1J1DA

Crystal structure of the 46kda domain of human cardiac troponin in the ca2+ saturated form
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
161
structure length
159
Chain Sequence
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRSMKDDSKSEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein
molecule keywords Troponin C
publication title Structure of the core domain of human cardiac troponin in the Ca2+-saturated form
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 159
sequence length 161
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1j1dA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1j1dA02
1OE9B 1ZACA 1OMDA 5CSIA 1DJHA 1IJ5A 3PALA 2BE4A 4C0JA 1WRZA 2OTGC 3FIAA 1QS7A 4ORCB 1DJZA 1C7VA 2LMVA 1EH2A 1YURA 4MVFA 2F3ZA 4YGCB 2L4HA 4E68A 1DGUA 2H2KA 2HPSA 2BECA 1XFVO 2JNXA 3VRRA 1QIWA 5KTYA 1QLKA 2LUXA 2K2AA 1XFUO 5CSFA 3CWGA 4ORAB 3LLEA 4NDBA 4HSZA 3CZTX 2CTNA 1M31A 1WDCB 4N5XA 3TS5B 1V1GA 1TIZA 1CDMA 2D8NA 5KSZA 2OS8C 1ALWA 2VRGA 1GGZA 1N65A 1BU3A 1QV0A 2BE6A 3JTDC 1F4OA 2KYFA 4QJ3B 4AOMA 1CMGA 1PK0D 1CDPA 4OV2A 1OQPA 1S36A 1S3PA 3PATA 1F54A 1SW8A 1WY9A 3SG7A 1SNLA 5AANA 4F0ZB 4BY5A 1QXPA 2KAXA 2LHIA 5FYXA 1PULA 1C7WA 2M8UA 3DVMA 1FF1A 3CGAA 2LUCA 4D1EA 2GGZA 1SMGA 4NDCA 2CCMA 2I94A 2EC6C 2NLNA 4OR9B 1BODA 3I5HC 3TS5C 1OOJA 2K61A 5IBWA 3MSEB 3OHMB 1LA3A 2BCBA 4PE7A 1PSRA 4MEWA 2G9BA 3KEVA 4YGAA 4DIRA 4M2OA 4PE4A 1VRKA 2GGMA 4ORBB 3BOWA 5BPJA 2K2FA 3NSLA 4I5JA 1LKJA 1AVSA 1K90D 1Y6WA 2M1UA 1IG5A 3GK2A 2JXCA 1DMOA 1IH0A 1KK8B 4GNKB 3D10A 2K7OA 2COLB 2BCAA 1PSBA 3RLZA 1BOCA 1BT6A 4CFQA 1QASA 3TUYC 2HQWA 1CLMA 4C0KA 1KQMB 1TNPA 4GFTA 4IL1A 2SCPA 2LE9B 3DD4A 2ZNEA 1J55A 1QIVA 2F33A 2RGIA 2JQ6A 2KAYA 1K95A 1XA5A 4ICBA 2H61A 2KYCA 1NX0A 1YTZC 2KGRA 3A4UB 1MXLC 1DF0A 1NX2A 5AXIA 1XFXO 2O60A 4CIDA 4YBHB 1CM1A 1UWOA 1G8IA 1DJGA 1H4BA 2LVIA 1TRFA 4YGBB 4GGFA 1KK8C 4XYNA 5K89A 1F70A 3PM8A 1QJTA 1DJYA 5JOLA 2PASA 2Y4QA 4GGNA 1FW4A 2G2BA 1SK6D 2JU0A 2LP2A 2L2EA 3M0WA 4ZCVA 1MWNA 3SG5A 4A4BA 4YRUA 1A2XA 2KFFA 1SR6B 1EJ3A 3CLNA 1EL4A 3VRQA 1MQ1A 1KQMC 1G4YR 2MJWB 2LLUA 4OCIA 1CKKA 2Y1MA 1KK7Y 1S6JA 1YRUB 2EGDA 4XJKB 3KHEA 3WXAA 1JBAA 1ZUZA 2KQYA 4M2QA 3ICBA 1FPWA 4A4CA 1TNQA 3ZWHA 1S1EA 1UURA 1F71A 2MLFC 2KGBC 3KO0A 4GPLB 3DF0A 1CFPA 1SL8A 5PALA 1XVJA 4YI8A 4NDDA 3SIBA 2IS9A 1QX2A 1NWDA 1YX7A 4UPGA 1OZSA 2KNEA 1SBJA 2I2RE 4USLA 3KF9A 1AK8A 4I5LB 2OPOA 1DTLA 1JUOA 1KFUL 1MHOA 1ZMZA 4JPZB 1AJ5A 3SG4A 1EXRA 2MBXA 1JFJA 2LVVA 2Y5IA 5ER5A 3AKBA 4MSPA 3OB1B 4AQIA 2KI4C 3VRPA 2LHLA 4R1EA 1NIWA 2JTTA 3JVTB 2KFGA 3PN7B 1IJ6A 4WQ2A 5D69A 5G08A 4FQOA 2MAZA 4PHMA 5JJGA 1QATA 2KOTA 1PVAA 1XK4A 2LVJA 3CR2A 1RFJA 3BUWB 3GK4X 2MRDA 3I5FB 2L0PA 1XK4C 1K9UA 3AAKA 2F8PA 5ER4X 1LXFC 1CFCA 4I5NB 3LK1A 4WQ3A 2K7BA 1SRAA 1NX1A 1PRWA 2BCXA 1KFXS 4GBAA 1YRTB 1J1EA 2WOSA 1B1GA 2FOTA 3DVKA 5CPVA 1UHNA 1YUSA 2M1KB 1KK7Z 1TOPA 2L4IA 3BQ3A 4MRYA 4MZJA 1X02A 2E30A 4DRWA 1SCMB 2CT9A 5KU1A 2JRFA 2HQ8A 3SG6A 1SPYA 5AERA 3WHUB 2PMYA 2JWWA 1WRLA 1YUUA 2WCEA 1IQ5A 1QLSA 3JVTC 1LINA 3PN7C 1XYDA 2L51A 1RK9A 4I5KA 1WDCC 1FBVA 2O5GA 4OVNF 1OMRA 2M0RA 3IQOA 4YI9A 4ETOA 2CNPA 1SCVA 1JSAA 3I5FC 1CDLA 1UHHA 2Y1NA 1UHKA 5F6TA 1K94A 1DVIA 1L7ZA 3O2PA 5J3XA 2WCBA 3PFVA 3HCMA 1BMOA 1M63B 1RROA 1IWQA 3E3RA 3EK4A 1OZOA 5HLOA 1B47A 1HQVA 3NXAA 3AKAA 1TN4A 1MXEA 1MUXA 2PVBA 3QRXA 1CMFA 2ZRTA 1E8AA 1KSMA 4JWQA 4DCKA 1UP5A 3ZNIA 2JT8A 1CDNA 2WORA 1S26D 3KPXA 4HRGA 2WC8A 1SCMC 3EK8A 1CM4A 5DKNA 2KFHA 2NXQA 2JT3A 2M7NA 2GV5A 4P5OE 1RJVA 2LLTA 3OP0A 4CPVA 4NQGA 5AFPA 1QX7A 2TN4A 1SY9A 2M3WA 1CNPA 1B7TY 1XFYO 5DKRA 1FI6A 1NSHA 4DS7A 3NSKA 2PSRA 2DOQA 2KBIA 5D7FA 3A8RA 3AAJA 2I18A 1NCZA 1OSAA 1R2UA 2MA2A 4JQ0D 1A75B 2LP3A 1QX5B 1XFWO 3FWBA 3VGOA 3C1VA 4DUQA 3K21A 1GJYA 1SL7A 1TCOB 1MF8B 1GGWA 1RTP1 4MBEA 2A4JA 4PHKA 2BBNA 1S6IA 2KI6D 1J7QA 2K0JA 2JPTA 1QVIZ 4MZLA 3TDIA 1UHIA 2JZIA 2LC5A 4FTGA 4MN0A 2LCPA 1ALVA 2LMUA 2BL0B 2FCEA 3JTDB 1SL9A 5HKWA 1PVBA 3BUXB 3LK0A 1B8CA 2OTGB 3GK1A 1KQVA 2K8MB 4HREE 1RECA 2ZFDA 3I5IB 1N2DA 1K93D 3OX5A 1HT9A 1B4CA 4GAOA 4QJ4B 1S5GZ 1K8UA 2F2PA 1CFDA 1SR6C 1BJFA 1TNWA 1AP4A 2L98A 1IRJA 1R6PA 3O6BA 4XJKA 2NCPA 2LVKA 1JWDA 3WHTB 1B7TZ 3DVJA 3NSOA 4TNCA 1M46A 1CTRA 2EHBA 1XO5A 1EG3A 1QV1A 1JC2A 1DJXA 3I5GB 2LANA 1A03A 3IQQA 1NPQA 1ZOTB 5HKZA 5I2QA 2L5XB 2LNKA 1K2HA 1D1OA 2FCDA 1SKTA 4PHJA 1KWOB 2ZN8A 1AHRA 2HETA 2ZRSA 3FS7A 3I5IC 4PDZA 1ODBA 3SJSA 3OX6A 1BF5A 3SG2A 1TTXA 2WNDA 1L2OB 2JTZA 5HLVA 3WNXB 1NCXA 1WLMA 2KQ6A 2M49B 3BYAA 3RM1A 2M29A 1GQMA 2EC6B 4Q04A 1CLBA 1K9KA 1RWYA 5CSNA 5TNCA 4QJ5B 3EVUA 1B9AA 1YVHA 3I5HB 2LLSA 2MHHA 1IKUA 2BBMA 2K7DA 3CS1A 3BUMB 1YX8A 4CFRA 2LMTA 1DGVA 2CXJA 1EG4A 1NX3A 1A4PA 2PRUA 3H4SE 3PLFB 3BUNB 1YR5A 3I5GC 1TCFA 2LM5A 4L9MA 4N1GA 3VROA 1C07A 1QVIY 1NCYA 3O78A 3BUOB 3OB2B 2JNFA 1AUIB 1KFUS 2WCFA 3BOWB 4MZKA 1SYMA 4BY4A 1BR1B 1JF2A 1KWOC 4YGEB 3D0YB 3CR5X 3TUYB 1G33A 2AAOA 1L2OC 2F2OA 2SASA 4C0LA 4P2YB 2HF5A 2JT0A 2KBMA 3LCPC 5I2OA 4OKHA 3CTNA 1WLZA 4HRHA 1H8BA 5AEQA 1LVCD 4M2PA 1J7PA 1ZFSA 2KI6C 1Q80A 2JULA 1WRKA 3TZ1A 3BXKA 2CBLA 1S5GY 3F45A 3EVVA 1K96A 3EVRA 1V1FA 1UUSA 2KHNA 1M39A 1CLLA 2KDHA 1K9PA 2M7LA 4AQJA 1DF0B 4PHNA 4YGDB 4ZCUA 5HYDA 1NYAA 3D0YA 1AJ4A 1A29A 2ZKMX 5HKYA 2LV7A 1YVLA 2BKIB 1PALA 2QACA 3TDZA 2B1UA 1U5IB 3DVEA 3PSRA 1S6CA 2L50A 2PALA 1BLQA 1CB1A 2KAVA 2JC2A 5DKQA 2E6WA 1LA0A 1J7RA 2AUCA 2ISDA 4PALA 2FJUB 4PCWA 1UHJA 1JF0A 3O4YA 2P6BB 2LAPA 2H61C 4WRIA 2NZ0A 2QPTA 1CFFA 4PE0A 1KCYA 3EKHA 1BR4B 1DT7B 4MRXA 2ZN9A 3EKJA 3HX4A 3GOFA 5GQQC 5I8NA 2M9GA 3DF0B 1Y1AA 1J7OA 3FWCA 1A75A 4MLWA 5CSJA 2AMIA 1MR8A 4GGFC 5I2LA 2JOJA 2Q4UA 1U5IA 4U8DA 2K7CA 3SG3A 1F8HA 1W7IB 1W7JB 3VRNA 2MLEC 1B8RA 1IGVA 1F4QA 1TNXA 1YUTA 4N1FA 1JFKA 1Y0VH 1M45A 4GUKA 1N0YA 2ZNDA 3SIAA 1Y1UA 1NUBA 2KI4B 3CR4X 1NP8A 1XFZO 3LL8B 1J1DA 1DJWA 2JXLA 2F3YA 2M97A 2NCOA 1KFXL 3TDUA 1B8LA 2BKHB 1IQ3A 3IF7A 1QTXA 4PE1A 1OMVA 2Q91A 3EK7A 2KSPA 1F55A 1BG1A 1Y1XA 2OS8B 1KSOA 2V53A 2I7AA 3NSIA 2BL0C 2R2IA 4CLNA 5B8IB 1DJIA 1FI5A
chains in the Genus database with same CATH superfamily
1OE9B 1ZACA 1OMDA 5CSIA 1DJHA 1IJ5A 3PALA 2BE4A 4C0JA 1WRZA 2OTGC 3FIAA 1QS7A 4ORCB 1DJZA 1C7VA 2WCLA 2LMVA 1EH2A 1YURA 4MVFA 2F3ZA 4YGCB 3UNWA 2L4HA 4E68A 1DGUA 2H2KA 2HPSA 3B6XA 1OW4A 3S0GA 2BECA 1XFVO 3PM2A 2JNXA 3VRRA 2KLEA 1QIWA 5KTYA 1QLKA 2LUXA 2K2AA 5FI6A 1XFUO 5CSFA 3CWGA 4ORAB 3LLEA 4NDBA 4HSZA 3CZTX 2CTNA 1M31A 1WDCB 3B87A 4N5XA 3TS5B 1V1GA 1TIZA 1CDMA 2D8NA 5KSZA 2OS8C 1ALWA 2VRGA 1GGZA 1DEKA 1N65A 1BU3A 1QV0A 2BE6A 3JTDC 1F4OA 2KYFA 3BFBA 4QJ3B 4AOMA 2WCHA 1CMGA 1PK0D 1TUJA 1CDPA 4OV2A 1OQPA 1S36A 1S3PA 3PATA 1F54A 3FE8A 1SW8A 1WY9A 3B88A 3SG7A 1SNLA 3BFAA 5AANA 4F0ZB 4BY5A 3D78A 1QXPA 2KAXA 2LHIA 3CZ1A 5FYXA 1PULA 1C7WA 2M8UA 3DVMA 1FF1A 3CGAA 2LUCA 4D1EA 2BNXA 1SMGA 2GGZA 2CCMA 4NDCA 2I94A 2EC6C 2NLNA 2WC6A 4OR9B 1BODA 3I5HC 3TS5C 1OOJA 2K61A 5IBWA 3MSEB 3OHMB 1C3YA 1LA3A 2BCBA 4PE7A 1PSRA 4MEWA 2G9BA 3KEVA 4YGAA 3BJHA 4DIRA 4M2OA 4PE4A 1VRKA 3PJIA 3D74A 2GGMA 4ORBB 3BOWA 5BPJA 2K2FA 3NSLA 4I5JA 1LKJA 1AVSA 1K90D 1Y6WA 2M1UA 1IG5A 3GK2A 2JXCA 5EL2A 2YGUA 1KK8B 4GNKB 1DMOA 3D10A 1IH0A 2K7OA 2COLB 2BCAA 1PSBA 2L2CA 3RLZA 1BT6A 1BOCA 4CFQA 1QASA 3TUYC 3CZ0A 2HQWA 1CLMA 4C0KA 1KQMB 1TNPA 4GFTA 4IL1A 2SCPA 2LE9B 3DD4A 2ZNEA 1J55A 1QIVA 2F33A 2RGIA 2JQ6A 2KAYA 1K95A 1XA5A 4ICBA 2H61A 2KYCA 1NX0A 1YTZC 2KGRA 3A4UB 1MXLC 1W9ZA 5FI2A 1DF0A 1NX2A 5AXIA 1XFXO 2O60A 4CIDA 4YBHB 1CM1A 1UWOA 1G8IA 3R72A 2PQLA 1DJGA 1H4BA 2LVIA 1TRFA 4YGBB 2H8VA 4FQTA 1KK8C 3R1OA 4GGFA 4XYNA 3PM8A 5K89A 1F70A 1QJTA 1DJYA 5JOLA 2PASA 2Y4QA 4GGNA 1FW4A 2G2BA 1SK6D 2JU0A 2LP2A 2L2EA 4F7FA 3M0WA 4ZCVA 1MWNA 3SG5A 1T14A 4A4BA 4YRUA 1A2XA 2KFFA 1SR6B 1EJ3A 3CLNA 1EL4A 3VRQA 1MQ1A 1KQMC 1G4YR 2MJWB 2LLUA 4OCIA 1CKKA 2Y1MA 1KK7Y 1S6JA 3R1VA 3D75A 1YRUB 2EGDA 4XJKB 3KHEA 5DICA 3WXAA 1JBAA 1ZUZA 2KQYA 2WCMA 1TWOA 4M2QA 3ICBA 4JD9A 1FPWA 4A4CA 1TNQA 3ZWHA 1S1EA 1UURA 1F71A 2MLFC 2KGBC 3KO0A 4GPLB 3DF0A 1CFPA 1SL8A 1P28A 5PALA 1XVJA 3RZSA 4YI8A 3S0FA 4NDDA 3SIBA 2IS9A 1QX2A 2QEOA 1NWDA 1YX7A 4UPGA 1OZSA 2KNEA 1SBJA 2I2RE 4USLA 3KF9A 1AK8A 4I5LB 2OPOA 1DTLA 1JUOA 1KFUL 1MHOA 1ZMZA 4JKTA 1AJ5A 4JPZB 1EXRA 3SG4A 2MBXA 1JFJA 2LVVA 3DZTA 2Y5IA 5ER5A 3AKBA 4MSPA 3OB1B 4AQIA 3Q8IA 2KI4C 3O4XA 3VRPA 2LHLA 4R1EA 1NIWA 2JTTA 3JVTB 2KFGA 1ORGA 3PN7B 1IJ6A 5FI7A 4WQ2A 4PT1A 5D69A 5G08A 3UO9A 4FQOA 2MAZA 4PHMA 2QEVA 5JJGA 1QATA 2KOTA 1PVAA 1XK4A 2LVJA 3CR2A 1RFJA 3BUWB 3GK4X 2MRDA 3I5FB 2L0PA 1XK4C 1K9UA 3AAKA 2F8PA 5ER4X 1LXFC 1CFCA 4I5NB 3LK1A 4WQ3A 2K7BA 1SRAA 1NX1A 1PRWA 2BCXA 1KFXS 4GBAA 1YRTB 1J1EA 2WOSA 1B1GA 5I94A 2FOTA 3DVKA 3DY9A 1UHNA 5CPVA 1YUSA 2M1KB 1KK7Z 1TOPA 2L4IA 3BQ3A 3D73A 4MRYA 4MZJA 1X02A 2E30A 4DRWA 3S0EA 1SCMB 2CT9A 5KU1A 2JRFA 2HQ8A 3NHTA 1SPYA 3SG6A 5AERA 3WHUB 2PMYA 2JWWA 1WRLA 1YUUA 2WCEA 1IQ5A 1QLSA 3CYZA 1LINA 3JVTC 1XYDA 3PN7C 2L51A 1RK9A 4I5KA 4INWA 1WDCC 1FBVA 2O5GA 5HL1A 4OVNF 1OMRA 2M0RA 3IQOA 4YI9A 4ETOA 1SCVA 2CNPA 1JSAA 3I5FC 1CDLA 1UHHA 2Y1NA 1UHKA 2WCJA 4IJ7A 5F6TA 1K94A 1DVIA 1L7ZA 3O2PA 5J3XA 2WCBA 3PFVA 3HCMA 2WC5A 1BMOA 1M63B 1RROA 1IWQA 3E3RA 3EK4A 1OZOA 5HLOA 1B47A 1HQVA 3NXAA 3AKAA 1TN4A 1MXEA 1MUXA 4KYNA 2PVBA 3QRXA 1CMFA 2ZRTA 2L5YA 1E8AA 1KSMA 4JWQA 4DCKA 1UP5A 5D3OA 3S0DA 3ZNIA 3L47A 2JT8A 1CDNA 2WORA 1TUZA 1S26D 3KPXA 4HRGA 2WC8A 1SCMC 3EK8A 1CM4A 5DKNA 2KFHA 1XFRA 2JT3A 2NXQA 2M7NA 2GV5A 4P5OE 1RJVA 2LLTA 3K1EA 3OP0A 2QEHA 4CPVA 4NQGA 5AFPA 3VB1A 1QX7A 2TN4A 1SY9A 2M3WA 1CNPA 1B7TY 1XFYO 2K60A 5DKRA 1FI6A 1NSHA 4DS7A 3NSKA 2PSRA 2DOQA 2KBIA 5D7FA 3A8RA 3AAJA 2I18A 1NCZA 1OSAA 1R2UA 2MA2A 4JQ0D 1A75B 2LP3A 1QX5B 1XFWO 3FWBA 3VGOA 3C1VA 4DUQA 1Z2CB 3K21A 1GJYA 1SL7A 3NGVA 1DC1A 1TCOB 1MF8B 1GGWA 1RTP1 4MBEA 2A4JA 4PHKA 2BBNA 1GM0A 2KLDA 1S6IA 2KI6D 1J7QA 2K0JA 2PYQA 3DXLA 2JPTA 1QVIZ 4MZLA 3IVTA 3TDIA 1UHIA 2JZIA 2LC5A 4FTGA 2BAPA 4MN0A 2LCPA 1QWVA 1ALVA 2LMUA 3CABA 2BL0B 2FCEA 3JTDB 1SL9A 4INXA 5HKWA 1PVBA 3BUXB 3LK0A 1B8CA 2OTGB 3GK1A 1KQVA 3FE9A 2K8MB 4HREE 1RECA 2ZFDA 3I5IB 1N2DA 3FE6A 1K93D 3OX5A 1HT9A 1B4CA 4GAOA 4QJ4B 1S5GZ 1K8UA 2F2PA 1CFDA 1SR6C 1BJFA 1TNWA 1AP4A 2L98A 1IRJA 3SS3A 1R6PA 3O6BA 4XJKA 2NCPA 2LVKA 1JWDA 1OOGA 3WHTB 1B7TZ 3DVJA 3NSOA 4TNCA 1M46A 4OZDA 1CTRA 2EHBA 1XO5A 1EG3A 1QV1A 2FJYA 1JC2A 2QDIA 1DJXA 1Z4HA 2LANA 3I5GB 1A03A 3IQQA 1NPQA 1ZOTB 5HKZA 3S0AA 5I2QA 2L5XB 2LNKA 3S0BA 1K2HA 1D1OA 2FCDA 1SKTA 2WCKA 4PHJA 1KWOB 2ZN8A 1AHRA 2HETA 2ZRSA 3FS7A 3I5IC 4PDZA 1ODBA 3SJSA 1DELA 3OX6A 1BF5A 3SG2A 1TTXA 2GTEA 1L2OB 2JTZA 2WNDA 5HLVA 3WNXB 1NCXA 1WLMA 2KQ6A 2M49B 3BYAA 3RM1A 2M29A 1GQMA 2EC6B 4Q04A 1CLBA 1K9KA 1RWYA 5CSNA 3B7AA 5TNCA 4QJ5B 2QEBA 3EVUA 1B9AA 1YVHA 3I5HB 2LLSA 2MHHA 1IKUA 2BBMA 2K7DA 3CS1A 3BUMB 1YX8A 4CFRA 2LMTA 1DGVA 2CXJA 1EG4A 1NX3A 1A4PA 2PRUA 3H4SE 3PLFB 3BUNB 1YR5A 3I5GC 1LS8A 1TCFA 2LM5A 4L9MA 4N1GA 2P70A 3VROA 1QVIY 1NCYA 3O78A 3BUOB 1C07A 3OB2B 2JNFA 1AUIB 1KFUS 2WCFA 2JPOA 3BOWB 4MZKA 3SS5A 1SYMA 4BY4A 1BR1B 1SSEB 1JF2A 1KWOC 4YGEB 3D0YB 3CR5X 3TUYB 1G33A 2AAOA 1L2OC 2F2OA 2SASA 4C0LA 4P2YB 2HF5A 2JT0A 2KBMA 3LCPC 3N7HA 3CZ2A 4OKHA 5I2OA 3CTNA 1WLZA 4HRHA 1H8BA 5AEQA 1LVCD 4M2PA 1J7PA 1ZFSA 1OOIX 1Q80A 2KI6C 3QMEA 2JULA 1WRKA 3TZ1A 3BXKA 2CBLA 1S5GY 3F45A 3SS4A 3EVVA 1K96A 3EVRA 1V1FA 1UUSA 2KHNA 1M39A 3DYEA 1CLLA 2KDHA 1K9PA 2P71A 2M7LA 4AQJA 1IIOA 1DF0B 4PHNA 1OOFA 4YGDB 4ZCUA 5HYDA 1NYAA 3D0YA 3OBVA 1AJ4A 1A29A 2ZKMX 5HKYA 2LV7A 1YVLA 2BKIB 1PALA 2QACA 3TDZA 2B1UA 1U5IB 3DVEA 3B86A 3PSRA 1S6CA 2L50A 2PALA 3OGNA 1BLQA 3EG5B 1CB1A 2KAVA 2JC2A 5DKQA 2E6WA 1LA0A 1J7RA 2AUCA 3CDNA 2ISDA 4PALA 2FJUB 4PCWA 1UHJA 1JF0A 3O4YA 2P6BB 2LAPA 2H61C 4WRIA 2NZ0A 2QPTA 1CFFA 4PE0A 1KCYA 3EKHA 1BR4B 1DT7B 3D76A 2ZN9A 3EKJA 3HX4A 3GOFA 4MRXA 5GQQC 3R1PA 2M9GA 5I8NA 3DF0B 1Y1AA 1J7OA 3FWCA 1A75A 4MLWA 5CSJA 2AMIA 1MR8A 4GGFC 5I2LA 2JOJA 2Q4UA 1U5IA 3NHIA 4U8DA 2K7CA 3BFHA 3SG3A 1F8HA 1W7IB 1W7JB 2KPHA 3L4LA 3VRNA 2MLEC 1C3ZA 1B8RA 1IGVA 1F4QA 1TNXA 1YUTA 4N1FA 1JFKA 1Y0VH 1M45A 4GUKA 1N0YA 2ZNDA 3SIAA 1Y1UA 1NUBA 2KI4B 3CR4X 1NP8A 2ERBA 1XFZO 3LL8B 1J1DA 1DJWA 2JXLA 2F3YA 2M97A 2NCOA 1KFXL 3TDUA 1B8LA 1DQEA 2BKHB 1IQ3A 3IF7A 1QTXA 4PE1A 1OMVA 2Q91A 3EK7A 2KSPA 1F55A 3D77A 1BG1A 3L4AA 1OOHA 1Y1XA 1KSOA 2OS8B 3V2LA 2V53A 2I7AA 3NSIA 2BL0C 2R2IA 4CLNA 5B8IB 1DJIA 1FI5A
chains in the Genus database with same CATH topology
1OE9B 1ZACA 1OMDA 5CSIA 1DJHA 1IJ5A 3PALA 2BE4A 4C0JA 1WRZA 2OTGC 3FIAA 1QS7A 4ORCB 1DJZA 1C7VA 2LMVA 1EH2A 1YURA 4MVFA 2F3ZA 4YGCB 2L4HA 4E68A 1DGUA 2H2KA 2HPSA 2BECA 1XFVO 2JNXA 3VRRA 1QIWA 5KTYA 1QLKA 2LUXA 2K2AA 1XFUO 5CSFA 3CWGA 4ORAB 3LLEA 4NDBA 4HSZA 3CZTX 2CTNA 1M31A 1WDCB 4N5XA 3TS5B 1V1GA 1TIZA 1CDMA 2D8NA 5KSZA 2OS8C 1ALWA 2VRGA 1GGZA 1N65A 1BU3A 1QV0A 2BE6A 3JTDC 1F4OA 2KYFA 4QJ3B 4AOMA 1CMGA 1PK0D 1CDPA 4OV2A 1OQPA 1S36A 1S3PA 3PATA 1F54A 1SW8A 1WY9A 3SG7A 1SNLA 5AANA 4F0ZB 4BY5A 1QXPA 2KAXA 2LHIA 5FYXA 1PULA 1C7WA 2M8UA 3DVMA 1FF1A 3CGAA 2LUCA 4D1EA 2GGZA 1SMGA 4NDCA 2CCMA 2I94A 2EC6C 2NLNA 4OR9B 1BODA 3I5HC 3TS5C 1OOJA 2K61A 5IBWA 3MSEB 3OHMB 1LA3A 2BCBA 4PE7A 1PSRA 4MEWA 2G9BA 3KEVA 4YGAA 4DIRA 4M2OA 4PE4A 1VRKA 2GGMA 4ORBB 3BOWA 5BPJA 2K2FA 3NSLA 4I5JA 1LKJA 1AVSA 1K90D 1Y6WA 2M1UA 1IG5A 3GK2A 2JXCA 1DMOA 1IH0A 1KK8B 4GNKB 3D10A 2K7OA 2COLB 2BCAA 1PSBA 3RLZA 1BOCA 1BT6A 4CFQA 1QASA 3TUYC 2HQWA 1CLMA 4C0KA 1KQMB 1TNPA 4GFTA 4IL1A 2SCPA 2LE9B 3DD4A 2ZNEA 1J55A 1QIVA 2F33A 2RGIA 2JQ6A 2KAYA 1K95A 1XA5A 4ICBA 2H61A 2KYCA 1NX0A 1YTZC 2KGRA 3A4UB 1MXLC 1DF0A 1NX2A 5AXIA 1XFXO 2O60A 4CIDA 4YBHB 1CM1A 1UWOA 1G8IA 1DJGA 1H4BA 2LVIA 1TRFA 4YGBB 4GGFA 1KK8C 4XYNA 5K89A 1F70A 3PM8A 1QJTA 1DJYA 5JOLA 2PASA 2Y4QA 4GGNA 1FW4A 2G2BA 1SK6D 2JU0A 2LP2A 2L2EA 3M0WA 4ZCVA 1MWNA 3SG5A 4A4BA 4YRUA 1A2XA 2KFFA 1SR6B 1EJ3A 3CLNA 1EL4A 3VRQA 1MQ1A 1KQMC 1G4YR 2MJWB 2LLUA 4OCIA 1CKKA 2Y1MA 1KK7Y 1S6JA 1YRUB 2EGDA 4XJKB 3KHEA 3WXAA 1JBAA 1ZUZA 2KQYA 4M2QA 3ICBA 1FPWA 4A4CA 1TNQA 3ZWHA 1S1EA 1UURA 1F71A 2MLFC 2KGBC 3KO0A 4GPLB 3DF0A 1CFPA 1SL8A 5PALA 1XVJA 4YI8A 4NDDA 3SIBA 2IS9A 1QX2A 1NWDA 1YX7A 4UPGA 1OZSA 2KNEA 1SBJA 2I2RE 4USLA 3KF9A 1AK8A 4I5LB 2OPOA 1DTLA 1JUOA 1KFUL 1MHOA 1ZMZA 4JPZB 1AJ5A 3SG4A 1EXRA 2MBXA 1JFJA 2LVVA 2Y5IA 5ER5A 3AKBA 4MSPA 3OB1B 4AQIA 2KI4C 3VRPA 2LHLA 4R1EA 1NIWA 2JTTA 3JVTB 2KFGA 3PN7B 1IJ6A 4WQ2A 5D69A 5G08A 4FQOA 2MAZA 4PHMA 5JJGA 1QATA 2KOTA 1PVAA 1XK4A 2LVJA 3CR2A 1RFJA 3BUWB 3GK4X 2MRDA 3I5FB 2L0PA 1XK4C 1K9UA 3AAKA 2F8PA 5ER4X 1LXFC 1CFCA 4I5NB 3LK1A 4WQ3A 2K7BA 1SRAA 1NX1A 1PRWA 2BCXA 1KFXS 4GBAA 1YRTB 1J1EA 2WOSA 1B1GA 2FOTA 3DVKA 5CPVA 1UHNA 1YUSA 2M1KB 1KK7Z 1TOPA 2L4IA 3BQ3A 4MRYA 4MZJA 1X02A 2E30A 4DRWA 1SCMB 2CT9A 5KU1A 2JRFA 2HQ8A 3SG6A 1SPYA 5AERA 3WHUB 2PMYA 2JWWA 1WRLA 1YUUA 2WCEA 1IQ5A 1QLSA 3JVTC 1LINA 3PN7C 1XYDA 2L51A 1RK9A 4I5KA 1WDCC 1FBVA 2O5GA 4OVNF 1OMRA 2M0RA 3IQOA 4YI9A 4ETOA 2CNPA 1SCVA 1JSAA 3I5FC 1CDLA 1UHHA 2Y1NA 1UHKA 5F6TA 1K94A 1DVIA 1L7ZA 3O2PA 5J3XA 2WCBA 3PFVA 3HCMA 1BMOA 1M63B 1RROA 1IWQA 3E3RA 3EK4A 1OZOA 5HLOA 1B47A 1HQVA 3NXAA 3AKAA 1TN4A 1MXEA 1MUXA 2PVBA 3QRXA 1CMFA 2ZRTA 1E8AA 1KSMA 4JWQA 4DCKA 1UP5A 3ZNIA 2JT8A 1CDNA 2WORA 1S26D 3KPXA 4HRGA 2WC8A 1SCMC 3EK8A 1CM4A 5DKNA 2KFHA 2NXQA 2JT3A 2M7NA 2GV5A 4P5OE 1RJVA 2LLTA 3OP0A 4CPVA 4NQGA 5AFPA 1QX7A 2TN4A 1SY9A 2M3WA 1CNPA 1B7TY 1XFYO 5DKRA 1FI6A 1NSHA 4DS7A 3NSKA 2PSRA 2DOQA 2KBIA 5D7FA 3A8RA 3AAJA 2I18A 1NCZA 1OSAA 1R2UA 2MA2A 4JQ0D 1A75B 2LP3A 1QX5B 1XFWO 3FWBA 3VGOA 3C1VA 4DUQA 3K21A 1GJYA 1SL7A 1TCOB 1MF8B 1GGWA 1RTP1 4MBEA 2A4JA 4PHKA 2BBNA 1S6IA 2KI6D 1J7QA 2K0JA 2JPTA 1QVIZ 4MZLA 3TDIA 1UHIA 2JZIA 2LC5A 4FTGA 4MN0A 2LCPA 1ALVA 2LMUA 2BL0B 2FCEA 3JTDB 1SL9A 5HKWA 1PVBA 3BUXB 3LK0A 1B8CA 2OTGB 3GK1A 1KQVA 2K8MB 4HREE 1RECA 2ZFDA 3I5IB 1N2DA 1K93D 3OX5A 1HT9A 1B4CA 4GAOA 4QJ4B 1S5GZ 1K8UA 2F2PA 1CFDA 1SR6C 1BJFA 1TNWA 1AP4A 2L98A 1IRJA 1R6PA 3O6BA 4XJKA 2NCPA 2LVKA 1JWDA 3WHTB 1B7TZ 3DVJA 3NSOA 4TNCA 1M46A 1CTRA 2EHBA 1XO5A 1EG3A 1QV1A 1JC2A 1DJXA 3I5GB 2LANA 1A03A 3IQQA 1NPQA 1ZOTB 5HKZA 5I2QA 2L5XB 2LNKA 1K2HA 1D1OA 2FCDA 1SKTA 4PHJA 1KWOB 2ZN8A 1AHRA 2HETA 2ZRSA 3FS7A 3I5IC 4PDZA 1ODBA 3SJSA 3OX6A 1BF5A 3SG2A 1TTXA 2WNDA 1L2OB 2JTZA 5HLVA 3WNXB 1NCXA 1WLMA 2KQ6A 2M49B 3BYAA 3RM1A 2M29A 1GQMA 2EC6B 4Q04A 1CLBA 1K9KA 1RWYA 5CSNA 5TNCA 4QJ5B 3EVUA 1B9AA 1YVHA 3I5HB 2LLSA 2MHHA 1IKUA 2BBMA 2K7DA 3CS1A 3BUMB 1YX8A 4CFRA 2LMTA 1DGVA 2CXJA 1EG4A 1NX3A 1A4PA 2PRUA 3H4SE 3PLFB 3BUNB 1YR5A 3I5GC 1TCFA 2LM5A 4L9MA 4N1GA 3VROA 1C07A 1QVIY 1NCYA 3O78A 3BUOB 3OB2B 2JNFA 1AUIB 1KFUS 2WCFA 3BOWB 4MZKA 1SYMA 4BY4A 1BR1B 1JF2A 1KWOC 4YGEB 3D0YB 3CR5X 3TUYB 1G33A 2AAOA 1L2OC 2F2OA 2SASA 4C0LA 4P2YB 2HF5A 2JT0A 2KBMA 3LCPC 5I2OA 4OKHA 3CTNA 1WLZA 4HRHA 1H8BA 5AEQA 1LVCD 4M2PA 1J7PA 1ZFSA 2KI6C 1Q80A 2JULA 1WRKA 3TZ1A 3BXKA 2CBLA 1S5GY 3F45A 3EVVA 1K96A 3EVRA 1V1FA 1UUSA 2KHNA 1M39A 1CLLA 2KDHA 1K9PA 2M7LA 4AQJA 1DF0B 4PHNA 4YGDB 4ZCUA 5HYDA 1NYAA 3D0YA 1AJ4A 1A29A 2ZKMX 5HKYA 2LV7A 1YVLA 2BKIB 1PALA 2QACA 3TDZA 2B1UA 1U5IB 3DVEA 3PSRA 1S6CA 2L50A 2PALA 1BLQA 1CB1A 2KAVA 2JC2A 5DKQA 2E6WA 1LA0A 1J7RA 2AUCA 2ISDA 4PALA 2FJUB 4PCWA 1UHJA 1JF0A 3O4YA 2P6BB 2LAPA 2H61C 4WRIA 2NZ0A 2QPTA 1CFFA 4PE0A 1KCYA 3EKHA 1BR4B 1DT7B 4MRXA 2ZN9A 3EKJA 3HX4A 3GOFA 5GQQC 5I8NA 2M9GA 3DF0B 1Y1AA 1J7OA 3FWCA 1A75A 4MLWA 5CSJA 2AMIA 1MR8A 4GGFC 5I2LA 2JOJA 2Q4UA 1U5IA 4U8DA 2K7CA 3SG3A 1F8HA 1W7IB 1W7JB 3VRNA 2MLEC 1B8RA 1IGVA 1F4QA 1TNXA 1YUTA 4N1FA 1JFKA 1Y0VH 1M45A 4GUKA 1N0YA 2ZNDA 3SIAA 1Y1UA 1NUBA 2KI4B 3CR4X 1NP8A 1XFZO 3LL8B 1J1DA 1DJWA 2JXLA 2F3YA 2M97A 2NCOA 1KFXL 3TDUA 1B8LA 2BKHB 1IQ3A 3IF7A 1QTXA 4PE1A 1OMVA 2Q91A 3EK7A 2KSPA 1F55A 1BG1A 1Y1XA 2OS8B 1KSOA 2V53A 2I7AA 3NSIA 2BL0C 2R2IA 4CLNA 5B8IB 1DJIA 1FI5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OE9 B;  1ZAC A;  1OMD A;  5CSI A;  1DJH A;  1IJ5 A;  3PAL A;  2BE4 A;  4C0J A;  1WRZ A;  2OTG C;  3FIA A;  1QS7 A;  4ORC B;  1DJZ A;  1C7V A;  2LMV A;  1EH2 A;  1YUR A;  4MVF A;  2F3Z A;  4YGC B;  2L4H A;  4E68 A;  1DGU A;  2H2K A;  2HPS A;  2BEC A;  1XFV O;  2JNX A;  3VRR A;  1QIW A;  5KTY A;  1QLK A;  2LUX A;  2K2A A;  1XFU O;  5CSF A;  3CWG A;  4ORA B;  3LLE A;  4NDB A;  4HSZ A;  3CZT X;  2CTN A;  1M31 A;  1WDC B;  4N5X A;  3TS5 B;  1V1G A;  1TIZ A;  1CDM A;  2D8N A;  5KSZ A;  2OS8 C;  1ALW A;  2VRG A;  1GGZ A;  1N65 A;  1BU3 A;  1QV0 A;  2BE6 A;  3JTD C;  1F4O A;  2KYF A;  4QJ3 B;  4AOM A;  1CMG A;  1PK0 D;  1CDP A;  4OV2 A;  1OQP A;  1S36 A;  1S3P A;  3PAT A;  1F54 A;  1SW8 A;  1WY9 A;  3SG7 A;  1SNL A;  5AAN A;  4F0Z B;  4BY5 A;  1QXP A;  2KAX A;  2LHI A;  5FYX A;  1PUL A;  1C7W A;  2M8U A;  3DVM A;  1FF1 A;  3CGA A;  2LUC A;  4D1E A;  2GGZ A;  1SMG A;  4NDC A;  2CCM A;  2I94 A;  2EC6 C;  2NLN A;  4OR9 B;  1BOD A;  3I5H C;  3TS5 C;  1OOJ A;  2K61 A;  5IBW A;  3MSE B;  3OHM B;  1LA3 A;  2BCB A;  4PE7 A;  1PSR A;  4MEW A;  2G9B A;  3KEV A;  4YGA A;  4DIR A;  4M2O A;  4PE4 A;  1VRK A;  2GGM A;  4ORB B;  3BOW A;  5BPJ A;  2K2F A;  3NSL A;  4I5J A;  1LKJ A;  1AVS A;  1K90 D;  1Y6W A;  2M1U A;  1IG5 A;  3GK2 A;  2JXC A;  1DMO A;  1IH0 A;  1KK8 B;  4GNK B;  3D10 A;  2K7O A;  2COL B;  2BCA A;  1PSB A;  3RLZ A;  1BOC A;  1BT6 A;  4CFQ A;  1QAS A;  3TUY C;  2HQW A;  1CLM A;  4C0K A;  1KQM B;  1TNP A;  4GFT A;  4IL1 A;  2SCP A;  2LE9 B;  3DD4 A;  2ZNE A;  1J55 A;  1QIV A;  2F33 A;  2RGI A;  2JQ6 A;  2KAY A;  1K95 A;  1XA5 A;  4ICB A;  2H61 A;  2KYC A;  1NX0 A;  1YTZ C;  2KGR A;  3A4U B;  1MXL C;  1DF0 A;  1NX2 A;  5AXI A;  1XFX O;  2O60 A;  4CID A;  4YBH B;  1CM1 A;  1UWO A;  1G8I A;  1DJG A;  1H4B A;  2LVI A;  1TRF A;  4YGB B;  4GGF A;  1KK8 C;  4XYN A;  5K89 A;  1F70 A;  3PM8 A;  1QJT A;  1DJY A;  5JOL A;  2PAS A;  2Y4Q A;  4GGN A;  1FW4 A;  2G2B A;  1SK6 D;  2JU0 A;  2LP2 A;  2L2E A;  3M0W A;  4ZCV A;  1MWN A;  3SG5 A;  4A4B A;  4YRU A;  1A2X A;  2KFF A;  1SR6 B;  1EJ3 A;  3CLN A;  1EL4 A;  3VRQ A;  1MQ1 A;  1KQM C;  1G4Y R;  2MJW B;  2LLU A;  4OCI A;  1CKK A;  2Y1M A;  1KK7 Y;  1S6J A;  1YRU B;  2EGD A;  4XJK B;  3KHE A;  3WXA A;  1JBA A;  1ZUZ A;  2KQY A;  4M2Q A;  3ICB A;  1FPW A;  4A4C A;  1TNQ A;  3ZWH A;  1S1E A;  1UUR A;  1F71 A;  2MLF C;  2KGB C;  3KO0 A;  4GPL B;  3DF0 A;  1CFP A;  1SL8 A;  5PAL A;  1XVJ A;  4YI8 A;  4NDD A;  3SIB A;  2IS9 A;  1QX2 A;  1NWD A;  1YX7 A;  4UPG A;  1OZS A;  2KNE A;  1SBJ A;  2I2R E;  4USL A;  3KF9 A;  1AK8 A;  4I5L B;  2OPO A;  1DTL A;  1JUO A;  1KFU L;  1MHO A;  1ZMZ A;  4JPZ B;  1AJ5 A;  3SG4 A;  1EXR A;  2MBX A;  1JFJ A;  2LVV A;  2Y5I A;  5ER5 A;  3AKB A;  4MSP A;  3OB1 B;  4AQI A;  2KI4 C;  3VRP A;  2LHL A;  4R1E A;  1NIW A;  2JTT A;  3JVT B;  2KFG A;  3PN7 B;  1IJ6 A;  4WQ2 A;  5D69 A;  5G08 A;  4FQO A;  2MAZ A;  4PHM A;  5JJG A;  1QAT A;  2KOT A;  1PVA A;  1XK4 A;  2LVJ A;  3CR2 A;  1RFJ A;  3BUW B;  3GK4 X;  2MRD A;  3I5F B;  2L0P A;  1XK4 C;  1K9U A;  3AAK A;  2F8P A;  5ER4 X;  1LXF C;  1CFC A;  4I5N B;  3LK1 A;  4WQ3 A;  2K7B A;  1SRA A;  1NX1 A;  1PRW A;  2BCX A;  1KFX S;  4GBA A;  1YRT B;  1J1E A;  2WOS A;  1B1G A;  2FOT A;  3DVK A;  5CPV A;  1UHN A;  1YUS A;  2M1K B;  1KK7 Z;  1TOP A;  2L4I A;  3BQ3 A;  4MRY A;  4MZJ A;  1X02 A;  2E30 A;  4DRW A;  1SCM B;  2CT9 A;  5KU1 A;  2JRF A;  2HQ8 A;  3SG6 A;  1SPY A;  5AER A;  3WHU B;  2PMY A;  2JWW A;  1WRL A;  1YUU A;  2WCE A;  1IQ5 A;  1QLS A;  3JVT C;  1LIN A;  3PN7 C;  1XYD A;  2L51 A;  1RK9 A;  4I5K A;  1WDC C;  1FBV A;  2O5G A;  4OVN F;  1OMR A;  2M0R A;  3IQO A;  4YI9 A;  4ETO A;  2CNP A;  1SCV A;  1JSA A;  3I5F C;  1CDL A;  1UHH A;  2Y1N A;  1UHK A;  5F6T A;  1K94 A;  1DVI A;  1L7Z A;  3O2P A;  5J3X A;  2WCB A;  3PFV A;  3HCM A;  1BMO A;  1M63 B;  1RRO A;  1IWQ A;  3E3R A;  3EK4 A;  1OZO A;  5HLO A;  1B47 A;  1HQV A;  3NXA A;  3AKA A;  1TN4 A;  1MXE A;  1MUX A;  2PVB A;  3QRX A;  1CMF A;  2ZRT A;  1E8A A;  1KSM A;  4JWQ A;  4DCK A;  1UP5 A;  3ZNI A;  2JT8 A;  1CDN A;  2WOR A;  1S26 D;  3KPX A;  4HRG A;  2WC8 A;  1SCM C;  3EK8 A;  1CM4 A;  5DKN A;  2KFH A;  2NXQ A;  2JT3 A;  2M7N A;  2GV5 A;  4P5O E;  1RJV A;  2LLT A;  3OP0 A;  4CPV A;  4NQG A;  5AFP A;  1QX7 A;  2TN4 A;  1SY9 A;  2M3W A;  1CNP A;  1B7T Y;  1XFY O;  5DKR A;  1FI6 A;  1NSH A;  4DS7 A;  3NSK A;  2PSR A;  2DOQ A;  2KBI A;  5D7F A;  3A8R A;  3AAJ A;  2I18 A;  1NCZ A;  1OSA A;  1R2U A;  2MA2 A;  4JQ0 D;  1A75 B;  2LP3 A;  1QX5 B;  1XFW O;  3FWB A;  3VGO A;  3C1V A;  4DUQ A;  3K21 A;  1GJY A;  1SL7 A;  1TCO B;  1MF8 B;  1GGW A;  1RTP 1;  4MBE A;  2A4J A;  4PHK A;  2BBN A;  1S6I A;  2KI6 D;  1J7Q A;  2K0J A;  2JPT A;  1QVI Z;  4MZL A;  3TDI A;  1UHI A;  2JZI A;  2LC5 A;  4FTG A;  4MN0 A;  2LCP A;  1ALV A;  2LMU A;  2BL0 B;  2FCE A;  3JTD B;  1SL9 A;  5HKW A;  1PVB A;  3BUX B;  3LK0 A;  1B8C A;  2OTG B;  3GK1 A;  1KQV A;  2K8M B;  4HRE E;  1REC A;  2ZFD A;  3I5I B;  1N2D A;  1K93 D;  3OX5 A;  1HT9 A;  1B4C A;  4GAO A;  4QJ4 B;  1S5G Z;  1K8U A;  2F2P A;  1CFD A;  1SR6 C;  1BJF A;  1TNW A;  1AP4 A;  2L98 A;  1IRJ A;  1R6P A;  3O6B A;  4XJK A;  2NCP A;  2LVK A;  1JWD A;  3WHT B;  1B7T Z;  3DVJ A;  3NSO A;  4TNC A;  1M46 A;  1CTR A;  2EHB A;  1XO5 A;  1EG3 A;  1QV1 A;  1JC2 A;  1DJX A;  3I5G B;  2LAN A;  1A03 A;  3IQQ A;  1NPQ A;  1ZOT B;  5HKZ A;  5I2Q A;  2L5X B;  2LNK A;  1K2H A;  1D1O A;  2FCD A;  1SKT A;  4PHJ A;  1KWO B;  2ZN8 A;  1AHR A;  2HET A;  2ZRS A;  3FS7 A;  3I5I C;  4PDZ A;  1ODB A;  3SJS A;  3OX6 A;  1BF5 A;  3SG2 A;  1TTX A;  2WND A;  1L2O B;  2JTZ A;  5HLV A;  3WNX B;  1NCX A;  1WLM A;  2KQ6 A;  2M49 B;  3BYA A;  3RM1 A;  2M29 A;  1GQM A;  2EC6 B;  4Q04 A;  1CLB A;  1K9K A;  1RWY A;  5CSN A;  5TNC A;  4QJ5 B;  3EVU A;  1B9A A;  1YVH A;  3I5H B;  2LLS A;  2MHH A;  1IKU A;  2BBM A;  2K7D A;  3CS1 A;  3BUM B;  1YX8 A;  4CFR A;  2LMT A;  1DGV A;  2CXJ A;  1EG4 A;  1NX3 A;  1A4P A;  2PRU A;  3H4S E;  3PLF B;  3BUN B;  1YR5 A;  3I5G C;  1TCF A;  2LM5 A;  4L9M A;  4N1G A;  3VRO A;  1C07 A;  1QVI Y;  1NCY A;  3O78 A;  3BUO B;  3OB2 B;  2JNF A;  1AUI B;  1KFU S;  2WCF A;  3BOW B;  4MZK A;  1SYM A;  4BY4 A;  1BR1 B;  1JF2 A;  1KWO C;  4YGE B;  3D0Y B;  3CR5 X;  3TUY B;  1G33 A;  2AAO A;  1L2O C;  2F2O A;  2SAS A;  4C0L A;  4P2Y B;  2HF5 A;  2JT0 A;  2KBM A;  3LCP C;  5I2O A;  4OKH A;  3CTN A;  1WLZ A;  4HRH A;  1H8B A;  5AEQ A;  1LVC D;  4M2P A;  1J7P A;  1ZFS A;  2KI6 C;  1Q80 A;  2JUL A;  1WRK A;  3TZ1 A;  3BXK A;  2CBL A;  1S5G Y;  3F45 A;  3EVV A;  1K96 A;  3EVR A;  1V1F A;  1UUS A;  2KHN A;  1M39 A;  1CLL A;  2KDH A;  1K9P A;  2M7L A;  4AQJ A;  1DF0 B;  4PHN A;  4YGD B;  4ZCU A;  5HYD A;  1NYA A;  3D0Y A;  1AJ4 A;  1A29 A;  2ZKM X;  5HKY A;  2LV7 A;  1YVL A;  2BKI B;  1PAL A;  2QAC A;  3TDZ A;  2B1U A;  1U5I B;  3DVE A;  3PSR A;  1S6C A;  2L50 A;  2PAL A;  1BLQ A;  1CB1 A;  2KAV A;  2JC2 A;  5DKQ A;  2E6W A;  1LA0 A;  1J7R A;  2AUC A;  2ISD A;  4PAL A;  2FJU B;  4PCW A;  1UHJ A;  1JF0 A;  3O4Y A;  2P6B B;  2LAP A;  2H61 C;  4WRI A;  2NZ0 A;  2QPT A;  1CFF A;  4PE0 A;  1KCY A;  3EKH A;  1BR4 B;  1DT7 B;  4MRX A;  2ZN9 A;  3EKJ A;  3HX4 A;  3GOF A;  5GQQ C;  5I8N A;  2M9G A;  3DF0 B;  1Y1A A;  1J7O A;  3FWC A;  1A75 A;  4MLW A;  5CSJ A;  2AMI A;  1MR8 A;  4GGF C;  5I2L A;  2JOJ A;  2Q4U A;  1U5I A;  4U8D A;  2K7C A;  3SG3 A;  1F8H A;  1W7I B;  1W7J B;  3VRN A;  2MLE C;  1B8R A;  1IGV A;  1F4Q A;  1TNX A;  1YUT A;  4N1F A;  1JFK A;  1Y0V H;  1M45 A;  4GUK A;  1N0Y A;  2ZND A;  3SIA A;  1Y1U A;  1NUB A;  2KI4 B;  3CR4 X;  1NP8 A;  1XFZ O;  3LL8 B;  1J1D A;  1DJW A;  2JXL A;  2F3Y A;  2M97 A;  2NCO A;  1KFX L;  3TDU A;  1B8L A;  2BKH B;  1IQ3 A;  3IF7 A;  1QTX A;  4PE1 A;  1OMV A;  2Q91 A;  3EK7 A;  2KSP A;  1F55 A;  1BG1 A;  1Y1X A;  2OS8 B;  1KSO A;  2V53 A;  2I7A A;  3NSI A;  2BL0 C;  2R2I A;  4CLN A;  5B8I B;  1DJI A;  1FI5 A; 
#chains in the Genus database with same CATH topology
 1OE9 B;  1ZAC A;  1OMD A;  5CSI A;  1DJH A;  1IJ5 A;  3PAL A;  2BE4 A;  4C0J A;  1WRZ A;  2OTG C;  3FIA A;  1QS7 A;  4ORC B;  1DJZ A;  1C7V A;  2WCL A;  2LMV A;  1EH2 A;  1YUR A;  4MVF A;  2F3Z A;  4YGC B;  3UNW A;  2L4H A;  4E68 A;  1DGU A;  2H2K A;  2HPS A;  3B6X A;  1OW4 A;  3S0G A;  2BEC A;  1XFV O;  3PM2 A;  2JNX A;  3VRR A;  2KLE A;  1QIW A;  5KTY A;  1QLK A;  2LUX A;  2K2A A;  5FI6 A;  1XFU O;  5CSF A;  3CWG A;  4ORA B;  3LLE A;  4NDB A;  4HSZ A;  3CZT X;  2CTN A;  1M31 A;  1WDC B;  3B87 A;  4N5X A;  3TS5 B;  1V1G A;  1TIZ A;  1CDM A;  2D8N A;  5KSZ A;  2OS8 C;  1ALW A;  2VRG A;  1GGZ A;  1DEK A;  1N65 A;  1BU3 A;  1QV0 A;  2BE6 A;  3JTD C;  1F4O A;  2KYF A;  3BFB A;  4QJ3 B;  4AOM A;  2WCH A;  1CMG A;  1PK0 D;  1TUJ A;  1CDP A;  4OV2 A;  1OQP A;  1S36 A;  1S3P A;  3PAT A;  1F54 A;  3FE8 A;  1SW8 A;  1WY9 A;  3B88 A;  3SG7 A;  1SNL A;  3BFA A;  5AAN A;  4F0Z B;  4BY5 A;  3D78 A;  1QXP A;  2KAX A;  2LHI A;  3CZ1 A;  5FYX A;  1PUL A;  1C7W A;  2M8U A;  3DVM A;  1FF1 A;  3CGA A;  2LUC A;  4D1E A;  2BNX A;  1SMG A;  2GGZ A;  2CCM A;  4NDC A;  2I94 A;  2EC6 C;  2NLN A;  2WC6 A;  4OR9 B;  1BOD A;  3I5H C;  3TS5 C;  1OOJ A;  2K61 A;  5IBW A;  3MSE B;  3OHM B;  1C3Y A;  1LA3 A;  2BCB A;  4PE7 A;  1PSR A;  4MEW A;  2G9B A;  3KEV A;  4YGA A;  3BJH A;  4DIR A;  4M2O A;  4PE4 A;  1VRK A;  3PJI A;  3D74 A;  2GGM A;  4ORB B;  3BOW A;  5BPJ A;  2K2F A;  3NSL A;  4I5J A;  1LKJ A;  1AVS A;  1K90 D;  1Y6W A;  2M1U A;  1IG5 A;  3GK2 A;  2JXC A;  5EL2 A;  2YGU A;  1KK8 B;  4GNK B;  1DMO A;  3D10 A;  1IH0 A;  2K7O A;  2COL B;  2BCA A;  1PSB A;  2L2C A;  3RLZ A;  1BT6 A;  1BOC A;  4CFQ A;  1QAS A;  3TUY C;  3CZ0 A;  2HQW A;  1CLM A;  4C0K A;  1KQM B;  1TNP A;  4GFT A;  4IL1 A;  2SCP A;  2LE9 B;  3DD4 A;  2ZNE A;  1J55 A;  1QIV A;  2F33 A;  2RGI A;  2JQ6 A;  2KAY A;  1K95 A;  1XA5 A;  4ICB A;  2H61 A;  2KYC A;  1NX0 A;  1YTZ C;  2KGR A;  3A4U B;  1MXL C;  1W9Z A;  5FI2 A;  1DF0 A;  1NX2 A;  5AXI A;  1XFX O;  2O60 A;  4CID A;  4YBH B;  1CM1 A;  1UWO A;  1G8I A;  3R72 A;  2PQL A;  1DJG A;  1H4B A;  2LVI A;  1TRF A;  4YGB B;  2H8V A;  4FQT A;  1KK8 C;  3R1O A;  4GGF A;  4XYN A;  3PM8 A;  5K89 A;  1F70 A;  1QJT A;  1DJY A;  5JOL A;  2PAS A;  2Y4Q A;  4GGN A;  1FW4 A;  2G2B A;  1SK6 D;  2JU0 A;  2LP2 A;  2L2E A;  4F7F A;  3M0W A;  4ZCV A;  1MWN A;  3SG5 A;  1T14 A;  4A4B A;  4YRU A;  1A2X A;  2KFF A;  1SR6 B;  1EJ3 A;  3CLN A;  1EL4 A;  3VRQ A;  1MQ1 A;  1KQM C;  1G4Y R;  2MJW B;  2LLU A;  4OCI A;  1CKK A;  2Y1M A;  1KK7 Y;  1S6J A;  3R1V A;  3D75 A;  1YRU B;  2EGD A;  4XJK B;  3KHE A;  5DIC A;  3WXA A;  1JBA A;  1ZUZ A;  2KQY A;  2WCM A;  1TWO A;  4M2Q A;  3ICB A;  4JD9 A;  1FPW A;  4A4C A;  1TNQ A;  3ZWH A;  1S1E A;  1UUR A;  1F71 A;  2MLF C;  2KGB C;  3KO0 A;  4GPL B;  3DF0 A;  1CFP A;  1SL8 A;  1P28 A;  5PAL A;  1XVJ A;  3RZS A;  4YI8 A;  3S0F A;  4NDD A;  3SIB A;  2IS9 A;  1QX2 A;  2QEO A;  1NWD A;  1YX7 A;  4UPG A;  1OZS A;  2KNE A;  1SBJ A;  2I2R E;  4USL A;  3KF9 A;  1AK8 A;  4I5L B;  2OPO A;  1DTL A;  1JUO A;  1KFU L;  1MHO A;  1ZMZ A;  4JKT A;  1AJ5 A;  4JPZ B;  1EXR A;  3SG4 A;  2MBX A;  1JFJ A;  2LVV A;  3DZT A;  2Y5I A;  5ER5 A;  3AKB A;  4MSP A;  3OB1 B;  4AQI A;  3Q8I A;  2KI4 C;  3O4X A;  3VRP A;  2LHL A;  4R1E A;  1NIW A;  2JTT A;  3JVT B;  2KFG A;  1ORG A;  3PN7 B;  1IJ6 A;  5FI7 A;  4WQ2 A;  4PT1 A;  5D69 A;  5G08 A;  3UO9 A;  4FQO A;  2MAZ A;  4PHM A;  2QEV A;  5JJG A;  1QAT A;  2KOT A;  1PVA A;  1XK4 A;  2LVJ A;  3CR2 A;  1RFJ A;  3BUW B;  3GK4 X;  2MRD A;  3I5F B;  2L0P A;  1XK4 C;  1K9U A;  3AAK A;  2F8P A;  5ER4 X;  1LXF C;  1CFC A;  4I5N B;  3LK1 A;  4WQ3 A;  2K7B A;  1SRA A;  1NX1 A;  1PRW A;  2BCX A;  1KFX S;  4GBA A;  1YRT B;  1J1E A;  2WOS A;  1B1G A;  5I94 A;  2FOT A;  3DVK A;  3DY9 A;  1UHN A;  5CPV A;  1YUS A;  2M1K B;  1KK7 Z;  1TOP A;  2L4I A;  3BQ3 A;  3D73 A;  4MRY A;  4MZJ A;  1X02 A;  2E30 A;  4DRW A;  3S0E A;  1SCM B;  2CT9 A;  5KU1 A;  2JRF A;  2HQ8 A;  3NHT A;  1SPY A;  3SG6 A;  5AER A;  3WHU B;  2PMY A;  2JWW A;  1WRL A;  1YUU A;  2WCE A;  1IQ5 A;  1QLS A;  3CYZ A;  1LIN A;  3JVT C;  1XYD A;  3PN7 C;  2L51 A;  1RK9 A;  4I5K A;  4INW A;  1WDC C;  1FBV A;  2O5G A;  5HL1 A;  4OVN F;  1OMR A;  2M0R A;  3IQO A;  4YI9 A;  4ETO A;  1SCV A;  2CNP A;  1JSA A;  3I5F C;  1CDL A;  1UHH A;  2Y1N A;  1UHK A;  2WCJ A;  4IJ7 A;  5F6T A;  1K94 A;  1DVI A;  1L7Z A;  3O2P A;  5J3X A;  2WCB A;  3PFV A;  3HCM A;  2WC5 A;  1BMO A;  1M63 B;  1RRO A;  1IWQ A;  3E3R A;  3EK4 A;  1OZO A;  5HLO A;  1B47 A;  1HQV A;  3NXA A;  3AKA A;  1TN4 A;  1MXE A;  1MUX A;  4KYN A;  2PVB A;  3QRX A;  1CMF A;  2ZRT A;  2L5Y A;  1E8A A;  1KSM A;  4JWQ A;  4DCK A;  1UP5 A;  5D3O A;  3S0D A;  3ZNI A;  3L47 A;  2JT8 A;  1CDN A;  2WOR A;  1TUZ A;  1S26 D;  3KPX A;  4HRG A;  2WC8 A;  1SCM C;  3EK8 A;  1CM4 A;  5DKN A;  2KFH A;  1XFR A;  2JT3 A;  2NXQ A;  2M7N A;  2GV5 A;  4P5O E;  1RJV A;  2LLT A;  3K1E A;  3OP0 A;  2QEH A;  4CPV A;  4NQG A;  5AFP A;  3VB1 A;  1QX7 A;  2TN4 A;  1SY9 A;  2M3W A;  1CNP A;  1B7T Y;  1XFY O;  2K60 A;  5DKR A;  1FI6 A;  1NSH A;  4DS7 A;  3NSK A;  2PSR A;  2DOQ A;  2KBI A;  5D7F A;  3A8R A;  3AAJ A;  2I18 A;  1NCZ A;  1OSA A;  1R2U A;  2MA2 A;  4JQ0 D;  1A75 B;  2LP3 A;  1QX5 B;  1XFW O;  3FWB A;  3VGO A;  3C1V A;  4DUQ A;  1Z2C B;  3K21 A;  1GJY A;  1SL7 A;  3NGV A;  1DC1 A;  1TCO B;  1MF8 B;  1GGW A;  1RTP 1;  4MBE A;  2A4J A;  4PHK A;  2BBN A;  1GM0 A;  2KLD A;  1S6I A;  2KI6 D;  1J7Q A;  2K0J A;  2PYQ A;  3DXL A;  2JPT A;  1QVI Z;  4MZL A;  3IVT A;  3TDI A;  1UHI A;  2JZI A;  2LC5 A;  4FTG A;  2BAP A;  4MN0 A;  2LCP A;  1QWV A;  1ALV A;  2LMU A;  3CAB A;  2BL0 B;  2FCE A;  3JTD B;  1SL9 A;  4INX A;  5HKW A;  1PVB A;  3BUX B;  3LK0 A;  1B8C A;  2OTG B;  3GK1 A;  1KQV A;  3FE9 A;  2K8M B;  4HRE E;  1REC A;  2ZFD A;  3I5I B;  1N2D A;  3FE6 A;  1K93 D;  3OX5 A;  1HT9 A;  1B4C A;  4GAO A;  4QJ4 B;  1S5G Z;  1K8U A;  2F2P A;  1CFD A;  1SR6 C;  1BJF A;  1TNW A;  1AP4 A;  2L98 A;  1IRJ A;  3SS3 A;  1R6P A;  3O6B A;  4XJK A;  2NCP A;  2LVK A;  1JWD A;  1OOG A;  3WHT B;  1B7T Z;  3DVJ A;  3NSO A;  4TNC A;  1M46 A;  4OZD A;  1CTR A;  2EHB A;  1XO5 A;  1EG3 A;  1QV1 A;  2FJY A;  1JC2 A;  2QDI A;  1DJX A;  1Z4H A;  2LAN A;  3I5G B;  1A03 A;  3IQQ A;  1NPQ A;  1ZOT B;  5HKZ A;  3S0A A;  5I2Q A;  2L5X B;  2LNK A;  3S0B A;  1K2H A;  1D1O A;  2FCD A;  1SKT A;  2WCK A;  4PHJ A;  1KWO B;  2ZN8 A;  1AHR A;  2HET A;  2ZRS A;  3FS7 A;  3I5I C;  4PDZ A;  1ODB A;  3SJS A;  1DEL A;  3OX6 A;  1BF5 A;  3SG2 A;  1TTX A;  2GTE A;  1L2O B;  2JTZ A;  2WND A;  5HLV A;  3WNX B;  1NCX A;  1WLM A;  2KQ6 A;  2M49 B;  3BYA A;  3RM1 A;  2M29 A;  1GQM A;  2EC6 B;  4Q04 A;  1CLB A;  1K9K A;  1RWY A;  5CSN A;  3B7A A;  5TNC A;  4QJ5 B;  2QEB A;  3EVU A;  1B9A A;  1YVH A;  3I5H B;  2LLS A;  2MHH A;  1IKU A;  2BBM A;  2K7D A;  3CS1 A;  3BUM B;  1YX8 A;  4CFR A;  2LMT A;  1DGV A;  2CXJ A;  1EG4 A;  1NX3 A;  1A4P A;  2PRU A;  3H4S E;  3PLF B;  3BUN B;  1YR5 A;  3I5G C;  1LS8 A;  1TCF A;  2LM5 A;  4L9M A;  4N1G A;  2P70 A;  3VRO A;  1QVI Y;  1NCY A;  3O78 A;  3BUO B;  1C07 A;  3OB2 B;  2JNF A;  1AUI B;  1KFU S;  2WCF A;  2JPO A;  3BOW B;  4MZK A;  3SS5 A;  1SYM A;  4BY4 A;  1BR1 B;  1SSE B;  1JF2 A;  1KWO C;  4YGE B;  3D0Y B;  3CR5 X;  3TUY B;  1G33 A;  2AAO A;  1L2O C;  2F2O A;  2SAS A;  4C0L A;  4P2Y B;  2HF5 A;  2JT0 A;  2KBM A;  3LCP C;  3N7H A;  3CZ2 A;  4OKH A;  5I2O A;  3CTN A;  1WLZ A;  4HRH A;  1H8B A;  5AEQ A;  1LVC D;  4M2P A;  1J7P A;  1ZFS A;  1OOI X;  1Q80 A;  2KI6 C;  3QME A;  2JUL A;  1WRK A;  3TZ1 A;  3BXK A;  2CBL A;  1S5G Y;  3F45 A;  3SS4 A;  3EVV A;  1K96 A;  3EVR A;  1V1F A;  1UUS A;  2KHN A;  1M39 A;  3DYE A;  1CLL A;  2KDH A;  1K9P A;  2P71 A;  2M7L A;  4AQJ A;  1IIO A;  1DF0 B;  4PHN A;  1OOF A;  4YGD B;  4ZCU A;  5HYD A;  1NYA A;  3D0Y A;  3OBV A;  1AJ4 A;  1A29 A;  2ZKM X;  5HKY A;  2LV7 A;  1YVL A;  2BKI B;  1PAL A;  2QAC A;  3TDZ A;  2B1U A;  1U5I B;  3DVE A;  3B86 A;  3PSR A;  1S6C A;  2L50 A;  2PAL A;  3OGN A;  1BLQ A;  3EG5 B;  1CB1 A;  2KAV A;  2JC2 A;  5DKQ A;  2E6W A;  1LA0 A;  1J7R A;  2AUC A;  3CDN A;  2ISD A;  4PAL A;  2FJU B;  4PCW A;  1UHJ A;  1JF0 A;  3O4Y A;  2P6B B;  2LAP A;  2H61 C;  4WRI A;  2NZ0 A;  2QPT A;  1CFF A;  4PE0 A;  1KCY A;  3EKH A;  1BR4 B;  1DT7 B;  3D76 A;  2ZN9 A;  3EKJ A;  3HX4 A;  3GOF A;  4MRX A;  5GQQ C;  3R1P A;  2M9G A;  5I8N A;  3DF0 B;  1Y1A A;  1J7O A;  3FWC A;  1A75 A;  4MLW A;  5CSJ A;  2AMI A;  1MR8 A;  4GGF C;  5I2L A;  2JOJ A;  2Q4U A;  1U5I A;  3NHI A;  4U8D A;  2K7C A;  3BFH A;  3SG3 A;  1F8H A;  1W7I B;  1W7J B;  2KPH A;  3L4L A;  3VRN A;  2MLE C;  1C3Z A;  1B8R A;  1IGV A;  1F4Q A;  1TNX A;  1YUT A;  4N1F A;  1JFK A;  1Y0V H;  1M45 A;  4GUK A;  1N0Y A;  2ZND A;  3SIA A;  1Y1U A;  1NUB A;  2KI4 B;  3CR4 X;  1NP8 A;  2ERB A;  1XFZ O;  3LL8 B;  1J1D A;  1DJW A;  2JXL A;  2F3Y A;  2M97 A;  2NCO A;  1KFX L;  3TDU A;  1B8L A;  1DQE A;  2BKH B;  1IQ3 A;  3IF7 A;  1QTX A;  4PE1 A;  1OMV A;  2Q91 A;  3EK7 A;  2KSP A;  1F55 A;  3D77 A;  1BG1 A;  3L4A A;  1OOH A;  1Y1X A;  1KSO A;  2OS8 B;  3V2L A;  2V53 A;  2I7A A;  3NSI A;  2BL0 C;  2R2I A;  4CLN A;  5B8I B;  1DJI A;  1FI5 A; 
#chains in the Genus database with same CATH homology
 1OE9 B;  1ZAC A;  1OMD A;  5CSI A;  1DJH A;  1IJ5 A;  3PAL A;  2BE4 A;  4C0J A;  1WRZ A;  2OTG C;  3FIA A;  1QS7 A;  4ORC B;  1DJZ A;  1C7V A;  2LMV A;  1EH2 A;  1YUR A;  4MVF A;  2F3Z A;  4YGC B;  2L4H A;  4E68 A;  1DGU A;  2H2K A;  2HPS A;  2BEC A;  1XFV O;  2JNX A;  3VRR A;  1QIW A;  5KTY A;  1QLK A;  2LUX A;  2K2A A;  1XFU O;  5CSF A;  3CWG A;  4ORA B;  3LLE A;  4NDB A;  4HSZ A;  3CZT X;  2CTN A;  1M31 A;  1WDC B;  4N5X A;  3TS5 B;  1V1G A;  1TIZ A;  1CDM A;  2D8N A;  5KSZ A;  2OS8 C;  1ALW A;  2VRG A;  1GGZ A;  1N65 A;  1BU3 A;  1QV0 A;  2BE6 A;  3JTD C;  1F4O A;  2KYF A;  4QJ3 B;  4AOM A;  1CMG A;  1PK0 D;  1CDP A;  4OV2 A;  1OQP A;  1S36 A;  1S3P A;  3PAT A;  1F54 A;  1SW8 A;  1WY9 A;  3SG7 A;  1SNL A;  5AAN A;  4F0Z B;  4BY5 A;  1QXP A;  2KAX A;  2LHI A;  5FYX A;  1PUL A;  1C7W A;  2M8U A;  3DVM A;  1FF1 A;  3CGA A;  2LUC A;  4D1E A;  2GGZ A;  1SMG A;  4NDC A;  2CCM A;  2I94 A;  2EC6 C;  2NLN A;  4OR9 B;  1BOD A;  3I5H C;  3TS5 C;  1OOJ A;  2K61 A;  5IBW A;  3MSE B;  3OHM B;  1LA3 A;  2BCB A;  4PE7 A;  1PSR A;  4MEW A;  2G9B A;  3KEV A;  4YGA A;  4DIR A;  4M2O A;  4PE4 A;  1VRK A;  2GGM A;  4ORB B;  3BOW A;  5BPJ A;  2K2F A;  3NSL A;  4I5J A;  1LKJ A;  1AVS A;  1K90 D;  1Y6W A;  2M1U A;  1IG5 A;  3GK2 A;  2JXC A;  1DMO A;  1IH0 A;  1KK8 B;  4GNK B;  3D10 A;  2K7O A;  2COL B;  2BCA A;  1PSB A;  3RLZ A;  1BOC A;  1BT6 A;  4CFQ A;  1QAS A;  3TUY C;  2HQW A;  1CLM A;  4C0K A;  1KQM B;  1TNP A;  4GFT A;  4IL1 A;  2SCP A;  2LE9 B;  3DD4 A;  2ZNE A;  1J55 A;  1QIV A;  2F33 A;  2RGI A;  2JQ6 A;  2KAY A;  1K95 A;  1XA5 A;  4ICB A;  2H61 A;  2KYC A;  1NX0 A;  1YTZ C;  2KGR A;  3A4U B;  1MXL C;  1DF0 A;  1NX2 A;  5AXI A;  1XFX O;  2O60 A;  4CID A;  4YBH B;  1CM1 A;  1UWO A;  1G8I A;  1DJG A;  1H4B A;  2LVI A;  1TRF A;  4YGB B;  4GGF A;  1KK8 C;  4XYN A;  5K89 A;  1F70 A;  3PM8 A;  1QJT A;  1DJY A;  5JOL A;  2PAS A;  2Y4Q A;  4GGN A;  1FW4 A;  2G2B A;  1SK6 D;  2JU0 A;  2LP2 A;  2L2E A;  3M0W A;  4ZCV A;  1MWN A;  3SG5 A;  4A4B A;  4YRU A;  1A2X A;  2KFF A;  1SR6 B;  1EJ3 A;  3CLN A;  1EL4 A;  3VRQ A;  1MQ1 A;  1KQM C;  1G4Y R;  2MJW B;  2LLU A;  4OCI A;  1CKK A;  2Y1M A;  1KK7 Y;  1S6J A;  1YRU B;  2EGD A;  4XJK B;  3KHE A;  3WXA A;  1JBA A;  1ZUZ A;  2KQY A;  4M2Q A;  3ICB A;  1FPW A;  4A4C A;  1TNQ A;  3ZWH A;  1S1E A;  1UUR A;  1F71 A;  2MLF C;  2KGB C;  3KO0 A;  4GPL B;  3DF0 A;  1CFP A;  1SL8 A;  5PAL A;  1XVJ A;  4YI8 A;  4NDD A;  3SIB A;  2IS9 A;  1QX2 A;  1NWD A;  1YX7 A;  4UPG A;  1OZS A;  2KNE A;  1SBJ A;  2I2R E;  4USL A;  3KF9 A;  1AK8 A;  4I5L B;  2OPO A;  1DTL A;  1JUO A;  1KFU L;  1MHO A;  1ZMZ A;  4JPZ B;  1AJ5 A;  3SG4 A;  1EXR A;  2MBX A;  1JFJ A;  2LVV A;  2Y5I A;  5ER5 A;  3AKB A;  4MSP A;  3OB1 B;  4AQI A;  2KI4 C;  3VRP A;  2LHL A;  4R1E A;  1NIW A;  2JTT A;  3JVT B;  2KFG A;  3PN7 B;  1IJ6 A;  4WQ2 A;  5D69 A;  5G08 A;  4FQO A;  2MAZ A;  4PHM A;  5JJG A;  1QAT A;  2KOT A;  1PVA A;  1XK4 A;  2LVJ A;  3CR2 A;  1RFJ A;  3BUW B;  3GK4 X;  2MRD A;  3I5F B;  2L0P A;  1XK4 C;  1K9U A;  3AAK A;  2F8P A;  5ER4 X;  1LXF C;  1CFC A;  4I5N B;  3LK1 A;  4WQ3 A;  2K7B A;  1SRA A;  1NX1 A;  1PRW A;  2BCX A;  1KFX S;  4GBA A;  1YRT B;  1J1E A;  2WOS A;  1B1G A;  2FOT A;  3DVK A;  5CPV A;  1UHN A;  1YUS A;  2M1K B;  1KK7 Z;  1TOP A;  2L4I A;  3BQ3 A;  4MRY A;  4MZJ A;  1X02 A;  2E30 A;  4DRW A;  1SCM B;  2CT9 A;  5KU1 A;  2JRF A;  2HQ8 A;  3SG6 A;  1SPY A;  5AER A;  3WHU B;  2PMY A;  2JWW A;  1WRL A;  1YUU A;  2WCE A;  1IQ5 A;  1QLS A;  3JVT C;  1LIN A;  3PN7 C;  1XYD A;  2L51 A;  1RK9 A;  4I5K A;  1WDC C;  1FBV A;  2O5G A;  4OVN F;  1OMR A;  2M0R A;  3IQO A;  4YI9 A;  4ETO A;  2CNP A;  1SCV A;  1JSA A;  3I5F C;  1CDL A;  1UHH A;  2Y1N A;  1UHK A;  5F6T A;  1K94 A;  1DVI A;  1L7Z A;  3O2P A;  5J3X A;  2WCB A;  3PFV A;  3HCM A;  1BMO A;  1M63 B;  1RRO A;  1IWQ A;  3E3R A;  3EK4 A;  1OZO A;  5HLO A;  1B47 A;  1HQV A;  3NXA A;  3AKA A;  1TN4 A;  1MXE A;  1MUX A;  2PVB A;  3QRX A;  1CMF A;  2ZRT A;  1E8A A;  1KSM A;  4JWQ A;  4DCK A;  1UP5 A;  3ZNI A;  2JT8 A;  1CDN A;  2WOR A;  1S26 D;  3KPX A;  4HRG A;  2WC8 A;  1SCM C;  3EK8 A;  1CM4 A;  5DKN A;  2KFH A;  2NXQ A;  2JT3 A;  2M7N A;  2GV5 A;  4P5O E;  1RJV A;  2LLT A;  3OP0 A;  4CPV A;  4NQG A;  5AFP A;  1QX7 A;  2TN4 A;  1SY9 A;  2M3W A;  1CNP A;  1B7T Y;  1XFY O;  5DKR A;  1FI6 A;  1NSH A;  4DS7 A;  3NSK A;  2PSR A;  2DOQ A;  2KBI A;  5D7F A;  3A8R A;  3AAJ A;  2I18 A;  1NCZ A;  1OSA A;  1R2U A;  2MA2 A;  4JQ0 D;  1A75 B;  2LP3 A;  1QX5 B;  1XFW O;  3FWB A;  3VGO A;  3C1V A;  4DUQ A;  3K21 A;  1GJY A;  1SL7 A;  1TCO B;  1MF8 B;  1GGW A;  1RTP 1;  4MBE A;  2A4J A;  4PHK A;  2BBN A;  1S6I A;  2KI6 D;  1J7Q A;  2K0J A;  2JPT A;  1QVI Z;  4MZL A;  3TDI A;  1UHI A;  2JZI A;  2LC5 A;  4FTG A;  4MN0 A;  2LCP A;  1ALV A;  2LMU A;  2BL0 B;  2FCE A;  3JTD B;  1SL9 A;  5HKW A;  1PVB A;  3BUX B;  3LK0 A;  1B8C A;  2OTG B;  3GK1 A;  1KQV A;  2K8M B;  4HRE E;  1REC A;  2ZFD A;  3I5I B;  1N2D A;  1K93 D;  3OX5 A;  1HT9 A;  1B4C A;  4GAO A;  4QJ4 B;  1S5G Z;  1K8U A;  2F2P A;  1CFD A;  1SR6 C;  1BJF A;  1TNW A;  1AP4 A;  2L98 A;  1IRJ A;  1R6P A;  3O6B A;  4XJK A;  2NCP A;  2LVK A;  1JWD A;  3WHT B;  1B7T Z;  3DVJ A;  3NSO A;  4TNC A;  1M46 A;  1CTR A;  2EHB A;  1XO5 A;  1EG3 A;  1QV1 A;  1JC2 A;  1DJX A;  3I5G B;  2LAN A;  1A03 A;  3IQQ A;  1NPQ A;  1ZOT B;  5HKZ A;  5I2Q A;  2L5X B;  2LNK A;  1K2H A;  1D1O A;  2FCD A;  1SKT A;  4PHJ A;  1KWO B;  2ZN8 A;  1AHR A;  2HET A;  2ZRS A;  3FS7 A;  3I5I C;  4PDZ A;  1ODB A;  3SJS A;  3OX6 A;  1BF5 A;  3SG2 A;  1TTX A;  2WND A;  1L2O B;  2JTZ A;  5HLV A;  3WNX B;  1NCX A;  1WLM A;  2KQ6 A;  2M49 B;  3BYA A;  3RM1 A;  2M29 A;  1GQM A;  2EC6 B;  4Q04 A;  1CLB A;  1K9K A;  1RWY A;  5CSN A;  5TNC A;  4QJ5 B;  3EVU A;  1B9A A;  1YVH A;  3I5H B;  2LLS A;  2MHH A;  1IKU A;  2BBM A;  2K7D A;  3CS1 A;  3BUM B;  1YX8 A;  4CFR A;  2LMT A;  1DGV A;  2CXJ A;  1EG4 A;  1NX3 A;  1A4P A;  2PRU A;  3H4S E;  3PLF B;  3BUN B;  1YR5 A;  3I5G C;  1TCF A;  2LM5 A;  4L9M A;  4N1G A;  3VRO A;  1C07 A;  1QVI Y;  1NCY A;  3O78 A;  3BUO B;  3OB2 B;  2JNF A;  1AUI B;  1KFU S;  2WCF A;  3BOW B;  4MZK A;  1SYM A;  4BY4 A;  1BR1 B;  1JF2 A;  1KWO C;  4YGE B;  3D0Y B;  3CR5 X;  3TUY B;  1G33 A;  2AAO A;  1L2O C;  2F2O A;  2SAS A;  4C0L A;  4P2Y B;  2HF5 A;  2JT0 A;  2KBM A;  3LCP C;  5I2O A;  4OKH A;  3CTN A;  1WLZ A;  4HRH A;  1H8B A;  5AEQ A;  1LVC D;  4M2P A;  1J7P A;  1ZFS A;  2KI6 C;  1Q80 A;  2JUL A;  1WRK A;  3TZ1 A;  3BXK A;  2CBL A;  1S5G Y;  3F45 A;  3EVV A;  1K96 A;  3EVR A;  1V1F A;  1UUS A;  2KHN A;  1M39 A;  1CLL A;  2KDH A;  1K9P A;  2M7L A;  4AQJ A;  1DF0 B;  4PHN A;  4YGD B;  4ZCU A;  5HYD A;  1NYA A;  3D0Y A;  1AJ4 A;  1A29 A;  2ZKM X;  5HKY A;  2LV7 A;  1YVL A;  2BKI B;  1PAL A;  2QAC A;  3TDZ A;  2B1U A;  1U5I B;  3DVE A;  3PSR A;  1S6C A;  2L50 A;  2PAL A;  1BLQ A;  1CB1 A;  2KAV A;  2JC2 A;  5DKQ A;  2E6W A;  1LA0 A;  1J7R A;  2AUC A;  2ISD A;  4PAL A;  2FJU B;  4PCW A;  1UHJ A;  1JF0 A;  3O4Y A;  2P6B B;  2LAP A;  2H61 C;  4WRI A;  2NZ0 A;  2QPT A;  1CFF A;  4PE0 A;  1KCY A;  3EKH A;  1BR4 B;  1DT7 B;  4MRX A;  2ZN9 A;  3EKJ A;  3HX4 A;  3GOF A;  5GQQ C;  5I8N A;  2M9G A;  3DF0 B;  1Y1A A;  1J7O A;  3FWC A;  1A75 A;  4MLW A;  5CSJ A;  2AMI A;  1MR8 A;  4GGF C;  5I2L A;  2JOJ A;  2Q4U A;  1U5I A;  4U8D A;  2K7C A;  3SG3 A;  1F8H A;  1W7I B;  1W7J B;  3VRN A;  2MLE C;  1B8R A;  1IGV A;  1F4Q A;  1TNX A;  1YUT A;  4N1F A;  1JFK A;  1Y0V H;  1M45 A;  4GUK A;  1N0Y A;  2ZND A;  3SIA A;  1Y1U A;  1NUB A;  2KI4 B;  3CR4 X;  1NP8 A;  1XFZ O;  3LL8 B;  1J1D A;  1DJW A;  2JXL A;  2F3Y A;  2M97 A;  2NCO A;  1KFX L;  3TDU A;  1B8L A;  2BKH B;  1IQ3 A;  3IF7 A;  1QTX A;  4PE1 A;  1OMV A;  2Q91 A;  3EK7 A;  2KSP A;  1F55 A;  1BG1 A;  1Y1X A;  2OS8 B;  1KSO A;  2V53 A;  2I7A A;  3NSI A;  2BL0 C;  2R2I A;  4CLN A;  5B8I B;  1DJI A;  1FI5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...