4CFRA

Ca-bound s100a4 c3s, c81s, c86s and f45w mutant complexed with non- muscle myosin iia
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
94
structure length
94
Chain Sequence
ASPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSWLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSSIAMMSNEFFEGFPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN S100-A4
publication title The C-Terminal Random Coil Region Tunes the Ca2+-Binding Affinity of S100A4 Through Conformational Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ca-binding protein/motor protein
total genus 35
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4cfrA00
2LHIA 1AJ4A 2IS9A 5GQQC 5DKRA 4CIDA 1OZOA 1WRKA 1ZACA 1YRTB 2JTZA 1DGUA 3EK4A 1CFPA 1A75A 1JF2A 4CLNA 4C0KA 1QJTA 3EVVA 3GK2A 4UPGA 4FTGA 5CSIA 3IQOA 1QXPA 3BYAA 1DJZA 1AJ5A 4AQIA 3LL8B 3IQQA 4DCKA 5I8NA 1D1OA 1WDCB 1TNXA 1UHNA 2JQ6A 3SG4A 1F54A 3PALA 3BXKA 1AHRA 4A4CA 2CT9A 1AK8A 2E30A 1EJ3A 3CWGA 1OMDA 4WQ3A 5FYXA 1M45A 3VRNA 2G9BA 2Y4QA 3CLNA 5DKNA 2LAPA 2KAVA 2JNXA 3CR2A 3GK1A 4M2PA 3SG3A 1BMOA 1OE9B 3BUNB 1N0YA 2BECA 3OX5A 4PE4A 5KSZA 4GGFA 1J7RA 1FBVA 1B7TY 1YUTA 5ER5A 1KK8C 1UUSA 2L98A 2LMVA 2RGIA 1MUXA 4NDDA 4U8DA 1G8IA 2LNKA 4QJ4B 1SR6C 1CLLA 1NIWA 1SRAA 2HQ8A 1MHOA 4WRIA 1XFYO 2ZKMX 3HX4A 5G08A 2MAZA 2K7DA 3OB2B 2CBLA 4BY4A 4OR9B 2L50A 1JUOA 1JFJA 4MZLA 1RFJA 4TNCA 4M2OA 5K89A 1CMGA 2BL0B 1CB1A 3VRRA 5J3XA 1B4CA 1XK4A 2ZNDA 3DVEA 1LKJA 2H61C 4QJ5B 2K61A 2LP2A 2OPOA 3EK8A 2G2BA 2LLTA 3EVUA 1M31A 1N65A 2WCBA 1KWOB 4IL1A 5DKQA 5F6TA 5CPVA 1K9KA 1A29A 2F3YA 2Y5IA 2K7CA 3VRPA 1FF1A 1QV0A 2KFFA 5HKWA 1OQPA 2COLB 2FJUB 2JWWA 1WRLA 3JTDB 3PM8A 3TUYB 1RROA 3RLZA 1S26D 3DVMA 1KQMB 2LVIA 4JPZB 5HKYA 1SY9A 3SG6A 5AEQA 1SPYA 1PULA 1A2XA 2SCPA 5ER4X 1C7VA 4AOMA 1TN4A 2L5XB 4YGEB 1AUIB 1IGVA 2L51A 2OTGC 1G4YR 4ETOA 3K21A 4Q04A 2K0JA 2FCEA 3I5GB 4YGCB 1K93D 1NPQA 1YX7A 2LMUA 1YUUA 3I5HB 1M39A 4AQJA 3VRQA 3FS7A 1LXFC 3BOWA 1PRWA 1YRUB 2JTTA 1UURA 1R2UA 1G33A 3LLEA 1ALWA 2FCDA 2WORA 1TTXA 4P5OE 2KI4C 3IF7A 4P2YB 4NDCA 4I5JA 4YGDB 3CR4X 4MN0A 1CMFA 2KSPA 1MQ1A 1K95A 3FWCA 3MSEB 1RECA 2M97A 1CFFA 1BU3A 1J1DA 2V53A 1OOJA 1JSAA 2KGBC 1CDLA 3TDIA 3TUYC 2JC2A 3TDUA 2KQ6A 2BCXA 2BE4A 2QPTA 1DMOA 4CPVA 1CDMA 1QV1A 4GUKA 1WY9A 3SG7A 2Y1NA 1GGWA 3EVRA 5JJGA 1SKTA 2MA2A 2OS8B 5BPJA 1XFVO 1S5GZ 1X02A 1KFUL 1KSOA 3CZTX 4PALA 1E8AA 2KOTA 3I5IC 4C0LA 3KHEA 2M8UA 2K8MB 3ICBA 1SL8A 1W7JB 1PSRA 1K96A 2M1KB 2PALA 5D69A 1DGVA 1B8RA 1XFWO 2LLUA 3D0YA 1WRZA 3F45A 4HSZA 3BUXB 1ZOTB 1FI5A 1GGZA 4FQOA 5CSJA 3JVTB 3AAKA 3PFVA 1BJFA 2JT8A 3GOFA 1SL7A 2WNDA 1NUBA 1JWDA 1BR1B 2GGMA 3D10A 1J7PA 5AFPA 4NQGA 3VROA 1UWOA 1CDNA 1CFDA 1A03A 4A4BA 2KBMA 1IJ6A 3DVKA 1QTXA 3O6BA 4N1FA 4XJKA 4YGBB 2M7LA 1SCMB 2KBIA 2EC6C 4R1EA 1KK7Z 2OS8C 3AKBA 5CSFA 2BKHB 2SASA 5I2LA 1QLSA 1J55A 1CFCA 1Y6WA 4HRHA 2K2AA 1SMGA 3I5FC 2WCFA 2MHHA 1KCYA 2ZNEA 1M46A 4I5NB 4ZCVA 4YGAA 3NSLA 2KYFA 5PALA 1W7IB 3EKJA 4GBAA 2HF5A 1B1GA 2KGRA 1EG4A 2F2OA 1K94A 2KAXA 3CTNA 3DF0A 5AANA 1RK9A 1WLZA 1WLMA 5AXIA 3TS5B 1NX3A 2BCAA 2WC8A 2LM5A 1TNWA 1QLKA 1WDCC 1F70A 1XFXO 1YURA 1EL4A 2KQYA 5KU1A 1V1FA 3NSIA 3DVJA 2KFHA 2P6BB 3BUOB 1L2OB 1ODBA 1FW4A 2M29A 1MXEA 3PATA 1BT6A 4USLA 1KFXS 2M1UA 3PN7B 2R2IA 3SJSA 1DT7B 1K9PA 3NXAA 3HCMA 3LK0A 4MBEA 1SW8A 5JOLA 4YRUA 3AKAA 1NCZA 1F55A 2NCPA 4MEWA 4F0ZB 3LK1A 2PSRA 2LLSA 2M0RA 1U5IB 2H61A 1S5GY 2NLNA 2FOTA 4CFQA 2NZ0A 1TCFA 5IBWA 2LCPA 2BL0C 1F4OA 1XA5A 1EH2A 1UHJA 1B7TZ 2Y1MA 3OX6A 1OMVA 2I7AA 1A75B 3H4SE 4DRWA 1Y1AA 2CXJA 2MBXA 1DJYA 2KFGA 1BLQA 4GAOA 1GQMA 2QACA 1JFKA 1EG3A 1PALA 1QASA 2NCOA 2LUCA 2TN4A 1KWOC 2F8PA 3WXAA 2VRGA 1IJ5A 1RJVA 2KHNA 2LVKA 3FIAA 1IWQA 5D7FA 1HQVA 1XO5A 1IRJA 1NP8A 3KPXA 2LHLA 2EHBA 2F2PA 3JTDC 4XJKB 1SCVA 1LVCD 2F33A 4MVFA 1KQMC 3WHTB 2BKIB 1HT9A 1OMRA 1KQVA 1R6PA 3OHMB 1DJHA 1OSAA 2A4JA 2LVJA 1V1GA 2M9GA 2JU0A 1KK7Y 1F71A 1DVIA 1H8BA 3OB1B 4PE0A 2WOSA 4ORBB 3CR5X 5HLVA 1H4BA 3I5GC 3OP0A 3I5HC 4PHJA 5HYDA 1PK0D 1QS7A 1Y0VH 4N1GA 1YVHA 3O4YA 2DOQA 1DJGA 1NWDA 1TRFA 4I5LB 1TNPA 4MLWA 1S6CA 2HPSA 2Q4UA 1AP4A 1RWYA 2ISDA 1C07A 1DJIA 1QX7A 1NCXA 3O78A 3KO0A 3CGAA 1N2DA 2LV7A 1YX8A 1ZMZA 1NSHA 4OV2A 1XFUO 1CM1A 3TZ1A 2MRDA 4DIRA 1IQ3A 1S1EA 1BODA 2AUCA 4PHKA 2M3WA 1UHIA 4GGNA 4HRGA 4MRYA 4MZJA 2LUXA 1JC2A 1MR8A 5HKZA 2BBNA 1VRKA 1ALVA 2JRFA 1S6JA 2O5GA 1MF8B 5KTYA 1DTLA 1A4PA 1NX0A 4CFRA 1KK8B 3DD4A 4OVNF 3SIAA 1SR6B 1SYMA 1TIZA 2JXLA 4GGFC 2L2EA 1UHHA 3TDZA 1QX2A 4PHMA 4PDZA 1IQ5A 4GFTA 4PHNA 2L4HA 1DF0A 2ZN8A 4QJ3B 1QVIZ 3EK7A 1L7ZA 1BR4B 4XYNA 3PLFB 3EKHA 3JVTC 1S6IA 3LCPC 2ZRSA 4PE7A 4MSPA 3KF9A 4BY5A 1J7OA 1UP5A 2AAOA 2JT3A 1MWNA 3RM1A 5TNCA 5CSNA 3VGOA 1M63B 1Q80A 1S3PA 2WCEA 1XK4C 1CTRA 5AERA 1CKKA 2ZRTA 1IH0A 2I2RE 1IKUA 2BBMA 3BOWB 3WHUB 2JNFA 3E3RA 4JWQA 2GGZA 2PASA 2JPTA 3SG5A 1DJWA 3O2PA 1IG5A 1YTZC 1SCMC 4YI8A 2MLEC 1LA0A 1PVAA 1SNLA 1NX2A 2O60A 1B8CA 1K2HA 1XFZO 4L9MA 3BQ3A 1SK6D 4WQ2A 5I2OA 1KSMA 1UHKA 4C0JA 4D1EA 2HQWA 2HETA 2JULA 2NXQA 2Q91A 1MXLC 3AAJA 5HLOA 1EXRA 2CCMA 2KI6C 1B9AA 4HREE 2K2FA 3ZNIA 2OTGB 4NDBA 1J7QA 1J1EA 2KAYA 2ZFDA 1Y1UA 2GV5A 1DJXA 3NSKA 1XVJA 2M49B 4GPLB 1QIVA 4PE1A 2LVVA 1OZSA 1BOCA 1KFUS 4YI9A 3TS5C 1FPWA 1PVBA 3BUMB 3ZWHA 1C7WA 4GNKB 2B1UA 2JT0A 1CLBA 3BUWB 2KNEA 1GJYA 2AMIA 1NYAA 1S36A 2L0PA 2MJWB 2KI4B 2PMYA 3CS1A 3D0YB 2I94A 1XYDA 2KDHA 4JQ0D 1Y1XA 2K7OA 1NX1A 2MLFC 3A4UB 1L2OC 4M2QA 1LINA 1CLMA 2K7BA 2BCBA 4I5KA 3PSRA 3C1VA 3PN7C 3A8RA 4N5XA 2E6WA 1TOPA 1B47A 3SIBA 2LP3A 4MZKA 4ICBA 1YUSA 2JOJA 3I5IB 4OCIA 4PCWA 3NSOA 5I2QA 3QRXA 1CM4A 1AVSA 1K9UA 4YBHB 4ORAB 2CNPA 2I18A 1CDPA 2ZN9A 3M0WA 1K90D 1NCYA 3WNXB 1BF5A 4ORCB 3GK4X 1JF0A 1QX5B 1ZFSA 1ZUZA 2EGDA 1KFXL 1DF0B 2KI6D 2KYCA 4OKHA 2LC5A 4E68A 2LMTA 4MRXA 1YR5A 2H2KA 2JXCA 2L4IA 2BE6A 1F8HA 1LA3A 2LANA 1YVLA 1QVIY 4DUQA 1SBJA 3DF0B 3FWBA 1PSBA 4DS7A 3SG2A 2PVBA 2CTNA 3KEVA 1JBAA 2D8NA 2PRUA 1BG1A 1CNPA 2EC6B 1RTP1 1QATA 2LE9B 1F4QA 1SL9A 1QIWA 2M7NA 5B8IB 1FI6A 1U5IA 1B8LA 3I5FB 2F3ZA 2JZIA 1K8UA 4ZCUA 1TCOB 1TNQA
chains in the Genus database with same CATH superfamily
2LHIA 1AJ4A 2IS9A 5GQQC 5DKRA 4CIDA 1OZOA 1WRKA 1ZACA 3NHIA 1YRTB 3S0BA 3CDNA 2JTZA 1DGUA 3EK4A 1CFPA 1A75A 1JF2A 4CLNA 4C0KA 1QJTA 3EVVA 3GK2A 4UPGA 4FTGA 5CSIA 3IQOA 1QXPA 3BYAA 3FE8A 1DJZA 1AJ5A 4AQIA 3LL8B 3IQQA 4DCKA 3R1PA 4KYNA 5I8NA 1D1OA 1WDCB 1TNXA 1UHNA 2JQ6A 3SG4A 1F54A 3PALA 3BXKA 1AHRA 5D3OA 4A4CA 2CT9A 1AK8A 2E30A 1EJ3A 3CWGA 1OMDA 2PQLA 4WQ3A 5FYXA 1M45A 3VRNA 4INWA 2G9BA 2Y4QA 3CLNA 5DKNA 2LAPA 2KAVA 2JNXA 2L2CA 1IIOA 3CR2A 3GK1A 4M2PA 3SG3A 1BMOA 1OE9B 3BUNB 1N0YA 3D74A 2BECA 3OX5A 4PE4A 5KSZA 4GGFA 1J7RA 1FBVA 1B7TY 1YUTA 5ER5A 1KK8C 1UUSA 2L98A 2LMVA 2RGIA 1MUXA 4NDDA 4U8DA 1G8IA 2LNKA 3S0DA 4QJ4B 1SR6C 1CLLA 1NIWA 1SRAA 2HQ8A 1MHOA 4WRIA 1XFYO 2ZKMX 3HX4A 5G08A 3RZSA 2MAZA 2K7DA 3OB2B 2CBLA 3R1OA 4BY4A 3NHTA 3IVTA 2L50A 4OR9B 4OZDA 1JUOA 1JFJA 4MZLA 1RFJA 4TNCA 4M2OA 5K89A 1CMGA 2BL0B 1CB1A 3VRRA 5J3XA 1B4CA 1XK4A 2ZNDA 3DVEA 1LKJA 2H61C 4QJ5B 2K61A 4IJ7A 2LP2A 3L4LA 2OPOA 3EK8A 2G2BA 2LLTA 3EVUA 1M31A 1N65A 2WCBA 1KWOB 4IL1A 5DKQA 5F6TA 5CPVA 1K9KA 1A29A 2F3YA 2KPHA 2Y5IA 2K7CA 3CS1A 3VRPA 1FF1A 1QV0A 1ORGA 2KFFA 5HKWA 1OQPA 2COLB 2FJUB 2JWWA 1WRLA 3JTDB 3PM8A 3TUYB 1RROA 3RLZA 1S26D 3DVMA 1KQMB 2LVIA 3DYEA 4JPZB 3BFBA 1SY9A 5HKYA 4FQTA 3D75A 3SG6A 5AEQA 3SS3A 1SPYA 1PULA 1A2XA 2SCPA 5ER4X 1C7VA 4AOMA 1TN4A 2L5XB 4YGEB 1AUIB 1IGVA 2L51A 2OTGC 3EG5B 1G4YR 4ETOA 3K21A 4Q04A 2K0JA 2FCEA 3I5GB 4YGCB 1K93D 1NPQA 1YX7A 1Z2CB 1YUUA 2LMUA 1M39A 3I5HB 4AQJA 1DC1A 3VRQA 3FS7A 1LXFC 3BOWA 2L5YA 1PRWA 3S0EA 1YRUB 2JTTA 1UURA 1R2UA 1G33A 3LLEA 1ALWA 3L47A 2FCDA 2WORA 1TTXA 4P5OE 3OBVA 2KI4C 3IF7A 4P2YB 4NDCA 4I5JA 4YGDB 3CR4X 4MN0A 1CMFA 2KSPA 1MQ1A 1K95A 3FWCA 3MSEB 1RECA 2M97A 2QEVA 1CFFA 1BU3A 1J1DA 2V53A 1OOJA 1JSAA 2KGBC 1CDLA 3TDIA 3TUYC 2JC2A 3TDUA 2KQ6A 2BCXA 2BE4A 2QPTA 1DMOA 3CZ2A 4CPVA 1CDMA 1QV1A 4GUKA 1WY9A 3SG7A 2Y1NA 1GGWA 3EVRA 5JJGA 1SKTA 2MA2A 2OS8B 3DZTA 5BPJA 1XFVO 1S5GZ 3CZ1A 1X02A 1KFUL 1KSOA 3CZTX 4PALA 1E8AA 2KOTA 3I5IC 4C0LA 3KHEA 2M8UA 2K8MB 3ICBA 1SL8A 1W7JB 1PSRA 1K96A 2M1KB 2PALA 5D69A 1DGVA 1B8RA 1XFWO 2LLUA 3D0YA 3D73A 1WRZA 3F45A 4HSZA 1GM0A 3BUXB 1ZOTB 1FI5A 3BFHA 1GGZA 4FQOA 5CSJA 3JVTB 3VB1A 3AAKA 3PFVA 1BJFA 2H8VA 2JT8A 5DICA 3GOFA 1SL7A 5FI7A 2WNDA 1NUBA 1JWDA 1BR1B 2GGMA 3D10A 1J7PA 5AFPA 4NQGA 3VROA 1UWOA 1CDNA 1CFDA 1A03A 4A4BA 2KBMA 1IJ6A 3DVKA 1QTXA 1W9ZA 3O6BA 4N1FA 4XJKA 4YGBB 1SCMB 2M7LA 2KBIA 3DXLA 2EC6C 4R1EA 1KK7Z 2OS8C 2WCHA 3AKBA 3L4AA 5CSFA 2BKHB 2SASA 5I2LA 1QLSA 1J55A 1CFCA 1Y6WA 4HRHA 2K2AA 1SMGA 3I5FC 2WCFA 2MHHA 1KCYA 2ZNEA 2QDIA 1M46A 3CABA 4I5NB 4ZCVA 1DQEA 4YGAA 3NSLA 2KYFA 5PALA 1W7IB 2P71A 3D77A 3EKJA 4GBAA 2HF5A 1B1GA 2KGRA 1EG4A 2F2OA 1K94A 2KAXA 3CYZA 2KLEA 3CTNA 3DF0A 5AANA 1RK9A 1WLZA 1WLMA 2WCLA 5AXIA 3TS5B 1NX3A 2BCAA 2WC8A 2LM5A 1TNWA 1QLKA 1WDCC 1F70A 1XFXO 1YURA 1OW4A 1EL4A 2KQYA 5KU1A 1V1FA 3NSIA 3DVJA 2KFHA 2P6BB 3BUOB 1L2OB 1ODBA 1FW4A 2M29A 1MXEA 3PATA 1BT6A 3UO9A 4USLA 1KFXS 2M1UA 3PN7B 2R2IA 3SJSA 1OOIX 1DT7B 1K9PA 3NXAA 3S0AA 3HCMA 3LK0A 4MBEA 1SW8A 5JOLA 4YRUA 3AKAA 1NCZA 1F55A 2NCPA 1DEKA 4MEWA 2QEBA 1C3YA 3B6XA 4F0ZB 3LK1A 2PSRA 2LLSA 3D78A 4F7FA 4JKTA 2M0RA 1U5IB 2H61A 5EL2A 1S5GY 2NLNA 2FOTA 1P28A 4CFQA 2NZ0A 1TCFA 5IBWA 2LCPA 2BL0C 1F4OA 1XA5A 1TUZA 1EH2A 1UHJA 1B7TZ 2Y1MA 3OX6A 1OMVA 2I7AA 1A75B 3H4SE 4DRWA 1Y1AA 2CXJA 2MBXA 1DJYA 2KFGA 1BLQA 4GAOA 1GQMA 4PT1A 2QACA 1JFKA 1EG3A 1PALA 1QASA 2NCOA 3B87A 2LUCA 2TN4A 1KWOC 2F8PA 3WXAA 2VRGA 1IJ5A 1RJVA 2KHNA 2LVKA 3FE9A 3FIAA 1IWQA 5D7FA 1HQVA 1XO5A 1IRJA 1NP8A 3KPXA 2LHLA 2EHBA 3DY9A 2F2PA 3JTDC 4XJKB 2GTEA 1SCVA 1LVCD 2F33A 4MVFA 1KQMC 3WHTB 1HT9A 2BKIB 1OMRA 1TWOA 1KQVA 1R6PA 3OHMB 1DJHA 1OSAA 2A4JA 2LVJA 1V1GA 2M9GA 2JU0A 1KK7Y 1OOFA 1F71A 1DVIA 1H8BA 3OB1B 4PE0A 2WOSA 4ORBB 2WCJA 3CR5X 5HLVA 1H4BA 3I5GC 3OP0A 3I5HC 4PHJA 5HYDA 1PK0D 1QS7A 1Y0VH 4N1GA 3R72A 1YVHA 3O4YA 2DOQA 1DJGA 1NWDA 1TRFA 4I5LB 1TNPA 4MLWA 1S6CA 2HPSA 2Q4UA 1AP4A 1RWYA 2ISDA 1C07A 1DJIA 1QX7A 1NCXA 3O78A 3KO0A 3CGAA 1N2DA 2LV7A 1YX8A 1ZMZA 1NSHA 4OV2A 1XFUO 1CM1A 5I94A 3TZ1A 2MRDA 2WCMA 4DIRA 1IQ3A 3S0GA 1S1EA 1BODA 2AUCA 4PHKA 2M3WA 1UHIA 4GGNA 4HRGA 4MRYA 4MZJA 1OOGA 2LUXA 1JC2A 1MR8A 5HKZA 2BBNA 1VRKA 1ALVA 2JRFA 4JD9A 1S6JA 2O5GA 1MF8B 5KTYA 1DTLA 1A4PA 1NX0A 3B86A 1KK8B 3DD4A 4CFRA 4OVNF 3SIAA 1SR6B 1SYMA 1TIZA 2JXLA 3CZ0A 4GGFC 2L2EA 1UHHA 3TDZA 1QX2A 4PHMA 4PDZA 1IQ5A 4GFTA 4PHNA 2L4HA 1DF0A 2ZN8A 1Z4HA 1LS8A 1QVIZ 3EK7A 4QJ3B 1L7ZA 1BR4B 4XYNA 3PLFB 3EKHA 3JVTC 1S6IA 3LCPC 3N7HA 2ZRSA 4PE7A 4MSPA 3KF9A 4BY5A 1J7OA 1UP5A 1DELA 2AAOA 2JT3A 1MWNA 1C3ZA 5TNCA 5CSNA 3RM1A 2ERBA 3VGOA 3B7AA 3V2LA 1M63B 3FE6A 2P70A 1Q80A 1S3PA 2WCEA 1XK4C 1CTRA 5AERA 1CKKA 2ZRTA 1IH0A 2I2RE 1IKUA 2BBMA 3BOWB 3WHUB 2JNFA 3E3RA 3O4XA 2GGZA 4JWQA 2PASA 2FJYA 2JPTA 2YGUA 1DJWA 3O2PA 3SG5A 1IG5A 1YTZC 3UNWA 1SCMC 4YI8A 2MLEC 1LA0A 1PVAA 1SNLA 1NX2A 2O60A 2QEHA 1B8CA 1K2HA 1XFZO 4L9MA 3BQ3A 1SK6D 4WQ2A 5I2OA 1KSMA 1UHKA 4C0JA 4D1EA 2HQWA 1XFRA 2HETA 2JULA 2NXQA 2Q91A 1MXLC 3AAJA 2WC6A 5HLOA 1EXRA 4INXA 2CCMA 2KI6C 1TUJA 1B9AA 4HREE 2K2FA 3ZNIA 2OTGB 4NDBA 3OGNA 1J7QA 1J1EA 2KAYA 2ZFDA 1Y1UA 2GV5A 1DJXA 3NSKA 1XVJA 2M49B 4GPLB 1QIVA 4PE1A 2LVVA 1OZSA 1BOCA 1KFUS 4YI9A 3TS5C 1FPWA 1PVBA 3BUMB 3ZWHA 1C7WA 4GNKB 2B1UA 2JT0A 1CLBA 3BUWB 2KNEA 1GJYA 2AMIA 1NYAA 1S36A 2L0PA 2MJWB 2KI4B 2PMYA 2PYQA 2K60A 2I94A 1XYDA 2KDHA 3D0YB 4JQ0D 1Y1XA 2K7OA 1T14A 3D76A 2WCKA 1NX1A 2MLFC 3A4UB 1L2OC 1SSEB 4M2QA 1LINA 1CLMA 2K7BA 2BCBA 5HL1A 2JPOA 4I5KA 3PSRA 5FI6A 3C1VA 2WC5A 3Q8IA 3PN7C 3A8RA 4N5XA 3S0FA 2E6WA 3SS4A 1TOPA 1B47A 3SIBA 2LP3A 4MZKA 4ICBA 3R1VA 1YUSA 2JOJA 3I5IB 4OCIA 4PCWA 3NSOA 3BFAA 5I2QA 3QRXA 1CM4A 2KLDA 1AVSA 1K9UA 4YBHB 5FI2A 4ORAB 3PJIA 2CNPA 2I18A 1CDPA 2ZN9A 3M0WA 1K90D 1NCYA 3SS5A 3WNXB 1BF5A 3B88A 2BAPA 4ORCB 3GK4X 1JF0A 1QX5B 1ZFSA 1ZUZA 2EGDA 1KFXL 1DF0B 2KI6D 2KYCA 3NGVA 2LC5A 4OKHA 2LMTA 4MRXA 4E68A 1YR5A 2QEOA 1OOHA 2H2KA 2JXCA 2L4IA 2BE6A 1F8HA 1LA3A 2LANA 1YVLA 1QVIY 4DUQA 3BJHA 1SBJA 3DF0B 3FWBA 1PSBA 4DS7A 3SG2A 2PVBA 2CTNA 3KEVA 1JBAA 2D8NA 2PRUA 1BG1A 3PM2A 1CNPA 2EC6B 1RTP1 1QATA 2LE9B 1QWVA 1F4QA 1SL9A 1QIWA 3QMEA 2M7NA 5B8IB 1FI6A 2BNXA 1U5IA 1B8LA 3I5FB 2F3ZA 3K1EA 2JZIA 1K8UA 4ZCUA 1TCOB 1TNQA
chains in the Genus database with same CATH topology
2LHIA 1AJ4A 2IS9A 5GQQC 5DKRA 4CIDA 1OZOA 1WRKA 1ZACA 1YRTB 2JTZA 1DGUA 3EK4A 1CFPA 1A75A 1JF2A 4CLNA 4C0KA 1QJTA 3EVVA 3GK2A 4UPGA 4FTGA 5CSIA 3IQOA 1QXPA 3BYAA 1DJZA 1AJ5A 4AQIA 3LL8B 3IQQA 4DCKA 5I8NA 1D1OA 1WDCB 1TNXA 1UHNA 2JQ6A 3SG4A 1F54A 3PALA 3BXKA 1AHRA 4A4CA 2CT9A 1AK8A 2E30A 1EJ3A 3CWGA 1OMDA 4WQ3A 5FYXA 1M45A 3VRNA 2G9BA 2Y4QA 3CLNA 5DKNA 2LAPA 2KAVA 2JNXA 3CR2A 3GK1A 4M2PA 3SG3A 1BMOA 1OE9B 3BUNB 1N0YA 2BECA 3OX5A 4PE4A 5KSZA 4GGFA 1J7RA 1FBVA 1B7TY 1YUTA 5ER5A 1KK8C 1UUSA 2L98A 2LMVA 2RGIA 1MUXA 4NDDA 4U8DA 1G8IA 2LNKA 4QJ4B 1SR6C 1CLLA 1NIWA 1SRAA 2HQ8A 1MHOA 4WRIA 1XFYO 2ZKMX 3HX4A 5G08A 2MAZA 2K7DA 3OB2B 2CBLA 4BY4A 4OR9B 2L50A 1JUOA 1JFJA 4MZLA 1RFJA 4TNCA 4M2OA 5K89A 1CMGA 2BL0B 1CB1A 3VRRA 5J3XA 1B4CA 1XK4A 2ZNDA 3DVEA 1LKJA 2H61C 4QJ5B 2K61A 2LP2A 2OPOA 3EK8A 2G2BA 2LLTA 3EVUA 1M31A 1N65A 2WCBA 1KWOB 4IL1A 5DKQA 5F6TA 5CPVA 1K9KA 1A29A 2F3YA 2Y5IA 2K7CA 3VRPA 1FF1A 1QV0A 2KFFA 5HKWA 1OQPA 2COLB 2FJUB 2JWWA 1WRLA 3JTDB 3PM8A 3TUYB 1RROA 3RLZA 1S26D 3DVMA 1KQMB 2LVIA 4JPZB 5HKYA 1SY9A 3SG6A 5AEQA 1SPYA 1PULA 1A2XA 2SCPA 5ER4X 1C7VA 4AOMA 1TN4A 2L5XB 4YGEB 1AUIB 1IGVA 2L51A 2OTGC 1G4YR 4ETOA 3K21A 4Q04A 2K0JA 2FCEA 3I5GB 4YGCB 1K93D 1NPQA 1YX7A 2LMUA 1YUUA 3I5HB 1M39A 4AQJA 3VRQA 3FS7A 1LXFC 3BOWA 1PRWA 1YRUB 2JTTA 1UURA 1R2UA 1G33A 3LLEA 1ALWA 2FCDA 2WORA 1TTXA 4P5OE 2KI4C 3IF7A 4P2YB 4NDCA 4I5JA 4YGDB 3CR4X 4MN0A 1CMFA 2KSPA 1MQ1A 1K95A 3FWCA 3MSEB 1RECA 2M97A 1CFFA 1BU3A 1J1DA 2V53A 1OOJA 1JSAA 2KGBC 1CDLA 3TDIA 3TUYC 2JC2A 3TDUA 2KQ6A 2BCXA 2BE4A 2QPTA 1DMOA 4CPVA 1CDMA 1QV1A 4GUKA 1WY9A 3SG7A 2Y1NA 1GGWA 3EVRA 5JJGA 1SKTA 2MA2A 2OS8B 5BPJA 1XFVO 1S5GZ 1X02A 1KFUL 1KSOA 3CZTX 4PALA 1E8AA 2KOTA 3I5IC 4C0LA 3KHEA 2M8UA 2K8MB 3ICBA 1SL8A 1W7JB 1PSRA 1K96A 2M1KB 2PALA 5D69A 1DGVA 1B8RA 1XFWO 2LLUA 3D0YA 1WRZA 3F45A 4HSZA 3BUXB 1ZOTB 1FI5A 1GGZA 4FQOA 5CSJA 3JVTB 3AAKA 3PFVA 1BJFA 2JT8A 3GOFA 1SL7A 2WNDA 1NUBA 1JWDA 1BR1B 2GGMA 3D10A 1J7PA 5AFPA 4NQGA 3VROA 1UWOA 1CDNA 1CFDA 1A03A 4A4BA 2KBMA 1IJ6A 3DVKA 1QTXA 3O6BA 4N1FA 4XJKA 4YGBB 2M7LA 1SCMB 2KBIA 2EC6C 4R1EA 1KK7Z 2OS8C 3AKBA 5CSFA 2BKHB 2SASA 5I2LA 1QLSA 1J55A 1CFCA 1Y6WA 4HRHA 2K2AA 1SMGA 3I5FC 2WCFA 2MHHA 1KCYA 2ZNEA 1M46A 4I5NB 4ZCVA 4YGAA 3NSLA 2KYFA 5PALA 1W7IB 3EKJA 4GBAA 2HF5A 1B1GA 2KGRA 1EG4A 2F2OA 1K94A 2KAXA 3CTNA 3DF0A 5AANA 1RK9A 1WLZA 1WLMA 5AXIA 3TS5B 1NX3A 2BCAA 2WC8A 2LM5A 1TNWA 1QLKA 1WDCC 1F70A 1XFXO 1YURA 1EL4A 2KQYA 5KU1A 1V1FA 3NSIA 3DVJA 2KFHA 2P6BB 3BUOB 1L2OB 1ODBA 1FW4A 2M29A 1MXEA 3PATA 1BT6A 4USLA 1KFXS 2M1UA 3PN7B 2R2IA 3SJSA 1DT7B 1K9PA 3NXAA 3HCMA 3LK0A 4MBEA 1SW8A 5JOLA 4YRUA 3AKAA 1NCZA 1F55A 2NCPA 4MEWA 4F0ZB 3LK1A 2PSRA 2LLSA 2M0RA 1U5IB 2H61A 1S5GY 2NLNA 2FOTA 4CFQA 2NZ0A 1TCFA 5IBWA 2LCPA 2BL0C 1F4OA 1XA5A 1EH2A 1UHJA 1B7TZ 2Y1MA 3OX6A 1OMVA 2I7AA 1A75B 3H4SE 4DRWA 1Y1AA 2CXJA 2MBXA 1DJYA 2KFGA 1BLQA 4GAOA 1GQMA 2QACA 1JFKA 1EG3A 1PALA 1QASA 2NCOA 2LUCA 2TN4A 1KWOC 2F8PA 3WXAA 2VRGA 1IJ5A 1RJVA 2KHNA 2LVKA 3FIAA 1IWQA 5D7FA 1HQVA 1XO5A 1IRJA 1NP8A 3KPXA 2LHLA 2EHBA 2F2PA 3JTDC 4XJKB 1SCVA 1LVCD 2F33A 4MVFA 1KQMC 3WHTB 2BKIB 1HT9A 1OMRA 1KQVA 1R6PA 3OHMB 1DJHA 1OSAA 2A4JA 2LVJA 1V1GA 2M9GA 2JU0A 1KK7Y 1F71A 1DVIA 1H8BA 3OB1B 4PE0A 2WOSA 4ORBB 3CR5X 5HLVA 1H4BA 3I5GC 3OP0A 3I5HC 4PHJA 5HYDA 1PK0D 1QS7A 1Y0VH 4N1GA 1YVHA 3O4YA 2DOQA 1DJGA 1NWDA 1TRFA 4I5LB 1TNPA 4MLWA 1S6CA 2HPSA 2Q4UA 1AP4A 1RWYA 2ISDA 1C07A 1DJIA 1QX7A 1NCXA 3O78A 3KO0A 3CGAA 1N2DA 2LV7A 1YX8A 1ZMZA 1NSHA 4OV2A 1XFUO 1CM1A 3TZ1A 2MRDA 4DIRA 1IQ3A 1S1EA 1BODA 2AUCA 4PHKA 2M3WA 1UHIA 4GGNA 4HRGA 4MRYA 4MZJA 2LUXA 1JC2A 1MR8A 5HKZA 2BBNA 1VRKA 1ALVA 2JRFA 1S6JA 2O5GA 1MF8B 5KTYA 1DTLA 1A4PA 1NX0A 4CFRA 1KK8B 3DD4A 4OVNF 3SIAA 1SR6B 1SYMA 1TIZA 2JXLA 4GGFC 2L2EA 1UHHA 3TDZA 1QX2A 4PHMA 4PDZA 1IQ5A 4GFTA 4PHNA 2L4HA 1DF0A 2ZN8A 4QJ3B 1QVIZ 3EK7A 1L7ZA 1BR4B 4XYNA 3PLFB 3EKHA 3JVTC 1S6IA 3LCPC 2ZRSA 4PE7A 4MSPA 3KF9A 4BY5A 1J7OA 1UP5A 2AAOA 2JT3A 1MWNA 3RM1A 5TNCA 5CSNA 3VGOA 1M63B 1Q80A 1S3PA 2WCEA 1XK4C 1CTRA 5AERA 1CKKA 2ZRTA 1IH0A 2I2RE 1IKUA 2BBMA 3BOWB 3WHUB 2JNFA 3E3RA 4JWQA 2GGZA 2PASA 2JPTA 3SG5A 1DJWA 3O2PA 1IG5A 1YTZC 1SCMC 4YI8A 2MLEC 1LA0A 1PVAA 1SNLA 1NX2A 2O60A 1B8CA 1K2HA 1XFZO 4L9MA 3BQ3A 1SK6D 4WQ2A 5I2OA 1KSMA 1UHKA 4C0JA 4D1EA 2HQWA 2HETA 2JULA 2NXQA 2Q91A 1MXLC 3AAJA 5HLOA 1EXRA 2CCMA 2KI6C 1B9AA 4HREE 2K2FA 3ZNIA 2OTGB 4NDBA 1J7QA 1J1EA 2KAYA 2ZFDA 1Y1UA 2GV5A 1DJXA 3NSKA 1XVJA 2M49B 4GPLB 1QIVA 4PE1A 2LVVA 1OZSA 1BOCA 1KFUS 4YI9A 3TS5C 1FPWA 1PVBA 3BUMB 3ZWHA 1C7WA 4GNKB 2B1UA 2JT0A 1CLBA 3BUWB 2KNEA 1GJYA 2AMIA 1NYAA 1S36A 2L0PA 2MJWB 2KI4B 2PMYA 3CS1A 3D0YB 2I94A 1XYDA 2KDHA 4JQ0D 1Y1XA 2K7OA 1NX1A 2MLFC 3A4UB 1L2OC 4M2QA 1LINA 1CLMA 2K7BA 2BCBA 4I5KA 3PSRA 3C1VA 3PN7C 3A8RA 4N5XA 2E6WA 1TOPA 1B47A 3SIBA 2LP3A 4MZKA 4ICBA 1YUSA 2JOJA 3I5IB 4OCIA 4PCWA 3NSOA 5I2QA 3QRXA 1CM4A 1AVSA 1K9UA 4YBHB 4ORAB 2CNPA 2I18A 1CDPA 2ZN9A 3M0WA 1K90D 1NCYA 3WNXB 1BF5A 4ORCB 3GK4X 1JF0A 1QX5B 1ZFSA 1ZUZA 2EGDA 1KFXL 1DF0B 2KI6D 2KYCA 4OKHA 2LC5A 4E68A 2LMTA 4MRXA 1YR5A 2H2KA 2JXCA 2L4IA 2BE6A 1F8HA 1LA3A 2LANA 1YVLA 1QVIY 4DUQA 1SBJA 3DF0B 3FWBA 1PSBA 4DS7A 3SG2A 2PVBA 2CTNA 3KEVA 1JBAA 2D8NA 2PRUA 1BG1A 1CNPA 2EC6B 1RTP1 1QATA 2LE9B 1F4QA 1SL9A 1QIWA 2M7NA 5B8IB 1FI6A 1U5IA 1B8LA 3I5FB 2F3ZA 2JZIA 1K8UA 4ZCUA 1TCOB 1TNQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LHI A;  1AJ4 A;  2IS9 A;  5GQQ C;  5DKR A;  4CID A;  1OZO A;  1WRK A;  1ZAC A;  1YRT B;  2JTZ A;  1DGU A;  3EK4 A;  1CFP A;  1A75 A;  1JF2 A;  4CLN A;  4C0K A;  1QJT A;  3EVV A;  3GK2 A;  4UPG A;  4FTG A;  5CSI A;  3IQO A;  1QXP A;  3BYA A;  1DJZ A;  1AJ5 A;  4AQI A;  3LL8 B;  3IQQ A;  4DCK A;  5I8N A;  1D1O A;  1WDC B;  1TNX A;  1UHN A;  2JQ6 A;  3SG4 A;  1F54 A;  3PAL A;  3BXK A;  1AHR A;  4A4C A;  2CT9 A;  1AK8 A;  2E30 A;  1EJ3 A;  3CWG A;  1OMD A;  4WQ3 A;  5FYX A;  1M45 A;  3VRN A;  2G9B A;  2Y4Q A;  3CLN A;  5DKN A;  2LAP A;  2KAV A;  2JNX A;  3CR2 A;  3GK1 A;  4M2P A;  3SG3 A;  1BMO A;  1OE9 B;  3BUN B;  1N0Y A;  2BEC A;  3OX5 A;  4PE4 A;  5KSZ A;  4GGF A;  1J7R A;  1FBV A;  1B7T Y;  1YUT A;  5ER5 A;  1KK8 C;  1UUS A;  2L98 A;  2LMV A;  2RGI A;  1MUX A;  4NDD A;  4U8D A;  1G8I A;  2LNK A;  4QJ4 B;  1SR6 C;  1CLL A;  1NIW A;  1SRA A;  2HQ8 A;  1MHO A;  4WRI A;  1XFY O;  2ZKM X;  3HX4 A;  5G08 A;  2MAZ A;  2K7D A;  3OB2 B;  2CBL A;  4BY4 A;  4OR9 B;  2L50 A;  1JUO A;  1JFJ A;  4MZL A;  1RFJ A;  4TNC A;  4M2O A;  5K89 A;  1CMG A;  2BL0 B;  1CB1 A;  3VRR A;  5J3X A;  1B4C A;  1XK4 A;  2ZND A;  3DVE A;  1LKJ A;  2H61 C;  4QJ5 B;  2K61 A;  2LP2 A;  2OPO A;  3EK8 A;  2G2B A;  2LLT A;  3EVU A;  1M31 A;  1N65 A;  2WCB A;  1KWO B;  4IL1 A;  5DKQ A;  5F6T A;  5CPV A;  1K9K A;  1A29 A;  2F3Y A;  2Y5I A;  2K7C A;  3VRP A;  1FF1 A;  1QV0 A;  2KFF A;  5HKW A;  1OQP A;  2COL B;  2FJU B;  2JWW A;  1WRL A;  3JTD B;  3PM8 A;  3TUY B;  1RRO A;  3RLZ A;  1S26 D;  3DVM A;  1KQM B;  2LVI A;  4JPZ B;  5HKY A;  1SY9 A;  3SG6 A;  5AEQ A;  1SPY A;  1PUL A;  1A2X A;  2SCP A;  5ER4 X;  1C7V A;  4AOM A;  1TN4 A;  2L5X B;  4YGE B;  1AUI B;  1IGV A;  2L51 A;  2OTG C;  1G4Y R;  4ETO A;  3K21 A;  4Q04 A;  2K0J A;  2FCE A;  3I5G B;  4YGC B;  1K93 D;  1NPQ A;  1YX7 A;  2LMU A;  1YUU A;  3I5H B;  1M39 A;  4AQJ A;  3VRQ A;  3FS7 A;  1LXF C;  3BOW A;  1PRW A;  1YRU B;  2JTT A;  1UUR A;  1R2U A;  1G33 A;  3LLE A;  1ALW A;  2FCD A;  2WOR A;  1TTX A;  4P5O E;  2KI4 C;  3IF7 A;  4P2Y B;  4NDC A;  4I5J A;  4YGD B;  3CR4 X;  4MN0 A;  1CMF A;  2KSP A;  1MQ1 A;  1K95 A;  3FWC A;  3MSE B;  1REC A;  2M97 A;  1CFF A;  1BU3 A;  1J1D A;  2V53 A;  1OOJ A;  1JSA A;  2KGB C;  1CDL A;  3TDI A;  3TUY C;  2JC2 A;  3TDU A;  2KQ6 A;  2BCX A;  2BE4 A;  2QPT A;  1DMO A;  4CPV A;  1CDM A;  1QV1 A;  4GUK A;  1WY9 A;  3SG7 A;  2Y1N A;  1GGW A;  3EVR A;  5JJG A;  1SKT A;  2MA2 A;  2OS8 B;  5BPJ A;  1XFV O;  1S5G Z;  1X02 A;  1KFU L;  1KSO A;  3CZT X;  4PAL A;  1E8A A;  2KOT A;  3I5I C;  4C0L A;  3KHE A;  2M8U A;  2K8M B;  3ICB A;  1SL8 A;  1W7J B;  1PSR A;  1K96 A;  2M1K B;  2PAL A;  5D69 A;  1DGV A;  1B8R A;  1XFW O;  2LLU A;  3D0Y A;  1WRZ A;  3F45 A;  4HSZ A;  3BUX B;  1ZOT B;  1FI5 A;  1GGZ A;  4FQO A;  5CSJ A;  3JVT B;  3AAK A;  3PFV A;  1BJF A;  2JT8 A;  3GOF A;  1SL7 A;  2WND A;  1NUB A;  1JWD A;  1BR1 B;  2GGM A;  3D10 A;  1J7P A;  5AFP A;  4NQG A;  3VRO A;  1UWO A;  1CDN A;  1CFD A;  1A03 A;  4A4B A;  2KBM A;  1IJ6 A;  3DVK A;  1QTX A;  3O6B A;  4N1F A;  4XJK A;  4YGB B;  2M7L A;  1SCM B;  2KBI A;  2EC6 C;  4R1E A;  1KK7 Z;  2OS8 C;  3AKB A;  5CSF A;  2BKH B;  2SAS A;  5I2L A;  1QLS A;  1J55 A;  1CFC A;  1Y6W A;  4HRH A;  2K2A A;  1SMG A;  3I5F C;  2WCF A;  2MHH A;  1KCY A;  2ZNE A;  1M46 A;  4I5N B;  4ZCV A;  4YGA A;  3NSL A;  2KYF A;  5PAL A;  1W7I B;  3EKJ A;  4GBA A;  2HF5 A;  1B1G A;  2KGR A;  1EG4 A;  2F2O A;  1K94 A;  2KAX A;  3CTN A;  3DF0 A;  5AAN A;  1RK9 A;  1WLZ A;  1WLM A;  5AXI A;  3TS5 B;  1NX3 A;  2BCA A;  2WC8 A;  2LM5 A;  1TNW A;  1QLK A;  1WDC C;  1F70 A;  1XFX O;  1YUR A;  1EL4 A;  2KQY A;  5KU1 A;  1V1F A;  3NSI A;  3DVJ A;  2KFH A;  2P6B B;  3BUO B;  1L2O B;  1ODB A;  1FW4 A;  2M29 A;  1MXE A;  3PAT A;  1BT6 A;  4USL A;  1KFX S;  2M1U A;  3PN7 B;  2R2I A;  3SJS A;  1DT7 B;  1K9P A;  3NXA A;  3HCM A;  3LK0 A;  4MBE A;  1SW8 A;  5JOL A;  4YRU A;  3AKA A;  1NCZ A;  1F55 A;  2NCP A;  4MEW A;  4F0Z B;  3LK1 A;  2PSR A;  2LLS A;  2M0R A;  1U5I B;  2H61 A;  1S5G Y;  2NLN A;  2FOT A;  4CFQ A;  2NZ0 A;  1TCF A;  5IBW A;  2LCP A;  2BL0 C;  1F4O A;  1XA5 A;  1EH2 A;  1UHJ A;  1B7T Z;  2Y1M A;  3OX6 A;  1OMV A;  2I7A A;  1A75 B;  3H4S E;  4DRW A;  1Y1A A;  2CXJ A;  2MBX A;  1DJY A;  2KFG A;  1BLQ A;  4GAO A;  1GQM A;  2QAC A;  1JFK A;  1EG3 A;  1PAL A;  1QAS A;  2NCO A;  2LUC A;  2TN4 A;  1KWO C;  2F8P A;  3WXA A;  2VRG A;  1IJ5 A;  1RJV A;  2KHN A;  2LVK A;  3FIA A;  1IWQ A;  5D7F A;  1HQV A;  1XO5 A;  1IRJ A;  1NP8 A;  3KPX A;  2LHL A;  2EHB A;  2F2P A;  3JTD C;  4XJK B;  1SCV A;  1LVC D;  2F33 A;  4MVF A;  1KQM C;  3WHT B;  2BKI B;  1HT9 A;  1OMR A;  1KQV A;  1R6P A;  3OHM B;  1DJH A;  1OSA A;  2A4J A;  2LVJ A;  1V1G A;  2M9G A;  2JU0 A;  1KK7 Y;  1F71 A;  1DVI A;  1H8B A;  3OB1 B;  4PE0 A;  2WOS A;  4ORB B;  3CR5 X;  5HLV A;  1H4B A;  3I5G C;  3OP0 A;  3I5H C;  4PHJ A;  5HYD A;  1PK0 D;  1QS7 A;  1Y0V H;  4N1G A;  1YVH A;  3O4Y A;  2DOQ A;  1DJG A;  1NWD A;  1TRF A;  4I5L B;  1TNP A;  4MLW A;  1S6C A;  2HPS A;  2Q4U A;  1AP4 A;  1RWY A;  2ISD A;  1C07 A;  1DJI A;  1QX7 A;  1NCX A;  3O78 A;  3KO0 A;  3CGA A;  1N2D A;  2LV7 A;  1YX8 A;  1ZMZ A;  1NSH A;  4OV2 A;  1XFU O;  1CM1 A;  3TZ1 A;  2MRD A;  4DIR A;  1IQ3 A;  1S1E A;  1BOD A;  2AUC A;  4PHK A;  2M3W A;  1UHI A;  4GGN A;  4HRG A;  4MRY A;  4MZJ A;  2LUX A;  1JC2 A;  1MR8 A;  5HKZ A;  2BBN A;  1VRK A;  1ALV A;  2JRF A;  1S6J A;  2O5G A;  1MF8 B;  5KTY A;  1DTL A;  1A4P A;  1NX0 A;  4CFR A;  1KK8 B;  3DD4 A;  4OVN F;  3SIA A;  1SR6 B;  1SYM A;  1TIZ A;  2JXL A;  4GGF C;  2L2E A;  1UHH A;  3TDZ A;  1QX2 A;  4PHM A;  4PDZ A;  1IQ5 A;  4GFT A;  4PHN A;  2L4H A;  1DF0 A;  2ZN8 A;  4QJ3 B;  1QVI Z;  3EK7 A;  1L7Z A;  1BR4 B;  4XYN A;  3PLF B;  3EKH A;  3JVT C;  1S6I A;  3LCP C;  2ZRS A;  4PE7 A;  4MSP A;  3KF9 A;  4BY5 A;  1J7O A;  1UP5 A;  2AAO A;  2JT3 A;  1MWN A;  3RM1 A;  5TNC A;  5CSN A;  3VGO A;  1M63 B;  1Q80 A;  1S3P A;  2WCE A;  1XK4 C;  1CTR A;  5AER A;  1CKK A;  2ZRT A;  1IH0 A;  2I2R E;  1IKU A;  2BBM A;  3BOW B;  3WHU B;  2JNF A;  3E3R A;  4JWQ A;  2GGZ A;  2PAS A;  2JPT A;  3SG5 A;  1DJW A;  3O2P A;  1IG5 A;  1YTZ C;  1SCM C;  4YI8 A;  2MLE C;  1LA0 A;  1PVA A;  1SNL A;  1NX2 A;  2O60 A;  1B8C A;  1K2H A;  1XFZ O;  4L9M A;  3BQ3 A;  1SK6 D;  4WQ2 A;  5I2O A;  1KSM A;  1UHK A;  4C0J A;  4D1E A;  2HQW A;  2HET A;  2JUL A;  2NXQ A;  2Q91 A;  1MXL C;  3AAJ A;  5HLO A;  1EXR A;  2CCM A;  2KI6 C;  1B9A A;  4HRE E;  2K2F A;  3ZNI A;  2OTG B;  4NDB A;  1J7Q A;  1J1E A;  2KAY A;  2ZFD A;  1Y1U A;  2GV5 A;  1DJX A;  3NSK A;  1XVJ A;  2M49 B;  4GPL B;  1QIV A;  4PE1 A;  2LVV A;  1OZS A;  1BOC A;  1KFU S;  4YI9 A;  3TS5 C;  1FPW A;  1PVB A;  3BUM B;  3ZWH A;  1C7W A;  4GNK B;  2B1U A;  2JT0 A;  1CLB A;  3BUW B;  2KNE A;  1GJY A;  2AMI A;  1NYA A;  1S36 A;  2L0P A;  2MJW B;  2KI4 B;  2PMY A;  3CS1 A;  3D0Y B;  2I94 A;  1XYD A;  2KDH A;  4JQ0 D;  1Y1X A;  2K7O A;  1NX1 A;  2MLF C;  3A4U B;  1L2O C;  4M2Q A;  1LIN A;  1CLM A;  2K7B A;  2BCB A;  4I5K A;  3PSR A;  3C1V A;  3PN7 C;  3A8R A;  4N5X A;  2E6W A;  1TOP A;  1B47 A;  3SIB A;  2LP3 A;  4MZK A;  4ICB A;  1YUS A;  2JOJ A;  3I5I B;  4OCI A;  4PCW A;  3NSO A;  5I2Q A;  3QRX A;  1CM4 A;  1AVS A;  1K9U A;  4YBH B;  4ORA B;  2CNP A;  2I18 A;  1CDP A;  2ZN9 A;  3M0W A;  1K90 D;  1NCY A;  3WNX B;  1BF5 A;  4ORC B;  3GK4 X;  1JF0 A;  1QX5 B;  1ZFS A;  1ZUZ A;  2EGD A;  1KFX L;  1DF0 B;  2KI6 D;  2KYC A;  4OKH A;  2LC5 A;  4E68 A;  2LMT A;  4MRX A;  1YR5 A;  2H2K A;  2JXC A;  2L4I A;  2BE6 A;  1F8H A;  1LA3 A;  2LAN A;  1YVL A;  1QVI Y;  4DUQ A;  1SBJ A;  3DF0 B;  3FWB A;  1PSB A;  4DS7 A;  3SG2 A;  2PVB A;  2CTN A;  3KEV A;  1JBA A;  2D8N A;  2PRU A;  1BG1 A;  1CNP A;  2EC6 B;  1RTP 1;  1QAT A;  2LE9 B;  1F4Q A;  1SL9 A;  1QIW A;  2M7N A;  5B8I B;  1FI6 A;  1U5I A;  1B8L A;  3I5F B;  2F3Z A;  2JZI A;  1K8U A;  4ZCU A;  1TCO B;  1TNQ A; 
#chains in the Genus database with same CATH topology
 2LHI A;  1AJ4 A;  2IS9 A;  5GQQ C;  5DKR A;  4CID A;  1OZO A;  1WRK A;  1ZAC A;  3NHI A;  1YRT B;  3S0B A;  3CDN A;  2JTZ A;  1DGU A;  3EK4 A;  1CFP A;  1A75 A;  1JF2 A;  4CLN A;  4C0K A;  1QJT A;  3EVV A;  3GK2 A;  4UPG A;  4FTG A;  5CSI A;  3IQO A;  1QXP A;  3BYA A;  3FE8 A;  1DJZ A;  1AJ5 A;  4AQI A;  3LL8 B;  3IQQ A;  4DCK A;  3R1P A;  4KYN A;  5I8N A;  1D1O A;  1WDC B;  1TNX A;  1UHN A;  2JQ6 A;  3SG4 A;  1F54 A;  3PAL A;  3BXK A;  1AHR A;  5D3O A;  4A4C A;  2CT9 A;  1AK8 A;  2E30 A;  1EJ3 A;  3CWG A;  1OMD A;  2PQL A;  4WQ3 A;  5FYX A;  1M45 A;  3VRN A;  4INW A;  2G9B A;  2Y4Q A;  3CLN A;  5DKN A;  2LAP A;  2KAV A;  2JNX A;  2L2C A;  1IIO A;  3CR2 A;  3GK1 A;  4M2P A;  3SG3 A;  1BMO A;  1OE9 B;  3BUN B;  1N0Y A;  3D74 A;  2BEC A;  3OX5 A;  4PE4 A;  5KSZ A;  4GGF A;  1J7R A;  1FBV A;  1B7T Y;  1YUT A;  5ER5 A;  1KK8 C;  1UUS A;  2L98 A;  2LMV A;  2RGI A;  1MUX A;  4NDD A;  4U8D A;  1G8I A;  2LNK A;  3S0D A;  4QJ4 B;  1SR6 C;  1CLL A;  1NIW A;  1SRA A;  2HQ8 A;  1MHO A;  4WRI A;  1XFY O;  2ZKM X;  3HX4 A;  5G08 A;  3RZS A;  2MAZ A;  2K7D A;  3OB2 B;  2CBL A;  3R1O A;  4BY4 A;  3NHT A;  3IVT A;  2L50 A;  4OR9 B;  4OZD A;  1JUO A;  1JFJ A;  4MZL A;  1RFJ A;  4TNC A;  4M2O A;  5K89 A;  1CMG A;  2BL0 B;  1CB1 A;  3VRR A;  5J3X A;  1B4C A;  1XK4 A;  2ZND A;  3DVE A;  1LKJ A;  2H61 C;  4QJ5 B;  2K61 A;  4IJ7 A;  2LP2 A;  3L4L A;  2OPO A;  3EK8 A;  2G2B A;  2LLT A;  3EVU A;  1M31 A;  1N65 A;  2WCB A;  1KWO B;  4IL1 A;  5DKQ A;  5F6T A;  5CPV A;  1K9K A;  1A29 A;  2F3Y A;  2KPH A;  2Y5I A;  2K7C A;  3CS1 A;  3VRP A;  1FF1 A;  1QV0 A;  1ORG A;  2KFF A;  5HKW A;  1OQP A;  2COL B;  2FJU B;  2JWW A;  1WRL A;  3JTD B;  3PM8 A;  3TUY B;  1RRO A;  3RLZ A;  1S26 D;  3DVM A;  1KQM B;  2LVI A;  3DYE A;  4JPZ B;  3BFB A;  1SY9 A;  5HKY A;  4FQT A;  3D75 A;  3SG6 A;  5AEQ A;  3SS3 A;  1SPY A;  1PUL A;  1A2X A;  2SCP A;  5ER4 X;  1C7V A;  4AOM A;  1TN4 A;  2L5X B;  4YGE B;  1AUI B;  1IGV A;  2L51 A;  2OTG C;  3EG5 B;  1G4Y R;  4ETO A;  3K21 A;  4Q04 A;  2K0J A;  2FCE A;  3I5G B;  4YGC B;  1K93 D;  1NPQ A;  1YX7 A;  1Z2C B;  1YUU A;  2LMU A;  1M39 A;  3I5H B;  4AQJ A;  1DC1 A;  3VRQ A;  3FS7 A;  1LXF C;  3BOW A;  2L5Y A;  1PRW A;  3S0E A;  1YRU B;  2JTT A;  1UUR A;  1R2U A;  1G33 A;  3LLE A;  1ALW A;  3L47 A;  2FCD A;  2WOR A;  1TTX A;  4P5O E;  3OBV A;  2KI4 C;  3IF7 A;  4P2Y B;  4NDC A;  4I5J A;  4YGD B;  3CR4 X;  4MN0 A;  1CMF A;  2KSP A;  1MQ1 A;  1K95 A;  3FWC A;  3MSE B;  1REC A;  2M97 A;  2QEV A;  1CFF A;  1BU3 A;  1J1D A;  2V53 A;  1OOJ A;  1JSA A;  2KGB C;  1CDL A;  3TDI A;  3TUY C;  2JC2 A;  3TDU A;  2KQ6 A;  2BCX A;  2BE4 A;  2QPT A;  1DMO A;  3CZ2 A;  4CPV A;  1CDM A;  1QV1 A;  4GUK A;  1WY9 A;  3SG7 A;  2Y1N A;  1GGW A;  3EVR A;  5JJG A;  1SKT A;  2MA2 A;  2OS8 B;  3DZT A;  5BPJ A;  1XFV O;  1S5G Z;  3CZ1 A;  1X02 A;  1KFU L;  1KSO A;  3CZT X;  4PAL A;  1E8A A;  2KOT A;  3I5I C;  4C0L A;  3KHE A;  2M8U A;  2K8M B;  3ICB A;  1SL8 A;  1W7J B;  1PSR A;  1K96 A;  2M1K B;  2PAL A;  5D69 A;  1DGV A;  1B8R A;  1XFW O;  2LLU A;  3D0Y A;  3D73 A;  1WRZ A;  3F45 A;  4HSZ A;  1GM0 A;  3BUX B;  1ZOT B;  1FI5 A;  3BFH A;  1GGZ A;  4FQO A;  5CSJ A;  3JVT B;  3VB1 A;  3AAK A;  3PFV A;  1BJF A;  2H8V A;  2JT8 A;  5DIC A;  3GOF A;  1SL7 A;  5FI7 A;  2WND A;  1NUB A;  1JWD A;  1BR1 B;  2GGM A;  3D10 A;  1J7P A;  5AFP A;  4NQG A;  3VRO A;  1UWO A;  1CDN A;  1CFD A;  1A03 A;  4A4B A;  2KBM A;  1IJ6 A;  3DVK A;  1QTX A;  1W9Z A;  3O6B A;  4N1F A;  4XJK A;  4YGB B;  1SCM B;  2M7L A;  2KBI A;  3DXL A;  2EC6 C;  4R1E A;  1KK7 Z;  2OS8 C;  2WCH A;  3AKB A;  3L4A A;  5CSF A;  2BKH B;  2SAS A;  5I2L A;  1QLS A;  1J55 A;  1CFC A;  1Y6W A;  4HRH A;  2K2A A;  1SMG A;  3I5F C;  2WCF A;  2MHH A;  1KCY A;  2ZNE A;  2QDI A;  1M46 A;  3CAB A;  4I5N B;  4ZCV A;  1DQE A;  4YGA A;  3NSL A;  2KYF A;  5PAL A;  1W7I B;  2P71 A;  3D77 A;  3EKJ A;  4GBA A;  2HF5 A;  1B1G A;  2KGR A;  1EG4 A;  2F2O A;  1K94 A;  2KAX A;  3CYZ A;  2KLE A;  3CTN A;  3DF0 A;  5AAN A;  1RK9 A;  1WLZ A;  1WLM A;  2WCL A;  5AXI A;  3TS5 B;  1NX3 A;  2BCA A;  2WC8 A;  2LM5 A;  1TNW A;  1QLK A;  1WDC C;  1F70 A;  1XFX O;  1YUR A;  1OW4 A;  1EL4 A;  2KQY A;  5KU1 A;  1V1F A;  3NSI A;  3DVJ A;  2KFH A;  2P6B B;  3BUO B;  1L2O B;  1ODB A;  1FW4 A;  2M29 A;  1MXE A;  3PAT A;  1BT6 A;  3UO9 A;  4USL A;  1KFX S;  2M1U A;  3PN7 B;  2R2I A;  3SJS A;  1OOI X;  1DT7 B;  1K9P A;  3NXA A;  3S0A A;  3HCM A;  3LK0 A;  4MBE A;  1SW8 A;  5JOL A;  4YRU A;  3AKA A;  1NCZ A;  1F55 A;  2NCP A;  1DEK A;  4MEW A;  2QEB A;  1C3Y A;  3B6X A;  4F0Z B;  3LK1 A;  2PSR A;  2LLS A;  3D78 A;  4F7F A;  4JKT A;  2M0R A;  1U5I B;  2H61 A;  5EL2 A;  1S5G Y;  2NLN A;  2FOT A;  1P28 A;  4CFQ A;  2NZ0 A;  1TCF A;  5IBW A;  2LCP A;  2BL0 C;  1F4O A;  1XA5 A;  1TUZ A;  1EH2 A;  1UHJ A;  1B7T Z;  2Y1M A;  3OX6 A;  1OMV A;  2I7A A;  1A75 B;  3H4S E;  4DRW A;  1Y1A A;  2CXJ A;  2MBX A;  1DJY A;  2KFG A;  1BLQ A;  4GAO A;  1GQM A;  4PT1 A;  2QAC A;  1JFK A;  1EG3 A;  1PAL A;  1QAS A;  2NCO A;  3B87 A;  2LUC A;  2TN4 A;  1KWO C;  2F8P A;  3WXA A;  2VRG A;  1IJ5 A;  1RJV A;  2KHN A;  2LVK A;  3FE9 A;  3FIA A;  1IWQ A;  5D7F A;  1HQV A;  1XO5 A;  1IRJ A;  1NP8 A;  3KPX A;  2LHL A;  2EHB A;  3DY9 A;  2F2P A;  3JTD C;  4XJK B;  2GTE A;  1SCV A;  1LVC D;  2F33 A;  4MVF A;  1KQM C;  3WHT B;  1HT9 A;  2BKI B;  1OMR A;  1TWO A;  1KQV A;  1R6P A;  3OHM B;  1DJH A;  1OSA A;  2A4J A;  2LVJ A;  1V1G A;  2M9G A;  2JU0 A;  1KK7 Y;  1OOF A;  1F71 A;  1DVI A;  1H8B A;  3OB1 B;  4PE0 A;  2WOS A;  4ORB B;  2WCJ A;  3CR5 X;  5HLV A;  1H4B A;  3I5G C;  3OP0 A;  3I5H C;  4PHJ A;  5HYD A;  1PK0 D;  1QS7 A;  1Y0V H;  4N1G A;  3R72 A;  1YVH A;  3O4Y A;  2DOQ A;  1DJG A;  1NWD A;  1TRF A;  4I5L B;  1TNP A;  4MLW A;  1S6C A;  2HPS A;  2Q4U A;  1AP4 A;  1RWY A;  2ISD A;  1C07 A;  1DJI A;  1QX7 A;  1NCX A;  3O78 A;  3KO0 A;  3CGA A;  1N2D A;  2LV7 A;  1YX8 A;  1ZMZ A;  1NSH A;  4OV2 A;  1XFU O;  1CM1 A;  5I94 A;  3TZ1 A;  2MRD A;  2WCM A;  4DIR A;  1IQ3 A;  3S0G A;  1S1E A;  1BOD A;  2AUC A;  4PHK A;  2M3W A;  1UHI A;  4GGN A;  4HRG A;  4MRY A;  4MZJ A;  1OOG A;  2LUX A;  1JC2 A;  1MR8 A;  5HKZ A;  2BBN A;  1VRK A;  1ALV A;  2JRF A;  4JD9 A;  1S6J A;  2O5G A;  1MF8 B;  5KTY A;  1DTL A;  1A4P A;  1NX0 A;  3B86 A;  1KK8 B;  3DD4 A;  4CFR A;  4OVN F;  3SIA A;  1SR6 B;  1SYM A;  1TIZ A;  2JXL A;  3CZ0 A;  4GGF C;  2L2E A;  1UHH A;  3TDZ A;  1QX2 A;  4PHM A;  4PDZ A;  1IQ5 A;  4GFT A;  4PHN A;  2L4H A;  1DF0 A;  2ZN8 A;  1Z4H A;  1LS8 A;  1QVI Z;  3EK7 A;  4QJ3 B;  1L7Z A;  1BR4 B;  4XYN A;  3PLF B;  3EKH A;  3JVT C;  1S6I A;  3LCP C;  3N7H A;  2ZRS A;  4PE7 A;  4MSP A;  3KF9 A;  4BY5 A;  1J7O A;  1UP5 A;  1DEL A;  2AAO A;  2JT3 A;  1MWN A;  1C3Z A;  5TNC A;  5CSN A;  3RM1 A;  2ERB A;  3VGO A;  3B7A A;  3V2L A;  1M63 B;  3FE6 A;  2P70 A;  1Q80 A;  1S3P A;  2WCE A;  1XK4 C;  1CTR A;  5AER A;  1CKK A;  2ZRT A;  1IH0 A;  2I2R E;  1IKU A;  2BBM A;  3BOW B;  3WHU B;  2JNF A;  3E3R A;  3O4X A;  2GGZ A;  4JWQ A;  2PAS A;  2FJY A;  2JPT A;  2YGU A;  1DJW A;  3O2P A;  3SG5 A;  1IG5 A;  1YTZ C;  3UNW A;  1SCM C;  4YI8 A;  2MLE C;  1LA0 A;  1PVA A;  1SNL A;  1NX2 A;  2O60 A;  2QEH A;  1B8C A;  1K2H A;  1XFZ O;  4L9M A;  3BQ3 A;  1SK6 D;  4WQ2 A;  5I2O A;  1KSM A;  1UHK A;  4C0J A;  4D1E A;  2HQW A;  1XFR A;  2HET A;  2JUL A;  2NXQ A;  2Q91 A;  1MXL C;  3AAJ A;  2WC6 A;  5HLO A;  1EXR A;  4INX A;  2CCM A;  2KI6 C;  1TUJ A;  1B9A A;  4HRE E;  2K2F A;  3ZNI A;  2OTG B;  4NDB A;  3OGN A;  1J7Q A;  1J1E A;  2KAY A;  2ZFD A;  1Y1U A;  2GV5 A;  1DJX A;  3NSK A;  1XVJ A;  2M49 B;  4GPL B;  1QIV A;  4PE1 A;  2LVV A;  1OZS A;  1BOC A;  1KFU S;  4YI9 A;  3TS5 C;  1FPW A;  1PVB A;  3BUM B;  3ZWH A;  1C7W A;  4GNK B;  2B1U A;  2JT0 A;  1CLB A;  3BUW B;  2KNE A;  1GJY A;  2AMI A;  1NYA A;  1S36 A;  2L0P A;  2MJW B;  2KI4 B;  2PMY A;  2PYQ A;  2K60 A;  2I94 A;  1XYD A;  2KDH A;  3D0Y B;  4JQ0 D;  1Y1X A;  2K7O A;  1T14 A;  3D76 A;  2WCK A;  1NX1 A;  2MLF C;  3A4U B;  1L2O C;  1SSE B;  4M2Q A;  1LIN A;  1CLM A;  2K7B A;  2BCB A;  5HL1 A;  2JPO A;  4I5K A;  3PSR A;  5FI6 A;  3C1V A;  2WC5 A;  3Q8I A;  3PN7 C;  3A8R A;  4N5X A;  3S0F A;  2E6W A;  3SS4 A;  1TOP A;  1B47 A;  3SIB A;  2LP3 A;  4MZK A;  4ICB A;  3R1V A;  1YUS A;  2JOJ A;  3I5I B;  4OCI A;  4PCW A;  3NSO A;  3BFA A;  5I2Q A;  3QRX A;  1CM4 A;  2KLD A;  1AVS A;  1K9U A;  4YBH B;  5FI2 A;  4ORA B;  3PJI A;  2CNP A;  2I18 A;  1CDP A;  2ZN9 A;  3M0W A;  1K90 D;  1NCY A;  3SS5 A;  3WNX B;  1BF5 A;  3B88 A;  2BAP A;  4ORC B;  3GK4 X;  1JF0 A;  1QX5 B;  1ZFS A;  1ZUZ A;  2EGD A;  1KFX L;  1DF0 B;  2KI6 D;  2KYC A;  3NGV A;  2LC5 A;  4OKH A;  2LMT A;  4MRX A;  4E68 A;  1YR5 A;  2QEO A;  1OOH A;  2H2K A;  2JXC A;  2L4I A;  2BE6 A;  1F8H A;  1LA3 A;  2LAN A;  1YVL A;  1QVI Y;  4DUQ A;  3BJH A;  1SBJ A;  3DF0 B;  3FWB A;  1PSB A;  4DS7 A;  3SG2 A;  2PVB A;  2CTN A;  3KEV A;  1JBA A;  2D8N A;  2PRU A;  1BG1 A;  3PM2 A;  1CNP A;  2EC6 B;  1RTP 1;  1QAT A;  2LE9 B;  1QWV A;  1F4Q A;  1SL9 A;  1QIW A;  3QME A;  2M7N A;  5B8I B;  1FI6 A;  2BNX A;  1U5I A;  1B8L A;  3I5F B;  2F3Z A;  3K1E A;  2JZI A;  1K8U A;  4ZCU A;  1TCO B;  1TNQ A; 
#chains in the Genus database with same CATH homology
 2LHI A;  1AJ4 A;  2IS9 A;  5GQQ C;  5DKR A;  4CID A;  1OZO A;  1WRK A;  1ZAC A;  1YRT B;  2JTZ A;  1DGU A;  3EK4 A;  1CFP A;  1A75 A;  1JF2 A;  4CLN A;  4C0K A;  1QJT A;  3EVV A;  3GK2 A;  4UPG A;  4FTG A;  5CSI A;  3IQO A;  1QXP A;  3BYA A;  1DJZ A;  1AJ5 A;  4AQI A;  3LL8 B;  3IQQ A;  4DCK A;  5I8N A;  1D1O A;  1WDC B;  1TNX A;  1UHN A;  2JQ6 A;  3SG4 A;  1F54 A;  3PAL A;  3BXK A;  1AHR A;  4A4C A;  2CT9 A;  1AK8 A;  2E30 A;  1EJ3 A;  3CWG A;  1OMD A;  4WQ3 A;  5FYX A;  1M45 A;  3VRN A;  2G9B A;  2Y4Q A;  3CLN A;  5DKN A;  2LAP A;  2KAV A;  2JNX A;  3CR2 A;  3GK1 A;  4M2P A;  3SG3 A;  1BMO A;  1OE9 B;  3BUN B;  1N0Y A;  2BEC A;  3OX5 A;  4PE4 A;  5KSZ A;  4GGF A;  1J7R A;  1FBV A;  1B7T Y;  1YUT A;  5ER5 A;  1KK8 C;  1UUS A;  2L98 A;  2LMV A;  2RGI A;  1MUX A;  4NDD A;  4U8D A;  1G8I A;  2LNK A;  4QJ4 B;  1SR6 C;  1CLL A;  1NIW A;  1SRA A;  2HQ8 A;  1MHO A;  4WRI A;  1XFY O;  2ZKM X;  3HX4 A;  5G08 A;  2MAZ A;  2K7D A;  3OB2 B;  2CBL A;  4BY4 A;  4OR9 B;  2L50 A;  1JUO A;  1JFJ A;  4MZL A;  1RFJ A;  4TNC A;  4M2O A;  5K89 A;  1CMG A;  2BL0 B;  1CB1 A;  3VRR A;  5J3X A;  1B4C A;  1XK4 A;  2ZND A;  3DVE A;  1LKJ A;  2H61 C;  4QJ5 B;  2K61 A;  2LP2 A;  2OPO A;  3EK8 A;  2G2B A;  2LLT A;  3EVU A;  1M31 A;  1N65 A;  2WCB A;  1KWO B;  4IL1 A;  5DKQ A;  5F6T A;  5CPV A;  1K9K A;  1A29 A;  2F3Y A;  2Y5I A;  2K7C A;  3VRP A;  1FF1 A;  1QV0 A;  2KFF A;  5HKW A;  1OQP A;  2COL B;  2FJU B;  2JWW A;  1WRL A;  3JTD B;  3PM8 A;  3TUY B;  1RRO A;  3RLZ A;  1S26 D;  3DVM A;  1KQM B;  2LVI A;  4JPZ B;  5HKY A;  1SY9 A;  3SG6 A;  5AEQ A;  1SPY A;  1PUL A;  1A2X A;  2SCP A;  5ER4 X;  1C7V A;  4AOM A;  1TN4 A;  2L5X B;  4YGE B;  1AUI B;  1IGV A;  2L51 A;  2OTG C;  1G4Y R;  4ETO A;  3K21 A;  4Q04 A;  2K0J A;  2FCE A;  3I5G B;  4YGC B;  1K93 D;  1NPQ A;  1YX7 A;  2LMU A;  1YUU A;  3I5H B;  1M39 A;  4AQJ A;  3VRQ A;  3FS7 A;  1LXF C;  3BOW A;  1PRW A;  1YRU B;  2JTT A;  1UUR A;  1R2U A;  1G33 A;  3LLE A;  1ALW A;  2FCD A;  2WOR A;  1TTX A;  4P5O E;  2KI4 C;  3IF7 A;  4P2Y B;  4NDC A;  4I5J A;  4YGD B;  3CR4 X;  4MN0 A;  1CMF A;  2KSP A;  1MQ1 A;  1K95 A;  3FWC A;  3MSE B;  1REC A;  2M97 A;  1CFF A;  1BU3 A;  1J1D A;  2V53 A;  1OOJ A;  1JSA A;  2KGB C;  1CDL A;  3TDI A;  3TUY C;  2JC2 A;  3TDU A;  2KQ6 A;  2BCX A;  2BE4 A;  2QPT A;  1DMO A;  4CPV A;  1CDM A;  1QV1 A;  4GUK A;  1WY9 A;  3SG7 A;  2Y1N A;  1GGW A;  3EVR A;  5JJG A;  1SKT A;  2MA2 A;  2OS8 B;  5BPJ A;  1XFV O;  1S5G Z;  1X02 A;  1KFU L;  1KSO A;  3CZT X;  4PAL A;  1E8A A;  2KOT A;  3I5I C;  4C0L A;  3KHE A;  2M8U A;  2K8M B;  3ICB A;  1SL8 A;  1W7J B;  1PSR A;  1K96 A;  2M1K B;  2PAL A;  5D69 A;  1DGV A;  1B8R A;  1XFW O;  2LLU A;  3D0Y A;  1WRZ A;  3F45 A;  4HSZ A;  3BUX B;  1ZOT B;  1FI5 A;  1GGZ A;  4FQO A;  5CSJ A;  3JVT B;  3AAK A;  3PFV A;  1BJF A;  2JT8 A;  3GOF A;  1SL7 A;  2WND A;  1NUB A;  1JWD A;  1BR1 B;  2GGM A;  3D10 A;  1J7P A;  5AFP A;  4NQG A;  3VRO A;  1UWO A;  1CDN A;  1CFD A;  1A03 A;  4A4B A;  2KBM A;  1IJ6 A;  3DVK A;  1QTX A;  3O6B A;  4N1F A;  4XJK A;  4YGB B;  2M7L A;  1SCM B;  2KBI A;  2EC6 C;  4R1E A;  1KK7 Z;  2OS8 C;  3AKB A;  5CSF A;  2BKH B;  2SAS A;  5I2L A;  1QLS A;  1J55 A;  1CFC A;  1Y6W A;  4HRH A;  2K2A A;  1SMG A;  3I5F C;  2WCF A;  2MHH A;  1KCY A;  2ZNE A;  1M46 A;  4I5N B;  4ZCV A;  4YGA A;  3NSL A;  2KYF A;  5PAL A;  1W7I B;  3EKJ A;  4GBA A;  2HF5 A;  1B1G A;  2KGR A;  1EG4 A;  2F2O A;  1K94 A;  2KAX A;  3CTN A;  3DF0 A;  5AAN A;  1RK9 A;  1WLZ A;  1WLM A;  5AXI A;  3TS5 B;  1NX3 A;  2BCA A;  2WC8 A;  2LM5 A;  1TNW A;  1QLK A;  1WDC C;  1F70 A;  1XFX O;  1YUR A;  1EL4 A;  2KQY A;  5KU1 A;  1V1F A;  3NSI A;  3DVJ A;  2KFH A;  2P6B B;  3BUO B;  1L2O B;  1ODB A;  1FW4 A;  2M29 A;  1MXE A;  3PAT A;  1BT6 A;  4USL A;  1KFX S;  2M1U A;  3PN7 B;  2R2I A;  3SJS A;  1DT7 B;  1K9P A;  3NXA A;  3HCM A;  3LK0 A;  4MBE A;  1SW8 A;  5JOL A;  4YRU A;  3AKA A;  1NCZ A;  1F55 A;  2NCP A;  4MEW A;  4F0Z B;  3LK1 A;  2PSR A;  2LLS A;  2M0R A;  1U5I B;  2H61 A;  1S5G Y;  2NLN A;  2FOT A;  4CFQ A;  2NZ0 A;  1TCF A;  5IBW A;  2LCP A;  2BL0 C;  1F4O A;  1XA5 A;  1EH2 A;  1UHJ A;  1B7T Z;  2Y1M A;  3OX6 A;  1OMV A;  2I7A A;  1A75 B;  3H4S E;  4DRW A;  1Y1A A;  2CXJ A;  2MBX A;  1DJY A;  2KFG A;  1BLQ A;  4GAO A;  1GQM A;  2QAC A;  1JFK A;  1EG3 A;  1PAL A;  1QAS A;  2NCO A;  2LUC A;  2TN4 A;  1KWO C;  2F8P A;  3WXA A;  2VRG A;  1IJ5 A;  1RJV A;  2KHN A;  2LVK A;  3FIA A;  1IWQ A;  5D7F A;  1HQV A;  1XO5 A;  1IRJ A;  1NP8 A;  3KPX A;  2LHL A;  2EHB A;  2F2P A;  3JTD C;  4XJK B;  1SCV A;  1LVC D;  2F33 A;  4MVF A;  1KQM C;  3WHT B;  2BKI B;  1HT9 A;  1OMR A;  1KQV A;  1R6P A;  3OHM B;  1DJH A;  1OSA A;  2A4J A;  2LVJ A;  1V1G A;  2M9G A;  2JU0 A;  1KK7 Y;  1F71 A;  1DVI A;  1H8B A;  3OB1 B;  4PE0 A;  2WOS A;  4ORB B;  3CR5 X;  5HLV A;  1H4B A;  3I5G C;  3OP0 A;  3I5H C;  4PHJ A;  5HYD A;  1PK0 D;  1QS7 A;  1Y0V H;  4N1G A;  1YVH A;  3O4Y A;  2DOQ A;  1DJG A;  1NWD A;  1TRF A;  4I5L B;  1TNP A;  4MLW A;  1S6C A;  2HPS A;  2Q4U A;  1AP4 A;  1RWY A;  2ISD A;  1C07 A;  1DJI A;  1QX7 A;  1NCX A;  3O78 A;  3KO0 A;  3CGA A;  1N2D A;  2LV7 A;  1YX8 A;  1ZMZ A;  1NSH A;  4OV2 A;  1XFU O;  1CM1 A;  3TZ1 A;  2MRD A;  4DIR A;  1IQ3 A;  1S1E A;  1BOD A;  2AUC A;  4PHK A;  2M3W A;  1UHI A;  4GGN A;  4HRG A;  4MRY A;  4MZJ A;  2LUX A;  1JC2 A;  1MR8 A;  5HKZ A;  2BBN A;  1VRK A;  1ALV A;  2JRF A;  1S6J A;  2O5G A;  1MF8 B;  5KTY A;  1DTL A;  1A4P A;  1NX0 A;  4CFR A;  1KK8 B;  3DD4 A;  4OVN F;  3SIA A;  1SR6 B;  1SYM A;  1TIZ A;  2JXL A;  4GGF C;  2L2E A;  1UHH A;  3TDZ A;  1QX2 A;  4PHM A;  4PDZ A;  1IQ5 A;  4GFT A;  4PHN A;  2L4H A;  1DF0 A;  2ZN8 A;  4QJ3 B;  1QVI Z;  3EK7 A;  1L7Z A;  1BR4 B;  4XYN A;  3PLF B;  3EKH A;  3JVT C;  1S6I A;  3LCP C;  2ZRS A;  4PE7 A;  4MSP A;  3KF9 A;  4BY5 A;  1J7O A;  1UP5 A;  2AAO A;  2JT3 A;  1MWN A;  3RM1 A;  5TNC A;  5CSN A;  3VGO A;  1M63 B;  1Q80 A;  1S3P A;  2WCE A;  1XK4 C;  1CTR A;  5AER A;  1CKK A;  2ZRT A;  1IH0 A;  2I2R E;  1IKU A;  2BBM A;  3BOW B;  3WHU B;  2JNF A;  3E3R A;  4JWQ A;  2GGZ A;  2PAS A;  2JPT A;  3SG5 A;  1DJW A;  3O2P A;  1IG5 A;  1YTZ C;  1SCM C;  4YI8 A;  2MLE C;  1LA0 A;  1PVA A;  1SNL A;  1NX2 A;  2O60 A;  1B8C A;  1K2H A;  1XFZ O;  4L9M A;  3BQ3 A;  1SK6 D;  4WQ2 A;  5I2O A;  1KSM A;  1UHK A;  4C0J A;  4D1E A;  2HQW A;  2HET A;  2JUL A;  2NXQ A;  2Q91 A;  1MXL C;  3AAJ A;  5HLO A;  1EXR A;  2CCM A;  2KI6 C;  1B9A A;  4HRE E;  2K2F A;  3ZNI A;  2OTG B;  4NDB A;  1J7Q A;  1J1E A;  2KAY A;  2ZFD A;  1Y1U A;  2GV5 A;  1DJX A;  3NSK A;  1XVJ A;  2M49 B;  4GPL B;  1QIV A;  4PE1 A;  2LVV A;  1OZS A;  1BOC A;  1KFU S;  4YI9 A;  3TS5 C;  1FPW A;  1PVB A;  3BUM B;  3ZWH A;  1C7W A;  4GNK B;  2B1U A;  2JT0 A;  1CLB A;  3BUW B;  2KNE A;  1GJY A;  2AMI A;  1NYA A;  1S36 A;  2L0P A;  2MJW B;  2KI4 B;  2PMY A;  3CS1 A;  3D0Y B;  2I94 A;  1XYD A;  2KDH A;  4JQ0 D;  1Y1X A;  2K7O A;  1NX1 A;  2MLF C;  3A4U B;  1L2O C;  4M2Q A;  1LIN A;  1CLM A;  2K7B A;  2BCB A;  4I5K A;  3PSR A;  3C1V A;  3PN7 C;  3A8R A;  4N5X A;  2E6W A;  1TOP A;  1B47 A;  3SIB A;  2LP3 A;  4MZK A;  4ICB A;  1YUS A;  2JOJ A;  3I5I B;  4OCI A;  4PCW A;  3NSO A;  5I2Q A;  3QRX A;  1CM4 A;  1AVS A;  1K9U A;  4YBH B;  4ORA B;  2CNP A;  2I18 A;  1CDP A;  2ZN9 A;  3M0W A;  1K90 D;  1NCY A;  3WNX B;  1BF5 A;  4ORC B;  3GK4 X;  1JF0 A;  1QX5 B;  1ZFS A;  1ZUZ A;  2EGD A;  1KFX L;  1DF0 B;  2KI6 D;  2KYC A;  4OKH A;  2LC5 A;  4E68 A;  2LMT A;  4MRX A;  1YR5 A;  2H2K A;  2JXC A;  2L4I A;  2BE6 A;  1F8H A;  1LA3 A;  2LAN A;  1YVL A;  1QVI Y;  4DUQ A;  1SBJ A;  3DF0 B;  3FWB A;  1PSB A;  4DS7 A;  3SG2 A;  2PVB A;  2CTN A;  3KEV A;  1JBA A;  2D8N A;  2PRU A;  1BG1 A;  1CNP A;  2EC6 B;  1RTP 1;  1QAT A;  2LE9 B;  1F4Q A;  1SL9 A;  1QIW A;  2M7N A;  5B8I B;  1FI6 A;  1U5I A;  1B8L A;  3I5F B;  2F3Z A;  2JZI A;  1K8U A;  4ZCU A;  1TCO B;  1TNQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...