4CFRA

Ca-bound s100a4 c3s, c81s, c86s and f45w mutant complexed with non- muscle myosin iia
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
94
structure length
94
Chain Sequence
ASPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSWLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSSIAMMSNEFFEGFPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN S100-A4
publication title The C-Terminal Random Coil Region Tunes the Ca2+-Binding Affinity of S100A4 Through Conformational Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ca-binding protein/motor protein
total genus 35
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4cfrA00
1IWQA 1TOPA 1MR8A 1QATA 1KQVA 4UPGA 1OMDA 1IQ5A 1PRWA 2Y1NA 2LE9B 2ZKMX 4MBEA 1SY9A 2KGRA 4ICBA 2WCEA 4GGNA 1YVHA 2BBMA 2F3YA 4AQJA 3EK7A 3EKJA 4A4BA 1NIWA 2LV7A 1Y1XA 2WCFA 4GFTA 3VRNA 1OSAA 1YUSA 2JRFA 3OB1B 1KCYA 1B8LA 1EL4A 1SPYA 1TIZA 2BBNA 2IS9A 1G33A 3DVJA 5DKQA 5PALA 1CDPA 3VGOA 3DVEA 4I5LB 1R2UA 1GGZA 1U5IA 1JFJA 3TDIA 4HRGA 2E30A 3SG7A 2KQYA 1B8RA 3IF7A 3SG3A 1UURA 1QX7A 1K9UA 1YR5A 2LP3A 5HKZA 3GOFA 1IQ3A 1KFXS 1XK4A 4PE1A 5I8NA 1K2HA 1NCXA 5BPJA 1AJ5A 3NSOA 2I94A 4TNCA 5F6TA 3EVVA 4C0LA 2LNKA 4QJ4B 2OS8C 1H8BA 1WRKA 1GQMA 1A4PA 1LXFC 1WDCB 2KI6C 2KQ6A 3DF0A 2KSPA 2A4JA 1AK8A 3WHTB 2O60A 4YRUA 2PSRA 4GBAA 1BR1B 1SR6C 1QTXA 1OQPA 1ZFSA 5JOLA 3I5HB 2BE6A 1JFKA 2F2OA 2K7DA 3DVMA 3SG4A 5CSIA 2K7BA 3GK1A 2BKHB 2KFGA 2HF5A 2M7LA 4ZCUA 5AFPA 1M39A 2NCOA 2EC6B 3BUNB 3WHUB 1OZSA 2KAYA 3HX4A 4OV2A 5HLVA 3TDUA 2KFFA 3CLNA 1RJVA 3I5FC 1JBAA 2BE4A 2KBIA 1UHNA 4N1FA 4F0ZB 1QXPA 2BECA 2HPSA 1K96A 3KF9A 2LAPA 2JT0A 5DKNA 1QLKA 4I5JA 2LCPA 2AUCA 1S6CA 2LVVA 1QVIY 1LA3A 5G08A 2LLSA 2MBXA 1AUIB 1DGUA 4P2YB 5KTYA 1FI6A 3JTDB 3A4UB 4GUKA 1LVCD 3C1VA 1IJ6A 1IKUA 1CMGA 1XFUO 3AKAA 1IG5A 2CTNA 5AXIA 1L2OC 1SCMC 2R2IA 5B8IB 4DCKA 2JT3A 3VRPA 3LCPC 1JUOA 1MWNA 1U5IB 2DOQA 4YGCB 3OHMB 5TNCA 1UHKA 1J1EA 2PALA 1RFJA 4PE0A 5CSJA 1F4OA 1RROA 4Q04A 3VRRA 3O2PA 2JC2A 1DMOA 1WLMA 3PATA 1B7TZ 4R1EA 1CFPA 1MQ1A 2PRUA 1DJGA 4HREE 3JVTC 1EXRA 3DF0B 2Y1MA 2MJWB 1BG1A 1IH0A 1YUUA 1FI5A 2BL0C 1NPQA 1TN4A 2K0JA 1J7RA 4ZCVA 2JWWA 4PDZA 2JZIA 1HQVA 3KPXA 3AAJA 2PVBA 4IL1A 4OVNF 2CCMA 1RWYA 2B1UA 2NXQA 1FPWA 3SG2A 2JNXA 3EKHA 2HQWA 1CFFA 1S5GZ 3BXKA 3BOWA 4PCWA 4AQIA 1SK6D 2RGIA 1JF2A 1SR6B 2L98A 5JJGA 1F71A 2LP2A 2LHLA 3H4SE 5FYXA 2BCXA 1UUSA 2BKIB 2PASA 4DS7A 2ZN8A 1J55A 1TNXA 2I7AA 1A03A 1S6IA 3O4YA 4A4CA 1XFVO 4GGFC 1EJ3A 2GGZA 2LUXA 1CLMA 2NCPA 1FW4A 1J7PA 1B47A 1CDLA 1NP8A 3I5FB 3D0YA 1MUXA 1AP4A 3PSRA 4GAOA 3LK0A 1DF0A 1M63B 3BUOB 2OPOA 1MXEA 4OCIA 2F33A 2H2KA 1UP5A 1S26D 2JTTA 4M2QA 2OTGC 2K61A 1B9AA 4MRXA 3BUXB 4CLNA 2WNDA 2JTZA 2ZRSA 5D69A 4FQOA 4PE4A 1BU3A 4ETOA 1Y0VH 4L9MA 1H4BA 1X02A 3QRXA 3I5IB 2F2PA 1KQMB 4MRYA 1F8HA 1QV0A 2K7OA 1XYDA 1BR4B 5DKRA 2KAXA 5HKYA 5HYDA 1JF0A 1AVSA 3TUYC 1SMGA 3NXAA 4PHMA 2L4IA 4FTGA 1M31A 1TCOB 2KGBC 2K7CA 1MF8B 3I5GC 2QACA 1CFCA 4PHJA 3CR5X 2LM5A 3CWGA 1C7VA 2JQ6A 1KFXL 2EHBA 2JXCA 4HRHA 1K9KA 2Q4UA 1B1GA 1PVAA 1MHOA 4CFRA 4MVFA 2FJUB 3BOWB 2KI4B 1OMVA 1QASA 1YRTB 4WRIA 3NSKA 2KI6D 2EGDA 1YX8A 2BL0B 3E3RA 2MRDA 1DTLA 1GJYA 3IQQA 1S5GY 3OX5A 1C7WA 1S36A 1N65A 1QIWA 1QX5B 2FCEA 2ZNEA 1NX0A 4NDBA 4M2PA 1PVBA 2HQ8A 4OR9B 1KWOB 2L2EA 1UWOA 3RLZA 2FOTA 3D0YB 3DD4A 2ZN9A 2MHHA 5K89A 1XFZO 1DF0B 1EG4A 1SCVA 2E6WA 5AERA 3VRQA 1BOCA 1W7IB 3CZTX 2MLEC 3KEVA 4BY4A 2K2AA 1AJ4A 5CSNA 1CMFA 2BCBA 2LVKA 1R6PA 3O6BA 1AHRA 1RECA 2I18A 1NWDA 1FBVA 1V1GA 2M7NA 3HCMA 3FWBA 1YX7A 4USLA 3TS5C 3VROA 1YUTA 1CNPA 1XFXO 3GK2A 4OKHA 1PALA 1L7ZA 3PN7C 3WXAA 1NX3A 2LMTA 2O5GA 1IGVA 1CTRA 3BUWB 2HETA 4D1EA 2L5XB 2BCAA 1QX2A 1YURA 3NSLA 3KHEA 4CFQA 1NX1A 1BMOA 2KYCA 1KK8C 1A75A 1QV1A 2LLTA 2ISDA 5I2OA 4WQ2A 1SL9A 2KHNA 1QS7A 2M9GA 5CPVA 4MEWA 1ODBA 1F55A 3OB2B 1OE9B 1F4QA 2GV5A 4CPVA 1Q80A 2M1UA 3CR2A 1DGVA 5ER5A 2JXLA 2H61C 1PSBA 1F70A 1WDCC 1DJYA 1CFDA 5KU1A 3D10A 3FWCA 1QJTA 1UHHA 4M2OA 1V1FA 1LA0A 3EK8A 1B8CA 4JPZB 3EVRA 4YI8A 4BY5A 2OS8B 3PLFB 2WC8A 1ZUZA 1BT6A 1K93D 2LANA 3I5HC 3DVKA 4MZLA 4XJKA 3CTNA 4YGAA 3TZ1A 2L4HA 1KFUL 3PFVA 1IRJA 3SIBA 1E8AA 1RTP1 4PHNA 1C07A 2TN4A 2KOTA 2JOJA 5HKWA 1DJXA 5D7FA 2JULA 3EK4A 3WNXB 4YGEB 2KFHA 3ICBA 4MZJA 2CNPA 1N2DA 1NUBA 2L51A 2ZNDA 4YI9A 1KSOA 3M0WA 4HSZA 1CB1A 1J1DA 1WRZA 4JQ0D 1Y1UA 4MN0A 1CDNA 1TNWA 1DJIA 2LLUA 2KNEA 2G9BA 3AKBA 3SJSA 1XO5A 3JTDC 3SG5A 2L50A 1Y1AA 1MXLC 4NQGA 1CKKA 2F3ZA 2ZRTA 1SKTA 1UHJA 2AMIA 3SIAA 1QVIZ 1QIVA 4N5XA 2LVIA 1BLQA 4MLWA 2KAVA 2V53A 2VRGA 3CGAA 1K8UA 1OZOA 1SBJA 4GGFA 4I5NB 1LKJA 2I2RE 1YRUB 1NYAA 1SYMA 4YBHB 5KSZA 1A75B 1BODA 1L2OB 1SCMB 3O78A 2M97A 2SASA 1GGWA 1XK4C 1A2XA 1WY9A 2G2BA 2M0RA 2K8MB 1B7TY 1CM1A 1NCZA 2M1KB 4GPLB 2LVJA 3RM1A 3TS5B 3EVUA 1EH2A 1JWDA 2M29A 4MSPA 3PN7B 1OMRA 2MA2A 1PK0D 2NLNA 3BQ3A 1KSMA 1YTZC 1K95A 1W7JB 2AAOA 1TTXA 2QPTA 2M8UA 1K94A 2WOSA 4NDDA 1JSAA 2SCPA 1KK8B 2F8PA 3JVTB 1XFYO 4XJKB 1XA5A 3MSEB 1IJ5A 3CR4X 3OX6A 3ZWHA 4ORBB 3CS1A 3LLEA 2CBLA 1XFWO 5ER4X 1F54A 1S1EA 3NSIA 1XVJA 2WCBA 4MZKA 2Y4QA 1RK9A 1OOJA 5I2LA 5IBWA 1CLBA 1ZOTB 3KO0A 1B4CA 4CIDA 5CSFA 3IQOA 1BJFA 1BF5A 5HLOA 2PMYA 1D1OA 1G4YR 1YVLA 3PM8A 2LMUA 1SL8A 1KK7Z 1CDMA 2Y5IA 4PE7A 4GNKB 2GGMA 2KDHA 4PHKA 2KYFA 2JT8A 2ZFDA 1SW8A 2LUCA 1SRAA 4ORCB 1J7QA 1TCFA 2FCDA 2NZ0A 1UHIA 4YGDB 1NCYA 4JWQA 1TNQA 4QJ5B 1G8IA 2JNFA 2L0PA 3K21A 3SG6A 1ZACA 1DJZA 3AAKA 4XYNA 1WLZA 2LMVA 2LHIA 3BYAA 2JU0A 4QJ3B 3BUMB 1LINA 3FS7A 3LL8B 4I5KA 1JC2A 1ALVA 1SNLA 1TRFA 1HT9A 1S3PA 2K2FA 3I5IC 5AANA 1KQMC 2CT9A 2OTGB 4AOMA 2JPTA 1A29A 1ALWA 2M49B 4WQ3A 1J7OA 2CXJA 4DIRA 3FIAA 1NSHA 1DJWA 3PALA 2M3WA 3TUYB 1PULA 5J3XA 1K90D 1DJHA 2D8NA 1FF1A 1M45A 4C0JA 4P5OE 5AEQA 3ZNIA 1WRLA 1EG3A 4ORAB 1SL7A 1Y6WA 3I5GB 2KI4C 2P6BB 4DUQA 4NDCA 3GK4X 1N0YA 2Q91A 2LC5A 3A8RA 5GQQC 1QLSA 1VRKA 4DRWA 1ZMZA 4YGBB 1CM4A 2EC6C 1K9PA 1KFUS 1M46A 2WORA 1PSRA 3F45A 2H61A 4E68A 3LK1A 1DVIA 2COLB 4N1GA 2KBMA 2MLFC 1KWOC 4C0KA 4U8DA 1KK7Y 3TDZA 4PALA 5I2QA 1TNPA 1CLLA 1S6JA 1NX2A 1DT7B 2MAZA 3OP0A
chains in the Genus database with same CATH superfamily
1IWQA 1TOPA 1MR8A 1QATA 1KQVA 4UPGA 1OMDA 1IQ5A 1PRWA 2Y1NA 2LE9B 2ZKMX 4MBEA 1SY9A 2KGRA 4ICBA 2WCEA 4GGNA 1YVHA 2BBMA 2F3YA 3PM2A 5DICA 3NGVA 3EK7A 3EKJA 4A4BA 4AQJA 1NIWA 5I94A 2LV7A 1Y1XA 2WCFA 4GFTA 3VRNA 2QEBA 1OSAA 1YUSA 2JRFA 3OB1B 1KCYA 1B8LA 1EL4A 1SPYA 1TIZA 3L4LA 2BBNA 2IS9A 1G33A 3DVJA 5DKQA 5FI6A 5PALA 1CDPA 3FE6A 3VGOA 3N7HA 3DVEA 4I5LB 1LS8A 1R2UA 1GGZA 1U5IA 1JFJA 3TDIA 4HRGA 2E30A 3SG7A 2KQYA 1B8RA 2QEOA 3IF7A 3SG3A 1UURA 1QX7A 1K9UA 1YR5A 3DXLA 2LP3A 3B86A 3GOFA 3NHTA 5HKZA 1IQ3A 1KFXS 1XK4A 4PE1A 5I8NA 3VB1A 1K2HA 1NCXA 3FE8A 5BPJA 1AJ5A 1T14A 3B7AA 2I94A 3NSOA 4TNCA 4PT1A 5F6TA 3EVVA 3S0FA 4C0LA 2LNKA 4QJ4B 2OS8C 1H8BA 1WRKA 1GQMA 1A4PA 1LXFC 1WDCB 2KI6C 2KQ6A 3DF0A 2KSPA 1C3ZA 2A4JA 1AK8A 3WHTB 2O60A 4YRUA 2PSRA 4GBAA 1BR1B 2BNXA 1SR6C 1QTXA 1OQPA 1P28A 1ZFSA 5JOLA 5HL1A 3I5HB 2BE6A 1QWVA 2P71A 1JFKA 2F2OA 2K7DA 3DVMA 3SG4A 5CSIA 2K7BA 3GK1A 2BKHB 3R1VA 2KFGA 2HF5A 2M7LA 4ZCUA 5AFPA 1M39A 2NCOA 2EC6B 3BUNB 3WHUB 1OZSA 2KAYA 3HX4A 3R72A 4OV2A 5HLVA 3TDUA 2KFFA 3CLNA 1RJVA 3I5FC 1JBAA 2BE4A 2KBIA 1UHNA 4N1FA 4F0ZB 1QXPA 2BECA 2HPSA 1K96A 2YGUA 3KF9A 3PJIA 2LAPA 2JT0A 5DKNA 3SS5A 1QLKA 4I5JA 2LCPA 2AUCA 4INWA 1S6CA 2LVVA 1QVIY 1LA3A 5G08A 2LLSA 2MBXA 1AUIB 1DGUA 4P2YB 4F7FA 5KTYA 1FI6A 3JTDB 3A4UB 4GUKA 1LVCD 3C1VA 1IJ6A 1IKUA 1CMGA 3K1EA 1XFUO 3AKAA 1IG5A 2CTNA 5AXIA 1L2OC 1SCMC 2R2IA 5B8IB 4DCKA 2JT3A 3VRPA 2WCKA 3LCPC 1JUOA 1MWNA 1U5IB 2DOQA 4YGCB 3OHMB 5TNCA 1UHKA 1J1EA 2PALA 1DELA 1RFJA 4PE0A 5CSJA 1F4OA 1RROA 4Q04A 3VRRA 3O2PA 2JC2A 3UNWA 1DMOA 3B6XA 1WLMA 3PATA 1B7TZ 4R1EA 1CFPA 1MQ1A 2PRUA 1DJGA 4HREE 3JVTC 1EXRA 3DF0B 2Y1MA 2MJWB 1BG1A 1IH0A 1YUUA 3CDNA 1GM0A 3SS3A 2BL0C 1FI5A 2WC6A 1NPQA 1TN4A 2K0JA 1J7RA 4ZCVA 2JWWA 4PDZA 2JZIA 1HQVA 3KPXA 3AAJA 2PVBA 4IL1A 4OVNF 2CCMA 1RWYA 2B1UA 2NXQA 1FPWA 3SG2A 2JNXA 3EKHA 4IJ7A 3IVTA 3S0AA 2HQWA 1CFFA 1S5GZ 3S0BA 3BXKA 3BOWA 4PCWA 4AQIA 1SK6D 2RGIA 1JF2A 1SR6B 2L98A 5JJGA 1F71A 2LP2A 2LHLA 3H4SE 5FYXA 2BCXA 1DEKA 2WCLA 1UUSA 2BKIB 2PASA 3DZTA 5FI7A 2ZN8A 1J55A 1TNXA 4DS7A 3R1PA 2I7AA 1A03A 1S6IA 3O4YA 4A4CA 1XFVO 4GGFC 1EJ3A 2GGZA 2LUXA 1CLMA 2NCPA 1DQEA 5D3OA 1FW4A 1J7PA 3D73A 1B47A 1CDLA 1NP8A 2KPHA 3I5FB 3D0YA 1MUXA 1AP4A 3PSRA 4GAOA 3LK0A 1DF0A 1M63B 3BUOB 2OPOA 1MXEA 4OCIA 2F33A 2H2KA 1UP5A 1S26D 2JTTA 4M2QA 2OTGC 2K61A 1B9AA 4MRXA 3BUXB 4CLNA 2WNDA 2JTZA 2ZRSA 5D69A 1C3YA 4FQOA 4PE4A 1BU3A 4ETOA 1Y0VH 4L9MA 3D75A 1H4BA 1X02A 3QRXA 3I5IB 2F2PA 1KQMB 4MRYA 1F8HA 1QV0A 2K7OA 1XYDA 1BR4B 5DKRA 2KAXA 5HKYA 3FE9A 1JF0A 1AVSA 5HYDA 3TUYC 3BFBA 1SMGA 3NXAA 2WCMA 4PHMA 2L4IA 4FTGA 1M31A 1TCOB 2KGBC 2K7CA 1MF8B 3I5GC 2QACA 1CFCA 4PHJA 3CR5X 2LM5A 3CWGA 1C7VA 2JQ6A 1KFXL 2EHBA 2JXCA 4HRHA 1K9KA 2GTEA 2Q4UA 1B1GA 1PVAA 2P70A 1MHOA 1TUZA 4CFRA 4MVFA 2FJUB 3BOWB 3S0EA 2KI4B 1OMVA 1QASA 1YRTB 4WRIA 3NSKA 2KI6D 2EGDA 1YX8A 3S0GA 2BL0B 3E3RA 2MRDA 1DTLA 1GJYA 1OOHA 2L2CA 3IQQA 1S5GY 3OX5A 1C7WA 3SS4A 1S36A 1N65A 1QIWA 1QX5B 2FCEA 2ZNEA 1NX0A 4NDBA 4M2PA 1PVBA 2HQ8A 4OR9B 1KWOB 2L2EA 1UWOA 3OGNA 3RLZA 2FOTA 3D0YB 3DD4A 2ZN9A 2MHHA 5K89A 1XFZO 1DF0B 1EG4A 1SCVA 2E6WA 3S0DA 3VRQA 5AERA 1W7IB 3CZTX 2MLEC 1BOCA 3KEVA 4BY4A 2K2AA 1AJ4A 5CSNA 1CMFA 2BCBA 2LVKA 1R6PA 3O6BA 1IIOA 1AHRA 1RECA 2I18A 1NWDA 1FBVA 1V1GA 2M7NA 3HCMA 3FWBA 3BFHA 1YX7A 1Z2CB 2QEVA 4USLA 3TS5C 3VROA 1YUTA 1CNPA 1XFXO 3GK2A 4OKHA 1PALA 1L7ZA 3PN7C 3WXAA 1NX3A 2LMTA 2O5GA 1IGVA 4FQTA 1CTRA 3BUWB 2HETA 4D1EA 2L5XB 2BCAA 1QX2A 1YURA 3CABA 3KHEA 3NSLA 4CFQA 1NX1A 1BMOA 2KYCA 1KK8C 1A75A 1QV1A 2KLEA 2LLTA 2ISDA 4WQ2A 5I2OA 1SL9A 2KHNA 1QS7A 2M9GA 5CPVA 4MEWA 1ODBA 1F55A 3OB2B 1OE9B 1F4QA 2GV5A 3BJHA 4CPVA 1Q80A 2M1UA 3CR2A 1DGVA 5ER5A 2JXLA 2H61C 1PSBA 1XFRA 1WDCC 1F70A 1DJYA 1CFDA 5KU1A 3D10A 3FWCA 1QJTA 1UHHA 4M2OA 1V1FA 1LA0A 3EK8A 1OOGA 1B8CA 4JPZB 3EVRA 4YI8A 4BY5A 2OS8B 3PLFB 2WC8A 1ZUZA 1BT6A 1K93D 2LANA 3I5HC 3DVKA 4MZLA 4XJKA 3CTNA 4YGAA 3TZ1A 2L4HA 1KFUL 1TWOA 1IRJA 3PFVA 1E8AA 3L47A 3SIBA 1RTP1 4PHNA 5EL2A 1C07A 2PYQA 2KOTA 2JOJA 2TN4A 5HKWA 1DJXA 3QMEA 5D7FA 2JULA 3EK4A 3WNXB 4YGEB 2KFHA 3ICBA 5FI2A 4MZJA 2CNPA 1N2DA 1NUBA 2L51A 2ZNDA 4YI9A 1KSOA 3M0WA 4HSZA 1CB1A 1Z4HA 1J1DA 1WRZA 4JQ0D 2H8VA 3R1OA 3DYEA 1Y1UA 4MN0A 1CDNA 2BAPA 1TNWA 1DJIA 2KLDA 2LLUA 2KNEA 2G9BA 3AKBA 3SJSA 1XO5A 3JTDC 3SG5A 2L50A 1Y1AA 2QDIA 1MXLC 4NQGA 1CKKA 3L4AA 2F3ZA 2ZRTA 1SKTA 1UHJA 2AMIA 1ORGA 3SIAA 1QVIZ 1QIVA 4N5XA 2LVIA 1BLQA 4MLWA 2KAVA 2V53A 2VRGA 3CGAA 1K8UA 1OZOA 1SBJA 3D76A 4GGFA 1LKJA 2I2RE 4I5NB 1YRUB 1NYAA 1SYMA 4YBHB 5KSZA 1A75B 1BODA 1L2OB 1SCMB 3O78A 2M97A 2SASA 3EG5B 1XK4C 1A2XA 3CZ1A 1WY9A 2G2BA 2M0RA 2PQLA 2K8MB 1DC1A 1B7TY 1CM1A 1NCZA 2M1KB 2WC5A 3CYZA 2LVJA 4GPLB 3RM1A 3TS5B 3EVUA 1EH2A 1JWDA 2M29A 4MSPA 3PN7B 1OMRA 2MA2A 1PK0D 2NLNA 3BQ3A 1KSMA 1YTZC 1K95A 1TUJA 1W7JB 1TTXA 2AAOA 1GGWA 3UO9A 1OOIX 2QPTA 2M8UA 3CZ0A 2L5YA 1K94A 2WOSA 4JKTA 4NDDA 2SCPA 1JSAA 1KK8B 2F8PA 3JVTB 1XFYO 4XJKB 1XA5A 3MSEB 1IJ5A 3CR4X 3OX6A 3ZWHA 2QEHA 4ORBB 3CS1A 3LLEA 2CBLA 1XFWO 5ER4X 1F54A 1S1EA 3NSIA 1XVJA 2WCBA 2WCHA 4MZKA 3BFAA 2Y4QA 1RK9A 1OOJA 2FJYA 5I2LA 5IBWA 1CLBA 1ZOTB 3KO0A 1B4CA 4CIDA 3DY9A 5CSFA 2JPOA 3B87A 3IQOA 1BJFA 1BF5A 5HLOA 2PMYA 1D1OA 1G4YR 1YVLA 3PM8A 2LMUA 1SL8A 1KK7Z 1CDMA 2Y5IA 4PE7A 4GNKB 2GGMA 2KDHA 1OW4A 4PHKA 2KYFA 2JT8A 2ZFDA 1SW8A 2LUCA 1SRAA 1OOFA 4KYNA 4ORCB 1J7QA 1TCFA 2FCDA 3D78A 2NZ0A 1UHIA 4YGDB 1NCYA 4JWQA 1TNQA 4QJ5B 1W9ZA 1G8IA 2JNFA 2ERBA 2L0PA 3K21A 3SG6A 1ZACA 1DJZA 3AAKA 4XYNA 1WLZA 2LMVA 2LHIA 3BYAA 2JU0A 4QJ3B 3BUMB 1LINA 3FS7A 3LL8B 4I5KA 1JC2A 1ALVA 1SNLA 1TRFA 1HT9A 1S3PA 2K2FA 3I5IC 5AANA 1KQMC 2CT9A 2OTGB 4AOMA 2JPTA 1A29A 1ALWA 2M49B 4WQ3A 1J7OA 2CXJA 4DIRA 3FIAA 1NSHA 1DJWA 3PALA 4OZDA 1SSEB 2M3WA 2WCJA 3TUYB 3V2LA 1PULA 5J3XA 1K90D 1DJHA 2D8NA 1FF1A 1M45A 4C0JA 4P5OE 5AEQA 3ZNIA 1WRLA 1EG3A 4ORAB 1SL7A 1Y6WA 3D77A 3NHIA 3I5GB 2KI4C 2K60A 2P6BB 3B88A 3O4XA 4NDCA 4DUQA 3GK4X 1N0YA 2Q91A 2LC5A 3A8RA 3D74A 5GQQC 1QLSA 1VRKA 4DRWA 1ZMZA 3Q8IA 4YGBB 1CM4A 4INXA 2EC6C 1K9PA 1KFUS 1M46A 2WORA 1PSRA 3F45A 2H61A 4E68A 3LK1A 1DVIA 2COLB 4N1GA 2KBMA 3RZSA 3OBVA 2MLFC 1KWOC 3CZ2A 4JD9A 4C0KA 4U8DA 1KK7Y 3TDZA 4PALA 5I2QA 1TNPA 1CLLA 1S6JA 1NX2A 1DT7B 2MAZA 3OP0A
chains in the Genus database with same CATH topology
1IWQA 1TOPA 1MR8A 1QATA 1KQVA 4UPGA 1OMDA 1IQ5A 1PRWA 2Y1NA 2LE9B 2ZKMX 4MBEA 1SY9A 2KGRA 4ICBA 2WCEA 4GGNA 1YVHA 2BBMA 2F3YA 4AQJA 3EK7A 3EKJA 4A4BA 1NIWA 2LV7A 1Y1XA 2WCFA 4GFTA 3VRNA 1OSAA 1YUSA 2JRFA 3OB1B 1KCYA 1B8LA 1EL4A 1SPYA 1TIZA 2BBNA 2IS9A 1G33A 3DVJA 5DKQA 5PALA 1CDPA 3VGOA 3DVEA 4I5LB 1R2UA 1GGZA 1U5IA 1JFJA 3TDIA 4HRGA 2E30A 3SG7A 2KQYA 1B8RA 3IF7A 3SG3A 1UURA 1QX7A 1K9UA 1YR5A 2LP3A 5HKZA 3GOFA 1IQ3A 1KFXS 1XK4A 4PE1A 5I8NA 1K2HA 1NCXA 5BPJA 1AJ5A 3NSOA 2I94A 4TNCA 5F6TA 3EVVA 4C0LA 2LNKA 4QJ4B 2OS8C 1H8BA 1WRKA 1GQMA 1A4PA 1LXFC 1WDCB 2KI6C 2KQ6A 3DF0A 2KSPA 2A4JA 1AK8A 3WHTB 2O60A 4YRUA 2PSRA 4GBAA 1BR1B 1SR6C 1QTXA 1OQPA 1ZFSA 5JOLA 3I5HB 2BE6A 1JFKA 2F2OA 2K7DA 3DVMA 3SG4A 5CSIA 2K7BA 3GK1A 2BKHB 2KFGA 2HF5A 2M7LA 4ZCUA 5AFPA 1M39A 2NCOA 2EC6B 3BUNB 3WHUB 1OZSA 2KAYA 3HX4A 4OV2A 5HLVA 3TDUA 2KFFA 3CLNA 1RJVA 3I5FC 1JBAA 2BE4A 2KBIA 1UHNA 4N1FA 4F0ZB 1QXPA 2BECA 2HPSA 1K96A 3KF9A 2LAPA 2JT0A 5DKNA 1QLKA 4I5JA 2LCPA 2AUCA 1S6CA 2LVVA 1QVIY 1LA3A 5G08A 2LLSA 2MBXA 1AUIB 1DGUA 4P2YB 5KTYA 1FI6A 3JTDB 3A4UB 4GUKA 1LVCD 3C1VA 1IJ6A 1IKUA 1CMGA 1XFUO 3AKAA 1IG5A 2CTNA 5AXIA 1L2OC 1SCMC 2R2IA 5B8IB 4DCKA 2JT3A 3VRPA 3LCPC 1JUOA 1MWNA 1U5IB 2DOQA 4YGCB 3OHMB 5TNCA 1UHKA 1J1EA 2PALA 1RFJA 4PE0A 5CSJA 1F4OA 1RROA 4Q04A 3VRRA 3O2PA 2JC2A 1DMOA 1WLMA 3PATA 1B7TZ 4R1EA 1CFPA 1MQ1A 2PRUA 1DJGA 4HREE 3JVTC 1EXRA 3DF0B 2Y1MA 2MJWB 1BG1A 1IH0A 1YUUA 1FI5A 2BL0C 1NPQA 1TN4A 2K0JA 1J7RA 4ZCVA 2JWWA 4PDZA 2JZIA 1HQVA 3KPXA 3AAJA 2PVBA 4IL1A 4OVNF 2CCMA 1RWYA 2B1UA 2NXQA 1FPWA 3SG2A 2JNXA 3EKHA 2HQWA 1CFFA 1S5GZ 3BXKA 3BOWA 4PCWA 4AQIA 1SK6D 2RGIA 1JF2A 1SR6B 2L98A 5JJGA 1F71A 2LP2A 2LHLA 3H4SE 5FYXA 2BCXA 1UUSA 2BKIB 2PASA 4DS7A 2ZN8A 1J55A 1TNXA 2I7AA 1A03A 1S6IA 3O4YA 4A4CA 1XFVO 4GGFC 1EJ3A 2GGZA 2LUXA 1CLMA 2NCPA 1FW4A 1J7PA 1B47A 1CDLA 1NP8A 3I5FB 3D0YA 1MUXA 1AP4A 3PSRA 4GAOA 3LK0A 1DF0A 1M63B 3BUOB 2OPOA 1MXEA 4OCIA 2F33A 2H2KA 1UP5A 1S26D 2JTTA 4M2QA 2OTGC 2K61A 1B9AA 4MRXA 3BUXB 4CLNA 2WNDA 2JTZA 2ZRSA 5D69A 4FQOA 4PE4A 1BU3A 4ETOA 1Y0VH 4L9MA 1H4BA 1X02A 3QRXA 3I5IB 2F2PA 1KQMB 4MRYA 1F8HA 1QV0A 2K7OA 1XYDA 1BR4B 5DKRA 2KAXA 5HKYA 5HYDA 1JF0A 1AVSA 3TUYC 1SMGA 3NXAA 4PHMA 2L4IA 4FTGA 1M31A 1TCOB 2KGBC 2K7CA 1MF8B 3I5GC 2QACA 1CFCA 4PHJA 3CR5X 2LM5A 3CWGA 1C7VA 2JQ6A 1KFXL 2EHBA 2JXCA 4HRHA 1K9KA 2Q4UA 1B1GA 1PVAA 1MHOA 4CFRA 4MVFA 2FJUB 3BOWB 2KI4B 1OMVA 1QASA 1YRTB 4WRIA 3NSKA 2KI6D 2EGDA 1YX8A 2BL0B 3E3RA 2MRDA 1DTLA 1GJYA 3IQQA 1S5GY 3OX5A 1C7WA 1S36A 1N65A 1QIWA 1QX5B 2FCEA 2ZNEA 1NX0A 4NDBA 4M2PA 1PVBA 2HQ8A 4OR9B 1KWOB 2L2EA 1UWOA 3RLZA 2FOTA 3D0YB 3DD4A 2ZN9A 2MHHA 5K89A 1XFZO 1DF0B 1EG4A 1SCVA 2E6WA 5AERA 3VRQA 1BOCA 1W7IB 3CZTX 2MLEC 3KEVA 4BY4A 2K2AA 1AJ4A 5CSNA 1CMFA 2BCBA 2LVKA 1R6PA 3O6BA 1AHRA 1RECA 2I18A 1NWDA 1FBVA 1V1GA 2M7NA 3HCMA 3FWBA 1YX7A 4USLA 3TS5C 3VROA 1YUTA 1CNPA 1XFXO 3GK2A 4OKHA 1PALA 1L7ZA 3PN7C 3WXAA 1NX3A 2LMTA 2O5GA 1IGVA 1CTRA 3BUWB 2HETA 4D1EA 2L5XB 2BCAA 1QX2A 1YURA 3NSLA 3KHEA 4CFQA 1NX1A 1BMOA 2KYCA 1KK8C 1A75A 1QV1A 2LLTA 2ISDA 5I2OA 4WQ2A 1SL9A 2KHNA 1QS7A 2M9GA 5CPVA 4MEWA 1ODBA 1F55A 3OB2B 1OE9B 1F4QA 2GV5A 4CPVA 1Q80A 2M1UA 3CR2A 1DGVA 5ER5A 2JXLA 2H61C 1PSBA 1F70A 1WDCC 1DJYA 1CFDA 5KU1A 3D10A 3FWCA 1QJTA 1UHHA 4M2OA 1V1FA 1LA0A 3EK8A 1B8CA 4JPZB 3EVRA 4YI8A 4BY5A 2OS8B 3PLFB 2WC8A 1ZUZA 1BT6A 1K93D 2LANA 3I5HC 3DVKA 4MZLA 4XJKA 3CTNA 4YGAA 3TZ1A 2L4HA 1KFUL 3PFVA 1IRJA 3SIBA 1E8AA 1RTP1 4PHNA 1C07A 2TN4A 2KOTA 2JOJA 5HKWA 1DJXA 5D7FA 2JULA 3EK4A 3WNXB 4YGEB 2KFHA 3ICBA 4MZJA 2CNPA 1N2DA 1NUBA 2L51A 2ZNDA 4YI9A 1KSOA 3M0WA 4HSZA 1CB1A 1J1DA 1WRZA 4JQ0D 1Y1UA 4MN0A 1CDNA 1TNWA 1DJIA 2LLUA 2KNEA 2G9BA 3AKBA 3SJSA 1XO5A 3JTDC 3SG5A 2L50A 1Y1AA 1MXLC 4NQGA 1CKKA 2F3ZA 2ZRTA 1SKTA 1UHJA 2AMIA 3SIAA 1QVIZ 1QIVA 4N5XA 2LVIA 1BLQA 4MLWA 2KAVA 2V53A 2VRGA 3CGAA 1K8UA 1OZOA 1SBJA 4GGFA 4I5NB 1LKJA 2I2RE 1YRUB 1NYAA 1SYMA 4YBHB 5KSZA 1A75B 1BODA 1L2OB 1SCMB 3O78A 2M97A 2SASA 1GGWA 1XK4C 1A2XA 1WY9A 2G2BA 2M0RA 2K8MB 1B7TY 1CM1A 1NCZA 2M1KB 4GPLB 2LVJA 3RM1A 3TS5B 3EVUA 1EH2A 1JWDA 2M29A 4MSPA 3PN7B 1OMRA 2MA2A 1PK0D 2NLNA 3BQ3A 1KSMA 1YTZC 1K95A 1W7JB 2AAOA 1TTXA 2QPTA 2M8UA 1K94A 2WOSA 4NDDA 1JSAA 2SCPA 1KK8B 2F8PA 3JVTB 1XFYO 4XJKB 1XA5A 3MSEB 1IJ5A 3CR4X 3OX6A 3ZWHA 4ORBB 3CS1A 3LLEA 2CBLA 1XFWO 5ER4X 1F54A 1S1EA 3NSIA 1XVJA 2WCBA 4MZKA 2Y4QA 1RK9A 1OOJA 5I2LA 5IBWA 1CLBA 1ZOTB 3KO0A 1B4CA 4CIDA 5CSFA 3IQOA 1BJFA 1BF5A 5HLOA 2PMYA 1D1OA 1G4YR 1YVLA 3PM8A 2LMUA 1SL8A 1KK7Z 1CDMA 2Y5IA 4PE7A 4GNKB 2GGMA 2KDHA 4PHKA 2KYFA 2JT8A 2ZFDA 1SW8A 2LUCA 1SRAA 4ORCB 1J7QA 1TCFA 2FCDA 2NZ0A 1UHIA 4YGDB 1NCYA 4JWQA 1TNQA 4QJ5B 1G8IA 2JNFA 2L0PA 3K21A 3SG6A 1ZACA 1DJZA 3AAKA 4XYNA 1WLZA 2LMVA 2LHIA 3BYAA 2JU0A 4QJ3B 3BUMB 1LINA 3FS7A 3LL8B 4I5KA 1JC2A 1ALVA 1SNLA 1TRFA 1HT9A 1S3PA 2K2FA 3I5IC 5AANA 1KQMC 2CT9A 2OTGB 4AOMA 2JPTA 1A29A 1ALWA 2M49B 4WQ3A 1J7OA 2CXJA 4DIRA 3FIAA 1NSHA 1DJWA 3PALA 2M3WA 3TUYB 1PULA 5J3XA 1K90D 1DJHA 2D8NA 1FF1A 1M45A 4C0JA 4P5OE 5AEQA 3ZNIA 1WRLA 1EG3A 4ORAB 1SL7A 1Y6WA 3I5GB 2KI4C 2P6BB 4DUQA 4NDCA 3GK4X 1N0YA 2Q91A 2LC5A 3A8RA 5GQQC 1QLSA 1VRKA 4DRWA 1ZMZA 4YGBB 1CM4A 2EC6C 1K9PA 1KFUS 1M46A 2WORA 1PSRA 3F45A 2H61A 4E68A 3LK1A 1DVIA 2COLB 4N1GA 2KBMA 2MLFC 1KWOC 4C0KA 4U8DA 1KK7Y 3TDZA 4PALA 5I2QA 1TNPA 1CLLA 1S6JA 1NX2A 1DT7B 2MAZA 3OP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IWQ A;  1TOP A;  1MR8 A;  1QAT A;  1KQV A;  4UPG A;  1OMD A;  1IQ5 A;  1PRW A;  2Y1N A;  2LE9 B;  2ZKM X;  4MBE A;  1SY9 A;  2KGR A;  4ICB A;  2WCE A;  4GGN A;  1YVH A;  2BBM A;  2F3Y A;  4AQJ A;  3EK7 A;  3EKJ A;  4A4B A;  1NIW A;  2LV7 A;  1Y1X A;  2WCF A;  4GFT A;  3VRN A;  1OSA A;  1YUS A;  2JRF A;  3OB1 B;  1KCY A;  1B8L A;  1EL4 A;  1SPY A;  1TIZ A;  2BBN A;  2IS9 A;  1G33 A;  3DVJ A;  5DKQ A;  5PAL A;  1CDP A;  3VGO A;  3DVE A;  4I5L B;  1R2U A;  1GGZ A;  1U5I A;  1JFJ A;  3TDI A;  4HRG A;  2E30 A;  3SG7 A;  2KQY A;  1B8R A;  3IF7 A;  3SG3 A;  1UUR A;  1QX7 A;  1K9U A;  1YR5 A;  2LP3 A;  5HKZ A;  3GOF A;  1IQ3 A;  1KFX S;  1XK4 A;  4PE1 A;  5I8N A;  1K2H A;  1NCX A;  5BPJ A;  1AJ5 A;  3NSO A;  2I94 A;  4TNC A;  5F6T A;  3EVV A;  4C0L A;  2LNK A;  4QJ4 B;  2OS8 C;  1H8B A;  1WRK A;  1GQM A;  1A4P A;  1LXF C;  1WDC B;  2KI6 C;  2KQ6 A;  3DF0 A;  2KSP A;  2A4J A;  1AK8 A;  3WHT B;  2O60 A;  4YRU A;  2PSR A;  4GBA A;  1BR1 B;  1SR6 C;  1QTX A;  1OQP A;  1ZFS A;  5JOL A;  3I5H B;  2BE6 A;  1JFK A;  2F2O A;  2K7D A;  3DVM A;  3SG4 A;  5CSI A;  2K7B A;  3GK1 A;  2BKH B;  2KFG A;  2HF5 A;  2M7L A;  4ZCU A;  5AFP A;  1M39 A;  2NCO A;  2EC6 B;  3BUN B;  3WHU B;  1OZS A;  2KAY A;  3HX4 A;  4OV2 A;  5HLV A;  3TDU A;  2KFF A;  3CLN A;  1RJV A;  3I5F C;  1JBA A;  2BE4 A;  2KBI A;  1UHN A;  4N1F A;  4F0Z B;  1QXP A;  2BEC A;  2HPS A;  1K96 A;  3KF9 A;  2LAP A;  2JT0 A;  5DKN A;  1QLK A;  4I5J A;  2LCP A;  2AUC A;  1S6C A;  2LVV A;  1QVI Y;  1LA3 A;  5G08 A;  2LLS A;  2MBX A;  1AUI B;  1DGU A;  4P2Y B;  5KTY A;  1FI6 A;  3JTD B;  3A4U B;  4GUK A;  1LVC D;  3C1V A;  1IJ6 A;  1IKU A;  1CMG A;  1XFU O;  3AKA A;  1IG5 A;  2CTN A;  5AXI A;  1L2O C;  1SCM C;  2R2I A;  5B8I B;  4DCK A;  2JT3 A;  3VRP A;  3LCP C;  1JUO A;  1MWN A;  1U5I B;  2DOQ A;  4YGC B;  3OHM B;  5TNC A;  1UHK A;  1J1E A;  2PAL A;  1RFJ A;  4PE0 A;  5CSJ A;  1F4O A;  1RRO A;  4Q04 A;  3VRR A;  3O2P A;  2JC2 A;  1DMO A;  1WLM A;  3PAT A;  1B7T Z;  4R1E A;  1CFP A;  1MQ1 A;  2PRU A;  1DJG A;  4HRE E;  3JVT C;  1EXR A;  3DF0 B;  2Y1M A;  2MJW B;  1BG1 A;  1IH0 A;  1YUU A;  1FI5 A;  2BL0 C;  1NPQ A;  1TN4 A;  2K0J A;  1J7R A;  4ZCV A;  2JWW A;  4PDZ A;  2JZI A;  1HQV A;  3KPX A;  3AAJ A;  2PVB A;  4IL1 A;  4OVN F;  2CCM A;  1RWY A;  2B1U A;  2NXQ A;  1FPW A;  3SG2 A;  2JNX A;  3EKH A;  2HQW A;  1CFF A;  1S5G Z;  3BXK A;  3BOW A;  4PCW A;  4AQI A;  1SK6 D;  2RGI A;  1JF2 A;  1SR6 B;  2L98 A;  5JJG A;  1F71 A;  2LP2 A;  2LHL A;  3H4S E;  5FYX A;  2BCX A;  1UUS A;  2BKI B;  2PAS A;  4DS7 A;  2ZN8 A;  1J55 A;  1TNX A;  2I7A A;  1A03 A;  1S6I A;  3O4Y A;  4A4C A;  1XFV O;  4GGF C;  1EJ3 A;  2GGZ A;  2LUX A;  1CLM A;  2NCP A;  1FW4 A;  1J7P A;  1B47 A;  1CDL A;  1NP8 A;  3I5F B;  3D0Y A;  1MUX A;  1AP4 A;  3PSR A;  4GAO A;  3LK0 A;  1DF0 A;  1M63 B;  3BUO B;  2OPO A;  1MXE A;  4OCI A;  2F33 A;  2H2K A;  1UP5 A;  1S26 D;  2JTT A;  4M2Q A;  2OTG C;  2K61 A;  1B9A A;  4MRX A;  3BUX B;  4CLN A;  2WND A;  2JTZ A;  2ZRS A;  5D69 A;  4FQO A;  4PE4 A;  1BU3 A;  4ETO A;  1Y0V H;  4L9M A;  1H4B A;  1X02 A;  3QRX A;  3I5I B;  2F2P A;  1KQM B;  4MRY A;  1F8H A;  1QV0 A;  2K7O A;  1XYD A;  1BR4 B;  5DKR A;  2KAX A;  5HKY A;  5HYD A;  1JF0 A;  1AVS A;  3TUY C;  1SMG A;  3NXA A;  4PHM A;  2L4I A;  4FTG A;  1M31 A;  1TCO B;  2KGB C;  2K7C A;  1MF8 B;  3I5G C;  2QAC A;  1CFC A;  4PHJ A;  3CR5 X;  2LM5 A;  3CWG A;  1C7V A;  2JQ6 A;  1KFX L;  2EHB A;  2JXC A;  4HRH A;  1K9K A;  2Q4U A;  1B1G A;  1PVA A;  1MHO A;  4CFR A;  4MVF A;  2FJU B;  3BOW B;  2KI4 B;  1OMV A;  1QAS A;  1YRT B;  4WRI A;  3NSK A;  2KI6 D;  2EGD A;  1YX8 A;  2BL0 B;  3E3R A;  2MRD A;  1DTL A;  1GJY A;  3IQQ A;  1S5G Y;  3OX5 A;  1C7W A;  1S36 A;  1N65 A;  1QIW A;  1QX5 B;  2FCE A;  2ZNE A;  1NX0 A;  4NDB A;  4M2P A;  1PVB A;  2HQ8 A;  4OR9 B;  1KWO B;  2L2E A;  1UWO A;  3RLZ A;  2FOT A;  3D0Y B;  3DD4 A;  2ZN9 A;  2MHH A;  5K89 A;  1XFZ O;  1DF0 B;  1EG4 A;  1SCV A;  2E6W A;  5AER A;  3VRQ A;  1BOC A;  1W7I B;  3CZT X;  2MLE C;  3KEV A;  4BY4 A;  2K2A A;  1AJ4 A;  5CSN A;  1CMF A;  2BCB A;  2LVK A;  1R6P A;  3O6B A;  1AHR A;  1REC A;  2I18 A;  1NWD A;  1FBV A;  1V1G A;  2M7N A;  3HCM A;  3FWB A;  1YX7 A;  4USL A;  3TS5 C;  3VRO A;  1YUT A;  1CNP A;  1XFX O;  3GK2 A;  4OKH A;  1PAL A;  1L7Z A;  3PN7 C;  3WXA A;  1NX3 A;  2LMT A;  2O5G A;  1IGV A;  1CTR A;  3BUW B;  2HET A;  4D1E A;  2L5X B;  2BCA A;  1QX2 A;  1YUR A;  3NSL A;  3KHE A;  4CFQ A;  1NX1 A;  1BMO A;  2KYC A;  1KK8 C;  1A75 A;  1QV1 A;  2LLT A;  2ISD A;  5I2O A;  4WQ2 A;  1SL9 A;  2KHN A;  1QS7 A;  2M9G A;  5CPV A;  4MEW A;  1ODB A;  1F55 A;  3OB2 B;  1OE9 B;  1F4Q A;  2GV5 A;  4CPV A;  1Q80 A;  2M1U A;  3CR2 A;  1DGV A;  5ER5 A;  2JXL A;  2H61 C;  1PSB A;  1F70 A;  1WDC C;  1DJY A;  1CFD A;  5KU1 A;  3D10 A;  3FWC A;  1QJT A;  1UHH A;  4M2O A;  1V1F A;  1LA0 A;  3EK8 A;  1B8C A;  4JPZ B;  3EVR A;  4YI8 A;  4BY5 A;  2OS8 B;  3PLF B;  2WC8 A;  1ZUZ A;  1BT6 A;  1K93 D;  2LAN A;  3I5H C;  3DVK A;  4MZL A;  4XJK A;  3CTN A;  4YGA A;  3TZ1 A;  2L4H A;  1KFU L;  3PFV A;  1IRJ A;  3SIB A;  1E8A A;  1RTP 1;  4PHN A;  1C07 A;  2TN4 A;  2KOT A;  2JOJ A;  5HKW A;  1DJX A;  5D7F A;  2JUL A;  3EK4 A;  3WNX B;  4YGE B;  2KFH A;  3ICB A;  4MZJ A;  2CNP A;  1N2D A;  1NUB A;  2L51 A;  2ZND A;  4YI9 A;  1KSO A;  3M0W A;  4HSZ A;  1CB1 A;  1J1D A;  1WRZ A;  4JQ0 D;  1Y1U A;  4MN0 A;  1CDN A;  1TNW A;  1DJI A;  2LLU A;  2KNE A;  2G9B A;  3AKB A;  3SJS A;  1XO5 A;  3JTD C;  3SG5 A;  2L50 A;  1Y1A A;  1MXL C;  4NQG A;  1CKK A;  2F3Z A;  2ZRT A;  1SKT A;  1UHJ A;  2AMI A;  3SIA A;  1QVI Z;  1QIV A;  4N5X A;  2LVI A;  1BLQ A;  4MLW A;  2KAV A;  2V53 A;  2VRG A;  3CGA A;  1K8U A;  1OZO A;  1SBJ A;  4GGF A;  4I5N B;  1LKJ A;  2I2R E;  1YRU B;  1NYA A;  1SYM A;  4YBH B;  5KSZ A;  1A75 B;  1BOD A;  1L2O B;  1SCM B;  3O78 A;  2M97 A;  2SAS A;  1GGW A;  1XK4 C;  1A2X A;  1WY9 A;  2G2B A;  2M0R A;  2K8M B;  1B7T Y;  1CM1 A;  1NCZ A;  2M1K B;  4GPL B;  2LVJ A;  3RM1 A;  3TS5 B;  3EVU A;  1EH2 A;  1JWD A;  2M29 A;  4MSP A;  3PN7 B;  1OMR A;  2MA2 A;  1PK0 D;  2NLN A;  3BQ3 A;  1KSM A;  1YTZ C;  1K95 A;  1W7J B;  2AAO A;  1TTX A;  2QPT A;  2M8U A;  1K94 A;  2WOS A;  4NDD A;  1JSA A;  2SCP A;  1KK8 B;  2F8P A;  3JVT B;  1XFY O;  4XJK B;  1XA5 A;  3MSE B;  1IJ5 A;  3CR4 X;  3OX6 A;  3ZWH A;  4ORB B;  3CS1 A;  3LLE A;  2CBL A;  1XFW O;  5ER4 X;  1F54 A;  1S1E A;  3NSI A;  1XVJ A;  2WCB A;  4MZK A;  2Y4Q A;  1RK9 A;  1OOJ A;  5I2L A;  5IBW A;  1CLB A;  1ZOT B;  3KO0 A;  1B4C A;  4CID A;  5CSF A;  3IQO A;  1BJF A;  1BF5 A;  5HLO A;  2PMY A;  1D1O A;  1G4Y R;  1YVL A;  3PM8 A;  2LMU A;  1SL8 A;  1KK7 Z;  1CDM A;  2Y5I A;  4PE7 A;  4GNK B;  2GGM A;  2KDH A;  4PHK A;  2KYF A;  2JT8 A;  2ZFD A;  1SW8 A;  2LUC A;  1SRA A;  4ORC B;  1J7Q A;  1TCF A;  2FCD A;  2NZ0 A;  1UHI A;  4YGD B;  1NCY A;  4JWQ A;  1TNQ A;  4QJ5 B;  1G8I A;  2JNF A;  2L0P A;  3K21 A;  3SG6 A;  1ZAC A;  1DJZ A;  3AAK A;  4XYN A;  1WLZ A;  2LMV A;  2LHI A;  3BYA A;  2JU0 A;  4QJ3 B;  3BUM B;  1LIN A;  3FS7 A;  3LL8 B;  4I5K A;  1JC2 A;  1ALV A;  1SNL A;  1TRF A;  1HT9 A;  1S3P A;  2K2F A;  3I5I C;  5AAN A;  1KQM C;  2CT9 A;  2OTG B;  4AOM A;  2JPT A;  1A29 A;  1ALW A;  2M49 B;  4WQ3 A;  1J7O A;  2CXJ A;  4DIR A;  3FIA A;  1NSH A;  1DJW A;  3PAL A;  2M3W A;  3TUY B;  1PUL A;  5J3X A;  1K90 D;  1DJH A;  2D8N A;  1FF1 A;  1M45 A;  4C0J A;  4P5O E;  5AEQ A;  3ZNI A;  1WRL A;  1EG3 A;  4ORA B;  1SL7 A;  1Y6W A;  3I5G B;  2KI4 C;  2P6B B;  4DUQ A;  4NDC A;  3GK4 X;  1N0Y A;  2Q91 A;  2LC5 A;  3A8R A;  5GQQ C;  1QLS A;  1VRK A;  4DRW A;  1ZMZ A;  4YGB B;  1CM4 A;  2EC6 C;  1K9P A;  1KFU S;  1M46 A;  2WOR A;  1PSR A;  3F45 A;  2H61 A;  4E68 A;  3LK1 A;  1DVI A;  2COL B;  4N1G A;  2KBM A;  2MLF C;  1KWO C;  4C0K A;  4U8D A;  1KK7 Y;  3TDZ A;  4PAL A;  5I2Q A;  1TNP A;  1CLL A;  1S6J A;  1NX2 A;  1DT7 B;  2MAZ A;  3OP0 A; 
#chains in the Genus database with same CATH topology
 1IWQ A;  1TOP A;  1MR8 A;  1QAT A;  1KQV A;  4UPG A;  1OMD A;  1IQ5 A;  1PRW A;  2Y1N A;  2LE9 B;  2ZKM X;  4MBE A;  1SY9 A;  2KGR A;  4ICB A;  2WCE A;  4GGN A;  1YVH A;  2BBM A;  2F3Y A;  3PM2 A;  5DIC A;  3NGV A;  3EK7 A;  3EKJ A;  4A4B A;  4AQJ A;  1NIW A;  5I94 A;  2LV7 A;  1Y1X A;  2WCF A;  4GFT A;  3VRN A;  2QEB A;  1OSA A;  1YUS A;  2JRF A;  3OB1 B;  1KCY A;  1B8L A;  1EL4 A;  1SPY A;  1TIZ A;  3L4L A;  2BBN A;  2IS9 A;  1G33 A;  3DVJ A;  5DKQ A;  5FI6 A;  5PAL A;  1CDP A;  3FE6 A;  3VGO A;  3N7H A;  3DVE A;  4I5L B;  1LS8 A;  1R2U A;  1GGZ A;  1U5I A;  1JFJ A;  3TDI A;  4HRG A;  2E30 A;  3SG7 A;  2KQY A;  1B8R A;  2QEO A;  3IF7 A;  3SG3 A;  1UUR A;  1QX7 A;  1K9U A;  1YR5 A;  3DXL A;  2LP3 A;  3B86 A;  3GOF A;  3NHT A;  5HKZ A;  1IQ3 A;  1KFX S;  1XK4 A;  4PE1 A;  5I8N A;  3VB1 A;  1K2H A;  1NCX A;  3FE8 A;  5BPJ A;  1AJ5 A;  1T14 A;  3B7A A;  2I94 A;  3NSO A;  4TNC A;  4PT1 A;  5F6T A;  3EVV A;  3S0F A;  4C0L A;  2LNK A;  4QJ4 B;  2OS8 C;  1H8B A;  1WRK A;  1GQM A;  1A4P A;  1LXF C;  1WDC B;  2KI6 C;  2KQ6 A;  3DF0 A;  2KSP A;  1C3Z A;  2A4J A;  1AK8 A;  3WHT B;  2O60 A;  4YRU A;  2PSR A;  4GBA A;  1BR1 B;  2BNX A;  1SR6 C;  1QTX A;  1OQP A;  1P28 A;  1ZFS A;  5JOL A;  5HL1 A;  3I5H B;  2BE6 A;  1QWV A;  2P71 A;  1JFK A;  2F2O A;  2K7D A;  3DVM A;  3SG4 A;  5CSI A;  2K7B A;  3GK1 A;  2BKH B;  3R1V A;  2KFG A;  2HF5 A;  2M7L A;  4ZCU A;  5AFP A;  1M39 A;  2NCO A;  2EC6 B;  3BUN B;  3WHU B;  1OZS A;  2KAY A;  3HX4 A;  3R72 A;  4OV2 A;  5HLV A;  3TDU A;  2KFF A;  3CLN A;  1RJV A;  3I5F C;  1JBA A;  2BE4 A;  2KBI A;  1UHN A;  4N1F A;  4F0Z B;  1QXP A;  2BEC A;  2HPS A;  1K96 A;  2YGU A;  3KF9 A;  3PJI A;  2LAP A;  2JT0 A;  5DKN A;  3SS5 A;  1QLK A;  4I5J A;  2LCP A;  2AUC A;  4INW A;  1S6C A;  2LVV A;  1QVI Y;  1LA3 A;  5G08 A;  2LLS A;  2MBX A;  1AUI B;  1DGU A;  4P2Y B;  4F7F A;  5KTY A;  1FI6 A;  3JTD B;  3A4U B;  4GUK A;  1LVC D;  3C1V A;  1IJ6 A;  1IKU A;  1CMG A;  3K1E A;  1XFU O;  3AKA A;  1IG5 A;  2CTN A;  5AXI A;  1L2O C;  1SCM C;  2R2I A;  5B8I B;  4DCK A;  2JT3 A;  3VRP A;  2WCK A;  3LCP C;  1JUO A;  1MWN A;  1U5I B;  2DOQ A;  4YGC B;  3OHM B;  5TNC A;  1UHK A;  1J1E A;  2PAL A;  1DEL A;  1RFJ A;  4PE0 A;  5CSJ A;  1F4O A;  1RRO A;  4Q04 A;  3VRR A;  3O2P A;  2JC2 A;  3UNW A;  1DMO A;  3B6X A;  1WLM A;  3PAT A;  1B7T Z;  4R1E A;  1CFP A;  1MQ1 A;  2PRU A;  1DJG A;  4HRE E;  3JVT C;  1EXR A;  3DF0 B;  2Y1M A;  2MJW B;  1BG1 A;  1IH0 A;  1YUU A;  3CDN A;  1GM0 A;  3SS3 A;  2BL0 C;  1FI5 A;  2WC6 A;  1NPQ A;  1TN4 A;  2K0J A;  1J7R A;  4ZCV A;  2JWW A;  4PDZ A;  2JZI A;  1HQV A;  3KPX A;  3AAJ A;  2PVB A;  4IL1 A;  4OVN F;  2CCM A;  1RWY A;  2B1U A;  2NXQ A;  1FPW A;  3SG2 A;  2JNX A;  3EKH A;  4IJ7 A;  3IVT A;  3S0A A;  2HQW A;  1CFF A;  1S5G Z;  3S0B A;  3BXK A;  3BOW A;  4PCW A;  4AQI A;  1SK6 D;  2RGI A;  1JF2 A;  1SR6 B;  2L98 A;  5JJG A;  1F71 A;  2LP2 A;  2LHL A;  3H4S E;  5FYX A;  2BCX A;  1DEK A;  2WCL A;  1UUS A;  2BKI B;  2PAS A;  3DZT A;  5FI7 A;  2ZN8 A;  1J55 A;  1TNX A;  4DS7 A;  3R1P A;  2I7A A;  1A03 A;  1S6I A;  3O4Y A;  4A4C A;  1XFV O;  4GGF C;  1EJ3 A;  2GGZ A;  2LUX A;  1CLM A;  2NCP A;  1DQE A;  5D3O A;  1FW4 A;  1J7P A;  3D73 A;  1B47 A;  1CDL A;  1NP8 A;  2KPH A;  3I5F B;  3D0Y A;  1MUX A;  1AP4 A;  3PSR A;  4GAO A;  3LK0 A;  1DF0 A;  1M63 B;  3BUO B;  2OPO A;  1MXE A;  4OCI A;  2F33 A;  2H2K A;  1UP5 A;  1S26 D;  2JTT A;  4M2Q A;  2OTG C;  2K61 A;  1B9A A;  4MRX A;  3BUX B;  4CLN A;  2WND A;  2JTZ A;  2ZRS A;  5D69 A;  1C3Y A;  4FQO A;  4PE4 A;  1BU3 A;  4ETO A;  1Y0V H;  4L9M A;  3D75 A;  1H4B A;  1X02 A;  3QRX A;  3I5I B;  2F2P A;  1KQM B;  4MRY A;  1F8H A;  1QV0 A;  2K7O A;  1XYD A;  1BR4 B;  5DKR A;  2KAX A;  5HKY A;  3FE9 A;  1JF0 A;  1AVS A;  5HYD A;  3TUY C;  3BFB A;  1SMG A;  3NXA A;  2WCM A;  4PHM A;  2L4I A;  4FTG A;  1M31 A;  1TCO B;  2KGB C;  2K7C A;  1MF8 B;  3I5G C;  2QAC A;  1CFC A;  4PHJ A;  3CR5 X;  2LM5 A;  3CWG A;  1C7V A;  2JQ6 A;  1KFX L;  2EHB A;  2JXC A;  4HRH A;  1K9K A;  2GTE A;  2Q4U A;  1B1G A;  1PVA A;  2P70 A;  1MHO A;  1TUZ A;  4CFR A;  4MVF A;  2FJU B;  3BOW B;  3S0E A;  2KI4 B;  1OMV A;  1QAS A;  1YRT B;  4WRI A;  3NSK A;  2KI6 D;  2EGD A;  1YX8 A;  3S0G A;  2BL0 B;  3E3R A;  2MRD A;  1DTL A;  1GJY A;  1OOH A;  2L2C A;  3IQQ A;  1S5G Y;  3OX5 A;  1C7W A;  3SS4 A;  1S36 A;  1N65 A;  1QIW A;  1QX5 B;  2FCE A;  2ZNE A;  1NX0 A;  4NDB A;  4M2P A;  1PVB A;  2HQ8 A;  4OR9 B;  1KWO B;  2L2E A;  1UWO A;  3OGN A;  3RLZ A;  2FOT A;  3D0Y B;  3DD4 A;  2ZN9 A;  2MHH A;  5K89 A;  1XFZ O;  1DF0 B;  1EG4 A;  1SCV A;  2E6W A;  3S0D A;  3VRQ A;  5AER A;  1W7I B;  3CZT X;  2MLE C;  1BOC A;  3KEV A;  4BY4 A;  2K2A A;  1AJ4 A;  5CSN A;  1CMF A;  2BCB A;  2LVK A;  1R6P A;  3O6B A;  1IIO A;  1AHR A;  1REC A;  2I18 A;  1NWD A;  1FBV A;  1V1G A;  2M7N A;  3HCM A;  3FWB A;  3BFH A;  1YX7 A;  1Z2C B;  2QEV A;  4USL A;  3TS5 C;  3VRO A;  1YUT A;  1CNP A;  1XFX O;  3GK2 A;  4OKH A;  1PAL A;  1L7Z A;  3PN7 C;  3WXA A;  1NX3 A;  2LMT A;  2O5G A;  1IGV A;  4FQT A;  1CTR A;  3BUW B;  2HET A;  4D1E A;  2L5X B;  2BCA A;  1QX2 A;  1YUR A;  3CAB A;  3KHE A;  3NSL A;  4CFQ A;  1NX1 A;  1BMO A;  2KYC A;  1KK8 C;  1A75 A;  1QV1 A;  2KLE A;  2LLT A;  2ISD A;  4WQ2 A;  5I2O A;  1SL9 A;  2KHN A;  1QS7 A;  2M9G A;  5CPV A;  4MEW A;  1ODB A;  1F55 A;  3OB2 B;  1OE9 B;  1F4Q A;  2GV5 A;  3BJH A;  4CPV A;  1Q80 A;  2M1U A;  3CR2 A;  1DGV A;  5ER5 A;  2JXL A;  2H61 C;  1PSB A;  1XFR A;  1WDC C;  1F70 A;  1DJY A;  1CFD A;  5KU1 A;  3D10 A;  3FWC A;  1QJT A;  1UHH A;  4M2O A;  1V1F A;  1LA0 A;  3EK8 A;  1OOG A;  1B8C A;  4JPZ B;  3EVR A;  4YI8 A;  4BY5 A;  2OS8 B;  3PLF B;  2WC8 A;  1ZUZ A;  1BT6 A;  1K93 D;  2LAN A;  3I5H C;  3DVK A;  4MZL A;  4XJK A;  3CTN A;  4YGA A;  3TZ1 A;  2L4H A;  1KFU L;  1TWO A;  1IRJ A;  3PFV A;  1E8A A;  3L47 A;  3SIB A;  1RTP 1;  4PHN A;  5EL2 A;  1C07 A;  2PYQ A;  2KOT A;  2JOJ A;  2TN4 A;  5HKW A;  1DJX A;  3QME A;  5D7F A;  2JUL A;  3EK4 A;  3WNX B;  4YGE B;  2KFH A;  3ICB A;  5FI2 A;  4MZJ A;  2CNP A;  1N2D A;  1NUB A;  2L51 A;  2ZND A;  4YI9 A;  1KSO A;  3M0W A;  4HSZ A;  1CB1 A;  1Z4H A;  1J1D A;  1WRZ A;  4JQ0 D;  2H8V A;  3R1O A;  3DYE A;  1Y1U A;  4MN0 A;  1CDN A;  2BAP A;  1TNW A;  1DJI A;  2KLD A;  2LLU A;  2KNE A;  2G9B A;  3AKB A;  3SJS A;  1XO5 A;  3JTD C;  3SG5 A;  2L50 A;  1Y1A A;  2QDI A;  1MXL C;  4NQG A;  1CKK A;  3L4A A;  2F3Z A;  2ZRT A;  1SKT A;  1UHJ A;  2AMI A;  1ORG A;  3SIA A;  1QVI Z;  1QIV A;  4N5X A;  2LVI A;  1BLQ A;  4MLW A;  2KAV A;  2V53 A;  2VRG A;  3CGA A;  1K8U A;  1OZO A;  1SBJ A;  3D76 A;  4GGF A;  1LKJ A;  2I2R E;  4I5N B;  1YRU B;  1NYA A;  1SYM A;  4YBH B;  5KSZ A;  1A75 B;  1BOD A;  1L2O B;  1SCM B;  3O78 A;  2M97 A;  2SAS A;  3EG5 B;  1XK4 C;  1A2X A;  3CZ1 A;  1WY9 A;  2G2B A;  2M0R A;  2PQL A;  2K8M B;  1DC1 A;  1B7T Y;  1CM1 A;  1NCZ A;  2M1K B;  2WC5 A;  3CYZ A;  2LVJ A;  4GPL B;  3RM1 A;  3TS5 B;  3EVU A;  1EH2 A;  1JWD A;  2M29 A;  4MSP A;  3PN7 B;  1OMR A;  2MA2 A;  1PK0 D;  2NLN A;  3BQ3 A;  1KSM A;  1YTZ C;  1K95 A;  1TUJ A;  1W7J B;  1TTX A;  2AAO A;  1GGW A;  3UO9 A;  1OOI X;  2QPT A;  2M8U A;  3CZ0 A;  2L5Y A;  1K94 A;  2WOS A;  4JKT A;  4NDD A;  2SCP A;  1JSA A;  1KK8 B;  2F8P A;  3JVT B;  1XFY O;  4XJK B;  1XA5 A;  3MSE B;  1IJ5 A;  3CR4 X;  3OX6 A;  3ZWH A;  2QEH A;  4ORB B;  3CS1 A;  3LLE A;  2CBL A;  1XFW O;  5ER4 X;  1F54 A;  1S1E A;  3NSI A;  1XVJ A;  2WCB A;  2WCH A;  4MZK A;  3BFA A;  2Y4Q A;  1RK9 A;  1OOJ A;  2FJY A;  5I2L A;  5IBW A;  1CLB A;  1ZOT B;  3KO0 A;  1B4C A;  4CID A;  3DY9 A;  5CSF A;  2JPO A;  3B87 A;  3IQO A;  1BJF A;  1BF5 A;  5HLO A;  2PMY A;  1D1O A;  1G4Y R;  1YVL A;  3PM8 A;  2LMU A;  1SL8 A;  1KK7 Z;  1CDM A;  2Y5I A;  4PE7 A;  4GNK B;  2GGM A;  2KDH A;  1OW4 A;  4PHK A;  2KYF A;  2JT8 A;  2ZFD A;  1SW8 A;  2LUC A;  1SRA A;  1OOF A;  4KYN A;  4ORC B;  1J7Q A;  1TCF A;  2FCD A;  3D78 A;  2NZ0 A;  1UHI A;  4YGD B;  1NCY A;  4JWQ A;  1TNQ A;  4QJ5 B;  1W9Z A;  1G8I A;  2JNF A;  2ERB A;  2L0P A;  3K21 A;  3SG6 A;  1ZAC A;  1DJZ A;  3AAK A;  4XYN A;  1WLZ A;  2LMV A;  2LHI A;  3BYA A;  2JU0 A;  4QJ3 B;  3BUM B;  1LIN A;  3FS7 A;  3LL8 B;  4I5K A;  1JC2 A;  1ALV A;  1SNL A;  1TRF A;  1HT9 A;  1S3P A;  2K2F A;  3I5I C;  5AAN A;  1KQM C;  2CT9 A;  2OTG B;  4AOM A;  2JPT A;  1A29 A;  1ALW A;  2M49 B;  4WQ3 A;  1J7O A;  2CXJ A;  4DIR A;  3FIA A;  1NSH A;  1DJW A;  3PAL A;  4OZD A;  1SSE B;  2M3W A;  2WCJ A;  3TUY B;  3V2L A;  1PUL A;  5J3X A;  1K90 D;  1DJH A;  2D8N A;  1FF1 A;  1M45 A;  4C0J A;  4P5O E;  5AEQ A;  3ZNI A;  1WRL A;  1EG3 A;  4ORA B;  1SL7 A;  1Y6W A;  3D77 A;  3NHI A;  3I5G B;  2KI4 C;  2K60 A;  2P6B B;  3B88 A;  3O4X A;  4NDC A;  4DUQ A;  3GK4 X;  1N0Y A;  2Q91 A;  2LC5 A;  3A8R A;  3D74 A;  5GQQ C;  1QLS A;  1VRK A;  4DRW A;  1ZMZ A;  3Q8I A;  4YGB B;  1CM4 A;  4INX A;  2EC6 C;  1K9P A;  1KFU S;  1M46 A;  2WOR A;  1PSR A;  3F45 A;  2H61 A;  4E68 A;  3LK1 A;  1DVI A;  2COL B;  4N1G A;  2KBM A;  3RZS A;  3OBV A;  2MLF C;  1KWO C;  3CZ2 A;  4JD9 A;  4C0K A;  4U8D A;  1KK7 Y;  3TDZ A;  4PAL A;  5I2Q A;  1TNP A;  1CLL A;  1S6J A;  1NX2 A;  1DT7 B;  2MAZ A;  3OP0 A; 
#chains in the Genus database with same CATH homology
 1IWQ A;  1TOP A;  1MR8 A;  1QAT A;  1KQV A;  4UPG A;  1OMD A;  1IQ5 A;  1PRW A;  2Y1N A;  2LE9 B;  2ZKM X;  4MBE A;  1SY9 A;  2KGR A;  4ICB A;  2WCE A;  4GGN A;  1YVH A;  2BBM A;  2F3Y A;  4AQJ A;  3EK7 A;  3EKJ A;  4A4B A;  1NIW A;  2LV7 A;  1Y1X A;  2WCF A;  4GFT A;  3VRN A;  1OSA A;  1YUS A;  2JRF A;  3OB1 B;  1KCY A;  1B8L A;  1EL4 A;  1SPY A;  1TIZ A;  2BBN A;  2IS9 A;  1G33 A;  3DVJ A;  5DKQ A;  5PAL A;  1CDP A;  3VGO A;  3DVE A;  4I5L B;  1R2U A;  1GGZ A;  1U5I A;  1JFJ A;  3TDI A;  4HRG A;  2E30 A;  3SG7 A;  2KQY A;  1B8R A;  3IF7 A;  3SG3 A;  1UUR A;  1QX7 A;  1K9U A;  1YR5 A;  2LP3 A;  5HKZ A;  3GOF A;  1IQ3 A;  1KFX S;  1XK4 A;  4PE1 A;  5I8N A;  1K2H A;  1NCX A;  5BPJ A;  1AJ5 A;  3NSO A;  2I94 A;  4TNC A;  5F6T A;  3EVV A;  4C0L A;  2LNK A;  4QJ4 B;  2OS8 C;  1H8B A;  1WRK A;  1GQM A;  1A4P A;  1LXF C;  1WDC B;  2KI6 C;  2KQ6 A;  3DF0 A;  2KSP A;  2A4J A;  1AK8 A;  3WHT B;  2O60 A;  4YRU A;  2PSR A;  4GBA A;  1BR1 B;  1SR6 C;  1QTX A;  1OQP A;  1ZFS A;  5JOL A;  3I5H B;  2BE6 A;  1JFK A;  2F2O A;  2K7D A;  3DVM A;  3SG4 A;  5CSI A;  2K7B A;  3GK1 A;  2BKH B;  2KFG A;  2HF5 A;  2M7L A;  4ZCU A;  5AFP A;  1M39 A;  2NCO A;  2EC6 B;  3BUN B;  3WHU B;  1OZS A;  2KAY A;  3HX4 A;  4OV2 A;  5HLV A;  3TDU A;  2KFF A;  3CLN A;  1RJV A;  3I5F C;  1JBA A;  2BE4 A;  2KBI A;  1UHN A;  4N1F A;  4F0Z B;  1QXP A;  2BEC A;  2HPS A;  1K96 A;  3KF9 A;  2LAP A;  2JT0 A;  5DKN A;  1QLK A;  4I5J A;  2LCP A;  2AUC A;  1S6C A;  2LVV A;  1QVI Y;  1LA3 A;  5G08 A;  2LLS A;  2MBX A;  1AUI B;  1DGU A;  4P2Y B;  5KTY A;  1FI6 A;  3JTD B;  3A4U B;  4GUK A;  1LVC D;  3C1V A;  1IJ6 A;  1IKU A;  1CMG A;  1XFU O;  3AKA A;  1IG5 A;  2CTN A;  5AXI A;  1L2O C;  1SCM C;  2R2I A;  5B8I B;  4DCK A;  2JT3 A;  3VRP A;  3LCP C;  1JUO A;  1MWN A;  1U5I B;  2DOQ A;  4YGC B;  3OHM B;  5TNC A;  1UHK A;  1J1E A;  2PAL A;  1RFJ A;  4PE0 A;  5CSJ A;  1F4O A;  1RRO A;  4Q04 A;  3VRR A;  3O2P A;  2JC2 A;  1DMO A;  1WLM A;  3PAT A;  1B7T Z;  4R1E A;  1CFP A;  1MQ1 A;  2PRU A;  1DJG A;  4HRE E;  3JVT C;  1EXR A;  3DF0 B;  2Y1M A;  2MJW B;  1BG1 A;  1IH0 A;  1YUU A;  1FI5 A;  2BL0 C;  1NPQ A;  1TN4 A;  2K0J A;  1J7R A;  4ZCV A;  2JWW A;  4PDZ A;  2JZI A;  1HQV A;  3KPX A;  3AAJ A;  2PVB A;  4IL1 A;  4OVN F;  2CCM A;  1RWY A;  2B1U A;  2NXQ A;  1FPW A;  3SG2 A;  2JNX A;  3EKH A;  2HQW A;  1CFF A;  1S5G Z;  3BXK A;  3BOW A;  4PCW A;  4AQI A;  1SK6 D;  2RGI A;  1JF2 A;  1SR6 B;  2L98 A;  5JJG A;  1F71 A;  2LP2 A;  2LHL A;  3H4S E;  5FYX A;  2BCX A;  1UUS A;  2BKI B;  2PAS A;  4DS7 A;  2ZN8 A;  1J55 A;  1TNX A;  2I7A A;  1A03 A;  1S6I A;  3O4Y A;  4A4C A;  1XFV O;  4GGF C;  1EJ3 A;  2GGZ A;  2LUX A;  1CLM A;  2NCP A;  1FW4 A;  1J7P A;  1B47 A;  1CDL A;  1NP8 A;  3I5F B;  3D0Y A;  1MUX A;  1AP4 A;  3PSR A;  4GAO A;  3LK0 A;  1DF0 A;  1M63 B;  3BUO B;  2OPO A;  1MXE A;  4OCI A;  2F33 A;  2H2K A;  1UP5 A;  1S26 D;  2JTT A;  4M2Q A;  2OTG C;  2K61 A;  1B9A A;  4MRX A;  3BUX B;  4CLN A;  2WND A;  2JTZ A;  2ZRS A;  5D69 A;  4FQO A;  4PE4 A;  1BU3 A;  4ETO A;  1Y0V H;  4L9M A;  1H4B A;  1X02 A;  3QRX A;  3I5I B;  2F2P A;  1KQM B;  4MRY A;  1F8H A;  1QV0 A;  2K7O A;  1XYD A;  1BR4 B;  5DKR A;  2KAX A;  5HKY A;  5HYD A;  1JF0 A;  1AVS A;  3TUY C;  1SMG A;  3NXA A;  4PHM A;  2L4I A;  4FTG A;  1M31 A;  1TCO B;  2KGB C;  2K7C A;  1MF8 B;  3I5G C;  2QAC A;  1CFC A;  4PHJ A;  3CR5 X;  2LM5 A;  3CWG A;  1C7V A;  2JQ6 A;  1KFX L;  2EHB A;  2JXC A;  4HRH A;  1K9K A;  2Q4U A;  1B1G A;  1PVA A;  1MHO A;  4CFR A;  4MVF A;  2FJU B;  3BOW B;  2KI4 B;  1OMV A;  1QAS A;  1YRT B;  4WRI A;  3NSK A;  2KI6 D;  2EGD A;  1YX8 A;  2BL0 B;  3E3R A;  2MRD A;  1DTL A;  1GJY A;  3IQQ A;  1S5G Y;  3OX5 A;  1C7W A;  1S36 A;  1N65 A;  1QIW A;  1QX5 B;  2FCE A;  2ZNE A;  1NX0 A;  4NDB A;  4M2P A;  1PVB A;  2HQ8 A;  4OR9 B;  1KWO B;  2L2E A;  1UWO A;  3RLZ A;  2FOT A;  3D0Y B;  3DD4 A;  2ZN9 A;  2MHH A;  5K89 A;  1XFZ O;  1DF0 B;  1EG4 A;  1SCV A;  2E6W A;  5AER A;  3VRQ A;  1BOC A;  1W7I B;  3CZT X;  2MLE C;  3KEV A;  4BY4 A;  2K2A A;  1AJ4 A;  5CSN A;  1CMF A;  2BCB A;  2LVK A;  1R6P A;  3O6B A;  1AHR A;  1REC A;  2I18 A;  1NWD A;  1FBV A;  1V1G A;  2M7N A;  3HCM A;  3FWB A;  1YX7 A;  4USL A;  3TS5 C;  3VRO A;  1YUT A;  1CNP A;  1XFX O;  3GK2 A;  4OKH A;  1PAL A;  1L7Z A;  3PN7 C;  3WXA A;  1NX3 A;  2LMT A;  2O5G A;  1IGV A;  1CTR A;  3BUW B;  2HET A;  4D1E A;  2L5X B;  2BCA A;  1QX2 A;  1YUR A;  3NSL A;  3KHE A;  4CFQ A;  1NX1 A;  1BMO A;  2KYC A;  1KK8 C;  1A75 A;  1QV1 A;  2LLT A;  2ISD A;  5I2O A;  4WQ2 A;  1SL9 A;  2KHN A;  1QS7 A;  2M9G A;  5CPV A;  4MEW A;  1ODB A;  1F55 A;  3OB2 B;  1OE9 B;  1F4Q A;  2GV5 A;  4CPV A;  1Q80 A;  2M1U A;  3CR2 A;  1DGV A;  5ER5 A;  2JXL A;  2H61 C;  1PSB A;  1F70 A;  1WDC C;  1DJY A;  1CFD A;  5KU1 A;  3D10 A;  3FWC A;  1QJT A;  1UHH A;  4M2O A;  1V1F A;  1LA0 A;  3EK8 A;  1B8C A;  4JPZ B;  3EVR A;  4YI8 A;  4BY5 A;  2OS8 B;  3PLF B;  2WC8 A;  1ZUZ A;  1BT6 A;  1K93 D;  2LAN A;  3I5H C;  3DVK A;  4MZL A;  4XJK A;  3CTN A;  4YGA A;  3TZ1 A;  2L4H A;  1KFU L;  3PFV A;  1IRJ A;  3SIB A;  1E8A A;  1RTP 1;  4PHN A;  1C07 A;  2TN4 A;  2KOT A;  2JOJ A;  5HKW A;  1DJX A;  5D7F A;  2JUL A;  3EK4 A;  3WNX B;  4YGE B;  2KFH A;  3ICB A;  4MZJ A;  2CNP A;  1N2D A;  1NUB A;  2L51 A;  2ZND A;  4YI9 A;  1KSO A;  3M0W A;  4HSZ A;  1CB1 A;  1J1D A;  1WRZ A;  4JQ0 D;  1Y1U A;  4MN0 A;  1CDN A;  1TNW A;  1DJI A;  2LLU A;  2KNE A;  2G9B A;  3AKB A;  3SJS A;  1XO5 A;  3JTD C;  3SG5 A;  2L50 A;  1Y1A A;  1MXL C;  4NQG A;  1CKK A;  2F3Z A;  2ZRT A;  1SKT A;  1UHJ A;  2AMI A;  3SIA A;  1QVI Z;  1QIV A;  4N5X A;  2LVI A;  1BLQ A;  4MLW A;  2KAV A;  2V53 A;  2VRG A;  3CGA A;  1K8U A;  1OZO A;  1SBJ A;  4GGF A;  4I5N B;  1LKJ A;  2I2R E;  1YRU B;  1NYA A;  1SYM A;  4YBH B;  5KSZ A;  1A75 B;  1BOD A;  1L2O B;  1SCM B;  3O78 A;  2M97 A;  2SAS A;  1GGW A;  1XK4 C;  1A2X A;  1WY9 A;  2G2B A;  2M0R A;  2K8M B;  1B7T Y;  1CM1 A;  1NCZ A;  2M1K B;  4GPL B;  2LVJ A;  3RM1 A;  3TS5 B;  3EVU A;  1EH2 A;  1JWD A;  2M29 A;  4MSP A;  3PN7 B;  1OMR A;  2MA2 A;  1PK0 D;  2NLN A;  3BQ3 A;  1KSM A;  1YTZ C;  1K95 A;  1W7J B;  2AAO A;  1TTX A;  2QPT A;  2M8U A;  1K94 A;  2WOS A;  4NDD A;  1JSA A;  2SCP A;  1KK8 B;  2F8P A;  3JVT B;  1XFY O;  4XJK B;  1XA5 A;  3MSE B;  1IJ5 A;  3CR4 X;  3OX6 A;  3ZWH A;  4ORB B;  3CS1 A;  3LLE A;  2CBL A;  1XFW O;  5ER4 X;  1F54 A;  1S1E A;  3NSI A;  1XVJ A;  2WCB A;  4MZK A;  2Y4Q A;  1RK9 A;  1OOJ A;  5I2L A;  5IBW A;  1CLB A;  1ZOT B;  3KO0 A;  1B4C A;  4CID A;  5CSF A;  3IQO A;  1BJF A;  1BF5 A;  5HLO A;  2PMY A;  1D1O A;  1G4Y R;  1YVL A;  3PM8 A;  2LMU A;  1SL8 A;  1KK7 Z;  1CDM A;  2Y5I A;  4PE7 A;  4GNK B;  2GGM A;  2KDH A;  4PHK A;  2KYF A;  2JT8 A;  2ZFD A;  1SW8 A;  2LUC A;  1SRA A;  4ORC B;  1J7Q A;  1TCF A;  2FCD A;  2NZ0 A;  1UHI A;  4YGD B;  1NCY A;  4JWQ A;  1TNQ A;  4QJ5 B;  1G8I A;  2JNF A;  2L0P A;  3K21 A;  3SG6 A;  1ZAC A;  1DJZ A;  3AAK A;  4XYN A;  1WLZ A;  2LMV A;  2LHI A;  3BYA A;  2JU0 A;  4QJ3 B;  3BUM B;  1LIN A;  3FS7 A;  3LL8 B;  4I5K A;  1JC2 A;  1ALV A;  1SNL A;  1TRF A;  1HT9 A;  1S3P A;  2K2F A;  3I5I C;  5AAN A;  1KQM C;  2CT9 A;  2OTG B;  4AOM A;  2JPT A;  1A29 A;  1ALW A;  2M49 B;  4WQ3 A;  1J7O A;  2CXJ A;  4DIR A;  3FIA A;  1NSH A;  1DJW A;  3PAL A;  2M3W A;  3TUY B;  1PUL A;  5J3X A;  1K90 D;  1DJH A;  2D8N A;  1FF1 A;  1M45 A;  4C0J A;  4P5O E;  5AEQ A;  3ZNI A;  1WRL A;  1EG3 A;  4ORA B;  1SL7 A;  1Y6W A;  3I5G B;  2KI4 C;  2P6B B;  4DUQ A;  4NDC A;  3GK4 X;  1N0Y A;  2Q91 A;  2LC5 A;  3A8R A;  5GQQ C;  1QLS A;  1VRK A;  4DRW A;  1ZMZ A;  4YGB B;  1CM4 A;  2EC6 C;  1K9P A;  1KFU S;  1M46 A;  2WOR A;  1PSR A;  3F45 A;  2H61 A;  4E68 A;  3LK1 A;  1DVI A;  2COL B;  4N1G A;  2KBM A;  2MLF C;  1KWO C;  4C0K A;  4U8D A;  1KK7 Y;  3TDZ A;  4PAL A;  5I2Q A;  1TNP A;  1CLL A;  1S6J A;  1NX2 A;  1DT7 B;  2MAZ A;  3OP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...