4CFRA

Ca-bound s100a4 c3s, c81s, c86s and f45w mutant complexed with non- muscle myosin iia
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
94
structure length
94
Chain Sequence
ASPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSWLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSSIAMMSNEFFEGFPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The C-Terminal Random Coil Region Tunes the Ca2+-Binding Affinity of S100A4 Through Conformational Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ca-binding protein/motor protein
molecule keywords PROTEIN S100-A4
total genus 35
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4cfrA00
2ZNEA 1DF0A 1UHIA 1A03A 4PALA 1DGVA 3CZTX 4F0ZB 2PSRA 2PRUA 3FWBA 4YGCB 1AVSA 4ORAB 3CWGA 2E30A 2KFHA 3CS1A 4OVNF 1KFUS 1SBJA 3SG2A 4P5OE 1YR5A 1G4YR 1SR6C 1EH2A 5AERA 1SL9A 2Y1NA 2LANA 1KWOC 1QASA 3A8RA 2LCPA 4GGFC 2LE9B 5HYDA 2BL0C 1ZFSA 1SYMA 1NPQA 1NX0A 1PRWA 2K61A 2MJWB 3OB1B 3TS5B 1DF0B 2G9BA 2M1KB 1TOPA 2KYFA 2M7LA 1MXEA 5CSIA 1BG1A 1CTRA 4CFQA 4U8DA 4MLWA 1L2OC 2A4JA 3EVRA 3RLZA 3TZ1A 4A4CA 4R1EA 1EJ3A 1K8UA 3DF0B 4MZLA 4YI9A 2LUCA 1WRZA 1WRLA 3NSKA 1RFJA 4M2OA 2HQ8A 2IS9A 3BQ3A 5K89A 2E6WA 1J7OA 3BUXB 2SASA 2LNKA 2BCXA 3NSIA 1S36A 1FBVA 2L98A 1YRUB 5I8NA 1UHHA 1JWDA 1QS7A 1UUSA 2K8MB 4PCWA 4HSZA 3PN7B 2NXQA 2WCBA 3BUNB 1BOCA 1UHKA 2D8NA 2JU0A 2KI6C 1J7QA 1XFXO 2FCEA 5G08A 2KFFA 2AAOA 2M0RA 1XO5A 2HF5A 2M1UA 2JZIA 1JC2A 3E3RA 2CXJA 1CNPA 1Y6WA 4C0LA 3IQQA 3GOFA 4N1FA 4QJ4B 3SIAA 2CTNA 4HREE 2LM5A 4MBEA 4AQJA 1TTXA 2MRDA 1LXFC 2Q4UA 3A4UB 1KCYA 1N65A 3I5GB 2BCBA 3SG5A 1E8AA 2F2OA 4MRXA 1GGWA 2EC6C 1KQMC 3CR5X 3EK7A 3DF0A 5IBWA 1S1EA 1GQMA 4NDCA 2BBNA 2QACA 2ZN9A 1DMOA 1BODA 4ZCUA 5D7FA 2K2FA 2KGRA 2Y4QA 3VGOA 1V1FA 2KI4C 1S3PA 1QV0A 1CLLA 2CBLA 2LLTA 3HX4A 1XVJA 1H4BA 2LVKA 5D69A 2KOTA 2BKHB 1IQ3A 4GGNA 4GFTA 4GUKA 3GK4X 1C7WA 1TNPA 3VRNA 1PALA 2H61A 3PLFB 1YX8A 2F8PA 2KNEA 1B1GA 1A75B 2JXCA 2JPTA 2JTZA 1ODBA 1DJXA 1QV1A 1EG3A 2JNFA 1F71A 1TRFA 3OHMB 1F8HA 2CCMA 1BR1B 2M9GA 4BY5A 2JQ6A 1BT6A 2M97A 2MHHA 1CFCA 2KHNA 1M63B 1QTXA 5HLOA 3SIBA 1F4QA 1XFZO 1S6JA 1DJYA 3CTNA 1J1EA 3ICBA 4CLNA 3OX5A 5CSNA 1A29A 1PK0D 1B47A 1KFUL 1K96A 4N1GA 1J7PA 5CSFA 4PHJA 1YRTB 1BLQA 1G33A 2JWWA 3BYAA 2H2KA 5DKNA 1QX7A 1G8IA 1K9KA 1SKTA 1SW8A 3PATA 2NZ0A 1NCYA 3SJSA 1SCMB 2WC8A 1OMRA 1UURA 1JF0A 3SG6A 4JPZB 1QXPA 3KF9A 4GPLB 1AUIB 1DTLA 3FWCA 3I5FB 5BPJA 1KK7Y 2I2RE 1OMDA 1HT9A 2BE6A 1KSOA 1CM4A 2B1UA 3BUWB 1K9PA 2JTTA 2OPOA 3BXKA 1YVHA 3JVTB 4I5JA 1HQVA 3EKHA 1RK9A 2WNDA 5TNCA 1TNQA 2L4IA 4OV2A 3I5IB 1KQVA 1V1GA 3LK0A 1AJ4A 2G2BA 1NX1A 1K9UA 1M39A 1IRJA 1TNXA 4I5LB 2H61C 1TN4A 2LAPA 1R6PA 4M2PA 2BE4A 2JRFA 3DVJA 3TDUA 3I5IC 1K94A 2MBXA 1QLSA 1QX2A 1EG4A 4OCIA 1OQPA 3NXAA 4D1EA 3JVTC 3RM1A 2LP2A 2PVBA 4PHKA 2JXLA 3SG7A 1RTP1 1LVCD 1PVAA 5JOLA 4DIRA 3D0YA 3I5FC 1LA3A 4CIDA 2KQ6A 1LKJA 2PALA 4WRIA 3OB2B 2KI4B 2K7BA 1SCMC 2ZN8A 1U5IB 2LMUA 1IG5A 2M3WA 3H4SE 2EHBA 2GV5A 3M0WA 2KAXA 1K93D 1OOJA 1QATA 4YI8A 2EC6B 1D1OA 5AEQA 5HKWA 1S5GZ 1JSAA 4HRHA 3I5GC 1SCVA 3EK4A 3DVKA 1DJZA 2BCAA 2K7DA 3SG4A 3VRQA 3OX6A 3WNXB 2WOSA 1MXLC 4Q04A 1BJFA 1SPYA 3KHEA 4AQIA 1NUBA 3VROA 4MZKA 4PE0A 4JQ0D 1GJYA 5I2QA 1UWOA 1B9AA 2LLUA 1NSHA 1YUTA 4MVFA 1UP5A 1FF1A 1H8BA 4QJ5B 2MLEC 2L4HA 1Y1UA 1B8CA 4N5XA 1CMGA 2GGZA 3PM8A 1NYAA 4ORCB 2KDHA 4HRGA 3PN7C 4FQOA 2JC2A 4QJ3B 1XK4A 2JOJA 4GGFA 2QPTA 1PVBA 3C1VA 2ZRTA 2KGBC 1RECA 2PASA 1NWDA 2O60A 3DVMA 2P6BB 4WQ2A 5KU1A 1CMFA 3CGAA 1KQMB 1ALVA 3AKBA 2M8UA 3DD4A 3KO0A 4UPGA 1MWNA 1Y1XA 1X02A 1RWYA 2L5XB 2KYCA 2LC5A 1KK7Z 3AAKA 1N2DA 3OP0A 5ER5A 2LMTA 3VRRA 2LP3A 1VRKA 3TDIA 2Y1MA 4OR9B 1CDLA 2BL0B 2K0JA 1SK6D 4ZCVA 1ZUZA 3FS7A 1AHRA 3FIAA 1PSRA 1Y0VH 1AJ5A 1C7VA 1IKUA 4IL1A 3O2PA 2M7NA 1M31A 3O6BA 4PE1A 2NLNA 2LVVA 4PE4A 1DJGA 1S5GY 1IH0A 1LINA 4CPVA 2FJUB 1CFFA 1Q80A 5F6TA 3WHUB 1LA0A 1QIWA 1S6CA 2WCEA 4FTGA 1PULA 1L7ZA 1OZSA 2JT0A 1ZOTB 5GQQC 1CM1A 2L51A 4E68A 4GAOA 2MAZA 2F2PA 3D10A 4JWQA 1WLMA 2LMVA 3WXAA 1L2OB 1CLMA 1DJIA 3EVUA 1NIWA 2KSPA 4NDDA 3DVEA 1Y1AA 2KBMA 1CFPA 1WLZA 3GK2A 2MLFC 3HCMA 1SRAA 2LLSA 3IF7A 2CT9A 3TS5C 5CPVA 2CNPA 2AMIA 1A75A 3AKAA 5DKQA 5HKYA 5KSZA 1CLBA 4ORBB 2KBIA 1CFDA 1RROA 1CB1A 1KWOB 1NP8A 1JFJA 4BY4A 3NSOA 1U5IA 3LK1A 5FYXA 1AK8A 3EVVA 1C07A 2JT8A 1SR6B 1S6IA 3PALA 2VRGA 2EGDA 4M2QA 2R2IA 1OMVA 2ZNDA 3D0YB 1MF8B 4MSPA 2HETA 1UHJA 1S26D 4AOMA 2WCFA 2FCDA 1TNWA 1XA5A 4PHNA 2KAYA 2LVIA 1BR4B 2LHLA 2TN4A 4NQGA 1A2XA 5AFPA 2KI6D 1MR8A 2PMYA 2HPSA 3CLNA 5AANA 4GBAA 1SNLA 2LUXA 1JF2A 2F3YA 3QRXA 2BECA 4USLA 3WHTB 5PALA 4XJKB 2JNXA 4A4BA 3LL8B 1WDCB 3JTDB 1RJVA 1XFWO 2OTGC 1ALWA 4YGDB 1IJ5A 2BBMA 3I5HB 4PDZA 1OZOA 1J7RA 2COLB 2M49B 5ER4X 5HKZA 4CFRA 4MEWA 5DKRA 1W7JB 1B7TY 1YVLA 1JFKA 1OSAA 3F45A 1R2UA 2I18A 1KK8C 1FPWA 1IGVA 1F4OA 4PHMA 5I2OA 3O78A 2NCPA 1KSMA 1IQ5A 1WRKA 2OS8C 3O4YA 2ISDA 4YGAA 1TCFA 4YRUA 1YURA 1SMGA 1NCZA 1BF5A 1FW4A 1NX3A 3PFVA 3BUOB 3EK8A 3ZNIA 2F33A 1XFVO 1PSBA 2KFGA 1BU3A 5B8IB 2L0PA 4GNKB 2K7CA 2Q91A 1QJTA 4I5NB 4YBHB 3TUYB 1F55A 1F70A 1DJHA 3GK1A 2I7AA 4DCKA 4DUQA 2F3ZA 3SG3A 2LVJA 2ZFDA 1MUXA 2OS8B 4WQ3A 1FI6A 1K2HA 1MHOA 1DT7B 1MQ1A 2AUCA 1KK8B 1YX7A 1JUOA 1DGUA 1DJWA 1CDPA 2NCOA 1J1DA 1XYDA 2GGMA 1IJ6A 3MSEB 1XK4C 2BKIB 1K95A 1SL8A 1K90D 4NDBA 1NX2A 1UHNA 1AP4A 4XJKA 3BOWA 3I5HC 5KTYA 2FOTA 2JT3A 4OKHA 1NCXA 1KFXS 1YUSA 3KEVA 1EL4A 1BMOA 1OE9B 3ZWHA 1QIVA 4DS7A 1EXRA 1TIZA 1QLKA 3NSLA 2SCPA 2DOQA 3BOWB 3CR4X 3EKJA 4I5KA 4XYNA 4MRYA 1B7TZ 2ZKMX 5AXIA 1M46A 5J3XA 2L50A 3TUYC 3BUMB 3AAJA 1CKKA 1CDMA 1QX5B 4YGEB 2V53A 2LV7A 2L2EA 3CR2A 4PE7A 1FI5A 1YUUA 1B4CA 2MA2A 4MZJA 3IQOA 4DRWA 1ZMZA 1XFUO 4TNCA 1ZACA 3PSRA 4P2YB 1B8RA 2Y5IA 2JULA 4ICBA 1KFXL 2KAVA 2I94A 1CDNA 1GGZA 1WY9A 2K2AA 2RGIA 5HLVA 4ETOA 1XFYO 1J55A 3TDZA 4MN0A 5JJGA 1F54A 2KQYA 4C0JA 2M29A 4YGBB 1W7IB 3KPXA 1DVIA 1YTZC 1N0YA 2WORA 1TCOB 2OTGB 1SY9A 1JBAA 5CSJA 3JTDC 1WDCC 2ZRSA 3LLEA 4C0KA 1M45A 2O5GA 3K21A 1IWQA 3LCPC 1SL7A 2LHIA 5I2LA 1A4PA 1B8LA 1QVIY 4L9MA 1QVIZ 2HQWA 2K7OA 3VRPA
chains in the Genus database with same CATH superfamily
2ZNEA 1DF0A 1UHIA 1A03A 4PALA 1DGVA 3CZTX 4F0ZB 2PSRA 2PRUA 3FWBA 4YGCB 1AVSA 4ORAB 2QEHA 3CWGA 1C3ZA 2E30A 2KFHA 3CS1A 4OVNF 1KFUS 1SBJA 3SG2A 4P5OE 1YR5A 1G4YR 1SR6C 1EH2A 2KPHA 1SL9A 5AERA 2Y1NA 2LANA 1KWOC 3DY9A 1QASA 3A8RA 2LCPA 4GGFC 2LE9B 5HYDA 2BL0C 1ZFSA 1SYMA 1NPQA 1NX0A 1PRWA 2K61A 2MJWB 3OB1B 3TS5B 1DF0B 2G9BA 2M1KB 1TOPA 2KYFA 2M7LA 1MXEA 5CSIA 1BG1A 1CTRA 4CFQA 4U8DA 3S0FA 4MLWA 1L2OC 2A4JA 3EVRA 3RLZA 3TZ1A 4A4CA 4R1EA 1EJ3A 1K8UA 3DF0B 4MZLA 4YI9A 2LUCA 1WRZA 1W9ZA 2BAPA 1WRLA 3NSKA 1RFJA 4M2OA 2HQ8A 2IS9A 3BQ3A 5K89A 2E6WA 1J7OA 3BUXB 2SASA 2LNKA 2BCXA 3NSIA 1S36A 1FBVA 2L98A 1YRUB 5I8NA 1UHHA 1JWDA 1QS7A 1UUSA 2K8MB 4PCWA 4HSZA 3PN7B 2NXQA 2WCBA 1Z4HA 3BUNB 2WCKA 1BOCA 1UHKA 2D8NA 2JU0A 2KI6C 2PYQA 3SS3A 1J7QA 3S0EA 1XFXO 2FCEA 5G08A 2KFFA 2AAOA 2M0RA 1XO5A 2HF5A 2M1UA 2JZIA 1JC2A 3E3RA 3NGVA 2CXJA 4KYNA 1CNPA 1Y6WA 4C0LA 3IQQA 3CABA 3GOFA 4N1FA 4QJ4B 3SIAA 2CTNA 4HREE 2LM5A 4MBEA 4AQJA 1TTXA 2MRDA 1LXFC 2Q4UA 2YGUA 3A4UB 1KCYA 1N65A 3I5GB 2BCBA 3SG5A 1E8AA 2F2OA 4MRXA 1GGWA 2EC6C 1KQMC 3CR5X 3EK7A 3DF0A 5IBWA 1S1EA 1GQMA 4NDCA 3SS5A 2BBNA 2QACA 2ZN9A 1DMOA 1BODA 4ZCUA 5D7FA 2K2FA 2KGRA 2Y4QA 3VGOA 1V1FA 2KI4C 1S3PA 1QV0A 1CLLA 2CBLA 2LLTA 3HX4A 1XVJA 1H4BA 2LVKA 1DC1A 5D69A 2KOTA 2BKHB 1IQ3A 4GGNA 4GFTA 4GUKA 3GK4X 1C7WA 1TNPA 3VRNA 1PALA 2H61A 3PLFB 3NHIA 1YX8A 2F8PA 2KNEA 1B1GA 1A75B 2JXCA 2JPTA 2JTZA 1ODBA 1DJXA 1QV1A 1EG3A 1T14A 3CZ0A 2JNFA 1F71A 1TRFA 3OHMB 1F8HA 2CCMA 1IIOA 1BR1B 1P28A 2M9GA 4BY5A 2JQ6A 1BT6A 2M97A 2MHHA 1CFCA 1TUJA 2KHNA 4FQTA 1M63B 1QTXA 3Q8IA 5HLOA 3SIBA 1F4QA 1XFZO 1S6JA 1DJYA 3CTNA 1ORGA 1J1EA 3ICBA 4CLNA 3OX5A 5CSNA 1A29A 1PK0D 1B47A 1KFUL 1K96A 4N1GA 1J7PA 5CSFA 4PHJA 1YRTB 1BLQA 2L5YA 1G33A 2JWWA 3BYAA 2H2KA 5DKNA 1QX7A 1G8IA 1K9KA 1SKTA 1SW8A 3BFBA 3PATA 2NZ0A 3R1PA 1NCYA 3SJSA 1SCMB 2WC8A 1OMRA 1UURA 1JF0A 3SG6A 1OOGA 4JPZB 1QXPA 3KF9A 4GPLB 1AUIB 1DTLA 3FWCA 3I5FB 5BPJA 1KK7Y 2I2RE 1OMDA 1HT9A 2BE6A 2GTEA 1KSOA 1CM4A 2B1UA 3BUWB 1K9PA 2JTTA 2OPOA 3BXKA 1YVHA 3JVTB 4I5JA 1HQVA 3EKHA 1RK9A 2WNDA 5TNCA 1TNQA 2L4IA 4OV2A 3I5IB 1LS8A 1KQVA 1V1GA 3LK0A 1AJ4A 2G2BA 2H8VA 1XFRA 1NX1A 2WC5A 1K9UA 1M39A 1SSEB 1IRJA 1TNXA 4I5LB 4JKTA 2H61C 5DICA 3D78A 1TN4A 2LAPA 1R6PA 4M2PA 2BE4A 2JRFA 3DVJA 2WCLA 3TDUA 3I5IC 3EG5B 3CDNA 1K94A 2MBXA 1QLSA 1QX2A 1EG4A 4OCIA 1OQPA 3NXAA 4D1EA 3JVTC 3RM1A 2LP2A 2PVBA 2QEOA 2PQLA 4PHKA 1OOHA 2JXLA 3SG7A 1RTP1 1LVCD 1PVAA 5JOLA 4DIRA 3D0YA 3I5FC 1LA3A 4CIDA 2KQ6A 1LKJA 2PALA 4WRIA 3OB2B 2KI4B 3RZSA 1OOIX 2K7BA 1SCMC 2ZN8A 1U5IB 2LMUA 1IG5A 2M3WA 3H4SE 2EHBA 2GV5A 3M0WA 2KAXA 1K93D 1OOJA 1QATA 4INWA 1CDNA 4YI8A 2EC6B 1D1OA 5AEQA 5HKWA 1S5GZ 1JSAA 2KLDA 4HRHA 3I5GC 1SCVA 3EK4A 3DVKA 1DJZA 2BCAA 2K7DA 3DZTA 3SG4A 3OX6A 3VRQA 2WOSA 1MXLC 4Q04A 1BJFA 3L47A 1SPYA 3KHEA 4AQIA 1NUBA 3VROA 4MZKA 4PE0A 3B86A 2K60A 2WCHA 4JQ0D 1GJYA 5I2QA 1UWOA 1B9AA 2LLUA 1NSHA 1YUTA 4MVFA 1UP5A 1FF1A 1H8BA 3FE9A 4QJ5B 2MLEC 2L4HA 1Y1UA 3CYZA 1B8CA 2L2CA 2WCMA 3O4XA 4N5XA 2GGZA 1CMGA 3PM8A 1NYAA 4ORCB 2KDHA 4HRGA 3PN7C 4FQOA 2JC2A 4QJ3B 3B7AA 1XK4A 2JOJA 3L4LA 4GGFA 2QPTA 1QWVA 1PVBA 3C1VA 3UNWA 2ZRTA 2KGBC 1RECA 2PASA 1NWDA 2O60A 3DVMA 2P6BB 4WQ2A 5KU1A 1CMFA 3CGAA 1KQMB 1ALVA 3AKBA 2M8UA 3DD4A 3KO0A 1DEKA 4UPGA 1MWNA 2WCJA 2ERBA 1Y1XA 1X02A 1RWYA 2L5XB 2KYCA 2LC5A 1KK7Z 3AAKA 1N2DA 3OP0A 5ER5A 2LMTA 3VRRA 2LP3A 1VRKA 5FI7A 2P70A 3DYEA 3TDIA 2Y1MA 4OR9B 1CDLA 2BL0B 2K0JA 1SK6D 4ZCVA 1ZUZA 3FS7A 1AHRA 3FIAA 1PSRA 1Y0VH 1AJ5A 1C7VA 1IKUA 4IL1A 3O2PA 2M7NA 1M31A 3O6BA 4PE1A 1TWOA 1OOFA 2NLNA 2LVVA 4PE4A 1DJGA 1S5GY 1IH0A 1LINA 4CPVA 2FJUB 2QDIA 3B6XA 1CFFA 1C3YA 1Q80A 5F6TA 3WHUB 1LA0A 1QIWA 3WNXB 1S6CA 2WCEA 3PM2A 4FTGA 1PULA 1L7ZA 1OZSA 2JT0A 1ZOTB 5GQQC 1CM1A 2L51A 4E68A 4GAOA 2MAZA 2F2PA 3D10A 3R72A 1WLMA 4JWQA 2LMVA 3WXAA 1L2OB 1CLMA 1DJIA 3EVUA 1NIWA 2KSPA 4NDDA 3DVEA 3S0GA 1Y1AA 2KBMA 1CFPA 1TUZA 1WLZA 3GK2A 2MLFC 3HCMA 1SRAA 2LLSA 3B87A 2CT9A 3IF7A 3TS5C 5CPVA 2CNPA 2AMIA 1GM0A 1A75A 3AKAA 5DKQA 5HKYA 5KSZA 1CLBA 4ORBB 2KBIA 1CFDA 3D74A 1RROA 1CB1A 3UO9A 1KWOB 1NP8A 1JFJA 4BY4A 3NSOA 1U5IA 3LK1A 3N7HA 5FYXA 1AK8A 3EVVA 1C07A 2JT8A 1SR6B 1S6IA 5HL1A 3PALA 2VRGA 2EGDA 4M2QA 2R2IA 1OMVA 2ZNDA 3D0YB 1MF8B 4MSPA 1DQEA 2HETA 1UHJA 1S26D 4AOMA 2WCFA 2FCDA 1TNWA 1XA5A 2BNXA 3CZ1A 3FE6A 4PHNA 2KAYA 2LVIA 3S0BA 1BR4B 2LHLA 2TN4A 4NQGA 1A2XA 5AFPA 2KI6D 1MR8A 2PMYA 2HPSA 3CLNA 3DXLA 2JPOA 5AANA 4GBAA 1SNLA 2LUXA 1JF2A 2F3YA 3QRXA 2BECA 4USLA 3WHTB 5PALA 4XJKB 2JNXA 3D76A 4A4BA 3LL8B 1WDCB 3JTDB 1RJVA 2QEVA 1Z2CB 1XFWO 2OTGC 1ALWA 4YGDB 1IJ5A 2BBMA 3I5HB 4PDZA 1OZOA 1J7RA 2COLB 2M49B 5ER4X 5HKZA 4CFRA 4MEWA 4JD9A 5DKRA 5EL2A 1W7JB 1B7TY 1YVLA 4INXA 1JFKA 1OSAA 3F45A 1R2UA 3OGNA 2I18A 1KK8C 1FPWA 1IGVA 1F4OA 3PJIA 4PHMA 5I2OA 3O78A 2NCPA 3NHTA 1KSMA 1IQ5A 1WRKA 2OS8C 3B88A 3O4YA 2ISDA 3BFAA 4YGAA 1TCFA 4YRUA 1YURA 2FJYA 1SMGA 1NCZA 1BF5A 1FW4A 1NX3A 3PFVA 3BUOB 3EK8A 3D73A 3ZNIA 2F33A 1XFVO 3VB1A 1PSBA 2KFGA 1BU3A 5B8IB 2L0PA 4GNKB 2K7CA 2Q91A 1QJTA 4I5NB 4YBHB 3TUYB 1F55A 1F70A 5FI6A 3D75A 3R1VA 1DJHA 3GK1A 3R1OA 3K1EA 2I7AA 4DCKA 4DUQA 2F3ZA 3SG3A 2LVJA 2ZFDA 1MUXA 2KLEA 2OS8B 4WQ3A 1FI6A 1K2HA 1MHOA 1DT7B 1MQ1A 2AUCA 1KK8B 1YX7A 1JUOA 1DGUA 1DJWA 1CDPA 2NCOA 1J1DA 1XYDA 2GGMA 1IJ6A 3MSEB 1XK4C 2BKIB 1K95A 1SL8A 1K90D 4NDBA 1NX2A 1UHNA 1AP4A 4XJKA 3BOWA 3I5HC 5KTYA 2FOTA 2JT3A 4OKHA 1NCXA 1KFXS 1YUSA 3KEVA 1EL4A 1BMOA 1OE9B 3ZWHA 1QIVA 3BJHA 4DS7A 1EXRA 1TIZA 4IJ7A 1QLKA 3NSLA 2SCPA 2DOQA 3BOWB 3CR4X 3EKJA 4I5KA 4XYNA 4MRYA 1B7TZ 2ZKMX 4OZDA 5AXIA 1M46A 5J3XA 2L50A 3SS4A 3TUYC 3BUMB 3AAJA 1CKKA 3S0DA 1CDMA 1QX5B 1DELA 3IVTA 4YGEB 2V53A 2LV7A 3L4AA 2L2EA 3CR2A 4PE7A 1FI5A 1YUUA 1B4CA 2MA2A 4MZJA 3IQOA 4DRWA 1ZMZA 1XFUO 4TNCA 1ZACA 3PSRA 4P2YB 1B8RA 2Y5IA 2JULA 3FE8A 1KFXL 2KAVA 2I94A 2WC6A 3D77A 4ICBA 5I94A 1GGZA 1WY9A 2K2AA 2RGIA 5HLVA 4ETOA 1XFYO 1J55A 3TDZA 4MN0A 5JJGA 5FI2A 1F54A 2KQYA 2P71A 4C0JA 2M29A 4YGBB 1W7IB 3KPXA 1DVIA 1YTZC 1N0YA 2WORA 3V2LA 1TCOB 2OTGB 1SY9A 1JBAA 5CSJA 3JTDC 1WDCC 4F7FA 2ZRSA 3LLEA 2QEBA 4C0KA 3S0AA 1M45A 2O5GA 3K21A 1IWQA 3LCPC 3QMEA 1SL7A 2LHIA 5I2LA 1OW4A 3OBVA 1A4PA 1B8LA 1QVIY 4L9MA 1QVIZ 2HQWA 3CZ2A 3BFHA 4PT1A 2K7OA 5D3OA 3VRPA
chains in the Genus database with same CATH topology
2ZNEA 1DF0A 1UHIA 1A03A 4PALA 1DGVA 3CZTX 4F0ZB 2PSRA 2PRUA 3FWBA 4YGCB 1AVSA 4ORAB 3CWGA 2E30A 2KFHA 3CS1A 4OVNF 1KFUS 1SBJA 3SG2A 4P5OE 1YR5A 1G4YR 1SR6C 1EH2A 5AERA 1SL9A 2Y1NA 2LANA 1KWOC 1QASA 3A8RA 2LCPA 4GGFC 2LE9B 5HYDA 2BL0C 1ZFSA 1SYMA 1NPQA 1NX0A 1PRWA 2K61A 2MJWB 3OB1B 3TS5B 1DF0B 2G9BA 2M1KB 1TOPA 2KYFA 2M7LA 1MXEA 5CSIA 1BG1A 1CTRA 4CFQA 4U8DA 4MLWA 1L2OC 2A4JA 3EVRA 3RLZA 3TZ1A 4A4CA 4R1EA 1EJ3A 1K8UA 3DF0B 4MZLA 4YI9A 2LUCA 1WRZA 1WRLA 3NSKA 1RFJA 4M2OA 2HQ8A 2IS9A 3BQ3A 5K89A 2E6WA 1J7OA 3BUXB 2SASA 2LNKA 2BCXA 3NSIA 1S36A 1FBVA 2L98A 1YRUB 5I8NA 1UHHA 1JWDA 1QS7A 1UUSA 2K8MB 4PCWA 4HSZA 3PN7B 2NXQA 2WCBA 3BUNB 1BOCA 1UHKA 2D8NA 2JU0A 2KI6C 1J7QA 1XFXO 2FCEA 5G08A 2KFFA 2AAOA 2M0RA 1XO5A 2HF5A 2M1UA 2JZIA 1JC2A 3E3RA 2CXJA 1CNPA 1Y6WA 4C0LA 3IQQA 3GOFA 4N1FA 4QJ4B 3SIAA 2CTNA 4HREE 2LM5A 4MBEA 4AQJA 1TTXA 2MRDA 1LXFC 2Q4UA 3A4UB 1KCYA 1N65A 3I5GB 2BCBA 3SG5A 1E8AA 2F2OA 4MRXA 1GGWA 2EC6C 1KQMC 3CR5X 3EK7A 3DF0A 5IBWA 1S1EA 1GQMA 4NDCA 2BBNA 2QACA 2ZN9A 1DMOA 1BODA 4ZCUA 5D7FA 2K2FA 2KGRA 2Y4QA 3VGOA 1V1FA 2KI4C 1S3PA 1QV0A 1CLLA 2CBLA 2LLTA 3HX4A 1XVJA 1H4BA 2LVKA 5D69A 2KOTA 2BKHB 1IQ3A 4GGNA 4GFTA 4GUKA 3GK4X 1C7WA 1TNPA 3VRNA 1PALA 2H61A 3PLFB 1YX8A 2F8PA 2KNEA 1B1GA 1A75B 2JXCA 2JPTA 2JTZA 1ODBA 1DJXA 1QV1A 1EG3A 2JNFA 1F71A 1TRFA 3OHMB 1F8HA 2CCMA 1BR1B 2M9GA 4BY5A 2JQ6A 1BT6A 2M97A 2MHHA 1CFCA 2KHNA 1M63B 1QTXA 5HLOA 3SIBA 1F4QA 1XFZO 1S6JA 1DJYA 3CTNA 1J1EA 3ICBA 4CLNA 3OX5A 5CSNA 1A29A 1PK0D 1B47A 1KFUL 1K96A 4N1GA 1J7PA 5CSFA 4PHJA 1YRTB 1BLQA 1G33A 2JWWA 3BYAA 2H2KA 5DKNA 1QX7A 1G8IA 1K9KA 1SKTA 1SW8A 3PATA 2NZ0A 1NCYA 3SJSA 1SCMB 2WC8A 1OMRA 1UURA 1JF0A 3SG6A 4JPZB 1QXPA 3KF9A 4GPLB 1AUIB 1DTLA 3FWCA 3I5FB 5BPJA 1KK7Y 2I2RE 1OMDA 1HT9A 2BE6A 1KSOA 1CM4A 2B1UA 3BUWB 1K9PA 2JTTA 2OPOA 3BXKA 1YVHA 3JVTB 4I5JA 1HQVA 3EKHA 1RK9A 2WNDA 5TNCA 1TNQA 2L4IA 4OV2A 3I5IB 1KQVA 1V1GA 3LK0A 1AJ4A 2G2BA 1NX1A 1K9UA 1M39A 1IRJA 1TNXA 4I5LB 2H61C 1TN4A 2LAPA 1R6PA 4M2PA 2BE4A 2JRFA 3DVJA 3TDUA 3I5IC 1K94A 2MBXA 1QLSA 1QX2A 1EG4A 4OCIA 1OQPA 3NXAA 4D1EA 3JVTC 3RM1A 2LP2A 2PVBA 4PHKA 2JXLA 3SG7A 1RTP1 1LVCD 1PVAA 5JOLA 4DIRA 3D0YA 3I5FC 1LA3A 4CIDA 2KQ6A 1LKJA 2PALA 4WRIA 3OB2B 2KI4B 2K7BA 1SCMC 2ZN8A 1U5IB 2LMUA 1IG5A 2M3WA 3H4SE 2EHBA 2GV5A 3M0WA 2KAXA 1K93D 1OOJA 1QATA 4YI8A 2EC6B 1D1OA 5AEQA 5HKWA 1S5GZ 1JSAA 4HRHA 3I5GC 1SCVA 3EK4A 3DVKA 1DJZA 2BCAA 2K7DA 3SG4A 3VRQA 3OX6A 3WNXB 2WOSA 1MXLC 4Q04A 1BJFA 1SPYA 3KHEA 4AQIA 1NUBA 3VROA 4MZKA 4PE0A 4JQ0D 1GJYA 5I2QA 1UWOA 1B9AA 2LLUA 1NSHA 1YUTA 4MVFA 1UP5A 1FF1A 1H8BA 4QJ5B 2MLEC 2L4HA 1Y1UA 1B8CA 4N5XA 1CMGA 2GGZA 3PM8A 1NYAA 4ORCB 2KDHA 4HRGA 3PN7C 4FQOA 2JC2A 4QJ3B 1XK4A 2JOJA 4GGFA 2QPTA 1PVBA 3C1VA 2ZRTA 2KGBC 1RECA 2PASA 1NWDA 2O60A 3DVMA 2P6BB 4WQ2A 5KU1A 1CMFA 3CGAA 1KQMB 1ALVA 3AKBA 2M8UA 3DD4A 3KO0A 4UPGA 1MWNA 1Y1XA 1X02A 1RWYA 2L5XB 2KYCA 2LC5A 1KK7Z 3AAKA 1N2DA 3OP0A 5ER5A 2LMTA 3VRRA 2LP3A 1VRKA 3TDIA 2Y1MA 4OR9B 1CDLA 2BL0B 2K0JA 1SK6D 4ZCVA 1ZUZA 3FS7A 1AHRA 3FIAA 1PSRA 1Y0VH 1AJ5A 1C7VA 1IKUA 4IL1A 3O2PA 2M7NA 1M31A 3O6BA 4PE1A 2NLNA 2LVVA 4PE4A 1DJGA 1S5GY 1IH0A 1LINA 4CPVA 2FJUB 1CFFA 1Q80A 5F6TA 3WHUB 1LA0A 1QIWA 1S6CA 2WCEA 4FTGA 1PULA 1L7ZA 1OZSA 2JT0A 1ZOTB 5GQQC 1CM1A 2L51A 4E68A 4GAOA 2MAZA 2F2PA 3D10A 4JWQA 1WLMA 2LMVA 3WXAA 1L2OB 1CLMA 1DJIA 3EVUA 1NIWA 2KSPA 4NDDA 3DVEA 1Y1AA 2KBMA 1CFPA 1WLZA 3GK2A 2MLFC 3HCMA 1SRAA 2LLSA 3IF7A 2CT9A 3TS5C 5CPVA 2CNPA 2AMIA 1A75A 3AKAA 5DKQA 5HKYA 5KSZA 1CLBA 4ORBB 2KBIA 1CFDA 1RROA 1CB1A 1KWOB 1NP8A 1JFJA 4BY4A 3NSOA 1U5IA 3LK1A 5FYXA 1AK8A 3EVVA 1C07A 2JT8A 1SR6B 1S6IA 3PALA 2VRGA 2EGDA 4M2QA 2R2IA 1OMVA 2ZNDA 3D0YB 1MF8B 4MSPA 2HETA 1UHJA 1S26D 4AOMA 2WCFA 2FCDA 1TNWA 1XA5A 4PHNA 2KAYA 2LVIA 1BR4B 2LHLA 2TN4A 4NQGA 1A2XA 5AFPA 2KI6D 1MR8A 2PMYA 2HPSA 3CLNA 5AANA 4GBAA 1SNLA 2LUXA 1JF2A 2F3YA 3QRXA 2BECA 4USLA 3WHTB 5PALA 4XJKB 2JNXA 4A4BA 3LL8B 1WDCB 3JTDB 1RJVA 1XFWO 2OTGC 1ALWA 4YGDB 1IJ5A 2BBMA 3I5HB 4PDZA 1OZOA 1J7RA 2COLB 2M49B 5ER4X 5HKZA 4CFRA 4MEWA 5DKRA 1W7JB 1B7TY 1YVLA 1JFKA 1OSAA 3F45A 1R2UA 2I18A 1KK8C 1FPWA 1IGVA 1F4OA 4PHMA 5I2OA 3O78A 2NCPA 1KSMA 1IQ5A 1WRKA 2OS8C 3O4YA 2ISDA 4YGAA 1TCFA 4YRUA 1YURA 1SMGA 1NCZA 1BF5A 1FW4A 1NX3A 3PFVA 3BUOB 3EK8A 3ZNIA 2F33A 1XFVO 1PSBA 2KFGA 1BU3A 5B8IB 2L0PA 4GNKB 2K7CA 2Q91A 1QJTA 4I5NB 4YBHB 3TUYB 1F55A 1F70A 1DJHA 3GK1A 2I7AA 4DCKA 4DUQA 2F3ZA 3SG3A 2LVJA 2ZFDA 1MUXA 2OS8B 4WQ3A 1FI6A 1K2HA 1MHOA 1DT7B 1MQ1A 2AUCA 1KK8B 1YX7A 1JUOA 1DGUA 1DJWA 1CDPA 2NCOA 1J1DA 1XYDA 2GGMA 1IJ6A 3MSEB 1XK4C 2BKIB 1K95A 1SL8A 1K90D 4NDBA 1NX2A 1UHNA 1AP4A 4XJKA 3BOWA 3I5HC 5KTYA 2FOTA 2JT3A 4OKHA 1NCXA 1KFXS 1YUSA 3KEVA 1EL4A 1BMOA 1OE9B 3ZWHA 1QIVA 4DS7A 1EXRA 1TIZA 1QLKA 3NSLA 2SCPA 2DOQA 3BOWB 3CR4X 3EKJA 4I5KA 4XYNA 4MRYA 1B7TZ 2ZKMX 5AXIA 1M46A 5J3XA 2L50A 3TUYC 3BUMB 3AAJA 1CKKA 1CDMA 1QX5B 4YGEB 2V53A 2LV7A 2L2EA 3CR2A 4PE7A 1FI5A 1YUUA 1B4CA 2MA2A 4MZJA 3IQOA 4DRWA 1ZMZA 1XFUO 4TNCA 1ZACA 3PSRA 4P2YB 1B8RA 2Y5IA 2JULA 4ICBA 1KFXL 2KAVA 2I94A 1CDNA 1GGZA 1WY9A 2K2AA 2RGIA 5HLVA 4ETOA 1XFYO 1J55A 3TDZA 4MN0A 5JJGA 1F54A 2KQYA 4C0JA 2M29A 4YGBB 1W7IB 3KPXA 1DVIA 1YTZC 1N0YA 2WORA 1TCOB 2OTGB 1SY9A 1JBAA 5CSJA 3JTDC 1WDCC 2ZRSA 3LLEA 4C0KA 1M45A 2O5GA 3K21A 1IWQA 3LCPC 1SL7A 2LHIA 5I2LA 1A4PA 1B8LA 1QVIY 4L9MA 1QVIZ 2HQWA 2K7OA 3VRPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZNE A;  1DF0 A;  1UHI A;  1A03 A;  4PAL A;  1DGV A;  3CZT X;  4F0Z B;  2PSR A;  2PRU A;  3FWB A;  4YGC B;  1AVS A;  4ORA B;  3CWG A;  2E30 A;  2KFH A;  3CS1 A;  4OVN F;  1KFU S;  1SBJ A;  3SG2 A;  4P5O E;  1YR5 A;  1G4Y R;  1SR6 C;  1EH2 A;  5AER A;  1SL9 A;  2Y1N A;  2LAN A;  1KWO C;  1QAS A;  3A8R A;  2LCP A;  4GGF C;  2LE9 B;  5HYD A;  2BL0 C;  1ZFS A;  1SYM A;  1NPQ A;  1NX0 A;  1PRW A;  2K61 A;  2MJW B;  3OB1 B;  3TS5 B;  1DF0 B;  2G9B A;  2M1K B;  1TOP A;  2KYF A;  2M7L A;  1MXE A;  5CSI A;  1BG1 A;  1CTR A;  4CFQ A;  4U8D A;  4MLW A;  1L2O C;  2A4J A;  3EVR A;  3RLZ A;  3TZ1 A;  4A4C A;  4R1E A;  1EJ3 A;  1K8U A;  3DF0 B;  4MZL A;  4YI9 A;  2LUC A;  1WRZ A;  1WRL A;  3NSK A;  1RFJ A;  4M2O A;  2HQ8 A;  2IS9 A;  3BQ3 A;  5K89 A;  2E6W A;  1J7O A;  3BUX B;  2SAS A;  2LNK A;  2BCX A;  3NSI A;  1S36 A;  1FBV A;  2L98 A;  1YRU B;  5I8N A;  1UHH A;  1JWD A;  1QS7 A;  1UUS A;  2K8M B;  4PCW A;  4HSZ A;  3PN7 B;  2NXQ A;  2WCB A;  3BUN B;  1BOC A;  1UHK A;  2D8N A;  2JU0 A;  2KI6 C;  1J7Q A;  1XFX O;  2FCE A;  5G08 A;  2KFF A;  2AAO A;  2M0R A;  1XO5 A;  2HF5 A;  2M1U A;  2JZI A;  1JC2 A;  3E3R A;  2CXJ A;  1CNP A;  1Y6W A;  4C0L A;  3IQQ A;  3GOF A;  4N1F A;  4QJ4 B;  3SIA A;  2CTN A;  4HRE E;  2LM5 A;  4MBE A;  4AQJ A;  1TTX A;  2MRD A;  1LXF C;  2Q4U A;  3A4U B;  1KCY A;  1N65 A;  3I5G B;  2BCB A;  3SG5 A;  1E8A A;  2F2O A;  4MRX A;  1GGW A;  2EC6 C;  1KQM C;  3CR5 X;  3EK7 A;  3DF0 A;  5IBW A;  1S1E A;  1GQM A;  4NDC A;  2BBN A;  2QAC A;  2ZN9 A;  1DMO A;  1BOD A;  4ZCU A;  5D7F A;  2K2F A;  2KGR A;  2Y4Q A;  3VGO A;  1V1F A;  2KI4 C;  1S3P A;  1QV0 A;  1CLL A;  2CBL A;  2LLT A;  3HX4 A;  1XVJ A;  1H4B A;  2LVK A;  5D69 A;  2KOT A;  2BKH B;  1IQ3 A;  4GGN A;  4GFT A;  4GUK A;  3GK4 X;  1C7W A;  1TNP A;  3VRN A;  1PAL A;  2H61 A;  3PLF B;  1YX8 A;  2F8P A;  2KNE A;  1B1G A;  1A75 B;  2JXC A;  2JPT A;  2JTZ A;  1ODB A;  1DJX A;  1QV1 A;  1EG3 A;  2JNF A;  1F71 A;  1TRF A;  3OHM B;  1F8H A;  2CCM A;  1BR1 B;  2M9G A;  4BY5 A;  2JQ6 A;  1BT6 A;  2M97 A;  2MHH A;  1CFC A;  2KHN A;  1M63 B;  1QTX A;  5HLO A;  3SIB A;  1F4Q A;  1XFZ O;  1S6J A;  1DJY A;  3CTN A;  1J1E A;  3ICB A;  4CLN A;  3OX5 A;  5CSN A;  1A29 A;  1PK0 D;  1B47 A;  1KFU L;  1K96 A;  4N1G A;  1J7P A;  5CSF A;  4PHJ A;  1YRT B;  1BLQ A;  1G33 A;  2JWW A;  3BYA A;  2H2K A;  5DKN A;  1QX7 A;  1G8I A;  1K9K A;  1SKT A;  1SW8 A;  3PAT A;  2NZ0 A;  1NCY A;  3SJS A;  1SCM B;  2WC8 A;  1OMR A;  1UUR A;  1JF0 A;  3SG6 A;  4JPZ B;  1QXP A;  3KF9 A;  4GPL B;  1AUI B;  1DTL A;  3FWC A;  3I5F B;  5BPJ A;  1KK7 Y;  2I2R E;  1OMD A;  1HT9 A;  2BE6 A;  1KSO A;  1CM4 A;  2B1U A;  3BUW B;  1K9P A;  2JTT A;  2OPO A;  3BXK A;  1YVH A;  3JVT B;  4I5J A;  1HQV A;  3EKH A;  1RK9 A;  2WND A;  5TNC A;  1TNQ A;  2L4I A;  4OV2 A;  3I5I B;  1KQV A;  1V1G A;  3LK0 A;  1AJ4 A;  2G2B A;  1NX1 A;  1K9U A;  1M39 A;  1IRJ A;  1TNX A;  4I5L B;  2H61 C;  1TN4 A;  2LAP A;  1R6P A;  4M2P A;  2BE4 A;  2JRF A;  3DVJ A;  3TDU A;  3I5I C;  1K94 A;  2MBX A;  1QLS A;  1QX2 A;  1EG4 A;  4OCI A;  1OQP A;  3NXA A;  4D1E A;  3JVT C;  3RM1 A;  2LP2 A;  2PVB A;  4PHK A;  2JXL A;  3SG7 A;  1RTP 1;  1LVC D;  1PVA A;  5JOL A;  4DIR A;  3D0Y A;  3I5F C;  1LA3 A;  4CID A;  2KQ6 A;  1LKJ A;  2PAL A;  4WRI A;  3OB2 B;  2KI4 B;  2K7B A;  1SCM C;  2ZN8 A;  1U5I B;  2LMU A;  1IG5 A;  2M3W A;  3H4S E;  2EHB A;  2GV5 A;  3M0W A;  2KAX A;  1K93 D;  1OOJ A;  1QAT A;  4YI8 A;  2EC6 B;  1D1O A;  5AEQ A;  5HKW A;  1S5G Z;  1JSA A;  4HRH A;  3I5G C;  1SCV A;  3EK4 A;  3DVK A;  1DJZ A;  2BCA A;  2K7D A;  3SG4 A;  3VRQ A;  3OX6 A;  3WNX B;  2WOS A;  1MXL C;  4Q04 A;  1BJF A;  1SPY A;  3KHE A;  4AQI A;  1NUB A;  3VRO A;  4MZK A;  4PE0 A;  4JQ0 D;  1GJY A;  5I2Q A;  1UWO A;  1B9A A;  2LLU A;  1NSH A;  1YUT A;  4MVF A;  1UP5 A;  1FF1 A;  1H8B A;  4QJ5 B;  2MLE C;  2L4H A;  1Y1U A;  1B8C A;  4N5X A;  1CMG A;  2GGZ A;  3PM8 A;  1NYA A;  4ORC B;  2KDH A;  4HRG A;  3PN7 C;  4FQO A;  2JC2 A;  4QJ3 B;  1XK4 A;  2JOJ A;  4GGF A;  2QPT A;  1PVB A;  3C1V A;  2ZRT A;  2KGB C;  1REC A;  2PAS A;  1NWD A;  2O60 A;  3DVM A;  2P6B B;  4WQ2 A;  5KU1 A;  1CMF A;  3CGA A;  1KQM B;  1ALV A;  3AKB A;  2M8U A;  3DD4 A;  3KO0 A;  4UPG A;  1MWN A;  1Y1X A;  1X02 A;  1RWY A;  2L5X B;  2KYC A;  2LC5 A;  1KK7 Z;  3AAK A;  1N2D A;  3OP0 A;  5ER5 A;  2LMT A;  3VRR A;  2LP3 A;  1VRK A;  3TDI A;  2Y1M A;  4OR9 B;  1CDL A;  2BL0 B;  2K0J A;  1SK6 D;  4ZCV A;  1ZUZ A;  3FS7 A;  1AHR A;  3FIA A;  1PSR A;  1Y0V H;  1AJ5 A;  1C7V A;  1IKU A;  4IL1 A;  3O2P A;  2M7N A;  1M31 A;  3O6B A;  4PE1 A;  2NLN A;  2LVV A;  4PE4 A;  1DJG A;  1S5G Y;  1IH0 A;  1LIN A;  4CPV A;  2FJU B;  1CFF A;  1Q80 A;  5F6T A;  3WHU B;  1LA0 A;  1QIW A;  1S6C A;  2WCE A;  4FTG A;  1PUL A;  1L7Z A;  1OZS A;  2JT0 A;  1ZOT B;  5GQQ C;  1CM1 A;  2L51 A;  4E68 A;  4GAO A;  2MAZ A;  2F2P A;  3D10 A;  4JWQ A;  1WLM A;  2LMV A;  3WXA A;  1L2O B;  1CLM A;  1DJI A;  3EVU A;  1NIW A;  2KSP A;  4NDD A;  3DVE A;  1Y1A A;  2KBM A;  1CFP A;  1WLZ A;  3GK2 A;  2MLF C;  3HCM A;  1SRA A;  2LLS A;  3IF7 A;  2CT9 A;  3TS5 C;  5CPV A;  2CNP A;  2AMI A;  1A75 A;  3AKA A;  5DKQ A;  5HKY A;  5KSZ A;  1CLB A;  4ORB B;  2KBI A;  1CFD A;  1RRO A;  1CB1 A;  1KWO B;  1NP8 A;  1JFJ A;  4BY4 A;  3NSO A;  1U5I A;  3LK1 A;  5FYX A;  1AK8 A;  3EVV A;  1C07 A;  2JT8 A;  1SR6 B;  1S6I A;  3PAL A;  2VRG A;  2EGD A;  4M2Q A;  2R2I A;  1OMV A;  2ZND A;  3D0Y B;  1MF8 B;  4MSP A;  2HET A;  1UHJ A;  1S26 D;  4AOM A;  2WCF A;  2FCD A;  1TNW A;  1XA5 A;  4PHN A;  2KAY A;  2LVI A;  1BR4 B;  2LHL A;  2TN4 A;  4NQG A;  1A2X A;  5AFP A;  2KI6 D;  1MR8 A;  2PMY A;  2HPS A;  3CLN A;  5AAN A;  4GBA A;  1SNL A;  2LUX A;  1JF2 A;  2F3Y A;  3QRX A;  2BEC A;  4USL A;  3WHT B;  5PAL A;  4XJK B;  2JNX A;  4A4B A;  3LL8 B;  1WDC B;  3JTD B;  1RJV A;  1XFW O;  2OTG C;  1ALW A;  4YGD B;  1IJ5 A;  2BBM A;  3I5H B;  4PDZ A;  1OZO A;  1J7R A;  2COL B;  2M49 B;  5ER4 X;  5HKZ A;  4CFR A;  4MEW A;  5DKR A;  1W7J B;  1B7T Y;  1YVL A;  1JFK A;  1OSA A;  3F45 A;  1R2U A;  2I18 A;  1KK8 C;  1FPW A;  1IGV A;  1F4O A;  4PHM A;  5I2O A;  3O78 A;  2NCP A;  1KSM A;  1IQ5 A;  1WRK A;  2OS8 C;  3O4Y A;  2ISD A;  4YGA A;  1TCF A;  4YRU A;  1YUR A;  1SMG A;  1NCZ A;  1BF5 A;  1FW4 A;  1NX3 A;  3PFV A;  3BUO B;  3EK8 A;  3ZNI A;  2F33 A;  1XFV O;  1PSB A;  2KFG A;  1BU3 A;  5B8I B;  2L0P A;  4GNK B;  2K7C A;  2Q91 A;  1QJT A;  4I5N B;  4YBH B;  3TUY B;  1F55 A;  1F70 A;  1DJH A;  3GK1 A;  2I7A A;  4DCK A;  4DUQ A;  2F3Z A;  3SG3 A;  2LVJ A;  2ZFD A;  1MUX A;  2OS8 B;  4WQ3 A;  1FI6 A;  1K2H A;  1MHO A;  1DT7 B;  1MQ1 A;  2AUC A;  1KK8 B;  1YX7 A;  1JUO A;  1DGU A;  1DJW A;  1CDP A;  2NCO A;  1J1D A;  1XYD A;  2GGM A;  1IJ6 A;  3MSE B;  1XK4 C;  2BKI B;  1K95 A;  1SL8 A;  1K90 D;  4NDB A;  1NX2 A;  1UHN A;  1AP4 A;  4XJK A;  3BOW A;  3I5H C;  5KTY A;  2FOT A;  2JT3 A;  4OKH A;  1NCX A;  1KFX S;  1YUS A;  3KEV A;  1EL4 A;  1BMO A;  1OE9 B;  3ZWH A;  1QIV A;  4DS7 A;  1EXR A;  1TIZ A;  1QLK A;  3NSL A;  2SCP A;  2DOQ A;  3BOW B;  3CR4 X;  3EKJ A;  4I5K A;  4XYN A;  4MRY A;  1B7T Z;  2ZKM X;  5AXI A;  1M46 A;  5J3X A;  2L50 A;  3TUY C;  3BUM B;  3AAJ A;  1CKK A;  1CDM A;  1QX5 B;  4YGE B;  2V53 A;  2LV7 A;  2L2E A;  3CR2 A;  4PE7 A;  1FI5 A;  1YUU A;  1B4C A;  2MA2 A;  4MZJ A;  3IQO A;  4DRW A;  1ZMZ A;  1XFU O;  4TNC A;  1ZAC A;  3PSR A;  4P2Y B;  1B8R A;  2Y5I A;  2JUL A;  4ICB A;  1KFX L;  2KAV A;  2I94 A;  1CDN A;  1GGZ A;  1WY9 A;  2K2A A;  2RGI A;  5HLV A;  4ETO A;  1XFY O;  1J55 A;  3TDZ A;  4MN0 A;  5JJG A;  1F54 A;  2KQY A;  4C0J A;  2M29 A;  4YGB B;  1W7I B;  3KPX A;  1DVI A;  1YTZ C;  1N0Y A;  2WOR A;  1TCO B;  2OTG B;  1SY9 A;  1JBA A;  5CSJ A;  3JTD C;  1WDC C;  2ZRS A;  3LLE A;  4C0K A;  1M45 A;  2O5G A;  3K21 A;  1IWQ A;  3LCP C;  1SL7 A;  2LHI A;  5I2L A;  1A4P A;  1B8L A;  1QVI Y;  4L9M A;  1QVI Z;  2HQW A;  2K7O A;  3VRP A; 
#chains in the Genus database with same CATH topology
 2ZNE A;  1DF0 A;  1UHI A;  1A03 A;  4PAL A;  1DGV A;  3CZT X;  4F0Z B;  2PSR A;  2PRU A;  3FWB A;  4YGC B;  1AVS A;  4ORA B;  2QEH A;  3CWG A;  1C3Z A;  2E30 A;  2KFH A;  3CS1 A;  4OVN F;  1KFU S;  1SBJ A;  3SG2 A;  4P5O E;  1YR5 A;  1G4Y R;  1SR6 C;  1EH2 A;  2KPH A;  1SL9 A;  5AER A;  2Y1N A;  2LAN A;  1KWO C;  3DY9 A;  1QAS A;  3A8R A;  2LCP A;  4GGF C;  2LE9 B;  5HYD A;  2BL0 C;  1ZFS A;  1SYM A;  1NPQ A;  1NX0 A;  1PRW A;  2K61 A;  2MJW B;  3OB1 B;  3TS5 B;  1DF0 B;  2G9B A;  2M1K B;  1TOP A;  2KYF A;  2M7L A;  1MXE A;  5CSI A;  1BG1 A;  1CTR A;  4CFQ A;  4U8D A;  3S0F A;  4MLW A;  1L2O C;  2A4J A;  3EVR A;  3RLZ A;  3TZ1 A;  4A4C A;  4R1E A;  1EJ3 A;  1K8U A;  3DF0 B;  4MZL A;  4YI9 A;  2LUC A;  1WRZ A;  1W9Z A;  2BAP A;  1WRL A;  3NSK A;  1RFJ A;  4M2O A;  2HQ8 A;  2IS9 A;  3BQ3 A;  5K89 A;  2E6W A;  1J7O A;  3BUX B;  2SAS A;  2LNK A;  2BCX A;  3NSI A;  1S36 A;  1FBV A;  2L98 A;  1YRU B;  5I8N A;  1UHH A;  1JWD A;  1QS7 A;  1UUS A;  2K8M B;  4PCW A;  4HSZ A;  3PN7 B;  2NXQ A;  2WCB A;  1Z4H A;  3BUN B;  2WCK A;  1BOC A;  1UHK A;  2D8N A;  2JU0 A;  2KI6 C;  2PYQ A;  3SS3 A;  1J7Q A;  3S0E A;  1XFX O;  2FCE A;  5G08 A;  2KFF A;  2AAO A;  2M0R A;  1XO5 A;  2HF5 A;  2M1U A;  2JZI A;  1JC2 A;  3E3R A;  3NGV A;  2CXJ A;  4KYN A;  1CNP A;  1Y6W A;  4C0L A;  3IQQ A;  3CAB A;  3GOF A;  4N1F A;  4QJ4 B;  3SIA A;  2CTN A;  4HRE E;  2LM5 A;  4MBE A;  4AQJ A;  1TTX A;  2MRD A;  1LXF C;  2Q4U A;  2YGU A;  3A4U B;  1KCY A;  1N65 A;  3I5G B;  2BCB A;  3SG5 A;  1E8A A;  2F2O A;  4MRX A;  1GGW A;  2EC6 C;  1KQM C;  3CR5 X;  3EK7 A;  3DF0 A;  5IBW A;  1S1E A;  1GQM A;  4NDC A;  3SS5 A;  2BBN A;  2QAC A;  2ZN9 A;  1DMO A;  1BOD A;  4ZCU A;  5D7F A;  2K2F A;  2KGR A;  2Y4Q A;  3VGO A;  1V1F A;  2KI4 C;  1S3P A;  1QV0 A;  1CLL A;  2CBL A;  2LLT A;  3HX4 A;  1XVJ A;  1H4B A;  2LVK A;  1DC1 A;  5D69 A;  2KOT A;  2BKH B;  1IQ3 A;  4GGN A;  4GFT A;  4GUK A;  3GK4 X;  1C7W A;  1TNP A;  3VRN A;  1PAL A;  2H61 A;  3PLF B;  3NHI A;  1YX8 A;  2F8P A;  2KNE A;  1B1G A;  1A75 B;  2JXC A;  2JPT A;  2JTZ A;  1ODB A;  1DJX A;  1QV1 A;  1EG3 A;  1T14 A;  3CZ0 A;  2JNF A;  1F71 A;  1TRF A;  3OHM B;  1F8H A;  2CCM A;  1IIO A;  1BR1 B;  1P28 A;  2M9G A;  4BY5 A;  2JQ6 A;  1BT6 A;  2M97 A;  2MHH A;  1CFC A;  1TUJ A;  2KHN A;  4FQT A;  1M63 B;  1QTX A;  3Q8I A;  5HLO A;  3SIB A;  1F4Q A;  1XFZ O;  1S6J A;  1DJY A;  3CTN A;  1ORG A;  1J1E A;  3ICB A;  4CLN A;  3OX5 A;  5CSN A;  1A29 A;  1PK0 D;  1B47 A;  1KFU L;  1K96 A;  4N1G A;  1J7P A;  5CSF A;  4PHJ A;  1YRT B;  1BLQ A;  2L5Y A;  1G33 A;  2JWW A;  3BYA A;  2H2K A;  5DKN A;  1QX7 A;  1G8I A;  1K9K A;  1SKT A;  1SW8 A;  3BFB A;  3PAT A;  2NZ0 A;  3R1P A;  1NCY A;  3SJS A;  1SCM B;  2WC8 A;  1OMR A;  1UUR A;  1JF0 A;  3SG6 A;  1OOG A;  4JPZ B;  1QXP A;  3KF9 A;  4GPL B;  1AUI B;  1DTL A;  3FWC A;  3I5F B;  5BPJ A;  1KK7 Y;  2I2R E;  1OMD A;  1HT9 A;  2BE6 A;  2GTE A;  1KSO A;  1CM4 A;  2B1U A;  3BUW B;  1K9P A;  2JTT A;  2OPO A;  3BXK A;  1YVH A;  3JVT B;  4I5J A;  1HQV A;  3EKH A;  1RK9 A;  2WND A;  5TNC A;  1TNQ A;  2L4I A;  4OV2 A;  3I5I B;  1LS8 A;  1KQV A;  1V1G A;  3LK0 A;  1AJ4 A;  2G2B A;  2H8V A;  1XFR A;  1NX1 A;  2WC5 A;  1K9U A;  1M39 A;  1SSE B;  1IRJ A;  1TNX A;  4I5L B;  4JKT A;  2H61 C;  5DIC A;  3D78 A;  1TN4 A;  2LAP A;  1R6P A;  4M2P A;  2BE4 A;  2JRF A;  3DVJ A;  2WCL A;  3TDU A;  3I5I C;  3EG5 B;  3CDN A;  1K94 A;  2MBX A;  1QLS A;  1QX2 A;  1EG4 A;  4OCI A;  1OQP A;  3NXA A;  4D1E A;  3JVT C;  3RM1 A;  2LP2 A;  2PVB A;  2QEO A;  2PQL A;  4PHK A;  1OOH A;  2JXL A;  3SG7 A;  1RTP 1;  1LVC D;  1PVA A;  5JOL A;  4DIR A;  3D0Y A;  3I5F C;  1LA3 A;  4CID A;  2KQ6 A;  1LKJ A;  2PAL A;  4WRI A;  3OB2 B;  2KI4 B;  3RZS A;  1OOI X;  2K7B A;  1SCM C;  2ZN8 A;  1U5I B;  2LMU A;  1IG5 A;  2M3W A;  3H4S E;  2EHB A;  2GV5 A;  3M0W A;  2KAX A;  1K93 D;  1OOJ A;  1QAT A;  4INW A;  1CDN A;  4YI8 A;  2EC6 B;  1D1O A;  5AEQ A;  5HKW A;  1S5G Z;  1JSA A;  2KLD A;  4HRH A;  3I5G C;  1SCV A;  3EK4 A;  3DVK A;  1DJZ A;  2BCA A;  2K7D A;  3DZT A;  3SG4 A;  3OX6 A;  3VRQ A;  2WOS A;  1MXL C;  4Q04 A;  1BJF A;  3L47 A;  1SPY A;  3KHE A;  4AQI A;  1NUB A;  3VRO A;  4MZK A;  4PE0 A;  3B86 A;  2K60 A;  2WCH A;  4JQ0 D;  1GJY A;  5I2Q A;  1UWO A;  1B9A A;  2LLU A;  1NSH A;  1YUT A;  4MVF A;  1UP5 A;  1FF1 A;  1H8B A;  3FE9 A;  4QJ5 B;  2MLE C;  2L4H A;  1Y1U A;  3CYZ A;  1B8C A;  2L2C A;  2WCM A;  3O4X A;  4N5X A;  2GGZ A;  1CMG A;  3PM8 A;  1NYA A;  4ORC B;  2KDH A;  4HRG A;  3PN7 C;  4FQO A;  2JC2 A;  4QJ3 B;  3B7A A;  1XK4 A;  2JOJ A;  3L4L A;  4GGF A;  2QPT A;  1QWV A;  1PVB A;  3C1V A;  3UNW A;  2ZRT A;  2KGB C;  1REC A;  2PAS A;  1NWD A;  2O60 A;  3DVM A;  2P6B B;  4WQ2 A;  5KU1 A;  1CMF A;  3CGA A;  1KQM B;  1ALV A;  3AKB A;  2M8U A;  3DD4 A;  3KO0 A;  1DEK A;  4UPG A;  1MWN A;  2WCJ A;  2ERB A;  1Y1X A;  1X02 A;  1RWY A;  2L5X B;  2KYC A;  2LC5 A;  1KK7 Z;  3AAK A;  1N2D A;  3OP0 A;  5ER5 A;  2LMT A;  3VRR A;  2LP3 A;  1VRK A;  5FI7 A;  2P70 A;  3DYE A;  3TDI A;  2Y1M A;  4OR9 B;  1CDL A;  2BL0 B;  2K0J A;  1SK6 D;  4ZCV A;  1ZUZ A;  3FS7 A;  1AHR A;  3FIA A;  1PSR A;  1Y0V H;  1AJ5 A;  1C7V A;  1IKU A;  4IL1 A;  3O2P A;  2M7N A;  1M31 A;  3O6B A;  4PE1 A;  1TWO A;  1OOF A;  2NLN A;  2LVV A;  4PE4 A;  1DJG A;  1S5G Y;  1IH0 A;  1LIN A;  4CPV A;  2FJU B;  2QDI A;  3B6X A;  1CFF A;  1C3Y A;  1Q80 A;  5F6T A;  3WHU B;  1LA0 A;  1QIW A;  3WNX B;  1S6C A;  2WCE A;  3PM2 A;  4FTG A;  1PUL A;  1L7Z A;  1OZS A;  2JT0 A;  1ZOT B;  5GQQ C;  1CM1 A;  2L51 A;  4E68 A;  4GAO A;  2MAZ A;  2F2P A;  3D10 A;  3R72 A;  1WLM A;  4JWQ A;  2LMV A;  3WXA A;  1L2O B;  1CLM A;  1DJI A;  3EVU A;  1NIW A;  2KSP A;  4NDD A;  3DVE A;  3S0G A;  1Y1A A;  2KBM A;  1CFP A;  1TUZ A;  1WLZ A;  3GK2 A;  2MLF C;  3HCM A;  1SRA A;  2LLS A;  3B87 A;  2CT9 A;  3IF7 A;  3TS5 C;  5CPV A;  2CNP A;  2AMI A;  1GM0 A;  1A75 A;  3AKA A;  5DKQ A;  5HKY A;  5KSZ A;  1CLB A;  4ORB B;  2KBI A;  1CFD A;  3D74 A;  1RRO A;  1CB1 A;  3UO9 A;  1KWO B;  1NP8 A;  1JFJ A;  4BY4 A;  3NSO A;  1U5I A;  3LK1 A;  3N7H A;  5FYX A;  1AK8 A;  3EVV A;  1C07 A;  2JT8 A;  1SR6 B;  1S6I A;  5HL1 A;  3PAL A;  2VRG A;  2EGD A;  4M2Q A;  2R2I A;  1OMV A;  2ZND A;  3D0Y B;  1MF8 B;  4MSP A;  1DQE A;  2HET A;  1UHJ A;  1S26 D;  4AOM A;  2WCF A;  2FCD A;  1TNW A;  1XA5 A;  2BNX A;  3CZ1 A;  3FE6 A;  4PHN A;  2KAY A;  2LVI A;  3S0B A;  1BR4 B;  2LHL A;  2TN4 A;  4NQG A;  1A2X A;  5AFP A;  2KI6 D;  1MR8 A;  2PMY A;  2HPS A;  3CLN A;  3DXL A;  2JPO A;  5AAN A;  4GBA A;  1SNL A;  2LUX A;  1JF2 A;  2F3Y A;  3QRX A;  2BEC A;  4USL A;  3WHT B;  5PAL A;  4XJK B;  2JNX A;  3D76 A;  4A4B A;  3LL8 B;  1WDC B;  3JTD B;  1RJV A;  2QEV A;  1Z2C B;  1XFW O;  2OTG C;  1ALW A;  4YGD B;  1IJ5 A;  2BBM A;  3I5H B;  4PDZ A;  1OZO A;  1J7R A;  2COL B;  2M49 B;  5ER4 X;  5HKZ A;  4CFR A;  4MEW A;  4JD9 A;  5DKR A;  5EL2 A;  1W7J B;  1B7T Y;  1YVL A;  4INX A;  1JFK A;  1OSA A;  3F45 A;  1R2U A;  3OGN A;  2I18 A;  1KK8 C;  1FPW A;  1IGV A;  1F4O A;  3PJI A;  4PHM A;  5I2O A;  3O78 A;  2NCP A;  3NHT A;  1KSM A;  1IQ5 A;  1WRK A;  2OS8 C;  3B88 A;  3O4Y A;  2ISD A;  3BFA A;  4YGA A;  1TCF A;  4YRU A;  1YUR A;  2FJY A;  1SMG A;  1NCZ A;  1BF5 A;  1FW4 A;  1NX3 A;  3PFV A;  3BUO B;  3EK8 A;  3D73 A;  3ZNI A;  2F33 A;  1XFV O;  3VB1 A;  1PSB A;  2KFG A;  1BU3 A;  5B8I B;  2L0P A;  4GNK B;  2K7C A;  2Q91 A;  1QJT A;  4I5N B;  4YBH B;  3TUY B;  1F55 A;  1F70 A;  5FI6 A;  3D75 A;  3R1V A;  1DJH A;  3GK1 A;  3R1O A;  3K1E A;  2I7A A;  4DCK A;  4DUQ A;  2F3Z A;  3SG3 A;  2LVJ A;  2ZFD A;  1MUX A;  2KLE A;  2OS8 B;  4WQ3 A;  1FI6 A;  1K2H A;  1MHO A;  1DT7 B;  1MQ1 A;  2AUC A;  1KK8 B;  1YX7 A;  1JUO A;  1DGU A;  1DJW A;  1CDP A;  2NCO A;  1J1D A;  1XYD A;  2GGM A;  1IJ6 A;  3MSE B;  1XK4 C;  2BKI B;  1K95 A;  1SL8 A;  1K90 D;  4NDB A;  1NX2 A;  1UHN A;  1AP4 A;  4XJK A;  3BOW A;  3I5H C;  5KTY A;  2FOT A;  2JT3 A;  4OKH A;  1NCX A;  1KFX S;  1YUS A;  3KEV A;  1EL4 A;  1BMO A;  1OE9 B;  3ZWH A;  1QIV A;  3BJH A;  4DS7 A;  1EXR A;  1TIZ A;  4IJ7 A;  1QLK A;  3NSL A;  2SCP A;  2DOQ A;  3BOW B;  3CR4 X;  3EKJ A;  4I5K A;  4XYN A;  4MRY A;  1B7T Z;  2ZKM X;  4OZD A;  5AXI A;  1M46 A;  5J3X A;  2L50 A;  3SS4 A;  3TUY C;  3BUM B;  3AAJ A;  1CKK A;  3S0D A;  1CDM A;  1QX5 B;  1DEL A;  3IVT A;  4YGE B;  2V53 A;  2LV7 A;  3L4A A;  2L2E A;  3CR2 A;  4PE7 A;  1FI5 A;  1YUU A;  1B4C A;  2MA2 A;  4MZJ A;  3IQO A;  4DRW A;  1ZMZ A;  1XFU O;  4TNC A;  1ZAC A;  3PSR A;  4P2Y B;  1B8R A;  2Y5I A;  2JUL A;  3FE8 A;  1KFX L;  2KAV A;  2I94 A;  2WC6 A;  3D77 A;  4ICB A;  5I94 A;  1GGZ A;  1WY9 A;  2K2A A;  2RGI A;  5HLV A;  4ETO A;  1XFY O;  1J55 A;  3TDZ A;  4MN0 A;  5JJG A;  5FI2 A;  1F54 A;  2KQY A;  2P71 A;  4C0J A;  2M29 A;  4YGB B;  1W7I B;  3KPX A;  1DVI A;  1YTZ C;  1N0Y A;  2WOR A;  3V2L A;  1TCO B;  2OTG B;  1SY9 A;  1JBA A;  5CSJ A;  3JTD C;  1WDC C;  4F7F A;  2ZRS A;  3LLE A;  2QEB A;  4C0K A;  3S0A A;  1M45 A;  2O5G A;  3K21 A;  1IWQ A;  3LCP C;  3QME A;  1SL7 A;  2LHI A;  5I2L A;  1OW4 A;  3OBV A;  1A4P A;  1B8L A;  1QVI Y;  4L9M A;  1QVI Z;  2HQW A;  3CZ2 A;  3BFH A;  4PT1 A;  2K7O A;  5D3O A;  3VRP A; 
#chains in the Genus database with same CATH homology
 2ZNE A;  1DF0 A;  1UHI A;  1A03 A;  4PAL A;  1DGV A;  3CZT X;  4F0Z B;  2PSR A;  2PRU A;  3FWB A;  4YGC B;  1AVS A;  4ORA B;  3CWG A;  2E30 A;  2KFH A;  3CS1 A;  4OVN F;  1KFU S;  1SBJ A;  3SG2 A;  4P5O E;  1YR5 A;  1G4Y R;  1SR6 C;  1EH2 A;  5AER A;  1SL9 A;  2Y1N A;  2LAN A;  1KWO C;  1QAS A;  3A8R A;  2LCP A;  4GGF C;  2LE9 B;  5HYD A;  2BL0 C;  1ZFS A;  1SYM A;  1NPQ A;  1NX0 A;  1PRW A;  2K61 A;  2MJW B;  3OB1 B;  3TS5 B;  1DF0 B;  2G9B A;  2M1K B;  1TOP A;  2KYF A;  2M7L A;  1MXE A;  5CSI A;  1BG1 A;  1CTR A;  4CFQ A;  4U8D A;  4MLW A;  1L2O C;  2A4J A;  3EVR A;  3RLZ A;  3TZ1 A;  4A4C A;  4R1E A;  1EJ3 A;  1K8U A;  3DF0 B;  4MZL A;  4YI9 A;  2LUC A;  1WRZ A;  1WRL A;  3NSK A;  1RFJ A;  4M2O A;  2HQ8 A;  2IS9 A;  3BQ3 A;  5K89 A;  2E6W A;  1J7O A;  3BUX B;  2SAS A;  2LNK A;  2BCX A;  3NSI A;  1S36 A;  1FBV A;  2L98 A;  1YRU B;  5I8N A;  1UHH A;  1JWD A;  1QS7 A;  1UUS A;  2K8M B;  4PCW A;  4HSZ A;  3PN7 B;  2NXQ A;  2WCB A;  3BUN B;  1BOC A;  1UHK A;  2D8N A;  2JU0 A;  2KI6 C;  1J7Q A;  1XFX O;  2FCE A;  5G08 A;  2KFF A;  2AAO A;  2M0R A;  1XO5 A;  2HF5 A;  2M1U A;  2JZI A;  1JC2 A;  3E3R A;  2CXJ A;  1CNP A;  1Y6W A;  4C0L A;  3IQQ A;  3GOF A;  4N1F A;  4QJ4 B;  3SIA A;  2CTN A;  4HRE E;  2LM5 A;  4MBE A;  4AQJ A;  1TTX A;  2MRD A;  1LXF C;  2Q4U A;  3A4U B;  1KCY A;  1N65 A;  3I5G B;  2BCB A;  3SG5 A;  1E8A A;  2F2O A;  4MRX A;  1GGW A;  2EC6 C;  1KQM C;  3CR5 X;  3EK7 A;  3DF0 A;  5IBW A;  1S1E A;  1GQM A;  4NDC A;  2BBN A;  2QAC A;  2ZN9 A;  1DMO A;  1BOD A;  4ZCU A;  5D7F A;  2K2F A;  2KGR A;  2Y4Q A;  3VGO A;  1V1F A;  2KI4 C;  1S3P A;  1QV0 A;  1CLL A;  2CBL A;  2LLT A;  3HX4 A;  1XVJ A;  1H4B A;  2LVK A;  5D69 A;  2KOT A;  2BKH B;  1IQ3 A;  4GGN A;  4GFT A;  4GUK A;  3GK4 X;  1C7W A;  1TNP A;  3VRN A;  1PAL A;  2H61 A;  3PLF B;  1YX8 A;  2F8P A;  2KNE A;  1B1G A;  1A75 B;  2JXC A;  2JPT A;  2JTZ A;  1ODB A;  1DJX A;  1QV1 A;  1EG3 A;  2JNF A;  1F71 A;  1TRF A;  3OHM B;  1F8H A;  2CCM A;  1BR1 B;  2M9G A;  4BY5 A;  2JQ6 A;  1BT6 A;  2M97 A;  2MHH A;  1CFC A;  2KHN A;  1M63 B;  1QTX A;  5HLO A;  3SIB A;  1F4Q A;  1XFZ O;  1S6J A;  1DJY A;  3CTN A;  1J1E A;  3ICB A;  4CLN A;  3OX5 A;  5CSN A;  1A29 A;  1PK0 D;  1B47 A;  1KFU L;  1K96 A;  4N1G A;  1J7P A;  5CSF A;  4PHJ A;  1YRT B;  1BLQ A;  1G33 A;  2JWW A;  3BYA A;  2H2K A;  5DKN A;  1QX7 A;  1G8I A;  1K9K A;  1SKT A;  1SW8 A;  3PAT A;  2NZ0 A;  1NCY A;  3SJS A;  1SCM B;  2WC8 A;  1OMR A;  1UUR A;  1JF0 A;  3SG6 A;  4JPZ B;  1QXP A;  3KF9 A;  4GPL B;  1AUI B;  1DTL A;  3FWC A;  3I5F B;  5BPJ A;  1KK7 Y;  2I2R E;  1OMD A;  1HT9 A;  2BE6 A;  1KSO A;  1CM4 A;  2B1U A;  3BUW B;  1K9P A;  2JTT A;  2OPO A;  3BXK A;  1YVH A;  3JVT B;  4I5J A;  1HQV A;  3EKH A;  1RK9 A;  2WND A;  5TNC A;  1TNQ A;  2L4I A;  4OV2 A;  3I5I B;  1KQV A;  1V1G A;  3LK0 A;  1AJ4 A;  2G2B A;  1NX1 A;  1K9U A;  1M39 A;  1IRJ A;  1TNX A;  4I5L B;  2H61 C;  1TN4 A;  2LAP A;  1R6P A;  4M2P A;  2BE4 A;  2JRF A;  3DVJ A;  3TDU A;  3I5I C;  1K94 A;  2MBX A;  1QLS A;  1QX2 A;  1EG4 A;  4OCI A;  1OQP A;  3NXA A;  4D1E A;  3JVT C;  3RM1 A;  2LP2 A;  2PVB A;  4PHK A;  2JXL A;  3SG7 A;  1RTP 1;  1LVC D;  1PVA A;  5JOL A;  4DIR A;  3D0Y A;  3I5F C;  1LA3 A;  4CID A;  2KQ6 A;  1LKJ A;  2PAL A;  4WRI A;  3OB2 B;  2KI4 B;  2K7B A;  1SCM C;  2ZN8 A;  1U5I B;  2LMU A;  1IG5 A;  2M3W A;  3H4S E;  2EHB A;  2GV5 A;  3M0W A;  2KAX A;  1K93 D;  1OOJ A;  1QAT A;  4YI8 A;  2EC6 B;  1D1O A;  5AEQ A;  5HKW A;  1S5G Z;  1JSA A;  4HRH A;  3I5G C;  1SCV A;  3EK4 A;  3DVK A;  1DJZ A;  2BCA A;  2K7D A;  3SG4 A;  3VRQ A;  3OX6 A;  3WNX B;  2WOS A;  1MXL C;  4Q04 A;  1BJF A;  1SPY A;  3KHE A;  4AQI A;  1NUB A;  3VRO A;  4MZK A;  4PE0 A;  4JQ0 D;  1GJY A;  5I2Q A;  1UWO A;  1B9A A;  2LLU A;  1NSH A;  1YUT A;  4MVF A;  1UP5 A;  1FF1 A;  1H8B A;  4QJ5 B;  2MLE C;  2L4H A;  1Y1U A;  1B8C A;  4N5X A;  1CMG A;  2GGZ A;  3PM8 A;  1NYA A;  4ORC B;  2KDH A;  4HRG A;  3PN7 C;  4FQO A;  2JC2 A;  4QJ3 B;  1XK4 A;  2JOJ A;  4GGF A;  2QPT A;  1PVB A;  3C1V A;  2ZRT A;  2KGB C;  1REC A;  2PAS A;  1NWD A;  2O60 A;  3DVM A;  2P6B B;  4WQ2 A;  5KU1 A;  1CMF A;  3CGA A;  1KQM B;  1ALV A;  3AKB A;  2M8U A;  3DD4 A;  3KO0 A;  4UPG A;  1MWN A;  1Y1X A;  1X02 A;  1RWY A;  2L5X B;  2KYC A;  2LC5 A;  1KK7 Z;  3AAK A;  1N2D A;  3OP0 A;  5ER5 A;  2LMT A;  3VRR A;  2LP3 A;  1VRK A;  3TDI A;  2Y1M A;  4OR9 B;  1CDL A;  2BL0 B;  2K0J A;  1SK6 D;  4ZCV A;  1ZUZ A;  3FS7 A;  1AHR A;  3FIA A;  1PSR A;  1Y0V H;  1AJ5 A;  1C7V A;  1IKU A;  4IL1 A;  3O2P A;  2M7N A;  1M31 A;  3O6B A;  4PE1 A;  2NLN A;  2LVV A;  4PE4 A;  1DJG A;  1S5G Y;  1IH0 A;  1LIN A;  4CPV A;  2FJU B;  1CFF A;  1Q80 A;  5F6T A;  3WHU B;  1LA0 A;  1QIW A;  1S6C A;  2WCE A;  4FTG A;  1PUL A;  1L7Z A;  1OZS A;  2JT0 A;  1ZOT B;  5GQQ C;  1CM1 A;  2L51 A;  4E68 A;  4GAO A;  2MAZ A;  2F2P A;  3D10 A;  4JWQ A;  1WLM A;  2LMV A;  3WXA A;  1L2O B;  1CLM A;  1DJI A;  3EVU A;  1NIW A;  2KSP A;  4NDD A;  3DVE A;  1Y1A A;  2KBM A;  1CFP A;  1WLZ A;  3GK2 A;  2MLF C;  3HCM A;  1SRA A;  2LLS A;  3IF7 A;  2CT9 A;  3TS5 C;  5CPV A;  2CNP A;  2AMI A;  1A75 A;  3AKA A;  5DKQ A;  5HKY A;  5KSZ A;  1CLB A;  4ORB B;  2KBI A;  1CFD A;  1RRO A;  1CB1 A;  1KWO B;  1NP8 A;  1JFJ A;  4BY4 A;  3NSO A;  1U5I A;  3LK1 A;  5FYX A;  1AK8 A;  3EVV A;  1C07 A;  2JT8 A;  1SR6 B;  1S6I A;  3PAL A;  2VRG A;  2EGD A;  4M2Q A;  2R2I A;  1OMV A;  2ZND A;  3D0Y B;  1MF8 B;  4MSP A;  2HET A;  1UHJ A;  1S26 D;  4AOM A;  2WCF A;  2FCD A;  1TNW A;  1XA5 A;  4PHN A;  2KAY A;  2LVI A;  1BR4 B;  2LHL A;  2TN4 A;  4NQG A;  1A2X A;  5AFP A;  2KI6 D;  1MR8 A;  2PMY A;  2HPS A;  3CLN A;  5AAN A;  4GBA A;  1SNL A;  2LUX A;  1JF2 A;  2F3Y A;  3QRX A;  2BEC A;  4USL A;  3WHT B;  5PAL A;  4XJK B;  2JNX A;  4A4B A;  3LL8 B;  1WDC B;  3JTD B;  1RJV A;  1XFW O;  2OTG C;  1ALW A;  4YGD B;  1IJ5 A;  2BBM A;  3I5H B;  4PDZ A;  1OZO A;  1J7R A;  2COL B;  2M49 B;  5ER4 X;  5HKZ A;  4CFR A;  4MEW A;  5DKR A;  1W7J B;  1B7T Y;  1YVL A;  1JFK A;  1OSA A;  3F45 A;  1R2U A;  2I18 A;  1KK8 C;  1FPW A;  1IGV A;  1F4O A;  4PHM A;  5I2O A;  3O78 A;  2NCP A;  1KSM A;  1IQ5 A;  1WRK A;  2OS8 C;  3O4Y A;  2ISD A;  4YGA A;  1TCF A;  4YRU A;  1YUR A;  1SMG A;  1NCZ A;  1BF5 A;  1FW4 A;  1NX3 A;  3PFV A;  3BUO B;  3EK8 A;  3ZNI A;  2F33 A;  1XFV O;  1PSB A;  2KFG A;  1BU3 A;  5B8I B;  2L0P A;  4GNK B;  2K7C A;  2Q91 A;  1QJT A;  4I5N B;  4YBH B;  3TUY B;  1F55 A;  1F70 A;  1DJH A;  3GK1 A;  2I7A A;  4DCK A;  4DUQ A;  2F3Z A;  3SG3 A;  2LVJ A;  2ZFD A;  1MUX A;  2OS8 B;  4WQ3 A;  1FI6 A;  1K2H A;  1MHO A;  1DT7 B;  1MQ1 A;  2AUC A;  1KK8 B;  1YX7 A;  1JUO A;  1DGU A;  1DJW A;  1CDP A;  2NCO A;  1J1D A;  1XYD A;  2GGM A;  1IJ6 A;  3MSE B;  1XK4 C;  2BKI B;  1K95 A;  1SL8 A;  1K90 D;  4NDB A;  1NX2 A;  1UHN A;  1AP4 A;  4XJK A;  3BOW A;  3I5H C;  5KTY A;  2FOT A;  2JT3 A;  4OKH A;  1NCX A;  1KFX S;  1YUS A;  3KEV A;  1EL4 A;  1BMO A;  1OE9 B;  3ZWH A;  1QIV A;  4DS7 A;  1EXR A;  1TIZ A;  1QLK A;  3NSL A;  2SCP A;  2DOQ A;  3BOW B;  3CR4 X;  3EKJ A;  4I5K A;  4XYN A;  4MRY A;  1B7T Z;  2ZKM X;  5AXI A;  1M46 A;  5J3X A;  2L50 A;  3TUY C;  3BUM B;  3AAJ A;  1CKK A;  1CDM A;  1QX5 B;  4YGE B;  2V53 A;  2LV7 A;  2L2E A;  3CR2 A;  4PE7 A;  1FI5 A;  1YUU A;  1B4C A;  2MA2 A;  4MZJ A;  3IQO A;  4DRW A;  1ZMZ A;  1XFU O;  4TNC A;  1ZAC A;  3PSR A;  4P2Y B;  1B8R A;  2Y5I A;  2JUL A;  4ICB A;  1KFX L;  2KAV A;  2I94 A;  1CDN A;  1GGZ A;  1WY9 A;  2K2A A;  2RGI A;  5HLV A;  4ETO A;  1XFY O;  1J55 A;  3TDZ A;  4MN0 A;  5JJG A;  1F54 A;  2KQY A;  4C0J A;  2M29 A;  4YGB B;  1W7I B;  3KPX A;  1DVI A;  1YTZ C;  1N0Y A;  2WOR A;  1TCO B;  2OTG B;  1SY9 A;  1JBA A;  5CSJ A;  3JTD C;  1WDC C;  2ZRS A;  3LLE A;  4C0K A;  1M45 A;  2O5G A;  3K21 A;  1IWQ A;  3LCP C;  1SL7 A;  2LHI A;  5I2L A;  1A4P A;  1B8L A;  1QVI Y;  4L9M A;  1QVI Z;  2HQW A;  2K7O A;  3VRP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...