4CFRA

Ca-bound s100a4 c3s, c81s, c86s and f45w mutant complexed with non- muscle myosin iia
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
94
structure length
94
Chain Sequence
b'ASPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSWLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSSIAMMSNEFFEGFPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN S100-A4
publication title The C-Terminal Random Coil Region Tunes the Ca2+-Binding Affinity of S100A4 Through Conformational Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ca-binding protein/motor protein
total genus 35
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4cfrA00
4OV2A 5KTYA 1KQMC 1TNPA 1J7QA 1SCMC 1EG3A 4M2OA 1DGVA 1TN4A 2LLSA 4QJ5B 5D69A 1IGVA 1ZFSA 4OR9B 1F71A 4WRIA 1CDPA 3VRRA 4AOMA 5AFPA 1D1OA 2BCXA 4YGAA 2KYFA 2E30A 1IQ5A 1Q80A 1UUSA 2ZRTA 4MRXA 4GFTA 4AQIA 1F8HA 1RFJA 1OZSA 3DVMA 1BOCA 2HETA 2FCEA 1QVIY 3ZWHA 4M2QA 2M49B 1AJ4A 1B47A 2AMIA 3VRNA 1HT9A 3PSRA 2K0JA 3IF7A 4WQ3A 1SBJA 2MAZA 2TN4A 1WRKA 1IJ6A 1GJYA 2M9GA 4USLA 2LP2A 4L9MA 5HLVA 4MSPA 1PSRA 4M2PA 4DIRA 1J7OA 2P6BB 2ZNDA 1CLBA 1GGWA 4ORBB 3WNXB 1CM4A 1BLQA 3LK0A 2JRFA 1XK4C 3TUYC 3AAKA 2CXJA 3AKBA 4N1FA 1JFJA 4HRGA 1SR6C 3OX5A 1DJXA 4A4CA 4GUKA 1X02A 5HYDA 2BCBA 1IJ5A 2ZKMX 1DJWA 1RECA 2KFFA 1L7ZA 3A8RA 5GQQC 1QLSA 1CFCA 1LA0A 2BBNA 3ICBA 4OCIA 1KK7Y 2I7AA 5KU1A 2BBMA 4BY5A 1WRLA 5CSFA 3WHUB 1Y6WA 1JC2A 1OSAA 3RM1A 2SCPA 2GV5A 2E6WA 4I5KA 1KSMA 2BKIB 2L50A 3NSKA 3EKJA 4GGNA 3OHMB 1YX7A 1YUTA 2EGDA 3K21A 1QLKA 1OMRA 1PK0D 4GGFC 4QJ3B 2H2KA 1QX7A 1QATA 2QPTA 2H61A 2BL0C 4OKHA 1WLZA 1BMOA 1CDMA 3LL8B 1YX8A 3BYAA 4PHJA 4C0KA 1YRTB 1SRAA 1NYAA 2NZ0A 2LV7A 1ALVA 3HCMA 4MEWA 1H8BA 5AXIA 1FI5A 3I5FB 2ZFDA 3PATA 1OZOA 1QJTA 3CTNA 1UHNA 2WORA 1NWDA 2AUCA 1MHOA 2KBMA 2SASA 4U8DA 1M46A 1SK6D 2MLEC 2KI4C 2KQ6A 3FWBA 1J7PA 2LLTA 5KSZA 5JOLA 2B1UA 2K7BA 3PALA 4PHMA 1JF0A 4HSZA 3WHTB 1B7TZ 1L2OB 1F4QA 1EXRA 1QXPA 3EVUA 4YGBB 2LMTA 3KPXA 1IRJA 2CTNA 1JF2A 2KAXA 1B8CA 1XFZO 4I5LB 3VRQA 2KGRA 4AQJA 2KDHA 3GOFA 1TNXA 2JT8A 2HQ8A 1YURA 3D10A 2WC8A 4PDZA 1SL8A 3M0WA 5HKZA 3SG4A 4GGFA 3SJSA 3TS5C 2JT0A 2LVVA 2AAOA 3I5IC 1NX3A 2K8MB 1XFXO 1WLMA 4I5NB 3SG5A 1S6JA 3I5GB 2PASA 2PMYA 1YUSA 2KGBC 4YGCB 1LINA 2R2IA 4MVFA 1AVSA 1F55A 2LUXA 2L0PA 2LANA 2VRGA 2LAPA 1NSHA 3I5HB 3DF0A 2A4JA 2OS8C 4CFRA 2KOTA 3A4UB 3D0YA 5BPJA 4JWQA 2ZNEA 3GK2A 3SG7A 4YI8A 2MBXA 1G4YR 1OOJA 1OQPA 1Y0VH 1KK8B 2WCEA 1GGZA 3IQQA 5ER4X 4ZCVA 1IKUA 1VRKA 5DKRA 1RJVA 1ZMZA 1XFYO 2LE9B 1QIVA 3O78A 3BOWA 2JC2A 3JTDB 3LLEA 3QRXA 2CNPA 1DMOA 4PCWA 1TOPA 4XJKA 1H4BA 4PE4A 1EL4A 2MLFC 1K90D 2MRDA 1ALWA 2L51A 1CLMA 1B4CA 1QX5B 1TCOB 1EH2A 1S1EA 2LCPA 5PALA 1B1GA 1IG5A 2M97A 3SIAA 1DGUA 2KAVA 4BY4A 2EC6B 1EG4A 1JBAA 4Q04A 1NX2A 1S6IA 1TRFA 2F8PA 1DF0B 2NXQA 1DJZA 1B7TY 1QASA 3LCPC 1A75A 1MXEA 2HQWA 2QACA 1PSBA 4JQ0D 1TTXA 2NCPA 1SNLA 1K9PA 2Q4UA 2RGIA 4NDDA 5IBWA 1S6CA 1NIWA 4ORCB 1MF8B 2BE4A 3VGOA 1BR1B 2IS9A 1NX0A 2WNDA 1U5IB 2Y5IA 3TZ1A 3ZNIA 4CFQA 3EVRA 2FJUB 1ZUZA 1UHKA 2KI6D 2MJWB 1A29A 2F3ZA 4OVNF 3VROA 1AK8A 2M3WA 1Y1XA 2LUCA 2F2OA 1K95A 4MZJA 2WOSA 4PHKA 4C0JA 2JTZA 3CZTX 2O60A 1SKTA 1SL7A 5AEQA 2LM5A 1M31A 4R1EA 3KEVA 1SW8A 5CPVA 4NQGA 5HKYA 2NLNA 1WY9A 3EK4A 4DUQA 4DRWA 2JULA 4GAOA 4N5XA 1V1GA 3AKAA 2K7DA 1N65A 2F3YA 2NCOA 1DJGA 1YUUA 2FOTA 1NUBA 2JWWA 1M39A 2ZN9A 1XK4A 1PALA 3CR5X 2L4HA 1CFPA 3NSIA 1KWOB 4PALA 1BG1A 2L2EA 3DF0B 4YI9A 4PE1A 3RLZA 5K89A 1QS7A 3D0YB 4YRUA 2LVKA 1SMGA 3BQ3A 3OB1B 1PVAA 2M1KB 1SCVA 2JT3A 2KYCA 1CMFA 2BCAA 3PLFB 2WCFA 1OE9B 3FIAA 1WRZA 2KNEA 3DD4A 1K94A 1A2XA 3PN7B 2K2AA 2O5GA 3BOWB 3KO0A 3SG2A 3CR2A 1SYMA 5AANA 1AUIB 1Y1UA 4XJKB 2ISDA 3JVTB 1WDCB 3I5FC 3OX6A 3PFVA 1BT6A 2OTGB 1KFXL 3SG3A 5I8NA 4PHNA 1C7VA 1UP5A 2KFGA 1FBVA 2PRUA 2MA2A 3DVJA 1E8AA 1GQMA 1XFVO 2JU0A 4ZCUA 1J7RA 1LKJA 5JJGA 5I2LA 1G8IA 3CLNA 1N2DA 4WQ2A 1NCZA 1C7WA 3CR4X 1UHJA 1KQVA 5ER5A 3DVKA 4CLNA 4GPLB 1L2OC 2GGZA 4YGEB 3NXAA 1F70A 1XFWO 2JXCA 3WXAA 5DKNA 4FQOA 1KCYA 3OP0A 2ZRSA 1A75B 5I2OA 4DS7A 4TNCA 2PALA 1K9UA 1K93D 1KQMB 1XYDA 3C1VA 1SCMB 4N1GA 1EJ3A 3VRPA 4YGDB 2M0RA 1CM1A 4IL1A 2G9BA 4QJ4B 1SL9A 2KQYA 3I5GC 2BE6A 1DTLA 3O4YA 2KHNA 4MN0A 1LXFC 1BJFA 4P2YB 2LMVA 3I5HC 1J55A 5AERA 1CFDA 1RTP1 1W7JB 1DT7B 1M45A 1LVCD 3EK7A 3CWGA 2JNFA 2V53A 1QV0A 1UWOA 1NCXA 1XVJA 3LK1A 1RK9A 5FYXA 5G08A 3E3RA 1NCYA 1KK8C 1XA5A 3EKHA 1SY9A 1YVLA 2MHHA 3FS7A 1DVIA 1DJYA 2I18A 2I2RE 3JTDC 1SPYA 4NDCA 2JOJA 2CT9A 5I2QA 1XFUO 1QV1A 2M1UA 1NX1A 2DOQA 1OMVA 1UHIA 1YRUB 2LMUA 3O2PA 1BODA 1FI6A 2Y1NA 4CPVA 2EHBA 1K8UA 2PVBA 4E68A 1A4PA 1S5GY 3TUYB 4MLWA 1A03A 1CB1A 1K2HA 1SR6B 5J3XA 2HF5A 1KFUL 1B8RA 2LLUA 3BUNB 2H61C 1S3PA 1Y1AA 2EC6C 2CBLA 1TCFA 3CGAA 1V1FA 4PE0A 3TDIA 1BU3A 2ZN8A 1IQ3A 2K7CA 1J1EA 1NP8A 1DJIA 1KFUS 1J1DA 2K2FA 4HREE 4XYNA 1K9KA 2LC5A 2K7OA 1W7IB 2WCBA 2GGMA 2K61A 4P5OE 4C0LA 1AJ5A 5CSNA 2M7LA 1OMDA 2F33A 1NPQA 2L4IA 2Y1MA 3OB2B 1CFFA 1KSOA 1R6PA 3KHEA 2KAYA 1JSAA 3TDZA 2KFHA 2KI6C 4CIDA 1F4OA 4GNKB 1ZOTB 2CCMA 4MRYA 5HLOA 1HQVA 1LA3A 3KF9A 2LVJA 1UURA 2LP3A 4HRHA 3CS1A 5TNCA 4ETOA 1C07A 2BL0B 3EVVA 3MSEB 4I5JA 2LHLA 4PE7A 2L5XB 1MUXA 1BF5A 2BECA 1FPWA 5HKWA 1MR8A 2D8NA 1CDNA 4MZLA 1PRWA 2BKHB 2L98A 3BUOB 5F6TA 1YTZC 1CMGA 2F2PA 2JNXA 1B8LA 2G2BA 1F54A 1PULA 1M63B 3GK4X 5DKQA 3SIBA 1IWQA 3F45A 3FWCA 4NDBA 1YVHA 2JPTA 5D7FA 1CLLA 3TDUA 1AP4A 2KI4B 1CDLA 2M8UA 1PVBA 1MQ1A 3O6BA 1QVIZ 1DF0A 1JWDA 1FW4A 3PM8A 1S26D 5CSJA 2KBIA 4F0ZB 1KWOC 1S36A 1XO5A 1S5GZ 4FTGA 3SG6A 4ORAB 2COLB 3NSLA 4UPGA 1TNWA 2KSPA 4YBHB 1UHHA 3BUWB 4MBEA 2FCDA 2LVIA 1B9AA 2PSRA 1ODBA 1AHRA 1CKKA 1U5IA 2HPSA 1JFKA 3PN7C 5CSIA 1CTRA 1KFXS 2JXLA 1MWNA 1QTXA 2M29A 4JPZB 3TS5B 1IH0A 2I94A 2JZIA 1WDCC 2Q91A 1BR4B 3I5IB 3JVTC 2LNKA 2OTGC 3AAJA 1R2UA 2M7NA 4MZKA 3DVEA 1ZACA 1K96A 3H4SE 1QX2A 1CNPA 3NSOA 2OS8B 3EK8A 5B8IB 1YR5A 1MXLC 2JTTA 3BUMB 3BUXB 1RWYA 2Y4QA 3GK1A 3IQOA 1G33A 1KK7Z 1JUOA 3HX4A 4ICBA 1QIWA 1TNQA 4DCKA 1DJHA 2OPOA 1TIZA 2LHIA 2JQ6A 4GBAA 1FF1A 1RROA 1N0YA 3BXKA 4A4BA 4D1EA
chains in the Genus database with same CATH superfamily
4OV2A 5KTYA 2KPHA 1LS8A 1KQMC 1TNPA 1J7QA 1SCMC 1EG3A 4M2OA 1DGVA 1TN4A 2LLSA 4QJ5B 5D69A 1IGVA 1ZFSA 2KLDA 4OR9B 1F71A 1W9ZA 4WRIA 1CDPA 3VRRA 4AOMA 5AFPA 1D1OA 2BCXA 4YGAA 5HL1A 2KYFA 2E30A 1IQ5A 1Q80A 1UUSA 2ZRTA 4MRXA 4GFTA 3UNWA 4AQIA 1RFJA 1F8HA 3VB1A 1OZSA 3DVMA 1BOCA 2HETA 2FCEA 1AP4A 1QVIY 3ZWHA 4M2QA 2M49B 1AJ4A 1B47A 2AMIA 3VRNA 1HT9A 3PSRA 3L4LA 2K0JA 3IF7A 3NHIA 4WQ3A 1SBJA 2MAZA 2TN4A 1WRKA 1IJ6A 4F7FA 1GJYA 2M9GA 4USLA 1P28A 2LP2A 4L9MA 4MSPA 1PSRA 3B87A 4M2PA 5HLVA 4DIRA 1J7OA 2P6BB 2ZNDA 1CLBA 5EL2A 1GGWA 4ORBB 3WNXB 3Q8IA 1CM4A 1BLQA 3LK0A 2P70A 2JRFA 1XK4C 3TUYC 2QEVA 3AAKA 2CXJA 3AKBA 4N1FA 1JFJA 4HRGA 1SR6C 3OX5A 1DJXA 4A4CA 4GUKA 3CDNA 1X02A 5HYDA 2BCBA 5D3OA 1IJ5A 2ZKMX 1DJWA 1QWVA 1RECA 2KFFA 1L7ZA 3A8RA 3R72A 5GQQC 1QLSA 1CFCA 1LA0A 2BBNA 3ICBA 4OCIA 1KK7Y 2I7AA 1DELA 5KU1A 2BBMA 4BY5A 1IKUA 1WRLA 5CSFA 3WHUB 1Y6WA 3R1PA 1JC2A 1OSAA 3RM1A 2SCPA 2GV5A 2E6WA 4JKTA 4I5KA 2PYQA 1KSMA 2BKIB 2L50A 3EG5B 3NSKA 3EKJA 4GGNA 3OHMB 1YX7A 1YUTA 3S0EA 2EGDA 3K21A 1QLKA 1OMRA 1PK0D 4GGFC 4QJ3B 2H2KA 1QX7A 1QATA 2QPTA 2H61A 2BL0C 4OKHA 1WLZA 1BMOA 1CDMA 3LL8B 3DYEA 1YX8A 3BYAA 4PHJA 4C0KA 1YRTB 1SRAA 2WC6A 1NYAA 2NZ0A 2LV7A 1ALVA 3D77A 3HCMA 4MEWA 1H8BA 5AXIA 1FI5A 3I5FB 2ZFDA 3PATA 1OZOA 1QJTA 3CTNA 1UHNA 2WORA 1NWDA 2AUCA 1TWOA 1MHOA 2FJYA 2KBMA 2SASA 4U8DA 1M46A 1SK6D 2MLEC 2KI4C 2BAPA 2KQ6A 3FWBA 1J7PA 2LLTA 5KSZA 5JOLA 2B1UA 3L4AA 2K7BA 1IIOA 3PALA 3QMEA 4PHMA 1JF0A 3DXLA 4HSZA 1B7TZ 1L2OB 1F4QA 2QEOA 3WHTB 1EXRA 1QXPA 3EVUA 1TUZA 2LMTA 4YGBB 3KPXA 3CZ1A 1IRJA 1XFRA 2CTNA 1JF2A 2KAXA 1B8CA 1XFZO 2H8VA 4I5LB 3VRQA 2KGRA 4AQJA 2KDHA 3GOFA 1OOIX 1TNXA 2JT8A 2HQ8A 1YURA 3D10A 2WC8A 4PDZA 1SL8A 1TUJA 3M0WA 5HKZA 4GGFA 3SG4A 3SJSA 1DC1A 3TS5C 2JT0A 1C3YA 2LVVA 2AAOA 3I5IC 1NX3A 2K8MB 1XFXO 1WLMA 4I5NB 3SG5A 1S6JA 3I5GB 2PASA 2PMYA 1YUSA 2KGBC 4YGCB 1LINA 2R2IA 4MVFA 1AVSA 1F55A 2LUXA 2L0PA 2LANA 2VRGA 2LAPA 1NSHA 3I5HB 3DF0A 2A4JA 2OS8C 4CFRA 2KOTA 3A4UB 3D0YA 5BPJA 4JWQA 2ZNEA 3B88A 3GK2A 3SG7A 1DQEA 4FQTA 4YI8A 2K60A 1G4YR 1OOJA 1OQPA 1Y0VH 1KK8B 2WCEA 1GGZA 3IQQA 3PM2A 5ER4X 4ZCVA 1VRKA 5DKRA 1RJVA 1T14A 1ZMZA 1XFYO 2LE9B 1QIVA 3O78A 3BOWA 2JC2A 3JTDB 3LLEA 3QRXA 2CNPA 1DMOA 4PCWA 1TOPA 4XJKA 2QEHA 1H4BA 4PE4A 1EL4A 2MLFC 1SSEB 1K90D 2MRDA 1ALWA 2L51A 1CLMA 3B7AA 1B4CA 1QX5B 1TCOB 2L2CA 1EH2A 1S1EA 2LCPA 5PALA 1B1GA 1IG5A 2M97A 3SIAA 1DGUA 2KAVA 4BY4A 2EC6B 1EG4A 1JBAA 4Q04A 1NX2A 1S6IA 1TRFA 2F8PA 1DF0B 2NXQA 1DJZA 1B7TY 1QASA 3LCPC 1A75A 1MXEA 2HQWA 2QACA 1PSBA 4JQ0D 1TTXA 3D78A 2NCPA 3S0GA 1SNLA 1K9PA 2Q4UA 2QDIA 2RGIA 4NDDA 5IBWA 3BFHA 3R1OA 1S6CA 1NIWA 2WC5A 4ORCB 1MF8B 2BE4A 3VGOA 1BR1B 2IS9A 1NX0A 2WNDA 1U5IB 2Y5IA 5FI2A 3TZ1A 3ZNIA 4CFQA 3EVRA 2FJUB 1ZUZA 1UHKA 2KI6D 2MJWB 1A29A 2F3ZA 4OVNF 3VROA 1AK8A 2M3WA 1Y1XA 2LUCA 3OGNA 2F2OA 1K95A 1DEKA 2WOSA 4MZJA 4PHKA 4C0JA 2JTZA 3CZTX 3N7HA 2O60A 1SKTA 1SL7A 5AEQA 2LM5A 1M31A 4R1EA 3KEVA 1SW8A 5CPVA 4NQGA 5HKYA 2NLNA 1WY9A 3EK4A 2QEBA 4INWA 3SS3A 2JULA 4GAOA 4DRWA 4N5XA 4DUQA 1V1GA 3AKAA 2K7DA 3OBVA 5FI7A 1N65A 2F3YA 4KYNA 2NCOA 1DJGA 1OOHA 1YUUA 2FOTA 1NUBA 2JPOA 2JWWA 3R1VA 1M39A 2ZN9A 1XK4A 1PALA 3CR5X 2L4HA 1CFPA 2WCHA 3NSIA 1KWOB 4PALA 1BG1A 2L2EA 3DF0B 4YI9A 4PE1A 3RLZA 5K89A 1QS7A 3D0YB 4YRUA 2LVKA 1SMGA 3BQ3A 3OB1B 1PVAA 2M1KB 1SCVA 2JT3A 2KYCA 3O4XA 3CYZA 3NHTA 1CMFA 2BCAA 3PLFB 2WCFA 1OE9B 5I94A 3FIAA 1WRZA 2KNEA 3DD4A 3S0FA 1GM0A 1K94A 1A2XA 3PN7B 2K2AA 2O5GA 3BOWB 3KO0A 3SG2A 4PT1A 3CR2A 1SYMA 5AANA 1AUIB 1Y1UA 4XJKB 2ISDA 3JVTB 1WDCB 3I5FC 3OX6A 3PFVA 1BT6A 2OTGB 1KFXL 3SG3A 5I8NA 4PHNA 1C7VA 1UP5A 3S0DA 2KFGA 3V2LA 1FBVA 2PRUA 2MA2A 3DVJA 1E8AA 1GQMA 1XFVO 2JU0A 4ZCUA 1J7RA 1LKJA 5JJGA 5I2LA 1G8IA 3CLNA 1N2DA 4WQ2A 1NCZA 1C7WA 3CR4X 1UHJA 1KQVA 5ER5A 3DVKA 4CLNA 4GPLB 1L2OC 2GGZA 2WCKA 4YGEB 3NXAA 1F70A 1XFWO 2JXCA 2BNXA 3CZ0A 3WXAA 5DKNA 4FQOA 1KCYA 3OP0A 2ZRSA 1A75B 3UO9A 5I2OA 4DS7A 4TNCA 2PALA 1K9UA 1K93D 1KQMB 1XYDA 3C1VA 1SCMB 4N1GA 3D74A 3S0AA 1EJ3A 3VRPA 4YGDB 2M0RA 1CM1A 4IL1A 4OZDA 2G9BA 4QJ4B 1SL9A 2KQYA 3I5GC 2BE6A 1DTLA 3O4YA 2KHNA 4MN0A 1LXFC 3BJHA 1BJFA 3B6XA 4P2YB 2LMVA 3S0BA 3I5HC 1J55A 5AERA 1CFDA 1RTP1 1W7JB 1DT7B 1M45A 1LVCD 3EK7A 3CWGA 2JNFA 2V53A 1QV0A 1UWOA 1NCXA 1XVJA 2WCJA 3LK1A 3FE6A 1RK9A 4JD9A 5FYXA 3E3RA 1NCYA 5G08A 3SS5A 1KK8C 1XA5A 3EKHA 4INXA 1SY9A 1YVLA 2MHHA 3FS7A 1DVIA 1DJYA 1Z4HA 2I18A 2I2RE 1SPYA 3JTDC 4NDCA 1OOGA 2JOJA 2CT9A 5I2QA 1XFUO 1QV1A 2M1UA 3PJIA 1NX1A 2DOQA 1OMVA 1UHIA 1YRUB 2LMUA 3O2PA 2YGUA 1OW4A 2Y1NA 3CABA 1BODA 4CPVA 1FI6A 2EHBA 1K8UA 2PVBA 4E68A 1A4PA 1S5GY 3TUYB 4MLWA 1A03A 3FE8A 1CB1A 1K2HA 1SR6B 5J3XA 3CZ2A 2HF5A 1KFUL 1B8RA 2ERBA 2LLUA 3BUNB 2H61C 1S3PA 1Y1AA 2EC6C 2CBLA 1TCFA 3CGAA 1V1FA 4PE0A 3TDIA 1BU3A 2ZN8A 2L5YA 3K1EA 1IQ3A 2K7CA 1J1EA 1NP8A 1DJIA 1KFUS 1J1DA 2K2FA 4HREE 4XYNA 1K9KA 2LC5A 2K7OA 1W7IB 2WCBA 2GGMA 2K61A 2WCMA 4P5OE 1AJ5A 5CSNA 2M7LA 1OMDA 4C0LA 2F33A 1NPQA 2L4IA 2Y1MA 3OB2B 1CFFA 1KSOA 2KLEA 1R6PA 3FE9A 2KAYA 3KHEA 3TDZA 1JSAA 2KFHA 2KI6C 4CIDA 1F4OA 4GNKB 1ZOTB 2CCMA 4MRYA 5HLOA 1HQVA 1LA3A 3KF9A 2LVJA 1UURA 2LP3A 4HRHA 3CS1A 5TNCA 4ETOA 1C07A 2BL0B 3EVVA 3MSEB 4I5JA 2LHLA 4PE7A 2L5XB 1MUXA 1BF5A 1Z2CB 2BECA 3DZTA 1FPWA 5HKWA 1MR8A 2D8NA 1CDNA 4MZLA 1PRWA 2BKHB 2L98A 3BUOB 3NGVA 5F6TA 2P71A 1YTZC 1CMGA 2F2PA 2JNXA 1B8LA 3SS4A 2G2BA 3BFAA 3D73A 1F54A 2PQLA 1PULA 3IVTA 1M63B 3GK4X 5DKQA 3SIBA 1IWQA 3F45A 3FWCA 4NDBA 1YVHA 2JPTA 5D7FA 1CLLA 3B86A 3TDUA 2KI4B 1CDLA 2M8UA 1PVBA 1MQ1A 1OOFA 3O6BA 1QVIZ 1DF0A 1JWDA 1FW4A 3PM8A 1S26D 5CSJA 2KBIA 4F0ZB 1KWOC 1S36A 1XO5A 1S5GZ 4FTGA 3SG6A 4IJ7A 4ORAB 2COLB 3NSLA 4UPGA 1TNWA 2KSPA 5FI6A 4YBHB 1UHHA 3BUWB 4MBEA 3L47A 2FCDA 2LVIA 1B9AA 2PSRA 1ODBA 1AHRA 1CKKA 1U5IA 2HPSA 1JFKA 3PN7C 5CSIA 1CTRA 1KFXS 2JXLA 1MWNA 1QTXA 2M29A 4JPZB 3BFBA 3TS5B 1IH0A 2I94A 2JZIA 1WDCC 2Q91A 1BR4B 3I5IB 3JVTC 2LNKA 2OTGC 2MBXA 3AAJA 1R2UA 2M7NA 4MZKA 3DVEA 3D76A 5DICA 1C3ZA 1ZACA 1K96A 3H4SE 3DY9A 1QX2A 3D75A 1CNPA 3NSOA 2OS8B 3EK8A 5B8IB 1YR5A 1MXLC 3RZSA 2JTTA 3BUMB 3BUXB 1RWYA 2Y4QA 3GK1A 3IQOA 1G33A 1KK7Z 1JUOA 3HX4A 4ICBA 1QIWA 2WCLA 1TNQA 4DCKA 1DJHA 2OPOA 1TIZA 2LHIA 2JQ6A 4GBAA 1FF1A 1RROA 1N0YA 1ORGA 2GTEA 3BXKA 4A4BA 4D1EA
chains in the Genus database with same CATH topology
4OV2A 5KTYA 1KQMC 1TNPA 1J7QA 1SCMC 1EG3A 4M2OA 1DGVA 1TN4A 2LLSA 4QJ5B 5D69A 1IGVA 1ZFSA 4OR9B 1F71A 4WRIA 1CDPA 3VRRA 4AOMA 5AFPA 1D1OA 2BCXA 4YGAA 2KYFA 2E30A 1IQ5A 1Q80A 1UUSA 2ZRTA 4MRXA 4GFTA 4AQIA 1F8HA 1RFJA 1OZSA 3DVMA 1BOCA 2HETA 2FCEA 1QVIY 3ZWHA 4M2QA 2M49B 1AJ4A 1B47A 2AMIA 3VRNA 1HT9A 3PSRA 2K0JA 3IF7A 4WQ3A 1SBJA 2MAZA 2TN4A 1WRKA 1IJ6A 1GJYA 2M9GA 4USLA 2LP2A 4L9MA 5HLVA 4MSPA 1PSRA 4M2PA 4DIRA 1J7OA 2P6BB 2ZNDA 1CLBA 1GGWA 4ORBB 3WNXB 1CM4A 1BLQA 3LK0A 2JRFA 1XK4C 3TUYC 3AAKA 2CXJA 3AKBA 4N1FA 1JFJA 4HRGA 1SR6C 3OX5A 1DJXA 4A4CA 4GUKA 1X02A 5HYDA 2BCBA 1IJ5A 2ZKMX 1DJWA 1RECA 2KFFA 1L7ZA 3A8RA 5GQQC 1QLSA 1CFCA 1LA0A 2BBNA 3ICBA 4OCIA 1KK7Y 2I7AA 5KU1A 2BBMA 4BY5A 1WRLA 5CSFA 3WHUB 1Y6WA 1JC2A 1OSAA 3RM1A 2SCPA 2GV5A 2E6WA 4I5KA 1KSMA 2BKIB 2L50A 3NSKA 3EKJA 4GGNA 3OHMB 1YX7A 1YUTA 2EGDA 3K21A 1QLKA 1OMRA 1PK0D 4GGFC 4QJ3B 2H2KA 1QX7A 1QATA 2QPTA 2H61A 2BL0C 4OKHA 1WLZA 1BMOA 1CDMA 3LL8B 1YX8A 3BYAA 4PHJA 4C0KA 1YRTB 1SRAA 1NYAA 2NZ0A 2LV7A 1ALVA 3HCMA 4MEWA 1H8BA 5AXIA 1FI5A 3I5FB 2ZFDA 3PATA 1OZOA 1QJTA 3CTNA 1UHNA 2WORA 1NWDA 2AUCA 1MHOA 2KBMA 2SASA 4U8DA 1M46A 1SK6D 2MLEC 2KI4C 2KQ6A 3FWBA 1J7PA 2LLTA 5KSZA 5JOLA 2B1UA 2K7BA 3PALA 4PHMA 1JF0A 4HSZA 3WHTB 1B7TZ 1L2OB 1F4QA 1EXRA 1QXPA 3EVUA 4YGBB 2LMTA 3KPXA 1IRJA 2CTNA 1JF2A 2KAXA 1B8CA 1XFZO 4I5LB 3VRQA 2KGRA 4AQJA 2KDHA 3GOFA 1TNXA 2JT8A 2HQ8A 1YURA 3D10A 2WC8A 4PDZA 1SL8A 3M0WA 5HKZA 3SG4A 4GGFA 3SJSA 3TS5C 2JT0A 2LVVA 2AAOA 3I5IC 1NX3A 2K8MB 1XFXO 1WLMA 4I5NB 3SG5A 1S6JA 3I5GB 2PASA 2PMYA 1YUSA 2KGBC 4YGCB 1LINA 2R2IA 4MVFA 1AVSA 1F55A 2LUXA 2L0PA 2LANA 2VRGA 2LAPA 1NSHA 3I5HB 3DF0A 2A4JA 2OS8C 4CFRA 2KOTA 3A4UB 3D0YA 5BPJA 4JWQA 2ZNEA 3GK2A 3SG7A 4YI8A 2MBXA 1G4YR 1OOJA 1OQPA 1Y0VH 1KK8B 2WCEA 1GGZA 3IQQA 5ER4X 4ZCVA 1IKUA 1VRKA 5DKRA 1RJVA 1ZMZA 1XFYO 2LE9B 1QIVA 3O78A 3BOWA 2JC2A 3JTDB 3LLEA 3QRXA 2CNPA 1DMOA 4PCWA 1TOPA 4XJKA 1H4BA 4PE4A 1EL4A 2MLFC 1K90D 2MRDA 1ALWA 2L51A 1CLMA 1B4CA 1QX5B 1TCOB 1EH2A 1S1EA 2LCPA 5PALA 1B1GA 1IG5A 2M97A 3SIAA 1DGUA 2KAVA 4BY4A 2EC6B 1EG4A 1JBAA 4Q04A 1NX2A 1S6IA 1TRFA 2F8PA 1DF0B 2NXQA 1DJZA 1B7TY 1QASA 3LCPC 1A75A 1MXEA 2HQWA 2QACA 1PSBA 4JQ0D 1TTXA 2NCPA 1SNLA 1K9PA 2Q4UA 2RGIA 4NDDA 5IBWA 1S6CA 1NIWA 4ORCB 1MF8B 2BE4A 3VGOA 1BR1B 2IS9A 1NX0A 2WNDA 1U5IB 2Y5IA 3TZ1A 3ZNIA 4CFQA 3EVRA 2FJUB 1ZUZA 1UHKA 2KI6D 2MJWB 1A29A 2F3ZA 4OVNF 3VROA 1AK8A 2M3WA 1Y1XA 2LUCA 2F2OA 1K95A 4MZJA 2WOSA 4PHKA 4C0JA 2JTZA 3CZTX 2O60A 1SKTA 1SL7A 5AEQA 2LM5A 1M31A 4R1EA 3KEVA 1SW8A 5CPVA 4NQGA 5HKYA 2NLNA 1WY9A 3EK4A 4DUQA 4DRWA 2JULA 4GAOA 4N5XA 1V1GA 3AKAA 2K7DA 1N65A 2F3YA 2NCOA 1DJGA 1YUUA 2FOTA 1NUBA 2JWWA 1M39A 2ZN9A 1XK4A 1PALA 3CR5X 2L4HA 1CFPA 3NSIA 1KWOB 4PALA 1BG1A 2L2EA 3DF0B 4YI9A 4PE1A 3RLZA 5K89A 1QS7A 3D0YB 4YRUA 2LVKA 1SMGA 3BQ3A 3OB1B 1PVAA 2M1KB 1SCVA 2JT3A 2KYCA 1CMFA 2BCAA 3PLFB 2WCFA 1OE9B 3FIAA 1WRZA 2KNEA 3DD4A 1K94A 1A2XA 3PN7B 2K2AA 2O5GA 3BOWB 3KO0A 3SG2A 3CR2A 1SYMA 5AANA 1AUIB 1Y1UA 4XJKB 2ISDA 3JVTB 1WDCB 3I5FC 3OX6A 3PFVA 1BT6A 2OTGB 1KFXL 3SG3A 5I8NA 4PHNA 1C7VA 1UP5A 2KFGA 1FBVA 2PRUA 2MA2A 3DVJA 1E8AA 1GQMA 1XFVO 2JU0A 4ZCUA 1J7RA 1LKJA 5JJGA 5I2LA 1G8IA 3CLNA 1N2DA 4WQ2A 1NCZA 1C7WA 3CR4X 1UHJA 1KQVA 5ER5A 3DVKA 4CLNA 4GPLB 1L2OC 2GGZA 4YGEB 3NXAA 1F70A 1XFWO 2JXCA 3WXAA 5DKNA 4FQOA 1KCYA 3OP0A 2ZRSA 1A75B 5I2OA 4DS7A 4TNCA 2PALA 1K9UA 1K93D 1KQMB 1XYDA 3C1VA 1SCMB 4N1GA 1EJ3A 3VRPA 4YGDB 2M0RA 1CM1A 4IL1A 2G9BA 4QJ4B 1SL9A 2KQYA 3I5GC 2BE6A 1DTLA 3O4YA 2KHNA 4MN0A 1LXFC 1BJFA 4P2YB 2LMVA 3I5HC 1J55A 5AERA 1CFDA 1RTP1 1W7JB 1DT7B 1M45A 1LVCD 3EK7A 3CWGA 2JNFA 2V53A 1QV0A 1UWOA 1NCXA 1XVJA 3LK1A 1RK9A 5FYXA 5G08A 3E3RA 1NCYA 1KK8C 1XA5A 3EKHA 1SY9A 1YVLA 2MHHA 3FS7A 1DVIA 1DJYA 2I18A 2I2RE 3JTDC 1SPYA 4NDCA 2JOJA 2CT9A 5I2QA 1XFUO 1QV1A 2M1UA 1NX1A 2DOQA 1OMVA 1UHIA 1YRUB 2LMUA 3O2PA 1BODA 1FI6A 2Y1NA 4CPVA 2EHBA 1K8UA 2PVBA 4E68A 1A4PA 1S5GY 3TUYB 4MLWA 1A03A 1CB1A 1K2HA 1SR6B 5J3XA 2HF5A 1KFUL 1B8RA 2LLUA 3BUNB 2H61C 1S3PA 1Y1AA 2EC6C 2CBLA 1TCFA 3CGAA 1V1FA 4PE0A 3TDIA 1BU3A 2ZN8A 1IQ3A 2K7CA 1J1EA 1NP8A 1DJIA 1KFUS 1J1DA 2K2FA 4HREE 4XYNA 1K9KA 2LC5A 2K7OA 1W7IB 2WCBA 2GGMA 2K61A 4P5OE 4C0LA 1AJ5A 5CSNA 2M7LA 1OMDA 2F33A 1NPQA 2L4IA 2Y1MA 3OB2B 1CFFA 1KSOA 1R6PA 3KHEA 2KAYA 1JSAA 3TDZA 2KFHA 2KI6C 4CIDA 1F4OA 4GNKB 1ZOTB 2CCMA 4MRYA 5HLOA 1HQVA 1LA3A 3KF9A 2LVJA 1UURA 2LP3A 4HRHA 3CS1A 5TNCA 4ETOA 1C07A 2BL0B 3EVVA 3MSEB 4I5JA 2LHLA 4PE7A 2L5XB 1MUXA 1BF5A 2BECA 1FPWA 5HKWA 1MR8A 2D8NA 1CDNA 4MZLA 1PRWA 2BKHB 2L98A 3BUOB 5F6TA 1YTZC 1CMGA 2F2PA 2JNXA 1B8LA 2G2BA 1F54A 1PULA 1M63B 3GK4X 5DKQA 3SIBA 1IWQA 3F45A 3FWCA 4NDBA 1YVHA 2JPTA 5D7FA 1CLLA 3TDUA 1AP4A 2KI4B 1CDLA 2M8UA 1PVBA 1MQ1A 3O6BA 1QVIZ 1DF0A 1JWDA 1FW4A 3PM8A 1S26D 5CSJA 2KBIA 4F0ZB 1KWOC 1S36A 1XO5A 1S5GZ 4FTGA 3SG6A 4ORAB 2COLB 3NSLA 4UPGA 1TNWA 2KSPA 4YBHB 1UHHA 3BUWB 4MBEA 2FCDA 2LVIA 1B9AA 2PSRA 1ODBA 1AHRA 1CKKA 1U5IA 2HPSA 1JFKA 3PN7C 5CSIA 1CTRA 1KFXS 2JXLA 1MWNA 1QTXA 2M29A 4JPZB 3TS5B 1IH0A 2I94A 2JZIA 1WDCC 2Q91A 1BR4B 3I5IB 3JVTC 2LNKA 2OTGC 3AAJA 1R2UA 2M7NA 4MZKA 3DVEA 1ZACA 1K96A 3H4SE 1QX2A 1CNPA 3NSOA 2OS8B 3EK8A 5B8IB 1YR5A 1MXLC 2JTTA 3BUMB 3BUXB 1RWYA 2Y4QA 3GK1A 3IQOA 1G33A 1KK7Z 1JUOA 3HX4A 4ICBA 1QIWA 1TNQA 4DCKA 1DJHA 2OPOA 1TIZA 2LHIA 2JQ6A 4GBAA 1FF1A 1RROA 1N0YA 3BXKA 4A4BA 4D1EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OV2 A;  5KTY A;  1KQM C;  1TNP A;  1J7Q A;  1SCM C;  1EG3 A;  4M2O A;  1DGV A;  1TN4 A;  2LLS A;  4QJ5 B;  5D69 A;  1IGV A;  1ZFS A;  4OR9 B;  1F71 A;  4WRI A;  1CDP A;  3VRR A;  4AOM A;  5AFP A;  1D1O A;  2BCX A;  4YGA A;  2KYF A;  2E30 A;  1IQ5 A;  1Q80 A;  1UUS A;  2ZRT A;  4MRX A;  4GFT A;  4AQI A;  1F8H A;  1RFJ A;  1OZS A;  3DVM A;  1BOC A;  2HET A;  2FCE A;  1QVI Y;  3ZWH A;  4M2Q A;  2M49 B;  1AJ4 A;  1B47 A;  2AMI A;  3VRN A;  1HT9 A;  3PSR A;  2K0J A;  3IF7 A;  4WQ3 A;  1SBJ A;  2MAZ A;  2TN4 A;  1WRK A;  1IJ6 A;  1GJY A;  2M9G A;  4USL A;  2LP2 A;  4L9M A;  5HLV A;  4MSP A;  1PSR A;  4M2P A;  4DIR A;  1J7O A;  2P6B B;  2ZND A;  1CLB A;  1GGW A;  4ORB B;  3WNX B;  1CM4 A;  1BLQ A;  3LK0 A;  2JRF A;  1XK4 C;  3TUY C;  3AAK A;  2CXJ A;  3AKB A;  4N1F A;  1JFJ A;  4HRG A;  1SR6 C;  3OX5 A;  1DJX A;  4A4C A;  4GUK A;  1X02 A;  5HYD A;  2BCB A;  1IJ5 A;  2ZKM X;  1DJW A;  1REC A;  2KFF A;  1L7Z A;  3A8R A;  5GQQ C;  1QLS A;  1CFC A;  1LA0 A;  2BBN A;  3ICB A;  4OCI A;  1KK7 Y;  2I7A A;  5KU1 A;  2BBM A;  4BY5 A;  1WRL A;  5CSF A;  3WHU B;  1Y6W A;  1JC2 A;  1OSA A;  3RM1 A;  2SCP A;  2GV5 A;  2E6W A;  4I5K A;  1KSM A;  2BKI B;  2L50 A;  3NSK A;  3EKJ A;  4GGN A;  3OHM B;  1YX7 A;  1YUT A;  2EGD A;  3K21 A;  1QLK A;  1OMR A;  1PK0 D;  4GGF C;  4QJ3 B;  2H2K A;  1QX7 A;  1QAT A;  2QPT A;  2H61 A;  2BL0 C;  4OKH A;  1WLZ A;  1BMO A;  1CDM A;  3LL8 B;  1YX8 A;  3BYA A;  4PHJ A;  4C0K A;  1YRT B;  1SRA A;  1NYA A;  2NZ0 A;  2LV7 A;  1ALV A;  3HCM A;  4MEW A;  1H8B A;  5AXI A;  1FI5 A;  3I5F B;  2ZFD A;  3PAT A;  1OZO A;  1QJT A;  3CTN A;  1UHN A;  2WOR A;  1NWD A;  2AUC A;  1MHO A;  2KBM A;  2SAS A;  4U8D A;  1M46 A;  1SK6 D;  2MLE C;  2KI4 C;  2KQ6 A;  3FWB A;  1J7P A;  2LLT A;  5KSZ A;  5JOL A;  2B1U A;  2K7B A;  3PAL A;  4PHM A;  1JF0 A;  4HSZ A;  3WHT B;  1B7T Z;  1L2O B;  1F4Q A;  1EXR A;  1QXP A;  3EVU A;  4YGB B;  2LMT A;  3KPX A;  1IRJ A;  2CTN A;  1JF2 A;  2KAX A;  1B8C A;  1XFZ O;  4I5L B;  3VRQ A;  2KGR A;  4AQJ A;  2KDH A;  3GOF A;  1TNX A;  2JT8 A;  2HQ8 A;  1YUR A;  3D10 A;  2WC8 A;  4PDZ A;  1SL8 A;  3M0W A;  5HKZ A;  3SG4 A;  4GGF A;  3SJS A;  3TS5 C;  2JT0 A;  2LVV A;  2AAO A;  3I5I C;  1NX3 A;  2K8M B;  1XFX O;  1WLM A;  4I5N B;  3SG5 A;  1S6J A;  3I5G B;  2PAS A;  2PMY A;  1YUS A;  2KGB C;  4YGC B;  1LIN A;  2R2I A;  4MVF A;  1AVS A;  1F55 A;  2LUX A;  2L0P A;  2LAN A;  2VRG A;  2LAP A;  1NSH A;  3I5H B;  3DF0 A;  2A4J A;  2OS8 C;  4CFR A;  2KOT A;  3A4U B;  3D0Y A;  5BPJ A;  4JWQ A;  2ZNE A;  3GK2 A;  3SG7 A;  4YI8 A;  2MBX A;  1G4Y R;  1OOJ A;  1OQP A;  1Y0V H;  1KK8 B;  2WCE A;  1GGZ A;  3IQQ A;  5ER4 X;  4ZCV A;  1IKU A;  1VRK A;  5DKR A;  1RJV A;  1ZMZ A;  1XFY O;  2LE9 B;  1QIV A;  3O78 A;  3BOW A;  2JC2 A;  3JTD B;  3LLE A;  3QRX A;  2CNP A;  1DMO A;  4PCW A;  1TOP A;  4XJK A;  1H4B A;  4PE4 A;  1EL4 A;  2MLF C;  1K90 D;  2MRD A;  1ALW A;  2L51 A;  1CLM A;  1B4C A;  1QX5 B;  1TCO B;  1EH2 A;  1S1E A;  2LCP A;  5PAL A;  1B1G A;  1IG5 A;  2M97 A;  3SIA A;  1DGU A;  2KAV A;  4BY4 A;  2EC6 B;  1EG4 A;  1JBA A;  4Q04 A;  1NX2 A;  1S6I A;  1TRF A;  2F8P A;  1DF0 B;  2NXQ A;  1DJZ A;  1B7T Y;  1QAS A;  3LCP C;  1A75 A;  1MXE A;  2HQW A;  2QAC A;  1PSB A;  4JQ0 D;  1TTX A;  2NCP A;  1SNL A;  1K9P A;  2Q4U A;  2RGI A;  4NDD A;  5IBW A;  1S6C A;  1NIW A;  4ORC B;  1MF8 B;  2BE4 A;  3VGO A;  1BR1 B;  2IS9 A;  1NX0 A;  2WND A;  1U5I B;  2Y5I A;  3TZ1 A;  3ZNI A;  4CFQ A;  3EVR A;  2FJU B;  1ZUZ A;  1UHK A;  2KI6 D;  2MJW B;  1A29 A;  2F3Z A;  4OVN F;  3VRO A;  1AK8 A;  2M3W A;  1Y1X A;  2LUC A;  2F2O A;  1K95 A;  4MZJ A;  2WOS A;  4PHK A;  4C0J A;  2JTZ A;  3CZT X;  2O60 A;  1SKT A;  1SL7 A;  5AEQ A;  2LM5 A;  1M31 A;  4R1E A;  3KEV A;  1SW8 A;  5CPV A;  4NQG A;  5HKY A;  2NLN A;  1WY9 A;  3EK4 A;  4DUQ A;  4DRW A;  2JUL A;  4GAO A;  4N5X A;  1V1G A;  3AKA A;  2K7D A;  1N65 A;  2F3Y A;  2NCO A;  1DJG A;  1YUU A;  2FOT A;  1NUB A;  2JWW A;  1M39 A;  2ZN9 A;  1XK4 A;  1PAL A;  3CR5 X;  2L4H A;  1CFP A;  3NSI A;  1KWO B;  4PAL A;  1BG1 A;  2L2E A;  3DF0 B;  4YI9 A;  4PE1 A;  3RLZ A;  5K89 A;  1QS7 A;  3D0Y B;  4YRU A;  2LVK A;  1SMG A;  3BQ3 A;  3OB1 B;  1PVA A;  2M1K B;  1SCV A;  2JT3 A;  2KYC A;  1CMF A;  2BCA A;  3PLF B;  2WCF A;  1OE9 B;  3FIA A;  1WRZ A;  2KNE A;  3DD4 A;  1K94 A;  1A2X A;  3PN7 B;  2K2A A;  2O5G A;  3BOW B;  3KO0 A;  3SG2 A;  3CR2 A;  1SYM A;  5AAN A;  1AUI B;  1Y1U A;  4XJK B;  2ISD A;  3JVT B;  1WDC B;  3I5F C;  3OX6 A;  3PFV A;  1BT6 A;  2OTG B;  1KFX L;  3SG3 A;  5I8N A;  4PHN A;  1C7V A;  1UP5 A;  2KFG A;  1FBV A;  2PRU A;  2MA2 A;  3DVJ A;  1E8A A;  1GQM A;  1XFV O;  2JU0 A;  4ZCU A;  1J7R A;  1LKJ A;  5JJG A;  5I2L A;  1G8I A;  3CLN A;  1N2D A;  4WQ2 A;  1NCZ A;  1C7W A;  3CR4 X;  1UHJ A;  1KQV A;  5ER5 A;  3DVK A;  4CLN A;  4GPL B;  1L2O C;  2GGZ A;  4YGE B;  3NXA A;  1F70 A;  1XFW O;  2JXC A;  3WXA A;  5DKN A;  4FQO A;  1KCY A;  3OP0 A;  2ZRS A;  1A75 B;  5I2O A;  4DS7 A;  4TNC A;  2PAL A;  1K9U A;  1K93 D;  1KQM B;  1XYD A;  3C1V A;  1SCM B;  4N1G A;  1EJ3 A;  3VRP A;  4YGD B;  2M0R A;  1CM1 A;  4IL1 A;  2G9B A;  4QJ4 B;  1SL9 A;  2KQY A;  3I5G C;  2BE6 A;  1DTL A;  3O4Y A;  2KHN A;  4MN0 A;  1LXF C;  1BJF A;  4P2Y B;  2LMV A;  3I5H C;  1J55 A;  5AER A;  1CFD A;  1RTP 1;  1W7J B;  1DT7 B;  1M45 A;  1LVC D;  3EK7 A;  3CWG A;  2JNF A;  2V53 A;  1QV0 A;  1UWO A;  1NCX A;  1XVJ A;  3LK1 A;  1RK9 A;  5FYX A;  5G08 A;  3E3R A;  1NCY A;  1KK8 C;  1XA5 A;  3EKH A;  1SY9 A;  1YVL A;  2MHH A;  3FS7 A;  1DVI A;  1DJY A;  2I18 A;  2I2R E;  3JTD C;  1SPY A;  4NDC A;  2JOJ A;  2CT9 A;  5I2Q A;  1XFU O;  1QV1 A;  2M1U A;  1NX1 A;  2DOQ A;  1OMV A;  1UHI A;  1YRU B;  2LMU A;  3O2P A;  1BOD A;  1FI6 A;  2Y1N A;  4CPV A;  2EHB A;  1K8U A;  2PVB A;  4E68 A;  1A4P A;  1S5G Y;  3TUY B;  4MLW A;  1A03 A;  1CB1 A;  1K2H A;  1SR6 B;  5J3X A;  2HF5 A;  1KFU L;  1B8R A;  2LLU A;  3BUN B;  2H61 C;  1S3P A;  1Y1A A;  2EC6 C;  2CBL A;  1TCF A;  3CGA A;  1V1F A;  4PE0 A;  3TDI A;  1BU3 A;  2ZN8 A;  1IQ3 A;  2K7C A;  1J1E A;  1NP8 A;  1DJI A;  1KFU S;  1J1D A;  2K2F A;  4HRE E;  4XYN A;  1K9K A;  2LC5 A;  2K7O A;  1W7I B;  2WCB A;  2GGM A;  2K61 A;  4P5O E;  4C0L A;  1AJ5 A;  5CSN A;  2M7L A;  1OMD A;  2F33 A;  1NPQ A;  2L4I A;  2Y1M A;  3OB2 B;  1CFF A;  1KSO A;  1R6P A;  3KHE A;  2KAY A;  1JSA A;  3TDZ A;  2KFH A;  2KI6 C;  4CID A;  1F4O A;  4GNK B;  1ZOT B;  2CCM A;  4MRY A;  5HLO A;  1HQV A;  1LA3 A;  3KF9 A;  2LVJ A;  1UUR A;  2LP3 A;  4HRH A;  3CS1 A;  5TNC A;  4ETO A;  1C07 A;  2BL0 B;  3EVV A;  3MSE B;  4I5J A;  2LHL A;  4PE7 A;  2L5X B;  1MUX A;  1BF5 A;  2BEC A;  1FPW A;  5HKW A;  1MR8 A;  2D8N A;  1CDN A;  4MZL A;  1PRW A;  2BKH B;  2L98 A;  3BUO B;  5F6T A;  1YTZ C;  1CMG A;  2F2P A;  2JNX A;  1B8L A;  2G2B A;  1F54 A;  1PUL A;  1M63 B;  3GK4 X;  5DKQ A;  3SIB A;  1IWQ A;  3F45 A;  3FWC A;  4NDB A;  1YVH A;  2JPT A;  5D7F A;  1CLL A;  3TDU A;  1AP4 A;  2KI4 B;  1CDL A;  2M8U A;  1PVB A;  1MQ1 A;  3O6B A;  1QVI Z;  1DF0 A;  1JWD A;  1FW4 A;  3PM8 A;  1S26 D;  5CSJ A;  2KBI A;  4F0Z B;  1KWO C;  1S36 A;  1XO5 A;  1S5G Z;  4FTG A;  3SG6 A;  4ORA B;  2COL B;  3NSL A;  4UPG A;  1TNW A;  2KSP A;  4YBH B;  1UHH A;  3BUW B;  4MBE A;  2FCD A;  2LVI A;  1B9A A;  2PSR A;  1ODB A;  1AHR A;  1CKK A;  1U5I A;  2HPS A;  1JFK A;  3PN7 C;  5CSI A;  1CTR A;  1KFX S;  2JXL A;  1MWN A;  1QTX A;  2M29 A;  4JPZ B;  3TS5 B;  1IH0 A;  2I94 A;  2JZI A;  1WDC C;  2Q91 A;  1BR4 B;  3I5I B;  3JVT C;  2LNK A;  2OTG C;  3AAJ A;  1R2U A;  2M7N A;  4MZK A;  3DVE A;  1ZAC A;  1K96 A;  3H4S E;  1QX2 A;  1CNP A;  3NSO A;  2OS8 B;  3EK8 A;  5B8I B;  1YR5 A;  1MXL C;  2JTT A;  3BUM B;  3BUX B;  1RWY A;  2Y4Q A;  3GK1 A;  3IQO A;  1G33 A;  1KK7 Z;  1JUO A;  3HX4 A;  4ICB A;  1QIW A;  1TNQ A;  4DCK A;  1DJH A;  2OPO A;  1TIZ A;  2LHI A;  2JQ6 A;  4GBA A;  1FF1 A;  1RRO A;  1N0Y A;  3BXK A;  4A4B A;  4D1E A; 
#chains in the Genus database with same CATH topology
 4OV2 A;  5KTY A;  2KPH A;  1LS8 A;  1KQM C;  1TNP A;  1J7Q A;  1SCM C;  1EG3 A;  4M2O A;  1DGV A;  1TN4 A;  2LLS A;  4QJ5 B;  5D69 A;  1IGV A;  1ZFS A;  2KLD A;  4OR9 B;  1F71 A;  1W9Z A;  4WRI A;  1CDP A;  3VRR A;  4AOM A;  5AFP A;  1D1O A;  2BCX A;  4YGA A;  5HL1 A;  2KYF A;  2E30 A;  1IQ5 A;  1Q80 A;  1UUS A;  2ZRT A;  4MRX A;  4GFT A;  3UNW A;  4AQI A;  1RFJ A;  1F8H A;  3VB1 A;  1OZS A;  3DVM A;  1BOC A;  2HET A;  2FCE A;  1AP4 A;  1QVI Y;  3ZWH A;  4M2Q A;  2M49 B;  1AJ4 A;  1B47 A;  2AMI A;  3VRN A;  1HT9 A;  3PSR A;  3L4L A;  2K0J A;  3IF7 A;  3NHI A;  4WQ3 A;  1SBJ A;  2MAZ A;  2TN4 A;  1WRK A;  1IJ6 A;  4F7F A;  1GJY A;  2M9G A;  4USL A;  1P28 A;  2LP2 A;  4L9M A;  4MSP A;  1PSR A;  3B87 A;  4M2P A;  5HLV A;  4DIR A;  1J7O A;  2P6B B;  2ZND A;  1CLB A;  5EL2 A;  1GGW A;  4ORB B;  3WNX B;  3Q8I A;  1CM4 A;  1BLQ A;  3LK0 A;  2P70 A;  2JRF A;  1XK4 C;  3TUY C;  2QEV A;  3AAK A;  2CXJ A;  3AKB A;  4N1F A;  1JFJ A;  4HRG A;  1SR6 C;  3OX5 A;  1DJX A;  4A4C A;  4GUK A;  3CDN A;  1X02 A;  5HYD A;  2BCB A;  5D3O A;  1IJ5 A;  2ZKM X;  1DJW A;  1QWV A;  1REC A;  2KFF A;  1L7Z A;  3A8R A;  3R72 A;  5GQQ C;  1QLS A;  1CFC A;  1LA0 A;  2BBN A;  3ICB A;  4OCI A;  1KK7 Y;  2I7A A;  1DEL A;  5KU1 A;  2BBM A;  4BY5 A;  1IKU A;  1WRL A;  5CSF A;  3WHU B;  1Y6W A;  3R1P A;  1JC2 A;  1OSA A;  3RM1 A;  2SCP A;  2GV5 A;  2E6W A;  4JKT A;  4I5K A;  2PYQ A;  1KSM A;  2BKI B;  2L50 A;  3EG5 B;  3NSK A;  3EKJ A;  4GGN A;  3OHM B;  1YX7 A;  1YUT A;  3S0E A;  2EGD A;  3K21 A;  1QLK A;  1OMR A;  1PK0 D;  4GGF C;  4QJ3 B;  2H2K A;  1QX7 A;  1QAT A;  2QPT A;  2H61 A;  2BL0 C;  4OKH A;  1WLZ A;  1BMO A;  1CDM A;  3LL8 B;  3DYE A;  1YX8 A;  3BYA A;  4PHJ A;  4C0K A;  1YRT B;  1SRA A;  2WC6 A;  1NYA A;  2NZ0 A;  2LV7 A;  1ALV A;  3D77 A;  3HCM A;  4MEW A;  1H8B A;  5AXI A;  1FI5 A;  3I5F B;  2ZFD A;  3PAT A;  1OZO A;  1QJT A;  3CTN A;  1UHN A;  2WOR A;  1NWD A;  2AUC A;  1TWO A;  1MHO A;  2FJY A;  2KBM A;  2SAS A;  4U8D A;  1M46 A;  1SK6 D;  2MLE C;  2KI4 C;  2BAP A;  2KQ6 A;  3FWB A;  1J7P A;  2LLT A;  5KSZ A;  5JOL A;  2B1U A;  3L4A A;  2K7B A;  1IIO A;  3PAL A;  3QME A;  4PHM A;  1JF0 A;  3DXL A;  4HSZ A;  1B7T Z;  1L2O B;  1F4Q A;  2QEO A;  3WHT B;  1EXR A;  1QXP A;  3EVU A;  1TUZ A;  2LMT A;  4YGB B;  3KPX A;  3CZ1 A;  1IRJ A;  1XFR A;  2CTN A;  1JF2 A;  2KAX A;  1B8C A;  1XFZ O;  2H8V A;  4I5L B;  3VRQ A;  2KGR A;  4AQJ A;  2KDH A;  3GOF A;  1OOI X;  1TNX A;  2JT8 A;  2HQ8 A;  1YUR A;  3D10 A;  2WC8 A;  4PDZ A;  1SL8 A;  1TUJ A;  3M0W A;  5HKZ A;  4GGF A;  3SG4 A;  3SJS A;  1DC1 A;  3TS5 C;  2JT0 A;  1C3Y A;  2LVV A;  2AAO A;  3I5I C;  1NX3 A;  2K8M B;  1XFX O;  1WLM A;  4I5N B;  3SG5 A;  1S6J A;  3I5G B;  2PAS A;  2PMY A;  1YUS A;  2KGB C;  4YGC B;  1LIN A;  2R2I A;  4MVF A;  1AVS A;  1F55 A;  2LUX A;  2L0P A;  2LAN A;  2VRG A;  2LAP A;  1NSH A;  3I5H B;  3DF0 A;  2A4J A;  2OS8 C;  4CFR A;  2KOT A;  3A4U B;  3D0Y A;  5BPJ A;  4JWQ A;  2ZNE A;  3B88 A;  3GK2 A;  3SG7 A;  1DQE A;  4FQT A;  4YI8 A;  2K60 A;  1G4Y R;  1OOJ A;  1OQP A;  1Y0V H;  1KK8 B;  2WCE A;  1GGZ A;  3IQQ A;  3PM2 A;  5ER4 X;  4ZCV A;  1VRK A;  5DKR A;  1RJV A;  1T14 A;  1ZMZ A;  1XFY O;  2LE9 B;  1QIV A;  3O78 A;  3BOW A;  2JC2 A;  3JTD B;  3LLE A;  3QRX A;  2CNP A;  1DMO A;  4PCW A;  1TOP A;  4XJK A;  2QEH A;  1H4B A;  4PE4 A;  1EL4 A;  2MLF C;  1SSE B;  1K90 D;  2MRD A;  1ALW A;  2L51 A;  1CLM A;  3B7A A;  1B4C A;  1QX5 B;  1TCO B;  2L2C A;  1EH2 A;  1S1E A;  2LCP A;  5PAL A;  1B1G A;  1IG5 A;  2M97 A;  3SIA A;  1DGU A;  2KAV A;  4BY4 A;  2EC6 B;  1EG4 A;  1JBA A;  4Q04 A;  1NX2 A;  1S6I A;  1TRF A;  2F8P A;  1DF0 B;  2NXQ A;  1DJZ A;  1B7T Y;  1QAS A;  3LCP C;  1A75 A;  1MXE A;  2HQW A;  2QAC A;  1PSB A;  4JQ0 D;  1TTX A;  3D78 A;  2NCP A;  3S0G A;  1SNL A;  1K9P A;  2Q4U A;  2QDI A;  2RGI A;  4NDD A;  5IBW A;  3BFH A;  3R1O A;  1S6C A;  1NIW A;  2WC5 A;  4ORC B;  1MF8 B;  2BE4 A;  3VGO A;  1BR1 B;  2IS9 A;  1NX0 A;  2WND A;  1U5I B;  2Y5I A;  5FI2 A;  3TZ1 A;  3ZNI A;  4CFQ A;  3EVR A;  2FJU B;  1ZUZ A;  1UHK A;  2KI6 D;  2MJW B;  1A29 A;  2F3Z A;  4OVN F;  3VRO A;  1AK8 A;  2M3W A;  1Y1X A;  2LUC A;  3OGN A;  2F2O A;  1K95 A;  1DEK A;  2WOS A;  4MZJ A;  4PHK A;  4C0J A;  2JTZ A;  3CZT X;  3N7H A;  2O60 A;  1SKT A;  1SL7 A;  5AEQ A;  2LM5 A;  1M31 A;  4R1E A;  3KEV A;  1SW8 A;  5CPV A;  4NQG A;  5HKY A;  2NLN A;  1WY9 A;  3EK4 A;  2QEB A;  4INW A;  3SS3 A;  2JUL A;  4GAO A;  4DRW A;  4N5X A;  4DUQ A;  1V1G A;  3AKA A;  2K7D A;  3OBV A;  5FI7 A;  1N65 A;  2F3Y A;  4KYN A;  2NCO A;  1DJG A;  1OOH A;  1YUU A;  2FOT A;  1NUB A;  2JPO A;  2JWW A;  3R1V A;  1M39 A;  2ZN9 A;  1XK4 A;  1PAL A;  3CR5 X;  2L4H A;  1CFP A;  2WCH A;  3NSI A;  1KWO B;  4PAL A;  1BG1 A;  2L2E A;  3DF0 B;  4YI9 A;  4PE1 A;  3RLZ A;  5K89 A;  1QS7 A;  3D0Y B;  4YRU A;  2LVK A;  1SMG A;  3BQ3 A;  3OB1 B;  1PVA A;  2M1K B;  1SCV A;  2JT3 A;  2KYC A;  3O4X A;  3CYZ A;  3NHT A;  1CMF A;  2BCA A;  3PLF B;  2WCF A;  1OE9 B;  5I94 A;  3FIA A;  1WRZ A;  2KNE A;  3DD4 A;  3S0F A;  1GM0 A;  1K94 A;  1A2X A;  3PN7 B;  2K2A A;  2O5G A;  3BOW B;  3KO0 A;  3SG2 A;  4PT1 A;  3CR2 A;  1SYM A;  5AAN A;  1AUI B;  1Y1U A;  4XJK B;  2ISD A;  3JVT B;  1WDC B;  3I5F C;  3OX6 A;  3PFV A;  1BT6 A;  2OTG B;  1KFX L;  3SG3 A;  5I8N A;  4PHN A;  1C7V A;  1UP5 A;  3S0D A;  2KFG A;  3V2L A;  1FBV A;  2PRU A;  2MA2 A;  3DVJ A;  1E8A A;  1GQM A;  1XFV O;  2JU0 A;  4ZCU A;  1J7R A;  1LKJ A;  5JJG A;  5I2L A;  1G8I A;  3CLN A;  1N2D A;  4WQ2 A;  1NCZ A;  1C7W A;  3CR4 X;  1UHJ A;  1KQV A;  5ER5 A;  3DVK A;  4CLN A;  4GPL B;  1L2O C;  2GGZ A;  2WCK A;  4YGE B;  3NXA A;  1F70 A;  1XFW O;  2JXC A;  2BNX A;  3CZ0 A;  3WXA A;  5DKN A;  4FQO A;  1KCY A;  3OP0 A;  2ZRS A;  1A75 B;  3UO9 A;  5I2O A;  4DS7 A;  4TNC A;  2PAL A;  1K9U A;  1K93 D;  1KQM B;  1XYD A;  3C1V A;  1SCM B;  4N1G A;  3D74 A;  3S0A A;  1EJ3 A;  3VRP A;  4YGD B;  2M0R A;  1CM1 A;  4IL1 A;  4OZD A;  2G9B A;  4QJ4 B;  1SL9 A;  2KQY A;  3I5G C;  2BE6 A;  1DTL A;  3O4Y A;  2KHN A;  4MN0 A;  1LXF C;  3BJH A;  1BJF A;  3B6X A;  4P2Y B;  2LMV A;  3S0B A;  3I5H C;  1J55 A;  5AER A;  1CFD A;  1RTP 1;  1W7J B;  1DT7 B;  1M45 A;  1LVC D;  3EK7 A;  3CWG A;  2JNF A;  2V53 A;  1QV0 A;  1UWO A;  1NCX A;  1XVJ A;  2WCJ A;  3LK1 A;  3FE6 A;  1RK9 A;  4JD9 A;  5FYX A;  3E3R A;  1NCY A;  5G08 A;  3SS5 A;  1KK8 C;  1XA5 A;  3EKH A;  4INX A;  1SY9 A;  1YVL A;  2MHH A;  3FS7 A;  1DVI A;  1DJY A;  1Z4H A;  2I18 A;  2I2R E;  1SPY A;  3JTD C;  4NDC A;  1OOG A;  2JOJ A;  2CT9 A;  5I2Q A;  1XFU O;  1QV1 A;  2M1U A;  3PJI A;  1NX1 A;  2DOQ A;  1OMV A;  1UHI A;  1YRU B;  2LMU A;  3O2P A;  2YGU A;  1OW4 A;  2Y1N A;  3CAB A;  1BOD A;  4CPV A;  1FI6 A;  2EHB A;  1K8U A;  2PVB A;  4E68 A;  1A4P A;  1S5G Y;  3TUY B;  4MLW A;  1A03 A;  3FE8 A;  1CB1 A;  1K2H A;  1SR6 B;  5J3X A;  3CZ2 A;  2HF5 A;  1KFU L;  1B8R A;  2ERB A;  2LLU A;  3BUN B;  2H61 C;  1S3P A;  1Y1A A;  2EC6 C;  2CBL A;  1TCF A;  3CGA A;  1V1F A;  4PE0 A;  3TDI A;  1BU3 A;  2ZN8 A;  2L5Y A;  3K1E A;  1IQ3 A;  2K7C A;  1J1E A;  1NP8 A;  1DJI A;  1KFU S;  1J1D A;  2K2F A;  4HRE E;  4XYN A;  1K9K A;  2LC5 A;  2K7O A;  1W7I B;  2WCB A;  2GGM A;  2K61 A;  2WCM A;  4P5O E;  1AJ5 A;  5CSN A;  2M7L A;  1OMD A;  4C0L A;  2F33 A;  1NPQ A;  2L4I A;  2Y1M A;  3OB2 B;  1CFF A;  1KSO A;  2KLE A;  1R6P A;  3FE9 A;  2KAY A;  3KHE A;  3TDZ A;  1JSA A;  2KFH A;  2KI6 C;  4CID A;  1F4O A;  4GNK B;  1ZOT B;  2CCM A;  4MRY A;  5HLO A;  1HQV A;  1LA3 A;  3KF9 A;  2LVJ A;  1UUR A;  2LP3 A;  4HRH A;  3CS1 A;  5TNC A;  4ETO A;  1C07 A;  2BL0 B;  3EVV A;  3MSE B;  4I5J A;  2LHL A;  4PE7 A;  2L5X B;  1MUX A;  1BF5 A;  1Z2C B;  2BEC A;  3DZT A;  1FPW A;  5HKW A;  1MR8 A;  2D8N A;  1CDN A;  4MZL A;  1PRW A;  2BKH B;  2L98 A;  3BUO B;  3NGV A;  5F6T A;  2P71 A;  1YTZ C;  1CMG A;  2F2P A;  2JNX A;  1B8L A;  3SS4 A;  2G2B A;  3BFA A;  3D73 A;  1F54 A;  2PQL A;  1PUL A;  3IVT A;  1M63 B;  3GK4 X;  5DKQ A;  3SIB A;  1IWQ A;  3F45 A;  3FWC A;  4NDB A;  1YVH A;  2JPT A;  5D7F A;  1CLL A;  3B86 A;  3TDU A;  2KI4 B;  1CDL A;  2M8U A;  1PVB A;  1MQ1 A;  1OOF A;  3O6B A;  1QVI Z;  1DF0 A;  1JWD A;  1FW4 A;  3PM8 A;  1S26 D;  5CSJ A;  2KBI A;  4F0Z B;  1KWO C;  1S36 A;  1XO5 A;  1S5G Z;  4FTG A;  3SG6 A;  4IJ7 A;  4ORA B;  2COL B;  3NSL A;  4UPG A;  1TNW A;  2KSP A;  5FI6 A;  4YBH B;  1UHH A;  3BUW B;  4MBE A;  3L47 A;  2FCD A;  2LVI A;  1B9A A;  2PSR A;  1ODB A;  1AHR A;  1CKK A;  1U5I A;  2HPS A;  1JFK A;  3PN7 C;  5CSI A;  1CTR A;  1KFX S;  2JXL A;  1MWN A;  1QTX A;  2M29 A;  4JPZ B;  3BFB A;  3TS5 B;  1IH0 A;  2I94 A;  2JZI A;  1WDC C;  2Q91 A;  1BR4 B;  3I5I B;  3JVT C;  2LNK A;  2OTG C;  2MBX A;  3AAJ A;  1R2U A;  2M7N A;  4MZK A;  3DVE A;  3D76 A;  5DIC A;  1C3Z A;  1ZAC A;  1K96 A;  3H4S E;  3DY9 A;  1QX2 A;  3D75 A;  1CNP A;  3NSO A;  2OS8 B;  3EK8 A;  5B8I B;  1YR5 A;  1MXL C;  3RZS A;  2JTT A;  3BUM B;  3BUX B;  1RWY A;  2Y4Q A;  3GK1 A;  3IQO A;  1G33 A;  1KK7 Z;  1JUO A;  3HX4 A;  4ICB A;  1QIW A;  2WCL A;  1TNQ A;  4DCK A;  1DJH A;  2OPO A;  1TIZ A;  2LHI A;  2JQ6 A;  4GBA A;  1FF1 A;  1RRO A;  1N0Y A;  1ORG A;  2GTE A;  3BXK A;  4A4B A;  4D1E A; 
#chains in the Genus database with same CATH homology
 4OV2 A;  5KTY A;  1KQM C;  1TNP A;  1J7Q A;  1SCM C;  1EG3 A;  4M2O A;  1DGV A;  1TN4 A;  2LLS A;  4QJ5 B;  5D69 A;  1IGV A;  1ZFS A;  4OR9 B;  1F71 A;  4WRI A;  1CDP A;  3VRR A;  4AOM A;  5AFP A;  1D1O A;  2BCX A;  4YGA A;  2KYF A;  2E30 A;  1IQ5 A;  1Q80 A;  1UUS A;  2ZRT A;  4MRX A;  4GFT A;  4AQI A;  1F8H A;  1RFJ A;  1OZS A;  3DVM A;  1BOC A;  2HET A;  2FCE A;  1QVI Y;  3ZWH A;  4M2Q A;  2M49 B;  1AJ4 A;  1B47 A;  2AMI A;  3VRN A;  1HT9 A;  3PSR A;  2K0J A;  3IF7 A;  4WQ3 A;  1SBJ A;  2MAZ A;  2TN4 A;  1WRK A;  1IJ6 A;  1GJY A;  2M9G A;  4USL A;  2LP2 A;  4L9M A;  5HLV A;  4MSP A;  1PSR A;  4M2P A;  4DIR A;  1J7O A;  2P6B B;  2ZND A;  1CLB A;  1GGW A;  4ORB B;  3WNX B;  1CM4 A;  1BLQ A;  3LK0 A;  2JRF A;  1XK4 C;  3TUY C;  3AAK A;  2CXJ A;  3AKB A;  4N1F A;  1JFJ A;  4HRG A;  1SR6 C;  3OX5 A;  1DJX A;  4A4C A;  4GUK A;  1X02 A;  5HYD A;  2BCB A;  1IJ5 A;  2ZKM X;  1DJW A;  1REC A;  2KFF A;  1L7Z A;  3A8R A;  5GQQ C;  1QLS A;  1CFC A;  1LA0 A;  2BBN A;  3ICB A;  4OCI A;  1KK7 Y;  2I7A A;  5KU1 A;  2BBM A;  4BY5 A;  1WRL A;  5CSF A;  3WHU B;  1Y6W A;  1JC2 A;  1OSA A;  3RM1 A;  2SCP A;  2GV5 A;  2E6W A;  4I5K A;  1KSM A;  2BKI B;  2L50 A;  3NSK A;  3EKJ A;  4GGN A;  3OHM B;  1YX7 A;  1YUT A;  2EGD A;  3K21 A;  1QLK A;  1OMR A;  1PK0 D;  4GGF C;  4QJ3 B;  2H2K A;  1QX7 A;  1QAT A;  2QPT A;  2H61 A;  2BL0 C;  4OKH A;  1WLZ A;  1BMO A;  1CDM A;  3LL8 B;  1YX8 A;  3BYA A;  4PHJ A;  4C0K A;  1YRT B;  1SRA A;  1NYA A;  2NZ0 A;  2LV7 A;  1ALV A;  3HCM A;  4MEW A;  1H8B A;  5AXI A;  1FI5 A;  3I5F B;  2ZFD A;  3PAT A;  1OZO A;  1QJT A;  3CTN A;  1UHN A;  2WOR A;  1NWD A;  2AUC A;  1MHO A;  2KBM A;  2SAS A;  4U8D A;  1M46 A;  1SK6 D;  2MLE C;  2KI4 C;  2KQ6 A;  3FWB A;  1J7P A;  2LLT A;  5KSZ A;  5JOL A;  2B1U A;  2K7B A;  3PAL A;  4PHM A;  1JF0 A;  4HSZ A;  3WHT B;  1B7T Z;  1L2O B;  1F4Q A;  1EXR A;  1QXP A;  3EVU A;  4YGB B;  2LMT A;  3KPX A;  1IRJ A;  2CTN A;  1JF2 A;  2KAX A;  1B8C A;  1XFZ O;  4I5L B;  3VRQ A;  2KGR A;  4AQJ A;  2KDH A;  3GOF A;  1TNX A;  2JT8 A;  2HQ8 A;  1YUR A;  3D10 A;  2WC8 A;  4PDZ A;  1SL8 A;  3M0W A;  5HKZ A;  3SG4 A;  4GGF A;  3SJS A;  3TS5 C;  2JT0 A;  2LVV A;  2AAO A;  3I5I C;  1NX3 A;  2K8M B;  1XFX O;  1WLM A;  4I5N B;  3SG5 A;  1S6J A;  3I5G B;  2PAS A;  2PMY A;  1YUS A;  2KGB C;  4YGC B;  1LIN A;  2R2I A;  4MVF A;  1AVS A;  1F55 A;  2LUX A;  2L0P A;  2LAN A;  2VRG A;  2LAP A;  1NSH A;  3I5H B;  3DF0 A;  2A4J A;  2OS8 C;  4CFR A;  2KOT A;  3A4U B;  3D0Y A;  5BPJ A;  4JWQ A;  2ZNE A;  3GK2 A;  3SG7 A;  4YI8 A;  2MBX A;  1G4Y R;  1OOJ A;  1OQP A;  1Y0V H;  1KK8 B;  2WCE A;  1GGZ A;  3IQQ A;  5ER4 X;  4ZCV A;  1IKU A;  1VRK A;  5DKR A;  1RJV A;  1ZMZ A;  1XFY O;  2LE9 B;  1QIV A;  3O78 A;  3BOW A;  2JC2 A;  3JTD B;  3LLE A;  3QRX A;  2CNP A;  1DMO A;  4PCW A;  1TOP A;  4XJK A;  1H4B A;  4PE4 A;  1EL4 A;  2MLF C;  1K90 D;  2MRD A;  1ALW A;  2L51 A;  1CLM A;  1B4C A;  1QX5 B;  1TCO B;  1EH2 A;  1S1E A;  2LCP A;  5PAL A;  1B1G A;  1IG5 A;  2M97 A;  3SIA A;  1DGU A;  2KAV A;  4BY4 A;  2EC6 B;  1EG4 A;  1JBA A;  4Q04 A;  1NX2 A;  1S6I A;  1TRF A;  2F8P A;  1DF0 B;  2NXQ A;  1DJZ A;  1B7T Y;  1QAS A;  3LCP C;  1A75 A;  1MXE A;  2HQW A;  2QAC A;  1PSB A;  4JQ0 D;  1TTX A;  2NCP A;  1SNL A;  1K9P A;  2Q4U A;  2RGI A;  4NDD A;  5IBW A;  1S6C A;  1NIW A;  4ORC B;  1MF8 B;  2BE4 A;  3VGO A;  1BR1 B;  2IS9 A;  1NX0 A;  2WND A;  1U5I B;  2Y5I A;  3TZ1 A;  3ZNI A;  4CFQ A;  3EVR A;  2FJU B;  1ZUZ A;  1UHK A;  2KI6 D;  2MJW B;  1A29 A;  2F3Z A;  4OVN F;  3VRO A;  1AK8 A;  2M3W A;  1Y1X A;  2LUC A;  2F2O A;  1K95 A;  4MZJ A;  2WOS A;  4PHK A;  4C0J A;  2JTZ A;  3CZT X;  2O60 A;  1SKT A;  1SL7 A;  5AEQ A;  2LM5 A;  1M31 A;  4R1E A;  3KEV A;  1SW8 A;  5CPV A;  4NQG A;  5HKY A;  2NLN A;  1WY9 A;  3EK4 A;  4DUQ A;  4DRW A;  2JUL A;  4GAO A;  4N5X A;  1V1G A;  3AKA A;  2K7D A;  1N65 A;  2F3Y A;  2NCO A;  1DJG A;  1YUU A;  2FOT A;  1NUB A;  2JWW A;  1M39 A;  2ZN9 A;  1XK4 A;  1PAL A;  3CR5 X;  2L4H A;  1CFP A;  3NSI A;  1KWO B;  4PAL A;  1BG1 A;  2L2E A;  3DF0 B;  4YI9 A;  4PE1 A;  3RLZ A;  5K89 A;  1QS7 A;  3D0Y B;  4YRU A;  2LVK A;  1SMG A;  3BQ3 A;  3OB1 B;  1PVA A;  2M1K B;  1SCV A;  2JT3 A;  2KYC A;  1CMF A;  2BCA A;  3PLF B;  2WCF A;  1OE9 B;  3FIA A;  1WRZ A;  2KNE A;  3DD4 A;  1K94 A;  1A2X A;  3PN7 B;  2K2A A;  2O5G A;  3BOW B;  3KO0 A;  3SG2 A;  3CR2 A;  1SYM A;  5AAN A;  1AUI B;  1Y1U A;  4XJK B;  2ISD A;  3JVT B;  1WDC B;  3I5F C;  3OX6 A;  3PFV A;  1BT6 A;  2OTG B;  1KFX L;  3SG3 A;  5I8N A;  4PHN A;  1C7V A;  1UP5 A;  2KFG A;  1FBV A;  2PRU A;  2MA2 A;  3DVJ A;  1E8A A;  1GQM A;  1XFV O;  2JU0 A;  4ZCU A;  1J7R A;  1LKJ A;  5JJG A;  5I2L A;  1G8I A;  3CLN A;  1N2D A;  4WQ2 A;  1NCZ A;  1C7W A;  3CR4 X;  1UHJ A;  1KQV A;  5ER5 A;  3DVK A;  4CLN A;  4GPL B;  1L2O C;  2GGZ A;  4YGE B;  3NXA A;  1F70 A;  1XFW O;  2JXC A;  3WXA A;  5DKN A;  4FQO A;  1KCY A;  3OP0 A;  2ZRS A;  1A75 B;  5I2O A;  4DS7 A;  4TNC A;  2PAL A;  1K9U A;  1K93 D;  1KQM B;  1XYD A;  3C1V A;  1SCM B;  4N1G A;  1EJ3 A;  3VRP A;  4YGD B;  2M0R A;  1CM1 A;  4IL1 A;  2G9B A;  4QJ4 B;  1SL9 A;  2KQY A;  3I5G C;  2BE6 A;  1DTL A;  3O4Y A;  2KHN A;  4MN0 A;  1LXF C;  1BJF A;  4P2Y B;  2LMV A;  3I5H C;  1J55 A;  5AER A;  1CFD A;  1RTP 1;  1W7J B;  1DT7 B;  1M45 A;  1LVC D;  3EK7 A;  3CWG A;  2JNF A;  2V53 A;  1QV0 A;  1UWO A;  1NCX A;  1XVJ A;  3LK1 A;  1RK9 A;  5FYX A;  5G08 A;  3E3R A;  1NCY A;  1KK8 C;  1XA5 A;  3EKH A;  1SY9 A;  1YVL A;  2MHH A;  3FS7 A;  1DVI A;  1DJY A;  2I18 A;  2I2R E;  3JTD C;  1SPY A;  4NDC A;  2JOJ A;  2CT9 A;  5I2Q A;  1XFU O;  1QV1 A;  2M1U A;  1NX1 A;  2DOQ A;  1OMV A;  1UHI A;  1YRU B;  2LMU A;  3O2P A;  1BOD A;  1FI6 A;  2Y1N A;  4CPV A;  2EHB A;  1K8U A;  2PVB A;  4E68 A;  1A4P A;  1S5G Y;  3TUY B;  4MLW A;  1A03 A;  1CB1 A;  1K2H A;  1SR6 B;  5J3X A;  2HF5 A;  1KFU L;  1B8R A;  2LLU A;  3BUN B;  2H61 C;  1S3P A;  1Y1A A;  2EC6 C;  2CBL A;  1TCF A;  3CGA A;  1V1F A;  4PE0 A;  3TDI A;  1BU3 A;  2ZN8 A;  1IQ3 A;  2K7C A;  1J1E A;  1NP8 A;  1DJI A;  1KFU S;  1J1D A;  2K2F A;  4HRE E;  4XYN A;  1K9K A;  2LC5 A;  2K7O A;  1W7I B;  2WCB A;  2GGM A;  2K61 A;  4P5O E;  4C0L A;  1AJ5 A;  5CSN A;  2M7L A;  1OMD A;  2F33 A;  1NPQ A;  2L4I A;  2Y1M A;  3OB2 B;  1CFF A;  1KSO A;  1R6P A;  3KHE A;  2KAY A;  1JSA A;  3TDZ A;  2KFH A;  2KI6 C;  4CID A;  1F4O A;  4GNK B;  1ZOT B;  2CCM A;  4MRY A;  5HLO A;  1HQV A;  1LA3 A;  3KF9 A;  2LVJ A;  1UUR A;  2LP3 A;  4HRH A;  3CS1 A;  5TNC A;  4ETO A;  1C07 A;  2BL0 B;  3EVV A;  3MSE B;  4I5J A;  2LHL A;  4PE7 A;  2L5X B;  1MUX A;  1BF5 A;  2BEC A;  1FPW A;  5HKW A;  1MR8 A;  2D8N A;  1CDN A;  4MZL A;  1PRW A;  2BKH B;  2L98 A;  3BUO B;  5F6T A;  1YTZ C;  1CMG A;  2F2P A;  2JNX A;  1B8L A;  2G2B A;  1F54 A;  1PUL A;  1M63 B;  3GK4 X;  5DKQ A;  3SIB A;  1IWQ A;  3F45 A;  3FWC A;  4NDB A;  1YVH A;  2JPT A;  5D7F A;  1CLL A;  3TDU A;  1AP4 A;  2KI4 B;  1CDL A;  2M8U A;  1PVB A;  1MQ1 A;  3O6B A;  1QVI Z;  1DF0 A;  1JWD A;  1FW4 A;  3PM8 A;  1S26 D;  5CSJ A;  2KBI A;  4F0Z B;  1KWO C;  1S36 A;  1XO5 A;  1S5G Z;  4FTG A;  3SG6 A;  4ORA B;  2COL B;  3NSL A;  4UPG A;  1TNW A;  2KSP A;  4YBH B;  1UHH A;  3BUW B;  4MBE A;  2FCD A;  2LVI A;  1B9A A;  2PSR A;  1ODB A;  1AHR A;  1CKK A;  1U5I A;  2HPS A;  1JFK A;  3PN7 C;  5CSI A;  1CTR A;  1KFX S;  2JXL A;  1MWN A;  1QTX A;  2M29 A;  4JPZ B;  3TS5 B;  1IH0 A;  2I94 A;  2JZI A;  1WDC C;  2Q91 A;  1BR4 B;  3I5I B;  3JVT C;  2LNK A;  2OTG C;  3AAJ A;  1R2U A;  2M7N A;  4MZK A;  3DVE A;  1ZAC A;  1K96 A;  3H4S E;  1QX2 A;  1CNP A;  3NSO A;  2OS8 B;  3EK8 A;  5B8I B;  1YR5 A;  1MXL C;  2JTT A;  3BUM B;  3BUX B;  1RWY A;  2Y4Q A;  3GK1 A;  3IQO A;  1G33 A;  1KK7 Z;  1JUO A;  3HX4 A;  4ICB A;  1QIW A;  1TNQ A;  4DCK A;  1DJH A;  2OPO A;  1TIZ A;  2LHI A;  2JQ6 A;  4GBA A;  1FF1 A;  1RRO A;  1N0Y A;  3BXK A;  4A4B A;  4D1E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...