2JQ6A

Structure of eh-domain of ehd1
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
139
structure length
139
Chain Sequence
GPLGSESLMPSQVVKGGAFDGTMNGPFGHGYGEGAGEGIDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPSKRRHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EH domain-containing protein 1
publication title EH domain of EHD1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 28
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2007-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12763 EF-hand_4 Cytoskeletal-regulatory complex EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2jq6A01
5FYXA 1TOPA 2TN4A 2KAVA 1CFCA 3DD4A 1ZOTB 1LINA 4MEWA 1KK8B 1NX1A 3TZ1A 2ZRTA 2KBMA 3HCMA 1WY9A 3LK0A 2I18A 4N5XA 2EHBA 3GK4X 5HKYA 3SG5A 1OSAA 1XYDA 5ER4X 4ZCUA 1CFFA 3DF0B 2JU0A 3TS5B 1YVLA 3I5IC 3BUXB 4CPVA 2JNXA 1J7QA 2BCBA 2ZNDA 2FCDA 2PRUA 1XFWO 1J55A 3SG3A 2OTGB 2ZFDA 1DJIA 3OP0A 1JF2A 4I5JA 4TNCA 3WXAA 2SASA 3FS7A 5HKWA 1IGVA 2ZN8A 4ORCB 3CZTX 1R6PA 1JBAA 1JC2A 1XFZO 1RJVA 1CMGA 2GGMA 1R2UA 2L0PA 1BMOA 3JVTB 1CFDA 1NCXA 2CBLA 1IKUA 2ZRSA 1BF5A 3QRXA 1JFKA 2MRDA 2D8NA 1SCMB 4GAOA 4D1EA 4CLNA 3TDUA 1H8BA 2K7CA 1DVIA 1RECA 3I5GC 4IL1A 5JOLA 1KFXS 1WLMA 2JRFA 1OMVA 4CFRA 1FI5A 1YX7A 2Y1MA 2LV7A 1S36A 1HQVA 2KFGA 3EKHA 2JZIA 4PHMA 2LVJA 1JSAA 2WCEA 4GPLB 3VROA 1RWYA 4PE7A 2MLEC 4MN0A 3VRQA 5AANA 2L5XB 5AEQA 4MZJA 4GBAA 1NX3A 1QJTA 2HQ8A 3WHUB 1DJZA 1SNLA 2BL0C 2IS9A 2ZKMX 3TUYB 5KTYA 2KI6D 1YTZC 2JOJA 2KNEA 2KYCA 1JFJA 2JT0A 2AUCA 1KQMB 2CCMA 1QTXA 2L2EA 3F45A 1L7ZA 4PE1A 2BECA 2M3WA 2WC8A 3BXKA 1B8LA 2LMUA 4A4BA 1CM1A 1AJ5A 1MXLC 1TCFA 2LC5A 3KO0A 1FF1A 1CLLA 1PVBA 2K61A 1KWOB 1B8RA 4DRWA 3HX4A 1YRUB 1N0YA 3CR5X 4UPGA 1KFUL 3IF7A 1BODA 2JC2A 3MSEB 1ZFSA 3JTDC 2K7DA 1G33A 1VRKA 2LCPA 1QIVA 5HLVA 5AERA 2BE4A 2KSPA 1SR6C 4Q04A 1QATA 1IWQA 2GGZA 1ALVA 2L51A 1A29A 1CB1A 1QIWA 2NLNA 2LAPA 4YRUA 2OS8B 1DGVA 4QJ4B 3SIBA 1GGWA 4PHKA 1QX2A 1YX8A 1CFPA 4GGNA 1QLKA 4C0JA 2V53A 4CFQA 1K96A 3ZWHA 5I2LA 1J1DA 2MLFC 2M1UA 2JWWA 4ORBB 1LXFC 2KAXA 2FCEA 4DCKA 2I2RE 1WRKA 2BCAA 2JTTA 2M1KB 3DVMA 4MZKA 4OVNF 2KGRA 4PDZA 1JWDA 1CDNA 1XK4C 4JQ0D 2KQYA 1AP4A 2LNKA 1OMRA 2KI6C 3PSRA 1YUTA 4WQ2A 1BOCA 2MHHA 1CDMA 1CDLA 1DTLA 1KK8C 3CR4X 5F6TA 1U5IB 2JXCA 4AQIA 3OX5A 1OOJA 1M39A 4OCIA 4QJ3B 1SK6D 5D69A 3SIAA 3D0YB 3SG2A 3TS5C 4ICBA 1G8IA 1UHJA 3EVVA 1Y0VH 1B7TY 1MQ1A 1GJYA 3EK8A 4GGFA 1M31A 2KYFA 1QS7A 3ZNIA 3NSOA 3FWCA 1OE9B 1DF0A 2LLTA 1WLZA 4P5OE 1UHHA 2OTGC 1DJGA 4FTGA 2LUCA 2BE6A 1SMGA 4GFTA 2LUXA 1A75B 1UHIA 4U8DA 1YURA 2BKHB 1W7JB 1SL7A 1Y1XA 1D1OA 3BUWB 3WHTB 3PN7C 2NCPA 1GQMA 4WRIA 1YVHA 1S6JA 2CXJA 3TDIA 1S1EA 4XJKA 4C0LA 4QJ5B 3JVTC 1J7RA 1NP8A 1LVCD 2DOQA 3GOFA 1CM4A 1A2XA 1YUUA 2KQ6A 3KEVA 3LL8B 1FPWA 3PN7B 1F55A 4AQJA 1G4YR 1SCMC 1F71A 3EVUA 3A8RA 2F2PA 2F3YA 2LLSA 2KBIA 1UUSA 1ODBA 2LMVA 3VRPA 2M49B 5HKZA 1A03A 1BR4B 3OB2B 4YGDB 5I8NA 2L4IA 1MXEA 4HRGA 2LP2A 2BKIB 3E3RA 2KOTA 2LHIA 3VGOA 1BLQA 4PCWA 5PALA 1CKKA 5KSZA 2JT3A 1MR8A 1SPYA 4GUKA 1S5GZ 1MWNA 4JWQA 2LE9B 1TN4A 1N2DA 1JF0A 1DMOA 3TUYC 2LLUA 3NSKA 3BOWB 1FW4A 1M46A 1MUXA 2NCOA 1F8HA 4L9MA 2KGBC 2P6BB 2ZN9A 2M7NA 1KQMC 1ZUZA 1XFXO 2CT9A 4YGAA 1KSMA 1QV1A 1K9KA 2EC6C 3AKAA 2AAOA 5BPJA 5KU1A 4ORAB 5DKNA 3DVEA 1KWOC 4ETOA 4NDBA 1AHRA 2JT8A 2LMTA 4PHJA 1UWOA 4YGCB 2EC6B 1XK4A 2NXQA 4N1FA 1NX0A 4MZLA 2JTZA 4HREE 2BBNA 2I7AA 1V1FA 3EK4A 4BY5A 5DKQA 2AMIA 2MJWB 3BQ3A 2F33A 1B1GA 4DUQA 4MLWA 2Y4QA 1IQ3A 1KCYA 2H61C 2OS8C 3KHEA 4YGBB 1QASA 5J3XA 5AFPA 5K89A 1SCVA 3CR2A 2JQ6A 2K0JA 2WNDA 4C0KA 3O6BA 4I5NB 1A4PA 1SBJA 4NDDA 1K9PA 1S6CA 1DJXA 2KHNA 3LK1A 4N1GA 5CSNA 1QV0A 4OKHA 2F2OA 1M45A 4E68A 1DT7B 2KDHA 4M2OA 1B9AA 1IG5A 1UURA 2I94A 5CSIA 5HLOA 1PALA 1S5GY 4PALA 2HF5A 4ZCVA 1IJ6A 1X02A 3CGAA 2PVBA 1AVSA 1C07A 5IBWA 4P2YB 3PFVA 1JUOA 2BBMA 2O60A 1H4BA 1WDCB 1SY9A 5I2OA 2PASA 1Y1AA 3NSLA 3BUMB 1KFUS 2M8UA 1NPQA 2RGIA 4MRYA 1SL9A 3EKJA 3RM1A 1SKTA 3CLNA 4R1EA 2Q4UA 3GK1A 1CTRA 2F8PA 1XVJA 1S26D 3DVKA 3FWBA 2WORA 1AJ4A 3IQOA 1NYAA 1YUSA 3RLZA 2KFFA 2KI4B 3IQQA 1B47A 1RFJA 1TNQA 2MAZA 1Y6WA 1AK8A 1K8UA 4I5LB 3CS1A 4PE4A 3EK7A 5JJGA 1BR1B 1SRAA 2E6WA 2QPTA 4FQOA 4PE0A 2BCXA 3SJSA 1OQPA 4AOMA 3OHMB 1K95A 1Y1UA 1CMFA 1UHKA 1NX2A 2K7BA 2MBXA 2G2BA 2F3ZA 1NCYA 2H2KA 1LA3A 1OZOA 3NXAA 2HETA 3I5HB 3PLFB 1F4QA 1TCOB 1IRJA 1XFYO 1KFXL 5AXIA 4I5KA 2PMYA 1EL4A 3H4SE 3OX6A 5CSJA 5TNCA 4USLA 1K9UA 4JPZB 4M2PA 5GQQC 2OPOA 1K90D 1PSBA 3KPXA 2FJUB 2JNFA 1M63B 3CWGA 2K8MB 3D10A 2Y5IA 3VRRA 2JPTA 1LKJA 4HSZA 1K94A 4MRXA 5CPVA 4A4CA 1YR5A 2NZ0A 1V1GA 1EH2A 1GGZA 5CSFA 3BUOB 4MSPA 2LM5A 1CNPA 1TRFA 3I5IB 1BT6A 1ZACA 2H61A 1IJ5A 1TNPA 1NCZA 3M0WA 3K21A 3OB1B 3CTNA 1MHOA 3KF9A 4MBEA 1WRZA 1S3PA 1J7OA 4BY4A 2LANA 1FI6A 1BJFA 3A4UB 3BYAA 1QXPA 1PSRA 3FIAA 1CLMA 3DVJA 1C7VA 1F4OA 2LVKA 1LA0A 1Q80A 2SCPA 4YI8A 2K2AA 4GGFC 1KK7Z 2L4HA 1ALWA 1TNXA 2GV5A 1NSHA 1QVIZ 3I5GB 1U5IA 1IQ5A 5D7FA 1NWDA 3SG6A 2G9BA 1TNWA 1B8CA 1F54A 3O2PA 1NIWA 1DJYA 2LP3A 3D0YA 3GK2A 1RTP1 1DF0B 2WCFA 1FBVA 2LVVA 2L98A 3VRNA 1RK9A 2M29A 2ISDA 2CTNA 3NSIA 1S6IA 1XFUO 1F70A 1CLBA 1WRLA 1OMDA 1PVAA 1NUBA 1K93D 3DF0A 2FOTA 1ZMZA 2CNPA 4YGEB 2PSRA 2Q91A 1A75A 2K2FA 4YBHB 4XJKB 4OR9B 2BL0B 2HPSA 4F0ZB 1B7TZ 2JXLA 1TIZA 1QX5B 1XA5A 3I5FC 4XYNA 3O78A 1J1EA 1C7WA 1SL8A 1W7IB 5G08A 4MVFA 3AAKA 2R2IA 3AKBA 1WDCC 1DJWA 2M97A 2PALA 1XFVO 1BG1A 4NDCA 4OV2A 2VRGA 4GNKB 3I5FB 1KSOA 1HT9A 2COLB 1L2OC 1TTXA 2M9GA 1B4CA 4M2QA 2M0RA 4CIDA 2MA2A 3JTDB 3PM8A 2QACA 3LLEA 5I2QA 1DJHA 2WCBA 1J7PA 2KI4C 1SR6B 2K7OA 4YI9A 2JULA 4DIRA 1L2OB 1CDPA 1MF8B 1EXRA 1XO5A 1UHNA 4DS7A 3ICBA 1UP5A 1KK7Y 4PHNA 1IH0A 1QX7A 3BUNB 2L50A 3PALA 1KQVA 2LVIA 1QVIY 1EJ3A 1OZSA 1YRTB 5ER5A 3AAJA 1QLSA 2LHLA 5DKRA 3WNXB 1K2HA 1DGUA 1BU3A 2KAYA 3BOWA 3TDZA 1SYMA 3C1VA 2A4JA 2ZNEA 1RROA 1PK0D 2EGDA 3EVRA 3SG4A 2Y1NA 4WQ3A 2HQWA 3I5HC 1EG3A 2M7LA 5HYDA 1PULA 1E8AA 4HRHA 2B1UA 2E30A 2WOSA 1AUIB 1EG4A 1PRWA 2KFHA 3LCPC 4NQGA 3O4YA 1N65A 3SG7A 5B8IB 2O5GA 1SW8A 3PATA
chains in the Genus database with same CATH superfamily
5FYXA 3BFBA 1TOPA 2TN4A 2KAVA 1CFCA 3DD4A 1ZOTB 1LINA 4MEWA 1KK8B 1NX1A 3TZ1A 2ZRTA 2KBMA 3HCMA 1WY9A 3LK0A 2I18A 4N5XA 2EHBA 3GK4X 5HKYA 3SG5A 1OSAA 1XYDA 5ER4X 4ZCUA 1CFFA 3DF0B 2JU0A 3TS5B 1YVLA 3I5IC 3BUXB 4CPVA 2JNXA 1J7QA 2BCBA 2ZNDA 2FCDA 2PRUA 1XFWO 2P71A 1J55A 3SG3A 2OTGB 2ZFDA 1DJIA 3D76A 3OP0A 1JF2A 4I5JA 4TNCA 3WXAA 2SASA 3FS7A 5HKWA 1IGVA 2ZN8A 3D78A 3CZTX 4ORCB 1R6PA 1JBAA 1OW4A 1JC2A 1XFZO 1RJVA 2QEHA 1CMGA 2QEOA 2GGMA 1R2UA 2L0PA 4PT1A 1BMOA 3JVTB 1CFDA 1NCXA 2CBLA 3FE9A 3S0AA 2ZRSA 1IKUA 1BF5A 3QRXA 1JFKA 3BJHA 2MRDA 2D8NA 1SCMB 4GAOA 2PYQA 4CLNA 3TDUA 4D1EA 1TUZA 1H8BA 2K7CA 1DVIA 1RECA 3I5GC 4IL1A 5JOLA 1KFXS 1WLMA 2JRFA 1OMVA 4CFRA 1FI5A 1YX7A 2Y1MA 2LV7A 1S36A 1HQVA 2KFGA 3EKHA 2JZIA 3D77A 2LVJA 3CZ2A 2WCEA 4PHMA 4GPLB 1JSAA 3VROA 1RWYA 4PE7A 2MLEC 3BFHA 4MN0A 3FE6A 5FI2A 3VRQA 5AANA 2L5XB 5AEQA 3S0GA 1QWVA 4GBAA 4MZJA 1NX3A 1QJTA 2HQ8A 3WHUB 1DJZA 1SNLA 2BL0C 2IS9A 2ZKMX 3TUYB 5KTYA 2KI6D 3R1OA 1YTZC 2JOJA 2KNEA 2KYCA 1JFJA 2JT0A 2AUCA 1KQMB 2CCMA 1QTXA 2L2EA 3F45A 1L7ZA 4PE1A 2BECA 2M3WA 2WC8A 3BXKA 1B8LA 2LMUA 1ORGA 4A4BA 1C3YA 1CM1A 1AJ5A 1MXLC 1TCFA 2LC5A 2WC6A 3B88A 3CZ0A 3KO0A 1FF1A 1CLLA 1PVBA 3D74A 2K61A 1KWOB 3DY9A 1B8RA 4DRWA 3HX4A 1YRUB 1N0YA 3CR5X 4UPGA 1KFUL 3IF7A 1BODA 2JC2A 3MSEB 1ZFSA 3JTDC 2K7DA 1G33A 1VRKA 2LCPA 1QIVA 5HLVA 5AERA 2BE4A 2KSPA 1SR6C 4Q04A 1QATA 1IWQA 2GGZA 3D73A 1T14A 1ALVA 2L51A 1A29A 3N7HA 1CB1A 1DC1A 1QIWA 2NLNA 2LAPA 4YRUA 2OS8B 1DELA 1DGVA 4QJ4B 3SIBA 1GGWA 4PHKA 1QX2A 1YX8A 4FQTA 1CFPA 4GGNA 5EL2A 1QLKA 4C0JA 2V53A 4CFQA 1K96A 3ZWHA 5I2LA 1J1DA 2MLFC 2M1UA 2JWWA 4ORBB 1XFRA 1LXFC 3R1PA 4F7FA 2KAXA 2FCEA 4DCKA 2I2RE 1WRKA 2BCAA 2JTTA 2M1KB 3DVMA 3EG5B 4MZKA 4OVNF 2KGRA 4PDZA 3DXLA 3L4LA 1JWDA 1CDNA 1XK4C 4JQ0D 1W9ZA 2KQYA 3FE8A 1AP4A 2LNKA 1OMRA 2KI6C 3PSRA 1YUTA 4WQ2A 5D3OA 1BOCA 2MHHA 1CDMA 1CDLA 1DTLA 1KK8C 3CR4X 5F6TA 1U5IB 2JXCA 4AQIA 3OX5A 1OOJA 1M39A 4OCIA 4QJ3B 1SK6D 5D69A 3SIAA 3L47A 2QEVA 3D0YB 3SG2A 3TS5C 4ICBA 1G8IA 1UHJA 3EVVA 1Y0VH 1B7TY 1MQ1A 1GJYA 3EK8A 4GGFA 1M31A 2KYFA 1QS7A 3ZNIA 3NSOA 3FWCA 2QDIA 1OE9B 1DF0A 2LLTA 1WLZA 4P5OE 1UHHA 2OTGC 1DJGA 1OOIX 4FTGA 2LUCA 2BE6A 1SMGA 4GFTA 2LUXA 1A75B 1UHIA 4U8DA 1YURA 2BKHB 1W7JB 3CDNA 1SL7A 1Y1XA 3QMEA 3BUWB 1D1OA 3WHTB 3PN7C 2NCPA 1GQMA 4WRIA 1YVHA 1S6JA 2CXJA 3TDIA 3UO9A 1S1EA 4XJKA 4C0LA 4QJ5B 3JVTC 1J7RA 1NP8A 1LVCD 2DOQA 3GOFA 1CM4A 1A2XA 1YUUA 2KQ6A 3KEVA 3LL8B 1FPWA 3PN7B 1F55A 1OOHA 4AQJA 1G4YR 1SCMC 1F71A 3EVUA 3A8RA 1DQEA 2F2PA 2F3YA 2LLSA 2KBIA 1UUSA 1ODBA 2GTEA 2LMVA 3VRPA 1LS8A 2M49B 5HKZA 1A03A 1BR4B 3OB2B 4YGDB 5I8NA 2L4IA 1MXEA 4HRGA 2LP2A 2BKIB 3E3RA 2KOTA 2LHIA 3VGOA 1BLQA 4PCWA 5PALA 1CKKA 5KSZA 2JT3A 1MR8A 1SPYA 4GUKA 1S5GZ 1MWNA 4JWQA 2LE9B 1TN4A 1N2DA 1JF0A 2WCMA 2H8VA 3BFAA 1DMOA 3TUYC 2LLUA 3NSKA 3BOWB 1FW4A 1M46A 1MUXA 2NCOA 1F8HA 4L9MA 5DICA 3UNWA 2KGBC 2P6BB 2ZN9A 2M7NA 1KQMC 1ZUZA 1XFXO 2KLDA 2CT9A 1SSEB 4YGAA 1KSMA 1QV1A 3B87A 2WCKA 1K9KA 2EC6C 3AKAA 2AAOA 5BPJA 5KU1A 4ORAB 5DKNA 3DVEA 1KWOC 4ETOA 4NDBA 1AHRA 2JT8A 2LMTA 4PHJA 1UWOA 4YGCB 2EC6B 1XK4A 2KLEA 2NXQA 4KYNA 4N1FA 1NX0A 4MZLA 2JTZA 4HREE 5HL1A 2BBNA 2I7AA 1GM0A 1V1FA 3EK4A 4BY5A 5DKQA 2AMIA 2MJWB 1Z4HA 2WCHA 3BQ3A 2F33A 3CZ1A 1B1GA 4DUQA 4MLWA 2Y4QA 1IQ3A 1KCYA 2H61C 2OS8C 3KHEA 4YGBB 1QASA 5J3XA 3SS5A 5AFPA 5K89A 3OGNA 1SCVA 3CR2A 3K1EA 2JQ6A 2K0JA 2WNDA 4C0KA 3O6BA 4I5NB 1A4PA 1SBJA 4NDDA 1K9PA 1S6CA 1DJXA 2KHNA 3LK1A 4N1GA 5CSNA 1QV0A 4OKHA 5FI7A 2F2OA 1M45A 4E68A 1DT7B 3NHTA 2KDHA 4M2OA 1B9AA 1IG5A 1UURA 2I94A 3CABA 3DYEA 5CSIA 5HLOA 1PALA 1S5GY 4PALA 2HF5A 4ZCVA 1IJ6A 1X02A 3R1VA 3CGAA 2PVBA 2L2CA 1AVSA 2BAPA 3S0DA 5IBWA 1C07A 4P2YB 3B6XA 3PFVA 1JUOA 2BBMA 2O60A 1H4BA 1WDCB 1SY9A 4JKTA 5I2OA 2PASA 1Y1AA 3NSLA 2WC5A 3RZSA 3BUMB 1KFUS 2WCJA 2M8UA 1NPQA 2RGIA 4MRYA 1SL9A 3EKJA 3RM1A 1SKTA 3CLNA 4R1EA 2Q4UA 3GK1A 2ERBA 1CTRA 2F8PA 1XVJA 1S26D 3DVKA 3FWBA 2WORA 1AJ4A 3IQOA 1NYAA 1YUSA 3RLZA 2KFFA 2KI4B 3IQQA 1B47A 1RFJA 1TNQA 2MAZA 1Y6WA 1AK8A 1K8UA 4I5LB 2L5YA 3CS1A 4PE4A 3EK7A 5JJGA 1BR1B 1SRAA 2E6WA 2QPTA 4FQOA 4PE0A 2BCXA 3SJSA 1OQPA 4AOMA 3OHMB 1K95A 2QEBA 1Y1UA 1CMFA 1UHKA 1NX2A 2K7BA 2MBXA 2G2BA 3CYZA 2F3ZA 5I94A 1NCYA 2H2KA 1LA3A 1OZOA 3NXAA 3IVTA 3R72A 2HETA 3I5HB 3PLFB 2WCLA 1F4QA 1TCOB 1IRJA 1C3ZA 1XFYO 1KFXL 5AXIA 4I5KA 2PMYA 2YGUA 1EL4A 3H4SE 3OX6A 5CSJA 1OOFA 2K60A 5TNCA 4USLA 1K9UA 4JPZB 4M2PA 5GQQC 2OPOA 1K90D 1PSBA 3DZTA 3KPXA 2FJUB 2JNFA 1M63B 3CWGA 2K8MB 3D10A 2Y5IA 3VRRA 2JPTA 1LKJA 4HSZA 1K94A 4MRXA 2FJYA 3NHIA 5CPVA 1YR5A 4A4CA 2NZ0A 1V1GA 1EH2A 1GGZA 5CSFA 3BUOB 4MSPA 2LM5A 1CNPA 1TRFA 2BNXA 3I5IB 1BT6A 1ZACA 2H61A 1IJ5A 1TNPA 1NCZA 3M0WA 3K21A 3OB1B 3CTNA 1MHOA 3KF9A 4MBEA 1WRZA 1S3PA 1J7OA 1IIOA 4BY4A 2LANA 1FI6A 1BJFA 3A4UB 3BYAA 3OBVA 1QXPA 4IJ7A 1PSRA 3FIAA 1CLMA 3DVJA 1C7VA 1F4OA 2LVKA 1LA0A 1Q80A 4JD9A 2SCPA 4YI8A 2K2AA 4GGFC 1KK7Z 2L4HA 1ALWA 1TNXA 3PJIA 2KPHA 2GV5A 1NSHA 1QVIZ 2P70A 3I5GB 1U5IA 1IQ5A 5D7FA 1NWDA 3VB1A 3SG6A 2G9BA 1TNWA 1B8CA 2PQLA 1F54A 3O2PA 1NIWA 1DJYA 2LP3A 3D0YA 3GK2A 1RTP1 1DF0B 3S0FA 1Z2CB 2WCFA 1FBVA 2LVVA 2L98A 3VRNA 1RK9A 2M29A 2ISDA 2CTNA 3NSIA 1S6IA 1XFUO 1F70A 1CLBA 1WRLA 1OMDA 1PVAA 3O4XA 1NUBA 1K93D 3DF0A 2FOTA 3B86A 1ZMZA 2CNPA 4YGEB 2PSRA 2Q91A 3SS3A 1A75A 2K2FA 4YBHB 4XJKB 4OR9B 2BL0B 2HPSA 4F0ZB 1B7TZ 3Q8IA 2JXLA 1TIZA 1QX5B 1XA5A 3I5FC 4XYNA 3O78A 4OZDA 1J1EA 1C7WA 1SL8A 1W7IB 5G08A 4MVFA 3AAKA 2R2IA 3S0EA 3AKBA 1WDCC 1DJWA 1OOGA 2M97A 2PALA 1XFVO 3D75A 1BG1A 2JPOA 4NDCA 4OV2A 2VRGA 4GNKB 3I5FB 1KSOA 1HT9A 2COLB 1L2OC 1TTXA 2M9GA 1B4CA 4M2QA 2M0RA 1TWOA 2MA2A 4CIDA 3JTDB 3PM8A 2QACA 3LLEA 5I2QA 1DJHA 2WCBA 3B7AA 1J7PA 3L4AA 5FI6A 2KI4C 1SR6B 2K7OA 4YI9A 2JULA 4DIRA 1L2OB 1CDPA 1MF8B 1EXRA 1XO5A 1UHNA 4INWA 4DS7A 3ICBA 1UP5A 1KK7Y 4PHNA 1IH0A 1QX7A 3BUNB 2L50A 3PALA 1KQVA 2LVIA 1QVIY 1EJ3A 1OZSA 1YRTB 5ER5A 3AAJA 3NGVA 1QLSA 2LHLA 5DKRA 3WNXB 1K2HA 1DGUA 1BU3A 2KAYA 3BOWA 3PM2A 3TDZA 1SYMA 3C1VA 2A4JA 2ZNEA 1RROA 1PK0D 2EGDA 3EVRA 3SS4A 3SG4A 2Y1NA 4WQ3A 2HQWA 1DEKA 1EG3A 1P28A 1TUJA 3I5HC 4INXA 2M7LA 3S0BA 5HYDA 1PULA 1E8AA 4HRHA 2B1UA 2E30A 2WOSA 1AUIB 1EG4A 1PRWA 2KFHA 3LCPC 4NQGA 3O4YA 1N65A 3SG7A 5B8IB 2O5GA 3V2LA 1SW8A 3PATA
chains in the Genus database with same CATH topology
5FYXA 1TOPA 2TN4A 2KAVA 1CFCA 3DD4A 1ZOTB 1LINA 4MEWA 1KK8B 1NX1A 3TZ1A 2ZRTA 2KBMA 3HCMA 1WY9A 3LK0A 2I18A 4N5XA 2EHBA 3GK4X 5HKYA 3SG5A 1OSAA 1XYDA 5ER4X 4ZCUA 1CFFA 3DF0B 2JU0A 3TS5B 1YVLA 3I5IC 3BUXB 4CPVA 2JNXA 1J7QA 2BCBA 2ZNDA 2FCDA 2PRUA 1XFWO 1J55A 3SG3A 2OTGB 2ZFDA 1DJIA 3OP0A 1JF2A 4I5JA 4TNCA 3WXAA 2SASA 3FS7A 5HKWA 1IGVA 2ZN8A 4ORCB 3CZTX 1R6PA 1JBAA 1JC2A 1XFZO 1RJVA 1CMGA 2GGMA 1R2UA 2L0PA 1BMOA 3JVTB 1CFDA 1NCXA 2CBLA 1IKUA 2ZRSA 1BF5A 3QRXA 1JFKA 2MRDA 2D8NA 1SCMB 4GAOA 4D1EA 4CLNA 3TDUA 1H8BA 2K7CA 1DVIA 1RECA 3I5GC 4IL1A 5JOLA 1KFXS 1WLMA 2JRFA 1OMVA 4CFRA 1FI5A 1YX7A 2Y1MA 2LV7A 1S36A 1HQVA 2KFGA 3EKHA 2JZIA 4PHMA 2LVJA 1JSAA 2WCEA 4GPLB 3VROA 1RWYA 4PE7A 2MLEC 4MN0A 3VRQA 5AANA 2L5XB 5AEQA 4MZJA 4GBAA 1NX3A 1QJTA 2HQ8A 3WHUB 1DJZA 1SNLA 2BL0C 2IS9A 2ZKMX 3TUYB 5KTYA 2KI6D 1YTZC 2JOJA 2KNEA 2KYCA 1JFJA 2JT0A 2AUCA 1KQMB 2CCMA 1QTXA 2L2EA 3F45A 1L7ZA 4PE1A 2BECA 2M3WA 2WC8A 3BXKA 1B8LA 2LMUA 4A4BA 1CM1A 1AJ5A 1MXLC 1TCFA 2LC5A 3KO0A 1FF1A 1CLLA 1PVBA 2K61A 1KWOB 1B8RA 4DRWA 3HX4A 1YRUB 1N0YA 3CR5X 4UPGA 1KFUL 3IF7A 1BODA 2JC2A 3MSEB 1ZFSA 3JTDC 2K7DA 1G33A 1VRKA 2LCPA 1QIVA 5HLVA 5AERA 2BE4A 2KSPA 1SR6C 4Q04A 1QATA 1IWQA 2GGZA 1ALVA 2L51A 1A29A 1CB1A 1QIWA 2NLNA 2LAPA 4YRUA 2OS8B 1DGVA 4QJ4B 3SIBA 1GGWA 4PHKA 1QX2A 1YX8A 1CFPA 4GGNA 1QLKA 4C0JA 2V53A 4CFQA 1K96A 3ZWHA 5I2LA 1J1DA 2MLFC 2M1UA 2JWWA 4ORBB 1LXFC 2KAXA 2FCEA 4DCKA 2I2RE 1WRKA 2BCAA 2JTTA 2M1KB 3DVMA 4MZKA 4OVNF 2KGRA 4PDZA 1JWDA 1CDNA 1XK4C 4JQ0D 2KQYA 1AP4A 2LNKA 1OMRA 2KI6C 3PSRA 1YUTA 4WQ2A 1BOCA 2MHHA 1CDMA 1CDLA 1DTLA 1KK8C 3CR4X 5F6TA 1U5IB 2JXCA 4AQIA 3OX5A 1OOJA 1M39A 4OCIA 4QJ3B 1SK6D 5D69A 3SIAA 3D0YB 3SG2A 3TS5C 4ICBA 1G8IA 1UHJA 3EVVA 1Y0VH 1B7TY 1MQ1A 1GJYA 3EK8A 4GGFA 1M31A 2KYFA 1QS7A 3ZNIA 3NSOA 3FWCA 1OE9B 1DF0A 2LLTA 1WLZA 4P5OE 1UHHA 2OTGC 1DJGA 4FTGA 2LUCA 2BE6A 1SMGA 4GFTA 2LUXA 1A75B 1UHIA 4U8DA 1YURA 2BKHB 1W7JB 1SL7A 1Y1XA 1D1OA 3BUWB 3WHTB 3PN7C 2NCPA 1GQMA 4WRIA 1YVHA 1S6JA 2CXJA 3TDIA 1S1EA 4XJKA 4C0LA 4QJ5B 3JVTC 1J7RA 1NP8A 1LVCD 2DOQA 3GOFA 1CM4A 1A2XA 1YUUA 2KQ6A 3KEVA 3LL8B 1FPWA 3PN7B 1F55A 4AQJA 1G4YR 1SCMC 1F71A 3EVUA 3A8RA 2F2PA 2F3YA 2LLSA 2KBIA 1UUSA 1ODBA 2LMVA 3VRPA 2M49B 5HKZA 1A03A 1BR4B 3OB2B 4YGDB 5I8NA 2L4IA 1MXEA 4HRGA 2LP2A 2BKIB 3E3RA 2KOTA 2LHIA 3VGOA 1BLQA 4PCWA 5PALA 1CKKA 5KSZA 2JT3A 1MR8A 1SPYA 4GUKA 1S5GZ 1MWNA 4JWQA 2LE9B 1TN4A 1N2DA 1JF0A 1DMOA 3TUYC 2LLUA 3NSKA 3BOWB 1FW4A 1M46A 1MUXA 2NCOA 1F8HA 4L9MA 2KGBC 2P6BB 2ZN9A 2M7NA 1KQMC 1ZUZA 1XFXO 2CT9A 4YGAA 1KSMA 1QV1A 1K9KA 2EC6C 3AKAA 2AAOA 5BPJA 5KU1A 4ORAB 5DKNA 3DVEA 1KWOC 4ETOA 4NDBA 1AHRA 2JT8A 2LMTA 4PHJA 1UWOA 4YGCB 2EC6B 1XK4A 2NXQA 4N1FA 1NX0A 4MZLA 2JTZA 4HREE 2BBNA 2I7AA 1V1FA 3EK4A 4BY5A 5DKQA 2AMIA 2MJWB 3BQ3A 2F33A 1B1GA 4DUQA 4MLWA 2Y4QA 1IQ3A 1KCYA 2H61C 2OS8C 3KHEA 4YGBB 1QASA 5J3XA 5AFPA 5K89A 1SCVA 3CR2A 2JQ6A 2K0JA 2WNDA 4C0KA 3O6BA 4I5NB 1A4PA 1SBJA 4NDDA 1K9PA 1S6CA 1DJXA 2KHNA 3LK1A 4N1GA 5CSNA 1QV0A 4OKHA 2F2OA 1M45A 4E68A 1DT7B 2KDHA 4M2OA 1B9AA 1IG5A 1UURA 2I94A 5CSIA 5HLOA 1PALA 1S5GY 4PALA 2HF5A 4ZCVA 1IJ6A 1X02A 3CGAA 2PVBA 1AVSA 1C07A 5IBWA 4P2YB 3PFVA 1JUOA 2BBMA 2O60A 1H4BA 1WDCB 1SY9A 5I2OA 2PASA 1Y1AA 3NSLA 3BUMB 1KFUS 2M8UA 1NPQA 2RGIA 4MRYA 1SL9A 3EKJA 3RM1A 1SKTA 3CLNA 4R1EA 2Q4UA 3GK1A 1CTRA 2F8PA 1XVJA 1S26D 3DVKA 3FWBA 2WORA 1AJ4A 3IQOA 1NYAA 1YUSA 3RLZA 2KFFA 2KI4B 3IQQA 1B47A 1RFJA 1TNQA 2MAZA 1Y6WA 1AK8A 1K8UA 4I5LB 3CS1A 4PE4A 3EK7A 5JJGA 1BR1B 1SRAA 2E6WA 2QPTA 4FQOA 4PE0A 2BCXA 3SJSA 1OQPA 4AOMA 3OHMB 1K95A 1Y1UA 1CMFA 1UHKA 1NX2A 2K7BA 2MBXA 2G2BA 2F3ZA 1NCYA 2H2KA 1LA3A 1OZOA 3NXAA 2HETA 3I5HB 3PLFB 1F4QA 1TCOB 1IRJA 1XFYO 1KFXL 5AXIA 4I5KA 2PMYA 1EL4A 3H4SE 3OX6A 5CSJA 5TNCA 4USLA 1K9UA 4JPZB 4M2PA 5GQQC 2OPOA 1K90D 1PSBA 3KPXA 2FJUB 2JNFA 1M63B 3CWGA 2K8MB 3D10A 2Y5IA 3VRRA 2JPTA 1LKJA 4HSZA 1K94A 4MRXA 5CPVA 4A4CA 1YR5A 2NZ0A 1V1GA 1EH2A 1GGZA 5CSFA 3BUOB 4MSPA 2LM5A 1CNPA 1TRFA 3I5IB 1BT6A 1ZACA 2H61A 1IJ5A 1TNPA 1NCZA 3M0WA 3K21A 3OB1B 3CTNA 1MHOA 3KF9A 4MBEA 1WRZA 1S3PA 1J7OA 4BY4A 2LANA 1FI6A 1BJFA 3A4UB 3BYAA 1QXPA 1PSRA 3FIAA 1CLMA 3DVJA 1C7VA 1F4OA 2LVKA 1LA0A 1Q80A 2SCPA 4YI8A 2K2AA 4GGFC 1KK7Z 2L4HA 1ALWA 1TNXA 2GV5A 1NSHA 1QVIZ 3I5GB 1U5IA 1IQ5A 5D7FA 1NWDA 3SG6A 2G9BA 1TNWA 1B8CA 1F54A 3O2PA 1NIWA 1DJYA 2LP3A 3D0YA 3GK2A 1RTP1 1DF0B 2WCFA 1FBVA 2LVVA 2L98A 3VRNA 1RK9A 2M29A 2ISDA 2CTNA 3NSIA 1S6IA 1XFUO 1F70A 1CLBA 1WRLA 1OMDA 1PVAA 1NUBA 1K93D 3DF0A 2FOTA 1ZMZA 2CNPA 4YGEB 2PSRA 2Q91A 1A75A 2K2FA 4YBHB 4XJKB 4OR9B 2BL0B 2HPSA 4F0ZB 1B7TZ 2JXLA 1TIZA 1QX5B 1XA5A 3I5FC 4XYNA 3O78A 1J1EA 1C7WA 1SL8A 1W7IB 5G08A 4MVFA 3AAKA 2R2IA 3AKBA 1WDCC 1DJWA 2M97A 2PALA 1XFVO 1BG1A 4NDCA 4OV2A 2VRGA 4GNKB 3I5FB 1KSOA 1HT9A 2COLB 1L2OC 1TTXA 2M9GA 1B4CA 4M2QA 2M0RA 4CIDA 2MA2A 3JTDB 3PM8A 2QACA 3LLEA 5I2QA 1DJHA 2WCBA 1J7PA 2KI4C 1SR6B 2K7OA 4YI9A 2JULA 4DIRA 1L2OB 1CDPA 1MF8B 1EXRA 1XO5A 1UHNA 4DS7A 3ICBA 1UP5A 1KK7Y 4PHNA 1IH0A 1QX7A 3BUNB 2L50A 3PALA 1KQVA 2LVIA 1QVIY 1EJ3A 1OZSA 1YRTB 5ER5A 3AAJA 1QLSA 2LHLA 5DKRA 3WNXB 1K2HA 1DGUA 1BU3A 2KAYA 3BOWA 3TDZA 1SYMA 3C1VA 2A4JA 2ZNEA 1RROA 1PK0D 2EGDA 3EVRA 3SG4A 2Y1NA 4WQ3A 2HQWA 3I5HC 1EG3A 2M7LA 5HYDA 1PULA 1E8AA 4HRHA 2B1UA 2E30A 2WOSA 1AUIB 1EG4A 1PRWA 2KFHA 3LCPC 4NQGA 3O4YA 1N65A 3SG7A 5B8IB 2O5GA 1SW8A 3PATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FYX A;  1TOP A;  2TN4 A;  2KAV A;  1CFC A;  3DD4 A;  1ZOT B;  1LIN A;  4MEW A;  1KK8 B;  1NX1 A;  3TZ1 A;  2ZRT A;  2KBM A;  3HCM A;  1WY9 A;  3LK0 A;  2I18 A;  4N5X A;  2EHB A;  3GK4 X;  5HKY A;  3SG5 A;  1OSA A;  1XYD A;  5ER4 X;  4ZCU A;  1CFF A;  3DF0 B;  2JU0 A;  3TS5 B;  1YVL A;  3I5I C;  3BUX B;  4CPV A;  2JNX A;  1J7Q A;  2BCB A;  2ZND A;  2FCD A;  2PRU A;  1XFW O;  1J55 A;  3SG3 A;  2OTG B;  2ZFD A;  1DJI A;  3OP0 A;  1JF2 A;  4I5J A;  4TNC A;  3WXA A;  2SAS A;  3FS7 A;  5HKW A;  1IGV A;  2ZN8 A;  4ORC B;  3CZT X;  1R6P A;  1JBA A;  1JC2 A;  1XFZ O;  1RJV A;  1CMG A;  2GGM A;  1R2U A;  2L0P A;  1BMO A;  3JVT B;  1CFD A;  1NCX A;  2CBL A;  1IKU A;  2ZRS A;  1BF5 A;  3QRX A;  1JFK A;  2MRD A;  2D8N A;  1SCM B;  4GAO A;  4D1E A;  4CLN A;  3TDU A;  1H8B A;  2K7C A;  1DVI A;  1REC A;  3I5G C;  4IL1 A;  5JOL A;  1KFX S;  1WLM A;  2JRF A;  1OMV A;  4CFR A;  1FI5 A;  1YX7 A;  2Y1M A;  2LV7 A;  1S36 A;  1HQV A;  2KFG A;  3EKH A;  2JZI A;  4PHM A;  2LVJ A;  1JSA A;  2WCE A;  4GPL B;  3VRO A;  1RWY A;  4PE7 A;  2MLE C;  4MN0 A;  3VRQ A;  5AAN A;  2L5X B;  5AEQ A;  4MZJ A;  4GBA A;  1NX3 A;  1QJT A;  2HQ8 A;  3WHU B;  1DJZ A;  1SNL A;  2BL0 C;  2IS9 A;  2ZKM X;  3TUY B;  5KTY A;  2KI6 D;  1YTZ C;  2JOJ A;  2KNE A;  2KYC A;  1JFJ A;  2JT0 A;  2AUC A;  1KQM B;  2CCM A;  1QTX A;  2L2E A;  3F45 A;  1L7Z A;  4PE1 A;  2BEC A;  2M3W A;  2WC8 A;  3BXK A;  1B8L A;  2LMU A;  4A4B A;  1CM1 A;  1AJ5 A;  1MXL C;  1TCF A;  2LC5 A;  3KO0 A;  1FF1 A;  1CLL A;  1PVB A;  2K61 A;  1KWO B;  1B8R A;  4DRW A;  3HX4 A;  1YRU B;  1N0Y A;  3CR5 X;  4UPG A;  1KFU L;  3IF7 A;  1BOD A;  2JC2 A;  3MSE B;  1ZFS A;  3JTD C;  2K7D A;  1G33 A;  1VRK A;  2LCP A;  1QIV A;  5HLV A;  5AER A;  2BE4 A;  2KSP A;  1SR6 C;  4Q04 A;  1QAT A;  1IWQ A;  2GGZ A;  1ALV A;  2L51 A;  1A29 A;  1CB1 A;  1QIW A;  2NLN A;  2LAP A;  4YRU A;  2OS8 B;  1DGV A;  4QJ4 B;  3SIB A;  1GGW A;  4PHK A;  1QX2 A;  1YX8 A;  1CFP A;  4GGN A;  1QLK A;  4C0J A;  2V53 A;  4CFQ A;  1K96 A;  3ZWH A;  5I2L A;  1J1D A;  2MLF C;  2M1U A;  2JWW A;  4ORB B;  1LXF C;  2KAX A;  2FCE A;  4DCK A;  2I2R E;  1WRK A;  2BCA A;  2JTT A;  2M1K B;  3DVM A;  4MZK A;  4OVN F;  2KGR A;  4PDZ A;  1JWD A;  1CDN A;  1XK4 C;  4JQ0 D;  2KQY A;  1AP4 A;  2LNK A;  1OMR A;  2KI6 C;  3PSR A;  1YUT A;  4WQ2 A;  1BOC A;  2MHH A;  1CDM A;  1CDL A;  1DTL A;  1KK8 C;  3CR4 X;  5F6T A;  1U5I B;  2JXC A;  4AQI A;  3OX5 A;  1OOJ A;  1M39 A;  4OCI A;  4QJ3 B;  1SK6 D;  5D69 A;  3SIA A;  3D0Y B;  3SG2 A;  3TS5 C;  4ICB A;  1G8I A;  1UHJ A;  3EVV A;  1Y0V H;  1B7T Y;  1MQ1 A;  1GJY A;  3EK8 A;  4GGF A;  1M31 A;  2KYF A;  1QS7 A;  3ZNI A;  3NSO A;  3FWC A;  1OE9 B;  1DF0 A;  2LLT A;  1WLZ A;  4P5O E;  1UHH A;  2OTG C;  1DJG A;  4FTG A;  2LUC A;  2BE6 A;  1SMG A;  4GFT A;  2LUX A;  1A75 B;  1UHI A;  4U8D A;  1YUR A;  2BKH B;  1W7J B;  1SL7 A;  1Y1X A;  1D1O A;  3BUW B;  3WHT B;  3PN7 C;  2NCP A;  1GQM A;  4WRI A;  1YVH A;  1S6J A;  2CXJ A;  3TDI A;  1S1E A;  4XJK A;  4C0L A;  4QJ5 B;  3JVT C;  1J7R A;  1NP8 A;  1LVC D;  2DOQ A;  3GOF A;  1CM4 A;  1A2X A;  1YUU A;  2KQ6 A;  3KEV A;  3LL8 B;  1FPW A;  3PN7 B;  1F55 A;  4AQJ A;  1G4Y R;  1SCM C;  1F71 A;  3EVU A;  3A8R A;  2F2P A;  2F3Y A;  2LLS A;  2KBI A;  1UUS A;  1ODB A;  2LMV A;  3VRP A;  2M49 B;  5HKZ A;  1A03 A;  1BR4 B;  3OB2 B;  4YGD B;  5I8N A;  2L4I A;  1MXE A;  4HRG A;  2LP2 A;  2BKI B;  3E3R A;  2KOT A;  2LHI A;  3VGO A;  1BLQ A;  4PCW A;  5PAL A;  1CKK A;  5KSZ A;  2JT3 A;  1MR8 A;  1SPY A;  4GUK A;  1S5G Z;  1MWN A;  4JWQ A;  2LE9 B;  1TN4 A;  1N2D A;  1JF0 A;  1DMO A;  3TUY C;  2LLU A;  3NSK A;  3BOW B;  1FW4 A;  1M46 A;  1MUX A;  2NCO A;  1F8H A;  4L9M A;  2KGB C;  2P6B B;  2ZN9 A;  2M7N A;  1KQM C;  1ZUZ A;  1XFX O;  2CT9 A;  4YGA A;  1KSM A;  1QV1 A;  1K9K A;  2EC6 C;  3AKA A;  2AAO A;  5BPJ A;  5KU1 A;  4ORA B;  5DKN A;  3DVE A;  1KWO C;  4ETO A;  4NDB A;  1AHR A;  2JT8 A;  2LMT A;  4PHJ A;  1UWO A;  4YGC B;  2EC6 B;  1XK4 A;  2NXQ A;  4N1F A;  1NX0 A;  4MZL A;  2JTZ A;  4HRE E;  2BBN A;  2I7A A;  1V1F A;  3EK4 A;  4BY5 A;  5DKQ A;  2AMI A;  2MJW B;  3BQ3 A;  2F33 A;  1B1G A;  4DUQ A;  4MLW A;  2Y4Q A;  1IQ3 A;  1KCY A;  2H61 C;  2OS8 C;  3KHE A;  4YGB B;  1QAS A;  5J3X A;  5AFP A;  5K89 A;  1SCV A;  3CR2 A;  2JQ6 A;  2K0J A;  2WND A;  4C0K A;  3O6B A;  4I5N B;  1A4P A;  1SBJ A;  4NDD A;  1K9P A;  1S6C A;  1DJX A;  2KHN A;  3LK1 A;  4N1G A;  5CSN A;  1QV0 A;  4OKH A;  2F2O A;  1M45 A;  4E68 A;  1DT7 B;  2KDH A;  4M2O A;  1B9A A;  1IG5 A;  1UUR A;  2I94 A;  5CSI A;  5HLO A;  1PAL A;  1S5G Y;  4PAL A;  2HF5 A;  4ZCV A;  1IJ6 A;  1X02 A;  3CGA A;  2PVB A;  1AVS A;  1C07 A;  5IBW A;  4P2Y B;  3PFV A;  1JUO A;  2BBM A;  2O60 A;  1H4B A;  1WDC B;  1SY9 A;  5I2O A;  2PAS A;  1Y1A A;  3NSL A;  3BUM B;  1KFU S;  2M8U A;  1NPQ A;  2RGI A;  4MRY A;  1SL9 A;  3EKJ A;  3RM1 A;  1SKT A;  3CLN A;  4R1E A;  2Q4U A;  3GK1 A;  1CTR A;  2F8P A;  1XVJ A;  1S26 D;  3DVK A;  3FWB A;  2WOR A;  1AJ4 A;  3IQO A;  1NYA A;  1YUS A;  3RLZ A;  2KFF A;  2KI4 B;  3IQQ A;  1B47 A;  1RFJ A;  1TNQ A;  2MAZ A;  1Y6W A;  1AK8 A;  1K8U A;  4I5L B;  3CS1 A;  4PE4 A;  3EK7 A;  5JJG A;  1BR1 B;  1SRA A;  2E6W A;  2QPT A;  4FQO A;  4PE0 A;  2BCX A;  3SJS A;  1OQP A;  4AOM A;  3OHM B;  1K95 A;  1Y1U A;  1CMF A;  1UHK A;  1NX2 A;  2K7B A;  2MBX A;  2G2B A;  2F3Z A;  1NCY A;  2H2K A;  1LA3 A;  1OZO A;  3NXA A;  2HET A;  3I5H B;  3PLF B;  1F4Q A;  1TCO B;  1IRJ A;  1XFY O;  1KFX L;  5AXI A;  4I5K A;  2PMY A;  1EL4 A;  3H4S E;  3OX6 A;  5CSJ A;  5TNC A;  4USL A;  1K9U A;  4JPZ B;  4M2P A;  5GQQ C;  2OPO A;  1K90 D;  1PSB A;  3KPX A;  2FJU B;  2JNF A;  1M63 B;  3CWG A;  2K8M B;  3D10 A;  2Y5I A;  3VRR A;  2JPT A;  1LKJ A;  4HSZ A;  1K94 A;  4MRX A;  5CPV A;  4A4C A;  1YR5 A;  2NZ0 A;  1V1G A;  1EH2 A;  1GGZ A;  5CSF A;  3BUO B;  4MSP A;  2LM5 A;  1CNP A;  1TRF A;  3I5I B;  1BT6 A;  1ZAC A;  2H61 A;  1IJ5 A;  1TNP A;  1NCZ A;  3M0W A;  3K21 A;  3OB1 B;  3CTN A;  1MHO A;  3KF9 A;  4MBE A;  1WRZ A;  1S3P A;  1J7O A;  4BY4 A;  2LAN A;  1FI6 A;  1BJF A;  3A4U B;  3BYA A;  1QXP A;  1PSR A;  3FIA A;  1CLM A;  3DVJ A;  1C7V A;  1F4O A;  2LVK A;  1LA0 A;  1Q80 A;  2SCP A;  4YI8 A;  2K2A A;  4GGF C;  1KK7 Z;  2L4H A;  1ALW A;  1TNX A;  2GV5 A;  1NSH A;  1QVI Z;  3I5G B;  1U5I A;  1IQ5 A;  5D7F A;  1NWD A;  3SG6 A;  2G9B A;  1TNW A;  1B8C A;  1F54 A;  3O2P A;  1NIW A;  1DJY A;  2LP3 A;  3D0Y A;  3GK2 A;  1RTP 1;  1DF0 B;  2WCF A;  1FBV A;  2LVV A;  2L98 A;  3VRN A;  1RK9 A;  2M29 A;  2ISD A;  2CTN A;  3NSI A;  1S6I A;  1XFU O;  1F70 A;  1CLB A;  1WRL A;  1OMD A;  1PVA A;  1NUB A;  1K93 D;  3DF0 A;  2FOT A;  1ZMZ A;  2CNP A;  4YGE B;  2PSR A;  2Q91 A;  1A75 A;  2K2F A;  4YBH B;  4XJK B;  4OR9 B;  2BL0 B;  2HPS A;  4F0Z B;  1B7T Z;  2JXL A;  1TIZ A;  1QX5 B;  1XA5 A;  3I5F C;  4XYN A;  3O78 A;  1J1E A;  1C7W A;  1SL8 A;  1W7I B;  5G08 A;  4MVF A;  3AAK A;  2R2I A;  3AKB A;  1WDC C;  1DJW A;  2M97 A;  2PAL A;  1XFV O;  1BG1 A;  4NDC A;  4OV2 A;  2VRG A;  4GNK B;  3I5F B;  1KSO A;  1HT9 A;  2COL B;  1L2O C;  1TTX A;  2M9G A;  1B4C A;  4M2Q A;  2M0R A;  4CID A;  2MA2 A;  3JTD B;  3PM8 A;  2QAC A;  3LLE A;  5I2Q A;  1DJH A;  2WCB A;  1J7P A;  2KI4 C;  1SR6 B;  2K7O A;  4YI9 A;  2JUL A;  4DIR A;  1L2O B;  1CDP A;  1MF8 B;  1EXR A;  1XO5 A;  1UHN A;  4DS7 A;  3ICB A;  1UP5 A;  1KK7 Y;  4PHN A;  1IH0 A;  1QX7 A;  3BUN B;  2L50 A;  3PAL A;  1KQV A;  2LVI A;  1QVI Y;  1EJ3 A;  1OZS A;  1YRT B;  5ER5 A;  3AAJ A;  1QLS A;  2LHL A;  5DKR A;  3WNX B;  1K2H A;  1DGU A;  1BU3 A;  2KAY A;  3BOW A;  3TDZ A;  1SYM A;  3C1V A;  2A4J A;  2ZNE A;  1RRO A;  1PK0 D;  2EGD A;  3EVR A;  3SG4 A;  2Y1N A;  4WQ3 A;  2HQW A;  3I5H C;  1EG3 A;  2M7L A;  5HYD A;  1PUL A;  1E8A A;  4HRH A;  2B1U A;  2E30 A;  2WOS A;  1AUI B;  1EG4 A;  1PRW A;  2KFH A;  3LCP C;  4NQG A;  3O4Y A;  1N65 A;  3SG7 A;  5B8I B;  2O5G A;  1SW8 A;  3PAT A; 
#chains in the Genus database with same CATH topology
 5FYX A;  3BFB A;  1TOP A;  2TN4 A;  2KAV A;  1CFC A;  3DD4 A;  1ZOT B;  1LIN A;  4MEW A;  1KK8 B;  1NX1 A;  3TZ1 A;  2ZRT A;  2KBM A;  3HCM A;  1WY9 A;  3LK0 A;  2I18 A;  4N5X A;  2EHB A;  3GK4 X;  5HKY A;  3SG5 A;  1OSA A;  1XYD A;  5ER4 X;  4ZCU A;  1CFF A;  3DF0 B;  2JU0 A;  3TS5 B;  1YVL A;  3I5I C;  3BUX B;  4CPV A;  2JNX A;  1J7Q A;  2BCB A;  2ZND A;  2FCD A;  2PRU A;  1XFW O;  2P71 A;  1J55 A;  3SG3 A;  2OTG B;  2ZFD A;  1DJI A;  3D76 A;  3OP0 A;  1JF2 A;  4I5J A;  4TNC A;  3WXA A;  2SAS A;  3FS7 A;  5HKW A;  1IGV A;  2ZN8 A;  3D78 A;  3CZT X;  4ORC B;  1R6P A;  1JBA A;  1OW4 A;  1JC2 A;  1XFZ O;  1RJV A;  2QEH A;  1CMG A;  2QEO A;  2GGM A;  1R2U A;  2L0P A;  4PT1 A;  1BMO A;  3JVT B;  1CFD A;  1NCX A;  2CBL A;  3FE9 A;  3S0A A;  2ZRS A;  1IKU A;  1BF5 A;  3QRX A;  1JFK A;  3BJH A;  2MRD A;  2D8N A;  1SCM B;  4GAO A;  2PYQ A;  4CLN A;  3TDU A;  4D1E A;  1TUZ A;  1H8B A;  2K7C A;  1DVI A;  1REC A;  3I5G C;  4IL1 A;  5JOL A;  1KFX S;  1WLM A;  2JRF A;  1OMV A;  4CFR A;  1FI5 A;  1YX7 A;  2Y1M A;  2LV7 A;  1S36 A;  1HQV A;  2KFG A;  3EKH A;  2JZI A;  3D77 A;  2LVJ A;  3CZ2 A;  2WCE A;  4PHM A;  4GPL B;  1JSA A;  3VRO A;  1RWY A;  4PE7 A;  2MLE C;  3BFH A;  4MN0 A;  3FE6 A;  5FI2 A;  3VRQ A;  5AAN A;  2L5X B;  5AEQ A;  3S0G A;  1QWV A;  4GBA A;  4MZJ A;  1NX3 A;  1QJT A;  2HQ8 A;  3WHU B;  1DJZ A;  1SNL A;  2BL0 C;  2IS9 A;  2ZKM X;  3TUY B;  5KTY A;  2KI6 D;  3R1O A;  1YTZ C;  2JOJ A;  2KNE A;  2KYC A;  1JFJ A;  2JT0 A;  2AUC A;  1KQM B;  2CCM A;  1QTX A;  2L2E A;  3F45 A;  1L7Z A;  4PE1 A;  2BEC A;  2M3W A;  2WC8 A;  3BXK A;  1B8L A;  2LMU A;  1ORG A;  4A4B A;  1C3Y A;  1CM1 A;  1AJ5 A;  1MXL C;  1TCF A;  2LC5 A;  2WC6 A;  3B88 A;  3CZ0 A;  3KO0 A;  1FF1 A;  1CLL A;  1PVB A;  3D74 A;  2K61 A;  1KWO B;  3DY9 A;  1B8R A;  4DRW A;  3HX4 A;  1YRU B;  1N0Y A;  3CR5 X;  4UPG A;  1KFU L;  3IF7 A;  1BOD A;  2JC2 A;  3MSE B;  1ZFS A;  3JTD C;  2K7D A;  1G33 A;  1VRK A;  2LCP A;  1QIV A;  5HLV A;  5AER A;  2BE4 A;  2KSP A;  1SR6 C;  4Q04 A;  1QAT A;  1IWQ A;  2GGZ A;  3D73 A;  1T14 A;  1ALV A;  2L51 A;  1A29 A;  3N7H A;  1CB1 A;  1DC1 A;  1QIW A;  2NLN A;  2LAP A;  4YRU A;  2OS8 B;  1DEL A;  1DGV A;  4QJ4 B;  3SIB A;  1GGW A;  4PHK A;  1QX2 A;  1YX8 A;  4FQT A;  1CFP A;  4GGN A;  5EL2 A;  1QLK A;  4C0J A;  2V53 A;  4CFQ A;  1K96 A;  3ZWH A;  5I2L A;  1J1D A;  2MLF C;  2M1U A;  2JWW A;  4ORB B;  1XFR A;  1LXF C;  3R1P A;  4F7F A;  2KAX A;  2FCE A;  4DCK A;  2I2R E;  1WRK A;  2BCA A;  2JTT A;  2M1K B;  3DVM A;  3EG5 B;  4MZK A;  4OVN F;  2KGR A;  4PDZ A;  3DXL A;  3L4L A;  1JWD A;  1CDN A;  1XK4 C;  4JQ0 D;  1W9Z A;  2KQY A;  3FE8 A;  1AP4 A;  2LNK A;  1OMR A;  2KI6 C;  3PSR A;  1YUT A;  4WQ2 A;  5D3O A;  1BOC A;  2MHH A;  1CDM A;  1CDL A;  1DTL A;  1KK8 C;  3CR4 X;  5F6T A;  1U5I B;  2JXC A;  4AQI A;  3OX5 A;  1OOJ A;  1M39 A;  4OCI A;  4QJ3 B;  1SK6 D;  5D69 A;  3SIA A;  3L47 A;  2QEV A;  3D0Y B;  3SG2 A;  3TS5 C;  4ICB A;  1G8I A;  1UHJ A;  3EVV A;  1Y0V H;  1B7T Y;  1MQ1 A;  1GJY A;  3EK8 A;  4GGF A;  1M31 A;  2KYF A;  1QS7 A;  3ZNI A;  3NSO A;  3FWC A;  2QDI A;  1OE9 B;  1DF0 A;  2LLT A;  1WLZ A;  4P5O E;  1UHH A;  2OTG C;  1DJG A;  1OOI X;  4FTG A;  2LUC A;  2BE6 A;  1SMG A;  4GFT A;  2LUX A;  1A75 B;  1UHI A;  4U8D A;  1YUR A;  2BKH B;  1W7J B;  3CDN A;  1SL7 A;  1Y1X A;  3QME A;  3BUW B;  1D1O A;  3WHT B;  3PN7 C;  2NCP A;  1GQM A;  4WRI A;  1YVH A;  1S6J A;  2CXJ A;  3TDI A;  3UO9 A;  1S1E A;  4XJK A;  4C0L A;  4QJ5 B;  3JVT C;  1J7R A;  1NP8 A;  1LVC D;  2DOQ A;  3GOF A;  1CM4 A;  1A2X A;  1YUU A;  2KQ6 A;  3KEV A;  3LL8 B;  1FPW A;  3PN7 B;  1F55 A;  1OOH A;  4AQJ A;  1G4Y R;  1SCM C;  1F71 A;  3EVU A;  3A8R A;  1DQE A;  2F2P A;  2F3Y A;  2LLS A;  2KBI A;  1UUS A;  1ODB A;  2GTE A;  2LMV A;  3VRP A;  1LS8 A;  2M49 B;  5HKZ A;  1A03 A;  1BR4 B;  3OB2 B;  4YGD B;  5I8N A;  2L4I A;  1MXE A;  4HRG A;  2LP2 A;  2BKI B;  3E3R A;  2KOT A;  2LHI A;  3VGO A;  1BLQ A;  4PCW A;  5PAL A;  1CKK A;  5KSZ A;  2JT3 A;  1MR8 A;  1SPY A;  4GUK A;  1S5G Z;  1MWN A;  4JWQ A;  2LE9 B;  1TN4 A;  1N2D A;  1JF0 A;  2WCM A;  2H8V A;  3BFA A;  1DMO A;  3TUY C;  2LLU A;  3NSK A;  3BOW B;  1FW4 A;  1M46 A;  1MUX A;  2NCO A;  1F8H A;  4L9M A;  5DIC A;  3UNW A;  2KGB C;  2P6B B;  2ZN9 A;  2M7N A;  1KQM C;  1ZUZ A;  1XFX O;  2KLD A;  2CT9 A;  1SSE B;  4YGA A;  1KSM A;  1QV1 A;  3B87 A;  2WCK A;  1K9K A;  2EC6 C;  3AKA A;  2AAO A;  5BPJ A;  5KU1 A;  4ORA B;  5DKN A;  3DVE A;  1KWO C;  4ETO A;  4NDB A;  1AHR A;  2JT8 A;  2LMT A;  4PHJ A;  1UWO A;  4YGC B;  2EC6 B;  1XK4 A;  2KLE A;  2NXQ A;  4KYN A;  4N1F A;  1NX0 A;  4MZL A;  2JTZ A;  4HRE E;  5HL1 A;  2BBN A;  2I7A A;  1GM0 A;  1V1F A;  3EK4 A;  4BY5 A;  5DKQ A;  2AMI A;  2MJW B;  1Z4H A;  2WCH A;  3BQ3 A;  2F33 A;  3CZ1 A;  1B1G A;  4DUQ A;  4MLW A;  2Y4Q A;  1IQ3 A;  1KCY A;  2H61 C;  2OS8 C;  3KHE A;  4YGB B;  1QAS A;  5J3X A;  3SS5 A;  5AFP A;  5K89 A;  3OGN A;  1SCV A;  3CR2 A;  3K1E A;  2JQ6 A;  2K0J A;  2WND A;  4C0K A;  3O6B A;  4I5N B;  1A4P A;  1SBJ A;  4NDD A;  1K9P A;  1S6C A;  1DJX A;  2KHN A;  3LK1 A;  4N1G A;  5CSN A;  1QV0 A;  4OKH A;  5FI7 A;  2F2O A;  1M45 A;  4E68 A;  1DT7 B;  3NHT A;  2KDH A;  4M2O A;  1B9A A;  1IG5 A;  1UUR A;  2I94 A;  3CAB A;  3DYE A;  5CSI A;  5HLO A;  1PAL A;  1S5G Y;  4PAL A;  2HF5 A;  4ZCV A;  1IJ6 A;  1X02 A;  3R1V A;  3CGA A;  2PVB A;  2L2C A;  1AVS A;  2BAP A;  3S0D A;  5IBW A;  1C07 A;  4P2Y B;  3B6X A;  3PFV A;  1JUO A;  2BBM A;  2O60 A;  1H4B A;  1WDC B;  1SY9 A;  4JKT A;  5I2O A;  2PAS A;  1Y1A A;  3NSL A;  2WC5 A;  3RZS A;  3BUM B;  1KFU S;  2WCJ A;  2M8U A;  1NPQ A;  2RGI A;  4MRY A;  1SL9 A;  3EKJ A;  3RM1 A;  1SKT A;  3CLN A;  4R1E A;  2Q4U A;  3GK1 A;  2ERB A;  1CTR A;  2F8P A;  1XVJ A;  1S26 D;  3DVK A;  3FWB A;  2WOR A;  1AJ4 A;  3IQO A;  1NYA A;  1YUS A;  3RLZ A;  2KFF A;  2KI4 B;  3IQQ A;  1B47 A;  1RFJ A;  1TNQ A;  2MAZ A;  1Y6W A;  1AK8 A;  1K8U A;  4I5L B;  2L5Y A;  3CS1 A;  4PE4 A;  3EK7 A;  5JJG A;  1BR1 B;  1SRA A;  2E6W A;  2QPT A;  4FQO A;  4PE0 A;  2BCX A;  3SJS A;  1OQP A;  4AOM A;  3OHM B;  1K95 A;  2QEB A;  1Y1U A;  1CMF A;  1UHK A;  1NX2 A;  2K7B A;  2MBX A;  2G2B A;  3CYZ A;  2F3Z A;  5I94 A;  1NCY A;  2H2K A;  1LA3 A;  1OZO A;  3NXA A;  3IVT A;  3R72 A;  2HET A;  3I5H B;  3PLF B;  2WCL A;  1F4Q A;  1TCO B;  1IRJ A;  1C3Z A;  1XFY O;  1KFX L;  5AXI A;  4I5K A;  2PMY A;  2YGU A;  1EL4 A;  3H4S E;  3OX6 A;  5CSJ A;  1OOF A;  2K60 A;  5TNC A;  4USL A;  1K9U A;  4JPZ B;  4M2P A;  5GQQ C;  2OPO A;  1K90 D;  1PSB A;  3DZT A;  3KPX A;  2FJU B;  2JNF A;  1M63 B;  3CWG A;  2K8M B;  3D10 A;  2Y5I A;  3VRR A;  2JPT A;  1LKJ A;  4HSZ A;  1K94 A;  4MRX A;  2FJY A;  3NHI A;  5CPV A;  1YR5 A;  4A4C A;  2NZ0 A;  1V1G A;  1EH2 A;  1GGZ A;  5CSF A;  3BUO B;  4MSP A;  2LM5 A;  1CNP A;  1TRF A;  2BNX A;  3I5I B;  1BT6 A;  1ZAC A;  2H61 A;  1IJ5 A;  1TNP A;  1NCZ A;  3M0W A;  3K21 A;  3OB1 B;  3CTN A;  1MHO A;  3KF9 A;  4MBE A;  1WRZ A;  1S3P A;  1J7O A;  1IIO A;  4BY4 A;  2LAN A;  1FI6 A;  1BJF A;  3A4U B;  3BYA A;  3OBV A;  1QXP A;  4IJ7 A;  1PSR A;  3FIA A;  1CLM A;  3DVJ A;  1C7V A;  1F4O A;  2LVK A;  1LA0 A;  1Q80 A;  4JD9 A;  2SCP A;  4YI8 A;  2K2A A;  4GGF C;  1KK7 Z;  2L4H A;  1ALW A;  1TNX A;  3PJI A;  2KPH A;  2GV5 A;  1NSH A;  1QVI Z;  2P70 A;  3I5G B;  1U5I A;  1IQ5 A;  5D7F A;  1NWD A;  3VB1 A;  3SG6 A;  2G9B A;  1TNW A;  1B8C A;  2PQL A;  1F54 A;  3O2P A;  1NIW A;  1DJY A;  2LP3 A;  3D0Y A;  3GK2 A;  1RTP 1;  1DF0 B;  3S0F A;  1Z2C B;  2WCF A;  1FBV A;  2LVV A;  2L98 A;  3VRN A;  1RK9 A;  2M29 A;  2ISD A;  2CTN A;  3NSI A;  1S6I A;  1XFU O;  1F70 A;  1CLB A;  1WRL A;  1OMD A;  1PVA A;  3O4X A;  1NUB A;  1K93 D;  3DF0 A;  2FOT A;  3B86 A;  1ZMZ A;  2CNP A;  4YGE B;  2PSR A;  2Q91 A;  3SS3 A;  1A75 A;  2K2F A;  4YBH B;  4XJK B;  4OR9 B;  2BL0 B;  2HPS A;  4F0Z B;  1B7T Z;  3Q8I A;  2JXL A;  1TIZ A;  1QX5 B;  1XA5 A;  3I5F C;  4XYN A;  3O78 A;  4OZD A;  1J1E A;  1C7W A;  1SL8 A;  1W7I B;  5G08 A;  4MVF A;  3AAK A;  2R2I A;  3S0E A;  3AKB A;  1WDC C;  1DJW A;  1OOG A;  2M97 A;  2PAL A;  1XFV O;  3D75 A;  1BG1 A;  2JPO A;  4NDC A;  4OV2 A;  2VRG A;  4GNK B;  3I5F B;  1KSO A;  1HT9 A;  2COL B;  1L2O C;  1TTX A;  2M9G A;  1B4C A;  4M2Q A;  2M0R A;  1TWO A;  2MA2 A;  4CID A;  3JTD B;  3PM8 A;  2QAC A;  3LLE A;  5I2Q A;  1DJH A;  2WCB A;  3B7A A;  1J7P A;  3L4A A;  5FI6 A;  2KI4 C;  1SR6 B;  2K7O A;  4YI9 A;  2JUL A;  4DIR A;  1L2O B;  1CDP A;  1MF8 B;  1EXR A;  1XO5 A;  1UHN A;  4INW A;  4DS7 A;  3ICB A;  1UP5 A;  1KK7 Y;  4PHN A;  1IH0 A;  1QX7 A;  3BUN B;  2L50 A;  3PAL A;  1KQV A;  2LVI A;  1QVI Y;  1EJ3 A;  1OZS A;  1YRT B;  5ER5 A;  3AAJ A;  3NGV A;  1QLS A;  2LHL A;  5DKR A;  3WNX B;  1K2H A;  1DGU A;  1BU3 A;  2KAY A;  3BOW A;  3PM2 A;  3TDZ A;  1SYM A;  3C1V A;  2A4J A;  2ZNE A;  1RRO A;  1PK0 D;  2EGD A;  3EVR A;  3SS4 A;  3SG4 A;  2Y1N A;  4WQ3 A;  2HQW A;  1DEK A;  1EG3 A;  1P28 A;  1TUJ A;  3I5H C;  4INX A;  2M7L A;  3S0B A;  5HYD A;  1PUL A;  1E8A A;  4HRH A;  2B1U A;  2E30 A;  2WOS A;  1AUI B;  1EG4 A;  1PRW A;  2KFH A;  3LCP C;  4NQG A;  3O4Y A;  1N65 A;  3SG7 A;  5B8I B;  2O5G A;  3V2L A;  1SW8 A;  3PAT A; 
#chains in the Genus database with same CATH homology
 5FYX A;  1TOP A;  2TN4 A;  2KAV A;  1CFC A;  3DD4 A;  1ZOT B;  1LIN A;  4MEW A;  1KK8 B;  1NX1 A;  3TZ1 A;  2ZRT A;  2KBM A;  3HCM A;  1WY9 A;  3LK0 A;  2I18 A;  4N5X A;  2EHB A;  3GK4 X;  5HKY A;  3SG5 A;  1OSA A;  1XYD A;  5ER4 X;  4ZCU A;  1CFF A;  3DF0 B;  2JU0 A;  3TS5 B;  1YVL A;  3I5I C;  3BUX B;  4CPV A;  2JNX A;  1J7Q A;  2BCB A;  2ZND A;  2FCD A;  2PRU A;  1XFW O;  1J55 A;  3SG3 A;  2OTG B;  2ZFD A;  1DJI A;  3OP0 A;  1JF2 A;  4I5J A;  4TNC A;  3WXA A;  2SAS A;  3FS7 A;  5HKW A;  1IGV A;  2ZN8 A;  4ORC B;  3CZT X;  1R6P A;  1JBA A;  1JC2 A;  1XFZ O;  1RJV A;  1CMG A;  2GGM A;  1R2U A;  2L0P A;  1BMO A;  3JVT B;  1CFD A;  1NCX A;  2CBL A;  1IKU A;  2ZRS A;  1BF5 A;  3QRX A;  1JFK A;  2MRD A;  2D8N A;  1SCM B;  4GAO A;  4D1E A;  4CLN A;  3TDU A;  1H8B A;  2K7C A;  1DVI A;  1REC A;  3I5G C;  4IL1 A;  5JOL A;  1KFX S;  1WLM A;  2JRF A;  1OMV A;  4CFR A;  1FI5 A;  1YX7 A;  2Y1M A;  2LV7 A;  1S36 A;  1HQV A;  2KFG A;  3EKH A;  2JZI A;  4PHM A;  2LVJ A;  1JSA A;  2WCE A;  4GPL B;  3VRO A;  1RWY A;  4PE7 A;  2MLE C;  4MN0 A;  3VRQ A;  5AAN A;  2L5X B;  5AEQ A;  4MZJ A;  4GBA A;  1NX3 A;  1QJT A;  2HQ8 A;  3WHU B;  1DJZ A;  1SNL A;  2BL0 C;  2IS9 A;  2ZKM X;  3TUY B;  5KTY A;  2KI6 D;  1YTZ C;  2JOJ A;  2KNE A;  2KYC A;  1JFJ A;  2JT0 A;  2AUC A;  1KQM B;  2CCM A;  1QTX A;  2L2E A;  3F45 A;  1L7Z A;  4PE1 A;  2BEC A;  2M3W A;  2WC8 A;  3BXK A;  1B8L A;  2LMU A;  4A4B A;  1CM1 A;  1AJ5 A;  1MXL C;  1TCF A;  2LC5 A;  3KO0 A;  1FF1 A;  1CLL A;  1PVB A;  2K61 A;  1KWO B;  1B8R A;  4DRW A;  3HX4 A;  1YRU B;  1N0Y A;  3CR5 X;  4UPG A;  1KFU L;  3IF7 A;  1BOD A;  2JC2 A;  3MSE B;  1ZFS A;  3JTD C;  2K7D A;  1G33 A;  1VRK A;  2LCP A;  1QIV A;  5HLV A;  5AER A;  2BE4 A;  2KSP A;  1SR6 C;  4Q04 A;  1QAT A;  1IWQ A;  2GGZ A;  1ALV A;  2L51 A;  1A29 A;  1CB1 A;  1QIW A;  2NLN A;  2LAP A;  4YRU A;  2OS8 B;  1DGV A;  4QJ4 B;  3SIB A;  1GGW A;  4PHK A;  1QX2 A;  1YX8 A;  1CFP A;  4GGN A;  1QLK A;  4C0J A;  2V53 A;  4CFQ A;  1K96 A;  3ZWH A;  5I2L A;  1J1D A;  2MLF C;  2M1U A;  2JWW A;  4ORB B;  1LXF C;  2KAX A;  2FCE A;  4DCK A;  2I2R E;  1WRK A;  2BCA A;  2JTT A;  2M1K B;  3DVM A;  4MZK A;  4OVN F;  2KGR A;  4PDZ A;  1JWD A;  1CDN A;  1XK4 C;  4JQ0 D;  2KQY A;  1AP4 A;  2LNK A;  1OMR A;  2KI6 C;  3PSR A;  1YUT A;  4WQ2 A;  1BOC A;  2MHH A;  1CDM A;  1CDL A;  1DTL A;  1KK8 C;  3CR4 X;  5F6T A;  1U5I B;  2JXC A;  4AQI A;  3OX5 A;  1OOJ A;  1M39 A;  4OCI A;  4QJ3 B;  1SK6 D;  5D69 A;  3SIA A;  3D0Y B;  3SG2 A;  3TS5 C;  4ICB A;  1G8I A;  1UHJ A;  3EVV A;  1Y0V H;  1B7T Y;  1MQ1 A;  1GJY A;  3EK8 A;  4GGF A;  1M31 A;  2KYF A;  1QS7 A;  3ZNI A;  3NSO A;  3FWC A;  1OE9 B;  1DF0 A;  2LLT A;  1WLZ A;  4P5O E;  1UHH A;  2OTG C;  1DJG A;  4FTG A;  2LUC A;  2BE6 A;  1SMG A;  4GFT A;  2LUX A;  1A75 B;  1UHI A;  4U8D A;  1YUR A;  2BKH B;  1W7J B;  1SL7 A;  1Y1X A;  1D1O A;  3BUW B;  3WHT B;  3PN7 C;  2NCP A;  1GQM A;  4WRI A;  1YVH A;  1S6J A;  2CXJ A;  3TDI A;  1S1E A;  4XJK A;  4C0L A;  4QJ5 B;  3JVT C;  1J7R A;  1NP8 A;  1LVC D;  2DOQ A;  3GOF A;  1CM4 A;  1A2X A;  1YUU A;  2KQ6 A;  3KEV A;  3LL8 B;  1FPW A;  3PN7 B;  1F55 A;  4AQJ A;  1G4Y R;  1SCM C;  1F71 A;  3EVU A;  3A8R A;  2F2P A;  2F3Y A;  2LLS A;  2KBI A;  1UUS A;  1ODB A;  2LMV A;  3VRP A;  2M49 B;  5HKZ A;  1A03 A;  1BR4 B;  3OB2 B;  4YGD B;  5I8N A;  2L4I A;  1MXE A;  4HRG A;  2LP2 A;  2BKI B;  3E3R A;  2KOT A;  2LHI A;  3VGO A;  1BLQ A;  4PCW A;  5PAL A;  1CKK A;  5KSZ A;  2JT3 A;  1MR8 A;  1SPY A;  4GUK A;  1S5G Z;  1MWN A;  4JWQ A;  2LE9 B;  1TN4 A;  1N2D A;  1JF0 A;  1DMO A;  3TUY C;  2LLU A;  3NSK A;  3BOW B;  1FW4 A;  1M46 A;  1MUX A;  2NCO A;  1F8H A;  4L9M A;  2KGB C;  2P6B B;  2ZN9 A;  2M7N A;  1KQM C;  1ZUZ A;  1XFX O;  2CT9 A;  4YGA A;  1KSM A;  1QV1 A;  1K9K A;  2EC6 C;  3AKA A;  2AAO A;  5BPJ A;  5KU1 A;  4ORA B;  5DKN A;  3DVE A;  1KWO C;  4ETO A;  4NDB A;  1AHR A;  2JT8 A;  2LMT A;  4PHJ A;  1UWO A;  4YGC B;  2EC6 B;  1XK4 A;  2NXQ A;  4N1F A;  1NX0 A;  4MZL A;  2JTZ A;  4HRE E;  2BBN A;  2I7A A;  1V1F A;  3EK4 A;  4BY5 A;  5DKQ A;  2AMI A;  2MJW B;  3BQ3 A;  2F33 A;  1B1G A;  4DUQ A;  4MLW A;  2Y4Q A;  1IQ3 A;  1KCY A;  2H61 C;  2OS8 C;  3KHE A;  4YGB B;  1QAS A;  5J3X A;  5AFP A;  5K89 A;  1SCV A;  3CR2 A;  2JQ6 A;  2K0J A;  2WND A;  4C0K A;  3O6B A;  4I5N B;  1A4P A;  1SBJ A;  4NDD A;  1K9P A;  1S6C A;  1DJX A;  2KHN A;  3LK1 A;  4N1G A;  5CSN A;  1QV0 A;  4OKH A;  2F2O A;  1M45 A;  4E68 A;  1DT7 B;  2KDH A;  4M2O A;  1B9A A;  1IG5 A;  1UUR A;  2I94 A;  5CSI A;  5HLO A;  1PAL A;  1S5G Y;  4PAL A;  2HF5 A;  4ZCV A;  1IJ6 A;  1X02 A;  3CGA A;  2PVB A;  1AVS A;  1C07 A;  5IBW A;  4P2Y B;  3PFV A;  1JUO A;  2BBM A;  2O60 A;  1H4B A;  1WDC B;  1SY9 A;  5I2O A;  2PAS A;  1Y1A A;  3NSL A;  3BUM B;  1KFU S;  2M8U A;  1NPQ A;  2RGI A;  4MRY A;  1SL9 A;  3EKJ A;  3RM1 A;  1SKT A;  3CLN A;  4R1E A;  2Q4U A;  3GK1 A;  1CTR A;  2F8P A;  1XVJ A;  1S26 D;  3DVK A;  3FWB A;  2WOR A;  1AJ4 A;  3IQO A;  1NYA A;  1YUS A;  3RLZ A;  2KFF A;  2KI4 B;  3IQQ A;  1B47 A;  1RFJ A;  1TNQ A;  2MAZ A;  1Y6W A;  1AK8 A;  1K8U A;  4I5L B;  3CS1 A;  4PE4 A;  3EK7 A;  5JJG A;  1BR1 B;  1SRA A;  2E6W A;  2QPT A;  4FQO A;  4PE0 A;  2BCX A;  3SJS A;  1OQP A;  4AOM A;  3OHM B;  1K95 A;  1Y1U A;  1CMF A;  1UHK A;  1NX2 A;  2K7B A;  2MBX A;  2G2B A;  2F3Z A;  1NCY A;  2H2K A;  1LA3 A;  1OZO A;  3NXA A;  2HET A;  3I5H B;  3PLF B;  1F4Q A;  1TCO B;  1IRJ A;  1XFY O;  1KFX L;  5AXI A;  4I5K A;  2PMY A;  1EL4 A;  3H4S E;  3OX6 A;  5CSJ A;  5TNC A;  4USL A;  1K9U A;  4JPZ B;  4M2P A;  5GQQ C;  2OPO A;  1K90 D;  1PSB A;  3KPX A;  2FJU B;  2JNF A;  1M63 B;  3CWG A;  2K8M B;  3D10 A;  2Y5I A;  3VRR A;  2JPT A;  1LKJ A;  4HSZ A;  1K94 A;  4MRX A;  5CPV A;  4A4C A;  1YR5 A;  2NZ0 A;  1V1G A;  1EH2 A;  1GGZ A;  5CSF A;  3BUO B;  4MSP A;  2LM5 A;  1CNP A;  1TRF A;  3I5I B;  1BT6 A;  1ZAC A;  2H61 A;  1IJ5 A;  1TNP A;  1NCZ A;  3M0W A;  3K21 A;  3OB1 B;  3CTN A;  1MHO A;  3KF9 A;  4MBE A;  1WRZ A;  1S3P A;  1J7O A;  4BY4 A;  2LAN A;  1FI6 A;  1BJF A;  3A4U B;  3BYA A;  1QXP A;  1PSR A;  3FIA A;  1CLM A;  3DVJ A;  1C7V A;  1F4O A;  2LVK A;  1LA0 A;  1Q80 A;  2SCP A;  4YI8 A;  2K2A A;  4GGF C;  1KK7 Z;  2L4H A;  1ALW A;  1TNX A;  2GV5 A;  1NSH A;  1QVI Z;  3I5G B;  1U5I A;  1IQ5 A;  5D7F A;  1NWD A;  3SG6 A;  2G9B A;  1TNW A;  1B8C A;  1F54 A;  3O2P A;  1NIW A;  1DJY A;  2LP3 A;  3D0Y A;  3GK2 A;  1RTP 1;  1DF0 B;  2WCF A;  1FBV A;  2LVV A;  2L98 A;  3VRN A;  1RK9 A;  2M29 A;  2ISD A;  2CTN A;  3NSI A;  1S6I A;  1XFU O;  1F70 A;  1CLB A;  1WRL A;  1OMD A;  1PVA A;  1NUB A;  1K93 D;  3DF0 A;  2FOT A;  1ZMZ A;  2CNP A;  4YGE B;  2PSR A;  2Q91 A;  1A75 A;  2K2F A;  4YBH B;  4XJK B;  4OR9 B;  2BL0 B;  2HPS A;  4F0Z B;  1B7T Z;  2JXL A;  1TIZ A;  1QX5 B;  1XA5 A;  3I5F C;  4XYN A;  3O78 A;  1J1E A;  1C7W A;  1SL8 A;  1W7I B;  5G08 A;  4MVF A;  3AAK A;  2R2I A;  3AKB A;  1WDC C;  1DJW A;  2M97 A;  2PAL A;  1XFV O;  1BG1 A;  4NDC A;  4OV2 A;  2VRG A;  4GNK B;  3I5F B;  1KSO A;  1HT9 A;  2COL B;  1L2O C;  1TTX A;  2M9G A;  1B4C A;  4M2Q A;  2M0R A;  4CID A;  2MA2 A;  3JTD B;  3PM8 A;  2QAC A;  3LLE A;  5I2Q A;  1DJH A;  2WCB A;  1J7P A;  2KI4 C;  1SR6 B;  2K7O A;  4YI9 A;  2JUL A;  4DIR A;  1L2O B;  1CDP A;  1MF8 B;  1EXR A;  1XO5 A;  1UHN A;  4DS7 A;  3ICB A;  1UP5 A;  1KK7 Y;  4PHN A;  1IH0 A;  1QX7 A;  3BUN B;  2L50 A;  3PAL A;  1KQV A;  2LVI A;  1QVI Y;  1EJ3 A;  1OZS A;  1YRT B;  5ER5 A;  3AAJ A;  1QLS A;  2LHL A;  5DKR A;  3WNX B;  1K2H A;  1DGU A;  1BU3 A;  2KAY A;  3BOW A;  3TDZ A;  1SYM A;  3C1V A;  2A4J A;  2ZNE A;  1RRO A;  1PK0 D;  2EGD A;  3EVR A;  3SG4 A;  2Y1N A;  4WQ3 A;  2HQW A;  3I5H C;  1EG3 A;  2M7L A;  5HYD A;  1PUL A;  1E8A A;  4HRH A;  2B1U A;  2E30 A;  2WOS A;  1AUI B;  1EG4 A;  1PRW A;  2KFH A;  3LCP C;  4NQG A;  3O4Y A;  1N65 A;  3SG7 A;  5B8I B;  2O5G A;  1SW8 A;  3PAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...