4CFRA

Ca-bound s100a4 c3s, c81s, c86s and f45w mutant complexed with non- muscle myosin iia
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
94
structure length
94
Chain Sequence
ASPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSWLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSSIAMMSNEFFEGFPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The C-Terminal Random Coil Region Tunes the Ca2+-Binding Affinity of S100A4 Through Conformational Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ca-binding protein/motor protein
molecule keywords PROTEIN S100-A4
total genus 35
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4cfrA00
1M46A 1U5IB 1DF0B 1S6CA 1SBJA 3LK1A 3SJSA 2LANA 4P2YB 2R2IA 3SIAA 5G08A 1YURA 5ER5A 1K9UA 3F45A 4CLNA 2MLEC 1XA5A 5HLOA 4AQIA 4U8DA 1JWDA 1YX8A 1TNPA 2JXCA 1KQMB 2PALA 1SW8A 2MAZA 4XJKB 2KHNA 1CM4A 1JUOA 3RM1A 2M49B 1SK6D 4DIRA 1B7TY 3SG3A 2CNPA 3TS5B 5B8IB 3VRRA 5DKNA 2K61A 2K7OA 1DJZA 1OE9B 1BMOA 2HQ8A 2MJWB 4GPLB 5AEQA 1W7JB 3WHUB 2L50A 5I2LA 2HETA 4M2QA 2ZN8A 4L9MA 4MRXA 1L2OC 4HRGA 3FS7A 2O5GA 2MRDA 1KSMA 1SY9A 1CDMA 1ZUZA 1XO5A 4I5JA 3JVTC 4PE4A 5AANA 3PN7B 2QACA 3BXKA 2DOQA 2F2PA 2JC2A 3LK0A 2JZIA 1RROA 2BL0C 1S26D 1DJWA 1F4OA 2ZN9A 1TRFA 2GGZA 3CGAA 3PALA 1JSAA 2JNFA 1RK9A 4QJ5B 1HT9A 2WCFA 4WQ2A 2CBLA 3CR4X 3SG4A 2Y1MA 1NYAA 1SKTA 1DJIA 1KQMC 1CDPA 3BUNB 4YGAA 2HQWA 3VGOA 4DUQA 3CR5X 5DKRA 1WRLA 2ZNDA 1H4BA 1MXEA 2M9GA 2M97A 1V1FA 4HREE 5TNCA 1XK4C 1RECA 5AERA 2H61C 1MUXA 1QV1A 1CFCA 3E3RA 3I5IB 2OTGB 1Y6WA 3A8RA 3KPXA 3OB1B 4YGCB 3FWCA 4D1EA 1B47A 1DGUA 1BG1A 1AP4A 1TCOB 3AKBA 4OVNF 1NSHA 2KI4C 2LVIA 4CIDA 2LNKA 1MXLC 2F3YA 1MQ1A 1F70A 1IGVA 3WNXB 1TTXA 4MLWA 1B8CA 2H2KA 3EKHA 1OOJA 1QLSA 1SMGA 1AK8A 2FJUB 2JNXA 3DF0B 4YBHB 1EG4A 4QJ3B 3D0YA 2WC8A 3LLEA 1C7WA 2WCBA 1N0YA 3O6BA 4Q04A 2KBIA 2EGDA 2KI6C 5CSNA 1QLKA 3BOWB 4YI8A 1FBVA 1QASA 2LM5A 1DJGA 3KF9A 4PHMA 1ZMZA 2IS9A 1CM1A 2NCOA 1AJ5A 3BUXB 3BUWB 2JPTA 4OKHA 2BECA 1TN4A 5ER4X 3VRNA 3HCMA 4BY4A 1K9KA 3GK2A 1M45A 2GV5A 1MHOA 2Y1NA 3BUMB 4IL1A 2F3ZA 3I5GC 5IBWA 4N1GA 3SG7A 4MN0A 4ORCB 1KFXL 1UHNA 1JBAA 2JU0A 1TCFA 5GQQC 3NSOA 4WQ3A 1IQ5A 2FCEA 5CPVA 2WNDA 1IG5A 3CZTX 4JWQA 1YRTB 4A4BA 1GJYA 3RLZA 2EHBA 1YR5A 1YVLA 1XFVO 1PRWA 3H4SE 1CLLA 2K8MB 4I5LB 1FW4A 1BU3A 1DJYA 2KYCA 3KEVA 2M7LA 1SCMB 1YUUA 4YGEB 1L2OB 2ISDA 2LLTA 4DCKA 1NWDA 1R2UA 2JT0A 4YI9A 5K89A 5HLVA 4GUKA 2LMTA 2G9BA 2LCPA 1NCXA 2KYFA 1J7RA 4E68A 1CKKA 2KFHA 1QVIZ 2LV7A 1K90D 1OZSA 1OMDA 4BY5A 2CTNA 2MHHA 1J1DA 5JOLA 1IWQA 1FF1A 1B1GA 3KHEA 4CFQA 4MEWA 4OV2A 5HKZA 1NCYA 1SPYA 2D8NA 1KFUS 2QPTA 1J7QA 2JQ6A 1OSAA 5CSFA 3FWBA 1UURA 1Q80A 3O4YA 1JF2A 1H8BA 3JTDB 3SG5A 2CCMA 1G8IA 4PE7A 1VRKA 1SR6C 1B7TZ 3IQOA 5PALA 2L2EA 1AVSA 3GK4X 5HYDA 1A75B 3WHTB 1MR8A 2KFGA 4GFTA 4N5XA 2Q4UA 1DMOA 3DD4A 3OB2B 4PCWA 1XFUO 1LXFC 1RTP1 5I2OA 2ZRTA 1CTRA 4PHKA 1TOPA 2MA2A 4I5KA 1JC2A 3SIBA 3EK7A 4MZJA 1DJXA 3CLNA 2LUXA 1S5GZ 1UHKA 1IJ5A 2MBXA 3CTNA 4DRWA 3I5HC 1NP8A 1YRUB 2LVKA 2M8UA 1K95A 2CT9A 4ICBA 4ORBB 1S5GY 1WY9A 3DVEA 1LKJA 1BODA 4GNKB 2L51A 3OHMB 1NUBA 2HPSA 4C0LA 1J1EA 3CWGA 3FIAA 3D10A 5JJGA 1W7IB 2NZ0A 1QIVA 2JOJA 1WLZA 2LMVA 2M29A 1F4QA 5AXIA 4GBAA 1J7OA 4MVFA 3EVRA 1DT7B 4AQJA 3JTDC 1A75A 1AHRA 4GGNA 4PHJA 1MF8B 1CFDA 4YGBB 1PSRA 4MRYA 3O78A 1B8LA 2FCDA 2F8PA 1B4CA 3I5HB 3QRXA 2B1UA 1XFYO 1ODBA 1BJFA 4TNCA 1FI6A 2NLNA 5CSJA 1EG3A 2HF5A 2JWWA 1TIZA 1JFJA 1D1OA 1GGWA 1AJ4A 1DF0A 2LVVA 4NQGA 2L0PA 3I5FC 2ZFDA 1QATA 5KU1A 2JTTA 4YGDB 1NX0A 3OP0A 1CDLA 1UWOA 2KBMA 1JFKA 1CLMA 2JT8A 2LUCA 1S6JA 1S6IA 3TDZA 1C07A 1PSBA 2SCPA 5KTYA 3AAJA 4JQ0D 1QVIY 2EC6C 1KWOB 4MSPA 4MZKA 2O60A 4ZCVA 1UP5A 2BBMA 2H61A 1MWNA 1F71A 1U5IA 2NXQA 4ORAB 2EC6B 2KNEA 3OX6A 3LL8B 1ZFSA 3M0WA 4MZLA 1UHHA 3ZWHA 1XFXO 1EXRA 2AAOA 2I94A 3JVTB 5I8NA 1ALVA 2L4HA 2LLSA 3AAKA 4N1FA 1TNXA 4I5NB 2CXJA 1K9PA 1EL4A 2BE6A 5HKWA 2BE4A 3GK1A 2WCEA 4R1EA 1KWOC 1S1EA 1IRJA 2KGBC 1CFPA 1S3PA 3CS1A 2K2AA 1XFWO 3I5GB 3HX4A 2TN4A 1M63B 2KDHA 4MBEA 2JTZA 3PLFB 2LLUA 1A4PA 3TS5C 4ETOA 2A4JA 3EKJA 3ICBA 4A4CA 4OR9B 4GGFA 2L4IA 1DTLA 1BLQA 2M0RA 1QXPA 1PALA 1ZOTB 2LVJA 2OS8C 1KQVA 3O2PA 1FPWA 2PASA 2M7NA 1A2XA 3VRQA 2ZNEA 4NDCA 2LP3A 2LE9B 1BR1B 5AFPA 1OMVA 4JPZB 2E30A 1OZOA 1KK8C 1C7VA 3CR2A 1CDNA 1PVAA 1QTXA 1GGZA 3LCPC 3C1VA 1NPQA 4CPVA 5FYXA 1YTZC 1WLMA 1RFJA 4PALA 1A03A 3NSKA 5HKYA 2JRFA 5D69A 4F0ZB 1NIWA 4C0KA 3DVMA 1CB1A 3GOFA 2KI6D 1SL9A 4OCIA 1XK4A 2PSRA 1NCZA 2LMUA 1SYMA 2SASA 4PE0A 1BR4B 4WRIA 1F54A 4YRUA 2LHIA 4FQOA 2VRGA 3TZ1A 2LHLA 3EVUA 1M31A 2LP2A 3EK8A 2I7AA 1LA0A 3I5IC 3BOWA 1PULA 1SNLA 1K94A 2KQ6A 4PE1A 3A4UB 1WRKA 1ALWA 3PATA 4M2OA 1LINA 2KOTA 1CMFA 1TNWA 1EH2A 5CSIA 3BUOB 2JULA 3TDUA 3OX5A 2K7CA 3K21A 2NCPA 1N2DA 4NDDA 2GGMA 3DVKA 1RJVA 1B8RA 4GAOA 1J7PA 1DJHA 2L5XB 1BOCA 1QS7A 1CFFA 1SL7A 2PVBA 2BL0B 2WORA 3D0YB 2MLFC 2PRUA 1SR6B 2AUCA 1LVCD 1XFZO 4NDBA 1WRZA 2BKIB 2Y4QA 1B9AA 2KAYA 2OS8B 1A29A 1QX7A 3BYAA 5J3XA 1IH0A 1V1GA 1F8HA 1JF0A 3KO0A 3WXAA 5F6TA 1GQMA 2OTGC 1SRAA 1QX2A 4GGFC 2BCBA 3EK4A 4CFRA 2M1UA 5KSZA 3TUYB 2LAPA 2K7BA 1G33A 3NSIA 4HSZA 3IQQA 4P5OE 4XYNA 3DVJA 1N65A 2KSPA 2KFFA 1NX2A 1K93D 2I18A 1Y1UA 1BT6A 4PDZA 3VRPA 1AUIB 2COLB 2LC5A 1CNPA 2M3WA 4UPGA 1SCMC 1Y1XA 3NXAA 4DS7A 4PHNA 1OQPA 1IKUA 1QV0A 2F33A 2KAXA 2RGIA 2KQYA 3SG2A 2WOSA 3TUYC 1UUSA 1M39A 3PN7C 1YVHA 4FTGA 1L7ZA 3PM8A 4XJKA 3SG6A 1RWYA 2M1KB 1KFUL 1QX5B 4M2PA 4USLA 2G2BA 1XYDA 1XVJA 1TNQA 1NX3A 1S36A 3BQ3A 3EVVA 3TDIA 1NX1A 2F2OA 1SL8A 1DGVA 1KSOA 2KGRA 3NSLA 2K0JA 2ZKMX 1KFXS 1PVBA 1YX7A 1IQ3A 2JT3A 1KCYA 2K7DA 1K8UA 1KK7Z 3IF7A 1K96A 3I5FB 1IJ6A 1J55A 1LA3A 4HRHA 5I2QA 1EJ3A 2OPOA 1OMRA 2BCAA 1UHIA 2BBNA 1R6PA 2P6BB 2PMYA 4ZCUA 1BF5A 2V53A 3PSRA 1FI5A 1DVIA 3VROA 1HQVA 4C0JA 1YUTA 2AMIA 5D7FA 1CLBA 1PK0D 1ZACA 2BCXA 2KAVA 2E6WA 1WDCC 4AOMA 1K2HA 1YUSA 1KK8B 3ZNIA 1G4YR 2FOTA 3DF0A 2I2RE 5BPJA 2JXLA 2Y5IA 1SCVA 2Q91A 1KK7Y 1Y1AA 1X02A 2K2FA 3PFVA 1QIWA 2L98A 3AKAA 2ZRSA 1F55A 2BKHB 5DKQA 1CMGA 1E8AA 4QJ4B 1Y0VH 2KI4B 3MSEB 1WDCB 1QJTA 1UHJA
chains in the Genus database with same CATH superfamily
1M46A 1U5IB 1DF0B 1S6CA 1SBJA 3LK1A 3SJSA 1TUZA 2LANA 4P2YB 3PM2A 2R2IA 3SIAA 5G08A 1YURA 5ER5A 1K9UA 3F45A 4CLNA 2MLEC 1XFRA 3B86A 1XA5A 5HLOA 4AQIA 4U8DA 1JWDA 1YX8A 1TNPA 1C3YA 2JXCA 1ORGA 1KQMB 2PALA 1SW8A 2MAZA 4XJKB 2KHNA 1CM4A 1JUOA 3RM1A 2M49B 1SK6D 4DIRA 1B7TY 3SG3A 2CNPA 3TS5B 5B8IB 3VRRA 5DKNA 2K61A 2K7OA 1DJZA 1OE9B 1BMOA 2HQ8A 2MJWB 3B6XA 4GPLB 1W7JB 5AEQA 2L50A 3WHUB 4F7FA 5I2LA 2HETA 4M2QA 2ZN8A 4L9MA 1SSEB 4MRXA 1L2OC 2QEBA 4HRGA 3FS7A 2O5GA 2MRDA 1KSMA 1SY9A 1CDMA 1ZUZA 1XO5A 4I5JA 3FE9A 3JVTC 4PE4A 5AANA 3PN7B 2QACA 3BXKA 2DOQA 2F2PA 2JC2A 3CZ2A 3FE8A 3LK0A 3NHTA 2JZIA 4PT1A 1RROA 2BL0C 1S26D 1DJWA 1F4OA 2ZN9A 1TRFA 2GGZA 3CGAA 3PALA 1JSAA 2JNFA 1OOFA 1RK9A 1HT9A 4QJ5B 2WCFA 4WQ2A 1Z2CB 2CBLA 3CR4X 3SG4A 2Y1MA 1NYAA 1SKTA 1DJIA 1KQMC 1CDPA 3BUNB 4YGAA 2HQWA 3VGOA 4DUQA 3CR5X 5DKRA 1WRLA 2ZNDA 1H4BA 1MXEA 2M9GA 2M97A 1V1FA 4HREE 5TNCA 1XK4C 1RECA 5AERA 3IVTA 2H61C 1MUXA 1QV1A 1CFCA 3E3RA 3I5IB 2OTGB 1Y6WA 3A8RA 3KPXA 3OB1B 4YGCB 3FWCA 4D1EA 1B47A 1DGUA 1BG1A 1AP4A 1TCOB 3AKBA 4OVNF 1NSHA 2KI4C 2LVIA 4CIDA 2LNKA 1MXLC 2F3YA 1MQ1A 1F70A 1IGVA 3WNXB 1TTXA 4MLWA 1B8CA 2H2KA 3EKHA 1OOJA 1QLSA 1SMGA 4JD9A 3L4LA 1DQEA 1AK8A 2FJUB 2JNXA 3DF0B 4YBHB 1EG4A 4QJ3B 3D0YA 2WC8A 3LLEA 1C7WA 2WCBA 2WCMA 1N0YA 3O6BA 2P71A 3B87A 4Q04A 2KBIA 2EGDA 2KI6C 5CSNA 1QLKA 1DC1A 2PYQA 3BOWB 1FBVA 1QASA 4YI8A 2LM5A 1DJGA 2QEOA 3KF9A 1ZMZA 4PHMA 2IS9A 1CM1A 2NCOA 1AJ5A 3BUXB 3BUWB 2JPTA 4OKHA 2BECA 1TN4A 5ER4X 3VRNA 3HCMA 4BY4A 1K9KA 3GK2A 1M45A 2GV5A 1MHOA 2Y1NA 3BUMB 4IL1A 2F3ZA 3I5GC 3S0DA 4N1GA 5IBWA 3SG7A 2ERBA 4MN0A 4ORCB 1KFXL 3CZ1A 1UHNA 1JBAA 2JU0A 1TCFA 5GQQC 3SS3A 3NSOA 4WQ3A 1IQ5A 3NGVA 2FCEA 5CPVA 2WNDA 5FI6A 1IG5A 3R1PA 1C3ZA 3CZTX 5D3OA 4JWQA 1YRTB 4A4BA 1GJYA 3RLZA 2EHBA 1YR5A 3S0GA 1YVLA 1XFVO 1PRWA 3H4SE 1CLLA 2K8MB 2WC5A 4I5LB 3R1VA 1FW4A 1BU3A 1DJYA 2KYCA 2WCHA 3KEVA 2M7LA 1SCMB 1YUUA 3O4XA 4YGEB 2BNXA 1L2OB 5I94A 2ISDA 3V2LA 2LLTA 4DCKA 1NWDA 1R2UA 2JT0A 4YI9A 5K89A 5HLVA 4GUKA 2LMTA 2G9BA 2LCPA 1NCXA 2KYFA 1J7RA 4E68A 1CKKA 2KFHA 1QVIZ 2LV7A 1DEKA 1K90D 1OZSA 3OGNA 1OMDA 4BY5A 2CTNA 5HL1A 2MHHA 1J1DA 3D78A 5JOLA 1IWQA 1FF1A 1B1GA 3KHEA 4CFQA 4MEWA 4OV2A 5HKZA 1NCYA 1SPYA 3CABA 2D8NA 1KFUS 2QPTA 3N7HA 2JQ6A 1OSAA 1J7QA 5CSFA 3FWBA 1UURA 1Q80A 3O4YA 1JF2A 1H8BA 3JTDB 3SG5A 2CCMA 1G8IA 4PE7A 3D73A 3SS5A 1VRKA 1SR6C 1B7TZ 3IQOA 5PALA 2L2EA 1AVSA 3D77A 3GK4X 2QEVA 5HYDA 1A75B 3WHTB 2KPHA 1MR8A 2KFGA 4GFTA 4N5XA 2Q4UA 1DMOA 3DD4A 3D75A 3OB2B 4PCWA 1XFUO 1LXFC 1RTP1 5I2OA 2ZRTA 3CDNA 3VB1A 1CTRA 4PHKA 1TOPA 2MA2A 4I5KA 4KYNA 1JC2A 2JPOA 3SIBA 3EK7A 4MZJA 2WCKA 1DJXA 3CLNA 2LUXA 1S5GZ 1UHKA 1IJ5A 2WCLA 2MBXA 3CTNA 4DRWA 3I5HC 1NP8A 1YRUB 2LVKA 2M8UA 1K95A 2CT9A 4ICBA 4ORBB 1S5GY 1WY9A 3DVEA 1LKJA 1BODA 4GNKB 2L51A 3OHMB 1NUBA 1P28A 2HPSA 4C0LA 1J1EA 3CWGA 3FIAA 3D10A 5JJGA 3FE6A 1W7IB 2NZ0A 1QIVA 2JOJA 1WLZA 2LMVA 2M29A 1F4QA 5AXIA 4GBAA 1J7OA 3EG5B 4MVFA 3EVRA 2WCJA 5EL2A 1DT7B 4AQJA 3JTDC 1A75A 1AHRA 3B88A 4GGNA 4PHJA 1MF8B 1CFDA 4YGBB 1PSRA 4MRYA 3O78A 1B8LA 2FCDA 2F8PA 1B4CA 3I5HB 3UNWA 3QRXA 2B1UA 1XFYO 3DZTA 1ODBA 1OOIX 1BJFA 2H8VA 4TNCA 3OBVA 1FI6A 2NLNA 3RZSA 5CSJA 1EG3A 2HF5A 2JWWA 1TIZA 1JFJA 1D1OA 1GGWA 1AJ4A 1DF0A 2LVVA 4NQGA 2L0PA 1TUJA 3I5FC 2ZFDA 1QATA 5KU1A 2JTTA 4YGDB 1NX0A 3OP0A 1CDLA 1UWOA 2KBMA 1JFKA 1CLMA 2JT8A 2LUCA 1S6JA 1S6IA 3TDZA 1C07A 1PSBA 2SCPA 5KTYA 3AAJA 4JQ0D 1QVIY 2EC6C 1KWOB 4MSPA 4MZKA 3S0BA 2O60A 2KLDA 4ZCVA 1UP5A 2BBMA 2H61A 1MWNA 1F71A 1U5IA 2NXQA 4ORAB 2EC6B 2KNEA 3OX6A 3LL8B 1ZFSA 3M0WA 4MZLA 1UHHA 3ZWHA 1XFXO 1EXRA 2AAOA 2I94A 3JVTB 5I8NA 1ALVA 2L4HA 2LLSA 3AAKA 1F54A 4N1FA 1GM0A 1TNXA 4I5NB 2CXJA 3DYEA 1K9PA 1EL4A 2BE6A 5HKWA 2BE4A 3GK1A 2WCEA 4R1EA 1KWOC 1S1EA 1IRJA 2KGBC 3UO9A 1CFPA 1S3PA 3CS1A 2K2AA 1XFWO 3I5GB 3HX4A 2TN4A 1M63B 2KDHA 4MBEA 2JTZA 3PLFB 2LLUA 3BFAA 1A4PA 3TS5C 4ETOA 2A4JA 3EKJA 2K60A 3ICBA 4A4CA 4OR9B 4GGFA 2L4IA 1DTLA 1BLQA 2M0RA 1QXPA 1PALA 1ZOTB 2LVJA 2OS8C 1KQVA 3O2PA 4JKTA 1FPWA 2PASA 2M7NA 1A2XA 3VRQA 2ZNEA 4NDCA 2LP3A 3S0FA 2LE9B 2PQLA 1BR1B 5AFPA 1OMVA 4JPZB 2E30A 1OZOA 1KK8C 1C7VA 3CR2A 1CDNA 3BFBA 1PVAA 1QTXA 1GGZA 3LCPC 3C1VA 1NPQA 3CYZA 4CPVA 5FYXA 1YTZC 5FI2A 4IJ7A 1WLMA 1RFJA 4PALA 1A03A 3NSKA 5HKYA 2JRFA 5D69A 4F0ZB 1OW4A 1NIWA 4C0KA 3DVMA 1CB1A 3GOFA 2KI6D 1SL9A 4OCIA 1XK4A 2PSRA 1NCZA 1TWOA 1SYMA 2LMUA 2SASA 1BR4B 4PE0A 4WRIA 4YRUA 2LHIA 4FQOA 2VRGA 3TZ1A 2LHLA 3EVUA 1M31A 2LP2A 3EK8A 1IIOA 2I7AA 1LA0A 3I5IC 3SS4A 2KLEA 3BOWA 1PULA 1SNLA 1K94A 2KQ6A 4PE1A 2QEHA 3A4UB 1WRKA 1ALWA 3PATA 4M2OA 1LINA 2KOTA 1CMFA 3K1EA 1TNWA 1EH2A 5CSIA 3BUOB 2JULA 3Q8IA 3OX5A 2K7CA 3S0EA 3TDUA 3K21A 2NCPA 1N2DA 4NDDA 2GGMA 3BJHA 1RJVA 1B8RA 3DVKA 4GAOA 1J7PA 1DJHA 2L5XB 3QMEA 1BOCA 1QS7A 1CFFA 1SL7A 2PVBA 3NHIA 2P70A 2BL0B 2WORA 3D0YB 2MLFC 2PRUA 1SR6B 2AUCA 1LVCD 1XFZO 4NDBA 1WRZA 2BKIB 2Y4QA 3R1OA 5DICA 1B9AA 2KAYA 2L2CA 2OS8B 1A29A 1QX7A 3BYAA 5J3XA 3L47A 1LS8A 1Z4HA 1V1GA 1IH0A 1F8HA 1JF0A 3KO0A 3WXAA 5F6TA 1GQMA 2OTGC 3BFHA 1SRAA 1QX2A 4GGFC 2BCBA 3EK4A 4CFRA 2M1UA 5KSZA 3TUYB 2LAPA 2YGUA 2K7BA 1G33A 3NSIA 4HSZA 2WC6A 3D74A 2BAPA 3D76A 3IQQA 4P5OE 4XYNA 3DVJA 1N65A 3R72A 2KSPA 2KFFA 1NX2A 3CZ0A 1K93D 2I18A 1Y1UA 1BT6A 4PDZA 3VRPA 1AUIB 2COLB 2LC5A 1CNPA 2M3WA 4UPGA 1SCMC 1Y1XA 3NXAA 4DS7A 4PHNA 1OQPA 1IKUA 1QV0A 2F33A 2KAXA 2RGIA 2KQYA 3SG2A 2WOSA 1QWVA 3TUYC 1UUSA 1M39A 3PN7C 1YVHA 4FTGA 1L7ZA 3PM8A 4XJKA 3SG6A 1RWYA 2M1KB 3S0AA 1KFUL 1QX5B 3B7AA 4M2PA 4USLA 2G2BA 1XYDA 1XVJA 3DY9A 1TNQA 1NX3A 1S36A 3BQ3A 3EVVA 3TDIA 1NX1A 2F2OA 4INWA 1T14A 1SL8A 1DGVA 1KSOA 2KGRA 3NSLA 2K0JA 2ZKMX 1OOHA 1KFXS 1PVBA 5FI7A 1YX7A 1IQ3A 2L5YA 3DXLA 2JT3A 1KCYA 2K7DA 1K8UA 1KK7Z 3IF7A 1K96A 3I5FB 1IJ6A 1J55A 1LA3A 4HRHA 5I2QA 1EJ3A 2OPOA 1OMRA 2BCAA 1UHIA 4OZDA 2BBNA 1R6PA 2P6BB 2PMYA 4ZCUA 1BF5A 2V53A 3PJIA 3PSRA 1FI5A 1DVIA 3VROA 1HQVA 1W9ZA 4C0JA 1YUTA 2AMIA 5D7FA 1CLBA 1PK0D 1ZACA 2BCXA 2GTEA 2E6WA 1WDCC 2KAVA 4AOMA 4FQTA 1YUSA 1K2HA 1KK8B 3L4AA 3ZNIA 1G4YR 2FOTA 3DF0A 2I2RE 5BPJA 2JXLA 2Y5IA 1SCVA 2Q91A 2QDIA 1KK7Y 1Y1AA 1X02A 2K2FA 1DELA 3PFVA 1QIWA 2L98A 3AKAA 2ZRSA 4INXA 1F55A 2BKHB 5DKQA 1CMGA 1E8AA 4QJ4B 1Y0VH 2KI4B 3MSEB 2FJYA 1WDCB 1QJTA 1OOGA 1UHJA
chains in the Genus database with same CATH topology
1M46A 1U5IB 1DF0B 1S6CA 1SBJA 3LK1A 3SJSA 2LANA 4P2YB 2R2IA 3SIAA 5G08A 1YURA 5ER5A 1K9UA 3F45A 4CLNA 2MLEC 1XA5A 5HLOA 4AQIA 4U8DA 1JWDA 1YX8A 1TNPA 2JXCA 1KQMB 2PALA 1SW8A 2MAZA 4XJKB 2KHNA 1CM4A 1JUOA 3RM1A 2M49B 1SK6D 4DIRA 1B7TY 3SG3A 2CNPA 3TS5B 5B8IB 3VRRA 5DKNA 2K61A 2K7OA 1DJZA 1OE9B 1BMOA 2HQ8A 2MJWB 4GPLB 5AEQA 1W7JB 3WHUB 2L50A 5I2LA 2HETA 4M2QA 2ZN8A 4L9MA 4MRXA 1L2OC 4HRGA 3FS7A 2O5GA 2MRDA 1KSMA 1SY9A 1CDMA 1ZUZA 1XO5A 4I5JA 3JVTC 4PE4A 5AANA 3PN7B 2QACA 3BXKA 2DOQA 2F2PA 2JC2A 3LK0A 2JZIA 1RROA 2BL0C 1S26D 1DJWA 1F4OA 2ZN9A 1TRFA 2GGZA 3CGAA 3PALA 1JSAA 2JNFA 1RK9A 4QJ5B 1HT9A 2WCFA 4WQ2A 2CBLA 3CR4X 3SG4A 2Y1MA 1NYAA 1SKTA 1DJIA 1KQMC 1CDPA 3BUNB 4YGAA 2HQWA 3VGOA 4DUQA 3CR5X 5DKRA 1WRLA 2ZNDA 1H4BA 1MXEA 2M9GA 2M97A 1V1FA 4HREE 5TNCA 1XK4C 1RECA 5AERA 2H61C 1MUXA 1QV1A 1CFCA 3E3RA 3I5IB 2OTGB 1Y6WA 3A8RA 3KPXA 3OB1B 4YGCB 3FWCA 4D1EA 1B47A 1DGUA 1BG1A 1AP4A 1TCOB 3AKBA 4OVNF 1NSHA 2KI4C 2LVIA 4CIDA 2LNKA 1MXLC 2F3YA 1MQ1A 1F70A 1IGVA 3WNXB 1TTXA 4MLWA 1B8CA 2H2KA 3EKHA 1OOJA 1QLSA 1SMGA 1AK8A 2FJUB 2JNXA 3DF0B 4YBHB 1EG4A 4QJ3B 3D0YA 2WC8A 3LLEA 1C7WA 2WCBA 1N0YA 3O6BA 4Q04A 2KBIA 2EGDA 2KI6C 5CSNA 1QLKA 3BOWB 4YI8A 1FBVA 1QASA 2LM5A 1DJGA 3KF9A 4PHMA 1ZMZA 2IS9A 1CM1A 2NCOA 1AJ5A 3BUXB 3BUWB 2JPTA 4OKHA 2BECA 1TN4A 5ER4X 3VRNA 3HCMA 4BY4A 1K9KA 3GK2A 1M45A 2GV5A 1MHOA 2Y1NA 3BUMB 4IL1A 2F3ZA 3I5GC 5IBWA 4N1GA 3SG7A 4MN0A 4ORCB 1KFXL 1UHNA 1JBAA 2JU0A 1TCFA 5GQQC 3NSOA 4WQ3A 1IQ5A 2FCEA 5CPVA 2WNDA 1IG5A 3CZTX 4JWQA 1YRTB 4A4BA 1GJYA 3RLZA 2EHBA 1YR5A 1YVLA 1XFVO 1PRWA 3H4SE 1CLLA 2K8MB 4I5LB 1FW4A 1BU3A 1DJYA 2KYCA 3KEVA 2M7LA 1SCMB 1YUUA 4YGEB 1L2OB 2ISDA 2LLTA 4DCKA 1NWDA 1R2UA 2JT0A 4YI9A 5K89A 5HLVA 4GUKA 2LMTA 2G9BA 2LCPA 1NCXA 2KYFA 1J7RA 4E68A 1CKKA 2KFHA 1QVIZ 2LV7A 1K90D 1OZSA 1OMDA 4BY5A 2CTNA 2MHHA 1J1DA 5JOLA 1IWQA 1FF1A 1B1GA 3KHEA 4CFQA 4MEWA 4OV2A 5HKZA 1NCYA 1SPYA 2D8NA 1KFUS 2QPTA 1J7QA 2JQ6A 1OSAA 5CSFA 3FWBA 1UURA 1Q80A 3O4YA 1JF2A 1H8BA 3JTDB 3SG5A 2CCMA 1G8IA 4PE7A 1VRKA 1SR6C 1B7TZ 3IQOA 5PALA 2L2EA 1AVSA 3GK4X 5HYDA 1A75B 3WHTB 1MR8A 2KFGA 4GFTA 4N5XA 2Q4UA 1DMOA 3DD4A 3OB2B 4PCWA 1XFUO 1LXFC 1RTP1 5I2OA 2ZRTA 1CTRA 4PHKA 1TOPA 2MA2A 4I5KA 1JC2A 3SIBA 3EK7A 4MZJA 1DJXA 3CLNA 2LUXA 1S5GZ 1UHKA 1IJ5A 2MBXA 3CTNA 4DRWA 3I5HC 1NP8A 1YRUB 2LVKA 2M8UA 1K95A 2CT9A 4ICBA 4ORBB 1S5GY 1WY9A 3DVEA 1LKJA 1BODA 4GNKB 2L51A 3OHMB 1NUBA 2HPSA 4C0LA 1J1EA 3CWGA 3FIAA 3D10A 5JJGA 1W7IB 2NZ0A 1QIVA 2JOJA 1WLZA 2LMVA 2M29A 1F4QA 5AXIA 4GBAA 1J7OA 4MVFA 3EVRA 1DT7B 4AQJA 3JTDC 1A75A 1AHRA 4GGNA 4PHJA 1MF8B 1CFDA 4YGBB 1PSRA 4MRYA 3O78A 1B8LA 2FCDA 2F8PA 1B4CA 3I5HB 3QRXA 2B1UA 1XFYO 1ODBA 1BJFA 4TNCA 1FI6A 2NLNA 5CSJA 1EG3A 2HF5A 2JWWA 1TIZA 1JFJA 1D1OA 1GGWA 1AJ4A 1DF0A 2LVVA 4NQGA 2L0PA 3I5FC 2ZFDA 1QATA 5KU1A 2JTTA 4YGDB 1NX0A 3OP0A 1CDLA 1UWOA 2KBMA 1JFKA 1CLMA 2JT8A 2LUCA 1S6JA 1S6IA 3TDZA 1C07A 1PSBA 2SCPA 5KTYA 3AAJA 4JQ0D 1QVIY 2EC6C 1KWOB 4MSPA 4MZKA 2O60A 4ZCVA 1UP5A 2BBMA 2H61A 1MWNA 1F71A 1U5IA 2NXQA 4ORAB 2EC6B 2KNEA 3OX6A 3LL8B 1ZFSA 3M0WA 4MZLA 1UHHA 3ZWHA 1XFXO 1EXRA 2AAOA 2I94A 3JVTB 5I8NA 1ALVA 2L4HA 2LLSA 3AAKA 4N1FA 1TNXA 4I5NB 2CXJA 1K9PA 1EL4A 2BE6A 5HKWA 2BE4A 3GK1A 2WCEA 4R1EA 1KWOC 1S1EA 1IRJA 2KGBC 1CFPA 1S3PA 3CS1A 2K2AA 1XFWO 3I5GB 3HX4A 2TN4A 1M63B 2KDHA 4MBEA 2JTZA 3PLFB 2LLUA 1A4PA 3TS5C 4ETOA 2A4JA 3EKJA 3ICBA 4A4CA 4OR9B 4GGFA 2L4IA 1DTLA 1BLQA 2M0RA 1QXPA 1PALA 1ZOTB 2LVJA 2OS8C 1KQVA 3O2PA 1FPWA 2PASA 2M7NA 1A2XA 3VRQA 2ZNEA 4NDCA 2LP3A 2LE9B 1BR1B 5AFPA 1OMVA 4JPZB 2E30A 1OZOA 1KK8C 1C7VA 3CR2A 1CDNA 1PVAA 1QTXA 1GGZA 3LCPC 3C1VA 1NPQA 4CPVA 5FYXA 1YTZC 1WLMA 1RFJA 4PALA 1A03A 3NSKA 5HKYA 2JRFA 5D69A 4F0ZB 1NIWA 4C0KA 3DVMA 1CB1A 3GOFA 2KI6D 1SL9A 4OCIA 1XK4A 2PSRA 1NCZA 2LMUA 1SYMA 2SASA 4PE0A 1BR4B 4WRIA 1F54A 4YRUA 2LHIA 4FQOA 2VRGA 3TZ1A 2LHLA 3EVUA 1M31A 2LP2A 3EK8A 2I7AA 1LA0A 3I5IC 3BOWA 1PULA 1SNLA 1K94A 2KQ6A 4PE1A 3A4UB 1WRKA 1ALWA 3PATA 4M2OA 1LINA 2KOTA 1CMFA 1TNWA 1EH2A 5CSIA 3BUOB 2JULA 3TDUA 3OX5A 2K7CA 3K21A 2NCPA 1N2DA 4NDDA 2GGMA 3DVKA 1RJVA 1B8RA 4GAOA 1J7PA 1DJHA 2L5XB 1BOCA 1QS7A 1CFFA 1SL7A 2PVBA 2BL0B 2WORA 3D0YB 2MLFC 2PRUA 1SR6B 2AUCA 1LVCD 1XFZO 4NDBA 1WRZA 2BKIB 2Y4QA 1B9AA 2KAYA 2OS8B 1A29A 1QX7A 3BYAA 5J3XA 1IH0A 1V1GA 1F8HA 1JF0A 3KO0A 3WXAA 5F6TA 1GQMA 2OTGC 1SRAA 1QX2A 4GGFC 2BCBA 3EK4A 4CFRA 2M1UA 5KSZA 3TUYB 2LAPA 2K7BA 1G33A 3NSIA 4HSZA 3IQQA 4P5OE 4XYNA 3DVJA 1N65A 2KSPA 2KFFA 1NX2A 1K93D 2I18A 1Y1UA 1BT6A 4PDZA 3VRPA 1AUIB 2COLB 2LC5A 1CNPA 2M3WA 4UPGA 1SCMC 1Y1XA 3NXAA 4DS7A 4PHNA 1OQPA 1IKUA 1QV0A 2F33A 2KAXA 2RGIA 2KQYA 3SG2A 2WOSA 3TUYC 1UUSA 1M39A 3PN7C 1YVHA 4FTGA 1L7ZA 3PM8A 4XJKA 3SG6A 1RWYA 2M1KB 1KFUL 1QX5B 4M2PA 4USLA 2G2BA 1XYDA 1XVJA 1TNQA 1NX3A 1S36A 3BQ3A 3EVVA 3TDIA 1NX1A 2F2OA 1SL8A 1DGVA 1KSOA 2KGRA 3NSLA 2K0JA 2ZKMX 1KFXS 1PVBA 1YX7A 1IQ3A 2JT3A 1KCYA 2K7DA 1K8UA 1KK7Z 3IF7A 1K96A 3I5FB 1IJ6A 1J55A 1LA3A 4HRHA 5I2QA 1EJ3A 2OPOA 1OMRA 2BCAA 1UHIA 2BBNA 1R6PA 2P6BB 2PMYA 4ZCUA 1BF5A 2V53A 3PSRA 1FI5A 1DVIA 3VROA 1HQVA 4C0JA 1YUTA 2AMIA 5D7FA 1CLBA 1PK0D 1ZACA 2BCXA 2KAVA 2E6WA 1WDCC 4AOMA 1K2HA 1YUSA 1KK8B 3ZNIA 1G4YR 2FOTA 3DF0A 2I2RE 5BPJA 2JXLA 2Y5IA 1SCVA 2Q91A 1KK7Y 1Y1AA 1X02A 2K2FA 3PFVA 1QIWA 2L98A 3AKAA 2ZRSA 1F55A 2BKHB 5DKQA 1CMGA 1E8AA 4QJ4B 1Y0VH 2KI4B 3MSEB 1WDCB 1QJTA 1UHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M46 A;  1U5I B;  1DF0 B;  1S6C A;  1SBJ A;  3LK1 A;  3SJS A;  2LAN A;  4P2Y B;  2R2I A;  3SIA A;  5G08 A;  1YUR A;  5ER5 A;  1K9U A;  3F45 A;  4CLN A;  2MLE C;  1XA5 A;  5HLO A;  4AQI A;  4U8D A;  1JWD A;  1YX8 A;  1TNP A;  2JXC A;  1KQM B;  2PAL A;  1SW8 A;  2MAZ A;  4XJK B;  2KHN A;  1CM4 A;  1JUO A;  3RM1 A;  2M49 B;  1SK6 D;  4DIR A;  1B7T Y;  3SG3 A;  2CNP A;  3TS5 B;  5B8I B;  3VRR A;  5DKN A;  2K61 A;  2K7O A;  1DJZ A;  1OE9 B;  1BMO A;  2HQ8 A;  2MJW B;  4GPL B;  5AEQ A;  1W7J B;  3WHU B;  2L50 A;  5I2L A;  2HET A;  4M2Q A;  2ZN8 A;  4L9M A;  4MRX A;  1L2O C;  4HRG A;  3FS7 A;  2O5G A;  2MRD A;  1KSM A;  1SY9 A;  1CDM A;  1ZUZ A;  1XO5 A;  4I5J A;  3JVT C;  4PE4 A;  5AAN A;  3PN7 B;  2QAC A;  3BXK A;  2DOQ A;  2F2P A;  2JC2 A;  3LK0 A;  2JZI A;  1RRO A;  2BL0 C;  1S26 D;  1DJW A;  1F4O A;  2ZN9 A;  1TRF A;  2GGZ A;  3CGA A;  3PAL A;  1JSA A;  2JNF A;  1RK9 A;  4QJ5 B;  1HT9 A;  2WCF A;  4WQ2 A;  2CBL A;  3CR4 X;  3SG4 A;  2Y1M A;  1NYA A;  1SKT A;  1DJI A;  1KQM C;  1CDP A;  3BUN B;  4YGA A;  2HQW A;  3VGO A;  4DUQ A;  3CR5 X;  5DKR A;  1WRL A;  2ZND A;  1H4B A;  1MXE A;  2M9G A;  2M97 A;  1V1F A;  4HRE E;  5TNC A;  1XK4 C;  1REC A;  5AER A;  2H61 C;  1MUX A;  1QV1 A;  1CFC A;  3E3R A;  3I5I B;  2OTG B;  1Y6W A;  3A8R A;  3KPX A;  3OB1 B;  4YGC B;  3FWC A;  4D1E A;  1B47 A;  1DGU A;  1BG1 A;  1AP4 A;  1TCO B;  3AKB A;  4OVN F;  1NSH A;  2KI4 C;  2LVI A;  4CID A;  2LNK A;  1MXL C;  2F3Y A;  1MQ1 A;  1F70 A;  1IGV A;  3WNX B;  1TTX A;  4MLW A;  1B8C A;  2H2K A;  3EKH A;  1OOJ A;  1QLS A;  1SMG A;  1AK8 A;  2FJU B;  2JNX A;  3DF0 B;  4YBH B;  1EG4 A;  4QJ3 B;  3D0Y A;  2WC8 A;  3LLE A;  1C7W A;  2WCB A;  1N0Y A;  3O6B A;  4Q04 A;  2KBI A;  2EGD A;  2KI6 C;  5CSN A;  1QLK A;  3BOW B;  4YI8 A;  1FBV A;  1QAS A;  2LM5 A;  1DJG A;  3KF9 A;  4PHM A;  1ZMZ A;  2IS9 A;  1CM1 A;  2NCO A;  1AJ5 A;  3BUX B;  3BUW B;  2JPT A;  4OKH A;  2BEC A;  1TN4 A;  5ER4 X;  3VRN A;  3HCM A;  4BY4 A;  1K9K A;  3GK2 A;  1M45 A;  2GV5 A;  1MHO A;  2Y1N A;  3BUM B;  4IL1 A;  2F3Z A;  3I5G C;  5IBW A;  4N1G A;  3SG7 A;  4MN0 A;  4ORC B;  1KFX L;  1UHN A;  1JBA A;  2JU0 A;  1TCF A;  5GQQ C;  3NSO A;  4WQ3 A;  1IQ5 A;  2FCE A;  5CPV A;  2WND A;  1IG5 A;  3CZT X;  4JWQ A;  1YRT B;  4A4B A;  1GJY A;  3RLZ A;  2EHB A;  1YR5 A;  1YVL A;  1XFV O;  1PRW A;  3H4S E;  1CLL A;  2K8M B;  4I5L B;  1FW4 A;  1BU3 A;  1DJY A;  2KYC A;  3KEV A;  2M7L A;  1SCM B;  1YUU A;  4YGE B;  1L2O B;  2ISD A;  2LLT A;  4DCK A;  1NWD A;  1R2U A;  2JT0 A;  4YI9 A;  5K89 A;  5HLV A;  4GUK A;  2LMT A;  2G9B A;  2LCP A;  1NCX A;  2KYF A;  1J7R A;  4E68 A;  1CKK A;  2KFH A;  1QVI Z;  2LV7 A;  1K90 D;  1OZS A;  1OMD A;  4BY5 A;  2CTN A;  2MHH A;  1J1D A;  5JOL A;  1IWQ A;  1FF1 A;  1B1G A;  3KHE A;  4CFQ A;  4MEW A;  4OV2 A;  5HKZ A;  1NCY A;  1SPY A;  2D8N A;  1KFU S;  2QPT A;  1J7Q A;  2JQ6 A;  1OSA A;  5CSF A;  3FWB A;  1UUR A;  1Q80 A;  3O4Y A;  1JF2 A;  1H8B A;  3JTD B;  3SG5 A;  2CCM A;  1G8I A;  4PE7 A;  1VRK A;  1SR6 C;  1B7T Z;  3IQO A;  5PAL A;  2L2E A;  1AVS A;  3GK4 X;  5HYD A;  1A75 B;  3WHT B;  1MR8 A;  2KFG A;  4GFT A;  4N5X A;  2Q4U A;  1DMO A;  3DD4 A;  3OB2 B;  4PCW A;  1XFU O;  1LXF C;  1RTP 1;  5I2O A;  2ZRT A;  1CTR A;  4PHK A;  1TOP A;  2MA2 A;  4I5K A;  1JC2 A;  3SIB A;  3EK7 A;  4MZJ A;  1DJX A;  3CLN A;  2LUX A;  1S5G Z;  1UHK A;  1IJ5 A;  2MBX A;  3CTN A;  4DRW A;  3I5H C;  1NP8 A;  1YRU B;  2LVK A;  2M8U A;  1K95 A;  2CT9 A;  4ICB A;  4ORB B;  1S5G Y;  1WY9 A;  3DVE A;  1LKJ A;  1BOD A;  4GNK B;  2L51 A;  3OHM B;  1NUB A;  2HPS A;  4C0L A;  1J1E A;  3CWG A;  3FIA A;  3D10 A;  5JJG A;  1W7I B;  2NZ0 A;  1QIV A;  2JOJ A;  1WLZ A;  2LMV A;  2M29 A;  1F4Q A;  5AXI A;  4GBA A;  1J7O A;  4MVF A;  3EVR A;  1DT7 B;  4AQJ A;  3JTD C;  1A75 A;  1AHR A;  4GGN A;  4PHJ A;  1MF8 B;  1CFD A;  4YGB B;  1PSR A;  4MRY A;  3O78 A;  1B8L A;  2FCD A;  2F8P A;  1B4C A;  3I5H B;  3QRX A;  2B1U A;  1XFY O;  1ODB A;  1BJF A;  4TNC A;  1FI6 A;  2NLN A;  5CSJ A;  1EG3 A;  2HF5 A;  2JWW A;  1TIZ A;  1JFJ A;  1D1O A;  1GGW A;  1AJ4 A;  1DF0 A;  2LVV A;  4NQG A;  2L0P A;  3I5F C;  2ZFD A;  1QAT A;  5KU1 A;  2JTT A;  4YGD B;  1NX0 A;  3OP0 A;  1CDL A;  1UWO A;  2KBM A;  1JFK A;  1CLM A;  2JT8 A;  2LUC A;  1S6J A;  1S6I A;  3TDZ A;  1C07 A;  1PSB A;  2SCP A;  5KTY A;  3AAJ A;  4JQ0 D;  1QVI Y;  2EC6 C;  1KWO B;  4MSP A;  4MZK A;  2O60 A;  4ZCV A;  1UP5 A;  2BBM A;  2H61 A;  1MWN A;  1F71 A;  1U5I A;  2NXQ A;  4ORA B;  2EC6 B;  2KNE A;  3OX6 A;  3LL8 B;  1ZFS A;  3M0W A;  4MZL A;  1UHH A;  3ZWH A;  1XFX O;  1EXR A;  2AAO A;  2I94 A;  3JVT B;  5I8N A;  1ALV A;  2L4H A;  2LLS A;  3AAK A;  4N1F A;  1TNX A;  4I5N B;  2CXJ A;  1K9P A;  1EL4 A;  2BE6 A;  5HKW A;  2BE4 A;  3GK1 A;  2WCE A;  4R1E A;  1KWO C;  1S1E A;  1IRJ A;  2KGB C;  1CFP A;  1S3P A;  3CS1 A;  2K2A A;  1XFW O;  3I5G B;  3HX4 A;  2TN4 A;  1M63 B;  2KDH A;  4MBE A;  2JTZ A;  3PLF B;  2LLU A;  1A4P A;  3TS5 C;  4ETO A;  2A4J A;  3EKJ A;  3ICB A;  4A4C A;  4OR9 B;  4GGF A;  2L4I A;  1DTL A;  1BLQ A;  2M0R A;  1QXP A;  1PAL A;  1ZOT B;  2LVJ A;  2OS8 C;  1KQV A;  3O2P A;  1FPW A;  2PAS A;  2M7N A;  1A2X A;  3VRQ A;  2ZNE A;  4NDC A;  2LP3 A;  2LE9 B;  1BR1 B;  5AFP A;  1OMV A;  4JPZ B;  2E30 A;  1OZO A;  1KK8 C;  1C7V A;  3CR2 A;  1CDN A;  1PVA A;  1QTX A;  1GGZ A;  3LCP C;  3C1V A;  1NPQ A;  4CPV A;  5FYX A;  1YTZ C;  1WLM A;  1RFJ A;  4PAL A;  1A03 A;  3NSK A;  5HKY A;  2JRF A;  5D69 A;  4F0Z B;  1NIW A;  4C0K A;  3DVM A;  1CB1 A;  3GOF A;  2KI6 D;  1SL9 A;  4OCI A;  1XK4 A;  2PSR A;  1NCZ A;  2LMU A;  1SYM A;  2SAS A;  4PE0 A;  1BR4 B;  4WRI A;  1F54 A;  4YRU A;  2LHI A;  4FQO A;  2VRG A;  3TZ1 A;  2LHL A;  3EVU A;  1M31 A;  2LP2 A;  3EK8 A;  2I7A A;  1LA0 A;  3I5I C;  3BOW A;  1PUL A;  1SNL A;  1K94 A;  2KQ6 A;  4PE1 A;  3A4U B;  1WRK A;  1ALW A;  3PAT A;  4M2O A;  1LIN A;  2KOT A;  1CMF A;  1TNW A;  1EH2 A;  5CSI A;  3BUO B;  2JUL A;  3TDU A;  3OX5 A;  2K7C A;  3K21 A;  2NCP A;  1N2D A;  4NDD A;  2GGM A;  3DVK A;  1RJV A;  1B8R A;  4GAO A;  1J7P A;  1DJH A;  2L5X B;  1BOC A;  1QS7 A;  1CFF A;  1SL7 A;  2PVB A;  2BL0 B;  2WOR A;  3D0Y B;  2MLF C;  2PRU A;  1SR6 B;  2AUC A;  1LVC D;  1XFZ O;  4NDB A;  1WRZ A;  2BKI B;  2Y4Q A;  1B9A A;  2KAY A;  2OS8 B;  1A29 A;  1QX7 A;  3BYA A;  5J3X A;  1IH0 A;  1V1G A;  1F8H A;  1JF0 A;  3KO0 A;  3WXA A;  5F6T A;  1GQM A;  2OTG C;  1SRA A;  1QX2 A;  4GGF C;  2BCB A;  3EK4 A;  4CFR A;  2M1U A;  5KSZ A;  3TUY B;  2LAP A;  2K7B A;  1G33 A;  3NSI A;  4HSZ A;  3IQQ A;  4P5O E;  4XYN A;  3DVJ A;  1N65 A;  2KSP A;  2KFF A;  1NX2 A;  1K93 D;  2I18 A;  1Y1U A;  1BT6 A;  4PDZ A;  3VRP A;  1AUI B;  2COL B;  2LC5 A;  1CNP A;  2M3W A;  4UPG A;  1SCM C;  1Y1X A;  3NXA A;  4DS7 A;  4PHN A;  1OQP A;  1IKU A;  1QV0 A;  2F33 A;  2KAX A;  2RGI A;  2KQY A;  3SG2 A;  2WOS A;  3TUY C;  1UUS A;  1M39 A;  3PN7 C;  1YVH A;  4FTG A;  1L7Z A;  3PM8 A;  4XJK A;  3SG6 A;  1RWY A;  2M1K B;  1KFU L;  1QX5 B;  4M2P A;  4USL A;  2G2B A;  1XYD A;  1XVJ A;  1TNQ A;  1NX3 A;  1S36 A;  3BQ3 A;  3EVV A;  3TDI A;  1NX1 A;  2F2O A;  1SL8 A;  1DGV A;  1KSO A;  2KGR A;  3NSL A;  2K0J A;  2ZKM X;  1KFX S;  1PVB A;  1YX7 A;  1IQ3 A;  2JT3 A;  1KCY A;  2K7D A;  1K8U A;  1KK7 Z;  3IF7 A;  1K96 A;  3I5F B;  1IJ6 A;  1J55 A;  1LA3 A;  4HRH A;  5I2Q A;  1EJ3 A;  2OPO A;  1OMR A;  2BCA A;  1UHI A;  2BBN A;  1R6P A;  2P6B B;  2PMY A;  4ZCU A;  1BF5 A;  2V53 A;  3PSR A;  1FI5 A;  1DVI A;  3VRO A;  1HQV A;  4C0J A;  1YUT A;  2AMI A;  5D7F A;  1CLB A;  1PK0 D;  1ZAC A;  2BCX A;  2KAV A;  2E6W A;  1WDC C;  4AOM A;  1K2H A;  1YUS A;  1KK8 B;  3ZNI A;  1G4Y R;  2FOT A;  3DF0 A;  2I2R E;  5BPJ A;  2JXL A;  2Y5I A;  1SCV A;  2Q91 A;  1KK7 Y;  1Y1A A;  1X02 A;  2K2F A;  3PFV A;  1QIW A;  2L98 A;  3AKA A;  2ZRS A;  1F55 A;  2BKH B;  5DKQ A;  1CMG A;  1E8A A;  4QJ4 B;  1Y0V H;  2KI4 B;  3MSE B;  1WDC B;  1QJT A;  1UHJ A; 
#chains in the Genus database with same CATH topology
 1M46 A;  1U5I B;  1DF0 B;  1S6C A;  1SBJ A;  3LK1 A;  3SJS A;  1TUZ A;  2LAN A;  4P2Y B;  3PM2 A;  2R2I A;  3SIA A;  5G08 A;  1YUR A;  5ER5 A;  1K9U A;  3F45 A;  4CLN A;  2MLE C;  1XFR A;  3B86 A;  1XA5 A;  5HLO A;  4AQI A;  4U8D A;  1JWD A;  1YX8 A;  1TNP A;  1C3Y A;  2JXC A;  1ORG A;  1KQM B;  2PAL A;  1SW8 A;  2MAZ A;  4XJK B;  2KHN A;  1CM4 A;  1JUO A;  3RM1 A;  2M49 B;  1SK6 D;  4DIR A;  1B7T Y;  3SG3 A;  2CNP A;  3TS5 B;  5B8I B;  3VRR A;  5DKN A;  2K61 A;  2K7O A;  1DJZ A;  1OE9 B;  1BMO A;  2HQ8 A;  2MJW B;  3B6X A;  4GPL B;  1W7J B;  5AEQ A;  2L50 A;  3WHU B;  4F7F A;  5I2L A;  2HET A;  4M2Q A;  2ZN8 A;  4L9M A;  1SSE B;  4MRX A;  1L2O C;  2QEB A;  4HRG A;  3FS7 A;  2O5G A;  2MRD A;  1KSM A;  1SY9 A;  1CDM A;  1ZUZ A;  1XO5 A;  4I5J A;  3FE9 A;  3JVT C;  4PE4 A;  5AAN A;  3PN7 B;  2QAC A;  3BXK A;  2DOQ A;  2F2P A;  2JC2 A;  3CZ2 A;  3FE8 A;  3LK0 A;  3NHT A;  2JZI A;  4PT1 A;  1RRO A;  2BL0 C;  1S26 D;  1DJW A;  1F4O A;  2ZN9 A;  1TRF A;  2GGZ A;  3CGA A;  3PAL A;  1JSA A;  2JNF A;  1OOF A;  1RK9 A;  1HT9 A;  4QJ5 B;  2WCF A;  4WQ2 A;  1Z2C B;  2CBL A;  3CR4 X;  3SG4 A;  2Y1M A;  1NYA A;  1SKT A;  1DJI A;  1KQM C;  1CDP A;  3BUN B;  4YGA A;  2HQW A;  3VGO A;  4DUQ A;  3CR5 X;  5DKR A;  1WRL A;  2ZND A;  1H4B A;  1MXE A;  2M9G A;  2M97 A;  1V1F A;  4HRE E;  5TNC A;  1XK4 C;  1REC A;  5AER A;  3IVT A;  2H61 C;  1MUX A;  1QV1 A;  1CFC A;  3E3R A;  3I5I B;  2OTG B;  1Y6W A;  3A8R A;  3KPX A;  3OB1 B;  4YGC B;  3FWC A;  4D1E A;  1B47 A;  1DGU A;  1BG1 A;  1AP4 A;  1TCO B;  3AKB A;  4OVN F;  1NSH A;  2KI4 C;  2LVI A;  4CID A;  2LNK A;  1MXL C;  2F3Y A;  1MQ1 A;  1F70 A;  1IGV A;  3WNX B;  1TTX A;  4MLW A;  1B8C A;  2H2K A;  3EKH A;  1OOJ A;  1QLS A;  1SMG A;  4JD9 A;  3L4L A;  1DQE A;  1AK8 A;  2FJU B;  2JNX A;  3DF0 B;  4YBH B;  1EG4 A;  4QJ3 B;  3D0Y A;  2WC8 A;  3LLE A;  1C7W A;  2WCB A;  2WCM A;  1N0Y A;  3O6B A;  2P71 A;  3B87 A;  4Q04 A;  2KBI A;  2EGD A;  2KI6 C;  5CSN A;  1QLK A;  1DC1 A;  2PYQ A;  3BOW B;  1FBV A;  1QAS A;  4YI8 A;  2LM5 A;  1DJG A;  2QEO A;  3KF9 A;  1ZMZ A;  4PHM A;  2IS9 A;  1CM1 A;  2NCO A;  1AJ5 A;  3BUX B;  3BUW B;  2JPT A;  4OKH A;  2BEC A;  1TN4 A;  5ER4 X;  3VRN A;  3HCM A;  4BY4 A;  1K9K A;  3GK2 A;  1M45 A;  2GV5 A;  1MHO A;  2Y1N A;  3BUM B;  4IL1 A;  2F3Z A;  3I5G C;  3S0D A;  4N1G A;  5IBW A;  3SG7 A;  2ERB A;  4MN0 A;  4ORC B;  1KFX L;  3CZ1 A;  1UHN A;  1JBA A;  2JU0 A;  1TCF A;  5GQQ C;  3SS3 A;  3NSO A;  4WQ3 A;  1IQ5 A;  3NGV A;  2FCE A;  5CPV A;  2WND A;  5FI6 A;  1IG5 A;  3R1P A;  1C3Z A;  3CZT X;  5D3O A;  4JWQ A;  1YRT B;  4A4B A;  1GJY A;  3RLZ A;  2EHB A;  1YR5 A;  3S0G A;  1YVL A;  1XFV O;  1PRW A;  3H4S E;  1CLL A;  2K8M B;  2WC5 A;  4I5L B;  3R1V A;  1FW4 A;  1BU3 A;  1DJY A;  2KYC A;  2WCH A;  3KEV A;  2M7L A;  1SCM B;  1YUU A;  3O4X A;  4YGE B;  2BNX A;  1L2O B;  5I94 A;  2ISD A;  3V2L A;  2LLT A;  4DCK A;  1NWD A;  1R2U A;  2JT0 A;  4YI9 A;  5K89 A;  5HLV A;  4GUK A;  2LMT A;  2G9B A;  2LCP A;  1NCX A;  2KYF A;  1J7R A;  4E68 A;  1CKK A;  2KFH A;  1QVI Z;  2LV7 A;  1DEK A;  1K90 D;  1OZS A;  3OGN A;  1OMD A;  4BY5 A;  2CTN A;  5HL1 A;  2MHH A;  1J1D A;  3D78 A;  5JOL A;  1IWQ A;  1FF1 A;  1B1G A;  3KHE A;  4CFQ A;  4MEW A;  4OV2 A;  5HKZ A;  1NCY A;  1SPY A;  3CAB A;  2D8N A;  1KFU S;  2QPT A;  3N7H A;  2JQ6 A;  1OSA A;  1J7Q A;  5CSF A;  3FWB A;  1UUR A;  1Q80 A;  3O4Y A;  1JF2 A;  1H8B A;  3JTD B;  3SG5 A;  2CCM A;  1G8I A;  4PE7 A;  3D73 A;  3SS5 A;  1VRK A;  1SR6 C;  1B7T Z;  3IQO A;  5PAL A;  2L2E A;  1AVS A;  3D77 A;  3GK4 X;  2QEV A;  5HYD A;  1A75 B;  3WHT B;  2KPH A;  1MR8 A;  2KFG A;  4GFT A;  4N5X A;  2Q4U A;  1DMO A;  3DD4 A;  3D75 A;  3OB2 B;  4PCW A;  1XFU O;  1LXF C;  1RTP 1;  5I2O A;  2ZRT A;  3CDN A;  3VB1 A;  1CTR A;  4PHK A;  1TOP A;  2MA2 A;  4I5K A;  4KYN A;  1JC2 A;  2JPO A;  3SIB A;  3EK7 A;  4MZJ A;  2WCK A;  1DJX A;  3CLN A;  2LUX A;  1S5G Z;  1UHK A;  1IJ5 A;  2WCL A;  2MBX A;  3CTN A;  4DRW A;  3I5H C;  1NP8 A;  1YRU B;  2LVK A;  2M8U A;  1K95 A;  2CT9 A;  4ICB A;  4ORB B;  1S5G Y;  1WY9 A;  3DVE A;  1LKJ A;  1BOD A;  4GNK B;  2L51 A;  3OHM B;  1NUB A;  1P28 A;  2HPS A;  4C0L A;  1J1E A;  3CWG A;  3FIA A;  3D10 A;  5JJG A;  3FE6 A;  1W7I B;  2NZ0 A;  1QIV A;  2JOJ A;  1WLZ A;  2LMV A;  2M29 A;  1F4Q A;  5AXI A;  4GBA A;  1J7O A;  3EG5 B;  4MVF A;  3EVR A;  2WCJ A;  5EL2 A;  1DT7 B;  4AQJ A;  3JTD C;  1A75 A;  1AHR A;  3B88 A;  4GGN A;  4PHJ A;  1MF8 B;  1CFD A;  4YGB B;  1PSR A;  4MRY A;  3O78 A;  1B8L A;  2FCD A;  2F8P A;  1B4C A;  3I5H B;  3UNW A;  3QRX A;  2B1U A;  1XFY O;  3DZT A;  1ODB A;  1OOI X;  1BJF A;  2H8V A;  4TNC A;  3OBV A;  1FI6 A;  2NLN A;  3RZS A;  5CSJ A;  1EG3 A;  2HF5 A;  2JWW A;  1TIZ A;  1JFJ A;  1D1O A;  1GGW A;  1AJ4 A;  1DF0 A;  2LVV A;  4NQG A;  2L0P A;  1TUJ A;  3I5F C;  2ZFD A;  1QAT A;  5KU1 A;  2JTT A;  4YGD B;  1NX0 A;  3OP0 A;  1CDL A;  1UWO A;  2KBM A;  1JFK A;  1CLM A;  2JT8 A;  2LUC A;  1S6J A;  1S6I A;  3TDZ A;  1C07 A;  1PSB A;  2SCP A;  5KTY A;  3AAJ A;  4JQ0 D;  1QVI Y;  2EC6 C;  1KWO B;  4MSP A;  4MZK A;  3S0B A;  2O60 A;  2KLD A;  4ZCV A;  1UP5 A;  2BBM A;  2H61 A;  1MWN A;  1F71 A;  1U5I A;  2NXQ A;  4ORA B;  2EC6 B;  2KNE A;  3OX6 A;  3LL8 B;  1ZFS A;  3M0W A;  4MZL A;  1UHH A;  3ZWH A;  1XFX O;  1EXR A;  2AAO A;  2I94 A;  3JVT B;  5I8N A;  1ALV A;  2L4H A;  2LLS A;  3AAK A;  1F54 A;  4N1F A;  1GM0 A;  1TNX A;  4I5N B;  2CXJ A;  3DYE A;  1K9P A;  1EL4 A;  2BE6 A;  5HKW A;  2BE4 A;  3GK1 A;  2WCE A;  4R1E A;  1KWO C;  1S1E A;  1IRJ A;  2KGB C;  3UO9 A;  1CFP A;  1S3P A;  3CS1 A;  2K2A A;  1XFW O;  3I5G B;  3HX4 A;  2TN4 A;  1M63 B;  2KDH A;  4MBE A;  2JTZ A;  3PLF B;  2LLU A;  3BFA A;  1A4P A;  3TS5 C;  4ETO A;  2A4J A;  3EKJ A;  2K60 A;  3ICB A;  4A4C A;  4OR9 B;  4GGF A;  2L4I A;  1DTL A;  1BLQ A;  2M0R A;  1QXP A;  1PAL A;  1ZOT B;  2LVJ A;  2OS8 C;  1KQV A;  3O2P A;  4JKT A;  1FPW A;  2PAS A;  2M7N A;  1A2X A;  3VRQ A;  2ZNE A;  4NDC A;  2LP3 A;  3S0F A;  2LE9 B;  2PQL A;  1BR1 B;  5AFP A;  1OMV A;  4JPZ B;  2E30 A;  1OZO A;  1KK8 C;  1C7V A;  3CR2 A;  1CDN A;  3BFB A;  1PVA A;  1QTX A;  1GGZ A;  3LCP C;  3C1V A;  1NPQ A;  3CYZ A;  4CPV A;  5FYX A;  1YTZ C;  5FI2 A;  4IJ7 A;  1WLM A;  1RFJ A;  4PAL A;  1A03 A;  3NSK A;  5HKY A;  2JRF A;  5D69 A;  4F0Z B;  1OW4 A;  1NIW A;  4C0K A;  3DVM A;  1CB1 A;  3GOF A;  2KI6 D;  1SL9 A;  4OCI A;  1XK4 A;  2PSR A;  1NCZ A;  1TWO A;  1SYM A;  2LMU A;  2SAS A;  1BR4 B;  4PE0 A;  4WRI A;  4YRU A;  2LHI A;  4FQO A;  2VRG A;  3TZ1 A;  2LHL A;  3EVU A;  1M31 A;  2LP2 A;  3EK8 A;  1IIO A;  2I7A A;  1LA0 A;  3I5I C;  3SS4 A;  2KLE A;  3BOW A;  1PUL A;  1SNL A;  1K94 A;  2KQ6 A;  4PE1 A;  2QEH A;  3A4U B;  1WRK A;  1ALW A;  3PAT A;  4M2O A;  1LIN A;  2KOT A;  1CMF A;  3K1E A;  1TNW A;  1EH2 A;  5CSI A;  3BUO B;  2JUL A;  3Q8I A;  3OX5 A;  2K7C A;  3S0E A;  3TDU A;  3K21 A;  2NCP A;  1N2D A;  4NDD A;  2GGM A;  3BJH A;  1RJV A;  1B8R A;  3DVK A;  4GAO A;  1J7P A;  1DJH A;  2L5X B;  3QME A;  1BOC A;  1QS7 A;  1CFF A;  1SL7 A;  2PVB A;  3NHI A;  2P70 A;  2BL0 B;  2WOR A;  3D0Y B;  2MLF C;  2PRU A;  1SR6 B;  2AUC A;  1LVC D;  1XFZ O;  4NDB A;  1WRZ A;  2BKI B;  2Y4Q A;  3R1O A;  5DIC A;  1B9A A;  2KAY A;  2L2C A;  2OS8 B;  1A29 A;  1QX7 A;  3BYA A;  5J3X A;  3L47 A;  1LS8 A;  1Z4H A;  1V1G A;  1IH0 A;  1F8H A;  1JF0 A;  3KO0 A;  3WXA A;  5F6T A;  1GQM A;  2OTG C;  3BFH A;  1SRA A;  1QX2 A;  4GGF C;  2BCB A;  3EK4 A;  4CFR A;  2M1U A;  5KSZ A;  3TUY B;  2LAP A;  2YGU A;  2K7B A;  1G33 A;  3NSI A;  4HSZ A;  2WC6 A;  3D74 A;  2BAP A;  3D76 A;  3IQQ A;  4P5O E;  4XYN A;  3DVJ A;  1N65 A;  3R72 A;  2KSP A;  2KFF A;  1NX2 A;  3CZ0 A;  1K93 D;  2I18 A;  1Y1U A;  1BT6 A;  4PDZ A;  3VRP A;  1AUI B;  2COL B;  2LC5 A;  1CNP A;  2M3W A;  4UPG A;  1SCM C;  1Y1X A;  3NXA A;  4DS7 A;  4PHN A;  1OQP A;  1IKU A;  1QV0 A;  2F33 A;  2KAX A;  2RGI A;  2KQY A;  3SG2 A;  2WOS A;  1QWV A;  3TUY C;  1UUS A;  1M39 A;  3PN7 C;  1YVH A;  4FTG A;  1L7Z A;  3PM8 A;  4XJK A;  3SG6 A;  1RWY A;  2M1K B;  3S0A A;  1KFU L;  1QX5 B;  3B7A A;  4M2P A;  4USL A;  2G2B A;  1XYD A;  1XVJ A;  3DY9 A;  1TNQ A;  1NX3 A;  1S36 A;  3BQ3 A;  3EVV A;  3TDI A;  1NX1 A;  2F2O A;  4INW A;  1T14 A;  1SL8 A;  1DGV A;  1KSO A;  2KGR A;  3NSL A;  2K0J A;  2ZKM X;  1OOH A;  1KFX S;  1PVB A;  5FI7 A;  1YX7 A;  1IQ3 A;  2L5Y A;  3DXL A;  2JT3 A;  1KCY A;  2K7D A;  1K8U A;  1KK7 Z;  3IF7 A;  1K96 A;  3I5F B;  1IJ6 A;  1J55 A;  1LA3 A;  4HRH A;  5I2Q A;  1EJ3 A;  2OPO A;  1OMR A;  2BCA A;  1UHI A;  4OZD A;  2BBN A;  1R6P A;  2P6B B;  2PMY A;  4ZCU A;  1BF5 A;  2V53 A;  3PJI A;  3PSR A;  1FI5 A;  1DVI A;  3VRO A;  1HQV A;  1W9Z A;  4C0J A;  1YUT A;  2AMI A;  5D7F A;  1CLB A;  1PK0 D;  1ZAC A;  2BCX A;  2GTE A;  2E6W A;  1WDC C;  2KAV A;  4AOM A;  4FQT A;  1YUS A;  1K2H A;  1KK8 B;  3L4A A;  3ZNI A;  1G4Y R;  2FOT A;  3DF0 A;  2I2R E;  5BPJ A;  2JXL A;  2Y5I A;  1SCV A;  2Q91 A;  2QDI A;  1KK7 Y;  1Y1A A;  1X02 A;  2K2F A;  1DEL A;  3PFV A;  1QIW A;  2L98 A;  3AKA A;  2ZRS A;  4INX A;  1F55 A;  2BKH B;  5DKQ A;  1CMG A;  1E8A A;  4QJ4 B;  1Y0V H;  2KI4 B;  3MSE B;  2FJY A;  1WDC B;  1QJT A;  1OOG A;  1UHJ A; 
#chains in the Genus database with same CATH homology
 1M46 A;  1U5I B;  1DF0 B;  1S6C A;  1SBJ A;  3LK1 A;  3SJS A;  2LAN A;  4P2Y B;  2R2I A;  3SIA A;  5G08 A;  1YUR A;  5ER5 A;  1K9U A;  3F45 A;  4CLN A;  2MLE C;  1XA5 A;  5HLO A;  4AQI A;  4U8D A;  1JWD A;  1YX8 A;  1TNP A;  2JXC A;  1KQM B;  2PAL A;  1SW8 A;  2MAZ A;  4XJK B;  2KHN A;  1CM4 A;  1JUO A;  3RM1 A;  2M49 B;  1SK6 D;  4DIR A;  1B7T Y;  3SG3 A;  2CNP A;  3TS5 B;  5B8I B;  3VRR A;  5DKN A;  2K61 A;  2K7O A;  1DJZ A;  1OE9 B;  1BMO A;  2HQ8 A;  2MJW B;  4GPL B;  5AEQ A;  1W7J B;  3WHU B;  2L50 A;  5I2L A;  2HET A;  4M2Q A;  2ZN8 A;  4L9M A;  4MRX A;  1L2O C;  4HRG A;  3FS7 A;  2O5G A;  2MRD A;  1KSM A;  1SY9 A;  1CDM A;  1ZUZ A;  1XO5 A;  4I5J A;  3JVT C;  4PE4 A;  5AAN A;  3PN7 B;  2QAC A;  3BXK A;  2DOQ A;  2F2P A;  2JC2 A;  3LK0 A;  2JZI A;  1RRO A;  2BL0 C;  1S26 D;  1DJW A;  1F4O A;  2ZN9 A;  1TRF A;  2GGZ A;  3CGA A;  3PAL A;  1JSA A;  2JNF A;  1RK9 A;  4QJ5 B;  1HT9 A;  2WCF A;  4WQ2 A;  2CBL A;  3CR4 X;  3SG4 A;  2Y1M A;  1NYA A;  1SKT A;  1DJI A;  1KQM C;  1CDP A;  3BUN B;  4YGA A;  2HQW A;  3VGO A;  4DUQ A;  3CR5 X;  5DKR A;  1WRL A;  2ZND A;  1H4B A;  1MXE A;  2M9G A;  2M97 A;  1V1F A;  4HRE E;  5TNC A;  1XK4 C;  1REC A;  5AER A;  2H61 C;  1MUX A;  1QV1 A;  1CFC A;  3E3R A;  3I5I B;  2OTG B;  1Y6W A;  3A8R A;  3KPX A;  3OB1 B;  4YGC B;  3FWC A;  4D1E A;  1B47 A;  1DGU A;  1BG1 A;  1AP4 A;  1TCO B;  3AKB A;  4OVN F;  1NSH A;  2KI4 C;  2LVI A;  4CID A;  2LNK A;  1MXL C;  2F3Y A;  1MQ1 A;  1F70 A;  1IGV A;  3WNX B;  1TTX A;  4MLW A;  1B8C A;  2H2K A;  3EKH A;  1OOJ A;  1QLS A;  1SMG A;  1AK8 A;  2FJU B;  2JNX A;  3DF0 B;  4YBH B;  1EG4 A;  4QJ3 B;  3D0Y A;  2WC8 A;  3LLE A;  1C7W A;  2WCB A;  1N0Y A;  3O6B A;  4Q04 A;  2KBI A;  2EGD A;  2KI6 C;  5CSN A;  1QLK A;  3BOW B;  4YI8 A;  1FBV A;  1QAS A;  2LM5 A;  1DJG A;  3KF9 A;  4PHM A;  1ZMZ A;  2IS9 A;  1CM1 A;  2NCO A;  1AJ5 A;  3BUX B;  3BUW B;  2JPT A;  4OKH A;  2BEC A;  1TN4 A;  5ER4 X;  3VRN A;  3HCM A;  4BY4 A;  1K9K A;  3GK2 A;  1M45 A;  2GV5 A;  1MHO A;  2Y1N A;  3BUM B;  4IL1 A;  2F3Z A;  3I5G C;  5IBW A;  4N1G A;  3SG7 A;  4MN0 A;  4ORC B;  1KFX L;  1UHN A;  1JBA A;  2JU0 A;  1TCF A;  5GQQ C;  3NSO A;  4WQ3 A;  1IQ5 A;  2FCE A;  5CPV A;  2WND A;  1IG5 A;  3CZT X;  4JWQ A;  1YRT B;  4A4B A;  1GJY A;  3RLZ A;  2EHB A;  1YR5 A;  1YVL A;  1XFV O;  1PRW A;  3H4S E;  1CLL A;  2K8M B;  4I5L B;  1FW4 A;  1BU3 A;  1DJY A;  2KYC A;  3KEV A;  2M7L A;  1SCM B;  1YUU A;  4YGE B;  1L2O B;  2ISD A;  2LLT A;  4DCK A;  1NWD A;  1R2U A;  2JT0 A;  4YI9 A;  5K89 A;  5HLV A;  4GUK A;  2LMT A;  2G9B A;  2LCP A;  1NCX A;  2KYF A;  1J7R A;  4E68 A;  1CKK A;  2KFH A;  1QVI Z;  2LV7 A;  1K90 D;  1OZS A;  1OMD A;  4BY5 A;  2CTN A;  2MHH A;  1J1D A;  5JOL A;  1IWQ A;  1FF1 A;  1B1G A;  3KHE A;  4CFQ A;  4MEW A;  4OV2 A;  5HKZ A;  1NCY A;  1SPY A;  2D8N A;  1KFU S;  2QPT A;  1J7Q A;  2JQ6 A;  1OSA A;  5CSF A;  3FWB A;  1UUR A;  1Q80 A;  3O4Y A;  1JF2 A;  1H8B A;  3JTD B;  3SG5 A;  2CCM A;  1G8I A;  4PE7 A;  1VRK A;  1SR6 C;  1B7T Z;  3IQO A;  5PAL A;  2L2E A;  1AVS A;  3GK4 X;  5HYD A;  1A75 B;  3WHT B;  1MR8 A;  2KFG A;  4GFT A;  4N5X A;  2Q4U A;  1DMO A;  3DD4 A;  3OB2 B;  4PCW A;  1XFU O;  1LXF C;  1RTP 1;  5I2O A;  2ZRT A;  1CTR A;  4PHK A;  1TOP A;  2MA2 A;  4I5K A;  1JC2 A;  3SIB A;  3EK7 A;  4MZJ A;  1DJX A;  3CLN A;  2LUX A;  1S5G Z;  1UHK A;  1IJ5 A;  2MBX A;  3CTN A;  4DRW A;  3I5H C;  1NP8 A;  1YRU B;  2LVK A;  2M8U A;  1K95 A;  2CT9 A;  4ICB A;  4ORB B;  1S5G Y;  1WY9 A;  3DVE A;  1LKJ A;  1BOD A;  4GNK B;  2L51 A;  3OHM B;  1NUB A;  2HPS A;  4C0L A;  1J1E A;  3CWG A;  3FIA A;  3D10 A;  5JJG A;  1W7I B;  2NZ0 A;  1QIV A;  2JOJ A;  1WLZ A;  2LMV A;  2M29 A;  1F4Q A;  5AXI A;  4GBA A;  1J7O A;  4MVF A;  3EVR A;  1DT7 B;  4AQJ A;  3JTD C;  1A75 A;  1AHR A;  4GGN A;  4PHJ A;  1MF8 B;  1CFD A;  4YGB B;  1PSR A;  4MRY A;  3O78 A;  1B8L A;  2FCD A;  2F8P A;  1B4C A;  3I5H B;  3QRX A;  2B1U A;  1XFY O;  1ODB A;  1BJF A;  4TNC A;  1FI6 A;  2NLN A;  5CSJ A;  1EG3 A;  2HF5 A;  2JWW A;  1TIZ A;  1JFJ A;  1D1O A;  1GGW A;  1AJ4 A;  1DF0 A;  2LVV A;  4NQG A;  2L0P A;  3I5F C;  2ZFD A;  1QAT A;  5KU1 A;  2JTT A;  4YGD B;  1NX0 A;  3OP0 A;  1CDL A;  1UWO A;  2KBM A;  1JFK A;  1CLM A;  2JT8 A;  2LUC A;  1S6J A;  1S6I A;  3TDZ A;  1C07 A;  1PSB A;  2SCP A;  5KTY A;  3AAJ A;  4JQ0 D;  1QVI Y;  2EC6 C;  1KWO B;  4MSP A;  4MZK A;  2O60 A;  4ZCV A;  1UP5 A;  2BBM A;  2H61 A;  1MWN A;  1F71 A;  1U5I A;  2NXQ A;  4ORA B;  2EC6 B;  2KNE A;  3OX6 A;  3LL8 B;  1ZFS A;  3M0W A;  4MZL A;  1UHH A;  3ZWH A;  1XFX O;  1EXR A;  2AAO A;  2I94 A;  3JVT B;  5I8N A;  1ALV A;  2L4H A;  2LLS A;  3AAK A;  4N1F A;  1TNX A;  4I5N B;  2CXJ A;  1K9P A;  1EL4 A;  2BE6 A;  5HKW A;  2BE4 A;  3GK1 A;  2WCE A;  4R1E A;  1KWO C;  1S1E A;  1IRJ A;  2KGB C;  1CFP A;  1S3P A;  3CS1 A;  2K2A A;  1XFW O;  3I5G B;  3HX4 A;  2TN4 A;  1M63 B;  2KDH A;  4MBE A;  2JTZ A;  3PLF B;  2LLU A;  1A4P A;  3TS5 C;  4ETO A;  2A4J A;  3EKJ A;  3ICB A;  4A4C A;  4OR9 B;  4GGF A;  2L4I A;  1DTL A;  1BLQ A;  2M0R A;  1QXP A;  1PAL A;  1ZOT B;  2LVJ A;  2OS8 C;  1KQV A;  3O2P A;  1FPW A;  2PAS A;  2M7N A;  1A2X A;  3VRQ A;  2ZNE A;  4NDC A;  2LP3 A;  2LE9 B;  1BR1 B;  5AFP A;  1OMV A;  4JPZ B;  2E30 A;  1OZO A;  1KK8 C;  1C7V A;  3CR2 A;  1CDN A;  1PVA A;  1QTX A;  1GGZ A;  3LCP C;  3C1V A;  1NPQ A;  4CPV A;  5FYX A;  1YTZ C;  1WLM A;  1RFJ A;  4PAL A;  1A03 A;  3NSK A;  5HKY A;  2JRF A;  5D69 A;  4F0Z B;  1NIW A;  4C0K A;  3DVM A;  1CB1 A;  3GOF A;  2KI6 D;  1SL9 A;  4OCI A;  1XK4 A;  2PSR A;  1NCZ A;  2LMU A;  1SYM A;  2SAS A;  4PE0 A;  1BR4 B;  4WRI A;  1F54 A;  4YRU A;  2LHI A;  4FQO A;  2VRG A;  3TZ1 A;  2LHL A;  3EVU A;  1M31 A;  2LP2 A;  3EK8 A;  2I7A A;  1LA0 A;  3I5I C;  3BOW A;  1PUL A;  1SNL A;  1K94 A;  2KQ6 A;  4PE1 A;  3A4U B;  1WRK A;  1ALW A;  3PAT A;  4M2O A;  1LIN A;  2KOT A;  1CMF A;  1TNW A;  1EH2 A;  5CSI A;  3BUO B;  2JUL A;  3TDU A;  3OX5 A;  2K7C A;  3K21 A;  2NCP A;  1N2D A;  4NDD A;  2GGM A;  3DVK A;  1RJV A;  1B8R A;  4GAO A;  1J7P A;  1DJH A;  2L5X B;  1BOC A;  1QS7 A;  1CFF A;  1SL7 A;  2PVB A;  2BL0 B;  2WOR A;  3D0Y B;  2MLF C;  2PRU A;  1SR6 B;  2AUC A;  1LVC D;  1XFZ O;  4NDB A;  1WRZ A;  2BKI B;  2Y4Q A;  1B9A A;  2KAY A;  2OS8 B;  1A29 A;  1QX7 A;  3BYA A;  5J3X A;  1IH0 A;  1V1G A;  1F8H A;  1JF0 A;  3KO0 A;  3WXA A;  5F6T A;  1GQM A;  2OTG C;  1SRA A;  1QX2 A;  4GGF C;  2BCB A;  3EK4 A;  4CFR A;  2M1U A;  5KSZ A;  3TUY B;  2LAP A;  2K7B A;  1G33 A;  3NSI A;  4HSZ A;  3IQQ A;  4P5O E;  4XYN A;  3DVJ A;  1N65 A;  2KSP A;  2KFF A;  1NX2 A;  1K93 D;  2I18 A;  1Y1U A;  1BT6 A;  4PDZ A;  3VRP A;  1AUI B;  2COL B;  2LC5 A;  1CNP A;  2M3W A;  4UPG A;  1SCM C;  1Y1X A;  3NXA A;  4DS7 A;  4PHN A;  1OQP A;  1IKU A;  1QV0 A;  2F33 A;  2KAX A;  2RGI A;  2KQY A;  3SG2 A;  2WOS A;  3TUY C;  1UUS A;  1M39 A;  3PN7 C;  1YVH A;  4FTG A;  1L7Z A;  3PM8 A;  4XJK A;  3SG6 A;  1RWY A;  2M1K B;  1KFU L;  1QX5 B;  4M2P A;  4USL A;  2G2B A;  1XYD A;  1XVJ A;  1TNQ A;  1NX3 A;  1S36 A;  3BQ3 A;  3EVV A;  3TDI A;  1NX1 A;  2F2O A;  1SL8 A;  1DGV A;  1KSO A;  2KGR A;  3NSL A;  2K0J A;  2ZKM X;  1KFX S;  1PVB A;  1YX7 A;  1IQ3 A;  2JT3 A;  1KCY A;  2K7D A;  1K8U A;  1KK7 Z;  3IF7 A;  1K96 A;  3I5F B;  1IJ6 A;  1J55 A;  1LA3 A;  4HRH A;  5I2Q A;  1EJ3 A;  2OPO A;  1OMR A;  2BCA A;  1UHI A;  2BBN A;  1R6P A;  2P6B B;  2PMY A;  4ZCU A;  1BF5 A;  2V53 A;  3PSR A;  1FI5 A;  1DVI A;  3VRO A;  1HQV A;  4C0J A;  1YUT A;  2AMI A;  5D7F A;  1CLB A;  1PK0 D;  1ZAC A;  2BCX A;  2KAV A;  2E6W A;  1WDC C;  4AOM A;  1K2H A;  1YUS A;  1KK8 B;  3ZNI A;  1G4Y R;  2FOT A;  3DF0 A;  2I2R E;  5BPJ A;  2JXL A;  2Y5I A;  1SCV A;  2Q91 A;  1KK7 Y;  1Y1A A;  1X02 A;  2K2F A;  3PFV A;  1QIW A;  2L98 A;  3AKA A;  2ZRS A;  1F55 A;  2BKH B;  5DKQ A;  1CMG A;  1E8A A;  4QJ4 B;  1Y0V H;  2KI4 B;  3MSE B;  1WDC B;  1QJT A;  1UHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...