2JQ6A

Structure of eh-domain of ehd1
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
139
structure length
139
Chain Sequence
GPLGSESLMPSQVVKGGAFDGTMNGPFGHGYGEGAGEGIDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPSKRRHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EH domain-containing protein 1
publication title EH domain of EHD1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 28
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2007-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12763 EF-hand_4 Cytoskeletal-regulatory complex EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2jq6A01
1UWOA 5HLOA 3KPXA 4M2OA 2I18A 4I5JA 2BECA 2M1KB 1MWNA 2LM5A 2M7NA 1PSBA 2AMIA 2NCPA 1DMOA 1GGZA 1K95A 3EK7A 1NIWA 1RJVA 3RM1A 1NX3A 2EC6B 4N5XA 2SCPA 2ZFDA 1IKUA 1B1GA 3DD4A 1LINA 1QIVA 1BR1B 1XA5A 1Y1XA 4PHMA 2NLNA 4DRWA 1A75A 2LE9B 2KBMA 1B47A 1FI5A 1J55A 2RGIA 3SG4A 3WHTB 1XFYO 2FCEA 2OTGC 2HETA 1LXFC 3NSIA 4ICBA 2KI4C 1S5GZ 5HKYA 2AAOA 2F33A 1EXRA 1YUUA 1QS7A 3BOWB 2FJUB 1KFUL 3FWCA 5TNCA 1GGWA 4D1EA 5JJGA 2K8MB 4QJ5B 1N2DA 3CTNA 1QV0A 1N65A 1YR5A 2KQYA 2O60A 3WHUB 1F4QA 1XK4A 1KK7Y 3BYAA 1YUSA 4XJKA 4DS7A 2LVKA 3O4YA 4AQJA 2F3YA 2KAVA 1EH2A 4U8DA 2MLEC 2HF5A 1OQPA 1OZSA 2K0JA 2K61A 2OTGB 2EHBA 1FW4A 1IGVA 1NCZA 1K9PA 1RROA 3NSLA 2LUXA 4YBHB 1MF8B 4GUKA 1CMGA 1R2UA 1UUSA 3TZ1A 1J7QA 2KYCA 2M8UA 4P2YB 2HQ8A 3DF0A 2K7BA 1BOCA 1FI6A 1MR8A 1QTXA 3GOFA 4MSPA 3FWBA 1RFJA 3DVEA 1NX2A 2BCXA 1YX8A 1S1EA 2L2EA 1A03A 4YGCB 2LNKA 1TCFA 5DKRA 4YGAA 3JTDC 1U5IB 2JT3A 2KOTA 2LMUA 1B9AA 2ZNDA 2E6WA 2K2FA 4PE1A 3TUYC 2MAZA 1QVIY 1ODBA 3LK0A 4P5OE 3TS5C 1TTXA 3C1VA 1WLMA 1A4PA 4MZKA 3RLZA 1S26D 1XFXO 1B8CA 5KU1A 1LA0A 1YRTB 5CSFA 2E30A 1G33A 1AVSA 1KQMC 2JTZA 2L5XB 2L98A 2BKIB 3LL8B 3OX6A 1SBJA 3IQOA 1K90D 3DVKA 1WDCC 2LP2A 3IF7A 5ER5A 2TN4A 1WLZA 1S6CA 1M39A 2GGMA 3JTDB 3BUXB 5HKZA 1C7WA 1B8RA 1NX1A 3FS7A 1YRUB 1OE9B 2WCEA 4A4BA 2PASA 2F3ZA 4A4CA 3AAKA 2OPOA 2L0PA 2KDHA 1DF0A 2BKHB 1XO5A 2I2RE 3SG2A 5PALA 1YVHA 2PSRA 1IJ6A 2K7OA 3E3RA 2B1UA 2JXCA 3SIAA 2A4JA 2Q91A 2PVBA 3H4SE 4M2QA 3TDUA 1KQMB 1M45A 3FIAA 1QIWA 2EGDA 4CIDA 2ISDA 4BY5A 3VGOA 4QJ4B 5HLVA 1DVIA 1TNXA 1JUOA 1WDCB 4PCWA 1XK4C 3SIBA 1RK9A 1M31A 1TRFA 2WCBA 2ZN8A 4NDDA 1JFKA 3D0YA 3I5HC 1NSHA 4HSZA 1W7IB 5KTYA 1SMGA 2VRGA 4QJ3B 2F8PA 1JF0A 3CS1A 4PE4A 1IQ3A 1EG3A 1TN4A 1IWQA 2WORA 5CSNA 1YX7A 2JWWA 4I5LB 2KGBC 1PALA 2BE4A 1Q80A 3BUOB 2JNXA 1OMRA 4AOMA 1KFUS 2F2PA 3OHMB 1QV1A 2KQ6A 1DTLA 1ZFSA 2L4HA 4PE0A 2JT0A 2SASA 1DJYA 1ALWA 4GAOA 5DKNA 1AP4A 4GBAA 1PULA 1AJ4A 2M49B 2CTNA 5K89A 4XJKB 1UURA 1CFCA 1CTRA 1OMVA 1CLBA 4OCIA 2H2KA 3LK1A 3I5HB 1K94A 5AANA 3EKHA 1G8IA 5AFPA 1LKJA 1IJ5A 1KK7Z 2IS9A 3O78A 3PFVA 3F45A 3SG7A 1PRWA 1BODA 5HYDA 1TNPA 4CFRA 1K96A 2QPTA 1KK8C 2OS8C 2JU0A 2ZRSA 5J3XA 1UHIA 1FF1A 3VRPA 1WRLA 5CSIA 3I5IC 2FCDA 1VRKA 1YUTA 1CLLA 5JOLA 2O5GA 3SG5A 1OZOA 1J1EA 3CR2A 1FBVA 2L50A 1TNQA 1J1DA 1CFFA 1B7TZ 3MSEB 3OP0A 4IL1A 4E68A 3SG6A 5HKWA 1F8HA 4MLWA 4F0ZB 5G08A 2FOTA 1S36A 1S6IA 2KI4B 1XVJA 1CDPA 1IG5A 3PALA 2LVVA 1W7JB 1JF2A 4PHJA 1KK8B 2KSPA 2BL0C 2KYFA 2OS8B 3PSRA 4WRIA 1JC2A 4PHKA 3SJSA 1SK6D 3PATA 3I5FC 3I5IB 5I2LA 1B8LA 2LP3A 1K9UA 3OB2B 2H61C 3HX4A 3A8RA 4M2PA 2JC2A 1WY9A 4YRUA 5GQQC 1MQ1A 1N0YA 1DF0B 5FYXA 3OX5A 2WOSA 2V53A 3SG3A 3AKBA 3BOWA 4DUQA 1SL7A 1RTP1 2KAYA 3ICBA 1KSMA 1SCMC 1J7OA 3QRXA 1F54A 4MRYA 2BBNA 1E8AA 2LANA 5AEQA 1UHNA 2BL0B 3PLFB 4MVFA 1NX0A 2JPTA 2BCAA 1JFJA 1CLMA 2JQ6A 1UP5A 3I5FB 1K9KA 2ZNEA 3EK8A 1PVBA 1C7VA 2Y1MA 1CNPA 1Y1AA 2BBMA 2L51A 3EVRA 5D69A 2MJWB 2KI6D 3GK1A 1K2HA 2KFGA 2KBIA 2JT8A 4HRGA 3TUYB 1CDNA 1KQVA 1SKTA 1BT6A 2CBLA 2BCBA 4DCKA 2BE6A 3TS5B 1DJXA 1CM4A 1XYDA 3A4UB 3AKAA 4JWQA 3NSOA 4ORAB 4AQIA 3CR5X 2JXLA 2Q4UA 1BLQA 2WNDA 5AERA 4GGNA 1A2XA 1SCMB 3D10A 1MHOA 3BUWB 2ZN9A 1BG1A 2JZIA 1KFXL 1TIZA 2DOQA 3LCPC 2K7CA 4JPZB 1MXLC 2QACA 2CT9A 2M97A 3NSKA 1ZOTB 2MBXA 1WRZA 3JVTC 1SRAA 1KSOA 2MRDA 2LUCA 4YI9A 4MBEA 1NWDA 1QATA 1UHHA 1KWOC 2I94A 4CFQA 2COLB 4PE7A 3VROA 3WNXB 4WQ3A 5I2QA 1YVLA 1DJWA 2LMVA 1A75B 3M0WA 1LA3A 1IRJA 5IBWA 4UPGA 2JNFA 2LMTA 2M9GA 2LV7A 3EKJA 4GFTA 3TDZA 1R6PA 2NXQA 3ZNIA 2KGRA 2LVIA 4GGFA 2K2AA 4NDCA 1CFPA 2JRFA 3DVJA 1M46A 1QXPA 1SCVA 5D7FA 2WCFA 1AK8A 1QLKA 4I5KA 4ZCVA 1V1GA 1BJFA 4Q04A 4OVNF 1ZMZA 1ZACA 4ZCUA 3KHEA 4TNCA 4MZLA 1OOJA 2G2BA 1DGUA 1F71A 2K7DA 3JVTB 1KWOB 1M63B 1WRKA 3AAJA 4C0JA 4L9MA 1JWDA 5CPVA 2JTTA 5I2OA 3PN7C 2M0RA 1SPYA 2ZRTA 4YI8A 4NDBA 1PSRA 1RWYA 1NYAA 2LVJA 1QASA 1GJYA 4PDZA 1PVAA 4DIRA 1QLSA 1QJTA 1BF5A 3GK4X 2NCOA 2R2IA 1LVCD 3DF0B 2MA2A 1SL9A 3OB1B 1QX2A 1L2OC 1NUBA 2M3WA 4OR9B 2L4IA 5BPJA 1BMOA 5AXIA 3KF9A 1OSAA 1DT7B 3PN7B 4XYNA 2CXJA 5F6TA 4FTGA 3VRRA 3CZTX 4CPVA 1NPQA 2JULA 1Y6WA 2G9BA 1XFWO 4PHNA 1D1OA 2P6BB 4YGEB 5I8NA 1CMFA 1J7PA 4PALA 4I5NB 1QVIZ 3CWGA 1IQ5A 1CFDA 1EL4A 1NCYA 1DJIA 4MEWA 3O6BA 1XFUO 1ALVA 1JSAA 2I7AA 3KEVA 1L2OB 4C0LA 1S5GY 4JQ0D 1CDMA 1CB1A 1ZUZA 4NQGA 1QX5B 2PALA 3EK4A 1SYMA 2KI6C 3O2PA 1SR6C 1CDLA 1S3PA 2D8NA 3NXAA 3CGAA 1TNWA 3HCMA 4N1FA 5DKQA 4GGFC 4OKHA 2M1UA 1AUIB 4MRXA 1TCOB 1KFXS 1GQMA 1X02A 2KFHA 4MN0A 2CNPA 3PM8A 1PK0D 3IQQA 4MZJA 1B7TY 1DJZA 1JBAA 1TOPA 1Y1UA 2MHHA 2AUCA 1J7RA 1F4OA 3GK2A 3BUNB 3TDIA 1DJHA 1B4CA 1OMDA 4WQ2A 4ETOA 1SR6B 1SY9A 2HPSA 3D0YB 3DVMA 4YGBB 1K8UA 4HREE 2WC8A 3EVUA 3ZWHA 1XFZO 4ORCB 1DGVA 2Y4QA 4C0KA 3CLNA 1L7ZA 1SW8A 1IH0A 3VRQA 2LLSA 1K93D 2LC5A 5CSJA 1NCXA 2Y5IA 1MUXA 2KFFA 2LLUA 1C07A 1FPWA 1UHJA 2GV5A 1RECA 1AHRA 1NP8A 1BR4B 1UHKA 2KHNA 1U5IA 1YURA 3VRNA 1H8BA 3BXKA 2PRUA 2Y1NA 4N1GA 2LHLA 2KAXA 2PMYA 1A29A 3BQ3A 3I5GC 2LLTA 4OV2A 4BY4A 1G4YR 2CCMA 1SNLA 1HT9A 1AJ5A 1SL8A 1S6JA 2LCPA 4ORBB 3BUMB 1CM1A 4USLA 1F55A 3CR4X 1HQVA 2F2OA 2JOJA 4R1EA 5ER4X 4CLNA 1H4BA 1KCYA 3K21A 3WXAA 1V1FA 1EJ3A 1MXEA 3KO0A 2EC6C 2M29A 2M7LA 1DJGA 1CKKA 1XFVO 2MLFC 4GPLB 4HRHA 2NZ0A 4GNKB 5B8IB 1F70A 5KSZA 4FQOA 2KNEA 2LAPA 2ZKMX 2LHIA 3EVVA 3LLEA 1EG4A 2H61A 2GGZA 1BU3A 1QX7A 3I5GB 4YGDB 2HQWA 1Y0VH 1YTZC
chains in the Genus database with same CATH superfamily
1UWOA 5HLOA 3KPXA 4M2OA 2I18A 4I5JA 2BECA 2M1KB 1MWNA 2LM5A 2M7NA 1PSBA 2AMIA 2NCPA 1DMOA 1GGZA 3BJHA 1K95A 3EK7A 1NIWA 1RJVA 3K1EA 1NX3A 2EC6B 4N5XA 2SCPA 3RM1A 2ZFDA 3D74A 1IKUA 1B1GA 3DD4A 1LINA 1QIVA 1BR1B 2WCJA 1XA5A 1Y1XA 4PHMA 2NLNA 4DRWA 1A75A 2LE9B 2KBMA 3R1PA 1B47A 1FI5A 1J55A 2RGIA 3SG4A 3WHTB 1XFYO 2FCEA 5D3OA 2OTGC 2HETA 1LXFC 3NSIA 4ICBA 2KI4C 1S5GZ 5HKYA 2AAOA 2F33A 1EXRA 1YUUA 3NHTA 1QS7A 3BOWB 2FJUB 1KFUL 3FWCA 5TNCA 1GGWA 4D1EA 5JJGA 4PT1A 2K8MB 4QJ5B 1N2DA 3CTNA 1QV0A 1N65A 1YR5A 3DYEA 2KQYA 2O60A 3WHUB 1F4QA 1XK4A 1KK7Y 3OBVA 3BYAA 1YUSA 4XJKA 1C3ZA 4DS7A 2LVKA 3O4YA 4AQJA 2F3YA 3CDNA 2KAVA 3S0FA 2FJYA 4U8DA 1EH2A 2MLEC 2HF5A 1OQPA 1OZSA 2K0JA 2K61A 2OTGB 2EHBA 3B7AA 1FW4A 1IGVA 1NCZA 1K9PA 1RROA 3DY9A 2LUXA 3NSLA 1MF8B 4GUKA 4YBHB 1CMGA 2BAPA 1R2UA 1UUSA 3TZ1A 1J7QA 2KYCA 2M8UA 4P2YB 3VB1A 2HQ8A 3CZ2A 3DF0A 2K7BA 1BOCA 1FI6A 1MR8A 1QTXA 3GOFA 4MSPA 3FWBA 1RFJA 3DVEA 1NX2A 1YX8A 2BCXA 1S1EA 2L2EA 1A03A 4YGCB 3B86A 2LNKA 1TCFA 5DKRA 4YGAA 1Z4HA 3JTDC 1U5IB 2JT3A 2KOTA 2LMUA 3BFHA 2JPOA 1B9AA 2ZNDA 2E6WA 2K2FA 4PE1A 3TUYC 2MAZA 1QVIY 1ODBA 1DQEA 2WCHA 3LK0A 4P5OE 5DICA 3SS4A 3TS5C 1TTXA 5HL1A 3C1VA 1WLMA 1A4PA 4MZKA 3RLZA 1S26D 1XFXO 1B8CA 5KU1A 1LA0A 1YRTB 5CSFA 2E30A 1G33A 1AVSA 3PM2A 4JD9A 1KQMC 2JTZA 2L5XB 2L98A 2BKIB 3LL8B 3OX6A 1SBJA 3IQOA 1K90D 3DVKA 1WDCC 2LP2A 2WCKA 3IF7A 5ER5A 2TN4A 1WLZA 1S6CA 1M39A 2GGMA 3D73A 3JTDB 3BUXB 5HKZA 1C7WA 1B8RA 1NX1A 3FS7A 1YRUB 1OE9B 2WCEA 4A4BA 2PASA 2F3ZA 4A4CA 3AAKA 1QWVA 2OPOA 2L0PA 3B87A 2KDHA 1DF0A 2BKHB 1XO5A 2I2RE 3SG2A 2WCMA 1YVHA 2PSRA 1IJ6A 2K7OA 1OW4A 3E3RA 5PALA 2B1UA 2JXCA 3R72A 3SIAA 2A4JA 2K60A 2Q91A 2PVBA 3H4SE 4M2QA 3TDUA 1KQMB 1M45A 3FIAA 1QIWA 2EGDA 4CIDA 2ISDA 4BY5A 3S0GA 3VGOA 4QJ4B 5HLVA 1DVIA 1TNXA 1JUOA 1WDCB 4PCWA 1XK4C 3SIBA 3D78A 1RK9A 3D75A 2ERBA 1M31A 2QEVA 1TRFA 2WCBA 2ZN8A 4NDDA 1JFKA 3D0YA 3I5HC 1NSHA 4HSZA 1W7IB 4OZDA 1SMGA 2VRGA 4QJ3B 3CABA 2F8PA 1JF0A 3CS1A 4PE4A 1IQ3A 1EG3A 3Q8IA 1TN4A 1IWQA 2WORA 5CSNA 1YX7A 2JWWA 4I5LB 2KGBC 1PALA 2BE4A 1Q80A 2WCLA 3BUOB 2JNXA 3NHIA 1DELA 1OMRA 3R1VA 4AOMA 1KFUS 3BFAA 2F2PA 3OHMB 1QV1A 2KQ6A 1DTLA 1ZFSA 2L4HA 4PE0A 2JT0A 2SASA 1DJYA 1ALWA 4GAOA 5DKNA 1AP4A 4GBAA 1PULA 1AJ4A 2M49B 2CTNA 5K89A 4XJKB 1UURA 1XFRA 1CTRA 1OMVA 1CFCA 1CLBA 4OCIA 2H2KA 3LK1A 3I5HB 1K94A 5AANA 3QMEA 2P70A 3EKHA 1G8IA 5AFPA 3CYZA 1LKJA 1IJ5A 1KK7Z 2IS9A 1TWOA 3O78A 4KYNA 3PFVA 3F45A 3SG7A 5I94A 1PRWA 1BODA 5HYDA 1TNPA 4CFRA 1K96A 2QPTA 1KK8C 2OS8C 3RZSA 3S0EA 2JU0A 2ZRSA 5J3XA 2QEOA 1UHIA 3FE6A 1FF1A 3VRPA 1WRLA 3L4LA 5CSIA 3I5IC 2FCDA 1VRKA 1YUTA 1CLLA 2YGUA 5JOLA 2O5GA 3SG5A 1OZOA 1LS8A 1J1EA 3CR2A 1FBVA 2L50A 1TNQA 1J1DA 1CFFA 1B7TZ 3MSEB 3OP0A 4IL1A 4E68A 3SG6A 5HKWA 1F8HA 4MLWA 4F0ZB 1SSEB 5G08A 2FOTA 1S36A 1S6IA 2KI4B 1XVJA 1CDPA 1IG5A 3UNWA 3PALA 2LVVA 1IIOA 1W7JB 1JF2A 4PHJA 1KK8B 2KSPA 2BL0C 2KYFA 2OS8B 3PSRA 4WRIA 5KTYA 2GTEA 1JC2A 4PHKA 3SJSA 1SK6D 3PATA 3I5FC 3I5IB 4JKTA 1B8LA 5I2LA 2LP3A 1K9UA 1DC1A 3OB2B 2BNXA 2H61C 3DZTA 3A8RA 3HX4A 4M2PA 2JC2A 1WY9A 4YRUA 5GQQC 1MQ1A 1N0YA 1DF0B 5FYXA 3OX5A 2WOSA 3D76A 2V53A 3SG3A 3O4XA 3AKBA 3BOWA 4DUQA 1SL7A 1RTP1 2KAYA 2WC5A 1KSMA 1SCMC 3ICBA 1J7OA 3QRXA 1W9ZA 1F54A 4MRYA 2BBNA 1E8AA 2WC6A 2LANA 5AEQA 2H8VA 1T14A 1UHNA 2BL0B 3PLFB 4MVFA 1NX0A 3SS5A 2JPTA 2BCAA 1JFJA 1CLMA 2JQ6A 5FI2A 1UP5A 4F7FA 3I5FB 1K9KA 2PYQA 2ZNEA 1PVBA 3EK8A 2Y1MA 1C7VA 1Y1AA 2BBMA 2L51A 3EVRA 5D69A 3FE9A 2MJWB 2KI6D 3GK1A 1K2HA 2KFGA 2KBIA 2JT8A 4HRGA 3TUYB 1CDNA 1KQVA 1SKTA 1BT6A 2CBLA 2BCBA 4DCKA 2BE6A 3TS5B 1DJXA 1CM4A 1XYDA 3A4UB 3AKAA 4JWQA 3NSOA 4ORAB 4AQIA 3CR5X 2JXLA 2Q4UA 1BLQA 2WNDA 2QEBA 4GGNA 5AERA 1A2XA 1SCMB 3D10A 1MHOA 3BUWB 2ZN9A 1BG1A 2JZIA 1KFXL 1TIZA 1TUJA 4IJ7A 2KLEA 2DOQA 3LCPC 3L4AA 2K7CA 4JPZB 1MXLC 2QACA 2CT9A 2M97A 3NSKA 1ZOTB 2MBXA 1WRZA 3JVTC 1SRAA 1KSOA 2MRDA 2LUCA 4YI9A 4MBEA 1NWDA 1QATA 1UHHA 1KWOC 2I94A 4CFQA 2COLB 4PE7A 3VROA 3WNXB 4WQ3A 3S0BA 1YVLA 5I2QA 1DJWA 2LMVA 1A75B 3M0WA 1LA3A 1IRJA 3OGNA 4UPGA 5IBWA 2JNFA 2LMTA 2M9GA 2LV7A 3EKJA 4GFTA 3TDZA 1R6PA 2NXQA 3ZNIA 2KGRA 2LVIA 4GGFA 2K2AA 4NDCA 1CFPA 2JRFA 3DVJA 1M46A 1QXPA 1SCVA 5D7FA 2WCFA 2PQLA 1AK8A 1QLKA 4I5KA 1DEKA 1V1GA 4ZCVA 1BJFA 3NGVA 5EL2A 4Q04A 4OVNF 1ZMZA 1ZACA 3UO9A 4ZCUA 3KHEA 4TNCA 4INXA 4MZLA 1OOJA 3CZ1A 2G2BA 1DGUA 1F71A 2K7DA 3JVTB 1KWOB 1M63B 1WRKA 2KPHA 3AAJA 4C0JA 4L9MA 1JWDA 5CPVA 2JTTA 5I2OA 3PN7C 2M0RA 1SPYA 4FQTA 2ZRTA 3SS3A 4YI8A 4NDBA 1PSRA 1RWYA 1NYAA 2LVJA 2L2CA 1QASA 1GJYA 4PDZA 1PVAA 4DIRA 1QLSA 1QJTA 1BF5A 3L47A 3GK4X 2NCOA 1C3YA 3PJIA 2R2IA 1LVCD 3DF0B 2MA2A 3FE8A 1SL9A 3OB1B 1QX2A 1L2OC 1NUBA 3N7HA 2M3WA 4OR9B 1OOGA 2L4IA 5BPJA 1BMOA 1Z2CB 2QDIA 5AXIA 3KF9A 1OSAA 3S0AA 1DT7B 3PN7B 4XYNA 2CXJA 5F6TA 4FTGA 3VRRA 3CZTX 4CPVA 1ORGA 1NPQA 2JULA 1Y6WA 2G9BA 1XFWO 4PHNA 1D1OA 2P71A 2P6BB 4YGEB 5I8NA 1CMFA 1CNPA 4PALA 1J7PA 4I5NB 1QVIZ 3CWGA 1IQ5A 1CFDA 1EL4A 1NCYA 1DJIA 4MEWA 3O6BA 1XFUO 1ALVA 1JSAA 2I7AA 3KEVA 1L2OB 4C0LA 1S5GY 4JQ0D 1CDMA 1CB1A 1ZUZA 4NQGA 1QX5B 2PALA 3EK4A 1SYMA 2KI6C 3O2PA 1SR6C 1CDLA 1S3PA 2D8NA 3NXAA 2QEHA 3CGAA 1TNWA 3HCMA 4N1FA 5DKQA 4GGFC 4OKHA 2M1UA 1AUIB 4MRXA 1TCOB 3DXLA 1KFXS 1GQMA 1X02A 2KFHA 4MN0A 2CNPA 3BFBA 3PM8A 1PK0D 1GM0A 3IQQA 3CZ0A 1B7TY 1DJZA 4MZJA 1TOPA 1Y1UA 2MHHA 1JBAA 2AUCA 1J7RA 1F4OA 3GK2A 4INWA 3BUNB 5FI6A 3TDIA 1DJHA 1B4CA 3B88A 1OMDA 4WQ2A 4ETOA 1SR6B 1SY9A 2HPSA 3D0YB 3DVMA 4YGBB 1K8UA 4HREE 2WC8A 3EVUA 3ZWHA 3D77A 1XFZO 4ORCB 1DGVA 2Y4QA 4C0KA 3CLNA 1L7ZA 1SW8A 3R1OA 1IH0A 3VRQA 2LLSA 1K93D 2LC5A 5CSJA 1NCXA 1OOFA 1MUXA 2Y5IA 3IVTA 2KFFA 2LLUA 1C07A 1FPWA 1UHJA 2GV5A 1RECA 3V2LA 1AHRA 1NP8A 1BR4B 1UHKA 2KHNA 1U5IA 1YURA 3VRNA 1H8BA 3BXKA 2PRUA 2Y1NA 4N1GA 2LHLA 2KAXA 2PMYA 1A29A 3BQ3A 3I5GC 2LLTA 4OV2A 3EG5B 4BY4A 1G4YR 2CCMA 1SNLA 1HT9A 1AJ5A 1SL8A 1S6JA 2LCPA 4ORBB 3BUMB 1CM1A 4USLA 1F55A 3CR4X 1HQVA 2F2OA 1OOIX 1TUZA 2JOJA 4R1EA 5ER4X 4CLNA 1H4BA 1KCYA 2L5YA 1P28A 3K21A 3WXAA 1V1FA 1EJ3A 1MXEA 3KO0A 2EC6C 2M29A 2M7LA 1DJGA 1CKKA 1XFVO 2MLFC 4GPLB 4HRHA 2KLDA 2NZ0A 4GNKB 5B8IB 1F70A 5KSZA 4FQOA 2KNEA 2LAPA 2ZKMX 2LHIA 3EVVA 3LLEA 1EG4A 1OOHA 2H61A 2GGZA 1BU3A 3B6XA 1QX7A 3I5GB 5FI7A 4YGDB 3S0DA 2HQWA 1Y0VH 1YTZC
chains in the Genus database with same CATH topology
1UWOA 5HLOA 3KPXA 4M2OA 2I18A 4I5JA 2BECA 2M1KB 1MWNA 2LM5A 2M7NA 1PSBA 2AMIA 2NCPA 1DMOA 1GGZA 1K95A 3EK7A 1NIWA 1RJVA 3RM1A 1NX3A 2EC6B 4N5XA 2SCPA 2ZFDA 1IKUA 1B1GA 3DD4A 1LINA 1QIVA 1BR1B 1XA5A 1Y1XA 4PHMA 2NLNA 4DRWA 1A75A 2LE9B 2KBMA 1B47A 1FI5A 1J55A 2RGIA 3SG4A 3WHTB 1XFYO 2FCEA 2OTGC 2HETA 1LXFC 3NSIA 4ICBA 2KI4C 1S5GZ 5HKYA 2AAOA 2F33A 1EXRA 1YUUA 1QS7A 3BOWB 2FJUB 1KFUL 3FWCA 5TNCA 1GGWA 4D1EA 5JJGA 2K8MB 4QJ5B 1N2DA 3CTNA 1QV0A 1N65A 1YR5A 2KQYA 2O60A 3WHUB 1F4QA 1XK4A 1KK7Y 3BYAA 1YUSA 4XJKA 4DS7A 2LVKA 3O4YA 4AQJA 2F3YA 2KAVA 1EH2A 4U8DA 2MLEC 2HF5A 1OQPA 1OZSA 2K0JA 2K61A 2OTGB 2EHBA 1FW4A 1IGVA 1NCZA 1K9PA 1RROA 3NSLA 2LUXA 4YBHB 1MF8B 4GUKA 1CMGA 1R2UA 1UUSA 3TZ1A 1J7QA 2KYCA 2M8UA 4P2YB 2HQ8A 3DF0A 2K7BA 1BOCA 1FI6A 1MR8A 1QTXA 3GOFA 4MSPA 3FWBA 1RFJA 3DVEA 1NX2A 2BCXA 1YX8A 1S1EA 2L2EA 1A03A 4YGCB 2LNKA 1TCFA 5DKRA 4YGAA 3JTDC 1U5IB 2JT3A 2KOTA 2LMUA 1B9AA 2ZNDA 2E6WA 2K2FA 4PE1A 3TUYC 2MAZA 1QVIY 1ODBA 3LK0A 4P5OE 3TS5C 1TTXA 3C1VA 1WLMA 1A4PA 4MZKA 3RLZA 1S26D 1XFXO 1B8CA 5KU1A 1LA0A 1YRTB 5CSFA 2E30A 1G33A 1AVSA 1KQMC 2JTZA 2L5XB 2L98A 2BKIB 3LL8B 3OX6A 1SBJA 3IQOA 1K90D 3DVKA 1WDCC 2LP2A 3IF7A 5ER5A 2TN4A 1WLZA 1S6CA 1M39A 2GGMA 3JTDB 3BUXB 5HKZA 1C7WA 1B8RA 1NX1A 3FS7A 1YRUB 1OE9B 2WCEA 4A4BA 2PASA 2F3ZA 4A4CA 3AAKA 2OPOA 2L0PA 2KDHA 1DF0A 2BKHB 1XO5A 2I2RE 3SG2A 5PALA 1YVHA 2PSRA 1IJ6A 2K7OA 3E3RA 2B1UA 2JXCA 3SIAA 2A4JA 2Q91A 2PVBA 3H4SE 4M2QA 3TDUA 1KQMB 1M45A 3FIAA 1QIWA 2EGDA 4CIDA 2ISDA 4BY5A 3VGOA 4QJ4B 5HLVA 1DVIA 1TNXA 1JUOA 1WDCB 4PCWA 1XK4C 3SIBA 1RK9A 1M31A 1TRFA 2WCBA 2ZN8A 4NDDA 1JFKA 3D0YA 3I5HC 1NSHA 4HSZA 1W7IB 5KTYA 1SMGA 2VRGA 4QJ3B 2F8PA 1JF0A 3CS1A 4PE4A 1IQ3A 1EG3A 1TN4A 1IWQA 2WORA 5CSNA 1YX7A 2JWWA 4I5LB 2KGBC 1PALA 2BE4A 1Q80A 3BUOB 2JNXA 1OMRA 4AOMA 1KFUS 2F2PA 3OHMB 1QV1A 2KQ6A 1DTLA 1ZFSA 2L4HA 4PE0A 2JT0A 2SASA 1DJYA 1ALWA 4GAOA 5DKNA 1AP4A 4GBAA 1PULA 1AJ4A 2M49B 2CTNA 5K89A 4XJKB 1UURA 1CFCA 1CTRA 1OMVA 1CLBA 4OCIA 2H2KA 3LK1A 3I5HB 1K94A 5AANA 3EKHA 1G8IA 5AFPA 1LKJA 1IJ5A 1KK7Z 2IS9A 3O78A 3PFVA 3F45A 3SG7A 1PRWA 1BODA 5HYDA 1TNPA 4CFRA 1K96A 2QPTA 1KK8C 2OS8C 2JU0A 2ZRSA 5J3XA 1UHIA 1FF1A 3VRPA 1WRLA 5CSIA 3I5IC 2FCDA 1VRKA 1YUTA 1CLLA 5JOLA 2O5GA 3SG5A 1OZOA 1J1EA 3CR2A 1FBVA 2L50A 1TNQA 1J1DA 1CFFA 1B7TZ 3MSEB 3OP0A 4IL1A 4E68A 3SG6A 5HKWA 1F8HA 4MLWA 4F0ZB 5G08A 2FOTA 1S36A 1S6IA 2KI4B 1XVJA 1CDPA 1IG5A 3PALA 2LVVA 1W7JB 1JF2A 4PHJA 1KK8B 2KSPA 2BL0C 2KYFA 2OS8B 3PSRA 4WRIA 1JC2A 4PHKA 3SJSA 1SK6D 3PATA 3I5FC 3I5IB 5I2LA 1B8LA 2LP3A 1K9UA 3OB2B 2H61C 3HX4A 3A8RA 4M2PA 2JC2A 1WY9A 4YRUA 5GQQC 1MQ1A 1N0YA 1DF0B 5FYXA 3OX5A 2WOSA 2V53A 3SG3A 3AKBA 3BOWA 4DUQA 1SL7A 1RTP1 2KAYA 3ICBA 1KSMA 1SCMC 1J7OA 3QRXA 1F54A 4MRYA 2BBNA 1E8AA 2LANA 5AEQA 1UHNA 2BL0B 3PLFB 4MVFA 1NX0A 2JPTA 2BCAA 1JFJA 1CLMA 2JQ6A 1UP5A 3I5FB 1K9KA 2ZNEA 3EK8A 1PVBA 1C7VA 2Y1MA 1CNPA 1Y1AA 2BBMA 2L51A 3EVRA 5D69A 2MJWB 2KI6D 3GK1A 1K2HA 2KFGA 2KBIA 2JT8A 4HRGA 3TUYB 1CDNA 1KQVA 1SKTA 1BT6A 2CBLA 2BCBA 4DCKA 2BE6A 3TS5B 1DJXA 1CM4A 1XYDA 3A4UB 3AKAA 4JWQA 3NSOA 4ORAB 4AQIA 3CR5X 2JXLA 2Q4UA 1BLQA 2WNDA 5AERA 4GGNA 1A2XA 1SCMB 3D10A 1MHOA 3BUWB 2ZN9A 1BG1A 2JZIA 1KFXL 1TIZA 2DOQA 3LCPC 2K7CA 4JPZB 1MXLC 2QACA 2CT9A 2M97A 3NSKA 1ZOTB 2MBXA 1WRZA 3JVTC 1SRAA 1KSOA 2MRDA 2LUCA 4YI9A 4MBEA 1NWDA 1QATA 1UHHA 1KWOC 2I94A 4CFQA 2COLB 4PE7A 3VROA 3WNXB 4WQ3A 5I2QA 1YVLA 1DJWA 2LMVA 1A75B 3M0WA 1LA3A 1IRJA 5IBWA 4UPGA 2JNFA 2LMTA 2M9GA 2LV7A 3EKJA 4GFTA 3TDZA 1R6PA 2NXQA 3ZNIA 2KGRA 2LVIA 4GGFA 2K2AA 4NDCA 1CFPA 2JRFA 3DVJA 1M46A 1QXPA 1SCVA 5D7FA 2WCFA 1AK8A 1QLKA 4I5KA 4ZCVA 1V1GA 1BJFA 4Q04A 4OVNF 1ZMZA 1ZACA 4ZCUA 3KHEA 4TNCA 4MZLA 1OOJA 2G2BA 1DGUA 1F71A 2K7DA 3JVTB 1KWOB 1M63B 1WRKA 3AAJA 4C0JA 4L9MA 1JWDA 5CPVA 2JTTA 5I2OA 3PN7C 2M0RA 1SPYA 2ZRTA 4YI8A 4NDBA 1PSRA 1RWYA 1NYAA 2LVJA 1QASA 1GJYA 4PDZA 1PVAA 4DIRA 1QLSA 1QJTA 1BF5A 3GK4X 2NCOA 2R2IA 1LVCD 3DF0B 2MA2A 1SL9A 3OB1B 1QX2A 1L2OC 1NUBA 2M3WA 4OR9B 2L4IA 5BPJA 1BMOA 5AXIA 3KF9A 1OSAA 1DT7B 3PN7B 4XYNA 2CXJA 5F6TA 4FTGA 3VRRA 3CZTX 4CPVA 1NPQA 2JULA 1Y6WA 2G9BA 1XFWO 4PHNA 1D1OA 2P6BB 4YGEB 5I8NA 1CMFA 1J7PA 4PALA 4I5NB 1QVIZ 3CWGA 1IQ5A 1CFDA 1EL4A 1NCYA 1DJIA 4MEWA 3O6BA 1XFUO 1ALVA 1JSAA 2I7AA 3KEVA 1L2OB 4C0LA 1S5GY 4JQ0D 1CDMA 1CB1A 1ZUZA 4NQGA 1QX5B 2PALA 3EK4A 1SYMA 2KI6C 3O2PA 1SR6C 1CDLA 1S3PA 2D8NA 3NXAA 3CGAA 1TNWA 3HCMA 4N1FA 5DKQA 4GGFC 4OKHA 2M1UA 1AUIB 4MRXA 1TCOB 1KFXS 1GQMA 1X02A 2KFHA 4MN0A 2CNPA 3PM8A 1PK0D 3IQQA 4MZJA 1B7TY 1DJZA 1JBAA 1TOPA 1Y1UA 2MHHA 2AUCA 1J7RA 1F4OA 3GK2A 3BUNB 3TDIA 1DJHA 1B4CA 1OMDA 4WQ2A 4ETOA 1SR6B 1SY9A 2HPSA 3D0YB 3DVMA 4YGBB 1K8UA 4HREE 2WC8A 3EVUA 3ZWHA 1XFZO 4ORCB 1DGVA 2Y4QA 4C0KA 3CLNA 1L7ZA 1SW8A 1IH0A 3VRQA 2LLSA 1K93D 2LC5A 5CSJA 1NCXA 2Y5IA 1MUXA 2KFFA 2LLUA 1C07A 1FPWA 1UHJA 2GV5A 1RECA 1AHRA 1NP8A 1BR4B 1UHKA 2KHNA 1U5IA 1YURA 3VRNA 1H8BA 3BXKA 2PRUA 2Y1NA 4N1GA 2LHLA 2KAXA 2PMYA 1A29A 3BQ3A 3I5GC 2LLTA 4OV2A 4BY4A 1G4YR 2CCMA 1SNLA 1HT9A 1AJ5A 1SL8A 1S6JA 2LCPA 4ORBB 3BUMB 1CM1A 4USLA 1F55A 3CR4X 1HQVA 2F2OA 2JOJA 4R1EA 5ER4X 4CLNA 1H4BA 1KCYA 3K21A 3WXAA 1V1FA 1EJ3A 1MXEA 3KO0A 2EC6C 2M29A 2M7LA 1DJGA 1CKKA 1XFVO 2MLFC 4GPLB 4HRHA 2NZ0A 4GNKB 5B8IB 1F70A 5KSZA 4FQOA 2KNEA 2LAPA 2ZKMX 2LHIA 3EVVA 3LLEA 1EG4A 2H61A 2GGZA 1BU3A 1QX7A 3I5GB 4YGDB 2HQWA 1Y0VH 1YTZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UWO A;  5HLO A;  3KPX A;  4M2O A;  2I18 A;  4I5J A;  2BEC A;  2M1K B;  1MWN A;  2LM5 A;  2M7N A;  1PSB A;  2AMI A;  2NCP A;  1DMO A;  1GGZ A;  1K95 A;  3EK7 A;  1NIW A;  1RJV A;  3RM1 A;  1NX3 A;  2EC6 B;  4N5X A;  2SCP A;  2ZFD A;  1IKU A;  1B1G A;  3DD4 A;  1LIN A;  1QIV A;  1BR1 B;  1XA5 A;  1Y1X A;  4PHM A;  2NLN A;  4DRW A;  1A75 A;  2LE9 B;  2KBM A;  1B47 A;  1FI5 A;  1J55 A;  2RGI A;  3SG4 A;  3WHT B;  1XFY O;  2FCE A;  2OTG C;  2HET A;  1LXF C;  3NSI A;  4ICB A;  2KI4 C;  1S5G Z;  5HKY A;  2AAO A;  2F33 A;  1EXR A;  1YUU A;  1QS7 A;  3BOW B;  2FJU B;  1KFU L;  3FWC A;  5TNC A;  1GGW A;  4D1E A;  5JJG A;  2K8M B;  4QJ5 B;  1N2D A;  3CTN A;  1QV0 A;  1N65 A;  1YR5 A;  2KQY A;  2O60 A;  3WHU B;  1F4Q A;  1XK4 A;  1KK7 Y;  3BYA A;  1YUS A;  4XJK A;  4DS7 A;  2LVK A;  3O4Y A;  4AQJ A;  2F3Y A;  2KAV A;  1EH2 A;  4U8D A;  2MLE C;  2HF5 A;  1OQP A;  1OZS A;  2K0J A;  2K61 A;  2OTG B;  2EHB A;  1FW4 A;  1IGV A;  1NCZ A;  1K9P A;  1RRO A;  3NSL A;  2LUX A;  4YBH B;  1MF8 B;  4GUK A;  1CMG A;  1R2U A;  1UUS A;  3TZ1 A;  1J7Q A;  2KYC A;  2M8U A;  4P2Y B;  2HQ8 A;  3DF0 A;  2K7B A;  1BOC A;  1FI6 A;  1MR8 A;  1QTX A;  3GOF A;  4MSP A;  3FWB A;  1RFJ A;  3DVE A;  1NX2 A;  2BCX A;  1YX8 A;  1S1E A;  2L2E A;  1A03 A;  4YGC B;  2LNK A;  1TCF A;  5DKR A;  4YGA A;  3JTD C;  1U5I B;  2JT3 A;  2KOT A;  2LMU A;  1B9A A;  2ZND A;  2E6W A;  2K2F A;  4PE1 A;  3TUY C;  2MAZ A;  1QVI Y;  1ODB A;  3LK0 A;  4P5O E;  3TS5 C;  1TTX A;  3C1V A;  1WLM A;  1A4P A;  4MZK A;  3RLZ A;  1S26 D;  1XFX O;  1B8C A;  5KU1 A;  1LA0 A;  1YRT B;  5CSF A;  2E30 A;  1G33 A;  1AVS A;  1KQM C;  2JTZ A;  2L5X B;  2L98 A;  2BKI B;  3LL8 B;  3OX6 A;  1SBJ A;  3IQO A;  1K90 D;  3DVK A;  1WDC C;  2LP2 A;  3IF7 A;  5ER5 A;  2TN4 A;  1WLZ A;  1S6C A;  1M39 A;  2GGM A;  3JTD B;  3BUX B;  5HKZ A;  1C7W A;  1B8R A;  1NX1 A;  3FS7 A;  1YRU B;  1OE9 B;  2WCE A;  4A4B A;  2PAS A;  2F3Z A;  4A4C A;  3AAK A;  2OPO A;  2L0P A;  2KDH A;  1DF0 A;  2BKH B;  1XO5 A;  2I2R E;  3SG2 A;  5PAL A;  1YVH A;  2PSR A;  1IJ6 A;  2K7O A;  3E3R A;  2B1U A;  2JXC A;  3SIA A;  2A4J A;  2Q91 A;  2PVB A;  3H4S E;  4M2Q A;  3TDU A;  1KQM B;  1M45 A;  3FIA A;  1QIW A;  2EGD A;  4CID A;  2ISD A;  4BY5 A;  3VGO A;  4QJ4 B;  5HLV A;  1DVI A;  1TNX A;  1JUO A;  1WDC B;  4PCW A;  1XK4 C;  3SIB A;  1RK9 A;  1M31 A;  1TRF A;  2WCB A;  2ZN8 A;  4NDD A;  1JFK A;  3D0Y A;  3I5H C;  1NSH A;  4HSZ A;  1W7I B;  5KTY A;  1SMG A;  2VRG A;  4QJ3 B;  2F8P A;  1JF0 A;  3CS1 A;  4PE4 A;  1IQ3 A;  1EG3 A;  1TN4 A;  1IWQ A;  2WOR A;  5CSN A;  1YX7 A;  2JWW A;  4I5L B;  2KGB C;  1PAL A;  2BE4 A;  1Q80 A;  3BUO B;  2JNX A;  1OMR A;  4AOM A;  1KFU S;  2F2P A;  3OHM B;  1QV1 A;  2KQ6 A;  1DTL A;  1ZFS A;  2L4H A;  4PE0 A;  2JT0 A;  2SAS A;  1DJY A;  1ALW A;  4GAO A;  5DKN A;  1AP4 A;  4GBA A;  1PUL A;  1AJ4 A;  2M49 B;  2CTN A;  5K89 A;  4XJK B;  1UUR A;  1CFC A;  1CTR A;  1OMV A;  1CLB A;  4OCI A;  2H2K A;  3LK1 A;  3I5H B;  1K94 A;  5AAN A;  3EKH A;  1G8I A;  5AFP A;  1LKJ A;  1IJ5 A;  1KK7 Z;  2IS9 A;  3O78 A;  3PFV A;  3F45 A;  3SG7 A;  1PRW A;  1BOD A;  5HYD A;  1TNP A;  4CFR A;  1K96 A;  2QPT A;  1KK8 C;  2OS8 C;  2JU0 A;  2ZRS A;  5J3X A;  1UHI A;  1FF1 A;  3VRP A;  1WRL A;  5CSI A;  3I5I C;  2FCD A;  1VRK A;  1YUT A;  1CLL A;  5JOL A;  2O5G A;  3SG5 A;  1OZO A;  1J1E A;  3CR2 A;  1FBV A;  2L50 A;  1TNQ A;  1J1D A;  1CFF A;  1B7T Z;  3MSE B;  3OP0 A;  4IL1 A;  4E68 A;  3SG6 A;  5HKW A;  1F8H A;  4MLW A;  4F0Z B;  5G08 A;  2FOT A;  1S36 A;  1S6I A;  2KI4 B;  1XVJ A;  1CDP A;  1IG5 A;  3PAL A;  2LVV A;  1W7J B;  1JF2 A;  4PHJ A;  1KK8 B;  2KSP A;  2BL0 C;  2KYF A;  2OS8 B;  3PSR A;  4WRI A;  1JC2 A;  4PHK A;  3SJS A;  1SK6 D;  3PAT A;  3I5F C;  3I5I B;  5I2L A;  1B8L A;  2LP3 A;  1K9U A;  3OB2 B;  2H61 C;  3HX4 A;  3A8R A;  4M2P A;  2JC2 A;  1WY9 A;  4YRU A;  5GQQ C;  1MQ1 A;  1N0Y A;  1DF0 B;  5FYX A;  3OX5 A;  2WOS A;  2V53 A;  3SG3 A;  3AKB A;  3BOW A;  4DUQ A;  1SL7 A;  1RTP 1;  2KAY A;  3ICB A;  1KSM A;  1SCM C;  1J7O A;  3QRX A;  1F54 A;  4MRY A;  2BBN A;  1E8A A;  2LAN A;  5AEQ A;  1UHN A;  2BL0 B;  3PLF B;  4MVF A;  1NX0 A;  2JPT A;  2BCA A;  1JFJ A;  1CLM A;  2JQ6 A;  1UP5 A;  3I5F B;  1K9K A;  2ZNE A;  3EK8 A;  1PVB A;  1C7V A;  2Y1M A;  1CNP A;  1Y1A A;  2BBM A;  2L51 A;  3EVR A;  5D69 A;  2MJW B;  2KI6 D;  3GK1 A;  1K2H A;  2KFG A;  2KBI A;  2JT8 A;  4HRG A;  3TUY B;  1CDN A;  1KQV A;  1SKT A;  1BT6 A;  2CBL A;  2BCB A;  4DCK A;  2BE6 A;  3TS5 B;  1DJX A;  1CM4 A;  1XYD A;  3A4U B;  3AKA A;  4JWQ A;  3NSO A;  4ORA B;  4AQI A;  3CR5 X;  2JXL A;  2Q4U A;  1BLQ A;  2WND A;  5AER A;  4GGN A;  1A2X A;  1SCM B;  3D10 A;  1MHO A;  3BUW B;  2ZN9 A;  1BG1 A;  2JZI A;  1KFX L;  1TIZ A;  2DOQ A;  3LCP C;  2K7C A;  4JPZ B;  1MXL C;  2QAC A;  2CT9 A;  2M97 A;  3NSK A;  1ZOT B;  2MBX A;  1WRZ A;  3JVT C;  1SRA A;  1KSO A;  2MRD A;  2LUC A;  4YI9 A;  4MBE A;  1NWD A;  1QAT A;  1UHH A;  1KWO C;  2I94 A;  4CFQ A;  2COL B;  4PE7 A;  3VRO A;  3WNX B;  4WQ3 A;  5I2Q A;  1YVL A;  1DJW A;  2LMV A;  1A75 B;  3M0W A;  1LA3 A;  1IRJ A;  5IBW A;  4UPG A;  2JNF A;  2LMT A;  2M9G A;  2LV7 A;  3EKJ A;  4GFT A;  3TDZ A;  1R6P A;  2NXQ A;  3ZNI A;  2KGR A;  2LVI A;  4GGF A;  2K2A A;  4NDC A;  1CFP A;  2JRF A;  3DVJ A;  1M46 A;  1QXP A;  1SCV A;  5D7F A;  2WCF A;  1AK8 A;  1QLK A;  4I5K A;  4ZCV A;  1V1G A;  1BJF A;  4Q04 A;  4OVN F;  1ZMZ A;  1ZAC A;  4ZCU A;  3KHE A;  4TNC A;  4MZL A;  1OOJ A;  2G2B A;  1DGU A;  1F71 A;  2K7D A;  3JVT B;  1KWO B;  1M63 B;  1WRK A;  3AAJ A;  4C0J A;  4L9M A;  1JWD A;  5CPV A;  2JTT A;  5I2O A;  3PN7 C;  2M0R A;  1SPY A;  2ZRT A;  4YI8 A;  4NDB A;  1PSR A;  1RWY A;  1NYA A;  2LVJ A;  1QAS A;  1GJY A;  4PDZ A;  1PVA A;  4DIR A;  1QLS A;  1QJT A;  1BF5 A;  3GK4 X;  2NCO A;  2R2I A;  1LVC D;  3DF0 B;  2MA2 A;  1SL9 A;  3OB1 B;  1QX2 A;  1L2O C;  1NUB A;  2M3W A;  4OR9 B;  2L4I A;  5BPJ A;  1BMO A;  5AXI A;  3KF9 A;  1OSA A;  1DT7 B;  3PN7 B;  4XYN A;  2CXJ A;  5F6T A;  4FTG A;  3VRR A;  3CZT X;  4CPV A;  1NPQ A;  2JUL A;  1Y6W A;  2G9B A;  1XFW O;  4PHN A;  1D1O A;  2P6B B;  4YGE B;  5I8N A;  1CMF A;  1J7P A;  4PAL A;  4I5N B;  1QVI Z;  3CWG A;  1IQ5 A;  1CFD A;  1EL4 A;  1NCY A;  1DJI A;  4MEW A;  3O6B A;  1XFU O;  1ALV A;  1JSA A;  2I7A A;  3KEV A;  1L2O B;  4C0L A;  1S5G Y;  4JQ0 D;  1CDM A;  1CB1 A;  1ZUZ A;  4NQG A;  1QX5 B;  2PAL A;  3EK4 A;  1SYM A;  2KI6 C;  3O2P A;  1SR6 C;  1CDL A;  1S3P A;  2D8N A;  3NXA A;  3CGA A;  1TNW A;  3HCM A;  4N1F A;  5DKQ A;  4GGF C;  4OKH A;  2M1U A;  1AUI B;  4MRX A;  1TCO B;  1KFX S;  1GQM A;  1X02 A;  2KFH A;  4MN0 A;  2CNP A;  3PM8 A;  1PK0 D;  3IQQ A;  4MZJ A;  1B7T Y;  1DJZ A;  1JBA A;  1TOP A;  1Y1U A;  2MHH A;  2AUC A;  1J7R A;  1F4O A;  3GK2 A;  3BUN B;  3TDI A;  1DJH A;  1B4C A;  1OMD A;  4WQ2 A;  4ETO A;  1SR6 B;  1SY9 A;  2HPS A;  3D0Y B;  3DVM A;  4YGB B;  1K8U A;  4HRE E;  2WC8 A;  3EVU A;  3ZWH A;  1XFZ O;  4ORC B;  1DGV A;  2Y4Q A;  4C0K A;  3CLN A;  1L7Z A;  1SW8 A;  1IH0 A;  3VRQ A;  2LLS A;  1K93 D;  2LC5 A;  5CSJ A;  1NCX A;  2Y5I A;  1MUX A;  2KFF A;  2LLU A;  1C07 A;  1FPW A;  1UHJ A;  2GV5 A;  1REC A;  1AHR A;  1NP8 A;  1BR4 B;  1UHK A;  2KHN A;  1U5I A;  1YUR A;  3VRN A;  1H8B A;  3BXK A;  2PRU A;  2Y1N A;  4N1G A;  2LHL A;  2KAX A;  2PMY A;  1A29 A;  3BQ3 A;  3I5G C;  2LLT A;  4OV2 A;  4BY4 A;  1G4Y R;  2CCM A;  1SNL A;  1HT9 A;  1AJ5 A;  1SL8 A;  1S6J A;  2LCP A;  4ORB B;  3BUM B;  1CM1 A;  4USL A;  1F55 A;  3CR4 X;  1HQV A;  2F2O A;  2JOJ A;  4R1E A;  5ER4 X;  4CLN A;  1H4B A;  1KCY A;  3K21 A;  3WXA A;  1V1F A;  1EJ3 A;  1MXE A;  3KO0 A;  2EC6 C;  2M29 A;  2M7L A;  1DJG A;  1CKK A;  1XFV O;  2MLF C;  4GPL B;  4HRH A;  2NZ0 A;  4GNK B;  5B8I B;  1F70 A;  5KSZ A;  4FQO A;  2KNE A;  2LAP A;  2ZKM X;  2LHI A;  3EVV A;  3LLE A;  1EG4 A;  2H61 A;  2GGZ A;  1BU3 A;  1QX7 A;  3I5G B;  4YGD B;  2HQW A;  1Y0V H;  1YTZ C; 
#chains in the Genus database with same CATH topology
 1UWO A;  5HLO A;  3KPX A;  4M2O A;  2I18 A;  4I5J A;  2BEC A;  2M1K B;  1MWN A;  2LM5 A;  2M7N A;  1PSB A;  2AMI A;  2NCP A;  1DMO A;  1GGZ A;  3BJH A;  1K95 A;  3EK7 A;  1NIW A;  1RJV A;  3K1E A;  1NX3 A;  2EC6 B;  4N5X A;  2SCP A;  3RM1 A;  2ZFD A;  3D74 A;  1IKU A;  1B1G A;  3DD4 A;  1LIN A;  1QIV A;  1BR1 B;  2WCJ A;  1XA5 A;  1Y1X A;  4PHM A;  2NLN A;  4DRW A;  1A75 A;  2LE9 B;  2KBM A;  3R1P A;  1B47 A;  1FI5 A;  1J55 A;  2RGI A;  3SG4 A;  3WHT B;  1XFY O;  2FCE A;  5D3O A;  2OTG C;  2HET A;  1LXF C;  3NSI A;  4ICB A;  2KI4 C;  1S5G Z;  5HKY A;  2AAO A;  2F33 A;  1EXR A;  1YUU A;  3NHT A;  1QS7 A;  3BOW B;  2FJU B;  1KFU L;  3FWC A;  5TNC A;  1GGW A;  4D1E A;  5JJG A;  4PT1 A;  2K8M B;  4QJ5 B;  1N2D A;  3CTN A;  1QV0 A;  1N65 A;  1YR5 A;  3DYE A;  2KQY A;  2O60 A;  3WHU B;  1F4Q A;  1XK4 A;  1KK7 Y;  3OBV A;  3BYA A;  1YUS A;  4XJK A;  1C3Z A;  4DS7 A;  2LVK A;  3O4Y A;  4AQJ A;  2F3Y A;  3CDN A;  2KAV A;  3S0F A;  2FJY A;  4U8D A;  1EH2 A;  2MLE C;  2HF5 A;  1OQP A;  1OZS A;  2K0J A;  2K61 A;  2OTG B;  2EHB A;  3B7A A;  1FW4 A;  1IGV A;  1NCZ A;  1K9P A;  1RRO A;  3DY9 A;  2LUX A;  3NSL A;  1MF8 B;  4GUK A;  4YBH B;  1CMG A;  2BAP A;  1R2U A;  1UUS A;  3TZ1 A;  1J7Q A;  2KYC A;  2M8U A;  4P2Y B;  3VB1 A;  2HQ8 A;  3CZ2 A;  3DF0 A;  2K7B A;  1BOC A;  1FI6 A;  1MR8 A;  1QTX A;  3GOF A;  4MSP A;  3FWB A;  1RFJ A;  3DVE A;  1NX2 A;  1YX8 A;  2BCX A;  1S1E A;  2L2E A;  1A03 A;  4YGC B;  3B86 A;  2LNK A;  1TCF A;  5DKR A;  4YGA A;  1Z4H A;  3JTD C;  1U5I B;  2JT3 A;  2KOT A;  2LMU A;  3BFH A;  2JPO A;  1B9A A;  2ZND A;  2E6W A;  2K2F A;  4PE1 A;  3TUY C;  2MAZ A;  1QVI Y;  1ODB A;  1DQE A;  2WCH A;  3LK0 A;  4P5O E;  5DIC A;  3SS4 A;  3TS5 C;  1TTX A;  5HL1 A;  3C1V A;  1WLM A;  1A4P A;  4MZK A;  3RLZ A;  1S26 D;  1XFX O;  1B8C A;  5KU1 A;  1LA0 A;  1YRT B;  5CSF A;  2E30 A;  1G33 A;  1AVS A;  3PM2 A;  4JD9 A;  1KQM C;  2JTZ A;  2L5X B;  2L98 A;  2BKI B;  3LL8 B;  3OX6 A;  1SBJ A;  3IQO A;  1K90 D;  3DVK A;  1WDC C;  2LP2 A;  2WCK A;  3IF7 A;  5ER5 A;  2TN4 A;  1WLZ A;  1S6C A;  1M39 A;  2GGM A;  3D73 A;  3JTD B;  3BUX B;  5HKZ A;  1C7W A;  1B8R A;  1NX1 A;  3FS7 A;  1YRU B;  1OE9 B;  2WCE A;  4A4B A;  2PAS A;  2F3Z A;  4A4C A;  3AAK A;  1QWV A;  2OPO A;  2L0P A;  3B87 A;  2KDH A;  1DF0 A;  2BKH B;  1XO5 A;  2I2R E;  3SG2 A;  2WCM A;  1YVH A;  2PSR A;  1IJ6 A;  2K7O A;  1OW4 A;  3E3R A;  5PAL A;  2B1U A;  2JXC A;  3R72 A;  3SIA A;  2A4J A;  2K60 A;  2Q91 A;  2PVB A;  3H4S E;  4M2Q A;  3TDU A;  1KQM B;  1M45 A;  3FIA A;  1QIW A;  2EGD A;  4CID A;  2ISD A;  4BY5 A;  3S0G A;  3VGO A;  4QJ4 B;  5HLV A;  1DVI A;  1TNX A;  1JUO A;  1WDC B;  4PCW A;  1XK4 C;  3SIB A;  3D78 A;  1RK9 A;  3D75 A;  2ERB A;  1M31 A;  2QEV A;  1TRF A;  2WCB A;  2ZN8 A;  4NDD A;  1JFK A;  3D0Y A;  3I5H C;  1NSH A;  4HSZ A;  1W7I B;  4OZD A;  1SMG A;  2VRG A;  4QJ3 B;  3CAB A;  2F8P A;  1JF0 A;  3CS1 A;  4PE4 A;  1IQ3 A;  1EG3 A;  3Q8I A;  1TN4 A;  1IWQ A;  2WOR A;  5CSN A;  1YX7 A;  2JWW A;  4I5L B;  2KGB C;  1PAL A;  2BE4 A;  1Q80 A;  2WCL A;  3BUO B;  2JNX A;  3NHI A;  1DEL A;  1OMR A;  3R1V A;  4AOM A;  1KFU S;  3BFA A;  2F2P A;  3OHM B;  1QV1 A;  2KQ6 A;  1DTL A;  1ZFS A;  2L4H A;  4PE0 A;  2JT0 A;  2SAS A;  1DJY A;  1ALW A;  4GAO A;  5DKN A;  1AP4 A;  4GBA A;  1PUL A;  1AJ4 A;  2M49 B;  2CTN A;  5K89 A;  4XJK B;  1UUR A;  1XFR A;  1CTR A;  1OMV A;  1CFC A;  1CLB A;  4OCI A;  2H2K A;  3LK1 A;  3I5H B;  1K94 A;  5AAN A;  3QME A;  2P70 A;  3EKH A;  1G8I A;  5AFP A;  3CYZ A;  1LKJ A;  1IJ5 A;  1KK7 Z;  2IS9 A;  1TWO A;  3O78 A;  4KYN A;  3PFV A;  3F45 A;  3SG7 A;  5I94 A;  1PRW A;  1BOD A;  5HYD A;  1TNP A;  4CFR A;  1K96 A;  2QPT A;  1KK8 C;  2OS8 C;  3RZS A;  3S0E A;  2JU0 A;  2ZRS A;  5J3X A;  2QEO A;  1UHI A;  3FE6 A;  1FF1 A;  3VRP A;  1WRL A;  3L4L A;  5CSI A;  3I5I C;  2FCD A;  1VRK A;  1YUT A;  1CLL A;  2YGU A;  5JOL A;  2O5G A;  3SG5 A;  1OZO A;  1LS8 A;  1J1E A;  3CR2 A;  1FBV A;  2L50 A;  1TNQ A;  1J1D A;  1CFF A;  1B7T Z;  3MSE B;  3OP0 A;  4IL1 A;  4E68 A;  3SG6 A;  5HKW A;  1F8H A;  4MLW A;  4F0Z B;  1SSE B;  5G08 A;  2FOT A;  1S36 A;  1S6I A;  2KI4 B;  1XVJ A;  1CDP A;  1IG5 A;  3UNW A;  3PAL A;  2LVV A;  1IIO A;  1W7J B;  1JF2 A;  4PHJ A;  1KK8 B;  2KSP A;  2BL0 C;  2KYF A;  2OS8 B;  3PSR A;  4WRI A;  5KTY A;  2GTE A;  1JC2 A;  4PHK A;  3SJS A;  1SK6 D;  3PAT A;  3I5F C;  3I5I B;  4JKT A;  1B8L A;  5I2L A;  2LP3 A;  1K9U A;  1DC1 A;  3OB2 B;  2BNX A;  2H61 C;  3DZT A;  3A8R A;  3HX4 A;  4M2P A;  2JC2 A;  1WY9 A;  4YRU A;  5GQQ C;  1MQ1 A;  1N0Y A;  1DF0 B;  5FYX A;  3OX5 A;  2WOS A;  3D76 A;  2V53 A;  3SG3 A;  3O4X A;  3AKB A;  3BOW A;  4DUQ A;  1SL7 A;  1RTP 1;  2KAY A;  2WC5 A;  1KSM A;  1SCM C;  3ICB A;  1J7O A;  3QRX A;  1W9Z A;  1F54 A;  4MRY A;  2BBN A;  1E8A A;  2WC6 A;  2LAN A;  5AEQ A;  2H8V A;  1T14 A;  1UHN A;  2BL0 B;  3PLF B;  4MVF A;  1NX0 A;  3SS5 A;  2JPT A;  2BCA A;  1JFJ A;  1CLM A;  2JQ6 A;  5FI2 A;  1UP5 A;  4F7F A;  3I5F B;  1K9K A;  2PYQ A;  2ZNE A;  1PVB A;  3EK8 A;  2Y1M A;  1C7V A;  1Y1A A;  2BBM A;  2L51 A;  3EVR A;  5D69 A;  3FE9 A;  2MJW B;  2KI6 D;  3GK1 A;  1K2H A;  2KFG A;  2KBI A;  2JT8 A;  4HRG A;  3TUY B;  1CDN A;  1KQV A;  1SKT A;  1BT6 A;  2CBL A;  2BCB A;  4DCK A;  2BE6 A;  3TS5 B;  1DJX A;  1CM4 A;  1XYD A;  3A4U B;  3AKA A;  4JWQ A;  3NSO A;  4ORA B;  4AQI A;  3CR5 X;  2JXL A;  2Q4U A;  1BLQ A;  2WND A;  2QEB A;  4GGN A;  5AER A;  1A2X A;  1SCM B;  3D10 A;  1MHO A;  3BUW B;  2ZN9 A;  1BG1 A;  2JZI A;  1KFX L;  1TIZ A;  1TUJ A;  4IJ7 A;  2KLE A;  2DOQ A;  3LCP C;  3L4A A;  2K7C A;  4JPZ B;  1MXL C;  2QAC A;  2CT9 A;  2M97 A;  3NSK A;  1ZOT B;  2MBX A;  1WRZ A;  3JVT C;  1SRA A;  1KSO A;  2MRD A;  2LUC A;  4YI9 A;  4MBE A;  1NWD A;  1QAT A;  1UHH A;  1KWO C;  2I94 A;  4CFQ A;  2COL B;  4PE7 A;  3VRO A;  3WNX B;  4WQ3 A;  3S0B A;  1YVL A;  5I2Q A;  1DJW A;  2LMV A;  1A75 B;  3M0W A;  1LA3 A;  1IRJ A;  3OGN A;  4UPG A;  5IBW A;  2JNF A;  2LMT A;  2M9G A;  2LV7 A;  3EKJ A;  4GFT A;  3TDZ A;  1R6P A;  2NXQ A;  3ZNI A;  2KGR A;  2LVI A;  4GGF A;  2K2A A;  4NDC A;  1CFP A;  2JRF A;  3DVJ A;  1M46 A;  1QXP A;  1SCV A;  5D7F A;  2WCF A;  2PQL A;  1AK8 A;  1QLK A;  4I5K A;  1DEK A;  1V1G A;  4ZCV A;  1BJF A;  3NGV A;  5EL2 A;  4Q04 A;  4OVN F;  1ZMZ A;  1ZAC A;  3UO9 A;  4ZCU A;  3KHE A;  4TNC A;  4INX A;  4MZL A;  1OOJ A;  3CZ1 A;  2G2B A;  1DGU A;  1F71 A;  2K7D A;  3JVT B;  1KWO B;  1M63 B;  1WRK A;  2KPH A;  3AAJ A;  4C0J A;  4L9M A;  1JWD A;  5CPV A;  2JTT A;  5I2O A;  3PN7 C;  2M0R A;  1SPY A;  4FQT A;  2ZRT A;  3SS3 A;  4YI8 A;  4NDB A;  1PSR A;  1RWY A;  1NYA A;  2LVJ A;  2L2C A;  1QAS A;  1GJY A;  4PDZ A;  1PVA A;  4DIR A;  1QLS A;  1QJT A;  1BF5 A;  3L47 A;  3GK4 X;  2NCO A;  1C3Y A;  3PJI A;  2R2I A;  1LVC D;  3DF0 B;  2MA2 A;  3FE8 A;  1SL9 A;  3OB1 B;  1QX2 A;  1L2O C;  1NUB A;  3N7H A;  2M3W A;  4OR9 B;  1OOG A;  2L4I A;  5BPJ A;  1BMO A;  1Z2C B;  2QDI A;  5AXI A;  3KF9 A;  1OSA A;  3S0A A;  1DT7 B;  3PN7 B;  4XYN A;  2CXJ A;  5F6T A;  4FTG A;  3VRR A;  3CZT X;  4CPV A;  1ORG A;  1NPQ A;  2JUL A;  1Y6W A;  2G9B A;  1XFW O;  4PHN A;  1D1O A;  2P71 A;  2P6B B;  4YGE B;  5I8N A;  1CMF A;  1CNP A;  4PAL A;  1J7P A;  4I5N B;  1QVI Z;  3CWG A;  1IQ5 A;  1CFD A;  1EL4 A;  1NCY A;  1DJI A;  4MEW A;  3O6B A;  1XFU O;  1ALV A;  1JSA A;  2I7A A;  3KEV A;  1L2O B;  4C0L A;  1S5G Y;  4JQ0 D;  1CDM A;  1CB1 A;  1ZUZ A;  4NQG A;  1QX5 B;  2PAL A;  3EK4 A;  1SYM A;  2KI6 C;  3O2P A;  1SR6 C;  1CDL A;  1S3P A;  2D8N A;  3NXA A;  2QEH A;  3CGA A;  1TNW A;  3HCM A;  4N1F A;  5DKQ A;  4GGF C;  4OKH A;  2M1U A;  1AUI B;  4MRX A;  1TCO B;  3DXL A;  1KFX S;  1GQM A;  1X02 A;  2KFH A;  4MN0 A;  2CNP A;  3BFB A;  3PM8 A;  1PK0 D;  1GM0 A;  3IQQ A;  3CZ0 A;  1B7T Y;  1DJZ A;  4MZJ A;  1TOP A;  1Y1U A;  2MHH A;  1JBA A;  2AUC A;  1J7R A;  1F4O A;  3GK2 A;  4INW A;  3BUN B;  5FI6 A;  3TDI A;  1DJH A;  1B4C A;  3B88 A;  1OMD A;  4WQ2 A;  4ETO A;  1SR6 B;  1SY9 A;  2HPS A;  3D0Y B;  3DVM A;  4YGB B;  1K8U A;  4HRE E;  2WC8 A;  3EVU A;  3ZWH A;  3D77 A;  1XFZ O;  4ORC B;  1DGV A;  2Y4Q A;  4C0K A;  3CLN A;  1L7Z A;  1SW8 A;  3R1O A;  1IH0 A;  3VRQ A;  2LLS A;  1K93 D;  2LC5 A;  5CSJ A;  1NCX A;  1OOF A;  1MUX A;  2Y5I A;  3IVT A;  2KFF A;  2LLU A;  1C07 A;  1FPW A;  1UHJ A;  2GV5 A;  1REC A;  3V2L A;  1AHR A;  1NP8 A;  1BR4 B;  1UHK A;  2KHN A;  1U5I A;  1YUR A;  3VRN A;  1H8B A;  3BXK A;  2PRU A;  2Y1N A;  4N1G A;  2LHL A;  2KAX A;  2PMY A;  1A29 A;  3BQ3 A;  3I5G C;  2LLT A;  4OV2 A;  3EG5 B;  4BY4 A;  1G4Y R;  2CCM A;  1SNL A;  1HT9 A;  1AJ5 A;  1SL8 A;  1S6J A;  2LCP A;  4ORB B;  3BUM B;  1CM1 A;  4USL A;  1F55 A;  3CR4 X;  1HQV A;  2F2O A;  1OOI X;  1TUZ A;  2JOJ A;  4R1E A;  5ER4 X;  4CLN A;  1H4B A;  1KCY A;  2L5Y A;  1P28 A;  3K21 A;  3WXA A;  1V1F A;  1EJ3 A;  1MXE A;  3KO0 A;  2EC6 C;  2M29 A;  2M7L A;  1DJG A;  1CKK A;  1XFV O;  2MLF C;  4GPL B;  4HRH A;  2KLD A;  2NZ0 A;  4GNK B;  5B8I B;  1F70 A;  5KSZ A;  4FQO A;  2KNE A;  2LAP A;  2ZKM X;  2LHI A;  3EVV A;  3LLE A;  1EG4 A;  1OOH A;  2H61 A;  2GGZ A;  1BU3 A;  3B6X A;  1QX7 A;  3I5G B;  5FI7 A;  4YGD B;  3S0D A;  2HQW A;  1Y0V H;  1YTZ C; 
#chains in the Genus database with same CATH homology
 1UWO A;  5HLO A;  3KPX A;  4M2O A;  2I18 A;  4I5J A;  2BEC A;  2M1K B;  1MWN A;  2LM5 A;  2M7N A;  1PSB A;  2AMI A;  2NCP A;  1DMO A;  1GGZ A;  1K95 A;  3EK7 A;  1NIW A;  1RJV A;  3RM1 A;  1NX3 A;  2EC6 B;  4N5X A;  2SCP A;  2ZFD A;  1IKU A;  1B1G A;  3DD4 A;  1LIN A;  1QIV A;  1BR1 B;  1XA5 A;  1Y1X A;  4PHM A;  2NLN A;  4DRW A;  1A75 A;  2LE9 B;  2KBM A;  1B47 A;  1FI5 A;  1J55 A;  2RGI A;  3SG4 A;  3WHT B;  1XFY O;  2FCE A;  2OTG C;  2HET A;  1LXF C;  3NSI A;  4ICB A;  2KI4 C;  1S5G Z;  5HKY A;  2AAO A;  2F33 A;  1EXR A;  1YUU A;  1QS7 A;  3BOW B;  2FJU B;  1KFU L;  3FWC A;  5TNC A;  1GGW A;  4D1E A;  5JJG A;  2K8M B;  4QJ5 B;  1N2D A;  3CTN A;  1QV0 A;  1N65 A;  1YR5 A;  2KQY A;  2O60 A;  3WHU B;  1F4Q A;  1XK4 A;  1KK7 Y;  3BYA A;  1YUS A;  4XJK A;  4DS7 A;  2LVK A;  3O4Y A;  4AQJ A;  2F3Y A;  2KAV A;  1EH2 A;  4U8D A;  2MLE C;  2HF5 A;  1OQP A;  1OZS A;  2K0J A;  2K61 A;  2OTG B;  2EHB A;  1FW4 A;  1IGV A;  1NCZ A;  1K9P A;  1RRO A;  3NSL A;  2LUX A;  4YBH B;  1MF8 B;  4GUK A;  1CMG A;  1R2U A;  1UUS A;  3TZ1 A;  1J7Q A;  2KYC A;  2M8U A;  4P2Y B;  2HQ8 A;  3DF0 A;  2K7B A;  1BOC A;  1FI6 A;  1MR8 A;  1QTX A;  3GOF A;  4MSP A;  3FWB A;  1RFJ A;  3DVE A;  1NX2 A;  2BCX A;  1YX8 A;  1S1E A;  2L2E A;  1A03 A;  4YGC B;  2LNK A;  1TCF A;  5DKR A;  4YGA A;  3JTD C;  1U5I B;  2JT3 A;  2KOT A;  2LMU A;  1B9A A;  2ZND A;  2E6W A;  2K2F A;  4PE1 A;  3TUY C;  2MAZ A;  1QVI Y;  1ODB A;  3LK0 A;  4P5O E;  3TS5 C;  1TTX A;  3C1V A;  1WLM A;  1A4P A;  4MZK A;  3RLZ A;  1S26 D;  1XFX O;  1B8C A;  5KU1 A;  1LA0 A;  1YRT B;  5CSF A;  2E30 A;  1G33 A;  1AVS A;  1KQM C;  2JTZ A;  2L5X B;  2L98 A;  2BKI B;  3LL8 B;  3OX6 A;  1SBJ A;  3IQO A;  1K90 D;  3DVK A;  1WDC C;  2LP2 A;  3IF7 A;  5ER5 A;  2TN4 A;  1WLZ A;  1S6C A;  1M39 A;  2GGM A;  3JTD B;  3BUX B;  5HKZ A;  1C7W A;  1B8R A;  1NX1 A;  3FS7 A;  1YRU B;  1OE9 B;  2WCE A;  4A4B A;  2PAS A;  2F3Z A;  4A4C A;  3AAK A;  2OPO A;  2L0P A;  2KDH A;  1DF0 A;  2BKH B;  1XO5 A;  2I2R E;  3SG2 A;  5PAL A;  1YVH A;  2PSR A;  1IJ6 A;  2K7O A;  3E3R A;  2B1U A;  2JXC A;  3SIA A;  2A4J A;  2Q91 A;  2PVB A;  3H4S E;  4M2Q A;  3TDU A;  1KQM B;  1M45 A;  3FIA A;  1QIW A;  2EGD A;  4CID A;  2ISD A;  4BY5 A;  3VGO A;  4QJ4 B;  5HLV A;  1DVI A;  1TNX A;  1JUO A;  1WDC B;  4PCW A;  1XK4 C;  3SIB A;  1RK9 A;  1M31 A;  1TRF A;  2WCB A;  2ZN8 A;  4NDD A;  1JFK A;  3D0Y A;  3I5H C;  1NSH A;  4HSZ A;  1W7I B;  5KTY A;  1SMG A;  2VRG A;  4QJ3 B;  2F8P A;  1JF0 A;  3CS1 A;  4PE4 A;  1IQ3 A;  1EG3 A;  1TN4 A;  1IWQ A;  2WOR A;  5CSN A;  1YX7 A;  2JWW A;  4I5L B;  2KGB C;  1PAL A;  2BE4 A;  1Q80 A;  3BUO B;  2JNX A;  1OMR A;  4AOM A;  1KFU S;  2F2P A;  3OHM B;  1QV1 A;  2KQ6 A;  1DTL A;  1ZFS A;  2L4H A;  4PE0 A;  2JT0 A;  2SAS A;  1DJY A;  1ALW A;  4GAO A;  5DKN A;  1AP4 A;  4GBA A;  1PUL A;  1AJ4 A;  2M49 B;  2CTN A;  5K89 A;  4XJK B;  1UUR A;  1CFC A;  1CTR A;  1OMV A;  1CLB A;  4OCI A;  2H2K A;  3LK1 A;  3I5H B;  1K94 A;  5AAN A;  3EKH A;  1G8I A;  5AFP A;  1LKJ A;  1IJ5 A;  1KK7 Z;  2IS9 A;  3O78 A;  3PFV A;  3F45 A;  3SG7 A;  1PRW A;  1BOD A;  5HYD A;  1TNP A;  4CFR A;  1K96 A;  2QPT A;  1KK8 C;  2OS8 C;  2JU0 A;  2ZRS A;  5J3X A;  1UHI A;  1FF1 A;  3VRP A;  1WRL A;  5CSI A;  3I5I C;  2FCD A;  1VRK A;  1YUT A;  1CLL A;  5JOL A;  2O5G A;  3SG5 A;  1OZO A;  1J1E A;  3CR2 A;  1FBV A;  2L50 A;  1TNQ A;  1J1D A;  1CFF A;  1B7T Z;  3MSE B;  3OP0 A;  4IL1 A;  4E68 A;  3SG6 A;  5HKW A;  1F8H A;  4MLW A;  4F0Z B;  5G08 A;  2FOT A;  1S36 A;  1S6I A;  2KI4 B;  1XVJ A;  1CDP A;  1IG5 A;  3PAL A;  2LVV A;  1W7J B;  1JF2 A;  4PHJ A;  1KK8 B;  2KSP A;  2BL0 C;  2KYF A;  2OS8 B;  3PSR A;  4WRI A;  1JC2 A;  4PHK A;  3SJS A;  1SK6 D;  3PAT A;  3I5F C;  3I5I B;  5I2L A;  1B8L A;  2LP3 A;  1K9U A;  3OB2 B;  2H61 C;  3HX4 A;  3A8R A;  4M2P A;  2JC2 A;  1WY9 A;  4YRU A;  5GQQ C;  1MQ1 A;  1N0Y A;  1DF0 B;  5FYX A;  3OX5 A;  2WOS A;  2V53 A;  3SG3 A;  3AKB A;  3BOW A;  4DUQ A;  1SL7 A;  1RTP 1;  2KAY A;  3ICB A;  1KSM A;  1SCM C;  1J7O A;  3QRX A;  1F54 A;  4MRY A;  2BBN A;  1E8A A;  2LAN A;  5AEQ A;  1UHN A;  2BL0 B;  3PLF B;  4MVF A;  1NX0 A;  2JPT A;  2BCA A;  1JFJ A;  1CLM A;  2JQ6 A;  1UP5 A;  3I5F B;  1K9K A;  2ZNE A;  3EK8 A;  1PVB A;  1C7V A;  2Y1M A;  1CNP A;  1Y1A A;  2BBM A;  2L51 A;  3EVR A;  5D69 A;  2MJW B;  2KI6 D;  3GK1 A;  1K2H A;  2KFG A;  2KBI A;  2JT8 A;  4HRG A;  3TUY B;  1CDN A;  1KQV A;  1SKT A;  1BT6 A;  2CBL A;  2BCB A;  4DCK A;  2BE6 A;  3TS5 B;  1DJX A;  1CM4 A;  1XYD A;  3A4U B;  3AKA A;  4JWQ A;  3NSO A;  4ORA B;  4AQI A;  3CR5 X;  2JXL A;  2Q4U A;  1BLQ A;  2WND A;  5AER A;  4GGN A;  1A2X A;  1SCM B;  3D10 A;  1MHO A;  3BUW B;  2ZN9 A;  1BG1 A;  2JZI A;  1KFX L;  1TIZ A;  2DOQ A;  3LCP C;  2K7C A;  4JPZ B;  1MXL C;  2QAC A;  2CT9 A;  2M97 A;  3NSK A;  1ZOT B;  2MBX A;  1WRZ A;  3JVT C;  1SRA A;  1KSO A;  2MRD A;  2LUC A;  4YI9 A;  4MBE A;  1NWD A;  1QAT A;  1UHH A;  1KWO C;  2I94 A;  4CFQ A;  2COL B;  4PE7 A;  3VRO A;  3WNX B;  4WQ3 A;  5I2Q A;  1YVL A;  1DJW A;  2LMV A;  1A75 B;  3M0W A;  1LA3 A;  1IRJ A;  5IBW A;  4UPG A;  2JNF A;  2LMT A;  2M9G A;  2LV7 A;  3EKJ A;  4GFT A;  3TDZ A;  1R6P A;  2NXQ A;  3ZNI A;  2KGR A;  2LVI A;  4GGF A;  2K2A A;  4NDC A;  1CFP A;  2JRF A;  3DVJ A;  1M46 A;  1QXP A;  1SCV A;  5D7F A;  2WCF A;  1AK8 A;  1QLK A;  4I5K A;  4ZCV A;  1V1G A;  1BJF A;  4Q04 A;  4OVN F;  1ZMZ A;  1ZAC A;  4ZCU A;  3KHE A;  4TNC A;  4MZL A;  1OOJ A;  2G2B A;  1DGU A;  1F71 A;  2K7D A;  3JVT B;  1KWO B;  1M63 B;  1WRK A;  3AAJ A;  4C0J A;  4L9M A;  1JWD A;  5CPV A;  2JTT A;  5I2O A;  3PN7 C;  2M0R A;  1SPY A;  2ZRT A;  4YI8 A;  4NDB A;  1PSR A;  1RWY A;  1NYA A;  2LVJ A;  1QAS A;  1GJY A;  4PDZ A;  1PVA A;  4DIR A;  1QLS A;  1QJT A;  1BF5 A;  3GK4 X;  2NCO A;  2R2I A;  1LVC D;  3DF0 B;  2MA2 A;  1SL9 A;  3OB1 B;  1QX2 A;  1L2O C;  1NUB A;  2M3W A;  4OR9 B;  2L4I A;  5BPJ A;  1BMO A;  5AXI A;  3KF9 A;  1OSA A;  1DT7 B;  3PN7 B;  4XYN A;  2CXJ A;  5F6T A;  4FTG A;  3VRR A;  3CZT X;  4CPV A;  1NPQ A;  2JUL A;  1Y6W A;  2G9B A;  1XFW O;  4PHN A;  1D1O A;  2P6B B;  4YGE B;  5I8N A;  1CMF A;  1J7P A;  4PAL A;  4I5N B;  1QVI Z;  3CWG A;  1IQ5 A;  1CFD A;  1EL4 A;  1NCY A;  1DJI A;  4MEW A;  3O6B A;  1XFU O;  1ALV A;  1JSA A;  2I7A A;  3KEV A;  1L2O B;  4C0L A;  1S5G Y;  4JQ0 D;  1CDM A;  1CB1 A;  1ZUZ A;  4NQG A;  1QX5 B;  2PAL A;  3EK4 A;  1SYM A;  2KI6 C;  3O2P A;  1SR6 C;  1CDL A;  1S3P A;  2D8N A;  3NXA A;  3CGA A;  1TNW A;  3HCM A;  4N1F A;  5DKQ A;  4GGF C;  4OKH A;  2M1U A;  1AUI B;  4MRX A;  1TCO B;  1KFX S;  1GQM A;  1X02 A;  2KFH A;  4MN0 A;  2CNP A;  3PM8 A;  1PK0 D;  3IQQ A;  4MZJ A;  1B7T Y;  1DJZ A;  1JBA A;  1TOP A;  1Y1U A;  2MHH A;  2AUC A;  1J7R A;  1F4O A;  3GK2 A;  3BUN B;  3TDI A;  1DJH A;  1B4C A;  1OMD A;  4WQ2 A;  4ETO A;  1SR6 B;  1SY9 A;  2HPS A;  3D0Y B;  3DVM A;  4YGB B;  1K8U A;  4HRE E;  2WC8 A;  3EVU A;  3ZWH A;  1XFZ O;  4ORC B;  1DGV A;  2Y4Q A;  4C0K A;  3CLN A;  1L7Z A;  1SW8 A;  1IH0 A;  3VRQ A;  2LLS A;  1K93 D;  2LC5 A;  5CSJ A;  1NCX A;  2Y5I A;  1MUX A;  2KFF A;  2LLU A;  1C07 A;  1FPW A;  1UHJ A;  2GV5 A;  1REC A;  1AHR A;  1NP8 A;  1BR4 B;  1UHK A;  2KHN A;  1U5I A;  1YUR A;  3VRN A;  1H8B A;  3BXK A;  2PRU A;  2Y1N A;  4N1G A;  2LHL A;  2KAX A;  2PMY A;  1A29 A;  3BQ3 A;  3I5G C;  2LLT A;  4OV2 A;  4BY4 A;  1G4Y R;  2CCM A;  1SNL A;  1HT9 A;  1AJ5 A;  1SL8 A;  1S6J A;  2LCP A;  4ORB B;  3BUM B;  1CM1 A;  4USL A;  1F55 A;  3CR4 X;  1HQV A;  2F2O A;  2JOJ A;  4R1E A;  5ER4 X;  4CLN A;  1H4B A;  1KCY A;  3K21 A;  3WXA A;  1V1F A;  1EJ3 A;  1MXE A;  3KO0 A;  2EC6 C;  2M29 A;  2M7L A;  1DJG A;  1CKK A;  1XFV O;  2MLF C;  4GPL B;  4HRH A;  2NZ0 A;  4GNK B;  5B8I B;  1F70 A;  5KSZ A;  4FQO A;  2KNE A;  2LAP A;  2ZKM X;  2LHI A;  3EVV A;  3LLE A;  1EG4 A;  2H61 A;  2GGZ A;  1BU3 A;  1QX7 A;  3I5G B;  4YGD B;  2HQW A;  1Y0V H;  1YTZ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...