4CFRA

Ca-bound s100a4 c3s, c81s, c86s and f45w mutant complexed with non- muscle myosin iia
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
94
structure length
94
Chain Sequence
ASPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSWLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSSIAMMSNEFFEGFPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ca-binding protein/motor protein
molecule keywords PROTEIN S100-A4
publication title The C-Terminal Random Coil Region Tunes the Ca2+-Binding Affinity of S100A4 Through Conformational Activation.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4cfrA00
4GPLB 3BOWB 1OQPA 2COLB 3BQ3A 3SJSA 1B9AA 2LLUA 2EGDA 3GK2A 1IQ5A 2BCXA 4I5KA 4P2YB 4OCIA 2SASA 5FYXA 5AEQA 4DCKA 1UHJA 2H61A 2AUCA 4YRUA 2KAXA 1WLMA 4D1EA 1NCYA 4HRHA 4NDDA 1TNQA 2WORA 3EKJA 4FTGA 4MEWA 3KF9A 1CMGA 1TN4A 3BUMB 4ORAB 2KYCA 3OB2B 1XO5A 2HQ8A 3VRNA 1XFVO 1S6IA 4A4BA 1JF2A 5HKWA 3DF0B 1SY9A 1S5GY 1S6CA 3EKHA 1MHOA 4IL1A 2LNKA 4MBEA 1CNPA 2KQ6A 1BOCA 1J7PA 5PALA 2KI4C 3HCMA 1UHIA 1DF0A 1K2HA 4I5LB 2ZN9A 1ODBA 2K7BA 1XA5A 3I5IC 1CDNA 1H8BA 2NCOA 3VRRA 1AP4A 2MBXA 1Y6WA 2HETA 1J7OA 1B7TZ 1DGVA 1PK0D 2D8NA 2GV5A 3TDUA 2GGZA 1K95A 2LVJA 5I2LA 2Q91A 1KFXL 1CMFA 2MRDA 4GUKA 4MRYA 1MXEA 2ZRTA 4C0LA 3M0WA 1M45A 4PE7A 1QASA 2Y5IA 2L50A 2LUXA 4U8DA 4BY4A 1S1EA 5DKQA 3BUXB 1YX7A 1NSHA 1J1EA 4AQJA 3RM1A 1SR6B 2VRGA 4P5OE 2Y1NA 1JWDA 1BF5A 3BOWA 1D1OA 3O6BA 1JFJA 1BMOA 4JQ0D 1ZMZA 2CCMA 5ER5A 1BODA 3PN7B 2KOTA 1QLSA 4OVNF 1KQVA 1SL8A 1WLZA 1A03A 2LAPA 2JRFA 2K61A 1LA3A 1NP8A 3EK8A 1SMGA 1QIVA 3I5FC 1CKKA 1R6PA 1XYDA 2O60A 3FS7A 1OMDA 4PCWA 1LA0A 1PALA 1S6JA 3DF0A 1KFUS 3IQOA 4NDBA 1KQMC 2PSRA 2EC6B 3DVKA 1XFYO 1CDMA 1G8IA 2GGMA 1NPQA 3FIAA 3WHUB 3QRXA 1WY9A 5I2QA 2WC8A 1BLQA 1RECA 3PSRA 4UPGA 1IRJA 3AKBA 1N2DA 5AERA 3OP0A 3I5HB 2I2RE 1Q80A 5J3XA 4GAOA 4F0ZB 2WCBA 1DJYA 2M49B 1X02A 2AMIA 3JTDC 1QLKA 1B1GA 3WXAA 4CPVA 2H2KA 2CBLA 2QACA 4NQGA 2JOJA 1K90D 1FBVA 4PDZA 2O5GA 4M2QA 2I18A 2JWWA 2OS8B 3PATA 1CFCA 1FI5A 4YI8A 1S36A 4R1EA 4DIRA 5HLVA 3GOFA 1QX7A 2L5XB 3OX6A 2L0PA 3WHTB 1A2XA 4CIDA 2K2AA 4ZCVA 4CFRA 1SCMB 1SBJA 2HF5A 2L51A 4GGNA 3DD4A 3ZNIA 1EH2A 1F71A 4YGBB 1KK8B 1TNXA 1RWYA 1NUBA 2TN4A 2CT9A 4I5NB 3A8RA 1JC2A 1NCZA 1Y1UA 1BG1A 1IJ6A 1XVJA 4JWQA 5DKNA 1K9PA 1GGWA 4DRWA 2LMUA 1DT7B 1SYMA 4Q04A 1BR1B 1YRUB 2BE6A 4CFQA 1NX1A 5KU1A 1CDLA 2ZRSA 2F33A 1K96A 1Y1XA 1CTRA 1IQ3A 3I5GC 4MSPA 3H4SE 1SK6D 5CSIA 2NCPA 3KEVA 1PRWA 1MWNA 5BPJA 2KGBC 2SCPA 1QJTA 4GGFC 4QJ5B 1XFUO 3D10A 2LLTA 3K21A 4E68A 1L2OC 2M0RA 1XK4C 2ZKMX 3EVVA 3VRQA 1QVIZ 4M2PA 1TOPA 3MSEB 5AXIA 1NCXA 1CM4A 2I7AA 2L98A 1IJ5A 1A75B 4YI9A 1AVSA 3EK4A 2KI4B 1J7RA 1U5IB 1C7VA 2KDHA 1DJWA 1BJFA 2AAOA 3SG5A 3I5IB 4PE0A 2LE9B 4I5JA 1L7ZA 2LV7A 2ZN8A 3SG6A 4YGDB 3O78A 1KK7Y 4NDCA 2BL0C 3TS5C 1YRTB 1CB1A 2K0JA 2JXLA 4HSZA 4XJKB 4MLWA 4PE4A 1UHKA 1QX2A 1CLMA 3HX4A 5DKRA 3A4UB 1DJZA 1EG4A 1B7TY 2F3ZA 2KGRA 1RK9A 1QTXA 1B4CA 2K2FA 2E6WA 1EL4A 1IGVA 1RJVA 2JC2A 2LP3A 1DJGA 1NX2A 2M3WA 1WRZA 1TCOB 2JZIA 1TRFA 3O2PA 4WQ3A 2G2BA 1W7IB 1KWOC 2M7NA 2M7LA 3CR5X 1QX5B 1G4YR 1DGUA 1R2UA 2MAZA 3ICBA 3CTNA 4MVFA 2JPTA 2PMYA 1N0YA 1JFKA 1V1FA 2WCEA 3VROA 1F55A 1KFXS 1FF1A 2FJUB 2NLNA 3BYAA 3C1VA 1PSRA 1OZOA 2M1KB 1EXRA 1F70A 1UP5A 2KAVA 2KNEA 3F45A 3BXKA 5AFPA 3BUWB 1M31A 1CFFA 1RROA 1F8HA 1N65A 3FWCA 3TUYC 2MLEC 2KI6D 2Q4UA 3I5FB 2Y1MA 2R2IA 1SW8A 3BUOB 1AK8A 2A4JA 4QJ4B 3TDIA 2WOSA 5I8NA 2H61C 1YUTA 1H4BA 1LINA 2JNFA 1KQMB 1JSAA 4GGFA 2WCFA 2LMTA 3JVTC 2JT3A 1A75A 1GGZA 4A4CA 1CFDA 1XK4A 1U5IA 1WRLA 1PVBA 2LANA 2PRUA 1SL9A 1PVAA 1WDCC 4L9MA 4PHMA 1HT9A 3OB1B 4AOMA 4HREE 2FCEA 1IH0A 3CR4X 3GK4X 3WNXB 1SL7A 3KPXA 1IKUA 1MXLC 2LLSA 3CZTX 4PHJA 1M39A 3EK7A 1AHRA 1Y0VH 1WDCB 2BCAA 4MN0A 4PE1A 3OX5A 3DVJA 1B8CA 1JUOA 2LHIA 1LVCD 2ZFDA 3NXAA 1DJHA 1OSAA 4MZJA 4XJKA 3JTDB 1K9UA 1DTLA 1DVIA 1OOJA 3D0YA 1UURA 2KFGA 2P6BB 3PLFB 1YVLA 1RFJA 4PALA 5AANA 1NX3A 1CDPA 2BECA 2OTGC 3CR2A 1UHNA 5GQQC 1QV0A 2JTZA 1S3PA 1MQ1A 2K7DA 3AKAA 2LVVA 5HKYA 4N1GA 4DS7A 1TCFA 1ALWA 5CPVA 2BBNA 1SNLA 4OR9B 1EJ3A 2KI6C 3NSIA 1BR4B 4C0KA 2KBIA 3IQQA 2HPSA 2M9GA 3CGAA 1TTXA 2LM5A 1W7JB 2KBMA 1F4OA 1MR8A 1OMRA 3LCPC 4MZLA 1YURA 1MF8B 2BKIB 2KQYA 1GJYA 1C07A 2PALA 2MLFC 1DMOA 4C0JA 1SKTA 1NX0A 1AJ5A 4DUQA 1ZFSA 4FQOA 1S5GZ 5CSNA 2G9BA 1YR5A 2LVIA 4ORBB 1B8RA 5HYDA 1FI6A 3PM8A 1LXFC 3FWBA 1GQMA 3CWGA 1K9KA 1YUUA 3I5GB 5KSZA 5JOLA 2M29A 2L2EA 4N5XA 2LMVA 1EG3A 1AJ4A 2HQWA 1DJIA 4N1FA 5HKZA 4YGCB 1L2OB 1LKJA 4USLA 5D69A 1J7QA 1Y1AA 1V1GA 1E8AA 2RGIA 4YGAA 1ZACA 4PHKA 1F54A 3NSOA 2LHLA 1CM1A 4XYNA 1XFWO 5HLOA 1WRKA 2L4HA 1KK7Z 4GNKB 1VRKA 2B1UA 4PHNA 1F4QA 1TNWA 1QVIY 2JQ6A 2JT0A 1UHHA 1G33A 2PASA 4YBHB 1UUSA 1XFXO 5CSFA 3LL8B 2PVBA 1NIWA 2CNPA 2K7OA 3AAJA 2BL0B 3CS1A 3TS5B 2F2OA 2I94A 1DJXA 5CSJA 3D0YB 2K8MB 2KFHA 3BUNB 4YGEB 1B8LA 1BU3A 1YX8A 1FPWA 2MA2A 4QJ3B 2F3YA 1KSMA 1RTP1 3SG2A 2BCBA 2V53A 5B8IB 2JULA 2KFFA 5JJGA 3TZ1A 1M63B 1SPYA 2M97A 3RLZA 1SR6C 4OV2A 2E30A 3EVRA 3PALA 4ORCB 4ZCUA 3AAKA 3O4YA 1KFUL 2JU0A 5F6TA 3NSKA 1QV1A 1QIWA 1OE9B 1K93D 1NWDA 1KWOB 2L4IA 2LUCA 2MJWB 3KO0A 1SRAA 4WQ2A 1J1DA 3VGOA 5K89A 3PN7C 3NSLA 1C7WA 2LVKA 2FOTA 2Y4QA 2NZ0A 3LK0A 1K8UA 1S26D 2KAYA 4TNCA 4MRXA 2BE4A 1QATA 1YUSA 3IF7A 3CLNA 1M46A 2IS9A 1PSBA 1IWQA 1YTZC 2BBMA 2LCPA 3SIAA 1JBAA 4AQIA 1OZSA 5KTYA 3GK1A 3TUYB 1J55A 1A29A 2EC6C 5TNCA 3OHMB 5G08A 3SG7A 2M1UA 2CXJA 1ZUZA 3JVTB 4ETOA 4MZKA 2ISDA 2JT8A 4BY5A 2KYFA 1TNPA 3I5HC 1CLBA 3EVUA 1K94A 2KHNA 2OPOA 2F2PA 3PFVA 2LP2A 1B47A 1IG5A 3LLEA 1AUIB 4M2OA 1OMVA 1BT6A 4CLNA 1DF0B 2MHHA 3SIBA 2BKHB 2M8UA 1HQVA 2LC5A 1XFZO 1ALVA 2OS8C 1A4PA 1FW4A 3ZWHA 1KCYA 3LK1A 5IBWA 1SCVA 2WNDA 2ZNDA 3TDZA 2F8PA 1QXPA 2QPTA 2CTNA 1MUXA 3E3RA 2OTGB 4ICBA 3SG3A 2K7CA 3VRPA 2DOQA 4OKHA 4HRGA 1TIZA 1ZOTB 3DVEA 5D7FA 1CLLA 1SCMC 2JXCA 1UWOA 1PULA 2FCDA 1JF0A 4WRIA 2ZNEA 2KSPA 1KK8C 5ER4X 2EHBA 1KSOA 5I2OA 2NXQA 3DVMA 1NYAA 3KHEA 4GFTA 4JPZB 1CFPA 4GBAA 3SG4A 2JNXA 1YVHA 2JTTA 1QS7A
chains in the Genus database with same CATH superfamily
4GPLB 3BOWB 1OQPA 3Q8IA 2COLB 3BQ3A 3SJSA 1B9AA 2LLUA 2EGDA 3GK2A 1IQ5A 2BCXA 4I5KA 4P2YB 4OCIA 2SASA 5FYXA 5AEQA 4DCKA 1UHJA 2H61A 2AUCA 4YRUA 2KAXA 1WLMA 4D1EA 1NCYA 2KLDA 4HRHA 4NDDA 1DELA 1TNQA 2WORA 3EKJA 4FTGA 4MEWA 3KF9A 1CMGA 1TN4A 3BUMB 4ORAB 3D78A 2KYCA 3OB2B 1XO5A 2HQ8A 3VRNA 1XFVO 1S6IA 4A4BA 1JF2A 5HKWA 3DF0B 3OGNA 1SY9A 1S5GY 2BNXA 1S6CA 3EKHA 1MHOA 4IL1A 2LNKA 4MBEA 1CNPA 2KQ6A 1GM0A 1BOCA 1J7PA 5PALA 2KI4C 3HCMA 1UHIA 1DF0A 1K2HA 3CZ0A 4I5LB 2ZN9A 5FI6A 1ODBA 2K7BA 3VB1A 1XA5A 3I5IC 1DEKA 3R1OA 1CDNA 1H8BA 2NCOA 3VRRA 1AP4A 1TWOA 1Y6WA 2HETA 2MBXA 1J7OA 1B7TZ 1DGVA 1IIOA 1PK0D 2D8NA 5D3OA 2GV5A 3TDUA 2GGZA 2WCJA 3CZ1A 1K95A 2LVJA 5I2LA 2Q91A 1KFXL 1CMFA 1T14A 2MRDA 4GUKA 1MXEA 3CYZA 4MRYA 2ZRTA 4C0LA 3M0WA 1M45A 4PE7A 1QASA 2Y5IA 2L50A 2LUXA 2L2CA 4U8DA 4BY4A 1S1EA 5DKQA 3S0DA 3BUXB 1YX7A 1NSHA 1J1EA 4AQJA 3RM1A 1SR6B 2VRGA 4P5OE 2Y1NA 1JWDA 1BF5A 3BOWA 1D1OA 3O6BA 1JFJA 1BMOA 4JQ0D 1ZMZA 2CCMA 5ER5A 1C3YA 3RZSA 1BODA 3PN7B 2KOTA 1QLSA 4OVNF 1KQVA 1SL8A 1WLZA 1C3ZA 2LAPA 1A03A 2JRFA 2K61A 1LA3A 1NP8A 3EK8A 1SMGA 2YGUA 1QIVA 3FE8A 3I5FC 3K1EA 1CKKA 1R6PA 1Z2CB 1XYDA 2O60A 3FS7A 1OMDA 4PCWA 1LA0A 1PALA 1S6JA 3DF0A 1KFUS 3IQOA 3PM2A 4NDBA 1KQMC 2PSRA 2EC6B 3DVKA 1XFYO 1CDMA 1G8IA 4JKTA 4OZDA 2GGMA 1NPQA 3FIAA 3WHUB 2PYQA 2WCMA 1Z4HA 3QRXA 1WY9A 5I2QA 2JPOA 2WC8A 1BLQA 1RECA 3PSRA 4UPGA 1IRJA 3AKBA 1N2DA 5AERA 3DY9A 3OP0A 3I5HB 1DC1A 1TUZA 1ORGA 2I2RE 3CDNA 1Q80A 5J3XA 4GAOA 4F0ZB 2WCBA 1DJYA 2M49B 1X02A 2AMIA 3JTDC 1QLKA 1B1GA 3WXAA 4CPVA 2H2KA 2CBLA 2QACA 2WC5A 4NQGA 5HL1A 2JOJA 1K90D 1FBVA 1OOHA 4PDZA 2O5GA 4M2QA 2I18A 2JWWA 2OS8B 3L4LA 3PATA 1CFCA 3B87A 1FI5A 5FI2A 1W9ZA 4YI8A 1S36A 4R1EA 4DIRA 5HLVA 3GOFA 1QX7A 2L5XB 3OX6A 2L0PA 3WHTB 2ERBA 1A2XA 4CIDA 2K2AA 4ZCVA 4CFRA 1SCMB 1SBJA 4FQTA 2HF5A 1DQEA 2L51A 3DD4A 4GGNA 5DICA 3ZNIA 1EH2A 1F71A 4YGBB 1KK8B 1TNXA 1RWYA 1NUBA 2TN4A 2CT9A 4I5NB 3A8RA 1JC2A 3CABA 2FJYA 1NCZA 1Y1UA 2BAPA 1BG1A 1IJ6A 1XVJA 4JWQA 5DKNA 1K9PA 1GGWA 4DRWA 2LMUA 1DT7B 1SYMA 4Q04A 1BR1B 1YRUB 2BE6A 4CFQA 3R1PA 1NX1A 5KU1A 1CDLA 2ZRSA 2F33A 3L47A 1K96A 1Y1XA 1CTRA 1IQ3A 1QWVA 3I5GC 3H4SE 1SK6D 4MSPA 5CSIA 2NCPA 3KEVA 1PRWA 1MWNA 5BPJA 2KGBC 2SCPA 1QJTA 4GGFC 5EL2A 1XFUO 3D10A 4QJ5B 2LLTA 3K21A 4E68A 1L2OC 2M0RA 1XK4C 2ZKMX 3EVVA 3S0EA 3VRQA 1QVIZ 4M2PA 1TOPA 3MSEB 5AXIA 1NCXA 1CM4A 1OOFA 2I7AA 2L98A 1IJ5A 1A75B 4YI9A 1AVSA 3EK4A 2KI4B 1J7RA 1U5IB 1C7VA 2KDHA 1DJWA 3D76A 1BJFA 2AAOA 3SG5A 3I5IB 4PE0A 2LE9B 4I5JA 1L7ZA 2LV7A 2ZN8A 3L4AA 3SG6A 4YGDB 3O78A 1KK7Y 4NDCA 3B86A 2BL0C 3BFAA 1YRTB 3TS5C 1CB1A 2QDIA 2K0JA 3S0FA 3DYEA 2JXLA 4HSZA 4XJKB 4MLWA 4JD9A 4PE4A 1UHKA 1QX2A 1CLMA 3HX4A 5DKRA 3A4UB 1DJZA 1EG4A 1B7TY 2F3ZA 2KGRA 1RK9A 1QTXA 2WCHA 1OOGA 2K2FA 1B4CA 2E6WA 1EL4A 1IGVA 1RJVA 3SS5A 2JC2A 2LP3A 1DJGA 3R72A 1NX2A 2M3WA 1WRZA 1TCOB 2JZIA 1TRFA 3O2PA 4WQ3A 2G2BA 1W7IB 1KWOC 2M7NA 1P28A 2M7LA 3CR5X 3PJIA 1QX5B 1G4YR 4F7FA 1DGUA 1R2UA 2MAZA 3ICBA 3CTNA 4MVFA 2JPTA 2PMYA 1N0YA 1JFKA 1V1FA 2WCEA 3S0BA 3VROA 1F55A 1KFXS 3D73A 1FF1A 2FJUB 2NLNA 3BYAA 3C1VA 1PSRA 2QEOA 1OZOA 2M1KB 1EXRA 1F70A 3D75A 1UP5A 2KAVA 2KNEA 3F45A 3BXKA 5AFPA 3DXLA 3BUWB 3NGVA 1M31A 1CFFA 1RROA 1F8HA 1N65A 3FWCA 3TUYC 2MLEC 2KI6D 2Q4UA 3D77A 2Y1MA 3I5FB 5FI7A 2R2IA 1SW8A 3BUOB 1AK8A 1TUJA 2A4JA 4QJ4B 3TDIA 2WOSA 5I8NA 2H61C 1YUTA 1H4BA 1LINA 2JNFA 1KQMB 1JSAA 4GGFA 2WCFA 2LMTA 3JVTC 3S0AA 2JT3A 3B7AA 1A75A 1GGZA 4A4CA 3CZ2A 1CFDA 1XK4A 1U5IA 1WRLA 1PVBA 2LANA 2PRUA 1SL9A 1PVAA 1WDCC 4L9MA 4PHMA 1HT9A 3NHTA 3OB1B 4HREE 2FCEA 4AOMA 1IH0A 3CR4X 3GK4X 3WNXB 1SL7A 1LS8A 3DZTA 3KPXA 1IKUA 1MXLC 2LLSA 3CZTX 4PHJA 1M39A 3EK7A 1AHRA 1Y0VH 1WDCB 2BCAA 4MN0A 3BFHA 3OX5A 4PE1A 3DVJA 1B8CA 1JUOA 2LHIA 1LVCD 2ZFDA 3NXAA 1DJHA 1OSAA 4MZJA 4XJKA 3JTDB 1K9UA 1DTLA 1DVIA 1OOJA 3D0YA 1UURA 2KFGA 2P6BB 3PLFB 1YVLA 1RFJA 4PALA 5AANA 1NX3A 1CDPA 2BECA 2OTGC 3CR2A 1UHNA 5GQQC 1QV0A 2JTZA 1S3PA 1MQ1A 2K7DA 3AKAA 2LVVA 5HKYA 4N1GA 4DS7A 1TCFA 1ALWA 5CPVA 2BBNA 4KYNA 1SNLA 4OR9B 1EJ3A 2KI6C 3NSIA 1BR4B 4C0KA 2KBIA 3IQQA 2HPSA 2M9GA 2P70A 1TTXA 2LM5A 3CGAA 1W7JB 2KBMA 1F4OA 1MR8A 1OMRA 3LCPC 4MZLA 1YURA 1MF8B 2BKIB 2KQYA 1GJYA 1C07A 2PALA 2MLFC 1DMOA 4C0JA 1SKTA 1NX0A 1AJ5A 4DUQA 1ZFSA 3BJHA 4FQOA 1OW4A 1S5GZ 5CSNA 2G9BA 1YR5A 2LVIA 4ORBB 1B8RA 3NHIA 5HYDA 1FI6A 3PM8A 1LXFC 3FWBA 2PQLA 1GQMA 3CWGA 1K9KA 1YUUA 3I5GB 5KSZA 3B88A 3EG5B 5JOLA 2M29A 2L2EA 4N5XA 1SSEB 1EG3A 2LMVA 2WCLA 1AJ4A 2HQWA 1DJIA 4N1FA 1XFRA 5HKZA 4YGCB 1L2OB 1LKJA 4USLA 5D69A 1J7QA 1Y1AA 1V1GA 2K60A 3B6XA 1E8AA 2RGIA 4YGAA 1ZACA 2KPHA 4PHKA 1F54A 3NSOA 4PT1A 2LHLA 1CM1A 4XYNA 1XFWO 5HLOA 1WRKA 2L4HA 3D74A 1KK7Z 4GNKB 1VRKA 2B1UA 4PHNA 1F4QA 1TNWA 1QVIY 2JQ6A 2JT0A 1UHHA 1G33A 2PASA 4YBHB 2QEBA 1UUSA 1XFXO 3UO9A 5CSFA 3LL8B 2PVBA 1NIWA 2CNPA 2K7OA 3AAJA 2BL0B 3CS1A 3TS5B 2F2OA 2I94A 1DJXA 5CSJA 3D0YB 2K8MB 2KFHA 3BUNB 4YGEB 1B8LA 1BU3A 1YX8A 1FPWA 2MA2A 4QJ3B 2F3YA 1KSMA 1RTP1 3SG2A 2BCBA 2V53A 3IVTA 5B8IB 2JULA 2KFFA 5JJGA 3TZ1A 1M63B 1SPYA 2M97A 3RLZA 1SR6C 4OV2A 2E30A 3EVRA 3PALA 4ORCB 4ZCUA 4INXA 3AAKA 3O4YA 1KFUL 2QEHA 2JU0A 5F6TA 3NSKA 1QV1A 1QIWA 1OE9B 1K93D 1NWDA 1KWOB 2L4IA 2KLEA 2LUCA 2MJWB 3KO0A 1SRAA 4WQ2A 1J1DA 3VGOA 5K89A 3PN7C 3NSLA 1C7WA 2LVKA 2FOTA 2Y4QA 2NZ0A 3LK0A 1K8UA 1S26D 2KAYA 4TNCA 4MRXA 2BE4A 3FE6A 2GTEA 2H8VA 1QATA 1YUSA 3IF7A 3CLNA 4IJ7A 1M46A 3V2LA 2IS9A 1PSBA 3FE9A 1IWQA 1YTZC 2BBMA 2LCPA 3SIAA 1JBAA 4AQIA 1OZSA 5KTYA 3GK1A 3TUYB 1J55A 1A29A 2EC6C 3BFBA 5TNCA 3O4XA 3OHMB 5G08A 3SG7A 2M1UA 2CXJA 1ZUZA 3JVTB 3QMEA 4MZKA 2ISDA 4ETOA 2JT8A 4BY5A 2KYFA 3N7HA 3SS3A 1TNPA 3I5HC 1CLBA 3EVUA 1K94A 2KHNA 2OPOA 3SS4A 2F2PA 3PFVA 2LP2A 2QEVA 1B47A 1IG5A 3LLEA 1AUIB 4M2OA 1OMVA 1BT6A 4INWA 4CLNA 1DF0B 2MHHA 3SIBA 2BKHB 2M8UA 1HQVA 2LC5A 3R1VA 5I94A 1XFZO 1ALVA 2OS8C 1A4PA 1FW4A 3ZWHA 1KCYA 3LK1A 5IBWA 1OOIX 2L5YA 1SCVA 2WNDA 2ZNDA 3TDZA 2F8PA 1QXPA 2QPTA 2CTNA 1MUXA 2WC6A 2OTGB 3E3RA 4ICBA 2K7CA 3SG3A 3VRPA 2DOQA 4OKHA 3UNWA 4HRGA 3S0GA 1TIZA 1ZOTB 3DVEA 5D7FA 2P71A 1CLLA 1SCMC 2JXCA 1UWOA 1PULA 2FCDA 1JF0A 4WRIA 2ZNEA 2KSPA 1KK8C 5ER4X 2EHBA 2WCKA 3OBVA 1KSOA 5I2OA 2NXQA 3DVMA 1NYAA 3KHEA 4GFTA 4JPZB 1CFPA 4GBAA 3SG4A 2JNXA 1YVHA 2JTTA 1QS7A
chains in the Genus database with same CATH topology
4GPLB 3BOWB 1OQPA 2COLB 3BQ3A 3SJSA 1B9AA 2LLUA 2EGDA 3GK2A 1IQ5A 2BCXA 4I5KA 4P2YB 4OCIA 2SASA 5FYXA 5AEQA 4DCKA 1UHJA 2H61A 2AUCA 4YRUA 2KAXA 1WLMA 4D1EA 1NCYA 4HRHA 4NDDA 1TNQA 2WORA 3EKJA 4FTGA 4MEWA 3KF9A 1CMGA 1TN4A 3BUMB 4ORAB 2KYCA 3OB2B 1XO5A 2HQ8A 3VRNA 1XFVO 1S6IA 4A4BA 1JF2A 5HKWA 3DF0B 1SY9A 1S5GY 1S6CA 3EKHA 1MHOA 4IL1A 2LNKA 4MBEA 1CNPA 2KQ6A 1BOCA 1J7PA 5PALA 2KI4C 3HCMA 1UHIA 1DF0A 1K2HA 4I5LB 2ZN9A 1ODBA 2K7BA 1XA5A 3I5IC 1CDNA 1H8BA 2NCOA 3VRRA 1AP4A 2MBXA 1Y6WA 2HETA 1J7OA 1B7TZ 1DGVA 1PK0D 2D8NA 2GV5A 3TDUA 2GGZA 1K95A 2LVJA 5I2LA 2Q91A 1KFXL 1CMFA 2MRDA 4GUKA 4MRYA 1MXEA 2ZRTA 4C0LA 3M0WA 1M45A 4PE7A 1QASA 2Y5IA 2L50A 2LUXA 4U8DA 4BY4A 1S1EA 5DKQA 3BUXB 1YX7A 1NSHA 1J1EA 4AQJA 3RM1A 1SR6B 2VRGA 4P5OE 2Y1NA 1JWDA 1BF5A 3BOWA 1D1OA 3O6BA 1JFJA 1BMOA 4JQ0D 1ZMZA 2CCMA 5ER5A 1BODA 3PN7B 2KOTA 1QLSA 4OVNF 1KQVA 1SL8A 1WLZA 1A03A 2LAPA 2JRFA 2K61A 1LA3A 1NP8A 3EK8A 1SMGA 1QIVA 3I5FC 1CKKA 1R6PA 1XYDA 2O60A 3FS7A 1OMDA 4PCWA 1LA0A 1PALA 1S6JA 3DF0A 1KFUS 3IQOA 4NDBA 1KQMC 2PSRA 2EC6B 3DVKA 1XFYO 1CDMA 1G8IA 2GGMA 1NPQA 3FIAA 3WHUB 3QRXA 1WY9A 5I2QA 2WC8A 1BLQA 1RECA 3PSRA 4UPGA 1IRJA 3AKBA 1N2DA 5AERA 3OP0A 3I5HB 2I2RE 1Q80A 5J3XA 4GAOA 4F0ZB 2WCBA 1DJYA 2M49B 1X02A 2AMIA 3JTDC 1QLKA 1B1GA 3WXAA 4CPVA 2H2KA 2CBLA 2QACA 4NQGA 2JOJA 1K90D 1FBVA 4PDZA 2O5GA 4M2QA 2I18A 2JWWA 2OS8B 3PATA 1CFCA 1FI5A 4YI8A 1S36A 4R1EA 4DIRA 5HLVA 3GOFA 1QX7A 2L5XB 3OX6A 2L0PA 3WHTB 1A2XA 4CIDA 2K2AA 4ZCVA 4CFRA 1SCMB 1SBJA 2HF5A 2L51A 4GGNA 3DD4A 3ZNIA 1EH2A 1F71A 4YGBB 1KK8B 1TNXA 1RWYA 1NUBA 2TN4A 2CT9A 4I5NB 3A8RA 1JC2A 1NCZA 1Y1UA 1BG1A 1IJ6A 1XVJA 4JWQA 5DKNA 1K9PA 1GGWA 4DRWA 2LMUA 1DT7B 1SYMA 4Q04A 1BR1B 1YRUB 2BE6A 4CFQA 1NX1A 5KU1A 1CDLA 2ZRSA 2F33A 1K96A 1Y1XA 1CTRA 1IQ3A 3I5GC 4MSPA 3H4SE 1SK6D 5CSIA 2NCPA 3KEVA 1PRWA 1MWNA 5BPJA 2KGBC 2SCPA 1QJTA 4GGFC 4QJ5B 1XFUO 3D10A 2LLTA 3K21A 4E68A 1L2OC 2M0RA 1XK4C 2ZKMX 3EVVA 3VRQA 1QVIZ 4M2PA 1TOPA 3MSEB 5AXIA 1NCXA 1CM4A 2I7AA 2L98A 1IJ5A 1A75B 4YI9A 1AVSA 3EK4A 2KI4B 1J7RA 1U5IB 1C7VA 2KDHA 1DJWA 1BJFA 2AAOA 3SG5A 3I5IB 4PE0A 2LE9B 4I5JA 1L7ZA 2LV7A 2ZN8A 3SG6A 4YGDB 3O78A 1KK7Y 4NDCA 2BL0C 3TS5C 1YRTB 1CB1A 2K0JA 2JXLA 4HSZA 4XJKB 4MLWA 4PE4A 1UHKA 1QX2A 1CLMA 3HX4A 5DKRA 3A4UB 1DJZA 1EG4A 1B7TY 2F3ZA 2KGRA 1RK9A 1QTXA 1B4CA 2K2FA 2E6WA 1EL4A 1IGVA 1RJVA 2JC2A 2LP3A 1DJGA 1NX2A 2M3WA 1WRZA 1TCOB 2JZIA 1TRFA 3O2PA 4WQ3A 2G2BA 1W7IB 1KWOC 2M7NA 2M7LA 3CR5X 1QX5B 1G4YR 1DGUA 1R2UA 2MAZA 3ICBA 3CTNA 4MVFA 2JPTA 2PMYA 1N0YA 1JFKA 1V1FA 2WCEA 3VROA 1F55A 1KFXS 1FF1A 2FJUB 2NLNA 3BYAA 3C1VA 1PSRA 1OZOA 2M1KB 1EXRA 1F70A 1UP5A 2KAVA 2KNEA 3F45A 3BXKA 5AFPA 3BUWB 1M31A 1CFFA 1RROA 1F8HA 1N65A 3FWCA 3TUYC 2MLEC 2KI6D 2Q4UA 3I5FB 2Y1MA 2R2IA 1SW8A 3BUOB 1AK8A 2A4JA 4QJ4B 3TDIA 2WOSA 5I8NA 2H61C 1YUTA 1H4BA 1LINA 2JNFA 1KQMB 1JSAA 4GGFA 2WCFA 2LMTA 3JVTC 2JT3A 1A75A 1GGZA 4A4CA 1CFDA 1XK4A 1U5IA 1WRLA 1PVBA 2LANA 2PRUA 1SL9A 1PVAA 1WDCC 4L9MA 4PHMA 1HT9A 3OB1B 4AOMA 4HREE 2FCEA 1IH0A 3CR4X 3GK4X 3WNXB 1SL7A 3KPXA 1IKUA 1MXLC 2LLSA 3CZTX 4PHJA 1M39A 3EK7A 1AHRA 1Y0VH 1WDCB 2BCAA 4MN0A 4PE1A 3OX5A 3DVJA 1B8CA 1JUOA 2LHIA 1LVCD 2ZFDA 3NXAA 1DJHA 1OSAA 4MZJA 4XJKA 3JTDB 1K9UA 1DTLA 1DVIA 1OOJA 3D0YA 1UURA 2KFGA 2P6BB 3PLFB 1YVLA 1RFJA 4PALA 5AANA 1NX3A 1CDPA 2BECA 2OTGC 3CR2A 1UHNA 5GQQC 1QV0A 2JTZA 1S3PA 1MQ1A 2K7DA 3AKAA 2LVVA 5HKYA 4N1GA 4DS7A 1TCFA 1ALWA 5CPVA 2BBNA 1SNLA 4OR9B 1EJ3A 2KI6C 3NSIA 1BR4B 4C0KA 2KBIA 3IQQA 2HPSA 2M9GA 3CGAA 1TTXA 2LM5A 1W7JB 2KBMA 1F4OA 1MR8A 1OMRA 3LCPC 4MZLA 1YURA 1MF8B 2BKIB 2KQYA 1GJYA 1C07A 2PALA 2MLFC 1DMOA 4C0JA 1SKTA 1NX0A 1AJ5A 4DUQA 1ZFSA 4FQOA 1S5GZ 5CSNA 2G9BA 1YR5A 2LVIA 4ORBB 1B8RA 5HYDA 1FI6A 3PM8A 1LXFC 3FWBA 1GQMA 3CWGA 1K9KA 1YUUA 3I5GB 5KSZA 5JOLA 2M29A 2L2EA 4N5XA 2LMVA 1EG3A 1AJ4A 2HQWA 1DJIA 4N1FA 5HKZA 4YGCB 1L2OB 1LKJA 4USLA 5D69A 1J7QA 1Y1AA 1V1GA 1E8AA 2RGIA 4YGAA 1ZACA 4PHKA 1F54A 3NSOA 2LHLA 1CM1A 4XYNA 1XFWO 5HLOA 1WRKA 2L4HA 1KK7Z 4GNKB 1VRKA 2B1UA 4PHNA 1F4QA 1TNWA 1QVIY 2JQ6A 2JT0A 1UHHA 1G33A 2PASA 4YBHB 1UUSA 1XFXO 5CSFA 3LL8B 2PVBA 1NIWA 2CNPA 2K7OA 3AAJA 2BL0B 3CS1A 3TS5B 2F2OA 2I94A 1DJXA 5CSJA 3D0YB 2K8MB 2KFHA 3BUNB 4YGEB 1B8LA 1BU3A 1YX8A 1FPWA 2MA2A 4QJ3B 2F3YA 1KSMA 1RTP1 3SG2A 2BCBA 2V53A 5B8IB 2JULA 2KFFA 5JJGA 3TZ1A 1M63B 1SPYA 2M97A 3RLZA 1SR6C 4OV2A 2E30A 3EVRA 3PALA 4ORCB 4ZCUA 3AAKA 3O4YA 1KFUL 2JU0A 5F6TA 3NSKA 1QV1A 1QIWA 1OE9B 1K93D 1NWDA 1KWOB 2L4IA 2LUCA 2MJWB 3KO0A 1SRAA 4WQ2A 1J1DA 3VGOA 5K89A 3PN7C 3NSLA 1C7WA 2LVKA 2FOTA 2Y4QA 2NZ0A 3LK0A 1K8UA 1S26D 2KAYA 4TNCA 4MRXA 2BE4A 1QATA 1YUSA 3IF7A 3CLNA 1M46A 2IS9A 1PSBA 1IWQA 1YTZC 2BBMA 2LCPA 3SIAA 1JBAA 4AQIA 1OZSA 5KTYA 3GK1A 3TUYB 1J55A 1A29A 2EC6C 5TNCA 3OHMB 5G08A 3SG7A 2M1UA 2CXJA 1ZUZA 3JVTB 4ETOA 4MZKA 2ISDA 2JT8A 4BY5A 2KYFA 1TNPA 3I5HC 1CLBA 3EVUA 1K94A 2KHNA 2OPOA 2F2PA 3PFVA 2LP2A 1B47A 1IG5A 3LLEA 1AUIB 4M2OA 1OMVA 1BT6A 4CLNA 1DF0B 2MHHA 3SIBA 2BKHB 2M8UA 1HQVA 2LC5A 1XFZO 1ALVA 2OS8C 1A4PA 1FW4A 3ZWHA 1KCYA 3LK1A 5IBWA 1SCVA 2WNDA 2ZNDA 3TDZA 2F8PA 1QXPA 2QPTA 2CTNA 1MUXA 3E3RA 2OTGB 4ICBA 3SG3A 2K7CA 3VRPA 2DOQA 4OKHA 4HRGA 1TIZA 1ZOTB 3DVEA 5D7FA 1CLLA 1SCMC 2JXCA 1UWOA 1PULA 2FCDA 1JF0A 4WRIA 2ZNEA 2KSPA 1KK8C 5ER4X 2EHBA 1KSOA 5I2OA 2NXQA 3DVMA 1NYAA 3KHEA 4GFTA 4JPZB 1CFPA 4GBAA 3SG4A 2JNXA 1YVHA 2JTTA 1QS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GPL B;  3BOW B;  1OQP A;  2COL B;  3BQ3 A;  3SJS A;  1B9A A;  2LLU A;  2EGD A;  3GK2 A;  1IQ5 A;  2BCX A;  4I5K A;  4P2Y B;  4OCI A;  2SAS A;  5FYX A;  5AEQ A;  4DCK A;  1UHJ A;  2H61 A;  2AUC A;  4YRU A;  2KAX A;  1WLM A;  4D1E A;  1NCY A;  4HRH A;  4NDD A;  1TNQ A;  2WOR A;  3EKJ A;  4FTG A;  4MEW A;  3KF9 A;  1CMG A;  1TN4 A;  3BUM B;  4ORA B;  2KYC A;  3OB2 B;  1XO5 A;  2HQ8 A;  3VRN A;  1XFV O;  1S6I A;  4A4B A;  1JF2 A;  5HKW A;  3DF0 B;  1SY9 A;  1S5G Y;  1S6C A;  3EKH A;  1MHO A;  4IL1 A;  2LNK A;  4MBE A;  1CNP A;  2KQ6 A;  1BOC A;  1J7P A;  5PAL A;  2KI4 C;  3HCM A;  1UHI A;  1DF0 A;  1K2H A;  4I5L B;  2ZN9 A;  1ODB A;  2K7B A;  1XA5 A;  3I5I C;  1CDN A;  1H8B A;  2NCO A;  3VRR A;  1AP4 A;  2MBX A;  1Y6W A;  2HET A;  1J7O A;  1B7T Z;  1DGV A;  1PK0 D;  2D8N A;  2GV5 A;  3TDU A;  2GGZ A;  1K95 A;  2LVJ A;  5I2L A;  2Q91 A;  1KFX L;  1CMF A;  2MRD A;  4GUK A;  4MRY A;  1MXE A;  2ZRT A;  4C0L A;  3M0W A;  1M45 A;  4PE7 A;  1QAS A;  2Y5I A;  2L50 A;  2LUX A;  4U8D A;  4BY4 A;  1S1E A;  5DKQ A;  3BUX B;  1YX7 A;  1NSH A;  1J1E A;  4AQJ A;  3RM1 A;  1SR6 B;  2VRG A;  4P5O E;  2Y1N A;  1JWD A;  1BF5 A;  3BOW A;  1D1O A;  3O6B A;  1JFJ A;  1BMO A;  4JQ0 D;  1ZMZ A;  2CCM A;  5ER5 A;  1BOD A;  3PN7 B;  2KOT A;  1QLS A;  4OVN F;  1KQV A;  1SL8 A;  1WLZ A;  1A03 A;  2LAP A;  2JRF A;  2K61 A;  1LA3 A;  1NP8 A;  3EK8 A;  1SMG A;  1QIV A;  3I5F C;  1CKK A;  1R6P A;  1XYD A;  2O60 A;  3FS7 A;  1OMD A;  4PCW A;  1LA0 A;  1PAL A;  1S6J A;  3DF0 A;  1KFU S;  3IQO A;  4NDB A;  1KQM C;  2PSR A;  2EC6 B;  3DVK A;  1XFY O;  1CDM A;  1G8I A;  2GGM A;  1NPQ A;  3FIA A;  3WHU B;  3QRX A;  1WY9 A;  5I2Q A;  2WC8 A;  1BLQ A;  1REC A;  3PSR A;  4UPG A;  1IRJ A;  3AKB A;  1N2D A;  5AER A;  3OP0 A;  3I5H B;  2I2R E;  1Q80 A;  5J3X A;  4GAO A;  4F0Z B;  2WCB A;  1DJY A;  2M49 B;  1X02 A;  2AMI A;  3JTD C;  1QLK A;  1B1G A;  3WXA A;  4CPV A;  2H2K A;  2CBL A;  2QAC A;  4NQG A;  2JOJ A;  1K90 D;  1FBV A;  4PDZ A;  2O5G A;  4M2Q A;  2I18 A;  2JWW A;  2OS8 B;  3PAT A;  1CFC A;  1FI5 A;  4YI8 A;  1S36 A;  4R1E A;  4DIR A;  5HLV A;  3GOF A;  1QX7 A;  2L5X B;  3OX6 A;  2L0P A;  3WHT B;  1A2X A;  4CID A;  2K2A A;  4ZCV A;  4CFR A;  1SCM B;  1SBJ A;  2HF5 A;  2L51 A;  4GGN A;  3DD4 A;  3ZNI A;  1EH2 A;  1F71 A;  4YGB B;  1KK8 B;  1TNX A;  1RWY A;  1NUB A;  2TN4 A;  2CT9 A;  4I5N B;  3A8R A;  1JC2 A;  1NCZ A;  1Y1U A;  1BG1 A;  1IJ6 A;  1XVJ A;  4JWQ A;  5DKN A;  1K9P A;  1GGW A;  4DRW A;  2LMU A;  1DT7 B;  1SYM A;  4Q04 A;  1BR1 B;  1YRU B;  2BE6 A;  4CFQ A;  1NX1 A;  5KU1 A;  1CDL A;  2ZRS A;  2F33 A;  1K96 A;  1Y1X A;  1CTR A;  1IQ3 A;  3I5G C;  4MSP A;  3H4S E;  1SK6 D;  5CSI A;  2NCP A;  3KEV A;  1PRW A;  1MWN A;  5BPJ A;  2KGB C;  2SCP A;  1QJT A;  4GGF C;  4QJ5 B;  1XFU O;  3D10 A;  2LLT A;  3K21 A;  4E68 A;  1L2O C;  2M0R A;  1XK4 C;  2ZKM X;  3EVV A;  3VRQ A;  1QVI Z;  4M2P A;  1TOP A;  3MSE B;  5AXI A;  1NCX A;  1CM4 A;  2I7A A;  2L98 A;  1IJ5 A;  1A75 B;  4YI9 A;  1AVS A;  3EK4 A;  2KI4 B;  1J7R A;  1U5I B;  1C7V A;  2KDH A;  1DJW A;  1BJF A;  2AAO A;  3SG5 A;  3I5I B;  4PE0 A;  2LE9 B;  4I5J A;  1L7Z A;  2LV7 A;  2ZN8 A;  3SG6 A;  4YGD B;  3O78 A;  1KK7 Y;  4NDC A;  2BL0 C;  3TS5 C;  1YRT B;  1CB1 A;  2K0J A;  2JXL A;  4HSZ A;  4XJK B;  4MLW A;  4PE4 A;  1UHK A;  1QX2 A;  1CLM A;  3HX4 A;  5DKR A;  3A4U B;  1DJZ A;  1EG4 A;  1B7T Y;  2F3Z A;  2KGR A;  1RK9 A;  1QTX A;  1B4C A;  2K2F A;  2E6W A;  1EL4 A;  1IGV A;  1RJV A;  2JC2 A;  2LP3 A;  1DJG A;  1NX2 A;  2M3W A;  1WRZ A;  1TCO B;  2JZI A;  1TRF A;  3O2P A;  4WQ3 A;  2G2B A;  1W7I B;  1KWO C;  2M7N A;  2M7L A;  3CR5 X;  1QX5 B;  1G4Y R;  1DGU A;  1R2U A;  2MAZ A;  3ICB A;  3CTN A;  4MVF A;  2JPT A;  2PMY A;  1N0Y A;  1JFK A;  1V1F A;  2WCE A;  3VRO A;  1F55 A;  1KFX S;  1FF1 A;  2FJU B;  2NLN A;  3BYA A;  3C1V A;  1PSR A;  1OZO A;  2M1K B;  1EXR A;  1F70 A;  1UP5 A;  2KAV A;  2KNE A;  3F45 A;  3BXK A;  5AFP A;  3BUW B;  1M31 A;  1CFF A;  1RRO A;  1F8H A;  1N65 A;  3FWC A;  3TUY C;  2MLE C;  2KI6 D;  2Q4U A;  3I5F B;  2Y1M A;  2R2I A;  1SW8 A;  3BUO B;  1AK8 A;  2A4J A;  4QJ4 B;  3TDI A;  2WOS A;  5I8N A;  2H61 C;  1YUT A;  1H4B A;  1LIN A;  2JNF A;  1KQM B;  1JSA A;  4GGF A;  2WCF A;  2LMT A;  3JVT C;  2JT3 A;  1A75 A;  1GGZ A;  4A4C A;  1CFD A;  1XK4 A;  1U5I A;  1WRL A;  1PVB A;  2LAN A;  2PRU A;  1SL9 A;  1PVA A;  1WDC C;  4L9M A;  4PHM A;  1HT9 A;  3OB1 B;  4AOM A;  4HRE E;  2FCE A;  1IH0 A;  3CR4 X;  3GK4 X;  3WNX B;  1SL7 A;  3KPX A;  1IKU A;  1MXL C;  2LLS A;  3CZT X;  4PHJ A;  1M39 A;  3EK7 A;  1AHR A;  1Y0V H;  1WDC B;  2BCA A;  4MN0 A;  4PE1 A;  3OX5 A;  3DVJ A;  1B8C A;  1JUO A;  2LHI A;  1LVC D;  2ZFD A;  3NXA A;  1DJH A;  1OSA A;  4MZJ A;  4XJK A;  3JTD B;  1K9U A;  1DTL A;  1DVI A;  1OOJ A;  3D0Y A;  1UUR A;  2KFG A;  2P6B B;  3PLF B;  1YVL A;  1RFJ A;  4PAL A;  5AAN A;  1NX3 A;  1CDP A;  2BEC A;  2OTG C;  3CR2 A;  1UHN A;  5GQQ C;  1QV0 A;  2JTZ A;  1S3P A;  1MQ1 A;  2K7D A;  3AKA A;  2LVV A;  5HKY A;  4N1G A;  4DS7 A;  1TCF A;  1ALW A;  5CPV A;  2BBN A;  1SNL A;  4OR9 B;  1EJ3 A;  2KI6 C;  3NSI A;  1BR4 B;  4C0K A;  2KBI A;  3IQQ A;  2HPS A;  2M9G A;  3CGA A;  1TTX A;  2LM5 A;  1W7J B;  2KBM A;  1F4O A;  1MR8 A;  1OMR A;  3LCP C;  4MZL A;  1YUR A;  1MF8 B;  2BKI B;  2KQY A;  1GJY A;  1C07 A;  2PAL A;  2MLF C;  1DMO A;  4C0J A;  1SKT A;  1NX0 A;  1AJ5 A;  4DUQ A;  1ZFS A;  4FQO A;  1S5G Z;  5CSN A;  2G9B A;  1YR5 A;  2LVI A;  4ORB B;  1B8R A;  5HYD A;  1FI6 A;  3PM8 A;  1LXF C;  3FWB A;  1GQM A;  3CWG A;  1K9K A;  1YUU A;  3I5G B;  5KSZ A;  5JOL A;  2M29 A;  2L2E A;  4N5X A;  2LMV A;  1EG3 A;  1AJ4 A;  2HQW A;  1DJI A;  4N1F A;  5HKZ A;  4YGC B;  1L2O B;  1LKJ A;  4USL A;  5D69 A;  1J7Q A;  1Y1A A;  1V1G A;  1E8A A;  2RGI A;  4YGA A;  1ZAC A;  4PHK A;  1F54 A;  3NSO A;  2LHL A;  1CM1 A;  4XYN A;  1XFW O;  5HLO A;  1WRK A;  2L4H A;  1KK7 Z;  4GNK B;  1VRK A;  2B1U A;  4PHN A;  1F4Q A;  1TNW A;  1QVI Y;  2JQ6 A;  2JT0 A;  1UHH A;  1G33 A;  2PAS A;  4YBH B;  1UUS A;  1XFX O;  5CSF A;  3LL8 B;  2PVB A;  1NIW A;  2CNP A;  2K7O A;  3AAJ A;  2BL0 B;  3CS1 A;  3TS5 B;  2F2O A;  2I94 A;  1DJX A;  5CSJ A;  3D0Y B;  2K8M B;  2KFH A;  3BUN B;  4YGE B;  1B8L A;  1BU3 A;  1YX8 A;  1FPW A;  2MA2 A;  4QJ3 B;  2F3Y A;  1KSM A;  1RTP 1;  3SG2 A;  2BCB A;  2V53 A;  5B8I B;  2JUL A;  2KFF A;  5JJG A;  3TZ1 A;  1M63 B;  1SPY A;  2M97 A;  3RLZ A;  1SR6 C;  4OV2 A;  2E30 A;  3EVR A;  3PAL A;  4ORC B;  4ZCU A;  3AAK A;  3O4Y A;  1KFU L;  2JU0 A;  5F6T A;  3NSK A;  1QV1 A;  1QIW A;  1OE9 B;  1K93 D;  1NWD A;  1KWO B;  2L4I A;  2LUC A;  2MJW B;  3KO0 A;  1SRA A;  4WQ2 A;  1J1D A;  3VGO A;  5K89 A;  3PN7 C;  3NSL A;  1C7W A;  2LVK A;  2FOT A;  2Y4Q A;  2NZ0 A;  3LK0 A;  1K8U A;  1S26 D;  2KAY A;  4TNC A;  4MRX A;  2BE4 A;  1QAT A;  1YUS A;  3IF7 A;  3CLN A;  1M46 A;  2IS9 A;  1PSB A;  1IWQ A;  1YTZ C;  2BBM A;  2LCP A;  3SIA A;  1JBA A;  4AQI A;  1OZS A;  5KTY A;  3GK1 A;  3TUY B;  1J55 A;  1A29 A;  2EC6 C;  5TNC A;  3OHM B;  5G08 A;  3SG7 A;  2M1U A;  2CXJ A;  1ZUZ A;  3JVT B;  4ETO A;  4MZK A;  2ISD A;  2JT8 A;  4BY5 A;  2KYF A;  1TNP A;  3I5H C;  1CLB A;  3EVU A;  1K94 A;  2KHN A;  2OPO A;  2F2P A;  3PFV A;  2LP2 A;  1B47 A;  1IG5 A;  3LLE A;  1AUI B;  4M2O A;  1OMV A;  1BT6 A;  4CLN A;  1DF0 B;  2MHH A;  3SIB A;  2BKH B;  2M8U A;  1HQV A;  2LC5 A;  1XFZ O;  1ALV A;  2OS8 C;  1A4P A;  1FW4 A;  3ZWH A;  1KCY A;  3LK1 A;  5IBW A;  1SCV A;  2WND A;  2ZND A;  3TDZ A;  2F8P A;  1QXP A;  2QPT A;  2CTN A;  1MUX A;  3E3R A;  2OTG B;  4ICB A;  3SG3 A;  2K7C A;  3VRP A;  2DOQ A;  4OKH A;  4HRG A;  1TIZ A;  1ZOT B;  3DVE A;  5D7F A;  1CLL A;  1SCM C;  2JXC A;  1UWO A;  1PUL A;  2FCD A;  1JF0 A;  4WRI A;  2ZNE A;  2KSP A;  1KK8 C;  5ER4 X;  2EHB A;  1KSO A;  5I2O A;  2NXQ A;  3DVM A;  1NYA A;  3KHE A;  4GFT A;  4JPZ B;  1CFP A;  4GBA A;  3SG4 A;  2JNX A;  1YVH A;  2JTT A;  1QS7 A; 
#chains in the Genus database with same CATH topology
 4GPL B;  3BOW B;  1OQP A;  3Q8I A;  2COL B;  3BQ3 A;  3SJS A;  1B9A A;  2LLU A;  2EGD A;  3GK2 A;  1IQ5 A;  2BCX A;  4I5K A;  4P2Y B;  4OCI A;  2SAS A;  5FYX A;  5AEQ A;  4DCK A;  1UHJ A;  2H61 A;  2AUC A;  4YRU A;  2KAX A;  1WLM A;  4D1E A;  1NCY A;  2KLD A;  4HRH A;  4NDD A;  1DEL A;  1TNQ A;  2WOR A;  3EKJ A;  4FTG A;  4MEW A;  3KF9 A;  1CMG A;  1TN4 A;  3BUM B;  4ORA B;  3D78 A;  2KYC A;  3OB2 B;  1XO5 A;  2HQ8 A;  3VRN A;  1XFV O;  1S6I A;  4A4B A;  1JF2 A;  5HKW A;  3DF0 B;  3OGN A;  1SY9 A;  1S5G Y;  2BNX A;  1S6C A;  3EKH A;  1MHO A;  4IL1 A;  2LNK A;  4MBE A;  1CNP A;  2KQ6 A;  1GM0 A;  1BOC A;  1J7P A;  5PAL A;  2KI4 C;  3HCM A;  1UHI A;  1DF0 A;  1K2H A;  3CZ0 A;  4I5L B;  2ZN9 A;  5FI6 A;  1ODB A;  2K7B A;  3VB1 A;  1XA5 A;  3I5I C;  1DEK A;  3R1O A;  1CDN A;  1H8B A;  2NCO A;  3VRR A;  1AP4 A;  1TWO A;  1Y6W A;  2HET A;  2MBX A;  1J7O A;  1B7T Z;  1DGV A;  1IIO A;  1PK0 D;  2D8N A;  5D3O A;  2GV5 A;  3TDU A;  2GGZ A;  2WCJ A;  3CZ1 A;  1K95 A;  2LVJ A;  5I2L A;  2Q91 A;  1KFX L;  1CMF A;  1T14 A;  2MRD A;  4GUK A;  1MXE A;  3CYZ A;  4MRY A;  2ZRT A;  4C0L A;  3M0W A;  1M45 A;  4PE7 A;  1QAS A;  2Y5I A;  2L50 A;  2LUX A;  2L2C A;  4U8D A;  4BY4 A;  1S1E A;  5DKQ A;  3S0D A;  3BUX B;  1YX7 A;  1NSH A;  1J1E A;  4AQJ A;  3RM1 A;  1SR6 B;  2VRG A;  4P5O E;  2Y1N A;  1JWD A;  1BF5 A;  3BOW A;  1D1O A;  3O6B A;  1JFJ A;  1BMO A;  4JQ0 D;  1ZMZ A;  2CCM A;  5ER5 A;  1C3Y A;  3RZS A;  1BOD A;  3PN7 B;  2KOT A;  1QLS A;  4OVN F;  1KQV A;  1SL8 A;  1WLZ A;  1C3Z A;  2LAP A;  1A03 A;  2JRF A;  2K61 A;  1LA3 A;  1NP8 A;  3EK8 A;  1SMG A;  2YGU A;  1QIV A;  3FE8 A;  3I5F C;  3K1E A;  1CKK A;  1R6P A;  1Z2C B;  1XYD A;  2O60 A;  3FS7 A;  1OMD A;  4PCW A;  1LA0 A;  1PAL A;  1S6J A;  3DF0 A;  1KFU S;  3IQO A;  3PM2 A;  4NDB A;  1KQM C;  2PSR A;  2EC6 B;  3DVK A;  1XFY O;  1CDM A;  1G8I A;  4JKT A;  4OZD A;  2GGM A;  1NPQ A;  3FIA A;  3WHU B;  2PYQ A;  2WCM A;  1Z4H A;  3QRX A;  1WY9 A;  5I2Q A;  2JPO A;  2WC8 A;  1BLQ A;  1REC A;  3PSR A;  4UPG A;  1IRJ A;  3AKB A;  1N2D A;  5AER A;  3DY9 A;  3OP0 A;  3I5H B;  1DC1 A;  1TUZ A;  1ORG A;  2I2R E;  3CDN A;  1Q80 A;  5J3X A;  4GAO A;  4F0Z B;  2WCB A;  1DJY A;  2M49 B;  1X02 A;  2AMI A;  3JTD C;  1QLK A;  1B1G A;  3WXA A;  4CPV A;  2H2K A;  2CBL A;  2QAC A;  2WC5 A;  4NQG A;  5HL1 A;  2JOJ A;  1K90 D;  1FBV A;  1OOH A;  4PDZ A;  2O5G A;  4M2Q A;  2I18 A;  2JWW A;  2OS8 B;  3L4L A;  3PAT A;  1CFC A;  3B87 A;  1FI5 A;  5FI2 A;  1W9Z A;  4YI8 A;  1S36 A;  4R1E A;  4DIR A;  5HLV A;  3GOF A;  1QX7 A;  2L5X B;  3OX6 A;  2L0P A;  3WHT B;  2ERB A;  1A2X A;  4CID A;  2K2A A;  4ZCV A;  4CFR A;  1SCM B;  1SBJ A;  4FQT A;  2HF5 A;  1DQE A;  2L51 A;  3DD4 A;  4GGN A;  5DIC A;  3ZNI A;  1EH2 A;  1F71 A;  4YGB B;  1KK8 B;  1TNX A;  1RWY A;  1NUB A;  2TN4 A;  2CT9 A;  4I5N B;  3A8R A;  1JC2 A;  3CAB A;  2FJY A;  1NCZ A;  1Y1U A;  2BAP A;  1BG1 A;  1IJ6 A;  1XVJ A;  4JWQ A;  5DKN A;  1K9P A;  1GGW A;  4DRW A;  2LMU A;  1DT7 B;  1SYM A;  4Q04 A;  1BR1 B;  1YRU B;  2BE6 A;  4CFQ A;  3R1P A;  1NX1 A;  5KU1 A;  1CDL A;  2ZRS A;  2F33 A;  3L47 A;  1K96 A;  1Y1X A;  1CTR A;  1IQ3 A;  1QWV A;  3I5G C;  3H4S E;  1SK6 D;  4MSP A;  5CSI A;  2NCP A;  3KEV A;  1PRW A;  1MWN A;  5BPJ A;  2KGB C;  2SCP A;  1QJT A;  4GGF C;  5EL2 A;  1XFU O;  3D10 A;  4QJ5 B;  2LLT A;  3K21 A;  4E68 A;  1L2O C;  2M0R A;  1XK4 C;  2ZKM X;  3EVV A;  3S0E A;  3VRQ A;  1QVI Z;  4M2P A;  1TOP A;  3MSE B;  5AXI A;  1NCX A;  1CM4 A;  1OOF A;  2I7A A;  2L98 A;  1IJ5 A;  1A75 B;  4YI9 A;  1AVS A;  3EK4 A;  2KI4 B;  1J7R A;  1U5I B;  1C7V A;  2KDH A;  1DJW A;  3D76 A;  1BJF A;  2AAO A;  3SG5 A;  3I5I B;  4PE0 A;  2LE9 B;  4I5J A;  1L7Z A;  2LV7 A;  2ZN8 A;  3L4A A;  3SG6 A;  4YGD B;  3O78 A;  1KK7 Y;  4NDC A;  3B86 A;  2BL0 C;  3BFA A;  1YRT B;  3TS5 C;  1CB1 A;  2QDI A;  2K0J A;  3S0F A;  3DYE A;  2JXL A;  4HSZ A;  4XJK B;  4MLW A;  4JD9 A;  4PE4 A;  1UHK A;  1QX2 A;  1CLM A;  3HX4 A;  5DKR A;  3A4U B;  1DJZ A;  1EG4 A;  1B7T Y;  2F3Z A;  2KGR A;  1RK9 A;  1QTX A;  2WCH A;  1OOG A;  2K2F A;  1B4C A;  2E6W A;  1EL4 A;  1IGV A;  1RJV A;  3SS5 A;  2JC2 A;  2LP3 A;  1DJG A;  3R72 A;  1NX2 A;  2M3W A;  1WRZ A;  1TCO B;  2JZI A;  1TRF A;  3O2P A;  4WQ3 A;  2G2B A;  1W7I B;  1KWO C;  2M7N A;  1P28 A;  2M7L A;  3CR5 X;  3PJI A;  1QX5 B;  1G4Y R;  4F7F A;  1DGU A;  1R2U A;  2MAZ A;  3ICB A;  3CTN A;  4MVF A;  2JPT A;  2PMY A;  1N0Y A;  1JFK A;  1V1F A;  2WCE A;  3S0B A;  3VRO A;  1F55 A;  1KFX S;  3D73 A;  1FF1 A;  2FJU B;  2NLN A;  3BYA A;  3C1V A;  1PSR A;  2QEO A;  1OZO A;  2M1K B;  1EXR A;  1F70 A;  3D75 A;  1UP5 A;  2KAV A;  2KNE A;  3F45 A;  3BXK A;  5AFP A;  3DXL A;  3BUW B;  3NGV A;  1M31 A;  1CFF A;  1RRO A;  1F8H A;  1N65 A;  3FWC A;  3TUY C;  2MLE C;  2KI6 D;  2Q4U A;  3D77 A;  2Y1M A;  3I5F B;  5FI7 A;  2R2I A;  1SW8 A;  3BUO B;  1AK8 A;  1TUJ A;  2A4J A;  4QJ4 B;  3TDI A;  2WOS A;  5I8N A;  2H61 C;  1YUT A;  1H4B A;  1LIN A;  2JNF A;  1KQM B;  1JSA A;  4GGF A;  2WCF A;  2LMT A;  3JVT C;  3S0A A;  2JT3 A;  3B7A A;  1A75 A;  1GGZ A;  4A4C A;  3CZ2 A;  1CFD A;  1XK4 A;  1U5I A;  1WRL A;  1PVB A;  2LAN A;  2PRU A;  1SL9 A;  1PVA A;  1WDC C;  4L9M A;  4PHM A;  1HT9 A;  3NHT A;  3OB1 B;  4HRE E;  2FCE A;  4AOM A;  1IH0 A;  3CR4 X;  3GK4 X;  3WNX B;  1SL7 A;  1LS8 A;  3DZT A;  3KPX A;  1IKU A;  1MXL C;  2LLS A;  3CZT X;  4PHJ A;  1M39 A;  3EK7 A;  1AHR A;  1Y0V H;  1WDC B;  2BCA A;  4MN0 A;  3BFH A;  3OX5 A;  4PE1 A;  3DVJ A;  1B8C A;  1JUO A;  2LHI A;  1LVC D;  2ZFD A;  3NXA A;  1DJH A;  1OSA A;  4MZJ A;  4XJK A;  3JTD B;  1K9U A;  1DTL A;  1DVI A;  1OOJ A;  3D0Y A;  1UUR A;  2KFG A;  2P6B B;  3PLF B;  1YVL A;  1RFJ A;  4PAL A;  5AAN A;  1NX3 A;  1CDP A;  2BEC A;  2OTG C;  3CR2 A;  1UHN A;  5GQQ C;  1QV0 A;  2JTZ A;  1S3P A;  1MQ1 A;  2K7D A;  3AKA A;  2LVV A;  5HKY A;  4N1G A;  4DS7 A;  1TCF A;  1ALW A;  5CPV A;  2BBN A;  4KYN A;  1SNL A;  4OR9 B;  1EJ3 A;  2KI6 C;  3NSI A;  1BR4 B;  4C0K A;  2KBI A;  3IQQ A;  2HPS A;  2M9G A;  2P70 A;  1TTX A;  2LM5 A;  3CGA A;  1W7J B;  2KBM A;  1F4O A;  1MR8 A;  1OMR A;  3LCP C;  4MZL A;  1YUR A;  1MF8 B;  2BKI B;  2KQY A;  1GJY A;  1C07 A;  2PAL A;  2MLF C;  1DMO A;  4C0J A;  1SKT A;  1NX0 A;  1AJ5 A;  4DUQ A;  1ZFS A;  3BJH A;  4FQO A;  1OW4 A;  1S5G Z;  5CSN A;  2G9B A;  1YR5 A;  2LVI A;  4ORB B;  1B8R A;  3NHI A;  5HYD A;  1FI6 A;  3PM8 A;  1LXF C;  3FWB A;  2PQL A;  1GQM A;  3CWG A;  1K9K A;  1YUU A;  3I5G B;  5KSZ A;  3B88 A;  3EG5 B;  5JOL A;  2M29 A;  2L2E A;  4N5X A;  1SSE B;  1EG3 A;  2LMV A;  2WCL A;  1AJ4 A;  2HQW A;  1DJI A;  4N1F A;  1XFR A;  5HKZ A;  4YGC B;  1L2O B;  1LKJ A;  4USL A;  5D69 A;  1J7Q A;  1Y1A A;  1V1G A;  2K60 A;  3B6X A;  1E8A A;  2RGI A;  4YGA A;  1ZAC A;  2KPH A;  4PHK A;  1F54 A;  3NSO A;  4PT1 A;  2LHL A;  1CM1 A;  4XYN A;  1XFW O;  5HLO A;  1WRK A;  2L4H A;  3D74 A;  1KK7 Z;  4GNK B;  1VRK A;  2B1U A;  4PHN A;  1F4Q A;  1TNW A;  1QVI Y;  2JQ6 A;  2JT0 A;  1UHH A;  1G33 A;  2PAS A;  4YBH B;  2QEB A;  1UUS A;  1XFX O;  3UO9 A;  5CSF A;  3LL8 B;  2PVB A;  1NIW A;  2CNP A;  2K7O A;  3AAJ A;  2BL0 B;  3CS1 A;  3TS5 B;  2F2O A;  2I94 A;  1DJX A;  5CSJ A;  3D0Y B;  2K8M B;  2KFH A;  3BUN B;  4YGE B;  1B8L A;  1BU3 A;  1YX8 A;  1FPW A;  2MA2 A;  4QJ3 B;  2F3Y A;  1KSM A;  1RTP 1;  3SG2 A;  2BCB A;  2V53 A;  3IVT A;  5B8I B;  2JUL A;  2KFF A;  5JJG A;  3TZ1 A;  1M63 B;  1SPY A;  2M97 A;  3RLZ A;  1SR6 C;  4OV2 A;  2E30 A;  3EVR A;  3PAL A;  4ORC B;  4ZCU A;  4INX A;  3AAK A;  3O4Y A;  1KFU L;  2QEH A;  2JU0 A;  5F6T A;  3NSK A;  1QV1 A;  1QIW A;  1OE9 B;  1K93 D;  1NWD A;  1KWO B;  2L4I A;  2KLE A;  2LUC A;  2MJW B;  3KO0 A;  1SRA A;  4WQ2 A;  1J1D A;  3VGO A;  5K89 A;  3PN7 C;  3NSL A;  1C7W A;  2LVK A;  2FOT A;  2Y4Q A;  2NZ0 A;  3LK0 A;  1K8U A;  1S26 D;  2KAY A;  4TNC A;  4MRX A;  2BE4 A;  3FE6 A;  2GTE A;  2H8V A;  1QAT A;  1YUS A;  3IF7 A;  3CLN A;  4IJ7 A;  1M46 A;  3V2L A;  2IS9 A;  1PSB A;  3FE9 A;  1IWQ A;  1YTZ C;  2BBM A;  2LCP A;  3SIA A;  1JBA A;  4AQI A;  1OZS A;  5KTY A;  3GK1 A;  3TUY B;  1J55 A;  1A29 A;  2EC6 C;  3BFB A;  5TNC A;  3O4X A;  3OHM B;  5G08 A;  3SG7 A;  2M1U A;  2CXJ A;  1ZUZ A;  3JVT B;  3QME A;  4MZK A;  2ISD A;  4ETO A;  2JT8 A;  4BY5 A;  2KYF A;  3N7H A;  3SS3 A;  1TNP A;  3I5H C;  1CLB A;  3EVU A;  1K94 A;  2KHN A;  2OPO A;  3SS4 A;  2F2P A;  3PFV A;  2LP2 A;  2QEV A;  1B47 A;  1IG5 A;  3LLE A;  1AUI B;  4M2O A;  1OMV A;  1BT6 A;  4INW A;  4CLN A;  1DF0 B;  2MHH A;  3SIB A;  2BKH B;  2M8U A;  1HQV A;  2LC5 A;  3R1V A;  5I94 A;  1XFZ O;  1ALV A;  2OS8 C;  1A4P A;  1FW4 A;  3ZWH A;  1KCY A;  3LK1 A;  5IBW A;  1OOI X;  2L5Y A;  1SCV A;  2WND A;  2ZND A;  3TDZ A;  2F8P A;  1QXP A;  2QPT A;  2CTN A;  1MUX A;  2WC6 A;  2OTG B;  3E3R A;  4ICB A;  2K7C A;  3SG3 A;  3VRP A;  2DOQ A;  4OKH A;  3UNW A;  4HRG A;  3S0G A;  1TIZ A;  1ZOT B;  3DVE A;  5D7F A;  2P71 A;  1CLL A;  1SCM C;  2JXC A;  1UWO A;  1PUL A;  2FCD A;  1JF0 A;  4WRI A;  2ZNE A;  2KSP A;  1KK8 C;  5ER4 X;  2EHB A;  2WCK A;  3OBV A;  1KSO A;  5I2O A;  2NXQ A;  3DVM A;  1NYA A;  3KHE A;  4GFT A;  4JPZ B;  1CFP A;  4GBA A;  3SG4 A;  2JNX A;  1YVH A;  2JTT A;  1QS7 A; 
#chains in the Genus database with same CATH homology
 4GPL B;  3BOW B;  1OQP A;  2COL B;  3BQ3 A;  3SJS A;  1B9A A;  2LLU A;  2EGD A;  3GK2 A;  1IQ5 A;  2BCX A;  4I5K A;  4P2Y B;  4OCI A;  2SAS A;  5FYX A;  5AEQ A;  4DCK A;  1UHJ A;  2H61 A;  2AUC A;  4YRU A;  2KAX A;  1WLM A;  4D1E A;  1NCY A;  4HRH A;  4NDD A;  1TNQ A;  2WOR A;  3EKJ A;  4FTG A;  4MEW A;  3KF9 A;  1CMG A;  1TN4 A;  3BUM B;  4ORA B;  2KYC A;  3OB2 B;  1XO5 A;  2HQ8 A;  3VRN A;  1XFV O;  1S6I A;  4A4B A;  1JF2 A;  5HKW A;  3DF0 B;  1SY9 A;  1S5G Y;  1S6C A;  3EKH A;  1MHO A;  4IL1 A;  2LNK A;  4MBE A;  1CNP A;  2KQ6 A;  1BOC A;  1J7P A;  5PAL A;  2KI4 C;  3HCM A;  1UHI A;  1DF0 A;  1K2H A;  4I5L B;  2ZN9 A;  1ODB A;  2K7B A;  1XA5 A;  3I5I C;  1CDN A;  1H8B A;  2NCO A;  3VRR A;  1AP4 A;  2MBX A;  1Y6W A;  2HET A;  1J7O A;  1B7T Z;  1DGV A;  1PK0 D;  2D8N A;  2GV5 A;  3TDU A;  2GGZ A;  1K95 A;  2LVJ A;  5I2L A;  2Q91 A;  1KFX L;  1CMF A;  2MRD A;  4GUK A;  4MRY A;  1MXE A;  2ZRT A;  4C0L A;  3M0W A;  1M45 A;  4PE7 A;  1QAS A;  2Y5I A;  2L50 A;  2LUX A;  4U8D A;  4BY4 A;  1S1E A;  5DKQ A;  3BUX B;  1YX7 A;  1NSH A;  1J1E A;  4AQJ A;  3RM1 A;  1SR6 B;  2VRG A;  4P5O E;  2Y1N A;  1JWD A;  1BF5 A;  3BOW A;  1D1O A;  3O6B A;  1JFJ A;  1BMO A;  4JQ0 D;  1ZMZ A;  2CCM A;  5ER5 A;  1BOD A;  3PN7 B;  2KOT A;  1QLS A;  4OVN F;  1KQV A;  1SL8 A;  1WLZ A;  1A03 A;  2LAP A;  2JRF A;  2K61 A;  1LA3 A;  1NP8 A;  3EK8 A;  1SMG A;  1QIV A;  3I5F C;  1CKK A;  1R6P A;  1XYD A;  2O60 A;  3FS7 A;  1OMD A;  4PCW A;  1LA0 A;  1PAL A;  1S6J A;  3DF0 A;  1KFU S;  3IQO A;  4NDB A;  1KQM C;  2PSR A;  2EC6 B;  3DVK A;  1XFY O;  1CDM A;  1G8I A;  2GGM A;  1NPQ A;  3FIA A;  3WHU B;  3QRX A;  1WY9 A;  5I2Q A;  2WC8 A;  1BLQ A;  1REC A;  3PSR A;  4UPG A;  1IRJ A;  3AKB A;  1N2D A;  5AER A;  3OP0 A;  3I5H B;  2I2R E;  1Q80 A;  5J3X A;  4GAO A;  4F0Z B;  2WCB A;  1DJY A;  2M49 B;  1X02 A;  2AMI A;  3JTD C;  1QLK A;  1B1G A;  3WXA A;  4CPV A;  2H2K A;  2CBL A;  2QAC A;  4NQG A;  2JOJ A;  1K90 D;  1FBV A;  4PDZ A;  2O5G A;  4M2Q A;  2I18 A;  2JWW A;  2OS8 B;  3PAT A;  1CFC A;  1FI5 A;  4YI8 A;  1S36 A;  4R1E A;  4DIR A;  5HLV A;  3GOF A;  1QX7 A;  2L5X B;  3OX6 A;  2L0P A;  3WHT B;  1A2X A;  4CID A;  2K2A A;  4ZCV A;  4CFR A;  1SCM B;  1SBJ A;  2HF5 A;  2L51 A;  4GGN A;  3DD4 A;  3ZNI A;  1EH2 A;  1F71 A;  4YGB B;  1KK8 B;  1TNX A;  1RWY A;  1NUB A;  2TN4 A;  2CT9 A;  4I5N B;  3A8R A;  1JC2 A;  1NCZ A;  1Y1U A;  1BG1 A;  1IJ6 A;  1XVJ A;  4JWQ A;  5DKN A;  1K9P A;  1GGW A;  4DRW A;  2LMU A;  1DT7 B;  1SYM A;  4Q04 A;  1BR1 B;  1YRU B;  2BE6 A;  4CFQ A;  1NX1 A;  5KU1 A;  1CDL A;  2ZRS A;  2F33 A;  1K96 A;  1Y1X A;  1CTR A;  1IQ3 A;  3I5G C;  4MSP A;  3H4S E;  1SK6 D;  5CSI A;  2NCP A;  3KEV A;  1PRW A;  1MWN A;  5BPJ A;  2KGB C;  2SCP A;  1QJT A;  4GGF C;  4QJ5 B;  1XFU O;  3D10 A;  2LLT A;  3K21 A;  4E68 A;  1L2O C;  2M0R A;  1XK4 C;  2ZKM X;  3EVV A;  3VRQ A;  1QVI Z;  4M2P A;  1TOP A;  3MSE B;  5AXI A;  1NCX A;  1CM4 A;  2I7A A;  2L98 A;  1IJ5 A;  1A75 B;  4YI9 A;  1AVS A;  3EK4 A;  2KI4 B;  1J7R A;  1U5I B;  1C7V A;  2KDH A;  1DJW A;  1BJF A;  2AAO A;  3SG5 A;  3I5I B;  4PE0 A;  2LE9 B;  4I5J A;  1L7Z A;  2LV7 A;  2ZN8 A;  3SG6 A;  4YGD B;  3O78 A;  1KK7 Y;  4NDC A;  2BL0 C;  3TS5 C;  1YRT B;  1CB1 A;  2K0J A;  2JXL A;  4HSZ A;  4XJK B;  4MLW A;  4PE4 A;  1UHK A;  1QX2 A;  1CLM A;  3HX4 A;  5DKR A;  3A4U B;  1DJZ A;  1EG4 A;  1B7T Y;  2F3Z A;  2KGR A;  1RK9 A;  1QTX A;  1B4C A;  2K2F A;  2E6W A;  1EL4 A;  1IGV A;  1RJV A;  2JC2 A;  2LP3 A;  1DJG A;  1NX2 A;  2M3W A;  1WRZ A;  1TCO B;  2JZI A;  1TRF A;  3O2P A;  4WQ3 A;  2G2B A;  1W7I B;  1KWO C;  2M7N A;  2M7L A;  3CR5 X;  1QX5 B;  1G4Y R;  1DGU A;  1R2U A;  2MAZ A;  3ICB A;  3CTN A;  4MVF A;  2JPT A;  2PMY A;  1N0Y A;  1JFK A;  1V1F A;  2WCE A;  3VRO A;  1F55 A;  1KFX S;  1FF1 A;  2FJU B;  2NLN A;  3BYA A;  3C1V A;  1PSR A;  1OZO A;  2M1K B;  1EXR A;  1F70 A;  1UP5 A;  2KAV A;  2KNE A;  3F45 A;  3BXK A;  5AFP A;  3BUW B;  1M31 A;  1CFF A;  1RRO A;  1F8H A;  1N65 A;  3FWC A;  3TUY C;  2MLE C;  2KI6 D;  2Q4U A;  3I5F B;  2Y1M A;  2R2I A;  1SW8 A;  3BUO B;  1AK8 A;  2A4J A;  4QJ4 B;  3TDI A;  2WOS A;  5I8N A;  2H61 C;  1YUT A;  1H4B A;  1LIN A;  2JNF A;  1KQM B;  1JSA A;  4GGF A;  2WCF A;  2LMT A;  3JVT C;  2JT3 A;  1A75 A;  1GGZ A;  4A4C A;  1CFD A;  1XK4 A;  1U5I A;  1WRL A;  1PVB A;  2LAN A;  2PRU A;  1SL9 A;  1PVA A;  1WDC C;  4L9M A;  4PHM A;  1HT9 A;  3OB1 B;  4AOM A;  4HRE E;  2FCE A;  1IH0 A;  3CR4 X;  3GK4 X;  3WNX B;  1SL7 A;  3KPX A;  1IKU A;  1MXL C;  2LLS A;  3CZT X;  4PHJ A;  1M39 A;  3EK7 A;  1AHR A;  1Y0V H;  1WDC B;  2BCA A;  4MN0 A;  4PE1 A;  3OX5 A;  3DVJ A;  1B8C A;  1JUO A;  2LHI A;  1LVC D;  2ZFD A;  3NXA A;  1DJH A;  1OSA A;  4MZJ A;  4XJK A;  3JTD B;  1K9U A;  1DTL A;  1DVI A;  1OOJ A;  3D0Y A;  1UUR A;  2KFG A;  2P6B B;  3PLF B;  1YVL A;  1RFJ A;  4PAL A;  5AAN A;  1NX3 A;  1CDP A;  2BEC A;  2OTG C;  3CR2 A;  1UHN A;  5GQQ C;  1QV0 A;  2JTZ A;  1S3P A;  1MQ1 A;  2K7D A;  3AKA A;  2LVV A;  5HKY A;  4N1G A;  4DS7 A;  1TCF A;  1ALW A;  5CPV A;  2BBN A;  1SNL A;  4OR9 B;  1EJ3 A;  2KI6 C;  3NSI A;  1BR4 B;  4C0K A;  2KBI A;  3IQQ A;  2HPS A;  2M9G A;  3CGA A;  1TTX A;  2LM5 A;  1W7J B;  2KBM A;  1F4O A;  1MR8 A;  1OMR A;  3LCP C;  4MZL A;  1YUR A;  1MF8 B;  2BKI B;  2KQY A;  1GJY A;  1C07 A;  2PAL A;  2MLF C;  1DMO A;  4C0J A;  1SKT A;  1NX0 A;  1AJ5 A;  4DUQ A;  1ZFS A;  4FQO A;  1S5G Z;  5CSN A;  2G9B A;  1YR5 A;  2LVI A;  4ORB B;  1B8R A;  5HYD A;  1FI6 A;  3PM8 A;  1LXF C;  3FWB A;  1GQM A;  3CWG A;  1K9K A;  1YUU A;  3I5G B;  5KSZ A;  5JOL A;  2M29 A;  2L2E A;  4N5X A;  2LMV A;  1EG3 A;  1AJ4 A;  2HQW A;  1DJI A;  4N1F A;  5HKZ A;  4YGC B;  1L2O B;  1LKJ A;  4USL A;  5D69 A;  1J7Q A;  1Y1A A;  1V1G A;  1E8A A;  2RGI A;  4YGA A;  1ZAC A;  4PHK A;  1F54 A;  3NSO A;  2LHL A;  1CM1 A;  4XYN A;  1XFW O;  5HLO A;  1WRK A;  2L4H A;  1KK7 Z;  4GNK B;  1VRK A;  2B1U A;  4PHN A;  1F4Q A;  1TNW A;  1QVI Y;  2JQ6 A;  2JT0 A;  1UHH A;  1G33 A;  2PAS A;  4YBH B;  1UUS A;  1XFX O;  5CSF A;  3LL8 B;  2PVB A;  1NIW A;  2CNP A;  2K7O A;  3AAJ A;  2BL0 B;  3CS1 A;  3TS5 B;  2F2O A;  2I94 A;  1DJX A;  5CSJ A;  3D0Y B;  2K8M B;  2KFH A;  3BUN B;  4YGE B;  1B8L A;  1BU3 A;  1YX8 A;  1FPW A;  2MA2 A;  4QJ3 B;  2F3Y A;  1KSM A;  1RTP 1;  3SG2 A;  2BCB A;  2V53 A;  5B8I B;  2JUL A;  2KFF A;  5JJG A;  3TZ1 A;  1M63 B;  1SPY A;  2M97 A;  3RLZ A;  1SR6 C;  4OV2 A;  2E30 A;  3EVR A;  3PAL A;  4ORC B;  4ZCU A;  3AAK A;  3O4Y A;  1KFU L;  2JU0 A;  5F6T A;  3NSK A;  1QV1 A;  1QIW A;  1OE9 B;  1K93 D;  1NWD A;  1KWO B;  2L4I A;  2LUC A;  2MJW B;  3KO0 A;  1SRA A;  4WQ2 A;  1J1D A;  3VGO A;  5K89 A;  3PN7 C;  3NSL A;  1C7W A;  2LVK A;  2FOT A;  2Y4Q A;  2NZ0 A;  3LK0 A;  1K8U A;  1S26 D;  2KAY A;  4TNC A;  4MRX A;  2BE4 A;  1QAT A;  1YUS A;  3IF7 A;  3CLN A;  1M46 A;  2IS9 A;  1PSB A;  1IWQ A;  1YTZ C;  2BBM A;  2LCP A;  3SIA A;  1JBA A;  4AQI A;  1OZS A;  5KTY A;  3GK1 A;  3TUY B;  1J55 A;  1A29 A;  2EC6 C;  5TNC A;  3OHM B;  5G08 A;  3SG7 A;  2M1U A;  2CXJ A;  1ZUZ A;  3JVT B;  4ETO A;  4MZK A;  2ISD A;  2JT8 A;  4BY5 A;  2KYF A;  1TNP A;  3I5H C;  1CLB A;  3EVU A;  1K94 A;  2KHN A;  2OPO A;  2F2P A;  3PFV A;  2LP2 A;  1B47 A;  1IG5 A;  3LLE A;  1AUI B;  4M2O A;  1OMV A;  1BT6 A;  4CLN A;  1DF0 B;  2MHH A;  3SIB A;  2BKH B;  2M8U A;  1HQV A;  2LC5 A;  1XFZ O;  1ALV A;  2OS8 C;  1A4P A;  1FW4 A;  3ZWH A;  1KCY A;  3LK1 A;  5IBW A;  1SCV A;  2WND A;  2ZND A;  3TDZ A;  2F8P A;  1QXP A;  2QPT A;  2CTN A;  1MUX A;  3E3R A;  2OTG B;  4ICB A;  3SG3 A;  2K7C A;  3VRP A;  2DOQ A;  4OKH A;  4HRG A;  1TIZ A;  1ZOT B;  3DVE A;  5D7F A;  1CLL A;  1SCM C;  2JXC A;  1UWO A;  1PUL A;  2FCD A;  1JF0 A;  4WRI A;  2ZNE A;  2KSP A;  1KK8 C;  5ER4 X;  2EHB A;  1KSO A;  5I2O A;  2NXQ A;  3DVM A;  1NYA A;  3KHE A;  4GFT A;  4JPZ B;  1CFP A;  4GBA A;  3SG4 A;  2JNX A;  1YVH A;  2JTT A;  1QS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...