2JQ6A

Structure of eh-domain of ehd1
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
139
structure length
139
Chain Sequence
GPLGSESLMPSQVVKGGAFDGTMNGPFGHGYGEGAGEGIDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPSKRRHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords EH domain-containing protein 1
publication title EH domain of EHD1
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2007-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12763 EF-hand_4 Cytoskeletal-regulatory complex EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2jq6A01
2LUXA 1WY9A 1XFVO 2NCOA 1MF8B 1MXEA 1FBVA 1WDCB 2KBMA 3F45A 1QTXA 1F54A 1IWQA 1EL4A 2OS8C 2Y1NA 1IQ5A 1ZMZA 2OS8B 1MHOA 1S3PA 1J55A 1YVHA 2HETA 1W7IB 2H2KA 2TN4A 3D10A 1DTLA 1QLKA 1BMOA 2JT8A 1YTZC 4F0ZB 3RM1A 3BUWB 4NDCA 3PLFB 1L2OC 5AEQA 1DJYA 1NCXA 1XO5A 5D7FA 4PHMA 1S6IA 3NSLA 3PFVA 2LHIA 1KK8C 1NYAA 1MXLC 2ZRSA 1J7QA 1B47A 3LK0A 4YGBB 3ZNIA 1KK8B 1UP5A 3KEVA 1OZOA 1V1GA 3PATA 5ER5A 1LA3A 2COLB 2ZN8A 3AAKA 3TUYB 1TRFA 5AXIA 4AQJA 5AFPA 4PDZA 5G08A 1QIWA 1LA0A 1U5IB 4I5NB 1K96A 1S6CA 3DVMA 1IRJA 1QX5B 2LVJA 2NCPA 1WRZA 3IF7A 4PHNA 1S36A 4HREE 4L9MA 2Y1MA 3CR4X 1F70A 1CLMA 2PRUA 2M97A 3SG4A 3NSOA 3HX4A 1KFUL 1C7WA 2KI6D 1BODA 3CZTX 2L5XB 1RECA 1AJ5A 4MBEA 1F71A 2I18A 4YI8A 4MZJA 2KFFA 1CM1A 2SASA 1EJ3A 2CCMA 1G8IA 1TTXA 1KFXL 1QLSA 2F2OA 2I2RE 2KDHA 2LUCA 2ZFDA 3CLNA 3VRRA 1CFDA 4ZCUA 2P6BB 3BUMB 5HKWA 1SNLA 1YURA 1UURA 1PVAA 1OMVA 1RK9A 5KTYA 4YGEB 1CDLA 1J7OA 2LC5A 2MLFC 1S26D 1B8LA 1G33A 1XFUO 3DVJA 4FTGA 3KHEA 3OX5A 2JPTA 3OHMB 2LV7A 4MEWA 2M1UA 3O4YA 1KSOA 1M63B 2A4JA 1DJHA 3M0WA 2ZNDA 1SL9A 1YX8A 2CT9A 3A4UB 2HQWA 5HKYA 2LM5A 1EG4A 1NPQA 4I5KA 5CPVA 3VROA 3NSIA 2AUCA 3FIAA 5HKZA 2K7BA 2H61A 2HQ8A 1JF2A 4GUKA 2K7CA 1YUUA 2PSRA 1UHHA 3FWBA 1FPWA 3MSEB 3OB2B 2HF5A 1K90D 2LAPA 2ZKMX 4MVFA 1ZACA 3ZWHA 2HPSA 1H8BA 1B7TY 1SPYA 1LXFC 3SJSA 3D0YA 4N1GA 3LCPC 1H4BA 5HYDA 2FJUB 2E6WA 2G9BA 1KWOC 2JXCA 2K61A 3ICBA 1GJYA 1KWOB 1AP4A 3EVVA 5B8IB 2JTTA 4XYNA 2M3WA 2WC8A 2M9GA 1RROA 1XVJA 4XJKA 5AANA 2LMVA 2EGDA 4DS7A 1N2DA 3DVKA 1QVIY 2L50A 1NX0A 3TDIA 1B8CA 1YX7A 3VRQA 2KQYA 3I5HB 1B9AA 1NX1A 2GGMA 2KI4C 2FCDA 1XYDA 2KHNA 4WQ3A 1S5GY 1UHNA 2K2FA 4CIDA 3KO0A 1SR6C 1GQMA 3DF0B 3FWCA 1C7VA 3JVTB 1SW8A 1CNPA 4GNKB 1B4CA 5CSFA 3O6BA 1V1FA 1DT7B 1CDMA 1KFUS 2JZIA 3EVUA 1QXPA 2FCEA 2PALA 1A2XA 3CTNA 5IBWA 4HSZA 4NDDA 4PHKA 1IGVA 3EK8A 1EH2A 3LK1A 5I2OA 1S1EA 1K2HA 1KFXS 1UUSA 1QS7A 1IJ6A 1EXRA 1LVCD 1SCVA 2WORA 1M39A 3SG7A 4GPLB 3D0YB 4YGDB 1D1OA 2KYFA 4I5JA 2M7NA 1K95A 1YVLA 4YI9A 1CLBA 2WCFA 1IKUA 2ZN9A 3SG2A 2L4IA 3TUYC 1F55A 1SY9A 2JULA 1FF1A 4XJKB 2JRFA 1W7JB 1UWOA 1SKTA 1S6JA 3QRXA 1CFCA 2O5GA 1AHRA 2KQ6A 4ORAB 4CFQA 1NWDA 1KSMA 2DOQA 4C0JA 5JOLA 4CLNA 1NCYA 1KQMC 4MLWA 1M31A 1TN4A 2LVVA 1KQMB 1QIVA 2BKIB 1PVBA 1MUXA 1PULA 3AAJA 1MWNA 1ZFSA 4ORCB 1XFZO 2MJWB 3RLZA 2R2IA 2MBXA 1B8RA 2KFGA 1OE9B 1F4QA 1CB1A 1JUOA 1WLMA 1YRUB 4DRWA 2L0PA 3I5FC 3VRNA 1BF5A 1KK7Y 3E3RA 2WCBA 3I5FB 2EHBA 4MZLA 5HLOA 1Y6WA 1YUSA 2IS9A 2B1UA 4QJ5B 2LLUA 2F33A 1CMGA 1JFKA 4JPZB 4ZCVA 2M8UA 3CR2A 5D69A 4DIRA 3EKJA 4NQGA 2Q91A 2GGZA 2MHHA 4PCWA 5CSJA 2OTGB 4USLA 1K93D 1IG5A 3BUXB 1C07A 1KCYA 3VRPA 1XFXO 3DVEA 5F6TA 1OQPA 4GAOA 1TNQA 2Q4UA 2SCPA 5I8NA 3DF0A 2KBIA 5CSNA 2M49B 4R1EA 2KGBC 1LKJA 2LP3A 3KF9A 1CFPA 1NX2A 2JXLA 4N1FA 4A4BA 5KSZA 1K9KA 2M1KB 1OMRA 1JFJA 1SBJA 1TCOB 1TNXA 1K9UA 1TNPA 1PRWA 1YR5A 4YBHB 1CFFA 2Y5IA 3WHUB 1J7RA 1DJXA 1RWYA 2JC2A 3A8RA 3BYAA 2KFHA 1UHKA 1BG1A 1B7TZ 4GGFA 5BPJA 4TNCA 1A03A 4MZKA 1F8HA 1BT6A 1FW4A 1N65A 2F3ZA 4M2OA 4MRXA 4IL1A 2BECA 4OV2A 2BBMA 1DF0B 3SIBA 1M45A 3C1VA 1CMFA 1DGVA 4Q04A 1L7ZA 4PHJA 3CGAA 3TZ1A 2K2AA 1OSAA 3K21A 2PMYA 1ALWA 1BJFA 1QVIZ 2BE6A 1BR4B 4PE7A 1MR8A 1QASA 4CFRA 1A29A 4PE1A 1DMOA 5KU1A 4C0KA 2BCAA 1Y0VH 2LLTA 1FI6A 1Q80A 2KI6C 1JWDA 4AOMA 3I5HC 3VGOA 1TOPA 1A75A 1J1DA 1TNWA 3IQQA 1J7PA 2BKHB 3TDUA 4WQ2A 4C0LA 3JVTC 1TIZA 1GGWA 1HT9A 2D8NA 3EK7A 4OVNF 3O2PA 1IQ3A 4HRGA 3AKAA 2MLEC 3I5GC 1RJVA 2MAZA 4N5XA 5I2QA 3I5GB 3BXKA 4GBAA 1SRAA 3CS1A 4YGAA 4PALA 4ETOA 1SL8A 2RGIA 3CR5X 1GGZA 3O78A 1EG3A 1SCMB 2H61C 1DJWA 3GK1A 4WRIA 2FOTA 3DD4A 5DKQA 1QX7A 2BCXA 4GGFC 1FI5A 1K94A 2LVKA 2BBNA 5DKNA 4MN0A 4OCIA 2K7DA 2BE4A 2KYCA 1UHJA 4OKHA 3H4SE 1DJIA 1NCZA 1SL7A 1XA5A 1QV1A 5ER4X 2LNKA 1AVSA 4ICBA 5JJGA 3BUOB 1HQVA 2K0JA 4HRHA 1DGUA 3CWGA 2BL0C 2BCBA 1ALVA 2F8PA 1Y1XA 3SG6A 2BL0B 2CTNA 1AJ4A 2CXJA 1MQ1A 2JTZA 2ZRTA 1DJGA 3WXAA 4D1EA 1BLQA 2F2PA 1CM4A 1ODBA 3BOWA 1A75B 1K8UA 3FS7A 3OX6A 1OOJA 4JWQA 2NLNA 2K8MB 1L2OB 4FQOA 1YUTA 4OR9B 2ISDA 5DKRA 2NXQA 1KK7Z 1RFJA 1CLLA 1B1GA 1PSRA 2ZNEA 2LE9B 2JNFA 2K7OA 1DJZA 2Y4QA 3PALA 4I5LB 1R2UA 2KAVA 3GK4X 1DF0A 4UPGA 1G4YR 1CDPA 3WHTB 2L4HA 4M2PA 3OP0A 2LMUA 3OB1B 2JQ6A 3GK2A 1NSHA 2KAXA 4NDBA 2AAOA 1Y1UA 3GOFA 1OMDA 2OTGC 5HLVA 1QX2A 2M29A 3EVRA 1JF0A 3BUNB 1CKKA 1X02A 2KGRA 1K9PA 2E30A 1WRKA 2NZ0A 3HCMA 2JT0A 4QJ3B 2LMTA 4QJ4B 3PN7C 3TS5C 4AQIA 2M7LA 3PN7B 3SG3A 4A4CA 1IJ5A 1CTRA 3TS5B 1XK4A 2O60A 1OZSA 3LL8B 4E68A 1PALA 2CNPA 2LHLA 1AK8A 4P2YB 4YGCB 1AUIB 2WCEA 4ORBB 3NSKA 1SMGA 1WLZA 2LP2A 4JQ0D 3SIAA 1VRKA 2PASA 3BOWB 4M2QA 1SK6D 1Y1AA 3EKHA 2LVIA 2KNEA 4GFTA 3KPXA 1PK0D 1TCFA 1YRTB 2JOJA 3SG5A 2KAYA 1JSAA 1BOCA 2G2BA 2WOSA 2LLSA 4CPVA 2KSPA 3LLEA 5TNCA 4DUQA 5AERA 1QV0A 1WRLA 3JTDC 1J1EA 3JTDB 1N0YA 2JU0A 1LINA 3PM8A 2PVBA 1DVIA 5K89A 3IQOA 5GQQC 1NUBA 1XFWO 5FYXA 1RTP1 1UHIA 2V53A 1S5GZ 4DCKA 2F3YA 1R6PA 2JT3A 2L51A 1SYMA 2JWWA 2M0RA 4BY5A 5CSIA 2GV5A 2LCPA 1NP8A 1XK4C 2I94A 2OPOA 4U8DA 2AMIA 4GGNA 1E8AA 1BU3A 2JNXA 3EK4A 1NIWA 2QACA 1JBAA 4YRUA 1IH0A 3AKBA 1NX3A 2VRGA 3I5IC 4PE4A 1ZOTB 1PSBA 1BR1B 2EC6C 1A4PA 3I5IB 2EC6B 4P5OE 3WNXB 1QATA 2LANA 2KOTA 3PSRA 1SCMC 5J3XA 2CBLA 1JC2A 1QJTA 2MRDA 4BY4A 1ZUZA 1KQVA 4PE0A 5PALA 1U5IA 2WNDA 2L98A 5I2LA 3TDZA 1F4OA 3BQ3A 2QPTA 2MA2A 2I7AA 1M46A 2KI4B 3NXAA 4MRYA 1CDNA 2L2EA 1XFYO 1SR6B 1WDCC 4MSPA
chains in the Genus database with same CATH superfamily
2LUXA 1WY9A 1XFVO 2NCOA 3D75A 1MF8B 1MXEA 1FBVA 1WDCB 2KBMA 3F45A 1QTXA 1F54A 1IWQA 1EL4A 2OS8C 2Y1NA 1IQ5A 1ZMZA 5D3OA 2OS8B 1MHOA 1S3PA 1J55A 1YVHA 2HETA 1W7IB 2BNXA 2H2KA 2TN4A 3D10A 4FQTA 2PYQA 1DTLA 1QLKA 1BMOA 2JT8A 3IVTA 1YTZC 3L4LA 4F0ZB 3RM1A 3O4XA 3BUWB 4NDCA 3PLFB 1L2OC 5AEQA 3CYZA 1DJYA 1NCXA 1XO5A 5D7FA 4PHMA 1S6IA 3NSLA 3PFVA 2LHIA 1KK8C 1NYAA 1MXLC 2ZRSA 1J7QA 1B47A 3LK0A 4YGBB 3OGNA 3ZNIA 1KK8B 1UP5A 3KEVA 1OZOA 1V1GA 3PATA 5ER5A 1LA3A 2COLB 3CABA 2ZN8A 3AAKA 3PM2A 3TUYB 5FI2A 1TRFA 3FE8A 5AXIA 1H4BA 4AQJA 5AFPA 4PDZA 5G08A 1QIWA 1LA0A 1U5IB 1W9ZA 4I5NB 1K96A 1S6CA 3DVMA 1IRJA 1QX5B 2LVJA 2KLDA 2NCPA 1WRZA 3IF7A 4PHNA 1S36A 4HREE 4L9MA 2Y1MA 3CR4X 1F70A 1CLMA 2PRUA 2M97A 3SG4A 3RZSA 3NSOA 3HX4A 1KFUL 1C7WA 2KI6D 1BODA 1OOHA 1OOGA 3CZTX 1TUJA 2L5XB 1RECA 5FI6A 1AJ5A 4MBEA 1F71A 2I18A 4YI8A 3CZ1A 4MZJA 2KFFA 1CM1A 2SASA 1EJ3A 1TWOA 1G8IA 1TTXA 1KFXL 1QLSA 2CCMA 2F2OA 2I2RE 2KDHA 2LUCA 2ZFDA 3CLNA 1CFDA 4ZCUA 3VRRA 2P6BB 3BUMB 5HKWA 1SNLA 1YURA 1UURA 1PVAA 1OMVA 1RK9A 5KTYA 5DICA 4YGEB 1CDLA 3NHTA 2LC5A 1J7OA 2MLFC 1S26D 1B8LA 1G33A 1XFUO 3DVJA 4FTGA 3KHEA 3R72A 3OX5A 2JPTA 3OHMB 2LV7A 1TUZA 4MEWA 2M1UA 3O4YA 1ORGA 1KSOA 1M63B 2A4JA 1DJHA 3M0WA 2ZNDA 4F7FA 1SL9A 2QEBA 1YX8A 2L2CA 2CT9A 3A4UB 2HQWA 5HKYA 2LM5A 1EG4A 1NPQA 4I5KA 5CPVA 3VROA 3NSIA 3PJIA 2AUCA 3FIAA 5HKZA 2K7BA 2H61A 2HQ8A 1JF2A 4GUKA 2K7CA 1YUUA 2PSRA 1UHHA 3FWBA 1FPWA 3MSEB 3OB2B 2HF5A 1K90D 2LAPA 2ZKMX 4MVFA 1ZACA 3ZWHA 2H8VA 2HPSA 3S0EA 1T14A 1H8BA 1B7TY 1SPYA 1LXFC 3SJSA 3D0YA 3B7AA 3LCPC 4N1GA 5HYDA 2FJUB 2E6WA 2G9BA 1KWOC 2JXCA 2K61A 3ICBA 1GJYA 1KWOB 1AP4A 3EVVA 5B8IB 2JTTA 4XYNA 2QEVA 2M3WA 2WC8A 2M9GA 1RROA 1XVJA 4XJKA 5AANA 2LMVA 2EGDA 4DS7A 1N2DA 3DVKA 1QVIY 2L50A 1NX0A 3TDIA 1B8CA 1YX7A 2WCKA 3VRQA 2KQYA 3I5HB 1B9AA 1NX1A 2GGMA 3S0GA 2KI4C 2FCDA 1XYDA 2KHNA 4WQ3A 1S5GY 1UHNA 2K2FA 3B86A 4CIDA 3KO0A 3BFHA 1SR6C 1GQMA 3BFAA 3DF0B 3FWCA 1C7VA 3V2LA 3R1VA 3JVTB 3R1PA 1SW8A 1CNPA 4GNKB 1B4CA 5CSFA 3S0BA 3R1OA 3O6BA 1V1FA 1DT7B 1CDMA 1KFUS 2JZIA 3EVUA 1QXPA 2FCEA 2PALA 1A2XA 1P28A 3CTNA 3N7HA 3OBVA 5IBWA 3BFBA 4HSZA 4NDDA 4PHKA 1IGVA 3EK8A 1EH2A 3LK1A 5I2OA 1S1EA 1K2HA 1KFXS 1UUSA 1QS7A 3EG5B 1IJ6A 1EXRA 1LVCD 1SCVA 2WORA 1M39A 3SG7A 5HL1A 4GPLB 3D0YB 4YGDB 1D1OA 2KYFA 4I5JA 2M7NA 1K95A 3SS3A 1YVLA 4YI9A 1CLBA 2WCFA 1IKUA 2ZN9A 3SG2A 2L4IA 3TUYC 1F55A 1SY9A 2JULA 1FF1A 1OOIX 2YGUA 4XJKB 2JRFA 1W7JB 1UWOA 1SKTA 1S6JA 3QRXA 1CFCA 2O5GA 1AHRA 2KQ6A 4ORAB 4CFQA 1NWDA 1KSMA 2DOQA 4C0JA 2PQLA 5JOLA 3S0DA 4CLNA 1NCYA 4INWA 1KQMC 4MLWA 1M31A 1TN4A 2LVVA 3D76A 1KQMB 1QIVA 2BKIB 1OOFA 1PVBA 3DXLA 1MUXA 3D77A 1PULA 3AAJA 1MWNA 1ZFSA 4ORCB 1XFZO 2MJWB 3RLZA 2R2IA 2MBXA 1B8RA 1C3YA 2KFGA 2K60A 1OE9B 1F4QA 1CB1A 1JUOA 1WLMA 1YRUB 4DRWA 2L0PA 3I5FC 3VRNA 1BF5A 1KK7Y 3E3RA 2WCBA 3QMEA 3I5FB 2P71A 3B6XA 2EHBA 4MZLA 5HLOA 1Y6WA 1YUSA 2IS9A 2B1UA 4QJ5B 2LLUA 2F33A 2WCMA 1CMGA 1JFKA 4JPZB 2JPOA 2M8UA 3CR2A 5D69A 4ZCVA 3SS5A 1C3ZA 4DIRA 3EKJA 4NQGA 2Q91A 3FE9A 2GGZA 2MHHA 4PCWA 5CSJA 2OTGB 4USLA 1K93D 1IG5A 3BUXB 1IIOA 1C07A 1KCYA 2BAPA 3VRPA 1XFXO 3NHIA 3DVEA 5F6TA 1OQPA 3B87A 1TNQA 4GAOA 2Q4UA 2SCPA 5I8NA 3DF0A 2KBIA 5CSNA 2M49B 2KPHA 4R1EA 2KGBC 1LKJA 2LP3A 3KF9A 1CFPA 1NX2A 2JXLA 4N1FA 4A4BA 5KSZA 1K9KA 1DQEA 2M1KB 1OMRA 1JFJA 1SBJA 1TCOB 1TNXA 1K9UA 1TNPA 1PRWA 1YR5A 4YBHB 1CFFA 1QWVA 2L5YA 2Y5IA 3WHUB 1J7RA 1DJXA 1RWYA 2JC2A 3A8RA 3BYAA 2KFHA 1UHKA 1BG1A 1B7TZ 4GGFA 5BPJA 4TNCA 1A03A 4MZKA 1F8HA 1BT6A 1FW4A 1N65A 3DZTA 2F3ZA 4M2OA 4MRXA 4IL1A 3K1EA 2BECA 4OV2A 3UO9A 2BBMA 3S0AA 1DF0B 3SIBA 1M45A 3C1VA 1CMFA 1DGVA 4Q04A 1L7ZA 4PHJA 3CGAA 3TZ1A 2K2AA 1OSAA 3K21A 2PMYA 1ALWA 1BJFA 1QVIZ 2BE6A 1BR4B 4PE7A 1MR8A 1QASA 2FJYA 4CFRA 1A29A 4PE1A 2WCJA 1DMOA 1DC1A 5KU1A 4C0KA 2BCAA 1Y0VH 2LLTA 3CZ0A 1Q80A 1Z4HA 2KI6C 1FI6A 4AOMA 3I5HC 1JWDA 3FE6A 3VGOA 1TOPA 1A75A 1J1DA 2QDIA 1TNWA 3IQQA 1DEKA 1J7PA 2BKHB 2KLEA 4WQ2A 3TDUA 3JVTC 1TIZA 4C0LA 1GGWA 1HT9A 2D8NA 3EK7A 4OVNF 1DELA 3O2PA 1IQ3A 4HRGA 3AKAA 2MLEC 3I5GC 4JKTA 1RJVA 2MAZA 4N5XA 5I2QA 3I5GB 3BXKA 4GBAA 1OW4A 1SRAA 3CS1A 4YGAA 4PALA 4ETOA 1SL8A 2RGIA 3CR5X 1GGZA 3O78A 1EG3A 1SCMB 2H61C 1DJWA 3GK1A 4WRIA 2FOTA 3DD4A 5DKQA 1QX7A 2BCXA 4GGFC 1FI5A 1K94A 2LVKA 2BBNA 1SSEB 5DKNA 4MN0A 4OCIA 2K7DA 2BE4A 2KYCA 1UHJA 2WCHA 4OKHA 2WC5A 3H4SE 1DJIA 1NCZA 1SL7A 2QEOA 1XA5A 1QV1A 5ER4X 3VB1A 2LNKA 1AVSA 4ICBA 3CDNA 5JJGA 3BUOB 1HQVA 2K0JA 4HRHA 1DGUA 3CWGA 2BL0C 2BCBA 1ALVA 2F8PA 1Y1XA 3SG6A 2BL0B 2CTNA 1AJ4A 2CXJA 1MQ1A 2JTZA 2ZRTA 1DJGA 3WXAA 4D1EA 1BLQA 3L47A 2F2PA 1CM4A 1ODBA 3BOWA 1A75B 1K8UA 3FS7A 3OX6A 1OOJA 4JWQA 2NLNA 2K8MB 1L2OB 4FQOA 1YUTA 4OR9B 2ISDA 3Q8IA 5DKRA 2NXQA 1KK7Z 2ERBA 3D73A 1RFJA 1CLLA 1B1GA 1PSRA 2ZNEA 2LE9B 2JNFA 2K7OA 4JD9A 1DJZA 2WC6A 2Y4QA 3PALA 4I5LB 1R2UA 2KAVA 3GK4X 4KYNA 1DF0A 4UPGA 1G4YR 1CDPA 3WHTB 2L4HA 4M2PA 3OP0A 2LMUA 3OB1B 3SS4A 2JQ6A 4INXA 3GK2A 1NSHA 2KAXA 4NDBA 2AAOA 1Y1UA 3GOFA 1OMDA 5EL2A 2OTGC 5HLVA 1QX2A 2M29A 3EVRA 1JF0A 3BUNB 1CKKA 1X02A 2KGRA 1K9PA 2E30A 1WRKA 2NZ0A 3HCMA 2JT0A 4QJ3B 2LMTA 4PT1A 2P70A 3PN7C 3CZ2A 4QJ4B 3TS5C 4AQIA 3L4AA 3PN7B 2M7LA 3SG3A 1IJ5A 3UNWA 1CTRA 3TS5B 4A4CA 1XK4A 2O60A 3DY9A 1OZSA 3BJHA 3LL8B 1PALA 2CNPA 2LHLA 4E68A 4P2YB 1AK8A 4YGCB 1AUIB 1XFRA 2WCEA 4ORBB 3NGVA 3NSKA 1SMGA 3DYEA 1WLZA 2LP2A 4OZDA 3S0FA 4JQ0D 3SIAA 1VRKA 2PASA 3BOWB 4M2QA 1SK6D 1Y1AA 3EKHA 2LVIA 1Z2CB 5I94A 1GM0A 2KNEA 3D74A 4GFTA 3KPXA 1PK0D 1TCFA 1YRTB 2JOJA 3SG5A 2KAYA 1LS8A 1JSAA 1BOCA 2G2BA 2WOSA 2LLSA 2GTEA 4CPVA 2KSPA 3LLEA 5TNCA 4DUQA 5AERA 1QV0A 3B88A 1WRLA 3JTDC 1J1EA 3JTDB 1N0YA 2JU0A 1LINA 3PM8A 2PVBA 1DVIA 5K89A 3IQOA 5GQQC 1NUBA 1XFWO 4IJ7A 5FYXA 1RTP1 1UHIA 2V53A 1S5GZ 4DCKA 2F3YA 1R6PA 2JT3A 2L51A 1SYMA 2JWWA 2M0RA 4BY5A 5CSIA 2QEHA 2GV5A 2LCPA 1NP8A 1XK4C 2I94A 2OPOA 4U8DA 2AMIA 4GGNA 1E8AA 1BU3A 2JNXA 3EK4A 1NIWA 2QACA 1JBAA 4YRUA 1IH0A 3AKBA 1NX3A 2VRGA 3I5IC 4PE4A 1ZOTB 1PSBA 1BR1B 2EC6C 1A4PA 3I5IB 5FI7A 2EC6B 4P5OE 3WNXB 1QATA 2LANA 2KOTA 3D78A 1SCMC 3PSRA 2CBLA 5J3XA 1JC2A 1QJTA 2MRDA 2WCLA 1ZUZA 4BY4A 1KQVA 4PE0A 5PALA 1U5IA 2WNDA 2L98A 5I2LA 3TDZA 1F4OA 3BQ3A 2QPTA 2MA2A 2I7AA 1M46A 2KI4B 3NXAA 4MRYA 1CDNA 2L2EA 1XFYO 1SR6B 1WDCC 4MSPA
chains in the Genus database with same CATH topology
2LUXA 1WY9A 1XFVO 2NCOA 1MF8B 1MXEA 1FBVA 1WDCB 2KBMA 3F45A 1QTXA 1F54A 1IWQA 1EL4A 2OS8C 2Y1NA 1IQ5A 1ZMZA 2OS8B 1MHOA 1S3PA 1J55A 1YVHA 2HETA 1W7IB 2H2KA 2TN4A 3D10A 1DTLA 1QLKA 1BMOA 2JT8A 1YTZC 4F0ZB 3RM1A 3BUWB 4NDCA 3PLFB 1L2OC 5AEQA 1DJYA 1NCXA 1XO5A 5D7FA 4PHMA 1S6IA 3NSLA 3PFVA 2LHIA 1KK8C 1NYAA 1MXLC 2ZRSA 1J7QA 1B47A 3LK0A 4YGBB 3ZNIA 1KK8B 1UP5A 3KEVA 1OZOA 1V1GA 3PATA 5ER5A 1LA3A 2COLB 2ZN8A 3AAKA 3TUYB 1TRFA 5AXIA 4AQJA 5AFPA 4PDZA 5G08A 1QIWA 1LA0A 1U5IB 4I5NB 1K96A 1S6CA 3DVMA 1IRJA 1QX5B 2LVJA 2NCPA 1WRZA 3IF7A 4PHNA 1S36A 4HREE 4L9MA 2Y1MA 3CR4X 1F70A 1CLMA 2PRUA 2M97A 3SG4A 3NSOA 3HX4A 1KFUL 1C7WA 2KI6D 1BODA 3CZTX 2L5XB 1RECA 1AJ5A 4MBEA 1F71A 2I18A 4YI8A 4MZJA 2KFFA 1CM1A 2SASA 1EJ3A 2CCMA 1G8IA 1TTXA 1KFXL 1QLSA 2F2OA 2I2RE 2KDHA 2LUCA 2ZFDA 3CLNA 3VRRA 1CFDA 4ZCUA 2P6BB 3BUMB 5HKWA 1SNLA 1YURA 1UURA 1PVAA 1OMVA 1RK9A 5KTYA 4YGEB 1CDLA 1J7OA 2LC5A 2MLFC 1S26D 1B8LA 1G33A 1XFUO 3DVJA 4FTGA 3KHEA 3OX5A 2JPTA 3OHMB 2LV7A 4MEWA 2M1UA 3O4YA 1KSOA 1M63B 2A4JA 1DJHA 3M0WA 2ZNDA 1SL9A 1YX8A 2CT9A 3A4UB 2HQWA 5HKYA 2LM5A 1EG4A 1NPQA 4I5KA 5CPVA 3VROA 3NSIA 2AUCA 3FIAA 5HKZA 2K7BA 2H61A 2HQ8A 1JF2A 4GUKA 2K7CA 1YUUA 2PSRA 1UHHA 3FWBA 1FPWA 3MSEB 3OB2B 2HF5A 1K90D 2LAPA 2ZKMX 4MVFA 1ZACA 3ZWHA 2HPSA 1H8BA 1B7TY 1SPYA 1LXFC 3SJSA 3D0YA 4N1GA 3LCPC 1H4BA 5HYDA 2FJUB 2E6WA 2G9BA 1KWOC 2JXCA 2K61A 3ICBA 1GJYA 1KWOB 1AP4A 3EVVA 5B8IB 2JTTA 4XYNA 2M3WA 2WC8A 2M9GA 1RROA 1XVJA 4XJKA 5AANA 2LMVA 2EGDA 4DS7A 1N2DA 3DVKA 1QVIY 2L50A 1NX0A 3TDIA 1B8CA 1YX7A 3VRQA 2KQYA 3I5HB 1B9AA 1NX1A 2GGMA 2KI4C 2FCDA 1XYDA 2KHNA 4WQ3A 1S5GY 1UHNA 2K2FA 4CIDA 3KO0A 1SR6C 1GQMA 3DF0B 3FWCA 1C7VA 3JVTB 1SW8A 1CNPA 4GNKB 1B4CA 5CSFA 3O6BA 1V1FA 1DT7B 1CDMA 1KFUS 2JZIA 3EVUA 1QXPA 2FCEA 2PALA 1A2XA 3CTNA 5IBWA 4HSZA 4NDDA 4PHKA 1IGVA 3EK8A 1EH2A 3LK1A 5I2OA 1S1EA 1K2HA 1KFXS 1UUSA 1QS7A 1IJ6A 1EXRA 1LVCD 1SCVA 2WORA 1M39A 3SG7A 4GPLB 3D0YB 4YGDB 1D1OA 2KYFA 4I5JA 2M7NA 1K95A 1YVLA 4YI9A 1CLBA 2WCFA 1IKUA 2ZN9A 3SG2A 2L4IA 3TUYC 1F55A 1SY9A 2JULA 1FF1A 4XJKB 2JRFA 1W7JB 1UWOA 1SKTA 1S6JA 3QRXA 1CFCA 2O5GA 1AHRA 2KQ6A 4ORAB 4CFQA 1NWDA 1KSMA 2DOQA 4C0JA 5JOLA 4CLNA 1NCYA 1KQMC 4MLWA 1M31A 1TN4A 2LVVA 1KQMB 1QIVA 2BKIB 1PVBA 1MUXA 1PULA 3AAJA 1MWNA 1ZFSA 4ORCB 1XFZO 2MJWB 3RLZA 2R2IA 2MBXA 1B8RA 2KFGA 1OE9B 1F4QA 1CB1A 1JUOA 1WLMA 1YRUB 4DRWA 2L0PA 3I5FC 3VRNA 1BF5A 1KK7Y 3E3RA 2WCBA 3I5FB 2EHBA 4MZLA 5HLOA 1Y6WA 1YUSA 2IS9A 2B1UA 4QJ5B 2LLUA 2F33A 1CMGA 1JFKA 4JPZB 4ZCVA 2M8UA 3CR2A 5D69A 4DIRA 3EKJA 4NQGA 2Q91A 2GGZA 2MHHA 4PCWA 5CSJA 2OTGB 4USLA 1K93D 1IG5A 3BUXB 1C07A 1KCYA 3VRPA 1XFXO 3DVEA 5F6TA 1OQPA 4GAOA 1TNQA 2Q4UA 2SCPA 5I8NA 3DF0A 2KBIA 5CSNA 2M49B 4R1EA 2KGBC 1LKJA 2LP3A 3KF9A 1CFPA 1NX2A 2JXLA 4N1FA 4A4BA 5KSZA 1K9KA 2M1KB 1OMRA 1JFJA 1SBJA 1TCOB 1TNXA 1K9UA 1TNPA 1PRWA 1YR5A 4YBHB 1CFFA 2Y5IA 3WHUB 1J7RA 1DJXA 1RWYA 2JC2A 3A8RA 3BYAA 2KFHA 1UHKA 1BG1A 1B7TZ 4GGFA 5BPJA 4TNCA 1A03A 4MZKA 1F8HA 1BT6A 1FW4A 1N65A 2F3ZA 4M2OA 4MRXA 4IL1A 2BECA 4OV2A 2BBMA 1DF0B 3SIBA 1M45A 3C1VA 1CMFA 1DGVA 4Q04A 1L7ZA 4PHJA 3CGAA 3TZ1A 2K2AA 1OSAA 3K21A 2PMYA 1ALWA 1BJFA 1QVIZ 2BE6A 1BR4B 4PE7A 1MR8A 1QASA 4CFRA 1A29A 4PE1A 1DMOA 5KU1A 4C0KA 2BCAA 1Y0VH 2LLTA 1FI6A 1Q80A 2KI6C 1JWDA 4AOMA 3I5HC 3VGOA 1TOPA 1A75A 1J1DA 1TNWA 3IQQA 1J7PA 2BKHB 3TDUA 4WQ2A 4C0LA 3JVTC 1TIZA 1GGWA 1HT9A 2D8NA 3EK7A 4OVNF 3O2PA 1IQ3A 4HRGA 3AKAA 2MLEC 3I5GC 1RJVA 2MAZA 4N5XA 5I2QA 3I5GB 3BXKA 4GBAA 1SRAA 3CS1A 4YGAA 4PALA 4ETOA 1SL8A 2RGIA 3CR5X 1GGZA 3O78A 1EG3A 1SCMB 2H61C 1DJWA 3GK1A 4WRIA 2FOTA 3DD4A 5DKQA 1QX7A 2BCXA 4GGFC 1FI5A 1K94A 2LVKA 2BBNA 5DKNA 4MN0A 4OCIA 2K7DA 2BE4A 2KYCA 1UHJA 4OKHA 3H4SE 1DJIA 1NCZA 1SL7A 1XA5A 1QV1A 5ER4X 2LNKA 1AVSA 4ICBA 5JJGA 3BUOB 1HQVA 2K0JA 4HRHA 1DGUA 3CWGA 2BL0C 2BCBA 1ALVA 2F8PA 1Y1XA 3SG6A 2BL0B 2CTNA 1AJ4A 2CXJA 1MQ1A 2JTZA 2ZRTA 1DJGA 3WXAA 4D1EA 1BLQA 2F2PA 1CM4A 1ODBA 3BOWA 1A75B 1K8UA 3FS7A 3OX6A 1OOJA 4JWQA 2NLNA 2K8MB 1L2OB 4FQOA 1YUTA 4OR9B 2ISDA 5DKRA 2NXQA 1KK7Z 1RFJA 1CLLA 1B1GA 1PSRA 2ZNEA 2LE9B 2JNFA 2K7OA 1DJZA 2Y4QA 3PALA 4I5LB 1R2UA 2KAVA 3GK4X 1DF0A 4UPGA 1G4YR 1CDPA 3WHTB 2L4HA 4M2PA 3OP0A 2LMUA 3OB1B 2JQ6A 3GK2A 1NSHA 2KAXA 4NDBA 2AAOA 1Y1UA 3GOFA 1OMDA 2OTGC 5HLVA 1QX2A 2M29A 3EVRA 1JF0A 3BUNB 1CKKA 1X02A 2KGRA 1K9PA 2E30A 1WRKA 2NZ0A 3HCMA 2JT0A 4QJ3B 2LMTA 4QJ4B 3PN7C 3TS5C 4AQIA 2M7LA 3PN7B 3SG3A 4A4CA 1IJ5A 1CTRA 3TS5B 1XK4A 2O60A 1OZSA 3LL8B 4E68A 1PALA 2CNPA 2LHLA 1AK8A 4P2YB 4YGCB 1AUIB 2WCEA 4ORBB 3NSKA 1SMGA 1WLZA 2LP2A 4JQ0D 3SIAA 1VRKA 2PASA 3BOWB 4M2QA 1SK6D 1Y1AA 3EKHA 2LVIA 2KNEA 4GFTA 3KPXA 1PK0D 1TCFA 1YRTB 2JOJA 3SG5A 2KAYA 1JSAA 1BOCA 2G2BA 2WOSA 2LLSA 4CPVA 2KSPA 3LLEA 5TNCA 4DUQA 5AERA 1QV0A 1WRLA 3JTDC 1J1EA 3JTDB 1N0YA 2JU0A 1LINA 3PM8A 2PVBA 1DVIA 5K89A 3IQOA 5GQQC 1NUBA 1XFWO 5FYXA 1RTP1 1UHIA 2V53A 1S5GZ 4DCKA 2F3YA 1R6PA 2JT3A 2L51A 1SYMA 2JWWA 2M0RA 4BY5A 5CSIA 2GV5A 2LCPA 1NP8A 1XK4C 2I94A 2OPOA 4U8DA 2AMIA 4GGNA 1E8AA 1BU3A 2JNXA 3EK4A 1NIWA 2QACA 1JBAA 4YRUA 1IH0A 3AKBA 1NX3A 2VRGA 3I5IC 4PE4A 1ZOTB 1PSBA 1BR1B 2EC6C 1A4PA 3I5IB 2EC6B 4P5OE 3WNXB 1QATA 2LANA 2KOTA 3PSRA 1SCMC 5J3XA 2CBLA 1JC2A 1QJTA 2MRDA 4BY4A 1ZUZA 1KQVA 4PE0A 5PALA 1U5IA 2WNDA 2L98A 5I2LA 3TDZA 1F4OA 3BQ3A 2QPTA 2MA2A 2I7AA 1M46A 2KI4B 3NXAA 4MRYA 1CDNA 2L2EA 1XFYO 1SR6B 1WDCC 4MSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LUX A;  1WY9 A;  1XFV O;  2NCO A;  1MF8 B;  1MXE A;  1FBV A;  1WDC B;  2KBM A;  3F45 A;  1QTX A;  1F54 A;  1IWQ A;  1EL4 A;  2OS8 C;  2Y1N A;  1IQ5 A;  1ZMZ A;  2OS8 B;  1MHO A;  1S3P A;  1J55 A;  1YVH A;  2HET A;  1W7I B;  2H2K A;  2TN4 A;  3D10 A;  1DTL A;  1QLK A;  1BMO A;  2JT8 A;  1YTZ C;  4F0Z B;  3RM1 A;  3BUW B;  4NDC A;  3PLF B;  1L2O C;  5AEQ A;  1DJY A;  1NCX A;  1XO5 A;  5D7F A;  4PHM A;  1S6I A;  3NSL A;  3PFV A;  2LHI A;  1KK8 C;  1NYA A;  1MXL C;  2ZRS A;  1J7Q A;  1B47 A;  3LK0 A;  4YGB B;  3ZNI A;  1KK8 B;  1UP5 A;  3KEV A;  1OZO A;  1V1G A;  3PAT A;  5ER5 A;  1LA3 A;  2COL B;  2ZN8 A;  3AAK A;  3TUY B;  1TRF A;  5AXI A;  4AQJ A;  5AFP A;  4PDZ A;  5G08 A;  1QIW A;  1LA0 A;  1U5I B;  4I5N B;  1K96 A;  1S6C A;  3DVM A;  1IRJ A;  1QX5 B;  2LVJ A;  2NCP A;  1WRZ A;  3IF7 A;  4PHN A;  1S36 A;  4HRE E;  4L9M A;  2Y1M A;  3CR4 X;  1F70 A;  1CLM A;  2PRU A;  2M97 A;  3SG4 A;  3NSO A;  3HX4 A;  1KFU L;  1C7W A;  2KI6 D;  1BOD A;  3CZT X;  2L5X B;  1REC A;  1AJ5 A;  4MBE A;  1F71 A;  2I18 A;  4YI8 A;  4MZJ A;  2KFF A;  1CM1 A;  2SAS A;  1EJ3 A;  2CCM A;  1G8I A;  1TTX A;  1KFX L;  1QLS A;  2F2O A;  2I2R E;  2KDH A;  2LUC A;  2ZFD A;  3CLN A;  3VRR A;  1CFD A;  4ZCU A;  2P6B B;  3BUM B;  5HKW A;  1SNL A;  1YUR A;  1UUR A;  1PVA A;  1OMV A;  1RK9 A;  5KTY A;  4YGE B;  1CDL A;  1J7O A;  2LC5 A;  2MLF C;  1S26 D;  1B8L A;  1G33 A;  1XFU O;  3DVJ A;  4FTG A;  3KHE A;  3OX5 A;  2JPT A;  3OHM B;  2LV7 A;  4MEW A;  2M1U A;  3O4Y A;  1KSO A;  1M63 B;  2A4J A;  1DJH A;  3M0W A;  2ZND A;  1SL9 A;  1YX8 A;  2CT9 A;  3A4U B;  2HQW A;  5HKY A;  2LM5 A;  1EG4 A;  1NPQ A;  4I5K A;  5CPV A;  3VRO A;  3NSI A;  2AUC A;  3FIA A;  5HKZ A;  2K7B A;  2H61 A;  2HQ8 A;  1JF2 A;  4GUK A;  2K7C A;  1YUU A;  2PSR A;  1UHH A;  3FWB A;  1FPW A;  3MSE B;  3OB2 B;  2HF5 A;  1K90 D;  2LAP A;  2ZKM X;  4MVF A;  1ZAC A;  3ZWH A;  2HPS A;  1H8B A;  1B7T Y;  1SPY A;  1LXF C;  3SJS A;  3D0Y A;  4N1G A;  3LCP C;  1H4B A;  5HYD A;  2FJU B;  2E6W A;  2G9B A;  1KWO C;  2JXC A;  2K61 A;  3ICB A;  1GJY A;  1KWO B;  1AP4 A;  3EVV A;  5B8I B;  2JTT A;  4XYN A;  2M3W A;  2WC8 A;  2M9G A;  1RRO A;  1XVJ A;  4XJK A;  5AAN A;  2LMV A;  2EGD A;  4DS7 A;  1N2D A;  3DVK A;  1QVI Y;  2L50 A;  1NX0 A;  3TDI A;  1B8C A;  1YX7 A;  3VRQ A;  2KQY A;  3I5H B;  1B9A A;  1NX1 A;  2GGM A;  2KI4 C;  2FCD A;  1XYD A;  2KHN A;  4WQ3 A;  1S5G Y;  1UHN A;  2K2F A;  4CID A;  3KO0 A;  1SR6 C;  1GQM A;  3DF0 B;  3FWC A;  1C7V A;  3JVT B;  1SW8 A;  1CNP A;  4GNK B;  1B4C A;  5CSF A;  3O6B A;  1V1F A;  1DT7 B;  1CDM A;  1KFU S;  2JZI A;  3EVU A;  1QXP A;  2FCE A;  2PAL A;  1A2X A;  3CTN A;  5IBW A;  4HSZ A;  4NDD A;  4PHK A;  1IGV A;  3EK8 A;  1EH2 A;  3LK1 A;  5I2O A;  1S1E A;  1K2H A;  1KFX S;  1UUS A;  1QS7 A;  1IJ6 A;  1EXR A;  1LVC D;  1SCV A;  2WOR A;  1M39 A;  3SG7 A;  4GPL B;  3D0Y B;  4YGD B;  1D1O A;  2KYF A;  4I5J A;  2M7N A;  1K95 A;  1YVL A;  4YI9 A;  1CLB A;  2WCF A;  1IKU A;  2ZN9 A;  3SG2 A;  2L4I A;  3TUY C;  1F55 A;  1SY9 A;  2JUL A;  1FF1 A;  4XJK B;  2JRF A;  1W7J B;  1UWO A;  1SKT A;  1S6J A;  3QRX A;  1CFC A;  2O5G A;  1AHR A;  2KQ6 A;  4ORA B;  4CFQ A;  1NWD A;  1KSM A;  2DOQ A;  4C0J A;  5JOL A;  4CLN A;  1NCY A;  1KQM C;  4MLW A;  1M31 A;  1TN4 A;  2LVV A;  1KQM B;  1QIV A;  2BKI B;  1PVB A;  1MUX A;  1PUL A;  3AAJ A;  1MWN A;  1ZFS A;  4ORC B;  1XFZ O;  2MJW B;  3RLZ A;  2R2I A;  2MBX A;  1B8R A;  2KFG A;  1OE9 B;  1F4Q A;  1CB1 A;  1JUO A;  1WLM A;  1YRU B;  4DRW A;  2L0P A;  3I5F C;  3VRN A;  1BF5 A;  1KK7 Y;  3E3R A;  2WCB A;  3I5F B;  2EHB A;  4MZL A;  5HLO A;  1Y6W A;  1YUS A;  2IS9 A;  2B1U A;  4QJ5 B;  2LLU A;  2F33 A;  1CMG A;  1JFK A;  4JPZ B;  4ZCV A;  2M8U A;  3CR2 A;  5D69 A;  4DIR A;  3EKJ A;  4NQG A;  2Q91 A;  2GGZ A;  2MHH A;  4PCW A;  5CSJ A;  2OTG B;  4USL A;  1K93 D;  1IG5 A;  3BUX B;  1C07 A;  1KCY A;  3VRP A;  1XFX O;  3DVE A;  5F6T A;  1OQP A;  4GAO A;  1TNQ A;  2Q4U A;  2SCP A;  5I8N A;  3DF0 A;  2KBI A;  5CSN A;  2M49 B;  4R1E A;  2KGB C;  1LKJ A;  2LP3 A;  3KF9 A;  1CFP A;  1NX2 A;  2JXL A;  4N1F A;  4A4B A;  5KSZ A;  1K9K A;  2M1K B;  1OMR A;  1JFJ A;  1SBJ A;  1TCO B;  1TNX A;  1K9U A;  1TNP A;  1PRW A;  1YR5 A;  4YBH B;  1CFF A;  2Y5I A;  3WHU B;  1J7R A;  1DJX A;  1RWY A;  2JC2 A;  3A8R A;  3BYA A;  2KFH A;  1UHK A;  1BG1 A;  1B7T Z;  4GGF A;  5BPJ A;  4TNC A;  1A03 A;  4MZK A;  1F8H A;  1BT6 A;  1FW4 A;  1N65 A;  2F3Z A;  4M2O A;  4MRX A;  4IL1 A;  2BEC A;  4OV2 A;  2BBM A;  1DF0 B;  3SIB A;  1M45 A;  3C1V A;  1CMF A;  1DGV A;  4Q04 A;  1L7Z A;  4PHJ A;  3CGA A;  3TZ1 A;  2K2A A;  1OSA A;  3K21 A;  2PMY A;  1ALW A;  1BJF A;  1QVI Z;  2BE6 A;  1BR4 B;  4PE7 A;  1MR8 A;  1QAS A;  4CFR A;  1A29 A;  4PE1 A;  1DMO A;  5KU1 A;  4C0K A;  2BCA A;  1Y0V H;  2LLT A;  1FI6 A;  1Q80 A;  2KI6 C;  1JWD A;  4AOM A;  3I5H C;  3VGO A;  1TOP A;  1A75 A;  1J1D A;  1TNW A;  3IQQ A;  1J7P A;  2BKH B;  3TDU A;  4WQ2 A;  4C0L A;  3JVT C;  1TIZ A;  1GGW A;  1HT9 A;  2D8N A;  3EK7 A;  4OVN F;  3O2P A;  1IQ3 A;  4HRG A;  3AKA A;  2MLE C;  3I5G C;  1RJV A;  2MAZ A;  4N5X A;  5I2Q A;  3I5G B;  3BXK A;  4GBA A;  1SRA A;  3CS1 A;  4YGA A;  4PAL A;  4ETO A;  1SL8 A;  2RGI A;  3CR5 X;  1GGZ A;  3O78 A;  1EG3 A;  1SCM B;  2H61 C;  1DJW A;  3GK1 A;  4WRI A;  2FOT A;  3DD4 A;  5DKQ A;  1QX7 A;  2BCX A;  4GGF C;  1FI5 A;  1K94 A;  2LVK A;  2BBN A;  5DKN A;  4MN0 A;  4OCI A;  2K7D A;  2BE4 A;  2KYC A;  1UHJ A;  4OKH A;  3H4S E;  1DJI A;  1NCZ A;  1SL7 A;  1XA5 A;  1QV1 A;  5ER4 X;  2LNK A;  1AVS A;  4ICB A;  5JJG A;  3BUO B;  1HQV A;  2K0J A;  4HRH A;  1DGU A;  3CWG A;  2BL0 C;  2BCB A;  1ALV A;  2F8P A;  1Y1X A;  3SG6 A;  2BL0 B;  2CTN A;  1AJ4 A;  2CXJ A;  1MQ1 A;  2JTZ A;  2ZRT A;  1DJG A;  3WXA A;  4D1E A;  1BLQ A;  2F2P A;  1CM4 A;  1ODB A;  3BOW A;  1A75 B;  1K8U A;  3FS7 A;  3OX6 A;  1OOJ A;  4JWQ A;  2NLN A;  2K8M B;  1L2O B;  4FQO A;  1YUT A;  4OR9 B;  2ISD A;  5DKR A;  2NXQ A;  1KK7 Z;  1RFJ A;  1CLL A;  1B1G A;  1PSR A;  2ZNE A;  2LE9 B;  2JNF A;  2K7O A;  1DJZ A;  2Y4Q A;  3PAL A;  4I5L B;  1R2U A;  2KAV A;  3GK4 X;  1DF0 A;  4UPG A;  1G4Y R;  1CDP A;  3WHT B;  2L4H A;  4M2P A;  3OP0 A;  2LMU A;  3OB1 B;  2JQ6 A;  3GK2 A;  1NSH A;  2KAX A;  4NDB A;  2AAO A;  1Y1U A;  3GOF A;  1OMD A;  2OTG C;  5HLV A;  1QX2 A;  2M29 A;  3EVR A;  1JF0 A;  3BUN B;  1CKK A;  1X02 A;  2KGR A;  1K9P A;  2E30 A;  1WRK A;  2NZ0 A;  3HCM A;  2JT0 A;  4QJ3 B;  2LMT A;  4QJ4 B;  3PN7 C;  3TS5 C;  4AQI A;  2M7L A;  3PN7 B;  3SG3 A;  4A4C A;  1IJ5 A;  1CTR A;  3TS5 B;  1XK4 A;  2O60 A;  1OZS A;  3LL8 B;  4E68 A;  1PAL A;  2CNP A;  2LHL A;  1AK8 A;  4P2Y B;  4YGC B;  1AUI B;  2WCE A;  4ORB B;  3NSK A;  1SMG A;  1WLZ A;  2LP2 A;  4JQ0 D;  3SIA A;  1VRK A;  2PAS A;  3BOW B;  4M2Q A;  1SK6 D;  1Y1A A;  3EKH A;  2LVI A;  2KNE A;  4GFT A;  3KPX A;  1PK0 D;  1TCF A;  1YRT B;  2JOJ A;  3SG5 A;  2KAY A;  1JSA A;  1BOC A;  2G2B A;  2WOS A;  2LLS A;  4CPV A;  2KSP A;  3LLE A;  5TNC A;  4DUQ A;  5AER A;  1QV0 A;  1WRL A;  3JTD C;  1J1E A;  3JTD B;  1N0Y A;  2JU0 A;  1LIN A;  3PM8 A;  2PVB A;  1DVI A;  5K89 A;  3IQO A;  5GQQ C;  1NUB A;  1XFW O;  5FYX A;  1RTP 1;  1UHI A;  2V53 A;  1S5G Z;  4DCK A;  2F3Y A;  1R6P A;  2JT3 A;  2L51 A;  1SYM A;  2JWW A;  2M0R A;  4BY5 A;  5CSI A;  2GV5 A;  2LCP A;  1NP8 A;  1XK4 C;  2I94 A;  2OPO A;  4U8D A;  2AMI A;  4GGN A;  1E8A A;  1BU3 A;  2JNX A;  3EK4 A;  1NIW A;  2QAC A;  1JBA A;  4YRU A;  1IH0 A;  3AKB A;  1NX3 A;  2VRG A;  3I5I C;  4PE4 A;  1ZOT B;  1PSB A;  1BR1 B;  2EC6 C;  1A4P A;  3I5I B;  2EC6 B;  4P5O E;  3WNX B;  1QAT A;  2LAN A;  2KOT A;  3PSR A;  1SCM C;  5J3X A;  2CBL A;  1JC2 A;  1QJT A;  2MRD A;  4BY4 A;  1ZUZ A;  1KQV A;  4PE0 A;  5PAL A;  1U5I A;  2WND A;  2L98 A;  5I2L A;  3TDZ A;  1F4O A;  3BQ3 A;  2QPT A;  2MA2 A;  2I7A A;  1M46 A;  2KI4 B;  3NXA A;  4MRY A;  1CDN A;  2L2E A;  1XFY O;  1SR6 B;  1WDC C;  4MSP A; 
#chains in the Genus database with same CATH topology
 2LUX A;  1WY9 A;  1XFV O;  2NCO A;  3D75 A;  1MF8 B;  1MXE A;  1FBV A;  1WDC B;  2KBM A;  3F45 A;  1QTX A;  1F54 A;  1IWQ A;  1EL4 A;  2OS8 C;  2Y1N A;  1IQ5 A;  1ZMZ A;  5D3O A;  2OS8 B;  1MHO A;  1S3P A;  1J55 A;  1YVH A;  2HET A;  1W7I B;  2BNX A;  2H2K A;  2TN4 A;  3D10 A;  4FQT A;  2PYQ A;  1DTL A;  1QLK A;  1BMO A;  2JT8 A;  3IVT A;  1YTZ C;  3L4L A;  4F0Z B;  3RM1 A;  3O4X A;  3BUW B;  4NDC A;  3PLF B;  1L2O C;  5AEQ A;  3CYZ A;  1DJY A;  1NCX A;  1XO5 A;  5D7F A;  4PHM A;  1S6I A;  3NSL A;  3PFV A;  2LHI A;  1KK8 C;  1NYA A;  1MXL C;  2ZRS A;  1J7Q A;  1B47 A;  3LK0 A;  4YGB B;  3OGN A;  3ZNI A;  1KK8 B;  1UP5 A;  3KEV A;  1OZO A;  1V1G A;  3PAT A;  5ER5 A;  1LA3 A;  2COL B;  3CAB A;  2ZN8 A;  3AAK A;  3PM2 A;  3TUY B;  5FI2 A;  1TRF A;  3FE8 A;  5AXI A;  1H4B A;  4AQJ A;  5AFP A;  4PDZ A;  5G08 A;  1QIW A;  1LA0 A;  1U5I B;  1W9Z A;  4I5N B;  1K96 A;  1S6C A;  3DVM A;  1IRJ A;  1QX5 B;  2LVJ A;  2KLD A;  2NCP A;  1WRZ A;  3IF7 A;  4PHN A;  1S36 A;  4HRE E;  4L9M A;  2Y1M A;  3CR4 X;  1F70 A;  1CLM A;  2PRU A;  2M97 A;  3SG4 A;  3RZS A;  3NSO A;  3HX4 A;  1KFU L;  1C7W A;  2KI6 D;  1BOD A;  1OOH A;  1OOG A;  3CZT X;  1TUJ A;  2L5X B;  1REC A;  5FI6 A;  1AJ5 A;  4MBE A;  1F71 A;  2I18 A;  4YI8 A;  3CZ1 A;  4MZJ A;  2KFF A;  1CM1 A;  2SAS A;  1EJ3 A;  1TWO A;  1G8I A;  1TTX A;  1KFX L;  1QLS A;  2CCM A;  2F2O A;  2I2R E;  2KDH A;  2LUC A;  2ZFD A;  3CLN A;  1CFD A;  4ZCU A;  3VRR A;  2P6B B;  3BUM B;  5HKW A;  1SNL A;  1YUR A;  1UUR A;  1PVA A;  1OMV A;  1RK9 A;  5KTY A;  5DIC A;  4YGE B;  1CDL A;  3NHT A;  2LC5 A;  1J7O A;  2MLF C;  1S26 D;  1B8L A;  1G33 A;  1XFU O;  3DVJ A;  4FTG A;  3KHE A;  3R72 A;  3OX5 A;  2JPT A;  3OHM B;  2LV7 A;  1TUZ A;  4MEW A;  2M1U A;  3O4Y A;  1ORG A;  1KSO A;  1M63 B;  2A4J A;  1DJH A;  3M0W A;  2ZND A;  4F7F A;  1SL9 A;  2QEB A;  1YX8 A;  2L2C A;  2CT9 A;  3A4U B;  2HQW A;  5HKY A;  2LM5 A;  1EG4 A;  1NPQ A;  4I5K A;  5CPV A;  3VRO A;  3NSI A;  3PJI A;  2AUC A;  3FIA A;  5HKZ A;  2K7B A;  2H61 A;  2HQ8 A;  1JF2 A;  4GUK A;  2K7C A;  1YUU A;  2PSR A;  1UHH A;  3FWB A;  1FPW A;  3MSE B;  3OB2 B;  2HF5 A;  1K90 D;  2LAP A;  2ZKM X;  4MVF A;  1ZAC A;  3ZWH A;  2H8V A;  2HPS A;  3S0E A;  1T14 A;  1H8B A;  1B7T Y;  1SPY A;  1LXF C;  3SJS A;  3D0Y A;  3B7A A;  3LCP C;  4N1G A;  5HYD A;  2FJU B;  2E6W A;  2G9B A;  1KWO C;  2JXC A;  2K61 A;  3ICB A;  1GJY A;  1KWO B;  1AP4 A;  3EVV A;  5B8I B;  2JTT A;  4XYN A;  2QEV A;  2M3W A;  2WC8 A;  2M9G A;  1RRO A;  1XVJ A;  4XJK A;  5AAN A;  2LMV A;  2EGD A;  4DS7 A;  1N2D A;  3DVK A;  1QVI Y;  2L50 A;  1NX0 A;  3TDI A;  1B8C A;  1YX7 A;  2WCK A;  3VRQ A;  2KQY A;  3I5H B;  1B9A A;  1NX1 A;  2GGM A;  3S0G A;  2KI4 C;  2FCD A;  1XYD A;  2KHN A;  4WQ3 A;  1S5G Y;  1UHN A;  2K2F A;  3B86 A;  4CID A;  3KO0 A;  3BFH A;  1SR6 C;  1GQM A;  3BFA A;  3DF0 B;  3FWC A;  1C7V A;  3V2L A;  3R1V A;  3JVT B;  3R1P A;  1SW8 A;  1CNP A;  4GNK B;  1B4C A;  5CSF A;  3S0B A;  3R1O A;  3O6B A;  1V1F A;  1DT7 B;  1CDM A;  1KFU S;  2JZI A;  3EVU A;  1QXP A;  2FCE A;  2PAL A;  1A2X A;  1P28 A;  3CTN A;  3N7H A;  3OBV A;  5IBW A;  3BFB A;  4HSZ A;  4NDD A;  4PHK A;  1IGV A;  3EK8 A;  1EH2 A;  3LK1 A;  5I2O A;  1S1E A;  1K2H A;  1KFX S;  1UUS A;  1QS7 A;  3EG5 B;  1IJ6 A;  1EXR A;  1LVC D;  1SCV A;  2WOR A;  1M39 A;  3SG7 A;  5HL1 A;  4GPL B;  3D0Y B;  4YGD B;  1D1O A;  2KYF A;  4I5J A;  2M7N A;  1K95 A;  3SS3 A;  1YVL A;  4YI9 A;  1CLB A;  2WCF A;  1IKU A;  2ZN9 A;  3SG2 A;  2L4I A;  3TUY C;  1F55 A;  1SY9 A;  2JUL A;  1FF1 A;  1OOI X;  2YGU A;  4XJK B;  2JRF A;  1W7J B;  1UWO A;  1SKT A;  1S6J A;  3QRX A;  1CFC A;  2O5G A;  1AHR A;  2KQ6 A;  4ORA B;  4CFQ A;  1NWD A;  1KSM A;  2DOQ A;  4C0J A;  2PQL A;  5JOL A;  3S0D A;  4CLN A;  1NCY A;  4INW A;  1KQM C;  4MLW A;  1M31 A;  1TN4 A;  2LVV A;  3D76 A;  1KQM B;  1QIV A;  2BKI B;  1OOF A;  1PVB A;  3DXL A;  1MUX A;  3D77 A;  1PUL A;  3AAJ A;  1MWN A;  1ZFS A;  4ORC B;  1XFZ O;  2MJW B;  3RLZ A;  2R2I A;  2MBX A;  1B8R A;  1C3Y A;  2KFG A;  2K60 A;  1OE9 B;  1F4Q A;  1CB1 A;  1JUO A;  1WLM A;  1YRU B;  4DRW A;  2L0P A;  3I5F C;  3VRN A;  1BF5 A;  1KK7 Y;  3E3R A;  2WCB A;  3QME A;  3I5F B;  2P71 A;  3B6X A;  2EHB A;  4MZL A;  5HLO A;  1Y6W A;  1YUS A;  2IS9 A;  2B1U A;  4QJ5 B;  2LLU A;  2F33 A;  2WCM A;  1CMG A;  1JFK A;  4JPZ B;  2JPO A;  2M8U A;  3CR2 A;  5D69 A;  4ZCV A;  3SS5 A;  1C3Z A;  4DIR A;  3EKJ A;  4NQG A;  2Q91 A;  3FE9 A;  2GGZ A;  2MHH A;  4PCW A;  5CSJ A;  2OTG B;  4USL A;  1K93 D;  1IG5 A;  3BUX B;  1IIO A;  1C07 A;  1KCY A;  2BAP A;  3VRP A;  1XFX O;  3NHI A;  3DVE A;  5F6T A;  1OQP A;  3B87 A;  1TNQ A;  4GAO A;  2Q4U A;  2SCP A;  5I8N A;  3DF0 A;  2KBI A;  5CSN A;  2M49 B;  2KPH A;  4R1E A;  2KGB C;  1LKJ A;  2LP3 A;  3KF9 A;  1CFP A;  1NX2 A;  2JXL A;  4N1F A;  4A4B A;  5KSZ A;  1K9K A;  1DQE A;  2M1K B;  1OMR A;  1JFJ A;  1SBJ A;  1TCO B;  1TNX A;  1K9U A;  1TNP A;  1PRW A;  1YR5 A;  4YBH B;  1CFF A;  1QWV A;  2L5Y A;  2Y5I A;  3WHU B;  1J7R A;  1DJX A;  1RWY A;  2JC2 A;  3A8R A;  3BYA A;  2KFH A;  1UHK A;  1BG1 A;  1B7T Z;  4GGF A;  5BPJ A;  4TNC A;  1A03 A;  4MZK A;  1F8H A;  1BT6 A;  1FW4 A;  1N65 A;  3DZT A;  2F3Z A;  4M2O A;  4MRX A;  4IL1 A;  3K1E A;  2BEC A;  4OV2 A;  3UO9 A;  2BBM A;  3S0A A;  1DF0 B;  3SIB A;  1M45 A;  3C1V A;  1CMF A;  1DGV A;  4Q04 A;  1L7Z A;  4PHJ A;  3CGA A;  3TZ1 A;  2K2A A;  1OSA A;  3K21 A;  2PMY A;  1ALW A;  1BJF A;  1QVI Z;  2BE6 A;  1BR4 B;  4PE7 A;  1MR8 A;  1QAS A;  2FJY A;  4CFR A;  1A29 A;  4PE1 A;  2WCJ A;  1DMO A;  1DC1 A;  5KU1 A;  4C0K A;  2BCA A;  1Y0V H;  2LLT A;  3CZ0 A;  1Q80 A;  1Z4H A;  2KI6 C;  1FI6 A;  4AOM A;  3I5H C;  1JWD A;  3FE6 A;  3VGO A;  1TOP A;  1A75 A;  1J1D A;  2QDI A;  1TNW A;  3IQQ A;  1DEK A;  1J7P A;  2BKH B;  2KLE A;  4WQ2 A;  3TDU A;  3JVT C;  1TIZ A;  4C0L A;  1GGW A;  1HT9 A;  2D8N A;  3EK7 A;  4OVN F;  1DEL A;  3O2P A;  1IQ3 A;  4HRG A;  3AKA A;  2MLE C;  3I5G C;  4JKT A;  1RJV A;  2MAZ A;  4N5X A;  5I2Q A;  3I5G B;  3BXK A;  4GBA A;  1OW4 A;  1SRA A;  3CS1 A;  4YGA A;  4PAL A;  4ETO A;  1SL8 A;  2RGI A;  3CR5 X;  1GGZ A;  3O78 A;  1EG3 A;  1SCM B;  2H61 C;  1DJW A;  3GK1 A;  4WRI A;  2FOT A;  3DD4 A;  5DKQ A;  1QX7 A;  2BCX A;  4GGF C;  1FI5 A;  1K94 A;  2LVK A;  2BBN A;  1SSE B;  5DKN A;  4MN0 A;  4OCI A;  2K7D A;  2BE4 A;  2KYC A;  1UHJ A;  2WCH A;  4OKH A;  2WC5 A;  3H4S E;  1DJI A;  1NCZ A;  1SL7 A;  2QEO A;  1XA5 A;  1QV1 A;  5ER4 X;  3VB1 A;  2LNK A;  1AVS A;  4ICB A;  3CDN A;  5JJG A;  3BUO B;  1HQV A;  2K0J A;  4HRH A;  1DGU A;  3CWG A;  2BL0 C;  2BCB A;  1ALV A;  2F8P A;  1Y1X A;  3SG6 A;  2BL0 B;  2CTN A;  1AJ4 A;  2CXJ A;  1MQ1 A;  2JTZ A;  2ZRT A;  1DJG A;  3WXA A;  4D1E A;  1BLQ A;  3L47 A;  2F2P A;  1CM4 A;  1ODB A;  3BOW A;  1A75 B;  1K8U A;  3FS7 A;  3OX6 A;  1OOJ A;  4JWQ A;  2NLN A;  2K8M B;  1L2O B;  4FQO A;  1YUT A;  4OR9 B;  2ISD A;  3Q8I A;  5DKR A;  2NXQ A;  1KK7 Z;  2ERB A;  3D73 A;  1RFJ A;  1CLL A;  1B1G A;  1PSR A;  2ZNE A;  2LE9 B;  2JNF A;  2K7O A;  4JD9 A;  1DJZ A;  2WC6 A;  2Y4Q A;  3PAL A;  4I5L B;  1R2U A;  2KAV A;  3GK4 X;  4KYN A;  1DF0 A;  4UPG A;  1G4Y R;  1CDP A;  3WHT B;  2L4H A;  4M2P A;  3OP0 A;  2LMU A;  3OB1 B;  3SS4 A;  2JQ6 A;  4INX A;  3GK2 A;  1NSH A;  2KAX A;  4NDB A;  2AAO A;  1Y1U A;  3GOF A;  1OMD A;  5EL2 A;  2OTG C;  5HLV A;  1QX2 A;  2M29 A;  3EVR A;  1JF0 A;  3BUN B;  1CKK A;  1X02 A;  2KGR A;  1K9P A;  2E30 A;  1WRK A;  2NZ0 A;  3HCM A;  2JT0 A;  4QJ3 B;  2LMT A;  4PT1 A;  2P70 A;  3PN7 C;  3CZ2 A;  4QJ4 B;  3TS5 C;  4AQI A;  3L4A A;  3PN7 B;  2M7L A;  3SG3 A;  1IJ5 A;  3UNW A;  1CTR A;  3TS5 B;  4A4C A;  1XK4 A;  2O60 A;  3DY9 A;  1OZS A;  3BJH A;  3LL8 B;  1PAL A;  2CNP A;  2LHL A;  4E68 A;  4P2Y B;  1AK8 A;  4YGC B;  1AUI B;  1XFR A;  2WCE A;  4ORB B;  3NGV A;  3NSK A;  1SMG A;  3DYE A;  1WLZ A;  2LP2 A;  4OZD A;  3S0F A;  4JQ0 D;  3SIA A;  1VRK A;  2PAS A;  3BOW B;  4M2Q A;  1SK6 D;  1Y1A A;  3EKH A;  2LVI A;  1Z2C B;  5I94 A;  1GM0 A;  2KNE A;  3D74 A;  4GFT A;  3KPX A;  1PK0 D;  1TCF A;  1YRT B;  2JOJ A;  3SG5 A;  2KAY A;  1LS8 A;  1JSA A;  1BOC A;  2G2B A;  2WOS A;  2LLS A;  2GTE A;  4CPV A;  2KSP A;  3LLE A;  5TNC A;  4DUQ A;  5AER A;  1QV0 A;  3B88 A;  1WRL A;  3JTD C;  1J1E A;  3JTD B;  1N0Y A;  2JU0 A;  1LIN A;  3PM8 A;  2PVB A;  1DVI A;  5K89 A;  3IQO A;  5GQQ C;  1NUB A;  1XFW O;  4IJ7 A;  5FYX A;  1RTP 1;  1UHI A;  2V53 A;  1S5G Z;  4DCK A;  2F3Y A;  1R6P A;  2JT3 A;  2L51 A;  1SYM A;  2JWW A;  2M0R A;  4BY5 A;  5CSI A;  2QEH A;  2GV5 A;  2LCP A;  1NP8 A;  1XK4 C;  2I94 A;  2OPO A;  4U8D A;  2AMI A;  4GGN A;  1E8A A;  1BU3 A;  2JNX A;  3EK4 A;  1NIW A;  2QAC A;  1JBA A;  4YRU A;  1IH0 A;  3AKB A;  1NX3 A;  2VRG A;  3I5I C;  4PE4 A;  1ZOT B;  1PSB A;  1BR1 B;  2EC6 C;  1A4P A;  3I5I B;  5FI7 A;  2EC6 B;  4P5O E;  3WNX B;  1QAT A;  2LAN A;  2KOT A;  3D78 A;  1SCM C;  3PSR A;  2CBL A;  5J3X A;  1JC2 A;  1QJT A;  2MRD A;  2WCL A;  1ZUZ A;  4BY4 A;  1KQV A;  4PE0 A;  5PAL A;  1U5I A;  2WND A;  2L98 A;  5I2L A;  3TDZ A;  1F4O A;  3BQ3 A;  2QPT A;  2MA2 A;  2I7A A;  1M46 A;  2KI4 B;  3NXA A;  4MRY A;  1CDN A;  2L2E A;  1XFY O;  1SR6 B;  1WDC C;  4MSP A; 
#chains in the Genus database with same CATH homology
 2LUX A;  1WY9 A;  1XFV O;  2NCO A;  1MF8 B;  1MXE A;  1FBV A;  1WDC B;  2KBM A;  3F45 A;  1QTX A;  1F54 A;  1IWQ A;  1EL4 A;  2OS8 C;  2Y1N A;  1IQ5 A;  1ZMZ A;  2OS8 B;  1MHO A;  1S3P A;  1J55 A;  1YVH A;  2HET A;  1W7I B;  2H2K A;  2TN4 A;  3D10 A;  1DTL A;  1QLK A;  1BMO A;  2JT8 A;  1YTZ C;  4F0Z B;  3RM1 A;  3BUW B;  4NDC A;  3PLF B;  1L2O C;  5AEQ A;  1DJY A;  1NCX A;  1XO5 A;  5D7F A;  4PHM A;  1S6I A;  3NSL A;  3PFV A;  2LHI A;  1KK8 C;  1NYA A;  1MXL C;  2ZRS A;  1J7Q A;  1B47 A;  3LK0 A;  4YGB B;  3ZNI A;  1KK8 B;  1UP5 A;  3KEV A;  1OZO A;  1V1G A;  3PAT A;  5ER5 A;  1LA3 A;  2COL B;  2ZN8 A;  3AAK A;  3TUY B;  1TRF A;  5AXI A;  4AQJ A;  5AFP A;  4PDZ A;  5G08 A;  1QIW A;  1LA0 A;  1U5I B;  4I5N B;  1K96 A;  1S6C A;  3DVM A;  1IRJ A;  1QX5 B;  2LVJ A;  2NCP A;  1WRZ A;  3IF7 A;  4PHN A;  1S36 A;  4HRE E;  4L9M A;  2Y1M A;  3CR4 X;  1F70 A;  1CLM A;  2PRU A;  2M97 A;  3SG4 A;  3NSO A;  3HX4 A;  1KFU L;  1C7W A;  2KI6 D;  1BOD A;  3CZT X;  2L5X B;  1REC A;  1AJ5 A;  4MBE A;  1F71 A;  2I18 A;  4YI8 A;  4MZJ A;  2KFF A;  1CM1 A;  2SAS A;  1EJ3 A;  2CCM A;  1G8I A;  1TTX A;  1KFX L;  1QLS A;  2F2O A;  2I2R E;  2KDH A;  2LUC A;  2ZFD A;  3CLN A;  3VRR A;  1CFD A;  4ZCU A;  2P6B B;  3BUM B;  5HKW A;  1SNL A;  1YUR A;  1UUR A;  1PVA A;  1OMV A;  1RK9 A;  5KTY A;  4YGE B;  1CDL A;  1J7O A;  2LC5 A;  2MLF C;  1S26 D;  1B8L A;  1G33 A;  1XFU O;  3DVJ A;  4FTG A;  3KHE A;  3OX5 A;  2JPT A;  3OHM B;  2LV7 A;  4MEW A;  2M1U A;  3O4Y A;  1KSO A;  1M63 B;  2A4J A;  1DJH A;  3M0W A;  2ZND A;  1SL9 A;  1YX8 A;  2CT9 A;  3A4U B;  2HQW A;  5HKY A;  2LM5 A;  1EG4 A;  1NPQ A;  4I5K A;  5CPV A;  3VRO A;  3NSI A;  2AUC A;  3FIA A;  5HKZ A;  2K7B A;  2H61 A;  2HQ8 A;  1JF2 A;  4GUK A;  2K7C A;  1YUU A;  2PSR A;  1UHH A;  3FWB A;  1FPW A;  3MSE B;  3OB2 B;  2HF5 A;  1K90 D;  2LAP A;  2ZKM X;  4MVF A;  1ZAC A;  3ZWH A;  2HPS A;  1H8B A;  1B7T Y;  1SPY A;  1LXF C;  3SJS A;  3D0Y A;  4N1G A;  3LCP C;  1H4B A;  5HYD A;  2FJU B;  2E6W A;  2G9B A;  1KWO C;  2JXC A;  2K61 A;  3ICB A;  1GJY A;  1KWO B;  1AP4 A;  3EVV A;  5B8I B;  2JTT A;  4XYN A;  2M3W A;  2WC8 A;  2M9G A;  1RRO A;  1XVJ A;  4XJK A;  5AAN A;  2LMV A;  2EGD A;  4DS7 A;  1N2D A;  3DVK A;  1QVI Y;  2L50 A;  1NX0 A;  3TDI A;  1B8C A;  1YX7 A;  3VRQ A;  2KQY A;  3I5H B;  1B9A A;  1NX1 A;  2GGM A;  2KI4 C;  2FCD A;  1XYD A;  2KHN A;  4WQ3 A;  1S5G Y;  1UHN A;  2K2F A;  4CID A;  3KO0 A;  1SR6 C;  1GQM A;  3DF0 B;  3FWC A;  1C7V A;  3JVT B;  1SW8 A;  1CNP A;  4GNK B;  1B4C A;  5CSF A;  3O6B A;  1V1F A;  1DT7 B;  1CDM A;  1KFU S;  2JZI A;  3EVU A;  1QXP A;  2FCE A;  2PAL A;  1A2X A;  3CTN A;  5IBW A;  4HSZ A;  4NDD A;  4PHK A;  1IGV A;  3EK8 A;  1EH2 A;  3LK1 A;  5I2O A;  1S1E A;  1K2H A;  1KFX S;  1UUS A;  1QS7 A;  1IJ6 A;  1EXR A;  1LVC D;  1SCV A;  2WOR A;  1M39 A;  3SG7 A;  4GPL B;  3D0Y B;  4YGD B;  1D1O A;  2KYF A;  4I5J A;  2M7N A;  1K95 A;  1YVL A;  4YI9 A;  1CLB A;  2WCF A;  1IKU A;  2ZN9 A;  3SG2 A;  2L4I A;  3TUY C;  1F55 A;  1SY9 A;  2JUL A;  1FF1 A;  4XJK B;  2JRF A;  1W7J B;  1UWO A;  1SKT A;  1S6J A;  3QRX A;  1CFC A;  2O5G A;  1AHR A;  2KQ6 A;  4ORA B;  4CFQ A;  1NWD A;  1KSM A;  2DOQ A;  4C0J A;  5JOL A;  4CLN A;  1NCY A;  1KQM C;  4MLW A;  1M31 A;  1TN4 A;  2LVV A;  1KQM B;  1QIV A;  2BKI B;  1PVB A;  1MUX A;  1PUL A;  3AAJ A;  1MWN A;  1ZFS A;  4ORC B;  1XFZ O;  2MJW B;  3RLZ A;  2R2I A;  2MBX A;  1B8R A;  2KFG A;  1OE9 B;  1F4Q A;  1CB1 A;  1JUO A;  1WLM A;  1YRU B;  4DRW A;  2L0P A;  3I5F C;  3VRN A;  1BF5 A;  1KK7 Y;  3E3R A;  2WCB A;  3I5F B;  2EHB A;  4MZL A;  5HLO A;  1Y6W A;  1YUS A;  2IS9 A;  2B1U A;  4QJ5 B;  2LLU A;  2F33 A;  1CMG A;  1JFK A;  4JPZ B;  4ZCV A;  2M8U A;  3CR2 A;  5D69 A;  4DIR A;  3EKJ A;  4NQG A;  2Q91 A;  2GGZ A;  2MHH A;  4PCW A;  5CSJ A;  2OTG B;  4USL A;  1K93 D;  1IG5 A;  3BUX B;  1C07 A;  1KCY A;  3VRP A;  1XFX O;  3DVE A;  5F6T A;  1OQP A;  4GAO A;  1TNQ A;  2Q4U A;  2SCP A;  5I8N A;  3DF0 A;  2KBI A;  5CSN A;  2M49 B;  4R1E A;  2KGB C;  1LKJ A;  2LP3 A;  3KF9 A;  1CFP A;  1NX2 A;  2JXL A;  4N1F A;  4A4B A;  5KSZ A;  1K9K A;  2M1K B;  1OMR A;  1JFJ A;  1SBJ A;  1TCO B;  1TNX A;  1K9U A;  1TNP A;  1PRW A;  1YR5 A;  4YBH B;  1CFF A;  2Y5I A;  3WHU B;  1J7R A;  1DJX A;  1RWY A;  2JC2 A;  3A8R A;  3BYA A;  2KFH A;  1UHK A;  1BG1 A;  1B7T Z;  4GGF A;  5BPJ A;  4TNC A;  1A03 A;  4MZK A;  1F8H A;  1BT6 A;  1FW4 A;  1N65 A;  2F3Z A;  4M2O A;  4MRX A;  4IL1 A;  2BEC A;  4OV2 A;  2BBM A;  1DF0 B;  3SIB A;  1M45 A;  3C1V A;  1CMF A;  1DGV A;  4Q04 A;  1L7Z A;  4PHJ A;  3CGA A;  3TZ1 A;  2K2A A;  1OSA A;  3K21 A;  2PMY A;  1ALW A;  1BJF A;  1QVI Z;  2BE6 A;  1BR4 B;  4PE7 A;  1MR8 A;  1QAS A;  4CFR A;  1A29 A;  4PE1 A;  1DMO A;  5KU1 A;  4C0K A;  2BCA A;  1Y0V H;  2LLT A;  1FI6 A;  1Q80 A;  2KI6 C;  1JWD A;  4AOM A;  3I5H C;  3VGO A;  1TOP A;  1A75 A;  1J1D A;  1TNW A;  3IQQ A;  1J7P A;  2BKH B;  3TDU A;  4WQ2 A;  4C0L A;  3JVT C;  1TIZ A;  1GGW A;  1HT9 A;  2D8N A;  3EK7 A;  4OVN F;  3O2P A;  1IQ3 A;  4HRG A;  3AKA A;  2MLE C;  3I5G C;  1RJV A;  2MAZ A;  4N5X A;  5I2Q A;  3I5G B;  3BXK A;  4GBA A;  1SRA A;  3CS1 A;  4YGA A;  4PAL A;  4ETO A;  1SL8 A;  2RGI A;  3CR5 X;  1GGZ A;  3O78 A;  1EG3 A;  1SCM B;  2H61 C;  1DJW A;  3GK1 A;  4WRI A;  2FOT A;  3DD4 A;  5DKQ A;  1QX7 A;  2BCX A;  4GGF C;  1FI5 A;  1K94 A;  2LVK A;  2BBN A;  5DKN A;  4MN0 A;  4OCI A;  2K7D A;  2BE4 A;  2KYC A;  1UHJ A;  4OKH A;  3H4S E;  1DJI A;  1NCZ A;  1SL7 A;  1XA5 A;  1QV1 A;  5ER4 X;  2LNK A;  1AVS A;  4ICB A;  5JJG A;  3BUO B;  1HQV A;  2K0J A;  4HRH A;  1DGU A;  3CWG A;  2BL0 C;  2BCB A;  1ALV A;  2F8P A;  1Y1X A;  3SG6 A;  2BL0 B;  2CTN A;  1AJ4 A;  2CXJ A;  1MQ1 A;  2JTZ A;  2ZRT A;  1DJG A;  3WXA A;  4D1E A;  1BLQ A;  2F2P A;  1CM4 A;  1ODB A;  3BOW A;  1A75 B;  1K8U A;  3FS7 A;  3OX6 A;  1OOJ A;  4JWQ A;  2NLN A;  2K8M B;  1L2O B;  4FQO A;  1YUT A;  4OR9 B;  2ISD A;  5DKR A;  2NXQ A;  1KK7 Z;  1RFJ A;  1CLL A;  1B1G A;  1PSR A;  2ZNE A;  2LE9 B;  2JNF A;  2K7O A;  1DJZ A;  2Y4Q A;  3PAL A;  4I5L B;  1R2U A;  2KAV A;  3GK4 X;  1DF0 A;  4UPG A;  1G4Y R;  1CDP A;  3WHT B;  2L4H A;  4M2P A;  3OP0 A;  2LMU A;  3OB1 B;  2JQ6 A;  3GK2 A;  1NSH A;  2KAX A;  4NDB A;  2AAO A;  1Y1U A;  3GOF A;  1OMD A;  2OTG C;  5HLV A;  1QX2 A;  2M29 A;  3EVR A;  1JF0 A;  3BUN B;  1CKK A;  1X02 A;  2KGR A;  1K9P A;  2E30 A;  1WRK A;  2NZ0 A;  3HCM A;  2JT0 A;  4QJ3 B;  2LMT A;  4QJ4 B;  3PN7 C;  3TS5 C;  4AQI A;  2M7L A;  3PN7 B;  3SG3 A;  4A4C A;  1IJ5 A;  1CTR A;  3TS5 B;  1XK4 A;  2O60 A;  1OZS A;  3LL8 B;  4E68 A;  1PAL A;  2CNP A;  2LHL A;  1AK8 A;  4P2Y B;  4YGC B;  1AUI B;  2WCE A;  4ORB B;  3NSK A;  1SMG A;  1WLZ A;  2LP2 A;  4JQ0 D;  3SIA A;  1VRK A;  2PAS A;  3BOW B;  4M2Q A;  1SK6 D;  1Y1A A;  3EKH A;  2LVI A;  2KNE A;  4GFT A;  3KPX A;  1PK0 D;  1TCF A;  1YRT B;  2JOJ A;  3SG5 A;  2KAY A;  1JSA A;  1BOC A;  2G2B A;  2WOS A;  2LLS A;  4CPV A;  2KSP A;  3LLE A;  5TNC A;  4DUQ A;  5AER A;  1QV0 A;  1WRL A;  3JTD C;  1J1E A;  3JTD B;  1N0Y A;  2JU0 A;  1LIN A;  3PM8 A;  2PVB A;  1DVI A;  5K89 A;  3IQO A;  5GQQ C;  1NUB A;  1XFW O;  5FYX A;  1RTP 1;  1UHI A;  2V53 A;  1S5G Z;  4DCK A;  2F3Y A;  1R6P A;  2JT3 A;  2L51 A;  1SYM A;  2JWW A;  2M0R A;  4BY5 A;  5CSI A;  2GV5 A;  2LCP A;  1NP8 A;  1XK4 C;  2I94 A;  2OPO A;  4U8D A;  2AMI A;  4GGN A;  1E8A A;  1BU3 A;  2JNX A;  3EK4 A;  1NIW A;  2QAC A;  1JBA A;  4YRU A;  1IH0 A;  3AKB A;  1NX3 A;  2VRG A;  3I5I C;  4PE4 A;  1ZOT B;  1PSB A;  1BR1 B;  2EC6 C;  1A4P A;  3I5I B;  2EC6 B;  4P5O E;  3WNX B;  1QAT A;  2LAN A;  2KOT A;  3PSR A;  1SCM C;  5J3X A;  2CBL A;  1JC2 A;  1QJT A;  2MRD A;  4BY4 A;  1ZUZ A;  1KQV A;  4PE0 A;  5PAL A;  1U5I A;  2WND A;  2L98 A;  5I2L A;  3TDZ A;  1F4O A;  3BQ3 A;  2QPT A;  2MA2 A;  2I7A A;  1M46 A;  2KI4 B;  3NXA A;  4MRY A;  1CDN A;  2L2E A;  1XFY O;  1SR6 B;  1WDC C;  4MSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...