1J1DA

Crystal structure of the 46kda domain of human cardiac troponin in the ca2+ saturated form
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
161
structure length
159
Chain Sequence
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRSMKDDSKSEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Troponin C
publication title Structure of the core domain of human cardiac troponin in the Ca2+-saturated form
pubmed doi rcsb
source organism Homo sapiens
molecule tags Contractile protein
total genus 50
structure length 159
sequence length 161
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1j1dA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1j1dA02
1Y1AA 5D7FA 2BECA 1QXPA 4GBAA 3CGAA 2Q4UA 1QX2A 2RGIA 5HKYA 1BLQA 1DMOA 2JC2A 4C0JA 1SRAA 1CLBA 4E68A 3KPXA 4OKHA 1G4YR 3NSIA 3AAKA 2LP2A 1AJ5A 1KCYA 1OMVA 5HKZA 1IJ6A 3SG5A 2KI6D 1BODA 2LAPA 1JF2A 2COLB 3F45A 4DIRA 1DVIA 1S5GZ 1SYMA 2D8NA 3BXKA 1OMDA 2KSPA 2HQWA 2DOQA 3BYAA 1A75B 2Q91A 2JNXA 1IWQA 1UHNA 2CXJA 3GOFA 1SL9A 1M63B 2M3WA 3DVEA 1F54A 4WQ2A 2EHBA 4MZKA 4GAOA 2LLTA 3GK2A 1AHRA 1MQ1A 1S26D 3A8RA 1C7VA 2HQ8A 1TCFA 1SKTA 1FBVA 3CR2A 3AKBA 4ORAB 4A4CA 1EH2A 3JVTC 1JUOA 1TIZA 3OX5A 2MHHA 2Y5IA 1TN4A 2MAZA 1S1EA 2K61A 1ALWA 4GFTA 2Y1NA 2K2FA 1ZOTB 2HF5A 4YGDB 1NX2A 1CB1A 3M0WA 1S36A 1TNWA 1S6CA 2IS9A 1S3PA 1YX7A 3BOWA 4R1EA 3SG6A 2GV5A 5DKRA 1CMFA 1V1GA 1H4BA 3D0YA 1AP4A 2JTTA 1B4CA 4GUKA 2L98A 1KWOB 3HCMA 1TTXA 1S6JA 2LMUA 3EVVA 1ZFSA 2JXLA 3LLEA 4DS7A 1PVBA 1MXLC 2M1KB 2F3YA 1CNPA 2ZRSA 4Q04A 4AQIA 4YRUA 1DJWA 1QX5B 1YRUB 2AAOA 2TN4A 2F2OA 2M49B 4WRIA 1B7TY 4IL1A 4F0ZB 1BU3A 4NDBA 2KBIA 2Y1MA 4FQOA 2VRGA 1V1FA 2JTZA 2JT3A 3EK7A 1XFVO 2I18A 1KK7Z 1SK6D 3DVJA 2KHNA 3BOWB 5ER4X 1L2OB 3RLZA 3AAJA 3E3RA 1R6PA 4CFQA 4CFRA 1WRKA 2KQ6A 2SCPA 2LUCA 3SJSA 4MEWA 2FCDA 1IRJA 2BCAA 2WNDA 4PHMA 2KFGA 2E6WA 4JWQA 1C7WA 3I5HB 4ORBB 4PDZA 1PVAA 3KHEA 4ETOA 2KAXA 2M7NA 1ALVA 4HSZA 2FCEA 2SASA 1NYAA 2E30A 1CFFA 2PASA 1B8RA 4MLWA 1CDPA 2LUXA 1CKKA 3MSEB 1N2DA 5HKWA 1W7JB 3WHUB 1CLLA 3RM1A 2CTNA 1QLSA 1KWOC 2KYCA 1HQVA 1A2XA 1EG4A 1YX8A 1J7QA 2PRUA 1BT6A 1Q80A 1F55A 1B9AA 1M46A 1EL4A 3TDIA 1PULA 1SW8A 2PVBA 3OB1B 4YGAA 3VROA 1XVJA 2LM5A 2KAVA 2WOSA 4MRYA 2BBNA 3VRPA 1QASA 1JSAA 3GK1A 2V53A 3CR4X 3PLFB 1NIWA 1UHJA 5AANA 3WXAA 3EVUA 1G8IA 3WNXB 1GJYA 5JOLA 3BUWB 1BMOA 3CWGA 3DVMA 1CFCA 1L2OC 1SL7A 3EVRA 4ORCB 1DTLA 2MRDA 2NCPA 4XJKA 1AVSA 1KFUS 1QV1A 3BUOB 4DUQA 1TOPA 2ZFDA 1FI5A 2F8PA 3IQQA 1UUSA 1OZSA 1IGVA 1SNLA 2LVJA 3I5HC 5DKQA 4C0LA 4M2OA 4YBHB 2ZN9A 1KFXL 5F6TA 1K9UA 2I94A 1RWYA 4P5OE 5AERA 1QLKA 3SG3A 1PK0D 1YURA 1B8LA 2LLUA 1K96A 1OQPA 3DD4A 4L9MA 3A4UB 2JT0A 2M97A 1KSOA 2K7CA 2KYFA 1TNXA 3PN7B 2LHIA 3O6BA 3OX6A 1LKJA 1WDCB 4AQJA 4U8DA 5I2OA 1XK4A 1N65A 1XFZO 1UHHA 5CPVA 2H61A 3EKJA 4PHJA 5IBWA 3EK4A 2ZN8A 2NCOA 1CDMA 1MR8A 2MLEC 1W7IB 1R2UA 2PSRA 2KGRA 1IKUA 1EJ3A 1MWNA 2A4JA 1U5IA 2EC6B 1DF0A 1WLMA 1F4OA 2M1UA 4GGNA 1ZMZA 1DJXA 1CLMA 4C0KA 2K2AA 1SR6B 2LNKA 2LVVA 1EXRA 2ZNDA 2GGZA 2JRFA 1JFKA 1K93D 1QVIZ 3PSRA 1M31A 3KEVA 1YVLA 1KQMB 2JULA 4I5NB 1RROA 1BG1A 4OCIA 3BUNB 1KK8B 3EK8A 1MXEA 1S5GY 3ZNIA 1GGZA 5AXIA 4ZCVA 1NX1A 1B47A 1B7TZ 1NCZA 2LANA 1J55A 3SG7A 5GQQC 5CSNA 3WHTB 2KI4B 5FYXA 3TDZA 1KQVA 2MA2A 4PE1A 3LCPC 1MHOA 3PN7C 1XYDA 5I8NA 1U5IB 2CNPA 2LVKA 1A03A 1WDCC 1B8CA 1JF0A 2NLNA 1LVCD 1RJVA 1WY9A 1B1GA 2JT8A 3TUYB 3NSKA 4CLNA 3BQ3A 1NCYA 4QJ5B 4MN0A 2KOTA 4NDCA 2BCBA 2KFFA 5HLVA 1QIVA 2KNEA 1PSBA 2NXQA 3FWBA 4OR9B 3D0YB 1RK9A 2EC6C 1J7RA 2WORA 2L5XB 3TDUA 4PHKA 1SR6C 1XA5A 2LMTA 3BUXB 3FWCA 1Y0VH 3NXAA 2KFHA 4USLA 1C07A 3AKAA 5CSJA 4DRWA 1BJFA 1JBAA 2JU0A 4JQ0D 1LINA 1KQMC 2FJUB 1TNPA 2L4HA 1FW4A 4GNKB 1NUBA 1KK8C 1A4PA 3K21A 3TZ1A 1FI6A 1LXFC 1FF1A 2OS8B 1K9PA 4I5KA 4D1EA 4YGCB 5I2QA 4PALA 2BBMA 2KI4C 2H2KA 1WLZA 1UWOA 1RTP1 1WRZA 4PCWA 1N0YA 1ZACA 2L50A 3D10A 5HYDA 1FPWA 3IF7A 3TUYC 1PRWA 2L4IA 3C1VA 3I5IB 3CLNA 3VRNA 4YGEB 1UURA 3JTDB 1CMGA 1NSHA 2LVIA 2ZRTA 3ZWHA 2BE4A 4DCKA 1OZOA 4BY5A 2HETA 1TNQA 2ISDA 3PATA 1XFWO 4OVNF 2CBLA 1H8BA 1IG5A 2OTGB 2JPTA 1CM4A 2EGDA 4AOMA 5PALA 5BPJA 2F3ZA 1QV0A 2JQ6A 2LP3A 3OP0A 1SPYA 5CSFA 4TNCA 1XO5A 2GGMA 1DT7B 2LV7A 1BF5A 1UHIA 1M39A 3O4YA 5K89A 1X02A 1QJTA 1SCVA 4QJ4B 1TRFA 1K95A 3I5FB 4YI9A 1LA3A 4HRHA 1UP5A 2OS8C 4FTGA 1LA0A 1OMRA 1F4QA 1QX7A 2M8UA 2K0JA 1J1DA 1A29A 1DJZA 1QS7A 1SL8A 3IQOA 5JJGA 1BR1B 1YR5A 4XJKB 3H4SE 2OPOA 2JWWA 1YRTB 1MF8B 2AMIA 3NSOA 4CIDA 1OOJA 1RFJA 4N5XA 1DGUA 2F2PA 3OB2B 3VGOA 1GGWA 3I5IC 3TS5B 3OHMB 2MBXA 2M0RA 4HREE 3JTDC 2BL0B 2MLFC 2HPSA 2KQYA 3KF9A 5HLOA 2LC5A 2R2IA 2LCPA 1QIWA 2K7OA 2WCBA 3GK4X 4HRGA 4A4BA 4ICBA 1CDNA 2OTGC 1ZUZA 3VRQA 1ODBA 1OE9B 1XFYO 5TNCA 1G33A 1XFXO 1CM1A 4PHNA 4PE4A 4PE7A 2BE6A 1YUUA 3FIAA 5DKNA 3PFVA 2B1UA 4I5JA 5J3XA 1IJ5A 3O2PA 4CPVA 2PALA 3SG2A 5B8IB 1KFUL 1Y1UA 1SCMB 1DJGA 2L2EA 2WC8A 5ER5A 2G9BA 2I7AA 2QACA 3I5FC 1VRKA 4GGFA 4WQ3A 5CSIA 5KTYA 1D1OA 1DJIA 1UHKA 1F70A 2MJWB 1K2HA 4MBEA 3DVKA 2KAYA 3HX4A 3I5GB 1CFPA 3EKHA 1DF0B 1DJYA 1NWDA 1AUIB 5I2LA 1BOCA 2G2BA 3DF0A 2JXCA 2KDHA 1DGVA 3PM8A 2BCXA 2LMVA 3TS5C 1J7OA 2CCMA 4MRXA 4MSPA 2QPTA 1K9KA 1QVIY 1NX0A 1Y6WA 2I2RE 2BL0C 3LK0A 4XYNA 5D69A 1JWDA 1EG3A 1QTXA 4BY4A 1BR4B 2NZ0A 2O60A 3CTNA 4NQGA 2JOJA 1CFDA 3NSLA 2KI6C 4GPLB 1DJHA 1YUTA 1GQMA 5G08A 1XK4C 3QRXA 3SIAA 1K94A 1SCMC 5KSZA 1HT9A 3DF0B 2H61C 4MZLA 1XFUO 1YVHA 2K8MB 1KFXS 2PMYA 4MVFA 2KGBC 4M2QA 3SG4A 4N1FA 2Y4QA 5AFPA 5KU1A 2BKHB 1NPQA 1NX3A 1PSRA 1WRLA 1JFJA 1KK7Y 4YI8A 4JPZB 2ZNEA 3FS7A 3I5GC 4PE0A 1AJ4A 1MUXA 1JC2A 1J1EA 4NDDA 1Y1XA 1IH0A 1NCXA 2K7DA 5AEQA 3CR5X 2CT9A 1L7ZA 2F33A 1OSAA 2JZIA 2L51A 3LK1A 4UPGA 2AUCA 4N1GA 1NP8A 2P6BB 1PALA 1YTZC 3BUMB 4ZCUA 2M9GA 1QATA 2BKIB 4GGFC 2L0PA 1S6IA 2ZKMX 1IQ5A 1IQ3A 1KSMA 3O78A 1TCOB 4OV2A 3LL8B 3PALA 4YGBB 2KBMA 2M29A 4I5LB 4P2YB 2M7LA 3VRRA 4M2PA 1E8AA 2O5GA 2WCFA 1K90D 3CZTX 1F71A 1AK8A 2FOTA 3ICBA 3SIBA 1SMGA 1SY9A 1YUSA 2K7BA 1K8UA 2LLSA 1RECA 4MZJA 4QJ3B 1CDLA 3JVTB 1A75A 1M45A 2LE9B 3KO0A 1F8HA 1CTRA 2JNFA 1J7PA 2WCEA 3CS1A 2LHLA 1SBJA
chains in the Genus database with same CATH superfamily
1Y1AA 5D7FA 2BECA 1QXPA 4GBAA 3CGAA 2Q4UA 1OW4A 1QX2A 2RGIA 3D75A 5HKYA 1BLQA 2JC2A 1DMOA 4C0JA 1SRAA 1CLBA 2WCKA 4E68A 3KPXA 4OKHA 1G4YR 3NSIA 3AAKA 2LP2A 5HL1A 1AJ5A 2K60A 1DEKA 1OMVA 5HKZA 1KCYA 1IJ6A 3SG5A 2KI6D 1BODA 2LAPA 1JF2A 2COLB 3F45A 4DIRA 1DVIA 1S5GZ 1SYMA 2D8NA 3BXKA 1OMDA 2KSPA 2HQWA 2DOQA 3D73A 3BYAA 1A75B 2Q91A 2JNXA 1IWQA 1UHNA 2CXJA 3GOFA 1SL9A 2WCHA 3EG5B 1M63B 2M3WA 3K1EA 4OZDA 5EL2A 3DVEA 1F54A 4WQ2A 2EHBA 5FI7A 4MZKA 4GAOA 2LLTA 3GK2A 1AHRA 1MQ1A 1S26D 3A8RA 1C7VA 2HQ8A 1TCFA 1SKTA 1FBVA 3CR2A 3AKBA 4ORAB 4INWA 4A4CA 1OOIX 1EH2A 3JVTC 1JUOA 1TIZA 3OX5A 2MHHA 2Y5IA 1TN4A 2MAZA 1S1EA 2K61A 1ALWA 4GFTA 2Y1NA 2K2FA 1ZOTB 2HF5A 4YGDB 1NX2A 1CB1A 3M0WA 1S36A 1TNWA 1S6CA 2IS9A 1S3PA 1YX7A 3BOWA 4R1EA 3SG6A 2GV5A 5DKRA 3SS5A 1QWVA 1CMFA 1V1GA 1H4BA 3D0YA 1AP4A 2JTTA 1B4CA 3N7HA 4GUKA 3VB1A 2L98A 1KWOB 3HCMA 1TTXA 1S6JA 2LMUA 3EVVA 1ZFSA 2JXLA 3LLEA 4DS7A 1PVBA 1MXLC 2M1KB 2F3YA 1CNPA 2ZRSA 4Q04A 4AQIA 4YRUA 1DJWA 3R1PA 1QX5B 1YRUB 2AAOA 2TN4A 1DELA 2F2OA 2M49B 4WRIA 1B7TY 4IL1A 4F0ZB 1BU3A 3L47A 4NDBA 4PT1A 3B6XA 2KBIA 2Y1MA 4FQOA 2VRGA 1V1FA 2JTZA 2JT3A 3EK7A 1XFVO 2I18A 1KK7Z 1SK6D 3DVJA 4JD9A 2KHNA 3BOWB 5ER4X 1L2OB 3RLZA 3AAJA 3E3RA 1R6PA 4CFQA 4CFRA 1WRKA 3B88A 2KQ6A 2SCPA 2LUCA 3SJSA 4MEWA 2FCDA 1IRJA 3CZ1A 2BCAA 2WNDA 2KLEA 4PHMA 2KFGA 5I94A 2E6WA 4JWQA 1C7WA 3I5HB 4ORBB 4PDZA 1PVAA 3KHEA 4ETOA 2KAXA 2M7NA 1ALVA 3D76A 2FCEA 2SASA 4HSZA 3R1OA 1NYAA 2E30A 1CFFA 2PASA 1B8RA 3UO9A 4MLWA 3BFBA 1CDPA 2LUXA 1CKKA 3MSEB 1N2DA 5HKWA 1W7JB 3WHUB 1CLLA 3RM1A 2CTNA 1QLSA 1KWOC 2KYCA 1HQVA 1A2XA 1EG4A 1YX8A 1J7QA 2PRUA 1BT6A 1Q80A 1F55A 1B9AA 1M46A 1EL4A 3TDIA 1PULA 1SW8A 2PVBA 3B7AA 3OB1B 4YGAA 3VROA 1XVJA 2LM5A 2KAVA 2WOSA 4MRYA 2BBNA 3R1VA 3VRPA 1QASA 1JSAA 3DXLA 3GK1A 2V53A 3CR4X 3PLFB 1NIWA 1UHJA 5AANA 3WXAA 3EVUA 2WCLA 3L4LA 1G8IA 3WNXB 1GJYA 1DC1A 5JOLA 3BUWB 1BMOA 3CWGA 3DVMA 1CFCA 1L2OC 1SL7A 3EVRA 4ORCB 1DTLA 2MRDA 2NCPA 4XJKA 1AVSA 1KFUS 1QV1A 3BUOB 4DUQA 1TOPA 4JKTA 3B86A 2ZFDA 1FI5A 3S0DA 2F8PA 3IQQA 1UUSA 1OZSA 1IGVA 1SNLA 2LVJA 3I5HC 5DKQA 4C0LA 3SS4A 4M2OA 4YBHB 2ZN9A 1KFXL 5F6TA 1K9UA 2I94A 1RWYA 4P5OE 3S0AA 3FE9A 5AERA 1QLKA 3SG3A 1PK0D 1YURA 1B8LA 2LLUA 1K96A 1OQPA 3D78A 3DD4A 4L9MA 3A4UB 2JT0A 1LS8A 2M97A 1KSOA 2K7CA 2KYFA 1TNXA 3PN7B 2LHIA 2QDIA 3CZ2A 3O6BA 3OX6A 1LKJA 1WDCB 3IVTA 4AQJA 4U8DA 5I2OA 1XK4A 1N65A 1XFZO 1UHHA 3CYZA 2H61A 3EKJA 4PHJA 5CPVA 3EK4A 5IBWA 1T14A 2ZN8A 3UNWA 1XFRA 2NCOA 1CDMA 1MR8A 2MLEC 1W7IB 1R2UA 2PSRA 2KGRA 1IKUA 1EJ3A 1MWNA 2A4JA 3PJIA 1U5IA 2EC6B 1DF0A 1WLMA 3DZTA 1F4OA 2M1UA 4GGNA 1ZMZA 1DJXA 1CLMA 4C0KA 2K2AA 1SR6B 2LNKA 2LVVA 1EXRA 2ZNDA 2GGZA 2JRFA 3CDNA 1JFKA 1K93D 1QVIZ 3PSRA 2WC6A 3V2LA 1M31A 3FE8A 2KLDA 2LHLA 3KEVA 1YVLA 1KQMB 2JULA 4I5NB 1RROA 1BG1A 4OCIA 5DICA 3BUNB 1KK8B 1OOHA 3EK8A 1MXEA 1S5GY 3ZNIA 1GGZA 5AXIA 4ZCVA 1NX1A 1B47A 1B7TZ 1NCZA 2L2CA 2LANA 1J55A 3SG7A 5GQQC 5CSNA 3WHTB 2KI4B 5FYXA 3TDZA 1KQVA 2MA2A 4PE1A 3LCPC 1MHOA 3PN7C 1XYDA 5I8NA 3BJHA 1U5IB 2CNPA 2LVKA 1A03A 1WDCC 1B8CA 1JF0A 2NLNA 1LVCD 1RJVA 1WY9A 1B1GA 2JT8A 3TUYB 3NSKA 4CLNA 3BQ3A 1NCYA 4QJ5B 4MN0A 2KPHA 2KOTA 4NDCA 2BCBA 2KFFA 5HLVA 1QIVA 2KNEA 1PSBA 2NXQA 3FWBA 4OR9B 3D0YB 1RK9A 1Z2CB 2EC6C 1J7RA 2WORA 2L5XB 3TDUA 4PHKA 1SR6C 3D77A 3OBVA 1XA5A 2LMTA 3BUXB 3NGVA 3FWCA 1Y0VH 2QEOA 1GM0A 3NXAA 2KFHA 4USLA 1C07A 3AKAA 5CSJA 1C3YA 4DRWA 1BJFA 1JBAA 2JU0A 4JQ0D 1LINA 1KQMC 2FJUB 1TNPA 2L4HA 1FW4A 4GNKB 1NUBA 1KK8C 1A4PA 3K21A 3TZ1A 1FI6A 1LXFC 1FF1A 2OS8B 1K9PA 4I5KA 4D1EA 4YGCB 5I2QA 4PALA 3Q8IA 2BBMA 2KI4C 4F7FA 2P70A 2H2KA 1WLZA 1UWOA 3R72A 1RTP1 1WRZA 4PCWA 1N0YA 1ZACA 2L50A 3D10A 5HYDA 1FPWA 3IF7A 3TUYC 1PRWA 2L4IA 3C1VA 3I5IB 3CLNA 2WCJA 3VRNA 4YGEB 3S0BA 1UURA 3JTDB 1CMGA 1NSHA 2LVIA 2ZRTA 5FI2A 2BE4A 3ZWHA 1TWOA 4DCKA 1OZOA 4BY5A 2HETA 1TNQA 2ISDA 3PATA 1XFWO 4OVNF 2CBLA 1H8BA 1IG5A 1W9ZA 2OTGB 2JPTA 3SS3A 1CM4A 2EGDA 4AOMA 3OGNA 5PALA 2F3ZA 1QV0A 5BPJA 2JQ6A 2LP3A 3OP0A 1SPYA 3DYEA 4TNCA 3L4AA 5CSFA 1XO5A 2GGMA 1DT7B 2LV7A 1BF5A 1UHIA 1M39A 3O4YA 3O4XA 5K89A 1X02A 1QJTA 1SCVA 4QJ4B 1TRFA 1K95A 3I5FB 3RZSA 4YI9A 1LA3A 4HRHA 1UP5A 2OS8C 4FTGA 1LA0A 1OMRA 1F4QA 1QX7A 2GTEA 2L5YA 3QMEA 2M8UA 2K0JA 1J1DA 1A29A 1DJZA 1QS7A 1SL8A 3B87A 1TUJA 1YR5A 1BR1B 3IQOA 4XJKB 5JJGA 3H4SE 5D3OA 2OPOA 2JWWA 1YRTB 1IIOA 1MF8B 2AMIA 3NSOA 4CIDA 1OOJA 2PYQA 1RFJA 1Z4HA 4N5XA 1DGUA 2F2PA 3OB2B 3VGOA 1GGWA 3I5IC 3TS5B 3OHMB 2MBXA 2M0RA 4HREE 3JTDC 1DQEA 1TUZA 2BL0B 2MLFC 2HPSA 2KQYA 2YGUA 3KF9A 5HLOA 2LC5A 2R2IA 2LCPA 1QIWA 2K7OA 2WCBA 3GK4X 4HRGA 4A4BA 4ICBA 1CDNA 2OTGC 1ZUZA 3VRQA 1ODBA 1OE9B 1XFYO 5TNCA 1G33A 1XFXO 1CM1A 1OOFA 4PHNA 4PE4A 4PE7A 2BE6A 1YUUA 3FIAA 5DKNA 3PFVA 2B1UA 4I5JA 5J3XA 1IJ5A 3O2PA 4CPVA 2PALA 3SG2A 5B8IB 1KFUL 1Y1UA 1SCMB 1DJGA 2L2EA 2WC8A 5ER5A 2G9BA 2I7AA 2QACA 3I5FC 1VRKA 4GGFA 4WQ3A 5CSIA 5KTYA 1D1OA 1DJIA 1UHKA 1F70A 2MJWB 1K2HA 4MBEA 3DVKA 2KAYA 3HX4A 3I5GB 1CFPA 3EKHA 1DF0B 1P28A 1DJYA 1NWDA 1AUIB 5I2LA 1BOCA 2G2BA 3DF0A 5FI6A 2JXCA 2KDHA 1DGVA 3NHIA 3PM8A 4KYNA 2BCXA 2LMVA 3TS5C 1J7OA 2CCMA 4MRXA 2QEBA 4MSPA 2QPTA 1K9KA 1QVIY 1NX0A 1Y6WA 2I2RE 2P71A 2BL0C 3LK0A 4XYNA 5D69A 2QEHA 1JWDA 1EG3A 1QTXA 2WCMA 1OOGA 4BY4A 3FE6A 1BR4B 1ORGA 2NZ0A 2O60A 3CTNA 4NQGA 2JOJA 1CFDA 3NSLA 3S0FA 2KI6C 2WC5A 4GPLB 3D74A 1DJHA 1YUTA 1GQMA 5G08A 1XK4C 3QRXA 3SIAA 1K94A 1SCMC 2ERBA 1HT9A 5KSZA 3DF0B 2H61C 4MZLA 1XFUO 1YVHA 2K8MB 1KFXS 2PMYA 4MVFA 2KGBC 4M2QA 3SG4A 4N1FA 2Y4QA 5AFPA 5KU1A 2BKHB 1NPQA 1NX3A 1PSRA 1WRLA 2PQLA 1JFJA 1KK7Y 4YI8A 3PM2A 3BFHA 4JPZB 2ZNEA 3FS7A 3I5GC 4PE0A 1AJ4A 1MUXA 1JC2A 1J1EA 4NDDA 1Y1XA 3CZ0A 1IH0A 1NCXA 2K7DA 5AEQA 3CR5X 3S0GA 2CT9A 1L7ZA 2F33A 4IJ7A 3DY9A 1OSAA 2JZIA 2L51A 3LK1A 4UPGA 2AUCA 1SSEB 4N1GA 1NP8A 2P6BB 1PALA 1YTZC 2JPOA 3BUMB 4ZCUA 2M9GA 1QATA 2FJYA 3CABA 2BKIB 4GGFC 2L0PA 1S6IA 2ZKMX 3NHTA 1IQ5A 1IQ3A 1KSMA 3O78A 1TCOB 2QEVA 4OV2A 3LL8B 2BNXA 3PALA 4YGBB 2KBMA 2M29A 4I5LB 4P2YB 2M7LA 3VRRA 4M2PA 1E8AA 2O5GA 2WCFA 1K90D 3CZTX 1F71A 1AK8A 3S0EA 2FOTA 3ICBA 3SIBA 1SMGA 1SY9A 1YUSA 2K7BA 1K8UA 2LLSA 2BAPA 2H8VA 1RECA 3BFAA 4MZJA 4QJ3B 1CDLA 3JVTB 4INXA 1A75A 1M45A 2LE9B 3KO0A 1F8HA 1CTRA 2JNFA 1J7PA 4FQTA 2WCEA 3CS1A 1C3ZA 1SBJA
chains in the Genus database with same CATH topology
1Y1AA 5D7FA 2BECA 1QXPA 4GBAA 3CGAA 2Q4UA 1QX2A 2RGIA 5HKYA 1BLQA 1DMOA 2JC2A 4C0JA 1SRAA 1CLBA 4E68A 3KPXA 4OKHA 1G4YR 3NSIA 3AAKA 2LP2A 1AJ5A 1KCYA 1OMVA 5HKZA 1IJ6A 3SG5A 2KI6D 1BODA 2LAPA 1JF2A 2COLB 3F45A 4DIRA 1DVIA 1S5GZ 1SYMA 2D8NA 3BXKA 1OMDA 2KSPA 2HQWA 2DOQA 3BYAA 1A75B 2Q91A 2JNXA 1IWQA 1UHNA 2CXJA 3GOFA 1SL9A 1M63B 2M3WA 3DVEA 1F54A 4WQ2A 2EHBA 4MZKA 4GAOA 2LLTA 3GK2A 1AHRA 1MQ1A 1S26D 3A8RA 1C7VA 2HQ8A 1TCFA 1SKTA 1FBVA 3CR2A 3AKBA 4ORAB 4A4CA 1EH2A 3JVTC 1JUOA 1TIZA 3OX5A 2MHHA 2Y5IA 1TN4A 2MAZA 1S1EA 2K61A 1ALWA 4GFTA 2Y1NA 2K2FA 1ZOTB 2HF5A 4YGDB 1NX2A 1CB1A 3M0WA 1S36A 1TNWA 1S6CA 2IS9A 1S3PA 1YX7A 3BOWA 4R1EA 3SG6A 2GV5A 5DKRA 1CMFA 1V1GA 1H4BA 3D0YA 1AP4A 2JTTA 1B4CA 4GUKA 2L98A 1KWOB 3HCMA 1TTXA 1S6JA 2LMUA 3EVVA 1ZFSA 2JXLA 3LLEA 4DS7A 1PVBA 1MXLC 2M1KB 2F3YA 1CNPA 2ZRSA 4Q04A 4AQIA 4YRUA 1DJWA 1QX5B 1YRUB 2AAOA 2TN4A 2F2OA 2M49B 4WRIA 1B7TY 4IL1A 4F0ZB 1BU3A 4NDBA 2KBIA 2Y1MA 4FQOA 2VRGA 1V1FA 2JTZA 2JT3A 3EK7A 1XFVO 2I18A 1KK7Z 1SK6D 3DVJA 2KHNA 3BOWB 5ER4X 1L2OB 3RLZA 3AAJA 3E3RA 1R6PA 4CFQA 4CFRA 1WRKA 2KQ6A 2SCPA 2LUCA 3SJSA 4MEWA 2FCDA 1IRJA 2BCAA 2WNDA 4PHMA 2KFGA 2E6WA 4JWQA 1C7WA 3I5HB 4ORBB 4PDZA 1PVAA 3KHEA 4ETOA 2KAXA 2M7NA 1ALVA 4HSZA 2FCEA 2SASA 1NYAA 2E30A 1CFFA 2PASA 1B8RA 4MLWA 1CDPA 2LUXA 1CKKA 3MSEB 1N2DA 5HKWA 1W7JB 3WHUB 1CLLA 3RM1A 2CTNA 1QLSA 1KWOC 2KYCA 1HQVA 1A2XA 1EG4A 1YX8A 1J7QA 2PRUA 1BT6A 1Q80A 1F55A 1B9AA 1M46A 1EL4A 3TDIA 1PULA 1SW8A 2PVBA 3OB1B 4YGAA 3VROA 1XVJA 2LM5A 2KAVA 2WOSA 4MRYA 2BBNA 3VRPA 1QASA 1JSAA 3GK1A 2V53A 3CR4X 3PLFB 1NIWA 1UHJA 5AANA 3WXAA 3EVUA 1G8IA 3WNXB 1GJYA 5JOLA 3BUWB 1BMOA 3CWGA 3DVMA 1CFCA 1L2OC 1SL7A 3EVRA 4ORCB 1DTLA 2MRDA 2NCPA 4XJKA 1AVSA 1KFUS 1QV1A 3BUOB 4DUQA 1TOPA 2ZFDA 1FI5A 2F8PA 3IQQA 1UUSA 1OZSA 1IGVA 1SNLA 2LVJA 3I5HC 5DKQA 4C0LA 4M2OA 4YBHB 2ZN9A 1KFXL 5F6TA 1K9UA 2I94A 1RWYA 4P5OE 5AERA 1QLKA 3SG3A 1PK0D 1YURA 1B8LA 2LLUA 1K96A 1OQPA 3DD4A 4L9MA 3A4UB 2JT0A 2M97A 1KSOA 2K7CA 2KYFA 1TNXA 3PN7B 2LHIA 3O6BA 3OX6A 1LKJA 1WDCB 4AQJA 4U8DA 5I2OA 1XK4A 1N65A 1XFZO 1UHHA 5CPVA 2H61A 3EKJA 4PHJA 5IBWA 3EK4A 2ZN8A 2NCOA 1CDMA 1MR8A 2MLEC 1W7IB 1R2UA 2PSRA 2KGRA 1IKUA 1EJ3A 1MWNA 2A4JA 1U5IA 2EC6B 1DF0A 1WLMA 1F4OA 2M1UA 4GGNA 1ZMZA 1DJXA 1CLMA 4C0KA 2K2AA 1SR6B 2LNKA 2LVVA 1EXRA 2ZNDA 2GGZA 2JRFA 1JFKA 1K93D 1QVIZ 3PSRA 1M31A 3KEVA 1YVLA 1KQMB 2JULA 4I5NB 1RROA 1BG1A 4OCIA 3BUNB 1KK8B 3EK8A 1MXEA 1S5GY 3ZNIA 1GGZA 5AXIA 4ZCVA 1NX1A 1B47A 1B7TZ 1NCZA 2LANA 1J55A 3SG7A 5GQQC 5CSNA 3WHTB 2KI4B 5FYXA 3TDZA 1KQVA 2MA2A 4PE1A 3LCPC 1MHOA 3PN7C 1XYDA 5I8NA 1U5IB 2CNPA 2LVKA 1A03A 1WDCC 1B8CA 1JF0A 2NLNA 1LVCD 1RJVA 1WY9A 1B1GA 2JT8A 3TUYB 3NSKA 4CLNA 3BQ3A 1NCYA 4QJ5B 4MN0A 2KOTA 4NDCA 2BCBA 2KFFA 5HLVA 1QIVA 2KNEA 1PSBA 2NXQA 3FWBA 4OR9B 3D0YB 1RK9A 2EC6C 1J7RA 2WORA 2L5XB 3TDUA 4PHKA 1SR6C 1XA5A 2LMTA 3BUXB 3FWCA 1Y0VH 3NXAA 2KFHA 4USLA 1C07A 3AKAA 5CSJA 4DRWA 1BJFA 1JBAA 2JU0A 4JQ0D 1LINA 1KQMC 2FJUB 1TNPA 2L4HA 1FW4A 4GNKB 1NUBA 1KK8C 1A4PA 3K21A 3TZ1A 1FI6A 1LXFC 1FF1A 2OS8B 1K9PA 4I5KA 4D1EA 4YGCB 5I2QA 4PALA 2BBMA 2KI4C 2H2KA 1WLZA 1UWOA 1RTP1 1WRZA 4PCWA 1N0YA 1ZACA 2L50A 3D10A 5HYDA 1FPWA 3IF7A 3TUYC 1PRWA 2L4IA 3C1VA 3I5IB 3CLNA 3VRNA 4YGEB 1UURA 3JTDB 1CMGA 1NSHA 2LVIA 2ZRTA 3ZWHA 2BE4A 4DCKA 1OZOA 4BY5A 2HETA 1TNQA 2ISDA 3PATA 1XFWO 4OVNF 2CBLA 1H8BA 1IG5A 2OTGB 2JPTA 1CM4A 2EGDA 4AOMA 5PALA 5BPJA 2F3ZA 1QV0A 2JQ6A 2LP3A 3OP0A 1SPYA 5CSFA 4TNCA 1XO5A 2GGMA 1DT7B 2LV7A 1BF5A 1UHIA 1M39A 3O4YA 5K89A 1X02A 1QJTA 1SCVA 4QJ4B 1TRFA 1K95A 3I5FB 4YI9A 1LA3A 4HRHA 1UP5A 2OS8C 4FTGA 1LA0A 1OMRA 1F4QA 1QX7A 2M8UA 2K0JA 1J1DA 1A29A 1DJZA 1QS7A 1SL8A 3IQOA 5JJGA 1BR1B 1YR5A 4XJKB 3H4SE 2OPOA 2JWWA 1YRTB 1MF8B 2AMIA 3NSOA 4CIDA 1OOJA 1RFJA 4N5XA 1DGUA 2F2PA 3OB2B 3VGOA 1GGWA 3I5IC 3TS5B 3OHMB 2MBXA 2M0RA 4HREE 3JTDC 2BL0B 2MLFC 2HPSA 2KQYA 3KF9A 5HLOA 2LC5A 2R2IA 2LCPA 1QIWA 2K7OA 2WCBA 3GK4X 4HRGA 4A4BA 4ICBA 1CDNA 2OTGC 1ZUZA 3VRQA 1ODBA 1OE9B 1XFYO 5TNCA 1G33A 1XFXO 1CM1A 4PHNA 4PE4A 4PE7A 2BE6A 1YUUA 3FIAA 5DKNA 3PFVA 2B1UA 4I5JA 5J3XA 1IJ5A 3O2PA 4CPVA 2PALA 3SG2A 5B8IB 1KFUL 1Y1UA 1SCMB 1DJGA 2L2EA 2WC8A 5ER5A 2G9BA 2I7AA 2QACA 3I5FC 1VRKA 4GGFA 4WQ3A 5CSIA 5KTYA 1D1OA 1DJIA 1UHKA 1F70A 2MJWB 1K2HA 4MBEA 3DVKA 2KAYA 3HX4A 3I5GB 1CFPA 3EKHA 1DF0B 1DJYA 1NWDA 1AUIB 5I2LA 1BOCA 2G2BA 3DF0A 2JXCA 2KDHA 1DGVA 3PM8A 2BCXA 2LMVA 3TS5C 1J7OA 2CCMA 4MRXA 4MSPA 2QPTA 1K9KA 1QVIY 1NX0A 1Y6WA 2I2RE 2BL0C 3LK0A 4XYNA 5D69A 1JWDA 1EG3A 1QTXA 4BY4A 1BR4B 2NZ0A 2O60A 3CTNA 4NQGA 2JOJA 1CFDA 3NSLA 2KI6C 4GPLB 1DJHA 1YUTA 1GQMA 5G08A 1XK4C 3QRXA 3SIAA 1K94A 1SCMC 5KSZA 1HT9A 3DF0B 2H61C 4MZLA 1XFUO 1YVHA 2K8MB 1KFXS 2PMYA 4MVFA 2KGBC 4M2QA 3SG4A 4N1FA 2Y4QA 5AFPA 5KU1A 2BKHB 1NPQA 1NX3A 1PSRA 1WRLA 1JFJA 1KK7Y 4YI8A 4JPZB 2ZNEA 3FS7A 3I5GC 4PE0A 1AJ4A 1MUXA 1JC2A 1J1EA 4NDDA 1Y1XA 1IH0A 1NCXA 2K7DA 5AEQA 3CR5X 2CT9A 1L7ZA 2F33A 1OSAA 2JZIA 2L51A 3LK1A 4UPGA 2AUCA 4N1GA 1NP8A 2P6BB 1PALA 1YTZC 3BUMB 4ZCUA 2M9GA 1QATA 2BKIB 4GGFC 2L0PA 1S6IA 2ZKMX 1IQ5A 1IQ3A 1KSMA 3O78A 1TCOB 4OV2A 3LL8B 3PALA 4YGBB 2KBMA 2M29A 4I5LB 4P2YB 2M7LA 3VRRA 4M2PA 1E8AA 2O5GA 2WCFA 1K90D 3CZTX 1F71A 1AK8A 2FOTA 3ICBA 3SIBA 1SMGA 1SY9A 1YUSA 2K7BA 1K8UA 2LLSA 1RECA 4MZJA 4QJ3B 1CDLA 3JVTB 1A75A 1M45A 2LE9B 3KO0A 1F8HA 1CTRA 2JNFA 1J7PA 2WCEA 3CS1A 2LHLA 1SBJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1A A;  5D7F A;  2BEC A;  1QXP A;  4GBA A;  3CGA A;  2Q4U A;  1QX2 A;  2RGI A;  5HKY A;  1BLQ A;  1DMO A;  2JC2 A;  4C0J A;  1SRA A;  1CLB A;  4E68 A;  3KPX A;  4OKH A;  1G4Y R;  3NSI A;  3AAK A;  2LP2 A;  1AJ5 A;  1KCY A;  1OMV A;  5HKZ A;  1IJ6 A;  3SG5 A;  2KI6 D;  1BOD A;  2LAP A;  1JF2 A;  2COL B;  3F45 A;  4DIR A;  1DVI A;  1S5G Z;  1SYM A;  2D8N A;  3BXK A;  1OMD A;  2KSP A;  2HQW A;  2DOQ A;  3BYA A;  1A75 B;  2Q91 A;  2JNX A;  1IWQ A;  1UHN A;  2CXJ A;  3GOF A;  1SL9 A;  1M63 B;  2M3W A;  3DVE A;  1F54 A;  4WQ2 A;  2EHB A;  4MZK A;  4GAO A;  2LLT A;  3GK2 A;  1AHR A;  1MQ1 A;  1S26 D;  3A8R A;  1C7V A;  2HQ8 A;  1TCF A;  1SKT A;  1FBV A;  3CR2 A;  3AKB A;  4ORA B;  4A4C A;  1EH2 A;  3JVT C;  1JUO A;  1TIZ A;  3OX5 A;  2MHH A;  2Y5I A;  1TN4 A;  2MAZ A;  1S1E A;  2K61 A;  1ALW A;  4GFT A;  2Y1N A;  2K2F A;  1ZOT B;  2HF5 A;  4YGD B;  1NX2 A;  1CB1 A;  3M0W A;  1S36 A;  1TNW A;  1S6C A;  2IS9 A;  1S3P A;  1YX7 A;  3BOW A;  4R1E A;  3SG6 A;  2GV5 A;  5DKR A;  1CMF A;  1V1G A;  1H4B A;  3D0Y A;  1AP4 A;  2JTT A;  1B4C A;  4GUK A;  2L98 A;  1KWO B;  3HCM A;  1TTX A;  1S6J A;  2LMU A;  3EVV A;  1ZFS A;  2JXL A;  3LLE A;  4DS7 A;  1PVB A;  1MXL C;  2M1K B;  2F3Y A;  1CNP A;  2ZRS A;  4Q04 A;  4AQI A;  4YRU A;  1DJW A;  1QX5 B;  1YRU B;  2AAO A;  2TN4 A;  2F2O A;  2M49 B;  4WRI A;  1B7T Y;  4IL1 A;  4F0Z B;  1BU3 A;  4NDB A;  2KBI A;  2Y1M A;  4FQO A;  2VRG A;  1V1F A;  2JTZ A;  2JT3 A;  3EK7 A;  1XFV O;  2I18 A;  1KK7 Z;  1SK6 D;  3DVJ A;  2KHN A;  3BOW B;  5ER4 X;  1L2O B;  3RLZ A;  3AAJ A;  3E3R A;  1R6P A;  4CFQ A;  4CFR A;  1WRK A;  2KQ6 A;  2SCP A;  2LUC A;  3SJS A;  4MEW A;  2FCD A;  1IRJ A;  2BCA A;  2WND A;  4PHM A;  2KFG A;  2E6W A;  4JWQ A;  1C7W A;  3I5H B;  4ORB B;  4PDZ A;  1PVA A;  3KHE A;  4ETO A;  2KAX A;  2M7N A;  1ALV A;  4HSZ A;  2FCE A;  2SAS A;  1NYA A;  2E30 A;  1CFF A;  2PAS A;  1B8R A;  4MLW A;  1CDP A;  2LUX A;  1CKK A;  3MSE B;  1N2D A;  5HKW A;  1W7J B;  3WHU B;  1CLL A;  3RM1 A;  2CTN A;  1QLS A;  1KWO C;  2KYC A;  1HQV A;  1A2X A;  1EG4 A;  1YX8 A;  1J7Q A;  2PRU A;  1BT6 A;  1Q80 A;  1F55 A;  1B9A A;  1M46 A;  1EL4 A;  3TDI A;  1PUL A;  1SW8 A;  2PVB A;  3OB1 B;  4YGA A;  3VRO A;  1XVJ A;  2LM5 A;  2KAV A;  2WOS A;  4MRY A;  2BBN A;  3VRP A;  1QAS A;  1JSA A;  3GK1 A;  2V53 A;  3CR4 X;  3PLF B;  1NIW A;  1UHJ A;  5AAN A;  3WXA A;  3EVU A;  1G8I A;  3WNX B;  1GJY A;  5JOL A;  3BUW B;  1BMO A;  3CWG A;  3DVM A;  1CFC A;  1L2O C;  1SL7 A;  3EVR A;  4ORC B;  1DTL A;  2MRD A;  2NCP A;  4XJK A;  1AVS A;  1KFU S;  1QV1 A;  3BUO B;  4DUQ A;  1TOP A;  2ZFD A;  1FI5 A;  2F8P A;  3IQQ A;  1UUS A;  1OZS A;  1IGV A;  1SNL A;  2LVJ A;  3I5H C;  5DKQ A;  4C0L A;  4M2O A;  4YBH B;  2ZN9 A;  1KFX L;  5F6T A;  1K9U A;  2I94 A;  1RWY A;  4P5O E;  5AER A;  1QLK A;  3SG3 A;  1PK0 D;  1YUR A;  1B8L A;  2LLU A;  1K96 A;  1OQP A;  3DD4 A;  4L9M A;  3A4U B;  2JT0 A;  2M97 A;  1KSO A;  2K7C A;  2KYF A;  1TNX A;  3PN7 B;  2LHI A;  3O6B A;  3OX6 A;  1LKJ A;  1WDC B;  4AQJ A;  4U8D A;  5I2O A;  1XK4 A;  1N65 A;  1XFZ O;  1UHH A;  5CPV A;  2H61 A;  3EKJ A;  4PHJ A;  5IBW A;  3EK4 A;  2ZN8 A;  2NCO A;  1CDM A;  1MR8 A;  2MLE C;  1W7I B;  1R2U A;  2PSR A;  2KGR A;  1IKU A;  1EJ3 A;  1MWN A;  2A4J A;  1U5I A;  2EC6 B;  1DF0 A;  1WLM A;  1F4O A;  2M1U A;  4GGN A;  1ZMZ A;  1DJX A;  1CLM A;  4C0K A;  2K2A A;  1SR6 B;  2LNK A;  2LVV A;  1EXR A;  2ZND A;  2GGZ A;  2JRF A;  1JFK A;  1K93 D;  1QVI Z;  3PSR A;  1M31 A;  3KEV A;  1YVL A;  1KQM B;  2JUL A;  4I5N B;  1RRO A;  1BG1 A;  4OCI A;  3BUN B;  1KK8 B;  3EK8 A;  1MXE A;  1S5G Y;  3ZNI A;  1GGZ A;  5AXI A;  4ZCV A;  1NX1 A;  1B47 A;  1B7T Z;  1NCZ A;  2LAN A;  1J55 A;  3SG7 A;  5GQQ C;  5CSN A;  3WHT B;  2KI4 B;  5FYX A;  3TDZ A;  1KQV A;  2MA2 A;  4PE1 A;  3LCP C;  1MHO A;  3PN7 C;  1XYD A;  5I8N A;  1U5I B;  2CNP A;  2LVK A;  1A03 A;  1WDC C;  1B8C A;  1JF0 A;  2NLN A;  1LVC D;  1RJV A;  1WY9 A;  1B1G A;  2JT8 A;  3TUY B;  3NSK A;  4CLN A;  3BQ3 A;  1NCY A;  4QJ5 B;  4MN0 A;  2KOT A;  4NDC A;  2BCB A;  2KFF A;  5HLV A;  1QIV A;  2KNE A;  1PSB A;  2NXQ A;  3FWB A;  4OR9 B;  3D0Y B;  1RK9 A;  2EC6 C;  1J7R A;  2WOR A;  2L5X B;  3TDU A;  4PHK A;  1SR6 C;  1XA5 A;  2LMT A;  3BUX B;  3FWC A;  1Y0V H;  3NXA A;  2KFH A;  4USL A;  1C07 A;  3AKA A;  5CSJ A;  4DRW A;  1BJF A;  1JBA A;  2JU0 A;  4JQ0 D;  1LIN A;  1KQM C;  2FJU B;  1TNP A;  2L4H A;  1FW4 A;  4GNK B;  1NUB A;  1KK8 C;  1A4P A;  3K21 A;  3TZ1 A;  1FI6 A;  1LXF C;  1FF1 A;  2OS8 B;  1K9P A;  4I5K A;  4D1E A;  4YGC B;  5I2Q A;  4PAL A;  2BBM A;  2KI4 C;  2H2K A;  1WLZ A;  1UWO A;  1RTP 1;  1WRZ A;  4PCW A;  1N0Y A;  1ZAC A;  2L50 A;  3D10 A;  5HYD A;  1FPW A;  3IF7 A;  3TUY C;  1PRW A;  2L4I A;  3C1V A;  3I5I B;  3CLN A;  3VRN A;  4YGE B;  1UUR A;  3JTD B;  1CMG A;  1NSH A;  2LVI A;  2ZRT A;  3ZWH A;  2BE4 A;  4DCK A;  1OZO A;  4BY5 A;  2HET A;  1TNQ A;  2ISD A;  3PAT A;  1XFW O;  4OVN F;  2CBL A;  1H8B A;  1IG5 A;  2OTG B;  2JPT A;  1CM4 A;  2EGD A;  4AOM A;  5PAL A;  5BPJ A;  2F3Z A;  1QV0 A;  2JQ6 A;  2LP3 A;  3OP0 A;  1SPY A;  5CSF A;  4TNC A;  1XO5 A;  2GGM A;  1DT7 B;  2LV7 A;  1BF5 A;  1UHI A;  1M39 A;  3O4Y A;  5K89 A;  1X02 A;  1QJT A;  1SCV A;  4QJ4 B;  1TRF A;  1K95 A;  3I5F B;  4YI9 A;  1LA3 A;  4HRH A;  1UP5 A;  2OS8 C;  4FTG A;  1LA0 A;  1OMR A;  1F4Q A;  1QX7 A;  2M8U A;  2K0J A;  1J1D A;  1A29 A;  1DJZ A;  1QS7 A;  1SL8 A;  3IQO A;  5JJG A;  1BR1 B;  1YR5 A;  4XJK B;  3H4S E;  2OPO A;  2JWW A;  1YRT B;  1MF8 B;  2AMI A;  3NSO A;  4CID A;  1OOJ A;  1RFJ A;  4N5X A;  1DGU A;  2F2P A;  3OB2 B;  3VGO A;  1GGW A;  3I5I C;  3TS5 B;  3OHM B;  2MBX A;  2M0R A;  4HRE E;  3JTD C;  2BL0 B;  2MLF C;  2HPS A;  2KQY A;  3KF9 A;  5HLO A;  2LC5 A;  2R2I A;  2LCP A;  1QIW A;  2K7O A;  2WCB A;  3GK4 X;  4HRG A;  4A4B A;  4ICB A;  1CDN A;  2OTG C;  1ZUZ A;  3VRQ A;  1ODB A;  1OE9 B;  1XFY O;  5TNC A;  1G33 A;  1XFX O;  1CM1 A;  4PHN A;  4PE4 A;  4PE7 A;  2BE6 A;  1YUU A;  3FIA A;  5DKN A;  3PFV A;  2B1U A;  4I5J A;  5J3X A;  1IJ5 A;  3O2P A;  4CPV A;  2PAL A;  3SG2 A;  5B8I B;  1KFU L;  1Y1U A;  1SCM B;  1DJG A;  2L2E A;  2WC8 A;  5ER5 A;  2G9B A;  2I7A A;  2QAC A;  3I5F C;  1VRK A;  4GGF A;  4WQ3 A;  5CSI A;  5KTY A;  1D1O A;  1DJI A;  1UHK A;  1F70 A;  2MJW B;  1K2H A;  4MBE A;  3DVK A;  2KAY A;  3HX4 A;  3I5G B;  1CFP A;  3EKH A;  1DF0 B;  1DJY A;  1NWD A;  1AUI B;  5I2L A;  1BOC A;  2G2B A;  3DF0 A;  2JXC A;  2KDH A;  1DGV A;  3PM8 A;  2BCX A;  2LMV A;  3TS5 C;  1J7O A;  2CCM A;  4MRX A;  4MSP A;  2QPT A;  1K9K A;  1QVI Y;  1NX0 A;  1Y6W A;  2I2R E;  2BL0 C;  3LK0 A;  4XYN A;  5D69 A;  1JWD A;  1EG3 A;  1QTX A;  4BY4 A;  1BR4 B;  2NZ0 A;  2O60 A;  3CTN A;  4NQG A;  2JOJ A;  1CFD A;  3NSL A;  2KI6 C;  4GPL B;  1DJH A;  1YUT A;  1GQM A;  5G08 A;  1XK4 C;  3QRX A;  3SIA A;  1K94 A;  1SCM C;  5KSZ A;  1HT9 A;  3DF0 B;  2H61 C;  4MZL A;  1XFU O;  1YVH A;  2K8M B;  1KFX S;  2PMY A;  4MVF A;  2KGB C;  4M2Q A;  3SG4 A;  4N1F A;  2Y4Q A;  5AFP A;  5KU1 A;  2BKH B;  1NPQ A;  1NX3 A;  1PSR A;  1WRL A;  1JFJ A;  1KK7 Y;  4YI8 A;  4JPZ B;  2ZNE A;  3FS7 A;  3I5G C;  4PE0 A;  1AJ4 A;  1MUX A;  1JC2 A;  1J1E A;  4NDD A;  1Y1X A;  1IH0 A;  1NCX A;  2K7D A;  5AEQ A;  3CR5 X;  2CT9 A;  1L7Z A;  2F33 A;  1OSA A;  2JZI A;  2L51 A;  3LK1 A;  4UPG A;  2AUC A;  4N1G A;  1NP8 A;  2P6B B;  1PAL A;  1YTZ C;  3BUM B;  4ZCU A;  2M9G A;  1QAT A;  2BKI B;  4GGF C;  2L0P A;  1S6I A;  2ZKM X;  1IQ5 A;  1IQ3 A;  1KSM A;  3O78 A;  1TCO B;  4OV2 A;  3LL8 B;  3PAL A;  4YGB B;  2KBM A;  2M29 A;  4I5L B;  4P2Y B;  2M7L A;  3VRR A;  4M2P A;  1E8A A;  2O5G A;  2WCF A;  1K90 D;  3CZT X;  1F71 A;  1AK8 A;  2FOT A;  3ICB A;  3SIB A;  1SMG A;  1SY9 A;  1YUS A;  2K7B A;  1K8U A;  2LLS A;  1REC A;  4MZJ A;  4QJ3 B;  1CDL A;  3JVT B;  1A75 A;  1M45 A;  2LE9 B;  3KO0 A;  1F8H A;  1CTR A;  2JNF A;  1J7P A;  2WCE A;  3CS1 A;  2LHL A;  1SBJ A; 
#chains in the Genus database with same CATH topology
 1Y1A A;  5D7F A;  2BEC A;  1QXP A;  4GBA A;  3CGA A;  2Q4U A;  1OW4 A;  1QX2 A;  2RGI A;  3D75 A;  5HKY A;  1BLQ A;  2JC2 A;  1DMO A;  4C0J A;  1SRA A;  1CLB A;  2WCK A;  4E68 A;  3KPX A;  4OKH A;  1G4Y R;  3NSI A;  3AAK A;  2LP2 A;  5HL1 A;  1AJ5 A;  2K60 A;  1DEK A;  1OMV A;  5HKZ A;  1KCY A;  1IJ6 A;  3SG5 A;  2KI6 D;  1BOD A;  2LAP A;  1JF2 A;  2COL B;  3F45 A;  4DIR A;  1DVI A;  1S5G Z;  1SYM A;  2D8N A;  3BXK A;  1OMD A;  2KSP A;  2HQW A;  2DOQ A;  3D73 A;  3BYA A;  1A75 B;  2Q91 A;  2JNX A;  1IWQ A;  1UHN A;  2CXJ A;  3GOF A;  1SL9 A;  2WCH A;  3EG5 B;  1M63 B;  2M3W A;  3K1E A;  4OZD A;  5EL2 A;  3DVE A;  1F54 A;  4WQ2 A;  2EHB A;  5FI7 A;  4MZK A;  4GAO A;  2LLT A;  3GK2 A;  1AHR A;  1MQ1 A;  1S26 D;  3A8R A;  1C7V A;  2HQ8 A;  1TCF A;  1SKT A;  1FBV A;  3CR2 A;  3AKB A;  4ORA B;  4INW A;  4A4C A;  1OOI X;  1EH2 A;  3JVT C;  1JUO A;  1TIZ A;  3OX5 A;  2MHH A;  2Y5I A;  1TN4 A;  2MAZ A;  1S1E A;  2K61 A;  1ALW A;  4GFT A;  2Y1N A;  2K2F A;  1ZOT B;  2HF5 A;  4YGD B;  1NX2 A;  1CB1 A;  3M0W A;  1S36 A;  1TNW A;  1S6C A;  2IS9 A;  1S3P A;  1YX7 A;  3BOW A;  4R1E A;  3SG6 A;  2GV5 A;  5DKR A;  3SS5 A;  1QWV A;  1CMF A;  1V1G A;  1H4B A;  3D0Y A;  1AP4 A;  2JTT A;  1B4C A;  3N7H A;  4GUK A;  3VB1 A;  2L98 A;  1KWO B;  3HCM A;  1TTX A;  1S6J A;  2LMU A;  3EVV A;  1ZFS A;  2JXL A;  3LLE A;  4DS7 A;  1PVB A;  1MXL C;  2M1K B;  2F3Y A;  1CNP A;  2ZRS A;  4Q04 A;  4AQI A;  4YRU A;  1DJW A;  3R1P A;  1QX5 B;  1YRU B;  2AAO A;  2TN4 A;  1DEL A;  2F2O A;  2M49 B;  4WRI A;  1B7T Y;  4IL1 A;  4F0Z B;  1BU3 A;  3L47 A;  4NDB A;  4PT1 A;  3B6X A;  2KBI A;  2Y1M A;  4FQO A;  2VRG A;  1V1F A;  2JTZ A;  2JT3 A;  3EK7 A;  1XFV O;  2I18 A;  1KK7 Z;  1SK6 D;  3DVJ A;  4JD9 A;  2KHN A;  3BOW B;  5ER4 X;  1L2O B;  3RLZ A;  3AAJ A;  3E3R A;  1R6P A;  4CFQ A;  4CFR A;  1WRK A;  3B88 A;  2KQ6 A;  2SCP A;  2LUC A;  3SJS A;  4MEW A;  2FCD A;  1IRJ A;  3CZ1 A;  2BCA A;  2WND A;  2KLE A;  4PHM A;  2KFG A;  5I94 A;  2E6W A;  4JWQ A;  1C7W A;  3I5H B;  4ORB B;  4PDZ A;  1PVA A;  3KHE A;  4ETO A;  2KAX A;  2M7N A;  1ALV A;  3D76 A;  2FCE A;  2SAS A;  4HSZ A;  3R1O A;  1NYA A;  2E30 A;  1CFF A;  2PAS A;  1B8R A;  3UO9 A;  4MLW A;  3BFB A;  1CDP A;  2LUX A;  1CKK A;  3MSE B;  1N2D A;  5HKW A;  1W7J B;  3WHU B;  1CLL A;  3RM1 A;  2CTN A;  1QLS A;  1KWO C;  2KYC A;  1HQV A;  1A2X A;  1EG4 A;  1YX8 A;  1J7Q A;  2PRU A;  1BT6 A;  1Q80 A;  1F55 A;  1B9A A;  1M46 A;  1EL4 A;  3TDI A;  1PUL A;  1SW8 A;  2PVB A;  3B7A A;  3OB1 B;  4YGA A;  3VRO A;  1XVJ A;  2LM5 A;  2KAV A;  2WOS A;  4MRY A;  2BBN A;  3R1V A;  3VRP A;  1QAS A;  1JSA A;  3DXL A;  3GK1 A;  2V53 A;  3CR4 X;  3PLF B;  1NIW A;  1UHJ A;  5AAN A;  3WXA A;  3EVU A;  2WCL A;  3L4L A;  1G8I A;  3WNX B;  1GJY A;  1DC1 A;  5JOL A;  3BUW B;  1BMO A;  3CWG A;  3DVM A;  1CFC A;  1L2O C;  1SL7 A;  3EVR A;  4ORC B;  1DTL A;  2MRD A;  2NCP A;  4XJK A;  1AVS A;  1KFU S;  1QV1 A;  3BUO B;  4DUQ A;  1TOP A;  4JKT A;  3B86 A;  2ZFD A;  1FI5 A;  3S0D A;  2F8P A;  3IQQ A;  1UUS A;  1OZS A;  1IGV A;  1SNL A;  2LVJ A;  3I5H C;  5DKQ A;  4C0L A;  3SS4 A;  4M2O A;  4YBH B;  2ZN9 A;  1KFX L;  5F6T A;  1K9U A;  2I94 A;  1RWY A;  4P5O E;  3S0A A;  3FE9 A;  5AER A;  1QLK A;  3SG3 A;  1PK0 D;  1YUR A;  1B8L A;  2LLU A;  1K96 A;  1OQP A;  3D78 A;  3DD4 A;  4L9M A;  3A4U B;  2JT0 A;  1LS8 A;  2M97 A;  1KSO A;  2K7C A;  2KYF A;  1TNX A;  3PN7 B;  2LHI A;  2QDI A;  3CZ2 A;  3O6B A;  3OX6 A;  1LKJ A;  1WDC B;  3IVT A;  4AQJ A;  4U8D A;  5I2O A;  1XK4 A;  1N65 A;  1XFZ O;  1UHH A;  3CYZ A;  2H61 A;  3EKJ A;  4PHJ A;  5CPV A;  3EK4 A;  5IBW A;  1T14 A;  2ZN8 A;  3UNW A;  1XFR A;  2NCO A;  1CDM A;  1MR8 A;  2MLE C;  1W7I B;  1R2U A;  2PSR A;  2KGR A;  1IKU A;  1EJ3 A;  1MWN A;  2A4J A;  3PJI A;  1U5I A;  2EC6 B;  1DF0 A;  1WLM A;  3DZT A;  1F4O A;  2M1U A;  4GGN A;  1ZMZ A;  1DJX A;  1CLM A;  4C0K A;  2K2A A;  1SR6 B;  2LNK A;  2LVV A;  1EXR A;  2ZND A;  2GGZ A;  2JRF A;  3CDN A;  1JFK A;  1K93 D;  1QVI Z;  3PSR A;  2WC6 A;  3V2L A;  1M31 A;  3FE8 A;  2KLD A;  2LHL A;  3KEV A;  1YVL A;  1KQM B;  2JUL A;  4I5N B;  1RRO A;  1BG1 A;  4OCI A;  5DIC A;  3BUN B;  1KK8 B;  1OOH A;  3EK8 A;  1MXE A;  1S5G Y;  3ZNI A;  1GGZ A;  5AXI A;  4ZCV A;  1NX1 A;  1B47 A;  1B7T Z;  1NCZ A;  2L2C A;  2LAN A;  1J55 A;  3SG7 A;  5GQQ C;  5CSN A;  3WHT B;  2KI4 B;  5FYX A;  3TDZ A;  1KQV A;  2MA2 A;  4PE1 A;  3LCP C;  1MHO A;  3PN7 C;  1XYD A;  5I8N A;  3BJH A;  1U5I B;  2CNP A;  2LVK A;  1A03 A;  1WDC C;  1B8C A;  1JF0 A;  2NLN A;  1LVC D;  1RJV A;  1WY9 A;  1B1G A;  2JT8 A;  3TUY B;  3NSK A;  4CLN A;  3BQ3 A;  1NCY A;  4QJ5 B;  4MN0 A;  2KPH A;  2KOT A;  4NDC A;  2BCB A;  2KFF A;  5HLV A;  1QIV A;  2KNE A;  1PSB A;  2NXQ A;  3FWB A;  4OR9 B;  3D0Y B;  1RK9 A;  1Z2C B;  2EC6 C;  1J7R A;  2WOR A;  2L5X B;  3TDU A;  4PHK A;  1SR6 C;  3D77 A;  3OBV A;  1XA5 A;  2LMT A;  3BUX B;  3NGV A;  3FWC A;  1Y0V H;  2QEO A;  1GM0 A;  3NXA A;  2KFH A;  4USL A;  1C07 A;  3AKA A;  5CSJ A;  1C3Y A;  4DRW A;  1BJF A;  1JBA A;  2JU0 A;  4JQ0 D;  1LIN A;  1KQM C;  2FJU B;  1TNP A;  2L4H A;  1FW4 A;  4GNK B;  1NUB A;  1KK8 C;  1A4P A;  3K21 A;  3TZ1 A;  1FI6 A;  1LXF C;  1FF1 A;  2OS8 B;  1K9P A;  4I5K A;  4D1E A;  4YGC B;  5I2Q A;  4PAL A;  3Q8I A;  2BBM A;  2KI4 C;  4F7F A;  2P70 A;  2H2K A;  1WLZ A;  1UWO A;  3R72 A;  1RTP 1;  1WRZ A;  4PCW A;  1N0Y A;  1ZAC A;  2L50 A;  3D10 A;  5HYD A;  1FPW A;  3IF7 A;  3TUY C;  1PRW A;  2L4I A;  3C1V A;  3I5I B;  3CLN A;  2WCJ A;  3VRN A;  4YGE B;  3S0B A;  1UUR A;  3JTD B;  1CMG A;  1NSH A;  2LVI A;  2ZRT A;  5FI2 A;  2BE4 A;  3ZWH A;  1TWO A;  4DCK A;  1OZO A;  4BY5 A;  2HET A;  1TNQ A;  2ISD A;  3PAT A;  1XFW O;  4OVN F;  2CBL A;  1H8B A;  1IG5 A;  1W9Z A;  2OTG B;  2JPT A;  3SS3 A;  1CM4 A;  2EGD A;  4AOM A;  3OGN A;  5PAL A;  2F3Z A;  1QV0 A;  5BPJ A;  2JQ6 A;  2LP3 A;  3OP0 A;  1SPY A;  3DYE A;  4TNC A;  3L4A A;  5CSF A;  1XO5 A;  2GGM A;  1DT7 B;  2LV7 A;  1BF5 A;  1UHI A;  1M39 A;  3O4Y A;  3O4X A;  5K89 A;  1X02 A;  1QJT A;  1SCV A;  4QJ4 B;  1TRF A;  1K95 A;  3I5F B;  3RZS A;  4YI9 A;  1LA3 A;  4HRH A;  1UP5 A;  2OS8 C;  4FTG A;  1LA0 A;  1OMR A;  1F4Q A;  1QX7 A;  2GTE A;  2L5Y A;  3QME A;  2M8U A;  2K0J A;  1J1D A;  1A29 A;  1DJZ A;  1QS7 A;  1SL8 A;  3B87 A;  1TUJ A;  1YR5 A;  1BR1 B;  3IQO A;  4XJK B;  5JJG A;  3H4S E;  5D3O A;  2OPO A;  2JWW A;  1YRT B;  1IIO A;  1MF8 B;  2AMI A;  3NSO A;  4CID A;  1OOJ A;  2PYQ A;  1RFJ A;  1Z4H A;  4N5X A;  1DGU A;  2F2P A;  3OB2 B;  3VGO A;  1GGW A;  3I5I C;  3TS5 B;  3OHM B;  2MBX A;  2M0R A;  4HRE E;  3JTD C;  1DQE A;  1TUZ A;  2BL0 B;  2MLF C;  2HPS A;  2KQY A;  2YGU A;  3KF9 A;  5HLO A;  2LC5 A;  2R2I A;  2LCP A;  1QIW A;  2K7O A;  2WCB A;  3GK4 X;  4HRG A;  4A4B A;  4ICB A;  1CDN A;  2OTG C;  1ZUZ A;  3VRQ A;  1ODB A;  1OE9 B;  1XFY O;  5TNC A;  1G33 A;  1XFX O;  1CM1 A;  1OOF A;  4PHN A;  4PE4 A;  4PE7 A;  2BE6 A;  1YUU A;  3FIA A;  5DKN A;  3PFV A;  2B1U A;  4I5J A;  5J3X A;  1IJ5 A;  3O2P A;  4CPV A;  2PAL A;  3SG2 A;  5B8I B;  1KFU L;  1Y1U A;  1SCM B;  1DJG A;  2L2E A;  2WC8 A;  5ER5 A;  2G9B A;  2I7A A;  2QAC A;  3I5F C;  1VRK A;  4GGF A;  4WQ3 A;  5CSI A;  5KTY A;  1D1O A;  1DJI A;  1UHK A;  1F70 A;  2MJW B;  1K2H A;  4MBE A;  3DVK A;  2KAY A;  3HX4 A;  3I5G B;  1CFP A;  3EKH A;  1DF0 B;  1P28 A;  1DJY A;  1NWD A;  1AUI B;  5I2L A;  1BOC A;  2G2B A;  3DF0 A;  5FI6 A;  2JXC A;  2KDH A;  1DGV A;  3NHI A;  3PM8 A;  4KYN A;  2BCX A;  2LMV A;  3TS5 C;  1J7O A;  2CCM A;  4MRX A;  2QEB A;  4MSP A;  2QPT A;  1K9K A;  1QVI Y;  1NX0 A;  1Y6W A;  2I2R E;  2P71 A;  2BL0 C;  3LK0 A;  4XYN A;  5D69 A;  2QEH A;  1JWD A;  1EG3 A;  1QTX A;  2WCM A;  1OOG A;  4BY4 A;  3FE6 A;  1BR4 B;  1ORG A;  2NZ0 A;  2O60 A;  3CTN A;  4NQG A;  2JOJ A;  1CFD A;  3NSL A;  3S0F A;  2KI6 C;  2WC5 A;  4GPL B;  3D74 A;  1DJH A;  1YUT A;  1GQM A;  5G08 A;  1XK4 C;  3QRX A;  3SIA A;  1K94 A;  1SCM C;  2ERB A;  1HT9 A;  5KSZ A;  3DF0 B;  2H61 C;  4MZL A;  1XFU O;  1YVH A;  2K8M B;  1KFX S;  2PMY A;  4MVF A;  2KGB C;  4M2Q A;  3SG4 A;  4N1F A;  2Y4Q A;  5AFP A;  5KU1 A;  2BKH B;  1NPQ A;  1NX3 A;  1PSR A;  1WRL A;  2PQL A;  1JFJ A;  1KK7 Y;  4YI8 A;  3PM2 A;  3BFH A;  4JPZ B;  2ZNE A;  3FS7 A;  3I5G C;  4PE0 A;  1AJ4 A;  1MUX A;  1JC2 A;  1J1E A;  4NDD A;  1Y1X A;  3CZ0 A;  1IH0 A;  1NCX A;  2K7D A;  5AEQ A;  3CR5 X;  3S0G A;  2CT9 A;  1L7Z A;  2F33 A;  4IJ7 A;  3DY9 A;  1OSA A;  2JZI A;  2L51 A;  3LK1 A;  4UPG A;  2AUC A;  1SSE B;  4N1G A;  1NP8 A;  2P6B B;  1PAL A;  1YTZ C;  2JPO A;  3BUM B;  4ZCU A;  2M9G A;  1QAT A;  2FJY A;  3CAB A;  2BKI B;  4GGF C;  2L0P A;  1S6I A;  2ZKM X;  3NHT A;  1IQ5 A;  1IQ3 A;  1KSM A;  3O78 A;  1TCO B;  2QEV A;  4OV2 A;  3LL8 B;  2BNX A;  3PAL A;  4YGB B;  2KBM A;  2M29 A;  4I5L B;  4P2Y B;  2M7L A;  3VRR A;  4M2P A;  1E8A A;  2O5G A;  2WCF A;  1K90 D;  3CZT X;  1F71 A;  1AK8 A;  3S0E A;  2FOT A;  3ICB A;  3SIB A;  1SMG A;  1SY9 A;  1YUS A;  2K7B A;  1K8U A;  2LLS A;  2BAP A;  2H8V A;  1REC A;  3BFA A;  4MZJ A;  4QJ3 B;  1CDL A;  3JVT B;  4INX A;  1A75 A;  1M45 A;  2LE9 B;  3KO0 A;  1F8H A;  1CTR A;  2JNF A;  1J7P A;  4FQT A;  2WCE A;  3CS1 A;  1C3Z A;  1SBJ A; 
#chains in the Genus database with same CATH homology
 1Y1A A;  5D7F A;  2BEC A;  1QXP A;  4GBA A;  3CGA A;  2Q4U A;  1QX2 A;  2RGI A;  5HKY A;  1BLQ A;  1DMO A;  2JC2 A;  4C0J A;  1SRA A;  1CLB A;  4E68 A;  3KPX A;  4OKH A;  1G4Y R;  3NSI A;  3AAK A;  2LP2 A;  1AJ5 A;  1KCY A;  1OMV A;  5HKZ A;  1IJ6 A;  3SG5 A;  2KI6 D;  1BOD A;  2LAP A;  1JF2 A;  2COL B;  3F45 A;  4DIR A;  1DVI A;  1S5G Z;  1SYM A;  2D8N A;  3BXK A;  1OMD A;  2KSP A;  2HQW A;  2DOQ A;  3BYA A;  1A75 B;  2Q91 A;  2JNX A;  1IWQ A;  1UHN A;  2CXJ A;  3GOF A;  1SL9 A;  1M63 B;  2M3W A;  3DVE A;  1F54 A;  4WQ2 A;  2EHB A;  4MZK A;  4GAO A;  2LLT A;  3GK2 A;  1AHR A;  1MQ1 A;  1S26 D;  3A8R A;  1C7V A;  2HQ8 A;  1TCF A;  1SKT A;  1FBV A;  3CR2 A;  3AKB A;  4ORA B;  4A4C A;  1EH2 A;  3JVT C;  1JUO A;  1TIZ A;  3OX5 A;  2MHH A;  2Y5I A;  1TN4 A;  2MAZ A;  1S1E A;  2K61 A;  1ALW A;  4GFT A;  2Y1N A;  2K2F A;  1ZOT B;  2HF5 A;  4YGD B;  1NX2 A;  1CB1 A;  3M0W A;  1S36 A;  1TNW A;  1S6C A;  2IS9 A;  1S3P A;  1YX7 A;  3BOW A;  4R1E A;  3SG6 A;  2GV5 A;  5DKR A;  1CMF A;  1V1G A;  1H4B A;  3D0Y A;  1AP4 A;  2JTT A;  1B4C A;  4GUK A;  2L98 A;  1KWO B;  3HCM A;  1TTX A;  1S6J A;  2LMU A;  3EVV A;  1ZFS A;  2JXL A;  3LLE A;  4DS7 A;  1PVB A;  1MXL C;  2M1K B;  2F3Y A;  1CNP A;  2ZRS A;  4Q04 A;  4AQI A;  4YRU A;  1DJW A;  1QX5 B;  1YRU B;  2AAO A;  2TN4 A;  2F2O A;  2M49 B;  4WRI A;  1B7T Y;  4IL1 A;  4F0Z B;  1BU3 A;  4NDB A;  2KBI A;  2Y1M A;  4FQO A;  2VRG A;  1V1F A;  2JTZ A;  2JT3 A;  3EK7 A;  1XFV O;  2I18 A;  1KK7 Z;  1SK6 D;  3DVJ A;  2KHN A;  3BOW B;  5ER4 X;  1L2O B;  3RLZ A;  3AAJ A;  3E3R A;  1R6P A;  4CFQ A;  4CFR A;  1WRK A;  2KQ6 A;  2SCP A;  2LUC A;  3SJS A;  4MEW A;  2FCD A;  1IRJ A;  2BCA A;  2WND A;  4PHM A;  2KFG A;  2E6W A;  4JWQ A;  1C7W A;  3I5H B;  4ORB B;  4PDZ A;  1PVA A;  3KHE A;  4ETO A;  2KAX A;  2M7N A;  1ALV A;  4HSZ A;  2FCE A;  2SAS A;  1NYA A;  2E30 A;  1CFF A;  2PAS A;  1B8R A;  4MLW A;  1CDP A;  2LUX A;  1CKK A;  3MSE B;  1N2D A;  5HKW A;  1W7J B;  3WHU B;  1CLL A;  3RM1 A;  2CTN A;  1QLS A;  1KWO C;  2KYC A;  1HQV A;  1A2X A;  1EG4 A;  1YX8 A;  1J7Q A;  2PRU A;  1BT6 A;  1Q80 A;  1F55 A;  1B9A A;  1M46 A;  1EL4 A;  3TDI A;  1PUL A;  1SW8 A;  2PVB A;  3OB1 B;  4YGA A;  3VRO A;  1XVJ A;  2LM5 A;  2KAV A;  2WOS A;  4MRY A;  2BBN A;  3VRP A;  1QAS A;  1JSA A;  3GK1 A;  2V53 A;  3CR4 X;  3PLF B;  1NIW A;  1UHJ A;  5AAN A;  3WXA A;  3EVU A;  1G8I A;  3WNX B;  1GJY A;  5JOL A;  3BUW B;  1BMO A;  3CWG A;  3DVM A;  1CFC A;  1L2O C;  1SL7 A;  3EVR A;  4ORC B;  1DTL A;  2MRD A;  2NCP A;  4XJK A;  1AVS A;  1KFU S;  1QV1 A;  3BUO B;  4DUQ A;  1TOP A;  2ZFD A;  1FI5 A;  2F8P A;  3IQQ A;  1UUS A;  1OZS A;  1IGV A;  1SNL A;  2LVJ A;  3I5H C;  5DKQ A;  4C0L A;  4M2O A;  4YBH B;  2ZN9 A;  1KFX L;  5F6T A;  1K9U A;  2I94 A;  1RWY A;  4P5O E;  5AER A;  1QLK A;  3SG3 A;  1PK0 D;  1YUR A;  1B8L A;  2LLU A;  1K96 A;  1OQP A;  3DD4 A;  4L9M A;  3A4U B;  2JT0 A;  2M97 A;  1KSO A;  2K7C A;  2KYF A;  1TNX A;  3PN7 B;  2LHI A;  3O6B A;  3OX6 A;  1LKJ A;  1WDC B;  4AQJ A;  4U8D A;  5I2O A;  1XK4 A;  1N65 A;  1XFZ O;  1UHH A;  5CPV A;  2H61 A;  3EKJ A;  4PHJ A;  5IBW A;  3EK4 A;  2ZN8 A;  2NCO A;  1CDM A;  1MR8 A;  2MLE C;  1W7I B;  1R2U A;  2PSR A;  2KGR A;  1IKU A;  1EJ3 A;  1MWN A;  2A4J A;  1U5I A;  2EC6 B;  1DF0 A;  1WLM A;  1F4O A;  2M1U A;  4GGN A;  1ZMZ A;  1DJX A;  1CLM A;  4C0K A;  2K2A A;  1SR6 B;  2LNK A;  2LVV A;  1EXR A;  2ZND A;  2GGZ A;  2JRF A;  1JFK A;  1K93 D;  1QVI Z;  3PSR A;  1M31 A;  3KEV A;  1YVL A;  1KQM B;  2JUL A;  4I5N B;  1RRO A;  1BG1 A;  4OCI A;  3BUN B;  1KK8 B;  3EK8 A;  1MXE A;  1S5G Y;  3ZNI A;  1GGZ A;  5AXI A;  4ZCV A;  1NX1 A;  1B47 A;  1B7T Z;  1NCZ A;  2LAN A;  1J55 A;  3SG7 A;  5GQQ C;  5CSN A;  3WHT B;  2KI4 B;  5FYX A;  3TDZ A;  1KQV A;  2MA2 A;  4PE1 A;  3LCP C;  1MHO A;  3PN7 C;  1XYD A;  5I8N A;  1U5I B;  2CNP A;  2LVK A;  1A03 A;  1WDC C;  1B8C A;  1JF0 A;  2NLN A;  1LVC D;  1RJV A;  1WY9 A;  1B1G A;  2JT8 A;  3TUY B;  3NSK A;  4CLN A;  3BQ3 A;  1NCY A;  4QJ5 B;  4MN0 A;  2KOT A;  4NDC A;  2BCB A;  2KFF A;  5HLV A;  1QIV A;  2KNE A;  1PSB A;  2NXQ A;  3FWB A;  4OR9 B;  3D0Y B;  1RK9 A;  2EC6 C;  1J7R A;  2WOR A;  2L5X B;  3TDU A;  4PHK A;  1SR6 C;  1XA5 A;  2LMT A;  3BUX B;  3FWC A;  1Y0V H;  3NXA A;  2KFH A;  4USL A;  1C07 A;  3AKA A;  5CSJ A;  4DRW A;  1BJF A;  1JBA A;  2JU0 A;  4JQ0 D;  1LIN A;  1KQM C;  2FJU B;  1TNP A;  2L4H A;  1FW4 A;  4GNK B;  1NUB A;  1KK8 C;  1A4P A;  3K21 A;  3TZ1 A;  1FI6 A;  1LXF C;  1FF1 A;  2OS8 B;  1K9P A;  4I5K A;  4D1E A;  4YGC B;  5I2Q A;  4PAL A;  2BBM A;  2KI4 C;  2H2K A;  1WLZ A;  1UWO A;  1RTP 1;  1WRZ A;  4PCW A;  1N0Y A;  1ZAC A;  2L50 A;  3D10 A;  5HYD A;  1FPW A;  3IF7 A;  3TUY C;  1PRW A;  2L4I A;  3C1V A;  3I5I B;  3CLN A;  3VRN A;  4YGE B;  1UUR A;  3JTD B;  1CMG A;  1NSH A;  2LVI A;  2ZRT A;  3ZWH A;  2BE4 A;  4DCK A;  1OZO A;  4BY5 A;  2HET A;  1TNQ A;  2ISD A;  3PAT A;  1XFW O;  4OVN F;  2CBL A;  1H8B A;  1IG5 A;  2OTG B;  2JPT A;  1CM4 A;  2EGD A;  4AOM A;  5PAL A;  5BPJ A;  2F3Z A;  1QV0 A;  2JQ6 A;  2LP3 A;  3OP0 A;  1SPY A;  5CSF A;  4TNC A;  1XO5 A;  2GGM A;  1DT7 B;  2LV7 A;  1BF5 A;  1UHI A;  1M39 A;  3O4Y A;  5K89 A;  1X02 A;  1QJT A;  1SCV A;  4QJ4 B;  1TRF A;  1K95 A;  3I5F B;  4YI9 A;  1LA3 A;  4HRH A;  1UP5 A;  2OS8 C;  4FTG A;  1LA0 A;  1OMR A;  1F4Q A;  1QX7 A;  2M8U A;  2K0J A;  1J1D A;  1A29 A;  1DJZ A;  1QS7 A;  1SL8 A;  3IQO A;  5JJG A;  1BR1 B;  1YR5 A;  4XJK B;  3H4S E;  2OPO A;  2JWW A;  1YRT B;  1MF8 B;  2AMI A;  3NSO A;  4CID A;  1OOJ A;  1RFJ A;  4N5X A;  1DGU A;  2F2P A;  3OB2 B;  3VGO A;  1GGW A;  3I5I C;  3TS5 B;  3OHM B;  2MBX A;  2M0R A;  4HRE E;  3JTD C;  2BL0 B;  2MLF C;  2HPS A;  2KQY A;  3KF9 A;  5HLO A;  2LC5 A;  2R2I A;  2LCP A;  1QIW A;  2K7O A;  2WCB A;  3GK4 X;  4HRG A;  4A4B A;  4ICB A;  1CDN A;  2OTG C;  1ZUZ A;  3VRQ A;  1ODB A;  1OE9 B;  1XFY O;  5TNC A;  1G33 A;  1XFX O;  1CM1 A;  4PHN A;  4PE4 A;  4PE7 A;  2BE6 A;  1YUU A;  3FIA A;  5DKN A;  3PFV A;  2B1U A;  4I5J A;  5J3X A;  1IJ5 A;  3O2P A;  4CPV A;  2PAL A;  3SG2 A;  5B8I B;  1KFU L;  1Y1U A;  1SCM B;  1DJG A;  2L2E A;  2WC8 A;  5ER5 A;  2G9B A;  2I7A A;  2QAC A;  3I5F C;  1VRK A;  4GGF A;  4WQ3 A;  5CSI A;  5KTY A;  1D1O A;  1DJI A;  1UHK A;  1F70 A;  2MJW B;  1K2H A;  4MBE A;  3DVK A;  2KAY A;  3HX4 A;  3I5G B;  1CFP A;  3EKH A;  1DF0 B;  1DJY A;  1NWD A;  1AUI B;  5I2L A;  1BOC A;  2G2B A;  3DF0 A;  2JXC A;  2KDH A;  1DGV A;  3PM8 A;  2BCX A;  2LMV A;  3TS5 C;  1J7O A;  2CCM A;  4MRX A;  4MSP A;  2QPT A;  1K9K A;  1QVI Y;  1NX0 A;  1Y6W A;  2I2R E;  2BL0 C;  3LK0 A;  4XYN A;  5D69 A;  1JWD A;  1EG3 A;  1QTX A;  4BY4 A;  1BR4 B;  2NZ0 A;  2O60 A;  3CTN A;  4NQG A;  2JOJ A;  1CFD A;  3NSL A;  2KI6 C;  4GPL B;  1DJH A;  1YUT A;  1GQM A;  5G08 A;  1XK4 C;  3QRX A;  3SIA A;  1K94 A;  1SCM C;  5KSZ A;  1HT9 A;  3DF0 B;  2H61 C;  4MZL A;  1XFU O;  1YVH A;  2K8M B;  1KFX S;  2PMY A;  4MVF A;  2KGB C;  4M2Q A;  3SG4 A;  4N1F A;  2Y4Q A;  5AFP A;  5KU1 A;  2BKH B;  1NPQ A;  1NX3 A;  1PSR A;  1WRL A;  1JFJ A;  1KK7 Y;  4YI8 A;  4JPZ B;  2ZNE A;  3FS7 A;  3I5G C;  4PE0 A;  1AJ4 A;  1MUX A;  1JC2 A;  1J1E A;  4NDD A;  1Y1X A;  1IH0 A;  1NCX A;  2K7D A;  5AEQ A;  3CR5 X;  2CT9 A;  1L7Z A;  2F33 A;  1OSA A;  2JZI A;  2L51 A;  3LK1 A;  4UPG A;  2AUC A;  4N1G A;  1NP8 A;  2P6B B;  1PAL A;  1YTZ C;  3BUM B;  4ZCU A;  2M9G A;  1QAT A;  2BKI B;  4GGF C;  2L0P A;  1S6I A;  2ZKM X;  1IQ5 A;  1IQ3 A;  1KSM A;  3O78 A;  1TCO B;  4OV2 A;  3LL8 B;  3PAL A;  4YGB B;  2KBM A;  2M29 A;  4I5L B;  4P2Y B;  2M7L A;  3VRR A;  4M2P A;  1E8A A;  2O5G A;  2WCF A;  1K90 D;  3CZT X;  1F71 A;  1AK8 A;  2FOT A;  3ICB A;  3SIB A;  1SMG A;  1SY9 A;  1YUS A;  2K7B A;  1K8U A;  2LLS A;  1REC A;  4MZJ A;  4QJ3 B;  1CDL A;  3JVT B;  1A75 A;  1M45 A;  2LE9 B;  3KO0 A;  1F8H A;  1CTR A;  2JNF A;  1J7P A;  2WCE A;  3CS1 A;  2LHL A;  1SBJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...