1L7ZA

Crystal structure of ca2+/calmodulin complexed with myristoylated cap-23/nap-22 peptide
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
144
structure length
142
Chain Sequence
QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein/protein binding
molecule keywords CALMODULIN
publication title Crystal structure of a myristoylated CAP-23/NAP-22 N-terminal domain complexed with Ca2+/calmodulin
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 142
sequence length 144
ec nomenclature
pdb deposition date 2002-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1l7zA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1l7zA02
2Y1MA 1BG1A 1C07A 4M2QA 1SR6C 3CS1A 5BPJA 1DJIA 1GJYA 1QX5B 2BL0B 1L7ZA 1EXRA 1XK4A 3AAKA 2F2PA 1IGVA 5J3XA 3TDZA 5GQQC 4CFRA 1ALWA 4MLWA 2ISDA 1N2DA 4DRWA 2KQ6A 1TOPA 1WRKA 5JJGA 4D1EA 1CLBA 2I7AA 1IJ6A 1ZUZA 2L98A 1H4BA 1S6IA 3I5FC 2KFHA 3NSOA 2KI6D 2NCPA 3I5GB 3I5IB 1CFPA 1QX7A 2BBMA 1WLZA 1NCYA 1PSRA 1B8CA 3C1VA 2KI4B 3KO0A 2FCDA 1B8RA 1TCFA 4PE7A 1NCXA 2JT0A 4N5XA 2ZNEA 1XFUO 1BU3A 5CSIA 3BOWB 1YTZC 1YURA 3CWGA 2LV7A 2F8PA 2HQWA 2M9GA 3NSKA 4L9MA 1SKTA 2LNKA 1RECA 1HQVA 1RTP1 3BOWA 3CTNA 1BMOA 1XVJA 2KBMA 3GK4X 1XFXO 3KF9A 3FWBA 3IQOA 4OCIA 2G9BA 3JTDC 4MZLA 1UURA 1EH2A 1MXEA 1CDLA 1QV0A 3WHTB 4CPVA 1OQPA 1U5IB 1B4CA 2LLUA 2KFGA 1KWOB 2KAVA 1U5IA 1F4QA 1AHRA 5FYXA 1TIZA 1F4OA 1MXLC 2AMIA 1J1DA 1MQ1A 3EKJA 1V1FA 1K2HA 1BLQA 3IQQA 1S6CA 4OV2A 4UPGA 1QLSA 1UP5A 3EK8A 1M45A 1N65A 4GAOA 4GGFC 4MN0A 1L2OB 4PHKA 4JPZB 4I5LB 2PMYA 1AUIB 2LM5A 2JU0A 1A03A 1PVBA 4NDCA 1YRUB 2V53A 2OTGC 3SJSA 1F71A 1CDPA 3FS7A 1F55A 1DJWA 1N0YA 5ER4X 3VRPA 4WQ3A 3PALA 1SW8A 1FBVA 3E3RA 1EG4A 1AP4A 4A4CA 4A4BA 1PULA 1JUOA 2JXCA 2AAOA 1Q80A 2COLB 3O2PA 2WCFA 2HF5A 1NX0A 2HQ8A 3IF7A 1QIWA 1XK4C 2LLTA 1GGWA 3NXAA 1KCYA 2K2AA 5CSFA 2Q4UA 3DVJA 3TDUA 4TNCA 3NSLA 1NX3A 1JWDA 1KQVA 4HRHA 2KNEA 4PE0A 2OS8B 2KI6C 1JF0A 2LP3A 3BUMB 3JVTC 5AERA 1MWNA 1ALVA 5ER5A 5I2LA 3SG6A 1XFZO 1CFCA 1K90D 2L0PA 3I5GC 2KYFA 4HRGA 4OR9B 3EVVA 4Q04A 1UHIA 3ZNIA 2CBLA 1LVCD 2MA2A 2SCPA 3PATA 3BYAA 1S1EA 2M3WA 5DKNA 3TUYC 1CTRA 2LCPA 2IS9A 2F3YA 4N1GA 4ORCB 1PALA 5KU1A 3QRXA 5HLOA 1Y1UA 1WDCC 1KQMC 1YRTB 2M97A 3FWCA 2E6WA 3AKAA 1OZSA 1OMVA 1AVSA 2CXJA 4NQGA 4C0JA 1JF2A 1OMDA 1KWOC 1TNPA 1PVAA 1YUUA 5G08A 1OMRA 2LP2A 4MBEA 1OOJA 4USLA 1YX7A 1SRAA 1V1GA 2BKHB 2LMVA 4BY5A 3EK4A 5D7FA 2Y5IA 1K93D 4HSZA 2CT9A 1KFXL 1SBJA 2LVKA 2AUCA 1S36A 2MBXA 1K96A 3BUOB 1L2OC 2M1UA 1J55A 4NDBA 1CB1A 1BJFA 2I18A 2I94A 3TS5B 2JNFA 1NCZA 2CCMA 3TDIA 1TRFA 2Q91A 2MJWB 3WNXB 4ETOA 1UHJA 1CLMA 1S6JA 1SMGA 5CSJA 3TZ1A 3ICBA 4HREE 4MZJA 2JXLA 3PM8A 3NSIA 5HYDA 3DF0B 4YI8A 1ODBA 2HETA 1DJHA 1B1GA 2H2KA 2LE9B 2WC8A 3SG2A 4DCKA 2Y4QA 1UHKA 3OB2B 3PLFB 1NP8A 4GNKB 4DUQA 2O60A 3SG4A 1KK8B 1K9PA 4FQOA 1RJVA 1CDNA 1A2XA 1M39A 1CMGA 4I5KA 4AQJA 2M8UA 2EC6C 2LHIA 4FTGA 1DT7B 3AKBA 1WRZA 2LVVA 2M0RA 1LA3A 2JC2A 2OS8C 2EGDA 2GV5A 2M7LA 1IRJA 1YVLA 3CR4X 1M31A 3O78A 1DF0B 3OB1B 4PCWA 2PRUA 3BUNB 1BR1B 2WORA 5CSNA 1DF0A 5B8IB 1AK8A 2WCBA 2NCOA 1K9KA 4GFTA 1UWOA 3OHMB 2JNXA 4YGAA 2LC5A 1LXFC 3SIAA 4C0KA 5AFPA 1VRKA 2M1KB 3DVKA 2F2OA 2F33A 1H8BA 1NWDA 1B8LA 1ZOTB 2LMUA 4CFQA 1UUSA 3D0YB 5KTYA 3I5FB 1J1EA 1SL7A 1PSBA 2K8MB 2PASA 3VGOA 3D0YA 1DJZA 4MRXA 2RGIA 1YVHA 1MF8B 2L5XB 1R6PA 2KGRA 3OX5A 2BL0C 3RLZA 1G8IA 1QATA 4N1FA 2JZIA 2LUXA 2LANA 4PHNA 3WHUB 2JOJA 4BY4A 1DMOA 4PE4A 2KQYA 5HKWA 2BKIB 3AAJA 1FI5A 1FI6A 2L50A 3MSEB 4MZKA 2M49B 2M7NA 1BOCA 2MLEC 1C7WA 5I2OA 2A4JA 2ZRTA 3EVUA 1GGZA 1Y6WA 2KFFA 2Y1NA 1D1OA 1BODA 3I5IC 2LAPA 1XFVO 2LMTA 5DKRA 3TS5C 2KI4C 4M2OA 2D8NA 3LCPC 5I2QA 5HKYA 5DKQA 1J7PA 3BXKA 3RM1A 1Y0VH 1KSOA 2HPSA 1UHNA 3LK1A 2ZNDA 2B1UA 2E30A 3O6BA 1RWYA 2BECA 2K2FA 1M63B 1K9UA 1A75B 3SG7A 2L2EA 2QPTA 1KFUS 1A75A 5AANA 1HT9A 1BR4B 1XYDA 3PFVA 1SPYA 2NXQA 2JT3A 3D10A 1KK8C 4U8DA 1SNLA 1UHHA 4GBAA 5AXIA 3OX6A 2DOQA 2OTGB 1R2UA 1XFWO 1Y1XA 4YGDB 1RROA 1B9AA 3BQ3A 3O4YA 5HKZA 4R1EA 2FCEA 4PALA 1SK6D 1W7IB 2KBIA 1SCMB 4GGNA 2NLNA 3CR5X 5I8NA 4QJ5B 1CDMA 1NYAA 1NPQA 2LVJA 4XJKB 1EJ3A 1ZFSA 3I5HB 4GPLB 3K21A 1DJGA 3DVEA 3VRQA 4XJKA 4F0ZB 1A29A 1YUSA 3SG5A 4PHMA 1CLLA 1TNWA 2H61A 3A4UB 5IBWA 2TN4A 1KK7Z 4IL1A 1J7OA 2F3ZA 5D69A 1B7TZ 1JC2A 4JWQA 1CMFA 2K7BA 5KSZA 1QASA 1F70A 1WLMA 3PSRA 5HLVA 1DGUA 2WOSA 3WXAA 3OP0A 1IWQA 1Y1AA 1CFFA 3SG3A 1YX8A 1CFDA 3JVTB 4MVFA 1IKUA 1FPWA 1LINA 3CZTX 1LKJA 3DF0A 4YRUA 1JFJA 5K89A 5JOLA 1AJ5A 4AQIA 1NX1A 2L4IA 2JTTA 3M0WA 2GGZA 2MAZA 3CGAA 4MRYA 4PDZA 3BUWB 3TUYB 2OPOA 2CNPA 1MUXA 4YGCB 1FF1A 3GK2A 4DS7A 1G4YR 1F8HA 1M46A 2KOTA 1TCOB 3EVRA 2CTNA 2ZKMX 4OKHA 1WDCB 2KSPA 1KQMB 1C7VA 1SYMA 1X02A 3PN7B 2K7CA 2ZN8A 3HCMA 1XFYO 2PSRA 1IQ3A 2KHNA 2M29A 1KK7Y 1JSAA 2WCEA 4WQ2A 1B7TY 1S3PA 1NUBA 1PK0D 1NIWA 2BCAA 2SASA 2BE6A 1OE9B 1S5GZ 1NX2A 3KPXA 1SR6B 2LVIA 4YGBB 2MRDA 1YUTA 2JTZA 4ORBB 1WY9A 1B47A 1J7RA 1JBAA 2KDHA 1MHOA 1TN4A 5TNCA 2LHLA 3KEVA 1DTLA 1TNQA 2PALA 2BE4A 3F45A 1SL9A 1SL8A 1QX2A 2JQ6A 1DGVA 1J7QA 4MEWA 1SY9A 2O5GA 1AJ4A 1EL4A 1WRLA 3VRNA 2BBNA 1G33A 2MLFC 3H4SE 4I5NB 4JQ0D 4ZCUA 2QACA 1QXPA 1F54A 2BCXA 4NDDA 3FIAA 1IJ5A 4CIDA 2KAXA 1QVIZ 1CM4A 1K95A 4XYNA 3CR2A 3ZWHA 1OSAA 3DD4A 1W7JB 4QJ4B 3VRRA 1BF5A 2JRFA 3SIBA 2PVBA 2K7DA 4QJ3B 5F6TA 1CM1A 4YGEB 4C0LA 1QV1A 1SCMC 2ZFDA 1FW4A 2FOTA 3CLNA 3GK1A 1S5GY 3LK0A 1RFJA 1IH0A 1TNXA 1RK9A 2BCBA 3I5HC 5AEQA 2WNDA 1IG5A 2ZRSA 3JTDB 4I5JA 2H61C 2L4HA 1QTXA 2JPTA 1OZOA 3LL8B 5PALA 1DJYA 2EHBA 3EK7A 3KHEA 1XO5A 4M2PA 1A4PA 2MHHA 2EC6B 2JULA 3DVMA 4P5OE 1K94A 2VRGA 1DJXA 1BT6A 1NSHA 3BUXB 2P6BB 5CPVA 2L51A 4YI9A 1CNPA 1EG3A 3HX4A 2K7OA 1YR5A 2NZ0A 4ORAB 4OVNF 3GOFA 4ZCVA 2KGBC 2ZN9A 1MR8A 1QJTA 4WRIA 2G2BA 1QVIY 4MSPA 1QIVA 3VROA 2JT8A 4YBHB 4GGFA 3A8RA 3LLEA 2K0JA 1KSMA 1DVIA 1GQMA 1TTXA 2K61A 2R2IA 2LUCA 4E68A 1S26D 1ZMZA 4AOMA 4DIRA 1IQ5A 2JWWA 2I2RE 2KYCA 4P2YB 1CKKA 4PHJA 1JFKA 2FJUB 1QLKA 1KFUL 4ICBA 1PRWA 3PN7C 1XA5A 1K8UA 4CLNA 1ZACA 1KFXS 1SCVA 4PE1A 1E8AA 1LA0A 3EKHA 4GUKA 2KAYA 2LLSA 1QS7A 2GGMA
chains in the Genus database with same CATH superfamily
2Y1MA 4IJ7A 1BG1A 1C07A 4M2QA 1SR6C 3CS1A 5BPJA 1DJIA 1GJYA 1QX5B 1XK4A 1L7ZA 1EXRA 2BL0B 3AAKA 2F2PA 1IGVA 5J3XA 3TDZA 5GQQC 3NHIA 4CFRA 1ALWA 4MLWA 2ISDA 3S0BA 1N2DA 4DRWA 2KQ6A 1TOPA 1WRKA 5JJGA 4D1EA 1CLBA 2I7AA 1IJ6A 1ZUZA 4JKTA 3VB1A 2L98A 1H4BA 1S6IA 3I5FC 3CDNA 2KFHA 3NSOA 2KI6D 3BFHA 2NCPA 3I5GB 3I5IB 1CFPA 3R1VA 1QX7A 2BBMA 1WLZA 1NCYA 1PSRA 1B8CA 3C1VA 2KI4B 3KO0A 2FCDA 1GM0A 1B8RA 5DICA 1TCFA 1W9ZA 4PE7A 3CZ1A 1NCXA 2JT0A 4N5XA 3SS5A 2ZNEA 1XFUO 1BU3A 5CSIA 5D3OA 3BOWB 1YTZC 1YURA 3CWGA 2LV7A 2F8PA 2HQWA 1TUZA 2M9GA 3NSKA 1SKTA 4L9MA 2LNKA 1RECA 1HQVA 1RTP1 3BOWA 3CTNA 1BMOA 1XVJA 2KBMA 3CABA 1XFXO 3FE6A 3GK4X 3FWBA 3IQOA 3KF9A 4OCIA 2G9BA 3JTDC 4MZLA 1UURA 3S0GA 1EH2A 3D75A 1MXEA 2K60A 1CDLA 1QV0A 3WHTB 4CPVA 1OQPA 1U5IB 1B4CA 2LLUA 2KFGA 1KWOB 2KAVA 1U5IA 1F4QA 1AHRA 5FYXA 1TIZA 1F4OA 1MXLC 2AMIA 1J1DA 1MQ1A 3EKJA 3D74A 1V1FA 1K2HA 1BLQA 1OOHA 3IQQA 1S6CA 4OV2A 4UPGA 1QLSA 1UP5A 3EK8A 4FQTA 1M45A 1N65A 2GTEA 4GAOA 4GGFC 4MN0A 3Q8IA 1L2OB 4PHKA 4JPZB 3S0DA 4I5LB 2PMYA 1AUIB 1OOGA 2LM5A 2JU0A 1A03A 1PVBA 3PJIA 2WCHA 4NDCA 3S0FA 1YRUB 2V53A 2OTGC 3SJSA 1F71A 1CDPA 3FS7A 3R1PA 1F55A 1DJWA 1N0YA 2QEOA 5ER4X 2KPHA 3VRPA 4WQ3A 3PALA 1SW8A 1FBVA 3E3RA 1EG4A 5EL2A 1AP4A 3L4LA 4A4CA 4A4BA 1PULA 1JUOA 2JXCA 2PQLA 2AAOA 1Q80A 2COLB 3O2PA 2WCFA 2HF5A 1NX0A 2BAPA 3L47A 2HQ8A 3IF7A 3O4XA 1QIWA 1XK4C 2LLTA 1GGWA 3NXAA 1KCYA 2K2AA 5CSFA 2Q4UA 3DVJA 3TDUA 3NGVA 4TNCA 3NSLA 5FI6A 1NX3A 1JWDA 1KQVA 4HRHA 2KNEA 4PE0A 2OS8B 2KI6C 1JF0A 2LP3A 3BUMB 3JVTC 5AERA 1MWNA 1ALVA 5ER5A 5I2LA 3SG6A 1XFZO 1CFCA 1K90D 2L0PA 3I5GC 2KYFA 4HRGA 4OR9B 3EVVA 4Q04A 1UHIA 3ZNIA 2CBLA 1LVCD 2MA2A 2SCPA 3PATA 3BYAA 1S1EA 2M3WA 5DKNA 3TUYC 1CTRA 2LCPA 2IS9A 2F3YA 4N1GA 4ORCB 1PALA 5KU1A 3UNWA 3QRXA 5HLOA 1Y1UA 1WDCC 1KQMC 1YRTB 2M97A 3FWCA 2E6WA 3AKAA 1OZSA 2QDIA 1OOIX 1OMVA 1AVSA 2CXJA 4NQGA 1DEKA 4C0JA 1JF2A 1OMDA 3D76A 1KWOC 1TNPA 1PVAA 1YUUA 5G08A 1OMRA 2LP2A 4MBEA 1OOJA 4USLA 1YX7A 1SRAA 5I94A 1V1GA 2BKHB 2LMVA 2WC6A 4BY5A 3EK4A 5D7FA 2Y5IA 1K93D 4HSZA 2CT9A 1KFXL 1SBJA 2LVKA 2AUCA 1S36A 2MBXA 1K96A 3BUOB 3N7HA 1L2OC 2M1UA 1J55A 4NDBA 1CB1A 1BJFA 2I18A 3OGNA 2I94A 3TS5B 2JNFA 3R1OA 1NCZA 2CCMA 3TDIA 1TRFA 3S0EA 3V2LA 2Q91A 2MJWB 3WNXB 4ETOA 1UHJA 1CLMA 3RZSA 1S6JA 1SMGA 5CSJA 3TZ1A 3ICBA 3BJHA 4HREE 4MZJA 2JXLA 3PM8A 3NSIA 5HYDA 3DF0B 4YI8A 1ODBA 2HETA 1DJHA 1B1GA 2H2KA 2LE9B 2WC8A 3SG2A 4DCKA 2Y4QA 1UHKA 3OB2B 3PLFB 1NP8A 4GNKB 4DUQA 2O60A 3SG4A 1KK8B 1K9PA 4FQOA 1RJVA 1CDNA 1A2XA 1M39A 3B7AA 3DYEA 4I5KA 1CMGA 4AQJA 5HL1A 2M8UA 2EC6C 2LHIA 4FTGA 1DT7B 3AKBA 1WRZA 2LVVA 2KLDA 2M0RA 3B6XA 1LA3A 2JC2A 2OS8C 2EGDA 2GV5A 2M7LA 1IRJA 1YVLA 3CR4X 3FE8A 2L2CA 1M31A 3O78A 1DF0B 3OB1B 4PCWA 2PRUA 3BUNB 1BR1B 2WORA 5CSNA 1DF0A 3BFAA 5B8IB 3S0AA 1AK8A 2WCBA 2NCOA 1K9KA 4GFTA 1UWOA 3OHMB 2JNXA 4YGAA 2LC5A 1LXFC 1P28A 3SIAA 4C0KA 5AFPA 1VRKA 2M1KB 3DVKA 2F2OA 2F33A 1H8BA 1NWDA 1B8LA 1ZOTB 2LMUA 4CFQA 1UUSA 3D0YB 5KTYA 3I5FB 1J1EA 1SL7A 1PSBA 2K8MB 2PASA 1C3YA 3VGOA 3D0YA 1DJZA 4MRXA 2FJYA 2RGIA 1YVHA 1MF8B 2L5XB 1R6PA 2KGRA 3OX5A 3D78A 2BL0C 3RLZA 1G8IA 1QATA 4N1FA 2QEHA 2JZIA 2LUXA 2LANA 3CZ2A 4PHNA 2JOJA 3WHUB 4BY4A 1DMOA 4PE4A 1IIOA 2KQYA 5HKWA 2BKIB 3AAJA 1FI5A 1FI6A 2L50A 3MSEB 4MZKA 2M49B 2M7NA 1BOCA 2MLEC 1C7WA 5I2OA 2A4JA 2ZRTA 3EVUA 1GGZA 1Y6WA 2KFFA 2Y1NA 1D1OA 1BODA 3I5IC 2LAPA 1XFVO 2LMTA 5DKRA 4OZDA 3TS5C 2KI4C 4M2OA 2D8NA 3LCPC 5I2QA 5HKYA 5DKQA 1J7PA 1TWOA 3BXKA 3RM1A 1Y0VH 1KSOA 2HPSA 1UHNA 3LK1A 2ZNDA 2B1UA 2E30A 3O6BA 1RWYA 2BECA 2K2FA 1M63B 1K9UA 1A75B 3BFBA 3CZ0A 2L2EA 2QPTA 3SG7A 1DQEA 1KFUS 3SS3A 1A75A 5AANA 1HT9A 1BR4B 1XYDA 3PFVA 1SPYA 2NXQA 2JT3A 3D10A 1LS8A 3IVTA 1KK8C 1DC1A 4U8DA 3R72A 1SNLA 1UHHA 4GBAA 5AXIA 3OX6A 2DOQA 2OTGB 1R2UA 1XFWO 1Y1XA 4YGDB 1RROA 1B9AA 3BQ3A 3O4YA 5HKZA 4R1EA 2FCEA 4PALA 1SK6D 1W7IB 2KBIA 1SCMB 4GGNA 2NLNA 3CR5X 5I8NA 4QJ5B 1CDMA 1NYAA 1NPQA 2WCKA 2LVJA 4XJKB 1EJ3A 2BNXA 1ZFSA 3I5HB 4GPLB 3K21A 1DJGA 3DVEA 3VRQA 4XJKA 4F0ZB 1A29A 1YUSA 3SG5A 4PHMA 1CLLA 1TNWA 2H61A 3A4UB 5IBWA 2QEVA 2TN4A 1KK7Z 4IL1A 1J7OA 2F3ZA 5D69A 1B7TZ 1JC2A 4JWQA 1CMFA 3DZTA 3DY9A 2K7BA 5KSZA 1QASA 3D73A 1F70A 1WLMA 3PSRA 5HLVA 1DGUA 2WOSA 3WXAA 3OP0A 1IWQA 1TUJA 1Y1AA 1CFFA 3SG3A 1YX8A 1CFDA 3JVTB 4MVFA 1IKUA 1ORGA 1LINA 3CZTX 1FPWA 1LKJA 3DF0A 4YRUA 1JFJA 5K89A 2WC5A 5JOLA 1AJ5A 3UO9A 1NX1A 2L4IA 4AQIA 2JTTA 3M0WA 2GGZA 2MAZA 3CGAA 4MRYA 3DXLA 3BUWB 4PDZA 1XFRA 3OBVA 2OPOA 2CNPA 3TUYB 1MUXA 4YGCB 1FF1A 3GK2A 4DS7A 1G4YR 1F8HA 1M46A 2KOTA 1TCOB 3EG5B 2CTNA 3EVRA 1QWVA 2ZKMX 4OKHA 1WDCB 2KSPA 1KQMB 4KYNA 1C7VA 1SYMA 1X02A 3PN7B 2K7CA 2ZN8A 3HCMA 1XFYO 3D77A 2PSRA 1IQ3A 2KHNA 2M29A 1KK7Y 1JSAA 2WCEA 4WQ2A 1B7TY 1S3PA 1NUBA 1PK0D 1NIWA 2BCAA 2SASA 2BE6A 1OE9B 1S5GZ 1NX2A 3KPXA 1SR6B 1C3ZA 2LVIA 4INXA 4YGBB 2MRDA 3FE9A 1YUTA 2JTZA 4ORBB 1WY9A 1B47A 1J7RA 1JBAA 2KDHA 1MHOA 1TN4A 5TNCA 2LHLA 3KEVA 1DTLA 1TNQA 2PALA 2BE4A 5FI7A 3F45A 1SL9A 1SL8A 1QX2A 2JQ6A 1DGVA 2WCMA 1J7QA 4MEWA 2P70A 1SY9A 2O5GA 1AJ4A 2JPOA 1EL4A 1WRLA 3QMEA 3VRNA 2BBNA 1G33A 2MLFC 3H4SE 4I5NB 4JD9A 4JQ0D 4ZCUA 2QACA 1QXPA 1F54A 2BCXA 4NDDA 3FIAA 1IJ5A 4CIDA 2KAXA 1QVIZ 1CM4A 1K95A 1Z4HA 3CR2A 4XYNA 1OSAA 3DD4A 1W7JB 3ZWHA 4QJ4B 3VRRA 1BF5A 2JRFA 3SIBA 2PVBA 2K7DA 4QJ3B 5F6TA 1CM1A 4YGEB 4C0LA 1QV1A 1SCMC 2QEBA 2ZFDA 1FW4A 2FOTA 3CLNA 3GK1A 1S5GY 3LK0A 1RFJA 3B87A 2P71A 4PT1A 1IH0A 1TNXA 1RK9A 2BCBA 3I5HC 5AEQA 2WNDA 1IG5A 2ZRSA 3JTDB 4I5JA 2H61C 2L4HA 2KLEA 3PM2A 1QTXA 1T14A 1OZOA 2JPTA 3LL8B 3B86A 5PALA 3B88A 1DJYA 4F7FA 2EHBA 3EK7A 3KHEA 1XO5A 4M2PA 1A4PA 2MHHA 2EC6B 2JULA 3DVMA 4P5OE 1K94A 2VRGA 1DJXA 1BT6A 1NSHA 3BUXB 2P6BB 5CPVA 2ERBA 2L51A 4YI9A 1EG3A 3HX4A 2K7OA 1CNPA 1YR5A 2NZ0A 2WCJA 4ORAB 4OVNF 3GOFA 4ZCVA 2KGBC 2ZN9A 1MR8A 1QJTA 2L5YA 4WRIA 2G2BA 1QVIY 3NHTA 1QIVA 4MSPA 3VROA 2JT8A 4YBHB 4GGFA 3A8RA 1OOFA 3LLEA 2K0JA 1KSMA 2H8VA 1DVIA 1GQMA 1DELA 3CYZA 1TTXA 5FI2A 2K61A 2R2IA 2LUCA 4E68A 1S26D 1ZMZA 1SSEB 4AOMA 3SS4A 4DIRA 1IQ5A 2JWWA 2I2RE 2KYCA 2PYQA 2WCLA 4INWA 4P2YB 1CKKA 3L4AA 4PHJA 1JFKA 2FJUB 1QLKA 1KFUL 4ICBA 1PRWA 3PN7C 1XA5A 1K8UA 4CLNA 1ZACA 1KFXS 1SCVA 4PE1A 1OW4A 1E8AA 1LA0A 3EKHA 1Z2CB 4GUKA 2KAYA 2LLSA 1QS7A 2YGUA 3K1EA 2GGMA
chains in the Genus database with same CATH topology
2Y1MA 1BG1A 1C07A 4M2QA 1SR6C 3CS1A 5BPJA 1DJIA 1GJYA 1QX5B 2BL0B 1L7ZA 1EXRA 1XK4A 3AAKA 2F2PA 1IGVA 5J3XA 3TDZA 5GQQC 4CFRA 1ALWA 4MLWA 2ISDA 1N2DA 4DRWA 2KQ6A 1TOPA 1WRKA 5JJGA 4D1EA 1CLBA 2I7AA 1IJ6A 1ZUZA 2L98A 1H4BA 1S6IA 3I5FC 2KFHA 3NSOA 2KI6D 2NCPA 3I5GB 3I5IB 1CFPA 1QX7A 2BBMA 1WLZA 1NCYA 1PSRA 1B8CA 3C1VA 2KI4B 3KO0A 2FCDA 1B8RA 1TCFA 4PE7A 1NCXA 2JT0A 4N5XA 2ZNEA 1XFUO 1BU3A 5CSIA 3BOWB 1YTZC 1YURA 3CWGA 2LV7A 2F8PA 2HQWA 2M9GA 3NSKA 4L9MA 1SKTA 2LNKA 1RECA 1HQVA 1RTP1 3BOWA 3CTNA 1BMOA 1XVJA 2KBMA 3GK4X 1XFXO 3KF9A 3FWBA 3IQOA 4OCIA 2G9BA 3JTDC 4MZLA 1UURA 1EH2A 1MXEA 1CDLA 1QV0A 3WHTB 4CPVA 1OQPA 1U5IB 1B4CA 2LLUA 2KFGA 1KWOB 2KAVA 1U5IA 1F4QA 1AHRA 5FYXA 1TIZA 1F4OA 1MXLC 2AMIA 1J1DA 1MQ1A 3EKJA 1V1FA 1K2HA 1BLQA 3IQQA 1S6CA 4OV2A 4UPGA 1QLSA 1UP5A 3EK8A 1M45A 1N65A 4GAOA 4GGFC 4MN0A 1L2OB 4PHKA 4JPZB 4I5LB 2PMYA 1AUIB 2LM5A 2JU0A 1A03A 1PVBA 4NDCA 1YRUB 2V53A 2OTGC 3SJSA 1F71A 1CDPA 3FS7A 1F55A 1DJWA 1N0YA 5ER4X 3VRPA 4WQ3A 3PALA 1SW8A 1FBVA 3E3RA 1EG4A 1AP4A 4A4CA 4A4BA 1PULA 1JUOA 2JXCA 2AAOA 1Q80A 2COLB 3O2PA 2WCFA 2HF5A 1NX0A 2HQ8A 3IF7A 1QIWA 1XK4C 2LLTA 1GGWA 3NXAA 1KCYA 2K2AA 5CSFA 2Q4UA 3DVJA 3TDUA 4TNCA 3NSLA 1NX3A 1JWDA 1KQVA 4HRHA 2KNEA 4PE0A 2OS8B 2KI6C 1JF0A 2LP3A 3BUMB 3JVTC 5AERA 1MWNA 1ALVA 5ER5A 5I2LA 3SG6A 1XFZO 1CFCA 1K90D 2L0PA 3I5GC 2KYFA 4HRGA 4OR9B 3EVVA 4Q04A 1UHIA 3ZNIA 2CBLA 1LVCD 2MA2A 2SCPA 3PATA 3BYAA 1S1EA 2M3WA 5DKNA 3TUYC 1CTRA 2LCPA 2IS9A 2F3YA 4N1GA 4ORCB 1PALA 5KU1A 3QRXA 5HLOA 1Y1UA 1WDCC 1KQMC 1YRTB 2M97A 3FWCA 2E6WA 3AKAA 1OZSA 1OMVA 1AVSA 2CXJA 4NQGA 4C0JA 1JF2A 1OMDA 1KWOC 1TNPA 1PVAA 1YUUA 5G08A 1OMRA 2LP2A 4MBEA 1OOJA 4USLA 1YX7A 1SRAA 1V1GA 2BKHB 2LMVA 4BY5A 3EK4A 5D7FA 2Y5IA 1K93D 4HSZA 2CT9A 1KFXL 1SBJA 2LVKA 2AUCA 1S36A 2MBXA 1K96A 3BUOB 1L2OC 2M1UA 1J55A 4NDBA 1CB1A 1BJFA 2I18A 2I94A 3TS5B 2JNFA 1NCZA 2CCMA 3TDIA 1TRFA 2Q91A 2MJWB 3WNXB 4ETOA 1UHJA 1CLMA 1S6JA 1SMGA 5CSJA 3TZ1A 3ICBA 4HREE 4MZJA 2JXLA 3PM8A 3NSIA 5HYDA 3DF0B 4YI8A 1ODBA 2HETA 1DJHA 1B1GA 2H2KA 2LE9B 2WC8A 3SG2A 4DCKA 2Y4QA 1UHKA 3OB2B 3PLFB 1NP8A 4GNKB 4DUQA 2O60A 3SG4A 1KK8B 1K9PA 4FQOA 1RJVA 1CDNA 1A2XA 1M39A 1CMGA 4I5KA 4AQJA 2M8UA 2EC6C 2LHIA 4FTGA 1DT7B 3AKBA 1WRZA 2LVVA 2M0RA 1LA3A 2JC2A 2OS8C 2EGDA 2GV5A 2M7LA 1IRJA 1YVLA 3CR4X 1M31A 3O78A 1DF0B 3OB1B 4PCWA 2PRUA 3BUNB 1BR1B 2WORA 5CSNA 1DF0A 5B8IB 1AK8A 2WCBA 2NCOA 1K9KA 4GFTA 1UWOA 3OHMB 2JNXA 4YGAA 2LC5A 1LXFC 3SIAA 4C0KA 5AFPA 1VRKA 2M1KB 3DVKA 2F2OA 2F33A 1H8BA 1NWDA 1B8LA 1ZOTB 2LMUA 4CFQA 1UUSA 3D0YB 5KTYA 3I5FB 1J1EA 1SL7A 1PSBA 2K8MB 2PASA 3VGOA 3D0YA 1DJZA 4MRXA 2RGIA 1YVHA 1MF8B 2L5XB 1R6PA 2KGRA 3OX5A 2BL0C 3RLZA 1G8IA 1QATA 4N1FA 2JZIA 2LUXA 2LANA 4PHNA 3WHUB 2JOJA 4BY4A 1DMOA 4PE4A 2KQYA 5HKWA 2BKIB 3AAJA 1FI5A 1FI6A 2L50A 3MSEB 4MZKA 2M49B 2M7NA 1BOCA 2MLEC 1C7WA 5I2OA 2A4JA 2ZRTA 3EVUA 1GGZA 1Y6WA 2KFFA 2Y1NA 1D1OA 1BODA 3I5IC 2LAPA 1XFVO 2LMTA 5DKRA 3TS5C 2KI4C 4M2OA 2D8NA 3LCPC 5I2QA 5HKYA 5DKQA 1J7PA 3BXKA 3RM1A 1Y0VH 1KSOA 2HPSA 1UHNA 3LK1A 2ZNDA 2B1UA 2E30A 3O6BA 1RWYA 2BECA 2K2FA 1M63B 1K9UA 1A75B 3SG7A 2L2EA 2QPTA 1KFUS 1A75A 5AANA 1HT9A 1BR4B 1XYDA 3PFVA 1SPYA 2NXQA 2JT3A 3D10A 1KK8C 4U8DA 1SNLA 1UHHA 4GBAA 5AXIA 3OX6A 2DOQA 2OTGB 1R2UA 1XFWO 1Y1XA 4YGDB 1RROA 1B9AA 3BQ3A 3O4YA 5HKZA 4R1EA 2FCEA 4PALA 1SK6D 1W7IB 2KBIA 1SCMB 4GGNA 2NLNA 3CR5X 5I8NA 4QJ5B 1CDMA 1NYAA 1NPQA 2LVJA 4XJKB 1EJ3A 1ZFSA 3I5HB 4GPLB 3K21A 1DJGA 3DVEA 3VRQA 4XJKA 4F0ZB 1A29A 1YUSA 3SG5A 4PHMA 1CLLA 1TNWA 2H61A 3A4UB 5IBWA 2TN4A 1KK7Z 4IL1A 1J7OA 2F3ZA 5D69A 1B7TZ 1JC2A 4JWQA 1CMFA 2K7BA 5KSZA 1QASA 1F70A 1WLMA 3PSRA 5HLVA 1DGUA 2WOSA 3WXAA 3OP0A 1IWQA 1Y1AA 1CFFA 3SG3A 1YX8A 1CFDA 3JVTB 4MVFA 1IKUA 1FPWA 1LINA 3CZTX 1LKJA 3DF0A 4YRUA 1JFJA 5K89A 5JOLA 1AJ5A 4AQIA 1NX1A 2L4IA 2JTTA 3M0WA 2GGZA 2MAZA 3CGAA 4MRYA 4PDZA 3BUWB 3TUYB 2OPOA 2CNPA 1MUXA 4YGCB 1FF1A 3GK2A 4DS7A 1G4YR 1F8HA 1M46A 2KOTA 1TCOB 3EVRA 2CTNA 2ZKMX 4OKHA 1WDCB 2KSPA 1KQMB 1C7VA 1SYMA 1X02A 3PN7B 2K7CA 2ZN8A 3HCMA 1XFYO 2PSRA 1IQ3A 2KHNA 2M29A 1KK7Y 1JSAA 2WCEA 4WQ2A 1B7TY 1S3PA 1NUBA 1PK0D 1NIWA 2BCAA 2SASA 2BE6A 1OE9B 1S5GZ 1NX2A 3KPXA 1SR6B 2LVIA 4YGBB 2MRDA 1YUTA 2JTZA 4ORBB 1WY9A 1B47A 1J7RA 1JBAA 2KDHA 1MHOA 1TN4A 5TNCA 2LHLA 3KEVA 1DTLA 1TNQA 2PALA 2BE4A 3F45A 1SL9A 1SL8A 1QX2A 2JQ6A 1DGVA 1J7QA 4MEWA 1SY9A 2O5GA 1AJ4A 1EL4A 1WRLA 3VRNA 2BBNA 1G33A 2MLFC 3H4SE 4I5NB 4JQ0D 4ZCUA 2QACA 1QXPA 1F54A 2BCXA 4NDDA 3FIAA 1IJ5A 4CIDA 2KAXA 1QVIZ 1CM4A 1K95A 4XYNA 3CR2A 3ZWHA 1OSAA 3DD4A 1W7JB 4QJ4B 3VRRA 1BF5A 2JRFA 3SIBA 2PVBA 2K7DA 4QJ3B 5F6TA 1CM1A 4YGEB 4C0LA 1QV1A 1SCMC 2ZFDA 1FW4A 2FOTA 3CLNA 3GK1A 1S5GY 3LK0A 1RFJA 1IH0A 1TNXA 1RK9A 2BCBA 3I5HC 5AEQA 2WNDA 1IG5A 2ZRSA 3JTDB 4I5JA 2H61C 2L4HA 1QTXA 2JPTA 1OZOA 3LL8B 5PALA 1DJYA 2EHBA 3EK7A 3KHEA 1XO5A 4M2PA 1A4PA 2MHHA 2EC6B 2JULA 3DVMA 4P5OE 1K94A 2VRGA 1DJXA 1BT6A 1NSHA 3BUXB 2P6BB 5CPVA 2L51A 4YI9A 1CNPA 1EG3A 3HX4A 2K7OA 1YR5A 2NZ0A 4ORAB 4OVNF 3GOFA 4ZCVA 2KGBC 2ZN9A 1MR8A 1QJTA 4WRIA 2G2BA 1QVIY 4MSPA 1QIVA 3VROA 2JT8A 4YBHB 4GGFA 3A8RA 3LLEA 2K0JA 1KSMA 1DVIA 1GQMA 1TTXA 2K61A 2R2IA 2LUCA 4E68A 1S26D 1ZMZA 4AOMA 4DIRA 1IQ5A 2JWWA 2I2RE 2KYCA 4P2YB 1CKKA 4PHJA 1JFKA 2FJUB 1QLKA 1KFUL 4ICBA 1PRWA 3PN7C 1XA5A 1K8UA 4CLNA 1ZACA 1KFXS 1SCVA 4PE1A 1E8AA 1LA0A 3EKHA 4GUKA 2KAYA 2LLSA 1QS7A 2GGMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y1M A;  1BG1 A;  1C07 A;  4M2Q A;  1SR6 C;  3CS1 A;  5BPJ A;  1DJI A;  1GJY A;  1QX5 B;  2BL0 B;  1L7Z A;  1EXR A;  1XK4 A;  3AAK A;  2F2P A;  1IGV A;  5J3X A;  3TDZ A;  5GQQ C;  4CFR A;  1ALW A;  4MLW A;  2ISD A;  1N2D A;  4DRW A;  2KQ6 A;  1TOP A;  1WRK A;  5JJG A;  4D1E A;  1CLB A;  2I7A A;  1IJ6 A;  1ZUZ A;  2L98 A;  1H4B A;  1S6I A;  3I5F C;  2KFH A;  3NSO A;  2KI6 D;  2NCP A;  3I5G B;  3I5I B;  1CFP A;  1QX7 A;  2BBM A;  1WLZ A;  1NCY A;  1PSR A;  1B8C A;  3C1V A;  2KI4 B;  3KO0 A;  2FCD A;  1B8R A;  1TCF A;  4PE7 A;  1NCX A;  2JT0 A;  4N5X A;  2ZNE A;  1XFU O;  1BU3 A;  5CSI A;  3BOW B;  1YTZ C;  1YUR A;  3CWG A;  2LV7 A;  2F8P A;  2HQW A;  2M9G A;  3NSK A;  4L9M A;  1SKT A;  2LNK A;  1REC A;  1HQV A;  1RTP 1;  3BOW A;  3CTN A;  1BMO A;  1XVJ A;  2KBM A;  3GK4 X;  1XFX O;  3KF9 A;  3FWB A;  3IQO A;  4OCI A;  2G9B A;  3JTD C;  4MZL A;  1UUR A;  1EH2 A;  1MXE A;  1CDL A;  1QV0 A;  3WHT B;  4CPV A;  1OQP A;  1U5I B;  1B4C A;  2LLU A;  2KFG A;  1KWO B;  2KAV A;  1U5I A;  1F4Q A;  1AHR A;  5FYX A;  1TIZ A;  1F4O A;  1MXL C;  2AMI A;  1J1D A;  1MQ1 A;  3EKJ A;  1V1F A;  1K2H A;  1BLQ A;  3IQQ A;  1S6C A;  4OV2 A;  4UPG A;  1QLS A;  1UP5 A;  3EK8 A;  1M45 A;  1N65 A;  4GAO A;  4GGF C;  4MN0 A;  1L2O B;  4PHK A;  4JPZ B;  4I5L B;  2PMY A;  1AUI B;  2LM5 A;  2JU0 A;  1A03 A;  1PVB A;  4NDC A;  1YRU B;  2V53 A;  2OTG C;  3SJS A;  1F71 A;  1CDP A;  3FS7 A;  1F55 A;  1DJW A;  1N0Y A;  5ER4 X;  3VRP A;  4WQ3 A;  3PAL A;  1SW8 A;  1FBV A;  3E3R A;  1EG4 A;  1AP4 A;  4A4C A;  4A4B A;  1PUL A;  1JUO A;  2JXC A;  2AAO A;  1Q80 A;  2COL B;  3O2P A;  2WCF A;  2HF5 A;  1NX0 A;  2HQ8 A;  3IF7 A;  1QIW A;  1XK4 C;  2LLT A;  1GGW A;  3NXA A;  1KCY A;  2K2A A;  5CSF A;  2Q4U A;  3DVJ A;  3TDU A;  4TNC A;  3NSL A;  1NX3 A;  1JWD A;  1KQV A;  4HRH A;  2KNE A;  4PE0 A;  2OS8 B;  2KI6 C;  1JF0 A;  2LP3 A;  3BUM B;  3JVT C;  5AER A;  1MWN A;  1ALV A;  5ER5 A;  5I2L A;  3SG6 A;  1XFZ O;  1CFC A;  1K90 D;  2L0P A;  3I5G C;  2KYF A;  4HRG A;  4OR9 B;  3EVV A;  4Q04 A;  1UHI A;  3ZNI A;  2CBL A;  1LVC D;  2MA2 A;  2SCP A;  3PAT A;  3BYA A;  1S1E A;  2M3W A;  5DKN A;  3TUY C;  1CTR A;  2LCP A;  2IS9 A;  2F3Y A;  4N1G A;  4ORC B;  1PAL A;  5KU1 A;  3QRX A;  5HLO A;  1Y1U A;  1WDC C;  1KQM C;  1YRT B;  2M97 A;  3FWC A;  2E6W A;  3AKA A;  1OZS A;  1OMV A;  1AVS A;  2CXJ A;  4NQG A;  4C0J A;  1JF2 A;  1OMD A;  1KWO C;  1TNP A;  1PVA A;  1YUU A;  5G08 A;  1OMR A;  2LP2 A;  4MBE A;  1OOJ A;  4USL A;  1YX7 A;  1SRA A;  1V1G A;  2BKH B;  2LMV A;  4BY5 A;  3EK4 A;  5D7F A;  2Y5I A;  1K93 D;  4HSZ A;  2CT9 A;  1KFX L;  1SBJ A;  2LVK A;  2AUC A;  1S36 A;  2MBX A;  1K96 A;  3BUO B;  1L2O C;  2M1U A;  1J55 A;  4NDB A;  1CB1 A;  1BJF A;  2I18 A;  2I94 A;  3TS5 B;  2JNF A;  1NCZ A;  2CCM A;  3TDI A;  1TRF A;  2Q91 A;  2MJW B;  3WNX B;  4ETO A;  1UHJ A;  1CLM A;  1S6J A;  1SMG A;  5CSJ A;  3TZ1 A;  3ICB A;  4HRE E;  4MZJ A;  2JXL A;  3PM8 A;  3NSI A;  5HYD A;  3DF0 B;  4YI8 A;  1ODB A;  2HET A;  1DJH A;  1B1G A;  2H2K A;  2LE9 B;  2WC8 A;  3SG2 A;  4DCK A;  2Y4Q A;  1UHK A;  3OB2 B;  3PLF B;  1NP8 A;  4GNK B;  4DUQ A;  2O60 A;  3SG4 A;  1KK8 B;  1K9P A;  4FQO A;  1RJV A;  1CDN A;  1A2X A;  1M39 A;  1CMG A;  4I5K A;  4AQJ A;  2M8U A;  2EC6 C;  2LHI A;  4FTG A;  1DT7 B;  3AKB A;  1WRZ A;  2LVV A;  2M0R A;  1LA3 A;  2JC2 A;  2OS8 C;  2EGD A;  2GV5 A;  2M7L A;  1IRJ A;  1YVL A;  3CR4 X;  1M31 A;  3O78 A;  1DF0 B;  3OB1 B;  4PCW A;  2PRU A;  3BUN B;  1BR1 B;  2WOR A;  5CSN A;  1DF0 A;  5B8I B;  1AK8 A;  2WCB A;  2NCO A;  1K9K A;  4GFT A;  1UWO A;  3OHM B;  2JNX A;  4YGA A;  2LC5 A;  1LXF C;  3SIA A;  4C0K A;  5AFP A;  1VRK A;  2M1K B;  3DVK A;  2F2O A;  2F33 A;  1H8B A;  1NWD A;  1B8L A;  1ZOT B;  2LMU A;  4CFQ A;  1UUS A;  3D0Y B;  5KTY A;  3I5F B;  1J1E A;  1SL7 A;  1PSB A;  2K8M B;  2PAS A;  3VGO A;  3D0Y A;  1DJZ A;  4MRX A;  2RGI A;  1YVH A;  1MF8 B;  2L5X B;  1R6P A;  2KGR A;  3OX5 A;  2BL0 C;  3RLZ A;  1G8I A;  1QAT A;  4N1F A;  2JZI A;  2LUX A;  2LAN A;  4PHN A;  3WHU B;  2JOJ A;  4BY4 A;  1DMO A;  4PE4 A;  2KQY A;  5HKW A;  2BKI B;  3AAJ A;  1FI5 A;  1FI6 A;  2L50 A;  3MSE B;  4MZK A;  2M49 B;  2M7N A;  1BOC A;  2MLE C;  1C7W A;  5I2O A;  2A4J A;  2ZRT A;  3EVU A;  1GGZ A;  1Y6W A;  2KFF A;  2Y1N A;  1D1O A;  1BOD A;  3I5I C;  2LAP A;  1XFV O;  2LMT A;  5DKR A;  3TS5 C;  2KI4 C;  4M2O A;  2D8N A;  3LCP C;  5I2Q A;  5HKY A;  5DKQ A;  1J7P A;  3BXK A;  3RM1 A;  1Y0V H;  1KSO A;  2HPS A;  1UHN A;  3LK1 A;  2ZND A;  2B1U A;  2E30 A;  3O6B A;  1RWY A;  2BEC A;  2K2F A;  1M63 B;  1K9U A;  1A75 B;  3SG7 A;  2L2E A;  2QPT A;  1KFU S;  1A75 A;  5AAN A;  1HT9 A;  1BR4 B;  1XYD A;  3PFV A;  1SPY A;  2NXQ A;  2JT3 A;  3D10 A;  1KK8 C;  4U8D A;  1SNL A;  1UHH A;  4GBA A;  5AXI A;  3OX6 A;  2DOQ A;  2OTG B;  1R2U A;  1XFW O;  1Y1X A;  4YGD B;  1RRO A;  1B9A A;  3BQ3 A;  3O4Y A;  5HKZ A;  4R1E A;  2FCE A;  4PAL A;  1SK6 D;  1W7I B;  2KBI A;  1SCM B;  4GGN A;  2NLN A;  3CR5 X;  5I8N A;  4QJ5 B;  1CDM A;  1NYA A;  1NPQ A;  2LVJ A;  4XJK B;  1EJ3 A;  1ZFS A;  3I5H B;  4GPL B;  3K21 A;  1DJG A;  3DVE A;  3VRQ A;  4XJK A;  4F0Z B;  1A29 A;  1YUS A;  3SG5 A;  4PHM A;  1CLL A;  1TNW A;  2H61 A;  3A4U B;  5IBW A;  2TN4 A;  1KK7 Z;  4IL1 A;  1J7O A;  2F3Z A;  5D69 A;  1B7T Z;  1JC2 A;  4JWQ A;  1CMF A;  2K7B A;  5KSZ A;  1QAS A;  1F70 A;  1WLM A;  3PSR A;  5HLV A;  1DGU A;  2WOS A;  3WXA A;  3OP0 A;  1IWQ A;  1Y1A A;  1CFF A;  3SG3 A;  1YX8 A;  1CFD A;  3JVT B;  4MVF A;  1IKU A;  1FPW A;  1LIN A;  3CZT X;  1LKJ A;  3DF0 A;  4YRU A;  1JFJ A;  5K89 A;  5JOL A;  1AJ5 A;  4AQI A;  1NX1 A;  2L4I A;  2JTT A;  3M0W A;  2GGZ A;  2MAZ A;  3CGA A;  4MRY A;  4PDZ A;  3BUW B;  3TUY B;  2OPO A;  2CNP A;  1MUX A;  4YGC B;  1FF1 A;  3GK2 A;  4DS7 A;  1G4Y R;  1F8H A;  1M46 A;  2KOT A;  1TCO B;  3EVR A;  2CTN A;  2ZKM X;  4OKH A;  1WDC B;  2KSP A;  1KQM B;  1C7V A;  1SYM A;  1X02 A;  3PN7 B;  2K7C A;  2ZN8 A;  3HCM A;  1XFY O;  2PSR A;  1IQ3 A;  2KHN A;  2M29 A;  1KK7 Y;  1JSA A;  2WCE A;  4WQ2 A;  1B7T Y;  1S3P A;  1NUB A;  1PK0 D;  1NIW A;  2BCA A;  2SAS A;  2BE6 A;  1OE9 B;  1S5G Z;  1NX2 A;  3KPX A;  1SR6 B;  2LVI A;  4YGB B;  2MRD A;  1YUT A;  2JTZ A;  4ORB B;  1WY9 A;  1B47 A;  1J7R A;  1JBA A;  2KDH A;  1MHO A;  1TN4 A;  5TNC A;  2LHL A;  3KEV A;  1DTL A;  1TNQ A;  2PAL A;  2BE4 A;  3F45 A;  1SL9 A;  1SL8 A;  1QX2 A;  2JQ6 A;  1DGV A;  1J7Q A;  4MEW A;  1SY9 A;  2O5G A;  1AJ4 A;  1EL4 A;  1WRL A;  3VRN A;  2BBN A;  1G33 A;  2MLF C;  3H4S E;  4I5N B;  4JQ0 D;  4ZCU A;  2QAC A;  1QXP A;  1F54 A;  2BCX A;  4NDD A;  3FIA A;  1IJ5 A;  4CID A;  2KAX A;  1QVI Z;  1CM4 A;  1K95 A;  4XYN A;  3CR2 A;  3ZWH A;  1OSA A;  3DD4 A;  1W7J B;  4QJ4 B;  3VRR A;  1BF5 A;  2JRF A;  3SIB A;  2PVB A;  2K7D A;  4QJ3 B;  5F6T A;  1CM1 A;  4YGE B;  4C0L A;  1QV1 A;  1SCM C;  2ZFD A;  1FW4 A;  2FOT A;  3CLN A;  3GK1 A;  1S5G Y;  3LK0 A;  1RFJ A;  1IH0 A;  1TNX A;  1RK9 A;  2BCB A;  3I5H C;  5AEQ A;  2WND A;  1IG5 A;  2ZRS A;  3JTD B;  4I5J A;  2H61 C;  2L4H A;  1QTX A;  2JPT A;  1OZO A;  3LL8 B;  5PAL A;  1DJY A;  2EHB A;  3EK7 A;  3KHE A;  1XO5 A;  4M2P A;  1A4P A;  2MHH A;  2EC6 B;  2JUL A;  3DVM A;  4P5O E;  1K94 A;  2VRG A;  1DJX A;  1BT6 A;  1NSH A;  3BUX B;  2P6B B;  5CPV A;  2L51 A;  4YI9 A;  1CNP A;  1EG3 A;  3HX4 A;  2K7O A;  1YR5 A;  2NZ0 A;  4ORA B;  4OVN F;  3GOF A;  4ZCV A;  2KGB C;  2ZN9 A;  1MR8 A;  1QJT A;  4WRI A;  2G2B A;  1QVI Y;  4MSP A;  1QIV A;  3VRO A;  2JT8 A;  4YBH B;  4GGF A;  3A8R A;  3LLE A;  2K0J A;  1KSM A;  1DVI A;  1GQM A;  1TTX A;  2K61 A;  2R2I A;  2LUC A;  4E68 A;  1S26 D;  1ZMZ A;  4AOM A;  4DIR A;  1IQ5 A;  2JWW A;  2I2R E;  2KYC A;  4P2Y B;  1CKK A;  4PHJ A;  1JFK A;  2FJU B;  1QLK A;  1KFU L;  4ICB A;  1PRW A;  3PN7 C;  1XA5 A;  1K8U A;  4CLN A;  1ZAC A;  1KFX S;  1SCV A;  4PE1 A;  1E8A A;  1LA0 A;  3EKH A;  4GUK A;  2KAY A;  2LLS A;  1QS7 A;  2GGM A; 
#chains in the Genus database with same CATH topology
 2Y1M A;  4IJ7 A;  1BG1 A;  1C07 A;  4M2Q A;  1SR6 C;  3CS1 A;  5BPJ A;  1DJI A;  1GJY A;  1QX5 B;  1XK4 A;  1L7Z A;  1EXR A;  2BL0 B;  3AAK A;  2F2P A;  1IGV A;  5J3X A;  3TDZ A;  5GQQ C;  3NHI A;  4CFR A;  1ALW A;  4MLW A;  2ISD A;  3S0B A;  1N2D A;  4DRW A;  2KQ6 A;  1TOP A;  1WRK A;  5JJG A;  4D1E A;  1CLB A;  2I7A A;  1IJ6 A;  1ZUZ A;  4JKT A;  3VB1 A;  2L98 A;  1H4B A;  1S6I A;  3I5F C;  3CDN A;  2KFH A;  3NSO A;  2KI6 D;  3BFH A;  2NCP A;  3I5G B;  3I5I B;  1CFP A;  3R1V A;  1QX7 A;  2BBM A;  1WLZ A;  1NCY A;  1PSR A;  1B8C A;  3C1V A;  2KI4 B;  3KO0 A;  2FCD A;  1GM0 A;  1B8R A;  5DIC A;  1TCF A;  1W9Z A;  4PE7 A;  3CZ1 A;  1NCX A;  2JT0 A;  4N5X A;  3SS5 A;  2ZNE A;  1XFU O;  1BU3 A;  5CSI A;  5D3O A;  3BOW B;  1YTZ C;  1YUR A;  3CWG A;  2LV7 A;  2F8P A;  2HQW A;  1TUZ A;  2M9G A;  3NSK A;  1SKT A;  4L9M A;  2LNK A;  1REC A;  1HQV A;  1RTP 1;  3BOW A;  3CTN A;  1BMO A;  1XVJ A;  2KBM A;  3CAB A;  1XFX O;  3FE6 A;  3GK4 X;  3FWB A;  3IQO A;  3KF9 A;  4OCI A;  2G9B A;  3JTD C;  4MZL A;  1UUR A;  3S0G A;  1EH2 A;  3D75 A;  1MXE A;  2K60 A;  1CDL A;  1QV0 A;  3WHT B;  4CPV A;  1OQP A;  1U5I B;  1B4C A;  2LLU A;  2KFG A;  1KWO B;  2KAV A;  1U5I A;  1F4Q A;  1AHR A;  5FYX A;  1TIZ A;  1F4O A;  1MXL C;  2AMI A;  1J1D A;  1MQ1 A;  3EKJ A;  3D74 A;  1V1F A;  1K2H A;  1BLQ A;  1OOH A;  3IQQ A;  1S6C A;  4OV2 A;  4UPG A;  1QLS A;  1UP5 A;  3EK8 A;  4FQT A;  1M45 A;  1N65 A;  2GTE A;  4GAO A;  4GGF C;  4MN0 A;  3Q8I A;  1L2O B;  4PHK A;  4JPZ B;  3S0D A;  4I5L B;  2PMY A;  1AUI B;  1OOG A;  2LM5 A;  2JU0 A;  1A03 A;  1PVB A;  3PJI A;  2WCH A;  4NDC A;  3S0F A;  1YRU B;  2V53 A;  2OTG C;  3SJS A;  1F71 A;  1CDP A;  3FS7 A;  3R1P A;  1F55 A;  1DJW A;  1N0Y A;  2QEO A;  5ER4 X;  2KPH A;  3VRP A;  4WQ3 A;  3PAL A;  1SW8 A;  1FBV A;  3E3R A;  1EG4 A;  5EL2 A;  1AP4 A;  3L4L A;  4A4C A;  4A4B A;  1PUL A;  1JUO A;  2JXC A;  2PQL A;  2AAO A;  1Q80 A;  2COL B;  3O2P A;  2WCF A;  2HF5 A;  1NX0 A;  2BAP A;  3L47 A;  2HQ8 A;  3IF7 A;  3O4X A;  1QIW A;  1XK4 C;  2LLT A;  1GGW A;  3NXA A;  1KCY A;  2K2A A;  5CSF A;  2Q4U A;  3DVJ A;  3TDU A;  3NGV A;  4TNC A;  3NSL A;  5FI6 A;  1NX3 A;  1JWD A;  1KQV A;  4HRH A;  2KNE A;  4PE0 A;  2OS8 B;  2KI6 C;  1JF0 A;  2LP3 A;  3BUM B;  3JVT C;  5AER A;  1MWN A;  1ALV A;  5ER5 A;  5I2L A;  3SG6 A;  1XFZ O;  1CFC A;  1K90 D;  2L0P A;  3I5G C;  2KYF A;  4HRG A;  4OR9 B;  3EVV A;  4Q04 A;  1UHI A;  3ZNI A;  2CBL A;  1LVC D;  2MA2 A;  2SCP A;  3PAT A;  3BYA A;  1S1E A;  2M3W A;  5DKN A;  3TUY C;  1CTR A;  2LCP A;  2IS9 A;  2F3Y A;  4N1G A;  4ORC B;  1PAL A;  5KU1 A;  3UNW A;  3QRX A;  5HLO A;  1Y1U A;  1WDC C;  1KQM C;  1YRT B;  2M97 A;  3FWC A;  2E6W A;  3AKA A;  1OZS A;  2QDI A;  1OOI X;  1OMV A;  1AVS A;  2CXJ A;  4NQG A;  1DEK A;  4C0J A;  1JF2 A;  1OMD A;  3D76 A;  1KWO C;  1TNP A;  1PVA A;  1YUU A;  5G08 A;  1OMR A;  2LP2 A;  4MBE A;  1OOJ A;  4USL A;  1YX7 A;  1SRA A;  5I94 A;  1V1G A;  2BKH B;  2LMV A;  2WC6 A;  4BY5 A;  3EK4 A;  5D7F A;  2Y5I A;  1K93 D;  4HSZ A;  2CT9 A;  1KFX L;  1SBJ A;  2LVK A;  2AUC A;  1S36 A;  2MBX A;  1K96 A;  3BUO B;  3N7H A;  1L2O C;  2M1U A;  1J55 A;  4NDB A;  1CB1 A;  1BJF A;  2I18 A;  3OGN A;  2I94 A;  3TS5 B;  2JNF A;  3R1O A;  1NCZ A;  2CCM A;  3TDI A;  1TRF A;  3S0E A;  3V2L A;  2Q91 A;  2MJW B;  3WNX B;  4ETO A;  1UHJ A;  1CLM A;  3RZS A;  1S6J A;  1SMG A;  5CSJ A;  3TZ1 A;  3ICB A;  3BJH A;  4HRE E;  4MZJ A;  2JXL A;  3PM8 A;  3NSI A;  5HYD A;  3DF0 B;  4YI8 A;  1ODB A;  2HET A;  1DJH A;  1B1G A;  2H2K A;  2LE9 B;  2WC8 A;  3SG2 A;  4DCK A;  2Y4Q A;  1UHK A;  3OB2 B;  3PLF B;  1NP8 A;  4GNK B;  4DUQ A;  2O60 A;  3SG4 A;  1KK8 B;  1K9P A;  4FQO A;  1RJV A;  1CDN A;  1A2X A;  1M39 A;  3B7A A;  3DYE A;  4I5K A;  1CMG A;  4AQJ A;  5HL1 A;  2M8U A;  2EC6 C;  2LHI A;  4FTG A;  1DT7 B;  3AKB A;  1WRZ A;  2LVV A;  2KLD A;  2M0R A;  3B6X A;  1LA3 A;  2JC2 A;  2OS8 C;  2EGD A;  2GV5 A;  2M7L A;  1IRJ A;  1YVL A;  3CR4 X;  3FE8 A;  2L2C A;  1M31 A;  3O78 A;  1DF0 B;  3OB1 B;  4PCW A;  2PRU A;  3BUN B;  1BR1 B;  2WOR A;  5CSN A;  1DF0 A;  3BFA A;  5B8I B;  3S0A A;  1AK8 A;  2WCB A;  2NCO A;  1K9K A;  4GFT A;  1UWO A;  3OHM B;  2JNX A;  4YGA A;  2LC5 A;  1LXF C;  1P28 A;  3SIA A;  4C0K A;  5AFP A;  1VRK A;  2M1K B;  3DVK A;  2F2O A;  2F33 A;  1H8B A;  1NWD A;  1B8L A;  1ZOT B;  2LMU A;  4CFQ A;  1UUS A;  3D0Y B;  5KTY A;  3I5F B;  1J1E A;  1SL7 A;  1PSB A;  2K8M B;  2PAS A;  1C3Y A;  3VGO A;  3D0Y A;  1DJZ A;  4MRX A;  2FJY A;  2RGI A;  1YVH A;  1MF8 B;  2L5X B;  1R6P A;  2KGR A;  3OX5 A;  3D78 A;  2BL0 C;  3RLZ A;  1G8I A;  1QAT A;  4N1F A;  2QEH A;  2JZI A;  2LUX A;  2LAN A;  3CZ2 A;  4PHN A;  2JOJ A;  3WHU B;  4BY4 A;  1DMO A;  4PE4 A;  1IIO A;  2KQY A;  5HKW A;  2BKI B;  3AAJ A;  1FI5 A;  1FI6 A;  2L50 A;  3MSE B;  4MZK A;  2M49 B;  2M7N A;  1BOC A;  2MLE C;  1C7W A;  5I2O A;  2A4J A;  2ZRT A;  3EVU A;  1GGZ A;  1Y6W A;  2KFF A;  2Y1N A;  1D1O A;  1BOD A;  3I5I C;  2LAP A;  1XFV O;  2LMT A;  5DKR A;  4OZD A;  3TS5 C;  2KI4 C;  4M2O A;  2D8N A;  3LCP C;  5I2Q A;  5HKY A;  5DKQ A;  1J7P A;  1TWO A;  3BXK A;  3RM1 A;  1Y0V H;  1KSO A;  2HPS A;  1UHN A;  3LK1 A;  2ZND A;  2B1U A;  2E30 A;  3O6B A;  1RWY A;  2BEC A;  2K2F A;  1M63 B;  1K9U A;  1A75 B;  3BFB A;  3CZ0 A;  2L2E A;  2QPT A;  3SG7 A;  1DQE A;  1KFU S;  3SS3 A;  1A75 A;  5AAN A;  1HT9 A;  1BR4 B;  1XYD A;  3PFV A;  1SPY A;  2NXQ A;  2JT3 A;  3D10 A;  1LS8 A;  3IVT A;  1KK8 C;  1DC1 A;  4U8D A;  3R72 A;  1SNL A;  1UHH A;  4GBA A;  5AXI A;  3OX6 A;  2DOQ A;  2OTG B;  1R2U A;  1XFW O;  1Y1X A;  4YGD B;  1RRO A;  1B9A A;  3BQ3 A;  3O4Y A;  5HKZ A;  4R1E A;  2FCE A;  4PAL A;  1SK6 D;  1W7I B;  2KBI A;  1SCM B;  4GGN A;  2NLN A;  3CR5 X;  5I8N A;  4QJ5 B;  1CDM A;  1NYA A;  1NPQ A;  2WCK A;  2LVJ A;  4XJK B;  1EJ3 A;  2BNX A;  1ZFS A;  3I5H B;  4GPL B;  3K21 A;  1DJG A;  3DVE A;  3VRQ A;  4XJK A;  4F0Z B;  1A29 A;  1YUS A;  3SG5 A;  4PHM A;  1CLL A;  1TNW A;  2H61 A;  3A4U B;  5IBW A;  2QEV A;  2TN4 A;  1KK7 Z;  4IL1 A;  1J7O A;  2F3Z A;  5D69 A;  1B7T Z;  1JC2 A;  4JWQ A;  1CMF A;  3DZT A;  3DY9 A;  2K7B A;  5KSZ A;  1QAS A;  3D73 A;  1F70 A;  1WLM A;  3PSR A;  5HLV A;  1DGU A;  2WOS A;  3WXA A;  3OP0 A;  1IWQ A;  1TUJ A;  1Y1A A;  1CFF A;  3SG3 A;  1YX8 A;  1CFD A;  3JVT B;  4MVF A;  1IKU A;  1ORG A;  1LIN A;  3CZT X;  1FPW A;  1LKJ A;  3DF0 A;  4YRU A;  1JFJ A;  5K89 A;  2WC5 A;  5JOL A;  1AJ5 A;  3UO9 A;  1NX1 A;  2L4I A;  4AQI A;  2JTT A;  3M0W A;  2GGZ A;  2MAZ A;  3CGA A;  4MRY A;  3DXL A;  3BUW B;  4PDZ A;  1XFR A;  3OBV A;  2OPO A;  2CNP A;  3TUY B;  1MUX A;  4YGC B;  1FF1 A;  3GK2 A;  4DS7 A;  1G4Y R;  1F8H A;  1M46 A;  2KOT A;  1TCO B;  3EG5 B;  2CTN A;  3EVR A;  1QWV A;  2ZKM X;  4OKH A;  1WDC B;  2KSP A;  1KQM B;  4KYN A;  1C7V A;  1SYM A;  1X02 A;  3PN7 B;  2K7C A;  2ZN8 A;  3HCM A;  1XFY O;  3D77 A;  2PSR A;  1IQ3 A;  2KHN A;  2M29 A;  1KK7 Y;  1JSA A;  2WCE A;  4WQ2 A;  1B7T Y;  1S3P A;  1NUB A;  1PK0 D;  1NIW A;  2BCA A;  2SAS A;  2BE6 A;  1OE9 B;  1S5G Z;  1NX2 A;  3KPX A;  1SR6 B;  1C3Z A;  2LVI A;  4INX A;  4YGB B;  2MRD A;  3FE9 A;  1YUT A;  2JTZ A;  4ORB B;  1WY9 A;  1B47 A;  1J7R A;  1JBA A;  2KDH A;  1MHO A;  1TN4 A;  5TNC A;  2LHL A;  3KEV A;  1DTL A;  1TNQ A;  2PAL A;  2BE4 A;  5FI7 A;  3F45 A;  1SL9 A;  1SL8 A;  1QX2 A;  2JQ6 A;  1DGV A;  2WCM A;  1J7Q A;  4MEW A;  2P70 A;  1SY9 A;  2O5G A;  1AJ4 A;  2JPO A;  1EL4 A;  1WRL A;  3QME A;  3VRN A;  2BBN A;  1G33 A;  2MLF C;  3H4S E;  4I5N B;  4JD9 A;  4JQ0 D;  4ZCU A;  2QAC A;  1QXP A;  1F54 A;  2BCX A;  4NDD A;  3FIA A;  1IJ5 A;  4CID A;  2KAX A;  1QVI Z;  1CM4 A;  1K95 A;  1Z4H A;  3CR2 A;  4XYN A;  1OSA A;  3DD4 A;  1W7J B;  3ZWH A;  4QJ4 B;  3VRR A;  1BF5 A;  2JRF A;  3SIB A;  2PVB A;  2K7D A;  4QJ3 B;  5F6T A;  1CM1 A;  4YGE B;  4C0L A;  1QV1 A;  1SCM C;  2QEB A;  2ZFD A;  1FW4 A;  2FOT A;  3CLN A;  3GK1 A;  1S5G Y;  3LK0 A;  1RFJ A;  3B87 A;  2P71 A;  4PT1 A;  1IH0 A;  1TNX A;  1RK9 A;  2BCB A;  3I5H C;  5AEQ A;  2WND A;  1IG5 A;  2ZRS A;  3JTD B;  4I5J A;  2H61 C;  2L4H A;  2KLE A;  3PM2 A;  1QTX A;  1T14 A;  1OZO A;  2JPT A;  3LL8 B;  3B86 A;  5PAL A;  3B88 A;  1DJY A;  4F7F A;  2EHB A;  3EK7 A;  3KHE A;  1XO5 A;  4M2P A;  1A4P A;  2MHH A;  2EC6 B;  2JUL A;  3DVM A;  4P5O E;  1K94 A;  2VRG A;  1DJX A;  1BT6 A;  1NSH A;  3BUX B;  2P6B B;  5CPV A;  2ERB A;  2L51 A;  4YI9 A;  1EG3 A;  3HX4 A;  2K7O A;  1CNP A;  1YR5 A;  2NZ0 A;  2WCJ A;  4ORA B;  4OVN F;  3GOF A;  4ZCV A;  2KGB C;  2ZN9 A;  1MR8 A;  1QJT A;  2L5Y A;  4WRI A;  2G2B A;  1QVI Y;  3NHT A;  1QIV A;  4MSP A;  3VRO A;  2JT8 A;  4YBH B;  4GGF A;  3A8R A;  1OOF A;  3LLE A;  2K0J A;  1KSM A;  2H8V A;  1DVI A;  1GQM A;  1DEL A;  3CYZ A;  1TTX A;  5FI2 A;  2K61 A;  2R2I A;  2LUC A;  4E68 A;  1S26 D;  1ZMZ A;  1SSE B;  4AOM A;  3SS4 A;  4DIR A;  1IQ5 A;  2JWW A;  2I2R E;  2KYC A;  2PYQ A;  2WCL A;  4INW A;  4P2Y B;  1CKK A;  3L4A A;  4PHJ A;  1JFK A;  2FJU B;  1QLK A;  1KFU L;  4ICB A;  1PRW A;  3PN7 C;  1XA5 A;  1K8U A;  4CLN A;  1ZAC A;  1KFX S;  1SCV A;  4PE1 A;  1OW4 A;  1E8A A;  1LA0 A;  3EKH A;  1Z2C B;  4GUK A;  2KAY A;  2LLS A;  1QS7 A;  2YGU A;  3K1E A;  2GGM A; 
#chains in the Genus database with same CATH homology
 2Y1M A;  1BG1 A;  1C07 A;  4M2Q A;  1SR6 C;  3CS1 A;  5BPJ A;  1DJI A;  1GJY A;  1QX5 B;  2BL0 B;  1L7Z A;  1EXR A;  1XK4 A;  3AAK A;  2F2P A;  1IGV A;  5J3X A;  3TDZ A;  5GQQ C;  4CFR A;  1ALW A;  4MLW A;  2ISD A;  1N2D A;  4DRW A;  2KQ6 A;  1TOP A;  1WRK A;  5JJG A;  4D1E A;  1CLB A;  2I7A A;  1IJ6 A;  1ZUZ A;  2L98 A;  1H4B A;  1S6I A;  3I5F C;  2KFH A;  3NSO A;  2KI6 D;  2NCP A;  3I5G B;  3I5I B;  1CFP A;  1QX7 A;  2BBM A;  1WLZ A;  1NCY A;  1PSR A;  1B8C A;  3C1V A;  2KI4 B;  3KO0 A;  2FCD A;  1B8R A;  1TCF A;  4PE7 A;  1NCX A;  2JT0 A;  4N5X A;  2ZNE A;  1XFU O;  1BU3 A;  5CSI A;  3BOW B;  1YTZ C;  1YUR A;  3CWG A;  2LV7 A;  2F8P A;  2HQW A;  2M9G A;  3NSK A;  4L9M A;  1SKT A;  2LNK A;  1REC A;  1HQV A;  1RTP 1;  3BOW A;  3CTN A;  1BMO A;  1XVJ A;  2KBM A;  3GK4 X;  1XFX O;  3KF9 A;  3FWB A;  3IQO A;  4OCI A;  2G9B A;  3JTD C;  4MZL A;  1UUR A;  1EH2 A;  1MXE A;  1CDL A;  1QV0 A;  3WHT B;  4CPV A;  1OQP A;  1U5I B;  1B4C A;  2LLU A;  2KFG A;  1KWO B;  2KAV A;  1U5I A;  1F4Q A;  1AHR A;  5FYX A;  1TIZ A;  1F4O A;  1MXL C;  2AMI A;  1J1D A;  1MQ1 A;  3EKJ A;  1V1F A;  1K2H A;  1BLQ A;  3IQQ A;  1S6C A;  4OV2 A;  4UPG A;  1QLS A;  1UP5 A;  3EK8 A;  1M45 A;  1N65 A;  4GAO A;  4GGF C;  4MN0 A;  1L2O B;  4PHK A;  4JPZ B;  4I5L B;  2PMY A;  1AUI B;  2LM5 A;  2JU0 A;  1A03 A;  1PVB A;  4NDC A;  1YRU B;  2V53 A;  2OTG C;  3SJS A;  1F71 A;  1CDP A;  3FS7 A;  1F55 A;  1DJW A;  1N0Y A;  5ER4 X;  3VRP A;  4WQ3 A;  3PAL A;  1SW8 A;  1FBV A;  3E3R A;  1EG4 A;  1AP4 A;  4A4C A;  4A4B A;  1PUL A;  1JUO A;  2JXC A;  2AAO A;  1Q80 A;  2COL B;  3O2P A;  2WCF A;  2HF5 A;  1NX0 A;  2HQ8 A;  3IF7 A;  1QIW A;  1XK4 C;  2LLT A;  1GGW A;  3NXA A;  1KCY A;  2K2A A;  5CSF A;  2Q4U A;  3DVJ A;  3TDU A;  4TNC A;  3NSL A;  1NX3 A;  1JWD A;  1KQV A;  4HRH A;  2KNE A;  4PE0 A;  2OS8 B;  2KI6 C;  1JF0 A;  2LP3 A;  3BUM B;  3JVT C;  5AER A;  1MWN A;  1ALV A;  5ER5 A;  5I2L A;  3SG6 A;  1XFZ O;  1CFC A;  1K90 D;  2L0P A;  3I5G C;  2KYF A;  4HRG A;  4OR9 B;  3EVV A;  4Q04 A;  1UHI A;  3ZNI A;  2CBL A;  1LVC D;  2MA2 A;  2SCP A;  3PAT A;  3BYA A;  1S1E A;  2M3W A;  5DKN A;  3TUY C;  1CTR A;  2LCP A;  2IS9 A;  2F3Y A;  4N1G A;  4ORC B;  1PAL A;  5KU1 A;  3QRX A;  5HLO A;  1Y1U A;  1WDC C;  1KQM C;  1YRT B;  2M97 A;  3FWC A;  2E6W A;  3AKA A;  1OZS A;  1OMV A;  1AVS A;  2CXJ A;  4NQG A;  4C0J A;  1JF2 A;  1OMD A;  1KWO C;  1TNP A;  1PVA A;  1YUU A;  5G08 A;  1OMR A;  2LP2 A;  4MBE A;  1OOJ A;  4USL A;  1YX7 A;  1SRA A;  1V1G A;  2BKH B;  2LMV A;  4BY5 A;  3EK4 A;  5D7F A;  2Y5I A;  1K93 D;  4HSZ A;  2CT9 A;  1KFX L;  1SBJ A;  2LVK A;  2AUC A;  1S36 A;  2MBX A;  1K96 A;  3BUO B;  1L2O C;  2M1U A;  1J55 A;  4NDB A;  1CB1 A;  1BJF A;  2I18 A;  2I94 A;  3TS5 B;  2JNF A;  1NCZ A;  2CCM A;  3TDI A;  1TRF A;  2Q91 A;  2MJW B;  3WNX B;  4ETO A;  1UHJ A;  1CLM A;  1S6J A;  1SMG A;  5CSJ A;  3TZ1 A;  3ICB A;  4HRE E;  4MZJ A;  2JXL A;  3PM8 A;  3NSI A;  5HYD A;  3DF0 B;  4YI8 A;  1ODB A;  2HET A;  1DJH A;  1B1G A;  2H2K A;  2LE9 B;  2WC8 A;  3SG2 A;  4DCK A;  2Y4Q A;  1UHK A;  3OB2 B;  3PLF B;  1NP8 A;  4GNK B;  4DUQ A;  2O60 A;  3SG4 A;  1KK8 B;  1K9P A;  4FQO A;  1RJV A;  1CDN A;  1A2X A;  1M39 A;  1CMG A;  4I5K A;  4AQJ A;  2M8U A;  2EC6 C;  2LHI A;  4FTG A;  1DT7 B;  3AKB A;  1WRZ A;  2LVV A;  2M0R A;  1LA3 A;  2JC2 A;  2OS8 C;  2EGD A;  2GV5 A;  2M7L A;  1IRJ A;  1YVL A;  3CR4 X;  1M31 A;  3O78 A;  1DF0 B;  3OB1 B;  4PCW A;  2PRU A;  3BUN B;  1BR1 B;  2WOR A;  5CSN A;  1DF0 A;  5B8I B;  1AK8 A;  2WCB A;  2NCO A;  1K9K A;  4GFT A;  1UWO A;  3OHM B;  2JNX A;  4YGA A;  2LC5 A;  1LXF C;  3SIA A;  4C0K A;  5AFP A;  1VRK A;  2M1K B;  3DVK A;  2F2O A;  2F33 A;  1H8B A;  1NWD A;  1B8L A;  1ZOT B;  2LMU A;  4CFQ A;  1UUS A;  3D0Y B;  5KTY A;  3I5F B;  1J1E A;  1SL7 A;  1PSB A;  2K8M B;  2PAS A;  3VGO A;  3D0Y A;  1DJZ A;  4MRX A;  2RGI A;  1YVH A;  1MF8 B;  2L5X B;  1R6P A;  2KGR A;  3OX5 A;  2BL0 C;  3RLZ A;  1G8I A;  1QAT A;  4N1F A;  2JZI A;  2LUX A;  2LAN A;  4PHN A;  3WHU B;  2JOJ A;  4BY4 A;  1DMO A;  4PE4 A;  2KQY A;  5HKW A;  2BKI B;  3AAJ A;  1FI5 A;  1FI6 A;  2L50 A;  3MSE B;  4MZK A;  2M49 B;  2M7N A;  1BOC A;  2MLE C;  1C7W A;  5I2O A;  2A4J A;  2ZRT A;  3EVU A;  1GGZ A;  1Y6W A;  2KFF A;  2Y1N A;  1D1O A;  1BOD A;  3I5I C;  2LAP A;  1XFV O;  2LMT A;  5DKR A;  3TS5 C;  2KI4 C;  4M2O A;  2D8N A;  3LCP C;  5I2Q A;  5HKY A;  5DKQ A;  1J7P A;  3BXK A;  3RM1 A;  1Y0V H;  1KSO A;  2HPS A;  1UHN A;  3LK1 A;  2ZND A;  2B1U A;  2E30 A;  3O6B A;  1RWY A;  2BEC A;  2K2F A;  1M63 B;  1K9U A;  1A75 B;  3SG7 A;  2L2E A;  2QPT A;  1KFU S;  1A75 A;  5AAN A;  1HT9 A;  1BR4 B;  1XYD A;  3PFV A;  1SPY A;  2NXQ A;  2JT3 A;  3D10 A;  1KK8 C;  4U8D A;  1SNL A;  1UHH A;  4GBA A;  5AXI A;  3OX6 A;  2DOQ A;  2OTG B;  1R2U A;  1XFW O;  1Y1X A;  4YGD B;  1RRO A;  1B9A A;  3BQ3 A;  3O4Y A;  5HKZ A;  4R1E A;  2FCE A;  4PAL A;  1SK6 D;  1W7I B;  2KBI A;  1SCM B;  4GGN A;  2NLN A;  3CR5 X;  5I8N A;  4QJ5 B;  1CDM A;  1NYA A;  1NPQ A;  2LVJ A;  4XJK B;  1EJ3 A;  1ZFS A;  3I5H B;  4GPL B;  3K21 A;  1DJG A;  3DVE A;  3VRQ A;  4XJK A;  4F0Z B;  1A29 A;  1YUS A;  3SG5 A;  4PHM A;  1CLL A;  1TNW A;  2H61 A;  3A4U B;  5IBW A;  2TN4 A;  1KK7 Z;  4IL1 A;  1J7O A;  2F3Z A;  5D69 A;  1B7T Z;  1JC2 A;  4JWQ A;  1CMF A;  2K7B A;  5KSZ A;  1QAS A;  1F70 A;  1WLM A;  3PSR A;  5HLV A;  1DGU A;  2WOS A;  3WXA A;  3OP0 A;  1IWQ A;  1Y1A A;  1CFF A;  3SG3 A;  1YX8 A;  1CFD A;  3JVT B;  4MVF A;  1IKU A;  1FPW A;  1LIN A;  3CZT X;  1LKJ A;  3DF0 A;  4YRU A;  1JFJ A;  5K89 A;  5JOL A;  1AJ5 A;  4AQI A;  1NX1 A;  2L4I A;  2JTT A;  3M0W A;  2GGZ A;  2MAZ A;  3CGA A;  4MRY A;  4PDZ A;  3BUW B;  3TUY B;  2OPO A;  2CNP A;  1MUX A;  4YGC B;  1FF1 A;  3GK2 A;  4DS7 A;  1G4Y R;  1F8H A;  1M46 A;  2KOT A;  1TCO B;  3EVR A;  2CTN A;  2ZKM X;  4OKH A;  1WDC B;  2KSP A;  1KQM B;  1C7V A;  1SYM A;  1X02 A;  3PN7 B;  2K7C A;  2ZN8 A;  3HCM A;  1XFY O;  2PSR A;  1IQ3 A;  2KHN A;  2M29 A;  1KK7 Y;  1JSA A;  2WCE A;  4WQ2 A;  1B7T Y;  1S3P A;  1NUB A;  1PK0 D;  1NIW A;  2BCA A;  2SAS A;  2BE6 A;  1OE9 B;  1S5G Z;  1NX2 A;  3KPX A;  1SR6 B;  2LVI A;  4YGB B;  2MRD A;  1YUT A;  2JTZ A;  4ORB B;  1WY9 A;  1B47 A;  1J7R A;  1JBA A;  2KDH A;  1MHO A;  1TN4 A;  5TNC A;  2LHL A;  3KEV A;  1DTL A;  1TNQ A;  2PAL A;  2BE4 A;  3F45 A;  1SL9 A;  1SL8 A;  1QX2 A;  2JQ6 A;  1DGV A;  1J7Q A;  4MEW A;  1SY9 A;  2O5G A;  1AJ4 A;  1EL4 A;  1WRL A;  3VRN A;  2BBN A;  1G33 A;  2MLF C;  3H4S E;  4I5N B;  4JQ0 D;  4ZCU A;  2QAC A;  1QXP A;  1F54 A;  2BCX A;  4NDD A;  3FIA A;  1IJ5 A;  4CID A;  2KAX A;  1QVI Z;  1CM4 A;  1K95 A;  4XYN A;  3CR2 A;  3ZWH A;  1OSA A;  3DD4 A;  1W7J B;  4QJ4 B;  3VRR A;  1BF5 A;  2JRF A;  3SIB A;  2PVB A;  2K7D A;  4QJ3 B;  5F6T A;  1CM1 A;  4YGE B;  4C0L A;  1QV1 A;  1SCM C;  2ZFD A;  1FW4 A;  2FOT A;  3CLN A;  3GK1 A;  1S5G Y;  3LK0 A;  1RFJ A;  1IH0 A;  1TNX A;  1RK9 A;  2BCB A;  3I5H C;  5AEQ A;  2WND A;  1IG5 A;  2ZRS A;  3JTD B;  4I5J A;  2H61 C;  2L4H A;  1QTX A;  2JPT A;  1OZO A;  3LL8 B;  5PAL A;  1DJY A;  2EHB A;  3EK7 A;  3KHE A;  1XO5 A;  4M2P A;  1A4P A;  2MHH A;  2EC6 B;  2JUL A;  3DVM A;  4P5O E;  1K94 A;  2VRG A;  1DJX A;  1BT6 A;  1NSH A;  3BUX B;  2P6B B;  5CPV A;  2L51 A;  4YI9 A;  1CNP A;  1EG3 A;  3HX4 A;  2K7O A;  1YR5 A;  2NZ0 A;  4ORA B;  4OVN F;  3GOF A;  4ZCV A;  2KGB C;  2ZN9 A;  1MR8 A;  1QJT A;  4WRI A;  2G2B A;  1QVI Y;  4MSP A;  1QIV A;  3VRO A;  2JT8 A;  4YBH B;  4GGF A;  3A8R A;  3LLE A;  2K0J A;  1KSM A;  1DVI A;  1GQM A;  1TTX A;  2K61 A;  2R2I A;  2LUC A;  4E68 A;  1S26 D;  1ZMZ A;  4AOM A;  4DIR A;  1IQ5 A;  2JWW A;  2I2R E;  2KYC A;  4P2Y B;  1CKK A;  4PHJ A;  1JFK A;  2FJU B;  1QLK A;  1KFU L;  4ICB A;  1PRW A;  3PN7 C;  1XA5 A;  1K8U A;  4CLN A;  1ZAC A;  1KFX S;  1SCV A;  4PE1 A;  1E8A A;  1LA0 A;  3EKH A;  4GUK A;  2KAY A;  2LLS A;  1QS7 A;  2GGM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...