1J1DA

Crystal structure of the 46kda domain of human cardiac troponin in the ca2+ saturated form
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
161
structure length
159
Chain Sequence
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRSMKDDSKSEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the core domain of human cardiac troponin in the Ca2+-saturated form
pubmed doi rcsb
source organism Homo sapiens
molecule tags Contractile protein
molecule keywords Troponin C
total genus 50
structure length 159
sequence length 161
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1j1dA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1j1dA02
1XA5A 1J1EA 3BQ3A 2L50A 1CNPA 2ZNEA 2SASA 1J7PA 1MR8A 1S5GY 2F8PA 1YRTB 3VRQA 4ORBB 3WHUB 1RK9A 3I5GB 1FPWA 1BR4B 3LLEA 4QJ3B 4GUKA 3KF9A 1VRKA 3EK4A 2CT9A 3CGAA 3EVUA 5F6TA 1OMRA 1QIWA 1G4YR 3PATA 5ER4X 2BE6A 4DS7A 4CFQA 1XYDA 2ZNDA 3D0YB 4GPLB 3IQOA 1KK8C 1DF0B 4MRYA 3ICBA 1OE9B 1QATA 1EL4A 1WRLA 3BOWA 3CR4X 4U8DA 1TRFA 2JWWA 1TNWA 2LHIA 2H61A 3BXKA 1SCMC 2M3WA 1M45A 2MAZA 3PN7C 1Y1XA 5AERA 3OP0A 4OKHA 2KI4C 1NWDA 4C0JA 2KFHA 1AK8A 2BCAA 2E6WA 2PASA 1K96A 3OX5A 2M49B 1DJYA 2CXJA 2KYCA 2TN4A 1NCZA 1PVAA 3VROA 3K21A 1OQPA 5DKRA 1K9UA 1TCOB 2KI6D 3BUMB 2KAXA 1BG1A 1SR6C 4OCIA 3TDZA 5JOLA 1PRWA 2LVKA 1MF8B 3SG6A 1B9AA 2KAYA 3DVKA 2KGRA 4DCKA 2IS9A 3SIAA 1DJHA 3SG4A 4BY4A 3AAKA 1IGVA 5D69A 4L9MA 1MHOA 3BUWB 3EKJA 1OSAA 1KFUL 4PE4A 2M29A 4HREE 2JXLA 1RTP1 4D1EA 1BODA 1KQMB 2KBMA 2KQ6A 1EG4A 1B47A 1LINA 2JNXA 1CMFA 2HQ8A 3TS5B 5CSJA 1SR6B 1Y0VH 1BF5A 1UWOA 2LVVA 1OOJA 3KHEA 4YI9A 1H8BA 1CMGA 1DGVA 1L2OB 2LVJA 5HLOA 1QV0A 1QS7A 1ALVA 3DD4A 4A4BA 4GGFA 2LMVA 1SL8A 2OPOA 1EXRA 1IKUA 1RFJA 1ODBA 1YX7A 1XFZO 2WOSA 4QJ4B 1UUSA 2FCEA 2M1KB 2RGIA 3AKBA 1SCMB 5IBWA 1A75A 1QX2A 1UHHA 2MRDA 3FIAA 2K7CA 1IG5A 1KFXL 4DRWA 1NX2A 3BYAA 1EH2A 1A4PA 4XJKB 2JQ6A 1XFXO 2AMIA 1S6JA 1CDPA 2P6BB 3LK0A 1D1OA 2LC5A 4E68A 1J7QA 1F55A 1JUOA 1F70A 3I5HB 1U5IA 1XFVO 2QPTA 2WCBA 3I5GC 3I5IB 3LCPC 3VGOA 2ZN9A 1AJ4A 2LLUA 1PSRA 3EK7A 5JJGA 4MBEA 1CDMA 3A8RA 2LAPA 1F54A 2LP2A 3AAJA 1ZFSA 4PE1A 3SG7A 2LVIA 4N5XA 1DMOA 1PALA 1WRKA 2L5XB 2LHLA 2BE4A 1SL9A 1SBJA 2WNDA 1A03A 2WCFA 4OVNF 1EJ3A 1C7WA 2F3YA 3F45A 4ORAB 4PHJA 1WDCB 2Y1MA 3SJSA 2CBLA 1TNXA 1K95A 1N65A 2WCEA 3GK1A 1OZSA 1XFUO 2JNFA 2BCBA 4P5OE 3PFVA 1CM1A 1B4CA 1NX0A 1B8LA 1NPQA 3I5FB 3NSLA 1QIVA 1PK0D 1JSAA 1PVBA 2GV5A 1ZMZA 5AFPA 2M8UA 4MRXA 4MZKA 2L4IA 1UHIA 2NCPA 1SNLA 3SG3A 4YGCB 1KFUS 5TNCA 1RROA 1WDCC 1SL7A 2BBMA 1CFPA 3TZ1A 2F2PA 4I5JA 4M2OA 4YGAA 1IWQA 3LL8B 4ZCUA 2JZIA 2KGBC 3FS7A 1B8RA 1ZOTB 3CZTX 3D10A 4UPGA 1UHJA 3NXAA 1QVIY 2KI4B 2K61A 1B7TY 2NXQA 1M31A 2JT3A 1XO5A 1S36A 3BUNB 1KFXS 1N0YA 2LP3A 1LXFC 2PMYA 2LMTA 4PCWA 4DUQA 1JFKA 3M0WA 1LVCD 1BJFA 2OS8C 4HRHA 1CLMA 2Y4QA 1NX3A 2JU0A 1KWOC 1TTXA 4GBAA 4HSZA 4XJKA 1CKKA 2HETA 3FWBA 2JT8A 1YUSA 4PHKA 1CTRA 2Y5IA 3KEVA 1B1GA 2KBIA 3I5FC 4NDDA 2ZRTA 1A2XA 1CLLA 2B1UA 2JOJA 1QX5B 2JRFA 1SPYA 1QASA 1FI5A 1J7RA 1X02A 3SG5A 1M63B 1MUXA 1F4QA 1QLKA 1YUUA 1JFJA 1K94A 2SCPA 1IH0A 1BT6A 2EHBA 2KSPA 2NZ0A 1UP5A 4MVFA 1PULA 2ISDA 2I2RE 1F8HA 1HQVA 4MSPA 2EC6C 2LNKA 2EGDA 1UURA 1CFFA 1Y1AA 5KTYA 5K89A 4ZCVA 1AVSA 1U5IB 1V1GA 1JF2A 4GGNA 1AP4A 1K8UA 1DGUA 3PALA 4GGFC 2JXCA 2L51A 2M9GA 2PRUA 2BKIB 1QXPA 2KI6C 4YGBB 3H4SE 3I5HC 3TDIA 2LMUA 2LUCA 2NLNA 4WQ3A 3O78A 4M2QA 2HF5A 1KK8B 3C1VA 4PE0A 5I2OA 2BL0B 1YRUB 3JVTB 1FW4A 3ZWHA 1QVIZ 4GAOA 5CPVA 4IL1A 1K93D 3KO0A 5AANA 3SIBA 4YGEB 2H2KA 1DJXA 1K9KA 2H61C 5DKNA 3DVEA 4YRUA 3QRXA 2FOTA 3CR5X 4ORCB 5KSZA 2I94A 5CSNA 1AJ5A 3NSKA 5CSFA 4JPZB 2KYFA 3NSIA 1OZOA 3WHTB 3DVMA 1NSHA 2KHNA 4NDCA 4MZJA 3PLFB 1AHRA 2LV7A 5HKYA 1G33A 2F3ZA 2WC8A 1DTLA 1S5GZ 4YBHB 1KK7Y 2ZKMX 2PSRA 3DVJA 4FTGA 1QTXA 4CFRA 3JTDB 5I2LA 2JULA 2JTTA 2L98A 1RECA 3PN7B 1FBVA 3IQQA 3CS1A 4N1FA 2ZFDA 4AQJA 4N1GA 1YR5A 4F0ZB 2BECA 1YX8A 3BUOB 2K2AA 3HCMA 1NCYA 2BKHB 3O6BA 5FYXA 4PDZA 1KQVA 1Y6WA 3OB1B 1BOCA 2D8NA 2K0JA 4R1EA 2MBXA 1WRZA 5HLVA 2KNEA 4I5NB 3OHMB 4FQOA 2M7LA 1R6PA 4C0KA 2K8MB 5D7FA 1DVIA 1A75B 1IQ5A 1L2OC 1S3PA 1DJWA 4WRIA 2L2EA 5BPJA 1NP8A 3RLZA 1CM4A 5CSIA 4Q04A 1IJ6A 3TS5C 1QJTA 1SK6D 3CR2A 3O2PA 1XK4A 4OR9B 3CTNA 1MXEA 2Q91A 1QLSA 2MLFC 1J1DA 2AAOA 3RM1A 3JTDC 5I8NA 1MQ1A 1CB1A 1W7JB 3I5IC 1QV1A 1KQMC 1S6CA 1M39A 2QACA 4AOMA 3TUYC 1KCYA 1CDLA 1SYMA 2LANA 5I2QA 1OMDA 1SCVA 2OTGC 4M2PA 1B8CA 3PM8A 1TIZA 1FF1A 2CNPA 1SMGA 1R2UA 3EVVA 2KDHA 1Q80A 2FCDA 2HQWA 1PSBA 5HKWA 1J7OA 1NCXA 5G08A 4A4CA 3EK8A 3NSOA 1S26D 2I7AA 2LLTA 4P2YB 4PALA 1YVLA 1SY9A 3TDUA 1A29A 5B8IB 2E30A 2KFGA 2R2IA 1CFDA 1SW8A 1TNQA 2FJUB 3JVTC 3BOWB 3EKHA 2MHHA 2KFFA 3OB2B 1YURA 2F33A 5J3XA 2L4HA 4USLA 4GFTA 1WLZA 1OMVA 1B7TZ 2OS8B 1N2DA 1F71A 1FI6A 1K9PA 1DJGA 2MA2A 1CDNA 1TCFA 2MLEC 2JC2A 1GGWA 4C0LA 1S6IA 2COLB 3GK4X 1TNPA 1XFWO 1CFCA 3MSEB 1QX7A 2O60A 4PHNA 5HYDA 1RJVA 3HX4A 3VRNA 1LA3A 1LKJA 1KSOA 3ZNIA 2Q4UA 1AUIB 4TNCA 3SG2A 4QJ5B 4MN0A 4AQIA 3A4UB 1EG3A 1MXLC 1UHNA 1NX1A 4CPVA 3GOFA 2A4JA 4HRGA 1JF0A 3GK2A 1NYAA 1W7IB 2LE9B 2LLSA 1BLQA 1IRJA 3OX6A 2KQYA 1RWYA 1L7ZA 5AEQA 1JWDA 2CCMA 1CLBA 4ETOA 1UHKA 4BY5A 1C7VA 4NQGA 3AKAA 1IQ3A 1K2HA 3WXAA 4NDBA 1M46A 2BL0C 3D0YA 2JTZA 1KWOB 1XFYO 2LUXA 2M97A 2G9BA 1KK7Z 2M7NA 1G8IA 3VRPA 1J55A 1Y1UA 2M0RA 1JBAA 2K7OA 4PE7A 1YTZC 2Y1NA 1XVJA 1TOPA 2BBNA 2CTNA 3FWCA 1H4BA 5KU1A 1YUTA 1NUBA 2PVBA 2VRGA 4ICBA 4PHMA 5DKQA 2M1UA 2WORA 1DT7B 1IJ5A 1MWNA 5HKZA 1GQMA 3IF7A 2NCOA 4DIRA 3EVRA 1E8AA 4MLWA 1BMOA 1SKTA 4GNKB 3E3RA 3O4YA 2O5GA 1S1EA 1ZUZA 2BCXA 2PALA 4CIDA 4MEWA 3WNXB 1V1FA 2OTGB 2K7DA 4XYNA 3KPXA 2KOTA 1BU3A 2LM5A 1K90D 1GGZA 1HT9A 2L0PA 2GGZA 1DJZA 1ALWA 3TUYB 1JC2A 1F4OA 2ZN8A 5ER5A 2AUCA 4JQ0D 1KSMA 4MZLA 2HPSA 4OV2A 4WQ2A 2V53A 4YI8A 2K7BA 1NIWA 2DOQA 2JT0A 3LK1A 4JWQA 4YGDB 4CLNA 1GJYA 1TN4A 1ZACA 4I5LB 2MJWB 3CWGA 1BR1B 3DF0B 2KAVA 2K2FA 3DF0A 2EC6B 2G2BA 3PSRA 1XK4C 1DJIA 3VRRA 2F2OA 1SRAA 3CLNA 2JPTA 2ZRSA 2LCPA 1DF0A 1WY9A 3BUXB 5GQQC 1C07A 5AXIA 2GGMA 2I18A 4I5KA 5PALA 1LA0A 1YVHA 1WLMA
chains in the Genus database with same CATH superfamily
1XA5A 1J1EA 3BQ3A 2L50A 1CNPA 2ZNEA 2SASA 3L4AA 1J7PA 1MR8A 1S5GY 2F8PA 1YRTB 3QMEA 3VRQA 4ORBB 3WHUB 1RK9A 3I5GB 1FPWA 1BR4B 3LLEA 1DELA 4QJ3B 4GUKA 3KF9A 1VRKA 3EK4A 2CT9A 3CGAA 3EVUA 5F6TA 1OMRA 1QIWA 1G4YR 3PATA 5ER4X 2BE6A 4DS7A 4CFQA 1XYDA 1Z4HA 2ZNDA 3D0YB 4GPLB 3IQOA 1KK8C 1DF0B 4MRYA 3ICBA 1OE9B 1QATA 3EG5B 1EL4A 1WRLA 1DC1A 3BOWA 3CR4X 4U8DA 1TRFA 2JWWA 1TNWA 2LHIA 2H61A 3BXKA 1SCMC 2M3WA 1M45A 2MAZA 3PN7C 1Y1XA 5AERA 3N7HA 3OP0A 4OKHA 3FE6A 2KI4C 3UO9A 1NWDA 4C0JA 2KFHA 1AK8A 2BCAA 2E6WA 1QWVA 2PASA 1K96A 3OX5A 2M49B 1DJYA 2CXJA 2KYCA 2TN4A 1NCZA 1PVAA 3K1EA 3VROA 1GM0A 3K21A 1OQPA 1ORGA 5DKRA 1K9UA 1TCOB 2KI6D 3BUMB 2KAXA 1BG1A 1SR6C 4OCIA 3TDZA 5JOLA 1C3YA 2PQLA 1PRWA 2LVKA 1MF8B 3B88A 3SG6A 1B9AA 2KAYA 3DVKA 2KGRA 4JKTA 2IS9A 3SIAA 1DJHA 3SG4A 4BY4A 3AAKA 4DCKA 1IGVA 4PT1A 5D69A 4L9MA 1MHOA 3BUWB 3DY9A 3EKJA 1OSAA 1KFUL 4PE4A 2M29A 4HREE 2JXLA 1RTP1 3PM2A 4D1EA 1BODA 1KQMB 2KBMA 2KQ6A 1EG4A 1B47A 1LINA 2JNXA 1CMFA 2HQ8A 3TS5B 5CSJA 1SR6B 1Y0VH 2WCKA 1BF5A 1UWOA 2LVVA 1OOJA 3KHEA 4YI9A 1H8BA 1CMGA 1DGVA 1L2OB 2LVJA 5HLOA 1QV0A 1QS7A 1ALVA 3D74A 3DD4A 4A4BA 4GGFA 2LMVA 3L47A 1SL8A 2OPOA 3NGVA 1EXRA 1IKUA 1RFJA 1ODBA 1YX7A 3DYEA 2QEOA 1XFZO 2WOSA 4QJ4B 1UUSA 3OGNA 2FCEA 2M1KB 2RGIA 3AKBA 1SCMB 2JPOA 3CDNA 4INWA 5IBWA 1A75A 3B86A 1QX2A 1UHHA 2MRDA 3FIAA 2K7CA 1IG5A 1KFXL 4DRWA 1NX2A 3BYAA 1EH2A 1A4PA 4XJKB 2JQ6A 1XFXO 2AMIA 1S6JA 3DXLA 1CDPA 2P6BB 3LK0A 1D1OA 2LC5A 4E68A 1J7QA 1F55A 1JUOA 1F70A 3I5HB 1U5IA 1XFVO 2QPTA 2WCBA 3I5GC 3I5IB 3D78A 3LCPC 3R1OA 3D73A 3VGOA 2ZN9A 1AJ4A 2LLUA 1PSRA 2WC5A 3EK7A 5JJGA 4MBEA 1Z2CB 1CDMA 2P70A 2LAPA 3A8RA 1F54A 2LP2A 3AAJA 2KLDA 3S0GA 1ZFSA 4PE1A 3SG7A 2LVIA 4N5XA 1DMOA 1PALA 1WRKA 2L5XB 2LHLA 3CZ1A 2BE4A 1SL9A 1SBJA 2WNDA 1A03A 3SS3A 2WCFA 3L4LA 4OVNF 5FI6A 2WCJA 1EJ3A 1C7WA 2F3YA 3F45A 4ORAB 4PHJA 1WDCB 2Y1MA 3SJSA 2CBLA 1TNXA 1K95A 1N65A 2WCEA 3GK1A 1OZSA 1XFUO 2JNFA 2BCBA 4P5OE 3PFVA 1CM1A 1B4CA 1NX0A 1W9ZA 1B8LA 1NPQA 3I5FB 3BJHA 2WCLA 1QIVA 1PK0D 3NSLA 1JSAA 1PVBA 2GV5A 1ZMZA 3VB1A 5AFPA 2M8UA 2FJYA 4MRXA 4MZKA 2L4IA 1UHIA 2NCPA 1SNLA 3SG3A 3FE9A 4YGCB 1KFUS 5TNCA 5FI2A 3SS4A 1RROA 2P71A 1WDCC 1SL7A 2BBMA 1CFPA 3TZ1A 2F2PA 4I5JA 4M2OA 3RZSA 4YGAA 1IWQA 3LL8B 4ZCUA 2JZIA 2KGBC 3FS7A 1B8RA 1ZOTB 3CZTX 3D10A 4UPGA 1UHJA 3NXAA 1QVIY 2KI4B 2K61A 1B7TY 1OOGA 2NXQA 1M31A 2JT3A 1XO5A 1DEKA 3B87A 2GTEA 1S36A 3BUNB 1KFXS 1N0YA 2LP3A 1LXFC 2PMYA 4KYNA 2LMTA 4PCWA 4DUQA 1JFKA 3CYZA 3M0WA 1LVCD 1BJFA 2OS8C 4HRHA 1CLMA 2Y4QA 1NX3A 2JU0A 1KWOC 1TTXA 4GBAA 4HSZA 4XJKA 1CKKA 2HETA 3FWBA 2JT8A 1YUSA 4PHKA 1CTRA 2Y5IA 3KEVA 1B1GA 2KBIA 3I5FC 4NDDA 2ZRTA 1A2XA 1CLLA 2B1UA 2JOJA 1QX5B 2JRFA 1SPYA 1QASA 1FI5A 1J7RA 1X02A 3NHTA 3SG5A 1M63B 1MUXA 1F4QA 1QLKA 1YUUA 1JFJA 1K94A 2SCPA 1IH0A 1BT6A 2EHBA 2KSPA 3CZ0A 4F7FA 2NZ0A 1UP5A 4MVFA 1PULA 2ISDA 2I2RE 1F8HA 1HQVA 1OOFA 4MSPA 2EC6C 2LNKA 2EGDA 1UURA 3CZ2A 1CFFA 2YGUA 1Y1AA 5KTYA 3S0AA 5K89A 4ZCVA 1AVSA 1U5IB 1V1GA 3SS5A 1JF2A 4GGNA 1AP4A 1K8UA 1DGUA 2QEVA 3PALA 4GGFC 2JXCA 2L51A 2M9GA 2BAPA 2PRUA 2BKIB 1QXPA 3D76A 2KI6C 4YGBB 3H4SE 3I5HC 3TDIA 1T14A 2LMUA 2LUCA 2WCHA 2NLNA 4WQ3A 3O78A 4M2QA 2HF5A 1KK8B 3C1VA 4PE0A 5I2OA 2BL0B 2K60A 1YRUB 2ERBA 1FW4A 3JVTB 1QVIZ 5FI7A 4GAOA 5DICA 5CPVA 3S0DA 3ZWHA 4IL1A 1K93D 3KO0A 5AANA 3S0FA 3SIBA 4YGEB 2H2KA 1DJXA 1K9KA 2H61C 5DKNA 3DVEA 4YRUA 3QRXA 2FOTA 3CR5X 4ORCB 5KSZA 2I94A 5CSNA 1AJ5A 3NSKA 5CSFA 4JPZB 2KYFA 3D75A 3NSIA 1OZOA 3WHTB 3DVMA 1NSHA 2KHNA 4NDCA 4MZJA 3PLFB 1AHRA 2LV7A 5HKYA 1G33A 2F3ZA 2WC8A 4JD9A 1DTLA 2PYQA 1S5GZ 4YBHB 1KK7Y 2ZKMX 2PSRA 3DVJA 4FTGA 1QTXA 1IIOA 4CFRA 3V2LA 3JTDB 5I2LA 2JULA 2JTTA 2L98A 1RECA 3PN7B 1FBVA 3IQQA 3CS1A 4N1FA 2ZFDA 1XFRA 4AQJA 4N1GA 1YR5A 4F0ZB 2BECA 1YX8A 3DZTA 3BUOB 3D77A 1TUZA 2K2AA 2BNXA 3HCMA 2KPHA 4OZDA 1NCYA 2BKHB 2KLEA 3O6BA 5FYXA 4PDZA 1KQVA 1Y6WA 3OB1B 1BOCA 3B7AA 2D8NA 2K0JA 4R1EA 2MBXA 1WRZA 5HLVA 2KNEA 4IJ7A 4I5NB 3OHMB 4FQOA 2M7LA 1R6PA 4C0KA 2K8MB 5D7FA 1DVIA 2QEHA 1A75B 1IQ5A 1L2OC 1S3PA 1DJWA 4WRIA 1OOIX 2L2EA 5BPJA 1NP8A 2H8VA 3RLZA 1CM4A 5CSIA 3PJIA 4Q04A 3R72A 1IJ6A 3TS5C 1QJTA 1SK6D 3CR2A 3O2PA 1XK4A 4OR9B 3BFBA 1TWOA 3CTNA 1MXEA 2Q91A 1QLSA 2MLFC 1J1DA 2AAOA 3RM1A 3JTDC 5I8NA 1MQ1A 1CB1A 1W7JB 3I5IC 1QV1A 1KQMC 1S6CA 3BFHA 1M39A 2QACA 4AOMA 3TUYC 1KCYA 1CDLA 1SYMA 2LANA 5I2QA 1OMDA 1SCVA 2OTGC 3OBVA 4M2PA 1B8CA 3PM8A 1TIZA 3S0BA 1FF1A 2CNPA 1SMGA 3R1PA 1R2UA 3EVVA 2KDHA 1Q80A 2FCDA 1TUJA 2HQWA 1PSBA 5HKWA 1J7OA 1NCXA 5G08A 4A4CA 3EK8A 3NSOA 1S26D 2I7AA 2LLTA 4P2YB 4PALA 1YVLA 1SY9A 3TDUA 1A29A 5B8IB 2E30A 3IVTA 2KFGA 2QEBA 2R2IA 1CFDA 1SW8A 1TNQA 2FJUB 3JVTC 3BOWB 5D3OA 3EKHA 2MHHA 2KFFA 3OB2B 1YURA 2F33A 3R1VA 2L4HA 3FE8A 4USLA 5J3XA 4GFTA 1WLZA 1OMVA 1B7TZ 2OS8B 5EL2A 5I94A 1N2DA 1F71A 1FI6A 1K9PA 1DJGA 2MA2A 1CDNA 1TCFA 2MLEC 2JC2A 1GGWA 4C0LA 1S6IA 2COLB 3GK4X 1TNPA 1XFWO 1CFCA 3MSEB 1QX7A 2O60A 4PHNA 5HYDA 1RJVA 3HX4A 3VRNA 1LA3A 1P28A 1LKJA 1KSOA 3ZNIA 3CABA 2Q4UA 1AUIB 4TNCA 3SG2A 4QJ5B 2L2CA 4MN0A 1OOHA 3A4UB 4AQIA 1EG3A 1MXLC 1OW4A 1UHNA 1NX1A 4CPVA 3GOFA 2A4JA 3NHIA 4HRGA 1JF0A 3GK2A 1NYAA 1W7IB 2LE9B 2LLSA 1BLQA 1IRJA 3OX6A 1DQEA 2KQYA 1RWYA 1L7ZA 5AEQA 1JWDA 1LS8A 2CCMA 4ETOA 1UHKA 4BY5A 5HL1A 1C7VA 4NQGA 1CLBA 3AKAA 3BFAA 1IQ3A 1K2HA 3WXAA 4NDBA 1M46A 2BL0C 3D0YA 2JTZA 1KWOB 1XFYO 2LUXA 2M97A 2G9BA 4INXA 1KK7Z 2M7NA 1G8IA 3VRPA 1J55A 1Y1UA 3S0EA 2M0RA 1JBAA 2K7OA 4PE7A 3B6XA 1YTZC 2Y1NA 1XVJA 1TOPA 2BBNA 2CTNA 3FWCA 1H4BA 5KU1A 1YUTA 1NUBA 2PVBA 2VRGA 4ICBA 4PHMA 2WCMA 5DKQA 2M1UA 2WORA 1DT7B 1IJ5A 2QDIA 1MWNA 1C3ZA 1SSEB 5HKZA 1GQMA 3IF7A 2NCOA 4DIRA 3EVRA 1E8AA 4MLWA 1BMOA 1SKTA 4GNKB 3E3RA 3O4YA 2O5GA 1S1EA 1ZUZA 2BCXA 2PALA 3Q8IA 4CIDA 3UNWA 4MEWA 3WNXB 1V1FA 2OTGB 2K7DA 4XYNA 3KPXA 2KOTA 1BU3A 2LM5A 1K90D 1GGZA 1HT9A 2L0PA 1DJZA 2GGZA 1ALWA 3TUYB 1JC2A 1F4OA 2L5YA 2ZN8A 5ER5A 2AUCA 4JQ0D 1KSMA 4MZLA 2HPSA 4FQTA 4OV2A 2V53A 4WQ2A 4YI8A 2K7BA 1NIWA 2DOQA 2JT0A 3LK1A 2WC6A 4JWQA 4YGDB 4CLNA 1GJYA 1TN4A 1ZACA 4I5LB 2MJWB 3CWGA 1BR1B 3DF0B 2KAVA 2K2FA 3DF0A 2EC6B 2G2BA 3PSRA 1XK4C 1DJIA 3VRRA 2F2OA 1SRAA 3CLNA 2JPTA 2ZRSA 2LCPA 1DF0A 1WY9A 3BUXB 5GQQC 1C07A 5AXIA 2GGMA 2I18A 4I5KA 5PALA 1LA0A 3O4XA 1YVHA 1WLMA
chains in the Genus database with same CATH topology
1XA5A 1J1EA 3BQ3A 2L50A 1CNPA 2ZNEA 2SASA 1J7PA 1MR8A 1S5GY 2F8PA 1YRTB 3VRQA 4ORBB 3WHUB 1RK9A 3I5GB 1FPWA 1BR4B 3LLEA 4QJ3B 4GUKA 3KF9A 1VRKA 3EK4A 2CT9A 3CGAA 3EVUA 5F6TA 1OMRA 1QIWA 1G4YR 3PATA 5ER4X 2BE6A 4DS7A 4CFQA 1XYDA 2ZNDA 3D0YB 4GPLB 3IQOA 1KK8C 1DF0B 4MRYA 3ICBA 1OE9B 1QATA 1EL4A 1WRLA 3BOWA 3CR4X 4U8DA 1TRFA 2JWWA 1TNWA 2LHIA 2H61A 3BXKA 1SCMC 2M3WA 1M45A 2MAZA 3PN7C 1Y1XA 5AERA 3OP0A 4OKHA 2KI4C 1NWDA 4C0JA 2KFHA 1AK8A 2BCAA 2E6WA 2PASA 1K96A 3OX5A 2M49B 1DJYA 2CXJA 2KYCA 2TN4A 1NCZA 1PVAA 3VROA 3K21A 1OQPA 5DKRA 1K9UA 1TCOB 2KI6D 3BUMB 2KAXA 1BG1A 1SR6C 4OCIA 3TDZA 5JOLA 1PRWA 2LVKA 1MF8B 3SG6A 1B9AA 2KAYA 3DVKA 2KGRA 4DCKA 2IS9A 3SIAA 1DJHA 3SG4A 4BY4A 3AAKA 1IGVA 5D69A 4L9MA 1MHOA 3BUWB 3EKJA 1OSAA 1KFUL 4PE4A 2M29A 4HREE 2JXLA 1RTP1 4D1EA 1BODA 1KQMB 2KBMA 2KQ6A 1EG4A 1B47A 1LINA 2JNXA 1CMFA 2HQ8A 3TS5B 5CSJA 1SR6B 1Y0VH 1BF5A 1UWOA 2LVVA 1OOJA 3KHEA 4YI9A 1H8BA 1CMGA 1DGVA 1L2OB 2LVJA 5HLOA 1QV0A 1QS7A 1ALVA 3DD4A 4A4BA 4GGFA 2LMVA 1SL8A 2OPOA 1EXRA 1IKUA 1RFJA 1ODBA 1YX7A 1XFZO 2WOSA 4QJ4B 1UUSA 2FCEA 2M1KB 2RGIA 3AKBA 1SCMB 5IBWA 1A75A 1QX2A 1UHHA 2MRDA 3FIAA 2K7CA 1IG5A 1KFXL 4DRWA 1NX2A 3BYAA 1EH2A 1A4PA 4XJKB 2JQ6A 1XFXO 2AMIA 1S6JA 1CDPA 2P6BB 3LK0A 1D1OA 2LC5A 4E68A 1J7QA 1F55A 1JUOA 1F70A 3I5HB 1U5IA 1XFVO 2QPTA 2WCBA 3I5GC 3I5IB 3LCPC 3VGOA 2ZN9A 1AJ4A 2LLUA 1PSRA 3EK7A 5JJGA 4MBEA 1CDMA 3A8RA 2LAPA 1F54A 2LP2A 3AAJA 1ZFSA 4PE1A 3SG7A 2LVIA 4N5XA 1DMOA 1PALA 1WRKA 2L5XB 2LHLA 2BE4A 1SL9A 1SBJA 2WNDA 1A03A 2WCFA 4OVNF 1EJ3A 1C7WA 2F3YA 3F45A 4ORAB 4PHJA 1WDCB 2Y1MA 3SJSA 2CBLA 1TNXA 1K95A 1N65A 2WCEA 3GK1A 1OZSA 1XFUO 2JNFA 2BCBA 4P5OE 3PFVA 1CM1A 1B4CA 1NX0A 1B8LA 1NPQA 3I5FB 3NSLA 1QIVA 1PK0D 1JSAA 1PVBA 2GV5A 1ZMZA 5AFPA 2M8UA 4MRXA 4MZKA 2L4IA 1UHIA 2NCPA 1SNLA 3SG3A 4YGCB 1KFUS 5TNCA 1RROA 1WDCC 1SL7A 2BBMA 1CFPA 3TZ1A 2F2PA 4I5JA 4M2OA 4YGAA 1IWQA 3LL8B 4ZCUA 2JZIA 2KGBC 3FS7A 1B8RA 1ZOTB 3CZTX 3D10A 4UPGA 1UHJA 3NXAA 1QVIY 2KI4B 2K61A 1B7TY 2NXQA 1M31A 2JT3A 1XO5A 1S36A 3BUNB 1KFXS 1N0YA 2LP3A 1LXFC 2PMYA 2LMTA 4PCWA 4DUQA 1JFKA 3M0WA 1LVCD 1BJFA 2OS8C 4HRHA 1CLMA 2Y4QA 1NX3A 2JU0A 1KWOC 1TTXA 4GBAA 4HSZA 4XJKA 1CKKA 2HETA 3FWBA 2JT8A 1YUSA 4PHKA 1CTRA 2Y5IA 3KEVA 1B1GA 2KBIA 3I5FC 4NDDA 2ZRTA 1A2XA 1CLLA 2B1UA 2JOJA 1QX5B 2JRFA 1SPYA 1QASA 1FI5A 1J7RA 1X02A 3SG5A 1M63B 1MUXA 1F4QA 1QLKA 1YUUA 1JFJA 1K94A 2SCPA 1IH0A 1BT6A 2EHBA 2KSPA 2NZ0A 1UP5A 4MVFA 1PULA 2ISDA 2I2RE 1F8HA 1HQVA 4MSPA 2EC6C 2LNKA 2EGDA 1UURA 1CFFA 1Y1AA 5KTYA 5K89A 4ZCVA 1AVSA 1U5IB 1V1GA 1JF2A 4GGNA 1AP4A 1K8UA 1DGUA 3PALA 4GGFC 2JXCA 2L51A 2M9GA 2PRUA 2BKIB 1QXPA 2KI6C 4YGBB 3H4SE 3I5HC 3TDIA 2LMUA 2LUCA 2NLNA 4WQ3A 3O78A 4M2QA 2HF5A 1KK8B 3C1VA 4PE0A 5I2OA 2BL0B 1YRUB 3JVTB 1FW4A 3ZWHA 1QVIZ 4GAOA 5CPVA 4IL1A 1K93D 3KO0A 5AANA 3SIBA 4YGEB 2H2KA 1DJXA 1K9KA 2H61C 5DKNA 3DVEA 4YRUA 3QRXA 2FOTA 3CR5X 4ORCB 5KSZA 2I94A 5CSNA 1AJ5A 3NSKA 5CSFA 4JPZB 2KYFA 3NSIA 1OZOA 3WHTB 3DVMA 1NSHA 2KHNA 4NDCA 4MZJA 3PLFB 1AHRA 2LV7A 5HKYA 1G33A 2F3ZA 2WC8A 1DTLA 1S5GZ 4YBHB 1KK7Y 2ZKMX 2PSRA 3DVJA 4FTGA 1QTXA 4CFRA 3JTDB 5I2LA 2JULA 2JTTA 2L98A 1RECA 3PN7B 1FBVA 3IQQA 3CS1A 4N1FA 2ZFDA 4AQJA 4N1GA 1YR5A 4F0ZB 2BECA 1YX8A 3BUOB 2K2AA 3HCMA 1NCYA 2BKHB 3O6BA 5FYXA 4PDZA 1KQVA 1Y6WA 3OB1B 1BOCA 2D8NA 2K0JA 4R1EA 2MBXA 1WRZA 5HLVA 2KNEA 4I5NB 3OHMB 4FQOA 2M7LA 1R6PA 4C0KA 2K8MB 5D7FA 1DVIA 1A75B 1IQ5A 1L2OC 1S3PA 1DJWA 4WRIA 2L2EA 5BPJA 1NP8A 3RLZA 1CM4A 5CSIA 4Q04A 1IJ6A 3TS5C 1QJTA 1SK6D 3CR2A 3O2PA 1XK4A 4OR9B 3CTNA 1MXEA 2Q91A 1QLSA 2MLFC 1J1DA 2AAOA 3RM1A 3JTDC 5I8NA 1MQ1A 1CB1A 1W7JB 3I5IC 1QV1A 1KQMC 1S6CA 1M39A 2QACA 4AOMA 3TUYC 1KCYA 1CDLA 1SYMA 2LANA 5I2QA 1OMDA 1SCVA 2OTGC 4M2PA 1B8CA 3PM8A 1TIZA 1FF1A 2CNPA 1SMGA 1R2UA 3EVVA 2KDHA 1Q80A 2FCDA 2HQWA 1PSBA 5HKWA 1J7OA 1NCXA 5G08A 4A4CA 3EK8A 3NSOA 1S26D 2I7AA 2LLTA 4P2YB 4PALA 1YVLA 1SY9A 3TDUA 1A29A 5B8IB 2E30A 2KFGA 2R2IA 1CFDA 1SW8A 1TNQA 2FJUB 3JVTC 3BOWB 3EKHA 2MHHA 2KFFA 3OB2B 1YURA 2F33A 5J3XA 2L4HA 4USLA 4GFTA 1WLZA 1OMVA 1B7TZ 2OS8B 1N2DA 1F71A 1FI6A 1K9PA 1DJGA 2MA2A 1CDNA 1TCFA 2MLEC 2JC2A 1GGWA 4C0LA 1S6IA 2COLB 3GK4X 1TNPA 1XFWO 1CFCA 3MSEB 1QX7A 2O60A 4PHNA 5HYDA 1RJVA 3HX4A 3VRNA 1LA3A 1LKJA 1KSOA 3ZNIA 2Q4UA 1AUIB 4TNCA 3SG2A 4QJ5B 4MN0A 4AQIA 3A4UB 1EG3A 1MXLC 1UHNA 1NX1A 4CPVA 3GOFA 2A4JA 4HRGA 1JF0A 3GK2A 1NYAA 1W7IB 2LE9B 2LLSA 1BLQA 1IRJA 3OX6A 2KQYA 1RWYA 1L7ZA 5AEQA 1JWDA 2CCMA 1CLBA 4ETOA 1UHKA 4BY5A 1C7VA 4NQGA 3AKAA 1IQ3A 1K2HA 3WXAA 4NDBA 1M46A 2BL0C 3D0YA 2JTZA 1KWOB 1XFYO 2LUXA 2M97A 2G9BA 1KK7Z 2M7NA 1G8IA 3VRPA 1J55A 1Y1UA 2M0RA 1JBAA 2K7OA 4PE7A 1YTZC 2Y1NA 1XVJA 1TOPA 2BBNA 2CTNA 3FWCA 1H4BA 5KU1A 1YUTA 1NUBA 2PVBA 2VRGA 4ICBA 4PHMA 5DKQA 2M1UA 2WORA 1DT7B 1IJ5A 1MWNA 5HKZA 1GQMA 3IF7A 2NCOA 4DIRA 3EVRA 1E8AA 4MLWA 1BMOA 1SKTA 4GNKB 3E3RA 3O4YA 2O5GA 1S1EA 1ZUZA 2BCXA 2PALA 4CIDA 4MEWA 3WNXB 1V1FA 2OTGB 2K7DA 4XYNA 3KPXA 2KOTA 1BU3A 2LM5A 1K90D 1GGZA 1HT9A 2L0PA 2GGZA 1DJZA 1ALWA 3TUYB 1JC2A 1F4OA 2ZN8A 5ER5A 2AUCA 4JQ0D 1KSMA 4MZLA 2HPSA 4OV2A 4WQ2A 2V53A 4YI8A 2K7BA 1NIWA 2DOQA 2JT0A 3LK1A 4JWQA 4YGDB 4CLNA 1GJYA 1TN4A 1ZACA 4I5LB 2MJWB 3CWGA 1BR1B 3DF0B 2KAVA 2K2FA 3DF0A 2EC6B 2G2BA 3PSRA 1XK4C 1DJIA 3VRRA 2F2OA 1SRAA 3CLNA 2JPTA 2ZRSA 2LCPA 1DF0A 1WY9A 3BUXB 5GQQC 1C07A 5AXIA 2GGMA 2I18A 4I5KA 5PALA 1LA0A 1YVHA 1WLMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XA5 A;  1J1E A;  3BQ3 A;  2L50 A;  1CNP A;  2ZNE A;  2SAS A;  1J7P A;  1MR8 A;  1S5G Y;  2F8P A;  1YRT B;  3VRQ A;  4ORB B;  3WHU B;  1RK9 A;  3I5G B;  1FPW A;  1BR4 B;  3LLE A;  4QJ3 B;  4GUK A;  3KF9 A;  1VRK A;  3EK4 A;  2CT9 A;  3CGA A;  3EVU A;  5F6T A;  1OMR A;  1QIW A;  1G4Y R;  3PAT A;  5ER4 X;  2BE6 A;  4DS7 A;  4CFQ A;  1XYD A;  2ZND A;  3D0Y B;  4GPL B;  3IQO A;  1KK8 C;  1DF0 B;  4MRY A;  3ICB A;  1OE9 B;  1QAT A;  1EL4 A;  1WRL A;  3BOW A;  3CR4 X;  4U8D A;  1TRF A;  2JWW A;  1TNW A;  2LHI A;  2H61 A;  3BXK A;  1SCM C;  2M3W A;  1M45 A;  2MAZ A;  3PN7 C;  1Y1X A;  5AER A;  3OP0 A;  4OKH A;  2KI4 C;  1NWD A;  4C0J A;  2KFH A;  1AK8 A;  2BCA A;  2E6W A;  2PAS A;  1K96 A;  3OX5 A;  2M49 B;  1DJY A;  2CXJ A;  2KYC A;  2TN4 A;  1NCZ A;  1PVA A;  3VRO A;  3K21 A;  1OQP A;  5DKR A;  1K9U A;  1TCO B;  2KI6 D;  3BUM B;  2KAX A;  1BG1 A;  1SR6 C;  4OCI A;  3TDZ A;  5JOL A;  1PRW A;  2LVK A;  1MF8 B;  3SG6 A;  1B9A A;  2KAY A;  3DVK A;  2KGR A;  4DCK A;  2IS9 A;  3SIA A;  1DJH A;  3SG4 A;  4BY4 A;  3AAK A;  1IGV A;  5D69 A;  4L9M A;  1MHO A;  3BUW B;  3EKJ A;  1OSA A;  1KFU L;  4PE4 A;  2M29 A;  4HRE E;  2JXL A;  1RTP 1;  4D1E A;  1BOD A;  1KQM B;  2KBM A;  2KQ6 A;  1EG4 A;  1B47 A;  1LIN A;  2JNX A;  1CMF A;  2HQ8 A;  3TS5 B;  5CSJ A;  1SR6 B;  1Y0V H;  1BF5 A;  1UWO A;  2LVV A;  1OOJ A;  3KHE A;  4YI9 A;  1H8B A;  1CMG A;  1DGV A;  1L2O B;  2LVJ A;  5HLO A;  1QV0 A;  1QS7 A;  1ALV A;  3DD4 A;  4A4B A;  4GGF A;  2LMV A;  1SL8 A;  2OPO A;  1EXR A;  1IKU A;  1RFJ A;  1ODB A;  1YX7 A;  1XFZ O;  2WOS A;  4QJ4 B;  1UUS A;  2FCE A;  2M1K B;  2RGI A;  3AKB A;  1SCM B;  5IBW A;  1A75 A;  1QX2 A;  1UHH A;  2MRD A;  3FIA A;  2K7C A;  1IG5 A;  1KFX L;  4DRW A;  1NX2 A;  3BYA A;  1EH2 A;  1A4P A;  4XJK B;  2JQ6 A;  1XFX O;  2AMI A;  1S6J A;  1CDP A;  2P6B B;  3LK0 A;  1D1O A;  2LC5 A;  4E68 A;  1J7Q A;  1F55 A;  1JUO A;  1F70 A;  3I5H B;  1U5I A;  1XFV O;  2QPT A;  2WCB A;  3I5G C;  3I5I B;  3LCP C;  3VGO A;  2ZN9 A;  1AJ4 A;  2LLU A;  1PSR A;  3EK7 A;  5JJG A;  4MBE A;  1CDM A;  3A8R A;  2LAP A;  1F54 A;  2LP2 A;  3AAJ A;  1ZFS A;  4PE1 A;  3SG7 A;  2LVI A;  4N5X A;  1DMO A;  1PAL A;  1WRK A;  2L5X B;  2LHL A;  2BE4 A;  1SL9 A;  1SBJ A;  2WND A;  1A03 A;  2WCF A;  4OVN F;  1EJ3 A;  1C7W A;  2F3Y A;  3F45 A;  4ORA B;  4PHJ A;  1WDC B;  2Y1M A;  3SJS A;  2CBL A;  1TNX A;  1K95 A;  1N65 A;  2WCE A;  3GK1 A;  1OZS A;  1XFU O;  2JNF A;  2BCB A;  4P5O E;  3PFV A;  1CM1 A;  1B4C A;  1NX0 A;  1B8L A;  1NPQ A;  3I5F B;  3NSL A;  1QIV A;  1PK0 D;  1JSA A;  1PVB A;  2GV5 A;  1ZMZ A;  5AFP A;  2M8U A;  4MRX A;  4MZK A;  2L4I A;  1UHI A;  2NCP A;  1SNL A;  3SG3 A;  4YGC B;  1KFU S;  5TNC A;  1RRO A;  1WDC C;  1SL7 A;  2BBM A;  1CFP A;  3TZ1 A;  2F2P A;  4I5J A;  4M2O A;  4YGA A;  1IWQ A;  3LL8 B;  4ZCU A;  2JZI A;  2KGB C;  3FS7 A;  1B8R A;  1ZOT B;  3CZT X;  3D10 A;  4UPG A;  1UHJ A;  3NXA A;  1QVI Y;  2KI4 B;  2K61 A;  1B7T Y;  2NXQ A;  1M31 A;  2JT3 A;  1XO5 A;  1S36 A;  3BUN B;  1KFX S;  1N0Y A;  2LP3 A;  1LXF C;  2PMY A;  2LMT A;  4PCW A;  4DUQ A;  1JFK A;  3M0W A;  1LVC D;  1BJF A;  2OS8 C;  4HRH A;  1CLM A;  2Y4Q A;  1NX3 A;  2JU0 A;  1KWO C;  1TTX A;  4GBA A;  4HSZ A;  4XJK A;  1CKK A;  2HET A;  3FWB A;  2JT8 A;  1YUS A;  4PHK A;  1CTR A;  2Y5I A;  3KEV A;  1B1G A;  2KBI A;  3I5F C;  4NDD A;  2ZRT A;  1A2X A;  1CLL A;  2B1U A;  2JOJ A;  1QX5 B;  2JRF A;  1SPY A;  1QAS A;  1FI5 A;  1J7R A;  1X02 A;  3SG5 A;  1M63 B;  1MUX A;  1F4Q A;  1QLK A;  1YUU A;  1JFJ A;  1K94 A;  2SCP A;  1IH0 A;  1BT6 A;  2EHB A;  2KSP A;  2NZ0 A;  1UP5 A;  4MVF A;  1PUL A;  2ISD A;  2I2R E;  1F8H A;  1HQV A;  4MSP A;  2EC6 C;  2LNK A;  2EGD A;  1UUR A;  1CFF A;  1Y1A A;  5KTY A;  5K89 A;  4ZCV A;  1AVS A;  1U5I B;  1V1G A;  1JF2 A;  4GGN A;  1AP4 A;  1K8U A;  1DGU A;  3PAL A;  4GGF C;  2JXC A;  2L51 A;  2M9G A;  2PRU A;  2BKI B;  1QXP A;  2KI6 C;  4YGB B;  3H4S E;  3I5H C;  3TDI A;  2LMU A;  2LUC A;  2NLN A;  4WQ3 A;  3O78 A;  4M2Q A;  2HF5 A;  1KK8 B;  3C1V A;  4PE0 A;  5I2O A;  2BL0 B;  1YRU B;  3JVT B;  1FW4 A;  3ZWH A;  1QVI Z;  4GAO A;  5CPV A;  4IL1 A;  1K93 D;  3KO0 A;  5AAN A;  3SIB A;  4YGE B;  2H2K A;  1DJX A;  1K9K A;  2H61 C;  5DKN A;  3DVE A;  4YRU A;  3QRX A;  2FOT A;  3CR5 X;  4ORC B;  5KSZ A;  2I94 A;  5CSN A;  1AJ5 A;  3NSK A;  5CSF A;  4JPZ B;  2KYF A;  3NSI A;  1OZO A;  3WHT B;  3DVM A;  1NSH A;  2KHN A;  4NDC A;  4MZJ A;  3PLF B;  1AHR A;  2LV7 A;  5HKY A;  1G33 A;  2F3Z A;  2WC8 A;  1DTL A;  1S5G Z;  4YBH B;  1KK7 Y;  2ZKM X;  2PSR A;  3DVJ A;  4FTG A;  1QTX A;  4CFR A;  3JTD B;  5I2L A;  2JUL A;  2JTT A;  2L98 A;  1REC A;  3PN7 B;  1FBV A;  3IQQ A;  3CS1 A;  4N1F A;  2ZFD A;  4AQJ A;  4N1G A;  1YR5 A;  4F0Z B;  2BEC A;  1YX8 A;  3BUO B;  2K2A A;  3HCM A;  1NCY A;  2BKH B;  3O6B A;  5FYX A;  4PDZ A;  1KQV A;  1Y6W A;  3OB1 B;  1BOC A;  2D8N A;  2K0J A;  4R1E A;  2MBX A;  1WRZ A;  5HLV A;  2KNE A;  4I5N B;  3OHM B;  4FQO A;  2M7L A;  1R6P A;  4C0K A;  2K8M B;  5D7F A;  1DVI A;  1A75 B;  1IQ5 A;  1L2O C;  1S3P A;  1DJW A;  4WRI A;  2L2E A;  5BPJ A;  1NP8 A;  3RLZ A;  1CM4 A;  5CSI A;  4Q04 A;  1IJ6 A;  3TS5 C;  1QJT A;  1SK6 D;  3CR2 A;  3O2P A;  1XK4 A;  4OR9 B;  3CTN A;  1MXE A;  2Q91 A;  1QLS A;  2MLF C;  1J1D A;  2AAO A;  3RM1 A;  3JTD C;  5I8N A;  1MQ1 A;  1CB1 A;  1W7J B;  3I5I C;  1QV1 A;  1KQM C;  1S6C A;  1M39 A;  2QAC A;  4AOM A;  3TUY C;  1KCY A;  1CDL A;  1SYM A;  2LAN A;  5I2Q A;  1OMD A;  1SCV A;  2OTG C;  4M2P A;  1B8C A;  3PM8 A;  1TIZ A;  1FF1 A;  2CNP A;  1SMG A;  1R2U A;  3EVV A;  2KDH A;  1Q80 A;  2FCD A;  2HQW A;  1PSB A;  5HKW A;  1J7O A;  1NCX A;  5G08 A;  4A4C A;  3EK8 A;  3NSO A;  1S26 D;  2I7A A;  2LLT A;  4P2Y B;  4PAL A;  1YVL A;  1SY9 A;  3TDU A;  1A29 A;  5B8I B;  2E30 A;  2KFG A;  2R2I A;  1CFD A;  1SW8 A;  1TNQ A;  2FJU B;  3JVT C;  3BOW B;  3EKH A;  2MHH A;  2KFF A;  3OB2 B;  1YUR A;  2F33 A;  5J3X A;  2L4H A;  4USL A;  4GFT A;  1WLZ A;  1OMV A;  1B7T Z;  2OS8 B;  1N2D A;  1F71 A;  1FI6 A;  1K9P A;  1DJG A;  2MA2 A;  1CDN A;  1TCF A;  2MLE C;  2JC2 A;  1GGW A;  4C0L A;  1S6I A;  2COL B;  3GK4 X;  1TNP A;  1XFW O;  1CFC A;  3MSE B;  1QX7 A;  2O60 A;  4PHN A;  5HYD A;  1RJV A;  3HX4 A;  3VRN A;  1LA3 A;  1LKJ A;  1KSO A;  3ZNI A;  2Q4U A;  1AUI B;  4TNC A;  3SG2 A;  4QJ5 B;  4MN0 A;  4AQI A;  3A4U B;  1EG3 A;  1MXL C;  1UHN A;  1NX1 A;  4CPV A;  3GOF A;  2A4J A;  4HRG A;  1JF0 A;  3GK2 A;  1NYA A;  1W7I B;  2LE9 B;  2LLS A;  1BLQ A;  1IRJ A;  3OX6 A;  2KQY A;  1RWY A;  1L7Z A;  5AEQ A;  1JWD A;  2CCM A;  1CLB A;  4ETO A;  1UHK A;  4BY5 A;  1C7V A;  4NQG A;  3AKA A;  1IQ3 A;  1K2H A;  3WXA A;  4NDB A;  1M46 A;  2BL0 C;  3D0Y A;  2JTZ A;  1KWO B;  1XFY O;  2LUX A;  2M97 A;  2G9B A;  1KK7 Z;  2M7N A;  1G8I A;  3VRP A;  1J55 A;  1Y1U A;  2M0R A;  1JBA A;  2K7O A;  4PE7 A;  1YTZ C;  2Y1N A;  1XVJ A;  1TOP A;  2BBN A;  2CTN A;  3FWC A;  1H4B A;  5KU1 A;  1YUT A;  1NUB A;  2PVB A;  2VRG A;  4ICB A;  4PHM A;  5DKQ A;  2M1U A;  2WOR A;  1DT7 B;  1IJ5 A;  1MWN A;  5HKZ A;  1GQM A;  3IF7 A;  2NCO A;  4DIR A;  3EVR A;  1E8A A;  4MLW A;  1BMO A;  1SKT A;  4GNK B;  3E3R A;  3O4Y A;  2O5G A;  1S1E A;  1ZUZ A;  2BCX A;  2PAL A;  4CID A;  4MEW A;  3WNX B;  1V1F A;  2OTG B;  2K7D A;  4XYN A;  3KPX A;  2KOT A;  1BU3 A;  2LM5 A;  1K90 D;  1GGZ A;  1HT9 A;  2L0P A;  2GGZ A;  1DJZ A;  1ALW A;  3TUY B;  1JC2 A;  1F4O A;  2ZN8 A;  5ER5 A;  2AUC A;  4JQ0 D;  1KSM A;  4MZL A;  2HPS A;  4OV2 A;  4WQ2 A;  2V53 A;  4YI8 A;  2K7B A;  1NIW A;  2DOQ A;  2JT0 A;  3LK1 A;  4JWQ A;  4YGD B;  4CLN A;  1GJY A;  1TN4 A;  1ZAC A;  4I5L B;  2MJW B;  3CWG A;  1BR1 B;  3DF0 B;  2KAV A;  2K2F A;  3DF0 A;  2EC6 B;  2G2B A;  3PSR A;  1XK4 C;  1DJI A;  3VRR A;  2F2O A;  1SRA A;  3CLN A;  2JPT A;  2ZRS A;  2LCP A;  1DF0 A;  1WY9 A;  3BUX B;  5GQQ C;  1C07 A;  5AXI A;  2GGM A;  2I18 A;  4I5K A;  5PAL A;  1LA0 A;  1YVH A;  1WLM A; 
#chains in the Genus database with same CATH topology
 1XA5 A;  1J1E A;  3BQ3 A;  2L50 A;  1CNP A;  2ZNE A;  2SAS A;  3L4A A;  1J7P A;  1MR8 A;  1S5G Y;  2F8P A;  1YRT B;  3QME A;  3VRQ A;  4ORB B;  3WHU B;  1RK9 A;  3I5G B;  1FPW A;  1BR4 B;  3LLE A;  1DEL A;  4QJ3 B;  4GUK A;  3KF9 A;  1VRK A;  3EK4 A;  2CT9 A;  3CGA A;  3EVU A;  5F6T A;  1OMR A;  1QIW A;  1G4Y R;  3PAT A;  5ER4 X;  2BE6 A;  4DS7 A;  4CFQ A;  1XYD A;  1Z4H A;  2ZND A;  3D0Y B;  4GPL B;  3IQO A;  1KK8 C;  1DF0 B;  4MRY A;  3ICB A;  1OE9 B;  1QAT A;  3EG5 B;  1EL4 A;  1WRL A;  1DC1 A;  3BOW A;  3CR4 X;  4U8D A;  1TRF A;  2JWW A;  1TNW A;  2LHI A;  2H61 A;  3BXK A;  1SCM C;  2M3W A;  1M45 A;  2MAZ A;  3PN7 C;  1Y1X A;  5AER A;  3N7H A;  3OP0 A;  4OKH A;  3FE6 A;  2KI4 C;  3UO9 A;  1NWD A;  4C0J A;  2KFH A;  1AK8 A;  2BCA A;  2E6W A;  1QWV A;  2PAS A;  1K96 A;  3OX5 A;  2M49 B;  1DJY A;  2CXJ A;  2KYC A;  2TN4 A;  1NCZ A;  1PVA A;  3K1E A;  3VRO A;  1GM0 A;  3K21 A;  1OQP A;  1ORG A;  5DKR A;  1K9U A;  1TCO B;  2KI6 D;  3BUM B;  2KAX A;  1BG1 A;  1SR6 C;  4OCI A;  3TDZ A;  5JOL A;  1C3Y A;  2PQL A;  1PRW A;  2LVK A;  1MF8 B;  3B88 A;  3SG6 A;  1B9A A;  2KAY A;  3DVK A;  2KGR A;  4JKT A;  2IS9 A;  3SIA A;  1DJH A;  3SG4 A;  4BY4 A;  3AAK A;  4DCK A;  1IGV A;  4PT1 A;  5D69 A;  4L9M A;  1MHO A;  3BUW B;  3DY9 A;  3EKJ A;  1OSA A;  1KFU L;  4PE4 A;  2M29 A;  4HRE E;  2JXL A;  1RTP 1;  3PM2 A;  4D1E A;  1BOD A;  1KQM B;  2KBM A;  2KQ6 A;  1EG4 A;  1B47 A;  1LIN A;  2JNX A;  1CMF A;  2HQ8 A;  3TS5 B;  5CSJ A;  1SR6 B;  1Y0V H;  2WCK A;  1BF5 A;  1UWO A;  2LVV A;  1OOJ A;  3KHE A;  4YI9 A;  1H8B A;  1CMG A;  1DGV A;  1L2O B;  2LVJ A;  5HLO A;  1QV0 A;  1QS7 A;  1ALV A;  3D74 A;  3DD4 A;  4A4B A;  4GGF A;  2LMV A;  3L47 A;  1SL8 A;  2OPO A;  3NGV A;  1EXR A;  1IKU A;  1RFJ A;  1ODB A;  1YX7 A;  3DYE A;  2QEO A;  1XFZ O;  2WOS A;  4QJ4 B;  1UUS A;  3OGN A;  2FCE A;  2M1K B;  2RGI A;  3AKB A;  1SCM B;  2JPO A;  3CDN A;  4INW A;  5IBW A;  1A75 A;  3B86 A;  1QX2 A;  1UHH A;  2MRD A;  3FIA A;  2K7C A;  1IG5 A;  1KFX L;  4DRW A;  1NX2 A;  3BYA A;  1EH2 A;  1A4P A;  4XJK B;  2JQ6 A;  1XFX O;  2AMI A;  1S6J A;  3DXL A;  1CDP A;  2P6B B;  3LK0 A;  1D1O A;  2LC5 A;  4E68 A;  1J7Q A;  1F55 A;  1JUO A;  1F70 A;  3I5H B;  1U5I A;  1XFV O;  2QPT A;  2WCB A;  3I5G C;  3I5I B;  3D78 A;  3LCP C;  3R1O A;  3D73 A;  3VGO A;  2ZN9 A;  1AJ4 A;  2LLU A;  1PSR A;  2WC5 A;  3EK7 A;  5JJG A;  4MBE A;  1Z2C B;  1CDM A;  2P70 A;  2LAP A;  3A8R A;  1F54 A;  2LP2 A;  3AAJ A;  2KLD A;  3S0G A;  1ZFS A;  4PE1 A;  3SG7 A;  2LVI A;  4N5X A;  1DMO A;  1PAL A;  1WRK A;  2L5X B;  2LHL A;  3CZ1 A;  2BE4 A;  1SL9 A;  1SBJ A;  2WND A;  1A03 A;  3SS3 A;  2WCF A;  3L4L A;  4OVN F;  5FI6 A;  2WCJ A;  1EJ3 A;  1C7W A;  2F3Y A;  3F45 A;  4ORA B;  4PHJ A;  1WDC B;  2Y1M A;  3SJS A;  2CBL A;  1TNX A;  1K95 A;  1N65 A;  2WCE A;  3GK1 A;  1OZS A;  1XFU O;  2JNF A;  2BCB A;  4P5O E;  3PFV A;  1CM1 A;  1B4C A;  1NX0 A;  1W9Z A;  1B8L A;  1NPQ A;  3I5F B;  3BJH A;  2WCL A;  1QIV A;  1PK0 D;  3NSL A;  1JSA A;  1PVB A;  2GV5 A;  1ZMZ A;  3VB1 A;  5AFP A;  2M8U A;  2FJY A;  4MRX A;  4MZK A;  2L4I A;  1UHI A;  2NCP A;  1SNL A;  3SG3 A;  3FE9 A;  4YGC B;  1KFU S;  5TNC A;  5FI2 A;  3SS4 A;  1RRO A;  2P71 A;  1WDC C;  1SL7 A;  2BBM A;  1CFP A;  3TZ1 A;  2F2P A;  4I5J A;  4M2O A;  3RZS A;  4YGA A;  1IWQ A;  3LL8 B;  4ZCU A;  2JZI A;  2KGB C;  3FS7 A;  1B8R A;  1ZOT B;  3CZT X;  3D10 A;  4UPG A;  1UHJ A;  3NXA A;  1QVI Y;  2KI4 B;  2K61 A;  1B7T Y;  1OOG A;  2NXQ A;  1M31 A;  2JT3 A;  1XO5 A;  1DEK A;  3B87 A;  2GTE A;  1S36 A;  3BUN B;  1KFX S;  1N0Y A;  2LP3 A;  1LXF C;  2PMY A;  4KYN A;  2LMT A;  4PCW A;  4DUQ A;  1JFK A;  3CYZ A;  3M0W A;  1LVC D;  1BJF A;  2OS8 C;  4HRH A;  1CLM A;  2Y4Q A;  1NX3 A;  2JU0 A;  1KWO C;  1TTX A;  4GBA A;  4HSZ A;  4XJK A;  1CKK A;  2HET A;  3FWB A;  2JT8 A;  1YUS A;  4PHK A;  1CTR A;  2Y5I A;  3KEV A;  1B1G A;  2KBI A;  3I5F C;  4NDD A;  2ZRT A;  1A2X A;  1CLL A;  2B1U A;  2JOJ A;  1QX5 B;  2JRF A;  1SPY A;  1QAS A;  1FI5 A;  1J7R A;  1X02 A;  3NHT A;  3SG5 A;  1M63 B;  1MUX A;  1F4Q A;  1QLK A;  1YUU A;  1JFJ A;  1K94 A;  2SCP A;  1IH0 A;  1BT6 A;  2EHB A;  2KSP A;  3CZ0 A;  4F7F A;  2NZ0 A;  1UP5 A;  4MVF A;  1PUL A;  2ISD A;  2I2R E;  1F8H A;  1HQV A;  1OOF A;  4MSP A;  2EC6 C;  2LNK A;  2EGD A;  1UUR A;  3CZ2 A;  1CFF A;  2YGU A;  1Y1A A;  5KTY A;  3S0A A;  5K89 A;  4ZCV A;  1AVS A;  1U5I B;  1V1G A;  3SS5 A;  1JF2 A;  4GGN A;  1AP4 A;  1K8U A;  1DGU A;  2QEV A;  3PAL A;  4GGF C;  2JXC A;  2L51 A;  2M9G A;  2BAP A;  2PRU A;  2BKI B;  1QXP A;  3D76 A;  2KI6 C;  4YGB B;  3H4S E;  3I5H C;  3TDI A;  1T14 A;  2LMU A;  2LUC A;  2WCH A;  2NLN A;  4WQ3 A;  3O78 A;  4M2Q A;  2HF5 A;  1KK8 B;  3C1V A;  4PE0 A;  5I2O A;  2BL0 B;  2K60 A;  1YRU B;  2ERB A;  1FW4 A;  3JVT B;  1QVI Z;  5FI7 A;  4GAO A;  5DIC A;  5CPV A;  3S0D A;  3ZWH A;  4IL1 A;  1K93 D;  3KO0 A;  5AAN A;  3S0F A;  3SIB A;  4YGE B;  2H2K A;  1DJX A;  1K9K A;  2H61 C;  5DKN A;  3DVE A;  4YRU A;  3QRX A;  2FOT A;  3CR5 X;  4ORC B;  5KSZ A;  2I94 A;  5CSN A;  1AJ5 A;  3NSK A;  5CSF A;  4JPZ B;  2KYF A;  3D75 A;  3NSI A;  1OZO A;  3WHT B;  3DVM A;  1NSH A;  2KHN A;  4NDC A;  4MZJ A;  3PLF B;  1AHR A;  2LV7 A;  5HKY A;  1G33 A;  2F3Z A;  2WC8 A;  4JD9 A;  1DTL A;  2PYQ A;  1S5G Z;  4YBH B;  1KK7 Y;  2ZKM X;  2PSR A;  3DVJ A;  4FTG A;  1QTX A;  1IIO A;  4CFR A;  3V2L A;  3JTD B;  5I2L A;  2JUL A;  2JTT A;  2L98 A;  1REC A;  3PN7 B;  1FBV A;  3IQQ A;  3CS1 A;  4N1F A;  2ZFD A;  1XFR A;  4AQJ A;  4N1G A;  1YR5 A;  4F0Z B;  2BEC A;  1YX8 A;  3DZT A;  3BUO B;  3D77 A;  1TUZ A;  2K2A A;  2BNX A;  3HCM A;  2KPH A;  4OZD A;  1NCY A;  2BKH B;  2KLE A;  3O6B A;  5FYX A;  4PDZ A;  1KQV A;  1Y6W A;  3OB1 B;  1BOC A;  3B7A A;  2D8N A;  2K0J A;  4R1E A;  2MBX A;  1WRZ A;  5HLV A;  2KNE A;  4IJ7 A;  4I5N B;  3OHM B;  4FQO A;  2M7L A;  1R6P A;  4C0K A;  2K8M B;  5D7F A;  1DVI A;  2QEH A;  1A75 B;  1IQ5 A;  1L2O C;  1S3P A;  1DJW A;  4WRI A;  1OOI X;  2L2E A;  5BPJ A;  1NP8 A;  2H8V A;  3RLZ A;  1CM4 A;  5CSI A;  3PJI A;  4Q04 A;  3R72 A;  1IJ6 A;  3TS5 C;  1QJT A;  1SK6 D;  3CR2 A;  3O2P A;  1XK4 A;  4OR9 B;  3BFB A;  1TWO A;  3CTN A;  1MXE A;  2Q91 A;  1QLS A;  2MLF C;  1J1D A;  2AAO A;  3RM1 A;  3JTD C;  5I8N A;  1MQ1 A;  1CB1 A;  1W7J B;  3I5I C;  1QV1 A;  1KQM C;  1S6C A;  3BFH A;  1M39 A;  2QAC A;  4AOM A;  3TUY C;  1KCY A;  1CDL A;  1SYM A;  2LAN A;  5I2Q A;  1OMD A;  1SCV A;  2OTG C;  3OBV A;  4M2P A;  1B8C A;  3PM8 A;  1TIZ A;  3S0B A;  1FF1 A;  2CNP A;  1SMG A;  3R1P A;  1R2U A;  3EVV A;  2KDH A;  1Q80 A;  2FCD A;  1TUJ A;  2HQW A;  1PSB A;  5HKW A;  1J7O A;  1NCX A;  5G08 A;  4A4C A;  3EK8 A;  3NSO A;  1S26 D;  2I7A A;  2LLT A;  4P2Y B;  4PAL A;  1YVL A;  1SY9 A;  3TDU A;  1A29 A;  5B8I B;  2E30 A;  3IVT A;  2KFG A;  2QEB A;  2R2I A;  1CFD A;  1SW8 A;  1TNQ A;  2FJU B;  3JVT C;  3BOW B;  5D3O A;  3EKH A;  2MHH A;  2KFF A;  3OB2 B;  1YUR A;  2F33 A;  3R1V A;  2L4H A;  3FE8 A;  4USL A;  5J3X A;  4GFT A;  1WLZ A;  1OMV A;  1B7T Z;  2OS8 B;  5EL2 A;  5I94 A;  1N2D A;  1F71 A;  1FI6 A;  1K9P A;  1DJG A;  2MA2 A;  1CDN A;  1TCF A;  2MLE C;  2JC2 A;  1GGW A;  4C0L A;  1S6I A;  2COL B;  3GK4 X;  1TNP A;  1XFW O;  1CFC A;  3MSE B;  1QX7 A;  2O60 A;  4PHN A;  5HYD A;  1RJV A;  3HX4 A;  3VRN A;  1LA3 A;  1P28 A;  1LKJ A;  1KSO A;  3ZNI A;  3CAB A;  2Q4U A;  1AUI B;  4TNC A;  3SG2 A;  4QJ5 B;  2L2C A;  4MN0 A;  1OOH A;  3A4U B;  4AQI A;  1EG3 A;  1MXL C;  1OW4 A;  1UHN A;  1NX1 A;  4CPV A;  3GOF A;  2A4J A;  3NHI A;  4HRG A;  1JF0 A;  3GK2 A;  1NYA A;  1W7I B;  2LE9 B;  2LLS A;  1BLQ A;  1IRJ A;  3OX6 A;  1DQE A;  2KQY A;  1RWY A;  1L7Z A;  5AEQ A;  1JWD A;  1LS8 A;  2CCM A;  4ETO A;  1UHK A;  4BY5 A;  5HL1 A;  1C7V A;  4NQG A;  1CLB A;  3AKA A;  3BFA A;  1IQ3 A;  1K2H A;  3WXA A;  4NDB A;  1M46 A;  2BL0 C;  3D0Y A;  2JTZ A;  1KWO B;  1XFY O;  2LUX A;  2M97 A;  2G9B A;  4INX A;  1KK7 Z;  2M7N A;  1G8I A;  3VRP A;  1J55 A;  1Y1U A;  3S0E A;  2M0R A;  1JBA A;  2K7O A;  4PE7 A;  3B6X A;  1YTZ C;  2Y1N A;  1XVJ A;  1TOP A;  2BBN A;  2CTN A;  3FWC A;  1H4B A;  5KU1 A;  1YUT A;  1NUB A;  2PVB A;  2VRG A;  4ICB A;  4PHM A;  2WCM A;  5DKQ A;  2M1U A;  2WOR A;  1DT7 B;  1IJ5 A;  2QDI A;  1MWN A;  1C3Z A;  1SSE B;  5HKZ A;  1GQM A;  3IF7 A;  2NCO A;  4DIR A;  3EVR A;  1E8A A;  4MLW A;  1BMO A;  1SKT A;  4GNK B;  3E3R A;  3O4Y A;  2O5G A;  1S1E A;  1ZUZ A;  2BCX A;  2PAL A;  3Q8I A;  4CID A;  3UNW A;  4MEW A;  3WNX B;  1V1F A;  2OTG B;  2K7D A;  4XYN A;  3KPX A;  2KOT A;  1BU3 A;  2LM5 A;  1K90 D;  1GGZ A;  1HT9 A;  2L0P A;  1DJZ A;  2GGZ A;  1ALW A;  3TUY B;  1JC2 A;  1F4O A;  2L5Y A;  2ZN8 A;  5ER5 A;  2AUC A;  4JQ0 D;  1KSM A;  4MZL A;  2HPS A;  4FQT A;  4OV2 A;  2V53 A;  4WQ2 A;  4YI8 A;  2K7B A;  1NIW A;  2DOQ A;  2JT0 A;  3LK1 A;  2WC6 A;  4JWQ A;  4YGD B;  4CLN A;  1GJY A;  1TN4 A;  1ZAC A;  4I5L B;  2MJW B;  3CWG A;  1BR1 B;  3DF0 B;  2KAV A;  2K2F A;  3DF0 A;  2EC6 B;  2G2B A;  3PSR A;  1XK4 C;  1DJI A;  3VRR A;  2F2O A;  1SRA A;  3CLN A;  2JPT A;  2ZRS A;  2LCP A;  1DF0 A;  1WY9 A;  3BUX B;  5GQQ C;  1C07 A;  5AXI A;  2GGM A;  2I18 A;  4I5K A;  5PAL A;  1LA0 A;  3O4X A;  1YVH A;  1WLM A; 
#chains in the Genus database with same CATH homology
 1XA5 A;  1J1E A;  3BQ3 A;  2L50 A;  1CNP A;  2ZNE A;  2SAS A;  1J7P A;  1MR8 A;  1S5G Y;  2F8P A;  1YRT B;  3VRQ A;  4ORB B;  3WHU B;  1RK9 A;  3I5G B;  1FPW A;  1BR4 B;  3LLE A;  4QJ3 B;  4GUK A;  3KF9 A;  1VRK A;  3EK4 A;  2CT9 A;  3CGA A;  3EVU A;  5F6T A;  1OMR A;  1QIW A;  1G4Y R;  3PAT A;  5ER4 X;  2BE6 A;  4DS7 A;  4CFQ A;  1XYD A;  2ZND A;  3D0Y B;  4GPL B;  3IQO A;  1KK8 C;  1DF0 B;  4MRY A;  3ICB A;  1OE9 B;  1QAT A;  1EL4 A;  1WRL A;  3BOW A;  3CR4 X;  4U8D A;  1TRF A;  2JWW A;  1TNW A;  2LHI A;  2H61 A;  3BXK A;  1SCM C;  2M3W A;  1M45 A;  2MAZ A;  3PN7 C;  1Y1X A;  5AER A;  3OP0 A;  4OKH A;  2KI4 C;  1NWD A;  4C0J A;  2KFH A;  1AK8 A;  2BCA A;  2E6W A;  2PAS A;  1K96 A;  3OX5 A;  2M49 B;  1DJY A;  2CXJ A;  2KYC A;  2TN4 A;  1NCZ A;  1PVA A;  3VRO A;  3K21 A;  1OQP A;  5DKR A;  1K9U A;  1TCO B;  2KI6 D;  3BUM B;  2KAX A;  1BG1 A;  1SR6 C;  4OCI A;  3TDZ A;  5JOL A;  1PRW A;  2LVK A;  1MF8 B;  3SG6 A;  1B9A A;  2KAY A;  3DVK A;  2KGR A;  4DCK A;  2IS9 A;  3SIA A;  1DJH A;  3SG4 A;  4BY4 A;  3AAK A;  1IGV A;  5D69 A;  4L9M A;  1MHO A;  3BUW B;  3EKJ A;  1OSA A;  1KFU L;  4PE4 A;  2M29 A;  4HRE E;  2JXL A;  1RTP 1;  4D1E A;  1BOD A;  1KQM B;  2KBM A;  2KQ6 A;  1EG4 A;  1B47 A;  1LIN A;  2JNX A;  1CMF A;  2HQ8 A;  3TS5 B;  5CSJ A;  1SR6 B;  1Y0V H;  1BF5 A;  1UWO A;  2LVV A;  1OOJ A;  3KHE A;  4YI9 A;  1H8B A;  1CMG A;  1DGV A;  1L2O B;  2LVJ A;  5HLO A;  1QV0 A;  1QS7 A;  1ALV A;  3DD4 A;  4A4B A;  4GGF A;  2LMV A;  1SL8 A;  2OPO A;  1EXR A;  1IKU A;  1RFJ A;  1ODB A;  1YX7 A;  1XFZ O;  2WOS A;  4QJ4 B;  1UUS A;  2FCE A;  2M1K B;  2RGI A;  3AKB A;  1SCM B;  5IBW A;  1A75 A;  1QX2 A;  1UHH A;  2MRD A;  3FIA A;  2K7C A;  1IG5 A;  1KFX L;  4DRW A;  1NX2 A;  3BYA A;  1EH2 A;  1A4P A;  4XJK B;  2JQ6 A;  1XFX O;  2AMI A;  1S6J A;  1CDP A;  2P6B B;  3LK0 A;  1D1O A;  2LC5 A;  4E68 A;  1J7Q A;  1F55 A;  1JUO A;  1F70 A;  3I5H B;  1U5I A;  1XFV O;  2QPT A;  2WCB A;  3I5G C;  3I5I B;  3LCP C;  3VGO A;  2ZN9 A;  1AJ4 A;  2LLU A;  1PSR A;  3EK7 A;  5JJG A;  4MBE A;  1CDM A;  3A8R A;  2LAP A;  1F54 A;  2LP2 A;  3AAJ A;  1ZFS A;  4PE1 A;  3SG7 A;  2LVI A;  4N5X A;  1DMO A;  1PAL A;  1WRK A;  2L5X B;  2LHL A;  2BE4 A;  1SL9 A;  1SBJ A;  2WND A;  1A03 A;  2WCF A;  4OVN F;  1EJ3 A;  1C7W A;  2F3Y A;  3F45 A;  4ORA B;  4PHJ A;  1WDC B;  2Y1M A;  3SJS A;  2CBL A;  1TNX A;  1K95 A;  1N65 A;  2WCE A;  3GK1 A;  1OZS A;  1XFU O;  2JNF A;  2BCB A;  4P5O E;  3PFV A;  1CM1 A;  1B4C A;  1NX0 A;  1B8L A;  1NPQ A;  3I5F B;  3NSL A;  1QIV A;  1PK0 D;  1JSA A;  1PVB A;  2GV5 A;  1ZMZ A;  5AFP A;  2M8U A;  4MRX A;  4MZK A;  2L4I A;  1UHI A;  2NCP A;  1SNL A;  3SG3 A;  4YGC B;  1KFU S;  5TNC A;  1RRO A;  1WDC C;  1SL7 A;  2BBM A;  1CFP A;  3TZ1 A;  2F2P A;  4I5J A;  4M2O A;  4YGA A;  1IWQ A;  3LL8 B;  4ZCU A;  2JZI A;  2KGB C;  3FS7 A;  1B8R A;  1ZOT B;  3CZT X;  3D10 A;  4UPG A;  1UHJ A;  3NXA A;  1QVI Y;  2KI4 B;  2K61 A;  1B7T Y;  2NXQ A;  1M31 A;  2JT3 A;  1XO5 A;  1S36 A;  3BUN B;  1KFX S;  1N0Y A;  2LP3 A;  1LXF C;  2PMY A;  2LMT A;  4PCW A;  4DUQ A;  1JFK A;  3M0W A;  1LVC D;  1BJF A;  2OS8 C;  4HRH A;  1CLM A;  2Y4Q A;  1NX3 A;  2JU0 A;  1KWO C;  1TTX A;  4GBA A;  4HSZ A;  4XJK A;  1CKK A;  2HET A;  3FWB A;  2JT8 A;  1YUS A;  4PHK A;  1CTR A;  2Y5I A;  3KEV A;  1B1G A;  2KBI A;  3I5F C;  4NDD A;  2ZRT A;  1A2X A;  1CLL A;  2B1U A;  2JOJ A;  1QX5 B;  2JRF A;  1SPY A;  1QAS A;  1FI5 A;  1J7R A;  1X02 A;  3SG5 A;  1M63 B;  1MUX A;  1F4Q A;  1QLK A;  1YUU A;  1JFJ A;  1K94 A;  2SCP A;  1IH0 A;  1BT6 A;  2EHB A;  2KSP A;  2NZ0 A;  1UP5 A;  4MVF A;  1PUL A;  2ISD A;  2I2R E;  1F8H A;  1HQV A;  4MSP A;  2EC6 C;  2LNK A;  2EGD A;  1UUR A;  1CFF A;  1Y1A A;  5KTY A;  5K89 A;  4ZCV A;  1AVS A;  1U5I B;  1V1G A;  1JF2 A;  4GGN A;  1AP4 A;  1K8U A;  1DGU A;  3PAL A;  4GGF C;  2JXC A;  2L51 A;  2M9G A;  2PRU A;  2BKI B;  1QXP A;  2KI6 C;  4YGB B;  3H4S E;  3I5H C;  3TDI A;  2LMU A;  2LUC A;  2NLN A;  4WQ3 A;  3O78 A;  4M2Q A;  2HF5 A;  1KK8 B;  3C1V A;  4PE0 A;  5I2O A;  2BL0 B;  1YRU B;  3JVT B;  1FW4 A;  3ZWH A;  1QVI Z;  4GAO A;  5CPV A;  4IL1 A;  1K93 D;  3KO0 A;  5AAN A;  3SIB A;  4YGE B;  2H2K A;  1DJX A;  1K9K A;  2H61 C;  5DKN A;  3DVE A;  4YRU A;  3QRX A;  2FOT A;  3CR5 X;  4ORC B;  5KSZ A;  2I94 A;  5CSN A;  1AJ5 A;  3NSK A;  5CSF A;  4JPZ B;  2KYF A;  3NSI A;  1OZO A;  3WHT B;  3DVM A;  1NSH A;  2KHN A;  4NDC A;  4MZJ A;  3PLF B;  1AHR A;  2LV7 A;  5HKY A;  1G33 A;  2F3Z A;  2WC8 A;  1DTL A;  1S5G Z;  4YBH B;  1KK7 Y;  2ZKM X;  2PSR A;  3DVJ A;  4FTG A;  1QTX A;  4CFR A;  3JTD B;  5I2L A;  2JUL A;  2JTT A;  2L98 A;  1REC A;  3PN7 B;  1FBV A;  3IQQ A;  3CS1 A;  4N1F A;  2ZFD A;  4AQJ A;  4N1G A;  1YR5 A;  4F0Z B;  2BEC A;  1YX8 A;  3BUO B;  2K2A A;  3HCM A;  1NCY A;  2BKH B;  3O6B A;  5FYX A;  4PDZ A;  1KQV A;  1Y6W A;  3OB1 B;  1BOC A;  2D8N A;  2K0J A;  4R1E A;  2MBX A;  1WRZ A;  5HLV A;  2KNE A;  4I5N B;  3OHM B;  4FQO A;  2M7L A;  1R6P A;  4C0K A;  2K8M B;  5D7F A;  1DVI A;  1A75 B;  1IQ5 A;  1L2O C;  1S3P A;  1DJW A;  4WRI A;  2L2E A;  5BPJ A;  1NP8 A;  3RLZ A;  1CM4 A;  5CSI A;  4Q04 A;  1IJ6 A;  3TS5 C;  1QJT A;  1SK6 D;  3CR2 A;  3O2P A;  1XK4 A;  4OR9 B;  3CTN A;  1MXE A;  2Q91 A;  1QLS A;  2MLF C;  1J1D A;  2AAO A;  3RM1 A;  3JTD C;  5I8N A;  1MQ1 A;  1CB1 A;  1W7J B;  3I5I C;  1QV1 A;  1KQM C;  1S6C A;  1M39 A;  2QAC A;  4AOM A;  3TUY C;  1KCY A;  1CDL A;  1SYM A;  2LAN A;  5I2Q A;  1OMD A;  1SCV A;  2OTG C;  4M2P A;  1B8C A;  3PM8 A;  1TIZ A;  1FF1 A;  2CNP A;  1SMG A;  1R2U A;  3EVV A;  2KDH A;  1Q80 A;  2FCD A;  2HQW A;  1PSB A;  5HKW A;  1J7O A;  1NCX A;  5G08 A;  4A4C A;  3EK8 A;  3NSO A;  1S26 D;  2I7A A;  2LLT A;  4P2Y B;  4PAL A;  1YVL A;  1SY9 A;  3TDU A;  1A29 A;  5B8I B;  2E30 A;  2KFG A;  2R2I A;  1CFD A;  1SW8 A;  1TNQ A;  2FJU B;  3JVT C;  3BOW B;  3EKH A;  2MHH A;  2KFF A;  3OB2 B;  1YUR A;  2F33 A;  5J3X A;  2L4H A;  4USL A;  4GFT A;  1WLZ A;  1OMV A;  1B7T Z;  2OS8 B;  1N2D A;  1F71 A;  1FI6 A;  1K9P A;  1DJG A;  2MA2 A;  1CDN A;  1TCF A;  2MLE C;  2JC2 A;  1GGW A;  4C0L A;  1S6I A;  2COL B;  3GK4 X;  1TNP A;  1XFW O;  1CFC A;  3MSE B;  1QX7 A;  2O60 A;  4PHN A;  5HYD A;  1RJV A;  3HX4 A;  3VRN A;  1LA3 A;  1LKJ A;  1KSO A;  3ZNI A;  2Q4U A;  1AUI B;  4TNC A;  3SG2 A;  4QJ5 B;  4MN0 A;  4AQI A;  3A4U B;  1EG3 A;  1MXL C;  1UHN A;  1NX1 A;  4CPV A;  3GOF A;  2A4J A;  4HRG A;  1JF0 A;  3GK2 A;  1NYA A;  1W7I B;  2LE9 B;  2LLS A;  1BLQ A;  1IRJ A;  3OX6 A;  2KQY A;  1RWY A;  1L7Z A;  5AEQ A;  1JWD A;  2CCM A;  1CLB A;  4ETO A;  1UHK A;  4BY5 A;  1C7V A;  4NQG A;  3AKA A;  1IQ3 A;  1K2H A;  3WXA A;  4NDB A;  1M46 A;  2BL0 C;  3D0Y A;  2JTZ A;  1KWO B;  1XFY O;  2LUX A;  2M97 A;  2G9B A;  1KK7 Z;  2M7N A;  1G8I A;  3VRP A;  1J55 A;  1Y1U A;  2M0R A;  1JBA A;  2K7O A;  4PE7 A;  1YTZ C;  2Y1N A;  1XVJ A;  1TOP A;  2BBN A;  2CTN A;  3FWC A;  1H4B A;  5KU1 A;  1YUT A;  1NUB A;  2PVB A;  2VRG A;  4ICB A;  4PHM A;  5DKQ A;  2M1U A;  2WOR A;  1DT7 B;  1IJ5 A;  1MWN A;  5HKZ A;  1GQM A;  3IF7 A;  2NCO A;  4DIR A;  3EVR A;  1E8A A;  4MLW A;  1BMO A;  1SKT A;  4GNK B;  3E3R A;  3O4Y A;  2O5G A;  1S1E A;  1ZUZ A;  2BCX A;  2PAL A;  4CID A;  4MEW A;  3WNX B;  1V1F A;  2OTG B;  2K7D A;  4XYN A;  3KPX A;  2KOT A;  1BU3 A;  2LM5 A;  1K90 D;  1GGZ A;  1HT9 A;  2L0P A;  2GGZ A;  1DJZ A;  1ALW A;  3TUY B;  1JC2 A;  1F4O A;  2ZN8 A;  5ER5 A;  2AUC A;  4JQ0 D;  1KSM A;  4MZL A;  2HPS A;  4OV2 A;  4WQ2 A;  2V53 A;  4YI8 A;  2K7B A;  1NIW A;  2DOQ A;  2JT0 A;  3LK1 A;  4JWQ A;  4YGD B;  4CLN A;  1GJY A;  1TN4 A;  1ZAC A;  4I5L B;  2MJW B;  3CWG A;  1BR1 B;  3DF0 B;  2KAV A;  2K2F A;  3DF0 A;  2EC6 B;  2G2B A;  3PSR A;  1XK4 C;  1DJI A;  3VRR A;  2F2O A;  1SRA A;  3CLN A;  2JPT A;  2ZRS A;  2LCP A;  1DF0 A;  1WY9 A;  3BUX B;  5GQQ C;  1C07 A;  5AXI A;  2GGM A;  2I18 A;  4I5K A;  5PAL A;  1LA0 A;  1YVH A;  1WLM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...