRY A;  1WRZ A;  4QJ3 B;  1CDM A;  4MSP A;  2KFH A;  2BE6 A;  1A4P A;  2KLD A;  2K7C A;  1BF5 A;  1N2D A;  1OMD A;  2BL0 C;  5CSN A;  4WQ2 A;  1IKU A;  1TUJ A;  3ZWH A;  5FYX A;  1SL9 A;  2KLE A;  1M39 A;  1J7O A;  1J1E A;  2RGI A;  1KFU L;  3HX4 A;  4GPL B;  1EG3 A;  2LMU A;  2KI4 B;  1IGV A;  2NCO A;  3BUO B;  3KHE A;  1W7J B;  2WCB A;  1CFF A;  2KFF A;  1FI6 A;  2FCE A;  3TS5 B;  2CTN A;  1PSB A;  3M0W A;  1FBV A;  2KNE A;  1QJT A;  3QRX A;  3I5I B;  5HKY A;  1B47 A;  4FQO A;  3BUW B;  1MQ1 A;  3EKH A;  1WRL A;  1IH0 A;  1DTL A;  3O6B A;  3FWB A;  1CFC A;  3LK0 A;  5TNC A;  1KSO A;  2WCK A;  2QEH A;  1D1O A;  4INX A;  3RM1 A;  1Y1U A;  1DVI A;  5FI2 A;  5HKZ A;  2VRG A;  1M46 A;  1MHO A;  1BOC A;  2M7N A;  5G08 A;  1S36 A;  2F33 A;  4C0K A;  4JWQ A;  1MXE A;  4YGD B;  3DF0 A;  1XFV O;  2K8M B;  2E6W A;  3RZS A;  2PMY A;  1F71 A;  1LKJ A;  1AHR A;  1K9U A;  2BEC A;  2BL0 B;  3N7H A;  3RLZ A;  1L7Z A;  1QIV A;  5ER5 A;  1KWO C;  3JTD C;  3VGO A;  3BXK A;  1LS8 A;  3DVK A;  1G33 A;  1TCF A;  1B7T Y;  2JZI A;  4ORC B;  2FJU B;  1LA0 A;  2CXJ A;  2KYF A;  1OMV A;  2LLS A;  2ISD A;  2Y1M A;  1SY9 A;  3TDI A;  5FI6 A;  1S5G Y;  4PDZ A;  3PM2 A;  4TNC A;  1IWQ A;  2HQW A;  3LL8 B;  1NX0 A;  2O5G A;  1KK7 Y;  1YVL A;  1XFR A;  1E8A A;  2BCB A;  1BR1 B;  1P28 A;  4N5X A;  4NQG A;  3TDZ A;  2JC2 A;  2LV7 A;  1XFW O;  3GK4 X;  1BJF A;  2M1U A;  4DRW A;  2LHI A;  5D3O A;  3S0A A;  1TNW A;  1CM4 A;  4NDB A;  1CMF A;  2MAZ A;  2AUC A;  2QEO A;  3D74 A;  5I2O A;  3D10 A;  3V2L A;  1RJV A;  2F3Y A;  5AEQ A;  2ZRT A;  4NDC A;  1SMG A;  1C7W A;  1UWO A;  1ZAC A;  3UNW A;  2WCL A;  2KI6 D;  5HLO A;  1OOG A;  1C3Y A;  1S6J A;  1AK8 A;  2KYC A;  3KO0 A;  3DVE A;  1NSH A;  1PVB A;  1TOP A;  2Y5I A;  4UPG A;  4FTG A;  4PE7 A;  1ZOT B;  3L4L A;  5AFP A;  1Y1A A;  3D0Y A;  3CR5 X;  1M63 B;  2WCF A;  1OOF A;  1KWO B;  1AJ4 A;  1TUZ A;  2H2K A;  2PAL A;  3JTD B;  3PN7 C;  4PE4 A;  3VRN A;  1J7Q A;  2BBM A;  3EVR A;  2LLU A;  4GGF A;  1DF0 A;  1ZUZ A;  1TNX A;  1UHI A;  5KSZ A;  1A75 B;  1PK0 D;  4WRI A;  1CB1 A;  1OQP A;  4PE1 A;  4R1E A;  2IS9 A;  1ODB A;  3S0G A;  1JUO A;  2LUC A;  1NCZ A;  2M3W A;  2Q4U A;  1GQM A;  3EK4 A;  2JPO A;  2BBN A;  4XYN A;  1C7V A;  4M2Q A;  1RRO A;  2K7D A;  1B8L A; 
#chains in the Genus database with same CATH homology
 1W7I B;  2K7B A;  5PAL A;  1BMO A;  1SYM A;  2L5X B;  2NXQ A;  3EVU A;  2M49 B;  4A4B A;  1UHJ A;  2NLN A;  4YI9 A;  2GV5 A;  3WHT B;  2AAO A;  2B1U A;  5AAN A;  3FIA A;  3IQQ A;  2Q91 A;  4QJ4 B;  5GQQ C;  1K95 A;  3F45 A;  5I2Q A;  1SW8 A;  1A03 A;  1SRA A;  1B1G A;  1NCY A;  2L4I A;  2CNP A;  2M9G A;  1SKT A;  1XK4 A;  2KI6 C;  2KSP A;  4PHK A;  1J1D A;  5AXI A;  1QX2 A;  3O2P A;  4HRE E;  4P2Y B;  3SIB A;  1KK8 C;  2JQ6 A;  1BT6 A;  2HPS A;  3IF7 A;  4OVN F;  3PN7 B;  1MF8 B;  1LA3 A;  2SAS A;  1PRW A;  2GGZ A;  1RTP 1;  1DGU A;  1C07 A;  2AMI A;  1JF0 A;  1CLL A;  3OB1 B;  4I5L B;  5HYD A;  3I5F C;  1TRF A;  3JVT B;  1OZS A;  3AKA A;  1UHH A;  3FWC A;  2M29 A;  4HRH A;  3DF0 B;  1ZMZ A;  4ETO A;  3PAL A;  4XJK A;  1HT9 A;  1BLQ A;  3KPX A;  2JT8 A;  3OB2 B;  3PM8 A;  5IBW A;  4E68 A;  3WHU B;  1NP8 A;  2FCD A;  4YRU A;  1ALW A;  2ZN9 A;  4GGF C;  4YGB B;  1AUI B;  2MHH A;  2K0J A;  4ORA B;  1R6P A;  2BE4 A;  1QAT A;  1YUT A;  4JPZ B;  4YBH B;  1DT7 B;  2KGB C;  2F2P A;  2MLE C;  2M7L A;  2K61 A;  4GBA A;  3FS7 A;  5HKW A;  1NIW A;  1KK8 B;  5CSJ A;  5DKN A;  3TUY C;  3CTN A;  1SK6 D;  2ZND A;  2H61 C;  5CSF A;  1UHN A;  1SNL A;  2BCA A;  4YI8 A;  1CMG A;  2A4J A;  1IQ5 A;  4MEW A;  3WNX B;  3I5F B;  2KAY A;  3TZ1 A;  3CZT X;  1K9K A;  4MZK A;  1JWD A;  1IQ3 A;  1Y1X A;  2PSR A;  4DIR A;  1SCV A;  1F4Q A;  2TN4 A;  1PAL A;  1JFJ A;  5KTY A;  4YGA A;  2KHN A;  1YUR A;  1QV1 A;  4WQ3 A;  1LIN A;  2M0R A;  3VRO A;  1LXF C;  2LVV A;  4YGC B;  4CPV A;  4CFR A;  5J3X A;  2KQY A;  1PVA A;  1WDC B;  2OTG B;  1CDL A;  1REC A;  1QLS A;  1DJX A;  4AQJ A;  1DF0 B;  2QPT A;  1V1G A;  1XFX O;  3BOW B;  3LK1 A;  1EJ3 A;  4QJ5 B;  3SG2 A;  1EH2 A;  2QAC A;  4GGN A;  1UUS A;  3SG5 A;  1J7P A;  1WRK A;  4MVF A;  1F70 A;  2GGM A;  1QIW A;  2JT3 A;  2MJW B;  3AAK A;  3TUY B;  1VRK A;  1S26 D;  5AER A;  1QX7 A;  1A29 A;  2CCM A;  2L98 A;  3HCM A;  1IG5 A;  3EK7 A;  4I5N B;  2LE9 B;  1R2U A;  3PLF B;  2HQ8 A;  3NXA A;  4PCW A;  2I18 A;  1N65 A;  2CT9 A;  5BPJ A;  2HF5 A;  1BOD A;  1GGW A;  1H4B A;  2F8P A;  1TCO B;  3BUN B;  4A4C A;  1DMO A;  4BY4 A;  1QLK A;  2P6B B;  5ER4 X;  1FF1 A;  1CLB A;  1F54 A;  1YRU B;  1K9P A;  3GK2 A;  1NWD A;  3JVT C;  4ORB B;  2ZKM X;  3OP0 A;  5HLV A;  3K21 A;  1UP5 A;  3VRQ A;  4NDD A;  1F8H A;  2KDH A;  4PAL A;  2MBX A;  1SCM C;  4F0Z B;  1DJH A;  2EC6 C;  4PHM A;  2Y1N A;  3DVM A;  3VRR A;  1G4Y R;  5I2L A;  2LVI A;  1K90 D;  2LNK A;  3OX5 A;  1XYD A;  4AQI A;  2JPT A;  3GK1 A;  5JJG A;  1BU3 A;  3VRP A;  1AJ5 A;  1NX1 A;  1SL7 A;  2KBM A;  2L0P A;  1QVI Z;  4N1G A;  4XJK B;  1K2H A;  2WOR A;  1QXP A;  4HRG A;  2D8N A;  2LMT A;  3ICB A;  3BUM B;  1DJW A;  3NSL A;  1AP4 A;  1QS7 A;  1TTX A;  1YTZ C;  1YX8 A;  3I5G C;  1F4O A;  1UHK A;  2KAX A;  1CDP A;  2LUX A;  1FW4 A;  2LVK A;  1DJI A;  1HQV A;  2JUL A;  4C0J A;  1KQV A;  1U5I A;  4OCI A;  1SR6 C;  1OZO A;  3BQ3 A;  3CWG A;  2LVJ A;  2LAN A;  2O60 A;  2JU0 A;  1CNP A;  3ZNI A;  2ZN8 A;  1H8B A;  1NPQ A;  1S6C A;  1XA5 A;  1KSM A;  1SCM B;  3SG3 A;  2EC6 B;  2OPO A;  2LLT A;  2JXL A;  1YUU A;  1Y0V H;  2NCP A;  4PHJ A;  1DJY A;  2DOQ A;  4CFQ A;  1TIZ A;  1S6I A;  1KQM C;  3BYA A;  1TNQ A;  2LCP A;  1XVJ A;  2F2O A;  1MXL C;  2KGR A;  1WDC C;  2G2B A;  2OTG C;  1QTX A;  2ZRS A;  1IJ6 A;  1DJZ A;  1WLZ A;  4M2P A;  1CFD A;  1OOJ A;  1QX5 B;  1OE9 B;  1S1E A;  5CPV A;  4L9M A;  5D7F A;  2Y4Q A;  3I5H C;  1CKK A;  2MLF C;  4GAO A;  4IL1 A;  1S3P A;  1NUB A;  2LHL A;  4DCK A;  1CM1 A;  4M2O A;  5DKQ A;  1SBJ A;  2JRF A;  1ZFS A;  3A8R A;  3I5G B;  4MLW A;  4OKH A;  1FI5 A;  2I7A A;  2JNF A;  1SR6 B;  2G9B A;  2L4H A;  2V53 A;  4N1F A;  1CFP A;  4U8D A;  1NCX A;  1JFK A;  3SG4 A;  3GOF A;  2MA2 A;  2ZFD A;  3IQO A;  1QV0 A;  4HSZ A;  1CTR A;  4PHN A;  1Y6W A;  1M45 A;  3PFV A;  1RFJ A;  2LMV A;  1XFY O;  1IRJ A;  1XO5 A;  3LLE A;  1ALV A;  2LM5 A;  2LP2 A;  3SG6 A;  1IJ5 A;  1XK4 C;  2PRU A;  4ICB A;  2K2A A;  4OV2 A;  2L51 A;  1N0Y A;  1CLM A;  1UUR A;  1J7R A;  2I94 A;  3D0Y B;  1KQM B;  1WY9 A;  4D1E A;  4I5J A;  2SCP A;  1DJG A;  1GJY A;  1V1F A;  2MRD A;  2OS8 B;  1TNP A;  3CR2 A;  1RK9 A;  1A2X A;  3CLN A;  3E3R A;  3OHM B;  3CS1 A;  1SL8 A;  2F3Z A;  2JTT A;  3I5H B;  1F55 A;  1XFZ O;  1JC2 A;  2JT0 A;  1QVI Y;  1KFX S;  3AKB A;  4PE0 A;  1EG4 A;  4DS7 A;  2WCE A;  4MRX A;  4AOM A;  4OR9 B;  2PAS A;  3O78 A;  1DGV A;  1YUS A;  5JOL A;  1B9A A;  2M1K B;  2PVB A;  1QAS A;  3KF9 A;  1XFU O;  5CSI A;  3PSR A;  1RWY A;  2KQ6 A;  1KFU S;  3SG7 A;  1X02 A;  2JWW A;  3O4Y A;  2KBI A;  3LCP C;  3NSI A;  3TDU A;  2LC5 A;  2KOT A;  3PAT A;  1PUL A;  5KU1 A;  3KEV A;  2HET A;  2M8U A;  2I2R E;  4GUK A;  1OMR A;  2WC8 A;  4JQ0 D;  4ZCU A;  1SPY A;  4BY5 A;  5B8I B;  1BG1 A;  1GGZ A;  3A4U B;  2L50 A;  1JBA A;  1U5I B;  4DUQ A;  1M31 A;  2K2F A;  1K93 D;  2JOJ A;  1J55 A;  2KAV A;  2LP3 A;  4P5O E;  2COL B;  5F6T A;  3H4S E;  4ZCV A;  2CBL A;  1L2O C;  1NX2 A;  3DVJ A;  1K94 A;  3MSE B;  3BUX B;  2WOS A;  2E30 A;  2EGD A;  1B4C A;  4CID A;  1MR8 A;  1KCY A;  1MWN A;  1PSR A;  4MZJ A;  3WXA A;  1BR4 B;  5K89 A;  1K8U A;  5DKR A;  3SJS A;  1LVC D;  1YR5 A;  2ZNE A;  3BOW A;  1YVH A;  2KFG A;  5I8N A;  3EVV A;  4YGE B;  2BKH B;  2R2I A;  1B8R A;  2WND A;  2JXC A;  4MBE A;  3CGA A;  1NX3 A;  2LAP A;  2M97 A;  1B7T Z;  4MZL A;  5D69 A;  1Q80 A;  3AAJ A;  3NSO A;  4GNK B;  3OX6 A;  1S5G Z;  1CDN A;  2H61 A;  2KI4 C;  2K7O A;  1G8I A;  1KK7 Z;  4I5K A;  2NZ0 A;  1K96 A;  4CLN A;  1MUX A;  1EXR A;  3SIA A;  3TS5 C;  3CR4 X;  2EHB A;  1B8C A;  3EK8 A;  1YRT B;  3I5I C;  4C0L A;  4USL A;  1AVS A;  1EL4 A;  2JTZ A;  1OSA A;  2L2E A;  4Q04 A;  2BKI B;  4GFT A;  4MN0 A;  1JF2 A;  1A75 A;  1L2O B;  1WLM A;  2FOT A;  2JNX A;  3DD4 A;  3C1V A;  1JSA A;  1FPW A;  1YX7 A;  1KFX L;  2BCX A;  1NYA A;  3NSK A;  3EKJ A;  2OS8 C;  1TN4 A;  4MRY A;  1WRZ A;  4QJ3 B;  1CDM A;  4MSP A;  2KFH A;  2BE6 A;  1A4P A;  2K7C A;  1BF5 A;  1N2D A;  1OMD A;  2BL0 C;  5CSN A;  4WQ2 A;  1IKU A;  3ZWH A;  5FYX A;  1SL9 A;  1M39 A;  1J7O A;  1J1E A;  2RGI A;  1KFU L;  3HX4 A;  4GPL B;  1EG3 A;  2LMU A;  2KI4 B;  1IGV A;  2NCO A;  3BUO B;  3KHE A;  1W7J B;  2WCB A;  1CFF A;  2KFF A;  1FI6 A;  2FCE A;  3TS5 B;  2CTN A;  1PSB A;  3M0W A;  1FBV A;  2KNE A;  1QJT A;  3QRX A;  3I5I B;  5HKY A;  1B47 A;  4FQO A;  3BUW B;  1MQ1 A;  3EKH A;  1WRL A;  1IH0 A;  1DTL A;  3O6B A;  3FWB A;  1CFC A;  3LK0 A;  5TNC A;  1KSO A;  1D1O A;  3RM1 A;  1Y1U A;  1DVI A;  5HKZ A;  2VRG A;  1M46 A;  1MHO A;  1BOC A;  2M7N A;  5G08 A;  1S36 A;  2F33 A;  4C0K A;  4JWQ A;  1MXE A;  4YGD B;  3DF0 A;  1XFV O;  2K8M B;  2E6W A;  2PMY A;  1F71 A;  1LKJ A;  1AHR A;  1K9U A;  2BEC A;  2BL0 B;  3RLZ A;  1L7Z A;  1QIV A;  5ER5 A;  1KWO C;  3JTD C;  3VGO A;  3BXK A;  3DVK A;  1G33 A;  1TCF A;  1B7T Y;  2JZI A;  4ORC B;  2FJU B;  1LA0 A;  2CXJ A;  2KYF A;  1OMV A;  2LLS A;  2ISD A;  2Y1M A;  1SY9 A;  3TDI A;  1S5G Y;  4PDZ A;  4TNC A;  1IWQ A;  2HQW A;  3LL8 B;  1NX0 A;  2O5G A;  1KK7 Y;  1YVL A;  1E8A A;  2BCB A;  1BR1 B;  4N5X A;  4NQG A;  3TDZ A;  2JC2 A;  2LV7 A;  1XFW O;  3GK4 X;  1BJF A;  2M1U A;  4DRW A;  2LHI A;  1TNW A;  1CM4 A;  4NDB A;  1CMF A;  2MAZ A;  2AUC A;  5I2O A;  3D10 A;  1RJV A;  2F3Y A;  5AEQ A;  2ZRT A;  4NDC A;  1SMG A;  1C7W A;  1UWO A;  1ZAC A;  2KI6 D;  5HLO A;  1S6J A;  1AK8 A;  2KYC A;  3KO0 A;  3DVE A;  1NSH A;  1PVB A;  1TOP A;  2Y5I A;  4UPG A;  4FTG A;  4PE7 A;  1ZOT B;  5AFP A;  1Y1A A;  3D0Y A;  3CR5 X;  1M63 B;  2WCF A;  2PAL A;  1KWO B;  1AJ4 A;  3JTD B;  2H2K A;  3PN7 C;  4PE4 A;  3VRN A;  1J7Q A;  2BBM A;  3EVR A;  2LLU A;  4GGF A;  1DF0 A;  1ZUZ A;  1TNX A;  1UHI A;  5KSZ A;  1A75 B;  1PK0 D;  4WRI A;  1CB1 A;  1OQP A;  4PE1 A;  4R1E A;  2IS9 A;  1ODB A;  1JUO A;  2LUC A;  1NCZ A;  2M3W A;  2Q4U A;  1GQM A;  3EK4 A;  4XYN A;  2BBN A;  1C7V A;  4M2Q A;  1RRO A;  2K7D A;  1B8L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...