1L7ZA

Crystal structure of ca2+/calmodulin complexed with myristoylated cap-23/nap-22 peptide
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
144
structure length
142
Chain Sequence
QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALMODULIN
publication title Crystal structure of a myristoylated CAP-23/NAP-22 N-terminal domain complexed with Ca2+/calmodulin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein/protein binding
total genus 55
structure length 142
sequence length 144
ec nomenclature
pdb deposition date 2002-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1l7zA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1l7zA02
1OMDA 4CFQA 4FQOA 1W7IB 1V1GA 1R2UA 1S5GZ 1NSHA 5JJGA 4MRXA 3DVKA 1QIWA 1JUOA 1EG3A 1IRJA 4ORCB 2H2KA 2FCEA 1KQMC 1TN4A 4OR9B 1K94A 2GGMA 2FCDA 1BR4B 2OS8C 1SCMC 2M29A 4NDDA 2LUXA 3JTDC 1J7OA 3AKBA 1DJYA 3FWCA 4D1EA 1SR6B 1WRLA 3BUNB 1A75B 2BCAA 1NYAA 2RGIA 1TOPA 1SL7A 2MBXA 1DT7B 2VRGA 5KU1A 1OZOA 1B7TZ 1M46A 5KTYA 3HCMA 2LLTA 1HT9A 2F8PA 4GPLB 2AUCA 4CFRA 1MWNA 3E3RA 3KHEA 4MZKA 1CLBA 5DKNA 2F3YA 2KBIA 2HF5A 1WDCB 1F55A 1LA0A 1BR1B 1K2HA 1X02A 4YBHB 1FF1A 3TUYB 2G2BA 4PHJA 2KOTA 2WCBA 2JRFA 3I5HB 2Y1MA 5AANA 2ISDA 1BODA 1SCVA 2D8NA 4CLNA 5CPVA 5I8NA 1L7ZA 4DRWA 1F4OA 2L98A 3DVJA 2K61A 3PFVA 1MR8A 3LK0A 4PDZA 3TDZA 2ZRSA 2P6BB 3PN7C 1MXEA 1F4QA 1B8RA 1SBJA 3KF9A 2M9GA 3PM8A 2BBNA 1DJXA 1C7WA 4BY5A 3D0YA 4I5NB 5I2LA 1SMGA 3VROA 1K9KA 1K8UA 1A2XA 1PK0D 1W7JB 2CTNA 1IJ5A 4MSPA 4NQGA 2KI4C 1CKKA 5AXIA 2WNDA 2JT8A 1SY9A 1KCYA 5DKRA 2LLSA 1XA5A 1NUBA 2PASA 3BYAA 1NPQA 3OHMB 4MBEA 4P5OE 1B1GA 5CSIA 1QS7A 1EL4A 3AAJA 1BF5A 1YVHA 1AUIB 3I5FB 1JFKA 4N1GA 2JTZA 1CMGA 1N65A 1YX7A 1TRFA 1ZACA 2AMIA 3BUMB 1IJ6A 1EH2A 1S26D 2HQWA 2JZIA 4HRHA 2BE4A 2Y4QA 4WQ3A 3I5GB 3TDIA 3GK2A 3PATA 1SRAA 4ORAB 4WQ2A 1GGWA 1JC2A 1PVBA 2K2FA 1CM4A 3VRNA 2B1UA 5HKZA 3CLNA 2LP3A 2KNEA 2EC6C 1SPYA 4HRGA 1KWOC 3NSLA 4MZLA 2WCEA 1LA3A 4PHKA 3O2PA 2JC2A 4ZCUA 4PE4A 2NLNA 3JVTB 4M2OA 4YI9A 1S6IA 1RFJA 1QTXA 2OTGB 3FS7A 3IQOA 4DCKA 5HKYA 4L9MA 1MQ1A 3BUWB 1WLMA 4GNKB 2KQYA 1M45A 3VGOA 4ZCVA 2KAVA 1FBVA 3BQ3A 4ETOA 3ZWHA 2I7AA 2L5XB 1DJGA 1ZUZA 3PALA 3SIAA 5KSZA 5HLVA 2LE9B 2OPOA 1Y1XA 1KSOA 1H8BA 1IQ5A 3MSEB 1QX5B 1DVIA 3GK1A 2EGDA 2HPSA 1FI5A 4MEWA 3SG5A 2ZN8A 2SASA 1UUSA 2BL0C 1WRZA 2SCPA 1B8LA 1DGUA 1ALWA 1YRTB 2NCPA 2LP2A 3EKJA 5G08A 5IBWA 2LHIA 1WRKA 4XJKA 3A8RA 3GK4X 4CIDA 1QX7A 2AAOA 2O60A 1D1OA 1Y1AA 1ZOTB 5D7FA 1E8AA 1N2DA 1H4BA 1A03A 2ZRTA 1BT6A 5JOLA 1AJ5A 3NSIA 1CNPA 2CNPA 2L4HA 3WNXB 1F54A 3SG4A 3CGAA 2MAZA 1GQMA 2JNXA 3KEVA 1YUUA 3AKAA 1SW8A 3LCPC 1LVCD 1QLSA 2BCBA 1S3PA 1LXFC 2L50A 1S36A 5DKQA 1CB1A 1S1EA 1OSAA 4GAOA 4ORBB 5K89A 4TNCA 2LAPA 3WHTB 1M63B 4JWQA 1VRKA 1SKTA 2JQ6A 2V53A 3KPXA 1NX1A 4I5JA 2O5GA 1YVLA 4YI8A 2JOJA 2ZKMX 1XFWO 1R6PA 1TNQA 1U5IB 1XFZO 2Y5IA 2NZ0A 1F8HA 1QV0A 1UHIA 1Y1UA 3D0YB 1RECA 1OMVA 2LMVA 1KK7Y 1KQVA 3I5IC 2KQ6A 1L2OC 4MRYA 4DUQA 4OKHA 3TDUA 4R1EA 5AFPA 3CR2A 3OB2B 1QATA 2LANA 1K90D 1K93D 1QIVA 4PHMA 5B8IB 5I2OA 5PALA 1MHOA 3RM1A 3EKHA 2KAYA 2KI6C 2F33A 3DF0B 4ICBA 1MF8B 4GFTA 1B47A 1Q80A 4C0JA 4PE7A 2E6WA 1J7QA 1CLMA 1CTRA 5BPJA 1GGZA 1KK8B 2MLEC 3ICBA 1DJIA 5ER5A 4OVNF 2JNFA 4YGDB 4FTGA 1KK7Z 1CDNA 3LLEA 4M2QA 2M7LA 1MXLC 1IWQA 2COLB 2M3WA 3NSOA 1QASA 1CFCA 1G33A 1KSMA 2K0JA 2NXQA 1B4CA 2M49B 1QV1A 1SR6C 1IKUA 1FW4A 1EG4A 1PRWA 2BE6A 1KQMB 4MVFA 2KFHA 3CR5X 4AQJA 2CCMA 4P2YB 5GQQC 2OS8B 3PLFB 1AP4A 1SCMB 1SK6D 1KFXL 4Q04A 4HSZA 1S6JA 3CWGA 3JTDB 2MA2A 1DF0B 5CSFA 1FPWA 1WDCC 1LKJA 1Y6WA 3OP0A 4PCWA 4YGAA 3TUYC 1TTXA 1NIWA 2CXJA 3SJSA 1CFFA 2PALA 1UWOA 2KGBC 3I5HC 1IG5A 5F6TA 4U8DA 1UP5A 3O6BA 2PMYA 3DD4A 2CT9A 2I94A 2WC8A 3BUOB 3DVMA 1YRUB 2JTTA 1RROA 2QACA 2TN4A 2A4JA 4WRIA 3LK1A 3BOWA 3SG2A 1CMFA 3OB1B 2M0RA 3SG6A 2HETA 4YGCB 1F71A 4MLWA 1QJTA 1ODBA 1BG1A 3CTNA 3IQQA 3HX4A 1TIZA 1CFDA 1HQVA 1YR5A 3EK7A 1A4PA 1J55A 2F3ZA 4JQ0D 4AOMA 2L0PA 1ALVA 2JT3A 1YUTA 2JU0A 1S6CA 1B8CA 2K7CA 3TS5B 4XJKB 2G9BA 1XFXO 5CSJA 2PRUA 1KFUL 2ZFDA 2BBMA 4GBAA 3K21A 2MLFC 1ZFSA 3PN7B 2L4IA 3O4YA 2KFFA 2MRDA 4UPGA 1DTLA 3NXAA 1NP8A 1BOCA 4CPVA 5HYDA 2DOQA 1WLZA 4N5XA 1QX2A 1CM1A 2H61A 5I2QA 4GGFC 1TCOB 5HKWA 2HQ8A 5AEQA 2BKHB 2K7OA 2LNKA 1J1DA 1AVSA 3I5FC 4QJ3B 1OZSA 2LVIA 1OE9B 1CLLA 2M7NA 4HREE 3H4SE 2BCXA 2WORA 2K8MB 4YGBB 1DGVA 1DJZA 1OMRA 3I5GC 2EHBA 1TNPA 1JF0A 2ZN9A 1PULA 2JXCA 3DVEA 1NCYA 2KSPA 2LM5A 4GGNA 1IGVA 1UHKA 2KBMA 4PE1A 2E30A 1J1EA 1IH0A 3C1VA 3VRPA 3IF7A 3EK8A 3GOFA 4A4BA 1QLKA 3CS1A 1J7PA 2I2RE 1XO5A 1NX3A 3FIAA 1GJYA 2IS9A 3JVTC 5J3XA 1YURA 4I5KA 2H61C 2KDHA 2OTGC 2BECA 3QRXA 2KI6D 3F45A 2EC6B 3OX5A 1RTP1 1KWOB 2LC5A 1AK8A 1XFYO 5TNCA 1G8IA 1K95A 1ZMZA 4AQIA 4MN0A 1A75A 2WCFA 2M1UA 2K7BA 1BMOA 2MHHA 1CFPA 5ER4X 2M1KB 1SL8A 2Q4UA 3TZ1A 2LMTA 4XYNA 2NCOA 1IQ3A 3SIBA 1JWDA 4OCIA 2K2AA 2LV7A 3WXAA 1KFXS 3FWBA 2L51A 3TS5C 4MZJA 1QVIY 3PSRA 1YX8A 2I18A 1OOJA 1TNWA 4PALA 1EJ3A 1XVJA 2JT0A 2Y1NA 4BY4A 1NWDA 4A4CA 1U5IA 1DJWA 1SNLA 2PVBA 1SL9A 1V1FA 1XFUO 2LMUA 1OQPA 1QXPA 2WOSA 1BJFA 4M2PA 3CZTX 1MUXA 2GGZA 3OX6A 4PHNA 4JPZB 2MJWB 4GUKA 1XYDA 3D10A 1JF2A 5D69A 1PSBA 1UHNA 4IL1A 1G4YR 2BL0B 5CSNA 1CDPA 1WY9A 3NSKA 2KYCA 4E68A 4I5LB 1QVIZ 3AAKA 3DF0A 1NCZA 1M31A 1YTZC 3M0WA 2ZNDA 1NCXA 1AJ4A 1XFVO 2FJUB 2LVVA 1K96A 3ZNIA 3O78A 1BLQA 4NDCA 5FYXA 1UHHA 5HLOA 1KFUS 4DIRA 4USLA 1JBAA 1K9UA 4C0KA 3BOWB 2K7DA 1CDLA 2Q91A 1XK4A 4DS7A 3BUXB 1M39A 1PVAA 1UURA 1DMOA 1F70A 4GGFA 1LINA 2FOTA 1SYMA 4NDBA 1RK9A 1TNXA 2LHLA 3RLZA 1FI6A 3A4UB 1CDMA 1K9PA 1UHJA 2LUCA 2R2IA 3CR4X 2KYFA 4C0LA 2PSRA 3LL8B 1TCFA 2JPTA 3SG7A 1JFJA 3EK4A 4PE0A 1N0YA 2GV5A 2LVJA 2BKIB 2LVKA 3BXKA 5AERA 1YUSA 2CBLA 2M8UA 2QPTA 3EVVA 3EVRA 2KAXA 4YGEB 1B9AA 2KHNA 1S5GY 1PALA 4F0ZB 3SG3A 2LLUA 3I5IB 1AHRA 1L2OB 3VRQA 2LCPA 2M97A 3EVUA 4N1FA 3WHUB 1JSAA 2F2PA 1DF0A 1EXRA 2KFGA 2JWWA 2KGRA 2ZNEA 1KK8C 1C07A 4QJ5B 4OV2A 1DJHA 1RJVA 1NX2A 1RWYA 2F2OA 1XK4C 3KO0A 2JXLA 1Y0VH 1NX0A 2L2EA 1A29A 1J7RA 4QJ4B 1PSRA 2KI4B 1BU3A 4YRUA 1C7VA 1B7TY 3VRRA 2JULA
chains in the Genus database with same CATH superfamily
1W9ZA 1OMDA 4CFQA 4FQOA 1W7IB 1V1GA 1R2UA 3R72A 5HL1A 1S5GZ 1NSHA 3B6XA 5JJGA 4MRXA 3DVKA 1QIWA 1JUOA 1EG3A 1IRJA 4ORCB 2H2KA 2FCEA 3R1PA 1KQMC 1TN4A 4OR9B 1K94A 2GGMA 2FCDA 1BR4B 2OS8C 1SCMC 2M29A 1LS8A 4IJ7A 4NDDA 1TUJA 2LUXA 3UO9A 3JTDC 1J7OA 3AKBA 1DJYA 1TWOA 1OOGA 1SR6B 1WRLA 3FWCA 3BUNB 1A75B 2BCAA 4D1EA 1NYAA 2RGIA 1TOPA 1SL7A 2MBXA 1DT7B 2VRGA 4INWA 1OZOA 1B7TZ 1M46A 5KU1A 5KTYA 3HCMA 2LLTA 1HT9A 2F8PA 4GPLB 3S0EA 1C3ZA 2AUCA 1OOIX 4CFRA 1DELA 1MWNA 3E3RA 3KHEA 4MZKA 1CLBA 5DKNA 2F3YA 2KBIA 2HF5A 1WDCB 1F55A 1LA0A 1BR1B 3EG5B 1X02A 4YBHB 1FF1A 1K2HA 4JKTA 3TUYB 2G2BA 4PHJA 2KOTA 2WCBA 2JRFA 3I5HB 2Y1MA 5AANA 2ISDA 1BODA 1SCVA 2D8NA 4CLNA 5CPVA 5I8NA 1L7ZA 4DRWA 1F4OA 2L98A 3DVJA 2K61A 3PFVA 1MR8A 3LK0A 4PDZA 2ERBA 3TDZA 2ZRSA 3Q8IA 2P6BB 3PN7C 1MXEA 3BFHA 1F4QA 1B8RA 1SBJA 3KF9A 2M9GA 3PM8A 2BBNA 1DJXA 1C7WA 4BY5A 3D0YA 4I5NB 5I2LA 1SMGA 3VROA 1K9KA 3V2LA 2L2CA 1K8UA 1A2XA 1PK0D 1W7JB 2CTNA 1IJ5A 4MSPA 4NQGA 2KI4C 1CKKA 5AXIA 2WNDA 2JT8A 5EL2A 1SY9A 1KCYA 5DKRA 2LLSA 3RZSA 1XA5A 1NUBA 2PASA 3BYAA 1NPQA 3OHMB 4MBEA 4P5OE 2WCMA 3DYEA 1B1GA 5CSIA 1QS7A 1EL4A 3AAJA 1BF5A 1YVHA 1AUIB 2L5YA 3I5FB 1JFKA 4N1GA 2JTZA 1CMGA 1N65A 1YX7A 1TRFA 1ZACA 2AMIA 3BUMB 1IJ6A 1EH2A 3CZ0A 1S26D 2HQWA 2JZIA 4HRHA 2BE4A 2Y4QA 4WQ3A 3I5GB 3TDIA 3GK2A 3PATA 1SRAA 4ORAB 4WQ2A 5DICA 1JC2A 1GGWA 1PVBA 2K2FA 1CM4A 3VRNA 2B1UA 5HKZA 3CLNA 1DC1A 2LP3A 2KNEA 2EC6C 1SPYA 3CYZA 4HRGA 2GTEA 1KWOC 3NSLA 3D75A 3K1EA 4MZLA 2WCEA 1LA3A 4PHKA 3O2PA 2JC2A 4ZCUA 3DZTA 4PE4A 2NLNA 3D78A 3JVTB 3B88A 3BFAA 4M2OA 1S6IA 4YI9A 1OOFA 1QTXA 1RFJA 2OTGB 3FS7A 3IQOA 2WCKA 3IVTA 4DCKA 5HKYA 3D77A 4L9MA 3L47A 1MQ1A 3BUWB 1WLMA 4GNKB 2KQYA 1M45A 3VGOA 5I94A 4ZCVA 4KYNA 2KAVA 1FBVA 3BQ3A 4ETOA 3ZWHA 2I7AA 2L5XB 1DJGA 1ZUZA 3PALA 3SIAA 5KSZA 3QMEA 2JPOA 5HLVA 2LE9B 2OPOA 3B86A 1Y1XA 1KSOA 1H8BA 1IQ5A 3MSEB 1QX5B 1DVIA 3GK1A 5D3OA 3CDNA 2EGDA 3S0GA 2HPSA 1FI5A 4MEWA 3SG5A 2PYQA 2SASA 1UUSA 2ZN8A 3O4XA 2BL0C 1WRZA 4FQTA 2SCPA 1B8LA 1DGUA 1ALWA 1YRTB 2NCPA 2LP2A 3EKJA 5G08A 5IBWA 2WC5A 2LHIA 1WRKA 4XJKA 3A8RA 3GK4X 4CIDA 1QX7A 2AAOA 2O60A 1D1OA 1Y1AA 1ZOTB 2QEVA 5D7FA 1E8AA 1N2DA 1H4BA 1A03A 2BNXA 2ZRTA 1BT6A 4PT1A 1TUZA 5JOLA 1AJ5A 3NSIA 1CNPA 2CNPA 2L4HA 3WNXB 1F54A 3SG4A 3CGAA 2MAZA 1GQMA 2JNXA 3KEVA 1YUUA 3AKAA 1SW8A 3SS5A 3LCPC 3CZ2A 1LVCD 1QLSA 2BCBA 1S3PA 1LXFC 2L50A 1S36A 2P71A 5DKQA 1S1EA 1OSAA 4GAOA 4ORBB 1CB1A 5K89A 4TNCA 2LAPA 3WHTB 4F7FA 1M63B 4JWQA 1VRKA 1SKTA 2JQ6A 2V53A 3KPXA 1NX1A 4I5JA 2O5GA 3OGNA 1YVLA 4YI8A 2JOJA 2ZKMX 1XFWO 1R6PA 1TNQA 1U5IB 1XFZO 1ORGA 2Y5IA 2NZ0A 1F8HA 1QV0A 1UHIA 1Y1UA 3D0YB 5FI2A 1RECA 1OMVA 2LMVA 1KK7Y 1KQVA 3I5IC 2KQ6A 1L2OC 3CZ1A 4MRYA 4DUQA 4OKHA 3TDUA 4R1EA 5AFPA 3CR2A 3OB2B 1QATA 3CABA 2LANA 1K90D 1Z2CB 3S0AA 1K93D 1QIVA 4PHMA 5B8IB 5I2OA 5PALA 1MHOA 3RM1A 3EKHA 2KAYA 2KI6C 2F33A 3DF0B 4ICBA 1MF8B 4GFTA 1B47A 1Q80A 4C0JA 4PE7A 2E6WA 1J7QA 1CLMA 1CTRA 5BPJA 1GGZA 1KK8B 2MLEC 3ICBA 3FE9A 1DJIA 5ER5A 4OVNF 2JNFA 4YGDB 4FTGA 1KK7Z 1CDNA 3LLEA 4M2QA 2M7LA 1MXLC 1IWQA 3DXLA 2COLB 2M3WA 5FI7A 3NSOA 1QASA 1CFCA 1G33A 2BAPA 1KSMA 2K0JA 2NXQA 1B4CA 2M49B 3PJIA 1QV1A 1GM0A 1SR6C 1IKUA 3S0DA 1FW4A 1EG4A 1PRWA 3DY9A 3N7HA 2BE6A 1KQMB 4MVFA 2KFHA 3CR5X 4AQJA 2CCMA 2QEBA 4P2YB 5GQQC 2OS8B 3L4LA 3BJHA 1OOHA 1SCMB 1SK6D 3PLFB 1KFXL 4Q04A 1AP4A 4HSZA 1S6JA 3CWGA 3JTDB 2MA2A 1DF0B 5CSFA 1FPWA 1WDCC 1LKJA 1Y6WA 3OP0A 4PCWA 4YGAA 2QEOA 3S0FA 1TTXA 3TUYC 1NIWA 2CXJA 3S0BA 3SJSA 1CFFA 2PALA 1UWOA 2KGBC 3I5HC 1IG5A 5F6TA 4U8DA 1UP5A 3O6BA 2PMYA 3DD4A 2CT9A 3SS4A 2I94A 2WC8A 3BUOB 3DVMA 1YRUB 3R1OA 2JTTA 1RROA 2QACA 2TN4A 2A4JA 4WRIA 3LK1A 3BOWA 3SG2A 1CMFA 3OB1B 2M0RA 3SG6A 2HETA 4YGCB 1F71A 4MLWA 1QJTA 1ODBA 1BG1A 3CTNA 3IQQA 3HX4A 1TIZA 1CFDA 1HQVA 3UNWA 1YR5A 3EK7A 1A4PA 1J55A 2F3ZA 2QDIA 4JQ0D 4AOMA 2L0PA 1ALVA 2JT3A 1YUTA 2JU0A 1S6CA 1B8CA 2K7CA 3TS5B 4XJKB 2G9BA 1XFXO 5CSJA 2PRUA 1KFUL 2ZFDA 2BBMA 4GBAA 3K21A 2MLFC 1ZFSA 3PN7B 2L4IA 3O4YA 2KFFA 2MRDA 4UPGA 1DTLA 3NXAA 1NP8A 2PQLA 4CPVA 1BOCA 5HYDA 2DOQA 1WLZA 2WC6A 4N5XA 1QX2A 3D73A 1SSEB 1CM1A 2H61A 5I2QA 2P70A 1TCOB 4GGFC 2HQ8A 5HKWA 5AEQA 2BKHB 2K7OA 2LNKA 1J1DA 1AVSA 3I5FC 4QJ3B 1OZSA 2LVIA 1OE9B 1CLLA 2M7NA 4HREE 3H4SE 2K60A 2BCXA 2KPHA 2WORA 2K8MB 4YGBB 1DGVA 1P28A 1DJZA 1OMRA 2KLDA 3I5GC 2EHBA 1TNPA 1JF0A 2FJYA 2ZN9A 1PULA 2JXCA 3DVEA 1NCYA 2KSPA 2LM5A 4GGNA 1IGVA 1UHKA 2KBMA 1C3YA 4PE1A 2E30A 1J1EA 1IH0A 3C1VA 3VRPA 3IF7A 3EK8A 3GOFA 4A4BA 1QLKA 3CS1A 1J7PA 2I2RE 2WCJA 1XO5A 1NX3A 3FIAA 1GJYA 2IS9A 3JVTC 5J3XA 1YURA 3BFBA 4I5KA 2H61C 2KDHA 2OTGC 2BECA 3QRXA 2KI6D 3F45A 2EC6B 3OX5A 1RTP1 1KWOB 2LC5A 1AK8A 1XFYO 5TNCA 1G8IA 1K95A 3VB1A 1ZMZA 4AQIA 4MN0A 1A75A 2WCFA 2M1UA 3NGVA 2K7BA 1BMOA 2MHHA 1DEKA 1CFPA 5ER4X 2M1KB 1IIOA 1SL8A 2Q4UA 3TZ1A 2LMTA 5FI6A 4XYNA 2NCOA 1IQ3A 3SIBA 1DQEA 4OCIA 2K2AA 1JWDA 2LV7A 4OZDA 3WXAA 1KFXS 3FWBA 2L51A 3TS5C 4MZJA 1QVIY 3PSRA 1YX8A 4C0LA 1OW4A 2I18A 1OOJA 1TNWA 4PALA 1EJ3A 1XVJA 2JT0A 2Y1NA 4BY4A 1NWDA 4A4CA 1QWVA 4JD9A 3NHTA 1U5IA 1DJWA 1SNLA 2PVBA 1SL9A 1V1FA 1XFUO 2LMUA 1OQPA 1QXPA 2WOSA 1BJFA 4M2PA 3CZTX 1MUXA 2GGZA 3OX6A 4PHNA 4JPZB 3D76A 2QEHA 2MJWB 3R1VA 4GUKA 1XYDA 3D10A 1JF2A 1Z4HA 5D69A 1PSBA 1UHNA 4IL1A 1G4YR 2BL0B 1T14A 3FE8A 5CSNA 1CDPA 1WY9A 3NSKA 2KYCA 4E68A 4I5LB 1QVIZ 3L4AA 3AAKA 3DF0A 1NCZA 1M31A 1YTZC 3M0WA 2ZNDA 1NCXA 1AJ4A 1XFVO 2FJUB 2LVVA 1K96A 3ZNIA 3O78A 1BLQA 4NDCA 5FYXA 2KLEA 1UHHA 2H8VA 1KFUS 5HLOA 4USLA 4DIRA 4INXA 1JBAA 1K9UA 4C0KA 3BOWB 2K7DA 1CDLA 2Q91A 3SS3A 1XK4A 4DS7A 3BUXB 1M39A 1PVAA 1UURA 1DMOA 1F70A 4GGFA 1LINA 2FOTA 1SYMA 4NDBA 1RK9A 1TNXA 2LHLA 3RLZA 1FI6A 2YGUA 1CDMA 1K9PA 1UHJA 2LUCA 2R2IA 3A4UB 2KYFA 3CR4X 2PSRA 3LL8B 1TCFA 2JPTA 3SG7A 1JFJA 3EK4A 4PE0A 1N0YA 2GV5A 2LVJA 3D74A 2BKIB 2LVKA 3BXKA 5AERA 1YUSA 2CBLA 2M8UA 2QPTA 3EVVA 3EVRA 2KAXA 2WCHA 1B9AA 4YGEB 2KHNA 1S5GY 1PALA 3FE6A 4F0ZB 3SG3A 2WCLA 2LLUA 3I5IB 3NHIA 1AHRA 1L2OB 3OBVA 2LCPA 2M97A 3EVUA 1XFRA 3PM2A 4N1FA 2F2PA 3VRQA 3WHUB 1DF0A 1EXRA 2KFGA 2JWWA 3B7AA 2KGRA 2ZNEA 1KK8C 1C07A 4QJ5B 4OV2A 1DJHA 1RJVA 3B87A 1NX2A 1RWYA 2F2OA 1XK4C 3KO0A 2JXLA 1Y0VH 1NX0A 2L2EA 1A29A 1J7RA 4QJ4B 1JSAA 1PSRA 2KI4B 1BU3A 4YRUA 1C7VA 1B7TY 3VRRA 2JULA
chains in the Genus database with same CATH topology
1OMDA 4CFQA 4FQOA 1W7IB 1V1GA 1R2UA 1S5GZ 1NSHA 5JJGA 4MRXA 3DVKA 1QIWA 1JUOA 1EG3A 1IRJA 4ORCB 2H2KA 2FCEA 1KQMC 1TN4A 4OR9B 1K94A 2GGMA 2FCDA 1BR4B 2OS8C 1SCMC 2M29A 4NDDA 2LUXA 3JTDC 1J7OA 3AKBA 1DJYA 3FWCA 4D1EA 1SR6B 1WRLA 3BUNB 1A75B 2BCAA 1NYAA 2RGIA 1TOPA 1SL7A 2MBXA 1DT7B 2VRGA 5KU1A 1OZOA 1B7TZ 1M46A 5KTYA 3HCMA 2LLTA 1HT9A 2F8PA 4GPLB 2AUCA 4CFRA 1MWNA 3E3RA 3KHEA 4MZKA 1CLBA 5DKNA 2F3YA 2KBIA 2HF5A 1WDCB 1F55A 1LA0A 1BR1B 1K2HA 1X02A 4YBHB 1FF1A 3TUYB 2G2BA 4PHJA 2KOTA 2WCBA 2JRFA 3I5HB 2Y1MA 5AANA 2ISDA 1BODA 1SCVA 2D8NA 4CLNA 5CPVA 5I8NA 1L7ZA 4DRWA 1F4OA 2L98A 3DVJA 2K61A 3PFVA 1MR8A 3LK0A 4PDZA 3TDZA 2ZRSA 2P6BB 3PN7C 1MXEA 1F4QA 1B8RA 1SBJA 3KF9A 2M9GA 3PM8A 2BBNA 1DJXA 1C7WA 4BY5A 3D0YA 4I5NB 5I2LA 1SMGA 3VROA 1K9KA 1K8UA 1A2XA 1PK0D 1W7JB 2CTNA 1IJ5A 4MSPA 4NQGA 2KI4C 1CKKA 5AXIA 2WNDA 2JT8A 1SY9A 1KCYA 5DKRA 2LLSA 1XA5A 1NUBA 2PASA 3BYAA 1NPQA 3OHMB 4MBEA 4P5OE 1B1GA 5CSIA 1QS7A 1EL4A 3AAJA 1BF5A 1YVHA 1AUIB 3I5FB 1JFKA 4N1GA 2JTZA 1CMGA 1N65A 1YX7A 1TRFA 1ZACA 2AMIA 3BUMB 1IJ6A 1EH2A 1S26D 2HQWA 2JZIA 4HRHA 2BE4A 2Y4QA 4WQ3A 3I5GB 3TDIA 3GK2A 3PATA 1SRAA 4ORAB 4WQ2A 1GGWA 1JC2A 1PVBA 2K2FA 1CM4A 3VRNA 2B1UA 5HKZA 3CLNA 2LP3A 2KNEA 2EC6C 1SPYA 4HRGA 1KWOC 3NSLA 4MZLA 2WCEA 1LA3A 4PHKA 3O2PA 2JC2A 4ZCUA 4PE4A 2NLNA 3JVTB 4M2OA 4YI9A 1S6IA 1RFJA 1QTXA 2OTGB 3FS7A 3IQOA 4DCKA 5HKYA 4L9MA 1MQ1A 3BUWB 1WLMA 4GNKB 2KQYA 1M45A 3VGOA 4ZCVA 2KAVA 1FBVA 3BQ3A 4ETOA 3ZWHA 2I7AA 2L5XB 1DJGA 1ZUZA 3PALA 3SIAA 5KSZA 5HLVA 2LE9B 2OPOA 1Y1XA 1KSOA 1H8BA 1IQ5A 3MSEB 1QX5B 1DVIA 3GK1A 2EGDA 2HPSA 1FI5A 4MEWA 3SG5A 2ZN8A 2SASA 1UUSA 2BL0C 1WRZA 2SCPA 1B8LA 1DGUA 1ALWA 1YRTB 2NCPA 2LP2A 3EKJA 5G08A 5IBWA 2LHIA 1WRKA 4XJKA 3A8RA 3GK4X 4CIDA 1QX7A 2AAOA 2O60A 1D1OA 1Y1AA 1ZOTB 5D7FA 1E8AA 1N2DA 1H4BA 1A03A 2ZRTA 1BT6A 5JOLA 1AJ5A 3NSIA 1CNPA 2CNPA 2L4HA 3WNXB 1F54A 3SG4A 3CGAA 2MAZA 1GQMA 2JNXA 3KEVA 1YUUA 3AKAA 1SW8A 3LCPC 1LVCD 1QLSA 2BCBA 1S3PA 1LXFC 2L50A 1S36A 5DKQA 1CB1A 1S1EA 1OSAA 4GAOA 4ORBB 5K89A 4TNCA 2LAPA 3WHTB 1M63B 4JWQA 1VRKA 1SKTA 2JQ6A 2V53A 3KPXA 1NX1A 4I5JA 2O5GA 1YVLA 4YI8A 2JOJA 2ZKMX 1XFWO 1R6PA 1TNQA 1U5IB 1XFZO 2Y5IA 2NZ0A 1F8HA 1QV0A 1UHIA 1Y1UA 3D0YB 1RECA 1OMVA 2LMVA 1KK7Y 1KQVA 3I5IC 2KQ6A 1L2OC 4MRYA 4DUQA 4OKHA 3TDUA 4R1EA 5AFPA 3CR2A 3OB2B 1QATA 2LANA 1K90D 1K93D 1QIVA 4PHMA 5B8IB 5I2OA 5PALA 1MHOA 3RM1A 3EKHA 2KAYA 2KI6C 2F33A 3DF0B 4ICBA 1MF8B 4GFTA 1B47A 1Q80A 4C0JA 4PE7A 2E6WA 1J7QA 1CLMA 1CTRA 5BPJA 1GGZA 1KK8B 2MLEC 3ICBA 1DJIA 5ER5A 4OVNF 2JNFA 4YGDB 4FTGA 1KK7Z 1CDNA 3LLEA 4M2QA 2M7LA 1MXLC 1IWQA 2COLB 2M3WA 3NSOA 1QASA 1CFCA 1G33A 1KSMA 2K0JA 2NXQA 1B4CA 2M49B 1QV1A 1SR6C 1IKUA 1FW4A 1EG4A 1PRWA 2BE6A 1KQMB 4MVFA 2KFHA 3CR5X 4AQJA 2CCMA 4P2YB 5GQQC 2OS8B 3PLFB 1AP4A 1SCMB 1SK6D 1KFXL 4Q04A 4HSZA 1S6JA 3CWGA 3JTDB 2MA2A 1DF0B 5CSFA 1FPWA 1WDCC 1LKJA 1Y6WA 3OP0A 4PCWA 4YGAA 3TUYC 1TTXA 1NIWA 2CXJA 3SJSA 1CFFA 2PALA 1UWOA 2KGBC 3I5HC 1IG5A 5F6TA 4U8DA 1UP5A 3O6BA 2PMYA 3DD4A 2CT9A 2I94A 2WC8A 3BUOB 3DVMA 1YRUB 2JTTA 1RROA 2QACA 2TN4A 2A4JA 4WRIA 3LK1A 3BOWA 3SG2A 1CMFA 3OB1B 2M0RA 3SG6A 2HETA 4YGCB 1F71A 4MLWA 1QJTA 1ODBA 1BG1A 3CTNA 3IQQA 3HX4A 1TIZA 1CFDA 1HQVA 1YR5A 3EK7A 1A4PA 1J55A 2F3ZA 4JQ0D 4AOMA 2L0PA 1ALVA 2JT3A 1YUTA 2JU0A 1S6CA 1B8CA 2K7CA 3TS5B 4XJKB 2G9BA 1XFXO 5CSJA 2PRUA 1KFUL 2ZFDA 2BBMA 4GBAA 3K21A 2MLFC 1ZFSA 3PN7B 2L4IA 3O4YA 2KFFA 2MRDA 4UPGA 1DTLA 3NXAA 1NP8A 1BOCA 4CPVA 5HYDA 2DOQA 1WLZA 4N5XA 1QX2A 1CM1A 2H61A 5I2QA 4GGFC 1TCOB 5HKWA 2HQ8A 5AEQA 2BKHB 2K7OA 2LNKA 1J1DA 1AVSA 3I5FC 4QJ3B 1OZSA 2LVIA 1OE9B 1CLLA 2M7NA 4HREE 3H4SE 2BCXA 2WORA 2K8MB 4YGBB 1DGVA 1DJZA 1OMRA 3I5GC 2EHBA 1TNPA 1JF0A 2ZN9A 1PULA 2JXCA 3DVEA 1NCYA 2KSPA 2LM5A 4GGNA 1IGVA 1UHKA 2KBMA 4PE1A 2E30A 1J1EA 1IH0A 3C1VA 3VRPA 3IF7A 3EK8A 3GOFA 4A4BA 1QLKA 3CS1A 1J7PA 2I2RE 1XO5A 1NX3A 3FIAA 1GJYA 2IS9A 3JVTC 5J3XA 1YURA 4I5KA 2H61C 2KDHA 2OTGC 2BECA 3QRXA 2KI6D 3F45A 2EC6B 3OX5A 1RTP1 1KWOB 2LC5A 1AK8A 1XFYO 5TNCA 1G8IA 1K95A 1ZMZA 4AQIA 4MN0A 1A75A 2WCFA 2M1UA 2K7BA 1BMOA 2MHHA 1CFPA 5ER4X 2M1KB 1SL8A 2Q4UA 3TZ1A 2LMTA 4XYNA 2NCOA 1IQ3A 3SIBA 1JWDA 4OCIA 2K2AA 2LV7A 3WXAA 1KFXS 3FWBA 2L51A 3TS5C 4MZJA 1QVIY 3PSRA 1YX8A 2I18A 1OOJA 1TNWA 4PALA 1EJ3A 1XVJA 2JT0A 2Y1NA 4BY4A 1NWDA 4A4CA 1U5IA 1DJWA 1SNLA 2PVBA 1SL9A 1V1FA 1XFUO 2LMUA 1OQPA 1QXPA 2WOSA 1BJFA 4M2PA 3CZTX 1MUXA 2GGZA 3OX6A 4PHNA 4JPZB 2MJWB 4GUKA 1XYDA 3D10A 1JF2A 5D69A 1PSBA 1UHNA 4IL1A 1G4YR 2BL0B 5CSNA 1CDPA 1WY9A 3NSKA 2KYCA 4E68A 4I5LB 1QVIZ 3AAKA 3DF0A 1NCZA 1M31A 1YTZC 3M0WA 2ZNDA 1NCXA 1AJ4A 1XFVO 2FJUB 2LVVA 1K96A 3ZNIA 3O78A 1BLQA 4NDCA 5FYXA 1UHHA 5HLOA 1KFUS 4DIRA 4USLA 1JBAA 1K9UA 4C0KA 3BOWB 2K7DA 1CDLA 2Q91A 1XK4A 4DS7A 3BUXB 1M39A 1PVAA 1UURA 1DMOA 1F70A 4GGFA 1LINA 2FOTA 1SYMA 4NDBA 1RK9A 1TNXA 2LHLA 3RLZA 1FI6A 3A4UB 1CDMA 1K9PA 1UHJA 2LUCA 2R2IA 3CR4X 2KYFA 4C0LA 2PSRA 3LL8B 1TCFA 2JPTA 3SG7A 1JFJA 3EK4A 4PE0A 1N0YA 2GV5A 2LVJA 2BKIB 2LVKA 3BXKA 5AERA 1YUSA 2CBLA 2M8UA 2QPTA 3EVVA 3EVRA 2KAXA 4YGEB 1B9AA 2KHNA 1S5GY 1PALA 4F0ZB 3SG3A 2LLUA 3I5IB 1AHRA 1L2OB 3VRQA 2LCPA 2M97A 3EVUA 4N1FA 3WHUB 1JSAA 2F2PA 1DF0A 1EXRA 2KFGA 2JWWA 2KGRA 2ZNEA 1KK8C 1C07A 4QJ5B 4OV2A 1DJHA 1RJVA 1NX2A 1RWYA 2F2OA 1XK4C 3KO0A 2JXLA 1Y0VH 1NX0A 2L2EA 1A29A 1J7RA 4QJ4B 1PSRA 2KI4B 1BU3A 4YRUA 1C7VA 1B7TY 3VRRA 2JULA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OMD A;  4CFQ A;  4FQO A;  1W7I B;  1V1G A;  1R2U A;  1S5G Z;  1NSH A;  5JJG A;  4MRX A;  3DVK A;  1QIW A;  1JUO A;  1EG3 A;  1IRJ A;  4ORC B;  2H2K A;  2FCE A;  1KQM C;  1TN4 A;  4OR9 B;  1K94 A;  2GGM A;  2FCD A;  1BR4 B;  2OS8 C;  1SCM C;  2M29 A;  4NDD A;  2LUX A;  3JTD C;  1J7O A;  3AKB A;  1DJY A;  3FWC A;  4D1E A;  1SR6 B;  1WRL A;  3BUN B;  1A75 B;  2BCA A;  1NYA A;  2RGI A;  1TOP A;  1SL7 A;  2MBX A;  1DT7 B;  2VRG A;  5KU1 A;  1OZO A;  1B7T Z;  1M46 A;  5KTY A;  3HCM A;  2LLT A;  1HT9 A;  2F8P A;  4GPL B;  2AUC A;  4CFR A;  1MWN A;  3E3R A;  3KHE A;  4MZK A;  1CLB A;  5DKN A;  2F3Y A;  2KBI A;  2HF5 A;  1WDC B;  1F55 A;  1LA0 A;  1BR1 B;  1K2H A;  1X02 A;  4YBH B;  1FF1 A;  3TUY B;  2G2B A;  4PHJ A;  2KOT A;  2WCB A;  2JRF A;  3I5H B;  2Y1M A;  5AAN A;  2ISD A;  1BOD A;  1SCV A;  2D8N A;  4CLN A;  5CPV A;  5I8N A;  1L7Z A;  4DRW A;  1F4O A;  2L98 A;  3DVJ A;  2K61 A;  3PFV A;  1MR8 A;  3LK0 A;  4PDZ A;  3TDZ A;  2ZRS A;  2P6B B;  3PN7 C;  1MXE A;  1F4Q A;  1B8R A;  1SBJ A;  3KF9 A;  2M9G A;  3PM8 A;  2BBN A;  1DJX A;  1C7W A;  4BY5 A;  3D0Y A;  4I5N B;  5I2L A;  1SMG A;  3VRO A;  1K9K A;  1K8U A;  1A2X A;  1PK0 D;  1W7J B;  2CTN A;  1IJ5 A;  4MSP A;  4NQG A;  2KI4 C;  1CKK A;  5AXI A;  2WND A;  2JT8 A;  1SY9 A;  1KCY A;  5DKR A;  2LLS A;  1XA5 A;  1NUB A;  2PAS A;  3BYA A;  1NPQ A;  3OHM B;  4MBE A;  4P5O E;  1B1G A;  5CSI A;  1QS7 A;  1EL4 A;  3AAJ A;  1BF5 A;  1YVH A;  1AUI B;  3I5F B;  1JFK A;  4N1G A;  2JTZ A;  1CMG A;  1N65 A;  1YX7 A;  1TRF A;  1ZAC A;  2AMI A;  3BUM B;  1IJ6 A;  1EH2 A;  1S26 D;  2HQW A;  2JZI A;  4HRH A;  2BE4 A;  2Y4Q A;  4WQ3 A;  3I5G B;  3TDI A;  3GK2 A;  3PAT A;  1SRA A;  4ORA B;  4WQ2 A;  1GGW A;  1JC2 A;  1PVB A;  2K2F A;  1CM4 A;  3VRN A;  2B1U A;  5HKZ A;  3CLN A;  2LP3 A;  2KNE A;  2EC6 C;  1SPY A;  4HRG A;  1KWO C;  3NSL A;  4MZL A;  2WCE A;  1LA3 A;  4PHK A;  3O2P A;  2JC2 A;  4ZCU A;  4PE4 A;  2NLN A;  3JVT B;  4M2O A;  4YI9 A;  1S6I A;  1RFJ A;  1QTX A;  2OTG B;  3FS7 A;  3IQO A;  4DCK A;  5HKY A;  4L9M A;  1MQ1 A;  3BUW B;  1WLM A;  4GNK B;  2KQY A;  1M45 A;  3VGO A;  4ZCV A;  2KAV A;  1FBV A;  3BQ3 A;  4ETO A;  3ZWH A;  2I7A A;  2L5X B;  1DJG A;  1ZUZ A;  3PAL A;  3SIA A;  5KSZ A;  5HLV A;  2LE9 B;  2OPO A;  1Y1X A;  1KSO A;  1H8B A;  1IQ5 A;  3MSE B;  1QX5 B;  1DVI A;  3GK1 A;  2EGD A;  2HPS A;  1FI5 A;  4MEW A;  3SG5 A;  2ZN8 A;  2SAS A;  1UUS A;  2BL0 C;  1WRZ A;  2SCP A;  1B8L A;  1DGU A;  1ALW A;  1YRT B;  2NCP A;  2LP2 A;  3EKJ A;  5G08 A;  5IBW A;  2LHI A;  1WRK A;  4XJK A;  3A8R A;  3GK4 X;  4CID A;  1QX7 A;  2AAO A;  2O60 A;  1D1O A;  1Y1A A;  1ZOT B;  5D7F A;  1E8A A;  1N2D A;  1H4B A;  1A03 A;  2ZRT A;  1BT6 A;  5JOL A;  1AJ5 A;  3NSI A;  1CNP A;  2CNP A;  2L4H A;  3WNX B;  1F54 A;  3SG4 A;  3CGA A;  2MAZ A;  1GQM A;  2JNX A;  3KEV A;  1YUU A;  3AKA A;  1SW8 A;  3LCP C;  1LVC D;  1QLS A;  2BCB A;  1S3P A;  1LXF C;  2L50 A;  1S36 A;  5DKQ A;  1CB1 A;  1S1E A;  1OSA A;  4GAO A;  4ORB B;  5K89 A;  4TNC A;  2LAP A;  3WHT B;  1M63 B;  4JWQ A;  1VRK A;  1SKT A;  2JQ6 A;  2V53 A;  3KPX A;  1NX1 A;  4I5J A;  2O5G A;  1YVL A;  4YI8 A;  2JOJ A;  2ZKM X;  1XFW O;  1R6P A;  1TNQ A;  1U5I B;  1XFZ O;  2Y5I A;  2NZ0 A;  1F8H A;  1QV0 A;  1UHI A;  1Y1U A;  3D0Y B;  1REC A;  1OMV A;  2LMV A;  1KK7 Y;  1KQV A;  3I5I C;  2KQ6 A;  1L2O C;  4MRY A;  4DUQ A;  4OKH A;  3TDU A;  4R1E A;  5AFP A;  3CR2 A;  3OB2 B;  1QAT A;  2LAN A;  1K90 D;  1K93 D;  1QIV A;  4PHM A;  5B8I B;  5I2O A;  5PAL A;  1MHO A;  3RM1 A;  3EKH A;  2KAY A;  2KI6 C;  2F33 A;  3DF0 B;  4ICB A;  1MF8 B;  4GFT A;  1B47 A;  1Q80 A;  4C0J A;  4PE7 A;  2E6W A;  1J7Q A;  1CLM A;  1CTR A;  5BPJ A;  1GGZ A;  1KK8 B;  2MLE C;  3ICB A;  1DJI A;  5ER5 A;  4OVN F;  2JNF A;  4YGD B;  4FTG A;  1KK7 Z;  1CDN A;  3LLE A;  4M2Q A;  2M7L A;  1MXL C;  1IWQ A;  2COL B;  2M3W A;  3NSO A;  1QAS A;  1CFC A;  1G33 A;  1KSM A;  2K0J A;  2NXQ A;  1B4C A;  2M49 B;  1QV1 A;  1SR6 C;  1IKU A;  1FW4 A;  1EG4 A;  1PRW A;  2BE6 A;  1KQM B;  4MVF A;  2KFH A;  3CR5 X;  4AQJ A;  2CCM A;  4P2Y B;  5GQQ C;  2OS8 B;  3PLF B;  1AP4 A;  1SCM B;  1SK6 D;  1KFX L;  4Q04 A;  4HSZ A;  1S6J A;  3CWG A;  3JTD B;  2MA2 A;  1DF0 B;  5CSF A;  1FPW A;  1WDC C;  1LKJ A;  1Y6W A;  3OP0 A;  4PCW A;  4YGA A;  3TUY C;  1TTX A;  1NIW A;  2CXJ A;  3SJS A;  1CFF A;  2PAL A;  1UWO A;  2KGB C;  3I5H C;  1IG5 A;  5F6T A;  4U8D A;  1UP5 A;  3O6B A;  2PMY A;  3DD4 A;  2CT9 A;  2I94 A;  2WC8 A;  3BUO B;  3DVM A;  1YRU B;  2JTT A;  1RRO A;  2QAC A;  2TN4 A;  2A4J A;  4WRI A;  3LK1 A;  3BOW A;  3SG2 A;  1CMF A;  3OB1 B;  2M0R A;  3SG6 A;  2HET A;  4YGC B;  1F71 A;  4MLW A;  1QJT A;  1ODB A;  1BG1 A;  3CTN A;  3IQQ A;  3HX4 A;  1TIZ A;  1CFD A;  1HQV A;  1YR5 A;  3EK7 A;  1A4P A;  1J55 A;  2F3Z A;  4JQ0 D;  4AOM A;  2L0P A;  1ALV A;  2JT3 A;  1YUT A;  2JU0 A;  1S6C A;  1B8C A;  2K7C A;  3TS5 B;  4XJK B;  2G9B A;  1XFX O;  5CSJ A;  2PRU A;  1KFU L;  2ZFD A;  2BBM A;  4GBA A;  3K21 A;  2MLF C;  1ZFS A;  3PN7 B;  2L4I A;  3O4Y A;  2KFF A;  2MRD A;  4UPG A;  1DTL A;  3NXA A;  1NP8 A;  1BOC A;  4CPV A;  5HYD A;  2DOQ A;  1WLZ A;  4N5X A;  1QX2 A;  1CM1 A;  2H61 A;  5I2Q A;  4GGF C;  1TCO B;  5HKW A;  2HQ8 A;  5AEQ A;  2BKH B;  2K7O A;  2LNK A;  1J1D A;  1AVS A;  3I5F C;  4QJ3 B;  1OZS A;  2LVI A;  1OE9 B;  1CLL A;  2M7N A;  4HRE E;  3H4S E;  2BCX A;  2WOR A;  2K8M B;  4YGB B;  1DGV A;  1DJZ A;  1OMR A;  3I5G C;  2EHB A;  1TNP A;  1JF0 A;  2ZN9 A;  1PUL A;  2JXC A;  3DVE A;  1NCY A;  2KSP A;  2LM5 A;  4GGN A;  1IGV A;  1UHK A;  2KBM A;  4PE1 A;  2E30 A;  1J1E A;  1IH0 A;  3C1V A;  3VRP A;  3IF7 A;  3EK8 A;  3GOF A;  4A4B A;  1QLK A;  3CS1 A;  1J7P A;  2I2R E;  1XO5 A;  1NX3 A;  3FIA A;  1GJY A;  2IS9 A;  3JVT C;  5J3X A;  1YUR A;  4I5K A;  2H61 C;  2KDH A;  2OTG C;  2BEC A;  3QRX A;  2KI6 D;  3F45 A;  2EC6 B;  3OX5 A;  1RTP 1;  1KWO B;  2LC5 A;  1AK8 A;  1XFY O;  5TNC A;  1G8I A;  1K95 A;  1ZMZ A;  4AQI A;  4MN0 A;  1A75 A;  2WCF A;  2M1U A;  2K7B A;  1BMO A;  2MHH A;  1CFP A;  5ER4 X;  2M1K B;  1SL8 A;  2Q4U A;  3TZ1 A;  2LMT A;  4XYN A;  2NCO A;  1IQ3 A;  3SIB A;  1JWD A;  4OCI A;  2K2A A;  2LV7 A;  3WXA A;  1KFX S;  3FWB A;  2L51 A;  3TS5 C;  4MZJ A;  1QVI Y;  3PSR A;  1YX8 A;  2I18 A;  1OOJ A;  1TNW A;  4PAL A;  1EJ3 A;  1XVJ A;  2JT0 A;  2Y1N A;  4BY4 A;  1NWD A;  4A4C A;  1U5I A;  1DJW A;  1SNL A;  2PVB A;  1SL9 A;  1V1F A;  1XFU O;  2LMU A;  1OQP A;  1QXP A;  2WOS A;  1BJF A;  4M2P A;  3CZT X;  1MUX A;  2GGZ A;  3OX6 A;  4PHN A;  4JPZ B;  2MJW B;  4GUK A;  1XYD A;  3D10 A;  1JF2 A;  5D69 A;  1PSB A;  1UHN A;  4IL1 A;  1G4Y R;  2BL0 B;  5CSN A;  1CDP A;  1WY9 A;  3NSK A;  2KYC A;  4E68 A;  4I5L B;  1QVI Z;  3AAK A;  3DF0 A;  1NCZ A;  1M31 A;  1YTZ C;  3M0W A;  2ZND A;  1NCX A;  1AJ4 A;  1XFV O;  2FJU B;  2LVV A;  1K96 A;  3ZNI A;  3O78 A;  1BLQ A;  4NDC A;  5FYX A;  1UHH A;  5HLO A;  1KFU S;  4DIR A;  4USL A;  1JBA A;  1K9U A;  4C0K A;  3BOW B;  2K7D A;  1CDL A;  2Q91 A;  1XK4 A;  4DS7 A;  3BUX B;  1M39 A;  1PVA A;  1UUR A;  1DMO A;  1F70 A;  4GGF A;  1LIN A;  2FOT A;  1SYM A;  4NDB A;  1RK9 A;  1TNX A;  2LHL A;  3RLZ A;  1FI6 A;  3A4U B;  1CDM A;  1K9P A;  1UHJ A;  2LUC A;  2R2I A;  3CR4 X;  2KYF A;  4C0L A;  2PSR A;  3LL8 B;  1TCF A;  2JPT A;  3SG7 A;  1JFJ A;  3EK4 A;  4PE0 A;  1N0Y A;  2GV5 A;  2LVJ A;  2BKI B;  2LVK A;  3BXK A;  5AER A;  1YUS A;  2CBL A;  2M8U A;  2QPT A;  3EVV A;  3EVR A;  2KAX A;  4YGE B;  1B9A A;  2KHN A;  1S5G Y;  1PAL A;  4F0Z B;  3SG3 A;  2LLU A;  3I5I B;  1AHR A;  1L2O B;  3VRQ A;  2LCP A;  2M97 A;  3EVU A;  4N1F A;  3WHU B;  1JSA A;  2F2P A;  1DF0 A;  1EXR A;  2KFG A;  2JWW A;  2KGR A;  2ZNE A;  1KK8 C;  1C07 A;  4QJ5 B;  4OV2 A;  1DJH A;  1RJV A;  1NX2 A;  1RWY A;  2F2O A;  1XK4 C;  3KO0 A;  2JXL A;  1Y0V H;  1NX0 A;  2L2E A;  1A29 A;  1J7R A;  4QJ4 B;  1PSR A;  2KI4 B;  1BU3 A;  4YRU A;  1C7V A;  1B7T Y;  3VRR A;  2JUL A; 
#chains in the Genus database with same CATH topology
 1W9Z A;  1OMD A;  4CFQ A;  4FQO A;  1W7I B;  1V1G A;  1R2U A;  3R72 A;  5HL1 A;  1S5G Z;  1NSH A;  3B6X A;  5JJG A;  4MRX A;  3DVK A;  1QIW A;  1JUO A;  1EG3 A;  1IRJ A;  4ORC B;  2H2K A;  2FCE A;  3R1P A;  1KQM C;  1TN4 A;  4OR9 B;  1K94 A;  2GGM A;  2FCD A;  1BR4 B;  2OS8 C;  1SCM C;  2M29 A;  1LS8 A;  4IJ7 A;  4NDD A;  1TUJ A;  2LUX A;  3UO9 A;  3JTD C;  1J7O A;  3AKB A;  1DJY A;  1TWO A;  1OOG A;  1SR6 B;  1WRL A;  3FWC A;  3BUN B;  1A75 B;  2BCA A;  4D1E A;  1NYA A;  2RGI A;  1TOP A;  1SL7 A;  2MBX A;  1DT7 B;  2VRG A;  4INW A;  1OZO A;  1B7T Z;  1M46 A;  5KU1 A;  5KTY A;  3HCM A;  2LLT A;  1HT9 A;  2F8P A;  4GPL B;  3S0E A;  1C3Z A;  2AUC A;  1OOI X;  4CFR A;  1DEL A;  1MWN A;  3E3R A;  3KHE A;  4MZK A;  1CLB A;  5DKN A;  2F3Y A;  2KBI A;  2HF5 A;  1WDC B;  1F55 A;  1LA0 A;  1BR1 B;  3EG5 B;  1X02 A;  4YBH B;  1FF1 A;  1K2H A;  4JKT A;  3TUY B;  2G2B A;  4PHJ A;  2KOT A;  2WCB A;  2JRF A;  3I5H B;  2Y1M A;  5AAN A;  2ISD A;  1BOD A;  1SCV A;  2D8N A;  4CLN A;  5CPV A;  5I8N A;  1L7Z A;  4DRW A;  1F4O A;  2L98 A;  3DVJ A;  2K61 A;  3PFV A;  1MR8 A;  3LK0 A;  4PDZ A;  2ERB A;  3TDZ A;  2ZRS A;  3Q8I A;  2P6B B;  3PN7 C;  1MXE A;  3BFH A;  1F4Q A;  1B8R A;  1SBJ A;  3KF9 A;  2M9G A;  3PM8 A;  2BBN A;  1DJX A;  1C7W A;  4BY5 A;  3D0Y A;  4I5N B;  5I2L A;  1SMG A;  3VRO A;  1K9K A;  3V2L A;  2L2C A;  1K8U A;  1A2X A;  1PK0 D;  1W7J B;  2CTN A;  1IJ5 A;  4MSP A;  4NQG A;  2KI4 C;  1CKK A;  5AXI A;  2WND A;  2JT8 A;  5EL2 A;  1SY9 A;  1KCY A;  5DKR A;  2LLS A;  3RZS A;  1XA5 A;  1NUB A;  2PAS A;  3BYA A;  1NPQ A;  3OHM B;  4MBE A;  4P5O E;  2WCM A;  3DYE A;  1B1G A;  5CSI A;  1QS7 A;  1EL4 A;  3AAJ A;  1BF5 A;  1YVH A;  1AUI B;  2L5Y A;  3I5F B;  1JFK A;  4N1G A;  2JTZ A;  1CMG A;  1N65 A;  1YX7 A;  1TRF A;  1ZAC A;  2AMI A;  3BUM B;  1IJ6 A;  1EH2 A;  3CZ0 A;  1S26 D;  2HQW A;  2JZI A;  4HRH A;  2BE4 A;  2Y4Q A;  4WQ3 A;  3I5G B;  3TDI A;  3GK2 A;  3PAT A;  1SRA A;  4ORA B;  4WQ2 A;  5DIC A;  1JC2 A;  1GGW A;  1PVB A;  2K2F A;  1CM4 A;  3VRN A;  2B1U A;  5HKZ A;  3CLN A;  1DC1 A;  2LP3 A;  2KNE A;  2EC6 C;  1SPY A;  3CYZ A;  4HRG A;  2GTE A;  1KWO C;  3NSL A;  3D75 A;  3K1E A;  4MZL A;  2WCE A;  1LA3 A;  4PHK A;  3O2P A;  2JC2 A;  4ZCU A;  3DZT A;  4PE4 A;  2NLN A;  3D78 A;  3JVT B;  3B88 A;  3BFA A;  4M2O A;  1S6I A;  4YI9 A;  1OOF A;  1QTX A;  1RFJ A;  2OTG B;  3FS7 A;  3IQO A;  2WCK A;  3IVT A;  4DCK A;  5HKY A;  3D77 A;  4L9M A;  3L47 A;  1MQ1 A;  3BUW B;  1WLM A;  4GNK B;  2KQY A;  1M45 A;  3VGO A;  5I94 A;  4ZCV A;  4KYN A;  2KAV A;  1FBV A;  3BQ3 A;  4ETO A;  3ZWH A;  2I7A A;  2L5X B;  1DJG A;  1ZUZ A;  3PAL A;  3SIA A;  5KSZ A;  3QME A;  2JPO A;  5HLV A;  2LE9 B;  2OPO A;  3B86 A;  1Y1X A;  1KSO A;  1H8B A;  1IQ5 A;  3MSE B;  1QX5 B;  1DVI A;  3GK1 A;  5D3O A;  3CDN A;  2EGD A;  3S0G A;  2HPS A;  1FI5 A;  4MEW A;  3SG5 A;  2PYQ A;  2SAS A;  1UUS A;  2ZN8 A;  3O4X A;  2BL0 C;  1WRZ A;  4FQT A;  2SCP A;  1B8L A;  1DGU A;  1ALW A;  1YRT B;  2NCP A;  2LP2 A;  3EKJ A;  5G08 A;  5IBW A;  2WC5 A;  2LHI A;  1WRK A;  4XJK A;  3A8R A;  3GK4 X;  4CID A;  1QX7 A;  2AAO A;  2O60 A;  1D1O A;  1Y1A A;  1ZOT B;  2QEV A;  5D7F A;  1E8A A;  1N2D A;  1H4B A;  1A03 A;  2BNX A;  2ZRT A;  1BT6 A;  4PT1 A;  1TUZ A;  5JOL A;  1AJ5 A;  3NSI A;  1CNP A;  2CNP A;  2L4H A;  3WNX B;  1F54 A;  3SG4 A;  3CGA A;  2MAZ A;  1GQM A;  2JNX A;  3KEV A;  1YUU A;  3AKA A;  1SW8 A;  3SS5 A;  3LCP C;  3CZ2 A;  1LVC D;  1QLS A;  2BCB A;  1S3P A;  1LXF C;  2L50 A;  1S36 A;  2P71 A;  5DKQ A;  1S1E A;  1OSA A;  4GAO A;  4ORB B;  1CB1 A;  5K89 A;  4TNC A;  2LAP A;  3WHT B;  4F7F A;  1M63 B;  4JWQ A;  1VRK A;  1SKT A;  2JQ6 A;  2V53 A;  3KPX A;  1NX1 A;  4I5J A;  2O5G A;  3OGN A;  1YVL A;  4YI8 A;  2JOJ A;  2ZKM X;  1XFW O;  1R6P A;  1TNQ A;  1U5I B;  1XFZ O;  1ORG A;  2Y5I A;  2NZ0 A;  1F8H A;  1QV0 A;  1UHI A;  1Y1U A;  3D0Y B;  5FI2 A;  1REC A;  1OMV A;  2LMV A;  1KK7 Y;  1KQV A;  3I5I C;  2KQ6 A;  1L2O C;  3CZ1 A;  4MRY A;  4DUQ A;  4OKH A;  3TDU A;  4R1E A;  5AFP A;  3CR2 A;  3OB2 B;  1QAT A;  3CAB A;  2LAN A;  1K90 D;  1Z2C B;  3S0A A;  1K93 D;  1QIV A;  4PHM A;  5B8I B;  5I2O A;  5PAL A;  1MHO A;  3RM1 A;  3EKH A;  2KAY A;  2KI6 C;  2F33 A;  3DF0 B;  4ICB A;  1MF8 B;  4GFT A;  1B47 A;  1Q80 A;  4C0J A;  4PE7 A;  2E6W A;  1J7Q A;  1CLM A;  1CTR A;  5BPJ A;  1GGZ A;  1KK8 B;  2MLE C;  3ICB A;  3FE9 A;  1DJI A;  5ER5 A;  4OVN F;  2JNF A;  4YGD B;  4FTG A;  1KK7 Z;  1CDN A;  3LLE A;  4M2Q A;  2M7L A;  1MXL C;  1IWQ A;  3DXL A;  2COL B;  2M3W A;  5FI7 A;  3NSO A;  1QAS A;  1CFC A;  1G33 A;  2BAP A;  1KSM A;  2K0J A;  2NXQ A;  1B4C A;  2M49 B;  3PJI A;  1QV1 A;  1GM0 A;  1SR6 C;  1IKU A;  3S0D A;  1FW4 A;  1EG4 A;  1PRW A;  3DY9 A;  3N7H A;  2BE6 A;  1KQM B;  4MVF A;  2KFH A;  3CR5 X;  4AQJ A;  2CCM A;  2QEB A;  4P2Y B;  5GQQ C;  2OS8 B;  3L4L A;  3BJH A;  1OOH A;  1SCM B;  1SK6 D;  3PLF B;  1KFX L;  4Q04 A;  1AP4 A;  4HSZ A;  1S6J A;  3CWG A;  3JTD B;  2MA2 A;  1DF0 B;  5CSF A;  1FPW A;  1WDC C;  1LKJ A;  1Y6W A;  3OP0 A;  4PCW A;  4YGA A;  2QEO A;  3S0F A;  1TTX A;  3TUY C;  1NIW A;  2CXJ A;  3S0B A;  3SJS A;  1CFF A;  2PAL A;  1UWO A;  2KGB C;  3I5H C;  1IG5 A;  5F6T A;  4U8D A;  1UP5 A;  3O6B A;  2PMY A;  3DD4 A;  2CT9 A;  3SS4 A;  2I94 A;  2WC8 A;  3BUO B;  3DVM A;  1YRU B;  3R1O A;  2JTT A;  1RRO A;  2QAC A;  2TN4 A;  2A4J A;  4WRI A;  3LK1 A;  3BOW A;  3SG2 A;  1CMF A;  3OB1 B;  2M0R A;  3SG6 A;  2HET A;  4YGC B;  1F71 A;  4MLW A;  1QJT A;  1ODB A;  1BG1 A;  3CTN A;  3IQQ A;  3HX4 A;  1TIZ A;  1CFD A;  1HQV A;  3UNW A;  1YR5 A;  3EK7 A;  1A4P A;  1J55 A;  2F3Z A;  2QDI A;  4JQ0 D;  4AOM A;  2L0P A;  1ALV A;  2JT3 A;  1YUT A;  2JU0 A;  1S6C A;  1B8C A;  2K7C A;  3TS5 B;  4XJK B;  2G9B A;  1XFX O;  5CSJ A;  2PRU A;  1KFU L;  2ZFD A;  2BBM A;  4GBA A;  3K21 A;  2MLF C;  1ZFS A;  3PN7 B;  2L4I A;  3O4Y A;  2KFF A;  2MRD A;  4UPG A;  1DTL A;  3NXA A;  1NP8 A;  2PQL A;  4CPV A;  1BOC A;  5HYD A;  2DOQ A;  1WLZ A;  2WC6 A;  4N5X A;  1QX2 A;  3D73 A;  1SSE B;  1CM1 A;  2H61 A;  5I2Q A;  2P70 A;  1TCO B;  4GGF C;  2HQ8 A;  5HKW A;  5AEQ A;  2BKH B;  2K7O A;  2LNK A;  1J1D A;  1AVS A;  3I5F C;  4QJ3 B;  1OZS A;  2LVI A;  1OE9 B;  1CLL A;  2M7N A;  4HRE E;  3H4S E;  2K60 A;  2BCX A;  2KPH A;  2WOR A;  2K8M B;  4YGB B;  1DGV A;  1P28 A;  1DJZ A;  1OMR A;  2KLD A;  3I5G C;  2EHB A;  1TNP A;  1JF0 A;  2FJY A;  2ZN9 A;  1PUL A;  2JXC A;  3DVE A;  1NCY A;  2KSP A;  2LM5 A;  4GGN A;  1IGV A;  1UHK A;  2KBM A;  1C3Y A;  4PE1 A;  2E30 A;  1J1E A;  1IH0 A;  3C1V A;  3VRP A;  3IF7 A;  3EK8 A;  3GOF A;  4A4B A;  1QLK A;  3CS1 A;  1J7P A;  2I2R E;  2WCJ A;  1XO5 A;  1NX3 A;  3FIA A;  1GJY A;  2IS9 A;  3JVT C;  5J3X A;  1YUR A;  3BFB A;  4I5K A;  2H61 C;  2KDH A;  2OTG C;  2BEC A;  3QRX A;  2KI6 D;  3F45 A;  2EC6 B;  3OX5 A;  1RTP 1;  1KWO B;  2LC5 A;  1AK8 A;  1XFY O;  5TNC A;  1G8I A;  1K95 A;  3VB1 A;  1ZMZ A;  4AQI A;  4MN0 A;  1A75 A;  2WCF A;  2M1U A;  3NGV A;  2K7B A;  1BMO A;  2MHH A;  1DEK A;  1CFP A;  5ER4 X;  2M1K B;  1IIO A;  1SL8 A;  2Q4U A;  3TZ1 A;  2LMT A;  5FI6 A;  4XYN A;  2NCO A;  1IQ3 A;  3SIB A;  1DQE A;  4OCI A;  2K2A A;  1JWD A;  2LV7 A;  4OZD A;  3WXA A;  1KFX S;  3FWB A;  2L51 A;  3TS5 C;  4MZJ A;  1QVI Y;  3PSR A;  1YX8 A;  4C0L A;  1OW4 A;  2I18 A;  1OOJ A;  1TNW A;  4PAL A;  1EJ3 A;  1XVJ A;  2JT0 A;  2Y1N A;  4BY4 A;  1NWD A;  4A4C A;  1QWV A;  4JD9 A;  3NHT A;  1U5I A;  1DJW A;  1SNL A;  2PVB A;  1SL9 A;  1V1F A;  1XFU O;  2LMU A;  1OQP A;  1QXP A;  2WOS A;  1BJF A;  4M2P A;  3CZT X;  1MUX A;  2GGZ A;  3OX6 A;  4PHN A;  4JPZ B;  3D76 A;  2QEH A;  2MJW B;  3R1V A;  4GUK A;  1XYD A;  3D10 A;  1JF2 A;  1Z4H A;  5D69 A;  1PSB A;  1UHN A;  4IL1 A;  1G4Y R;  2BL0 B;  1T14 A;  3FE8 A;  5CSN A;  1CDP A;  1WY9 A;  3NSK A;  2KYC A;  4E68 A;  4I5L B;  1QVI Z;  3L4A A;  3AAK A;  3DF0 A;  1NCZ A;  1M31 A;  1YTZ C;  3M0W A;  2ZND A;  1NCX A;  1AJ4 A;  1XFV O;  2FJU B;  2LVV A;  1K96 A;  3ZNI A;  3O78 A;  1BLQ A;  4NDC A;  5FYX A;  2KLE A;  1UHH A;  2H8V A;  1KFU S;  5HLO A;  4USL A;  4DIR A;  4INX A;  1JBA A;  1K9U A;  4C0K A;  3BOW B;  2K7D A;  1CDL A;  2Q91 A;  3SS3 A;  1XK4 A;  4DS7 A;  3BUX B;  1M39 A;  1PVA A;  1UUR A;  1DMO A;  1F70 A;  4GGF A;  1LIN A;  2FOT A;  1SYM A;  4NDB A;  1RK9 A;  1TNX A;  2LHL A;  3RLZ A;  1FI6 A;  2YGU A;  1CDM A;  1K9P A;  1UHJ A;  2LUC A;  2R2I A;  3A4U B;  2KYF A;  3CR4 X;  2PSR A;  3LL8 B;  1TCF A;  2JPT A;  3SG7 A;  1JFJ A;  3EK4 A;  4PE0 A;  1N0Y A;  2GV5 A;  2LVJ A;  3D74 A;  2BKI B;  2LVK A;  3BXK A;  5AER A;  1YUS A;  2CBL A;  2M8U A;  2QPT A;  3EVV A;  3EVR A;  2KAX A;  2WCH A;  1B9A A;  4YGE B;  2KHN A;  1S5G Y;  1PAL A;  3FE6 A;  4F0Z B;  3SG3 A;  2WCL A;  2LLU A;  3I5I B;  3NHI A;  1AHR A;  1L2O B;  3OBV A;  2LCP A;  2M97 A;  3EVU A;  1XFR A;  3PM2 A;  4N1F A;  2F2P A;  3VRQ A;  3WHU B;  1DF0 A;  1EXR A;  2KFG A;  2JWW A;  3B7A A;  2KGR A;  2ZNE A;  1KK8 C;  1C07 A;  4QJ5 B;  4OV2 A;  1DJH A;  1RJV A;  3B87 A;  1NX2 A;  1RWY A;  2F2O A;  1XK4 C;  3KO0 A;  2JXL A;  1Y0V H;  1NX0 A;  2L2E A;  1A29 A;  1J7R A;  4QJ4 B;  1JSA A;  1PSR A;  2KI4 B;  1BU3 A;  4YRU A;  1C7V A;  1B7T Y;  3VRR A;  2JUL A; 
#chains in the Genus database with same CATH homology
 1OMD A;  4CFQ A;  4FQO A;  1W7I B;  1V1G A;  1R2U A;  1S5G Z;  1NSH A;  5JJG A;  4MRX A;  3DVK A;  1QIW A;  1JUO A;  1EG3 A;  1IRJ A;  4ORC B;  2H2K A;  2FCE A;  1KQM C;  1TN4 A;  4OR9 B;  1K94 A;  2GGM A;  2FCD A;  1BR4 B;  2OS8 C;  1SCM C;  2M29 A;  4NDD A;  2LUX A;  3JTD C;  1J7O A;  3AKB A;  1DJY A;  3FWC A;  4D1E A;  1SR6 B;  1WRL A;  3BUN B;  1A75 B;  2BCA A;  1NYA A;  2RGI A;  1TOP A;  1SL7 A;  2MBX A;  1DT7 B;  2VRG A;  5KU1 A;  1OZO A;  1B7T Z;  1M46 A;  5KTY A;  3HCM A;  2LLT A;  1HT9 A;  2F8P A;  4GPL B;  2AUC A;  4CFR A;  1MWN A;  3E3R A;  3KHE A;  4MZK A;  1CLB A;  5DKN A;  2F3Y A;  2KBI A;  2HF5 A;  1WDC B;  1F55 A;  1LA0 A;  1BR1 B;  1K2H A;  1X02 A;  4YBH B;  1FF1 A;  3TUY B;  2G2B A;  4PHJ A;  2KOT A;  2WCB A;  2JRF A;  3I5H B;  2Y1M A;  5AAN A;  2ISD A;  1BOD A;  1SCV A;  2D8N A;  4CLN A;  5CPV A;  5I8N A;  1L7Z A;  4DRW A;  1F4O A;  2L98 A;  3DVJ A;  2K61 A;  3PFV A;  1MR8 A;  3LK0 A;  4PDZ A;  3TDZ A;  2ZRS A;  2P6B B;  3PN7 C;  1MXE A;  1F4Q A;  1B8R A;  1SBJ A;  3KF9 A;  2M9G A;  3PM8 A;  2BBN A;  1DJX A;  1C7W A;  4BY5 A;  3D0Y A;  4I5N B;  5I2L A;  1SMG A;  3VRO A;  1K9K A;  1K8U A;  1A2X A;  1PK0 D;  1W7J B;  2CTN A;  1IJ5 A;  4MSP A;  4NQG A;  2KI4 C;  1CKK A;  5AXI A;  2WND A;  2JT8 A;  1SY9 A;  1KCY A;  5DKR A;  2LLS A;  1XA5 A;  1NUB A;  2PAS A;  3BYA A;  1NPQ A;  3OHM B;  4MBE A;  4P5O E;  1B1G A;  5CSI A;  1QS7 A;  1EL4 A;  3AAJ A;  1BF5 A;  1YVH A;  1AUI B;  3I5F B;  1JFK A;  4N1G A;  2JTZ A;  1CMG A;  1N65 A;  1YX7 A;  1TRF A;  1ZAC A;  2AMI A;  3BUM B;  1IJ6 A;  1EH2 A;  1S26 D;  2HQW A;  2JZI A;  4HRH A;  2BE4 A;  2Y4Q A;  4WQ3 A;  3I5G B;  3TDI A;  3GK2 A;  3PAT A;  1SRA A;  4ORA B;  4WQ2 A;  1GGW A;  1JC2 A;  1PVB A;  2K2F A;  1CM4 A;  3VRN A;  2B1U A;  5HKZ A;  3CLN A;  2LP3 A;  2KNE A;  2EC6 C;  1SPY A;  4HRG A;  1KWO C;  3NSL A;  4MZL A;  2WCE A;  1LA3 A;  4PHK A;  3O2P A;  2JC2 A;  4ZCU A;  4PE4 A;  2NLN A;  3JVT B;  4M2O A;  4YI9 A;  1S6I A;  1RFJ A;  1QTX A;  2OTG B;  3FS7 A;  3IQO A;  4DCK A;  5HKY A;  4L9M A;  1MQ1 A;  3BUW B;  1WLM A;  4GNK B;  2KQY A;  1M45 A;  3VGO A;  4ZCV A;  2KAV A;  1FBV A;  3BQ3 A;  4ETO A;  3ZWH A;  2I7A A;  2L5X B;  1DJG A;  1ZUZ A;  3PAL A;  3SIA A;  5KSZ A;  5HLV A;  2LE9 B;  2OPO A;  1Y1X A;  1KSO A;  1H8B A;  1IQ5 A;  3MSE B;  1QX5 B;  1DVI A;  3GK1 A;  2EGD A;  2HPS A;  1FI5 A;  4MEW A;  3SG5 A;  2ZN8 A;  2SAS A;  1UUS A;  2BL0 C;  1WRZ A;  2SCP A;  1B8L A;  1DGU A;  1ALW A;  1YRT B;  2NCP A;  2LP2 A;  3EKJ A;  5G08 A;  5IBW A;  2LHI A;  1WRK A;  4XJK A;  3A8R A;  3GK4 X;  4CID A;  1QX7 A;  2AAO A;  2O60 A;  1D1O A;  1Y1A A;  1ZOT B;  5D7F A;  1E8A A;  1N2D A;  1H4B A;  1A03 A;  2ZRT A;  1BT6 A;  5JOL A;  1AJ5 A;  3NSI A;  1CNP A;  2CNP A;  2L4H A;  3WNX B;  1F54 A;  3SG4 A;  3CGA A;  2MAZ A;  1GQM A;  2JNX A;  3KEV A;  1YUU A;  3AKA A;  1SW8 A;  3LCP C;  1LVC D;  1QLS A;  2BCB A;  1S3P A;  1LXF C;  2L50 A;  1S36 A;  5DKQ A;  1CB1 A;  1S1E A;  1OSA A;  4GAO A;  4ORB B;  5K89 A;  4TNC A;  2LAP A;  3WHT B;  1M63 B;  4JWQ A;  1VRK A;  1SKT A;  2JQ6 A;  2V53 A;  3KPX A;  1NX1 A;  4I5J A;  2O5G A;  1YVL A;  4YI8 A;  2JOJ A;  2ZKM X;  1XFW O;  1R6P A;  1TNQ A;  1U5I B;  1XFZ O;  2Y5I A;  2NZ0 A;  1F8H A;  1QV0 A;  1UHI A;  1Y1U A;  3D0Y B;  1REC A;  1OMV A;  2LMV A;  1KK7 Y;  1KQV A;  3I5I C;  2KQ6 A;  1L2O C;  4MRY A;  4DUQ A;  4OKH A;  3TDU A;  4R1E A;  5AFP A;  3CR2 A;  3OB2 B;  1QAT A;  2LAN A;  1K90 D;  1K93 D;  1QIV A;  4PHM A;  5B8I B;  5I2O A;  5PAL A;  1MHO A;  3RM1 A;  3EKH A;  2KAY A;  2KI6 C;  2F33 A;  3DF0 B;  4ICB A;  1MF8 B;  4GFT A;  1B47 A;  1Q80 A;  4C0J A;  4PE7 A;  2E6W A;  1J7Q A;  1CLM A;  1CTR A;  5BPJ A;  1GGZ A;  1KK8 B;  2MLE C;  3ICB A;  1DJI A;  5ER5 A;  4OVN F;  2JNF A;  4YGD B;  4FTG A;  1KK7 Z;  1CDN A;  3LLE A;  4M2Q A;  2M7L A;  1MXL C;  1IWQ A;  2COL B;  2M3W A;  3NSO A;  1QAS A;  1CFC A;  1G33 A;  1KSM A;  2K0J A;  2NXQ A;  1B4C A;  2M49 B;  1QV1 A;  1SR6 C;  1IKU A;  1FW4 A;  1EG4 A;  1PRW A;  2BE6 A;  1KQM B;  4MVF A;  2KFH A;  3CR5 X;  4AQJ A;  2CCM A;  4P2Y B;  5GQQ C;  2OS8 B;  3PLF B;  1AP4 A;  1SCM B;  1SK6 D;  1KFX L;  4Q04 A;  4HSZ A;  1S6J A;  3CWG A;  3JTD B;  2MA2 A;  1DF0 B;  5CSF A;  1FPW A;  1WDC C;  1LKJ A;  1Y6W A;  3OP0 A;  4PCW A;  4YGA A;  3TUY C;  1TTX A;  1NIW A;  2CXJ A;  3SJS A;  1CFF A;  2PAL A;  1UWO A;  2KGB C;  3I5H C;  1IG5 A;  5F6T A;  4U8D A;  1UP5 A;  3O6B A;  2PMY A;  3DD4 A;  2CT9 A;  2I94 A;  2WC8 A;  3BUO B;  3DVM A;  1YRU B;  2JTT A;  1RRO A;  2QAC A;  2TN4 A;  2A4J A;  4WRI A;  3LK1 A;  3BOW A;  3SG2 A;  1CMF A;  3OB1 B;  2M0R A;  3SG6 A;  2HET A;  4YGC B;  1F71 A;  4MLW A;  1QJT A;  1ODB A;  1BG1 A;  3CTN A;  3IQQ A;  3HX4 A;  1TIZ A;  1CFD A;  1HQV A;  1YR5 A;  3EK7 A;  1A4P A;  1J55 A;  2F3Z A;  4JQ0 D;  4AOM A;  2L0P A;  1ALV A;  2JT3 A;  1YUT A;  2JU0 A;  1S6C A;  1B8C A;  2K7C A;  3TS5 B;  4XJK B;  2G9B A;  1XFX O;  5CSJ A;  2PRU A;  1KFU L;  2ZFD A;  2BBM A;  4GBA A;  3K21 A;  2MLF C;  1ZFS A;  3PN7 B;  2L4I A;  3O4Y A;  2KFF A;  2MRD A;  4UPG A;  1DTL A;  3NXA A;  1NP8 A;  1BOC A;  4CPV A;  5HYD A;  2DOQ A;  1WLZ A;  4N5X A;  1QX2 A;  1CM1 A;  2H61 A;  5I2Q A;  4GGF C;  1TCO B;  5HKW A;  2HQ8 A;  5AEQ A;  2BKH B;  2K7O A;  2LNK A;  1J1D A;  1AVS A;  3I5F C;  4QJ3 B;  1OZS A;  2LVI A;  1OE9 B;  1CLL A;  2M7N A;  4HRE E;  3H4S E;  2BCX A;  2WOR A;  2K8M B;  4YGB B;  1DGV A;  1DJZ A;  1OMR A;  3I5G C;  2EHB A;  1TNP A;  1JF0 A;  2ZN9 A;  1PUL A;  2JXC A;  3DVE A;  1NCY A;  2KSP A;  2LM5 A;  4GGN A;  1IGV A;  1UHK A;  2KBM A;  4PE1 A;  2E30 A;  1J1E A;  1IH0 A;  3C1V A;  3VRP A;  3IF7 A;  3EK8 A;  3GOF A;  4A4B A;  1QLK A;  3CS1 A;  1J7P A;  2I2R E;  1XO5 A;  1NX3 A;  3FIA A;  1GJY A;  2IS9 A;  3JVT C;  5J3X A;  1YUR A;  4I5K A;  2H61 C;  2KDH A;  2OTG C;  2BEC A;  3QRX A;  2KI6 D;  3F45 A;  2EC6 B;  3OX5 A;  1RTP 1;  1KWO B;  2LC5 A;  1AK8 A;  1XFY O;  5TNC A;  1G8I A;  1K95 A;  1ZMZ A;  4AQI A;  4MN0 A;  1A75 A;  2WCF A;  2M1U A;  2K7B A;  1BMO A;  2MHH A;  1CFP A;  5ER4 X;  2M1K B;  1SL8 A;  2Q4U A;  3TZ1 A;  2LMT A;  4XYN A;  2NCO A;  1IQ3 A;  3SIB A;  1JWD A;  4OCI A;  2K2A A;  2LV7 A;  3WXA A;  1KFX S;  3FWB A;  2L51 A;  3TS5 C;  4MZJ A;  1QVI Y;  3PSR A;  1YX8 A;  2I18 A;  1OOJ A;  1TNW A;  4PAL A;  1EJ3 A;  1XVJ A;  2JT0 A;  2Y1N A;  4BY4 A;  1NWD A;  4A4C A;  1U5I A;  1DJW A;  1SNL A;  2PVB A;  1SL9 A;  1V1F A;  1XFU O;  2LMU A;  1OQP A;  1QXP A;  2WOS A;  1BJF A;  4M2P A;  3CZT X;  1MUX A;  2GGZ A;  3OX6 A;  4PHN A;  4JPZ B;  2MJW B;  4GUK A;  1XYD A;  3D10 A;  1JF2 A;  5D69 A;  1PSB A;  1UHN A;  4IL1 A;  1G4Y R;  2BL0 B;  5CSN A;  1CDP A;  1WY9 A;  3NSK A;  2KYC A;  4E68 A;  4I5L B;  1QVI Z;  3AAK A;  3DF0 A;  1NCZ A;  1M31 A;  1YTZ C;  3M0W A;  2ZND A;  1NCX A;  1AJ4 A;  1XFV O;  2FJU B;  2LVV A;  1K96 A;  3ZNI A;  3O78 A;  1BLQ A;  4NDC A;  5FYX A;  1UHH A;  5HLO A;  1KFU S;  4DIR A;  4USL A;  1JBA A;  1K9U A;  4C0K A;  3BOW B;  2K7D A;  1CDL A;  2Q91 A;  1XK4 A;  4DS7 A;  3BUX B;  1M39 A;  1PVA A;  1UUR A;  1DMO A;  1F70 A;  4GGF A;  1LIN A;  2FOT A;  1SYM A;  4NDB A;  1RK9 A;  1TNX A;  2LHL A;  3RLZ A;  1FI6 A;  3A4U B;  1CDM A;  1K9P A;  1UHJ A;  2LUC A;  2R2I A;  3CR4 X;  2KYF A;  4C0L A;  2PSR A;  3LL8 B;  1TCF A;  2JPT A;  3SG7 A;  1JFJ A;  3EK4 A;  4PE0 A;  1N0Y A;  2GV5 A;  2LVJ A;  2BKI B;  2LVK A;  3BXK A;  5AER A;  1YUS A;  2CBL A;  2M8U A;  2QPT A;  3EVV A;  3EVR A;  2KAX A;  4YGE B;  1B9A A;  2KHN A;  1S5G Y;  1PAL A;  4F0Z B;  3SG3 A;  2LLU A;  3I5I B;  1AHR A;  1L2O B;  3VRQ A;  2LCP A;  2M97 A;  3EVU A;  4N1F A;  3WHU B;  1JSA A;  2F2P A;  1DF0 A;  1EXR A;  2KFG A;  2JWW A;  2KGR A;  2ZNE A;  1KK8 C;  1C07 A;  4QJ5 B;  4OV2 A;  1DJH A;  1RJV A;  1NX2 A;  1RWY A;  2F2O A;  1XK4 C;  3KO0 A;  2JXL A;  1Y0V H;  1NX0 A;  2L2E A;  1A29 A;  1J7R A;  4QJ4 B;  1PSR A;  2KI4 B;  1BU3 A;  4YRU A;  1C7V A;  1B7T Y;  3VRR A;  2JUL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...