1L2OB

Scallop myosin s1-adp-p-pdm in the actin-detached conformation
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
142
structure length
142
Chain Sequence
PQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKGSGEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein
molecule keywords MYOSIN HEAVY CHAIN
publication title Crystallographic findings on the internally uncoupled and near-rigor states of myosin: further insights into the mechanics of the motor.
pubmed doi rcsb
total genus 31
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2002-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1l2oB01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1l2oB02
1RFJA 3JTDB 2KHNA 1FPWA 1DJHA 3GK1A 2ZNDA 1J1EA 3SJSA 1SBJA 2LVJA 3EKHA 2KAXA 1KSOA 3BUWB 1B8CA 4PHNA 4OKHA 5I8NA 2LV7A 4CLNA 1L7ZA 1TNQA 1DJIA 1S3PA 3NSOA 4ZCVA 1XFWO 2BL0B 3CR4X 5HLOA 1ALVA 3A4UB 3TS5B 1XA5A 4AQIA 1W7JB 4ICBA 4GFTA 3K21A 5F6TA 2CCMA 2NCPA 4GUKA 3SG7A 3SG6A 3TDZA 2BCBA 3I5IC 1NYAA 4MVFA 5JOLA 3OX6A 5CSNA 1YRUB 1IH0A 1OE9B 1CB1A 2LMUA 2JT8A 3IQOA 1NUBA 1SNLA 2K0JA 3NSKA 1CDMA 1G4YR 2F8PA 2KYFA 1DTLA 2Y1MA 3CLNA 2K7CA 2QPTA 1CDPA 1WRKA 2LHIA 2MHHA 4AOMA 1YUSA 2M3WA 1K2HA 2AUCA 1JF0A 3FWCA 1NX2A 4CIDA 1CFPA 3RM1A 3VRQA 1B8RA 1QTXA 2OTGB 1LINA 1EL4A 1QX2A 2KFGA 5I2OA 5D69A 1AUIB 1B1GA 1M39A 3TDIA 3O78A 1E8AA 1FI6A 4PCWA 4MZLA 5JJGA 2D8NA 4N1GA 2BBMA 5CSFA 4YGEB 5GQQC 3BOWB 3LCPC 2PSRA 1ZFSA 3I5GB 4YI8A 1DJXA 3KO0A 3EVVA 2E30A 2R2IA 2H61A 2LLUA 2DOQA 1MHOA 1FI5A 2JTZA 2HQWA 2I94A 1OMVA 1MXEA 3OB1B 1RJVA 1MR8A 5HKZA 2TN4A 5CSJA 2HF5A 2L0PA 1CM1A 4GGFA 5AXIA 2F2OA 4JWQA 2M9GA 5K89A 4M2OA 2AMIA 1MQ1A 2GGZA 1OMDA 1DJZA 5J3XA 2NXQA 1K8UA 1M31A 5KU1A 1XFXO 1Y1UA 4M2PA 4GBAA 1UHIA 4ZCUA 4XYNA 1Y6WA 1MUXA 1ODBA 2KBIA 2KFHA 2OPOA 1Y1XA 3VRRA 2CNPA 5ER5A 1NSHA 1UHHA 2KQ6A 4WRIA 1NP8A 3KEVA 1F55A 2MBXA 1WDCC 2JPTA 1L2OC 1IWQA 5G08A 2L51A 1KFUS 3JVTC 1NPQA 1S5GY 4MBEA 3SIBA 2JQ6A 3OHMB 3CR5X 1UHKA 2LNKA 2BE6A 1TNPA 2ZN8A 1UHJA 2IS9A 2BKHB 1GGZA 1QX7A 3BUMB 3VGOA 1AP4A 1OZOA 2M49B 1K90D 1YX7A 3DVKA 1BJFA 1NX3A 3LL8B 2MLFC 4GPLB 2LE9B 4A4BA 3DF0A 1KWOC 2P6BB 1S5GZ 5FYXA 1F70A 5KTYA 2LANA 3EKJA 1YX8A 2L5XB 4I5LB 1ALWA 2KGRA 4OV2A 1JFKA 1LXFC 1SCMB 1IJ5A 2JXLA 1YRTB 4NQGA 2JULA 3SG2A 1KSMA 2MLEC 4YGAA 2LMVA 1AVSA 1K9UA 4GAOA 1BF5A 1KFXS 2WNDA 3RLZA 2HETA 1LA3A 1XVJA 5CSIA 2Y4QA 2COLB 1PALA 2ZRSA 2Q91A 2JT3A 3CR2A 1KK8C 1RK9A 5DKRA 1SKTA 3HCMA 3KF9A 3KPXA 3EVRA 1HQVA 2PALA 3OP0A 1RTP1 1SL9A 1LVCD 1J7PA 5AERA 2KNEA 1EJ3A 2K7DA 2AAOA 2L4IA 1CM4A 3CWGA 4NDBA 2PRUA 1NX0A 1A29A 1OQPA 3PFVA 1MWNA 4HRGA 2F2PA 2CXJA 1R6PA 1K94A 1ZUZA 2SASA 1DJWA 3I5FB 3VRNA 5B8IB 1A75B 2CBLA 1SR6B 2O60A 2OS8B 1C7WA 1IRJA 1S6IA 2KFFA 3WHTB 1QIWA 3PATA 4PHKA 3BXKA 2K2FA 3F45A 2EC6C 1G33A 3NXAA 1RWYA 2LUXA 3EK8A 4DRWA 4YGBB 1CFCA 4QJ4B 4E68A 1LA0A 4NDCA 1K95A 1UWOA 1C07A 2BCXA 2FOTA 2ZNEA 3DVJA 1SL7A 1PSRA 2FCDA 3I5HC 1WY9A 2KI4C 2K7BA 4ETOA 1QV0A 1KFXL 2SCPA 2JWWA 1F8HA 4I5KA 2VRGA 5I2QA 1A75A 5DKNA 1PULA 1XK4C 2K2AA 3FIAA 2G9BA 3WHUB 4PALA 1BOCA 2CT9A 1SYMA 2BE4A 4IL1A 3BYAA 4XJKA 4YBHB 1QASA 4ORCB 1CNPA 3BUXB 1N0YA 2LLSA 1JF2A 4GNKB 4QJ3B 5HKYA 1TCOB 4FQOA 2MRDA 1A4PA 1QV1A 1KQVA 3VROA 2K8MB 2LP2A 1H4BA 3LLEA 2K61A 1YTZC 2JC2A 4OVNF 2ZRTA 4YRUA 4WQ2A 4CFQA 5IBWA 1JSAA 1NX1A 1S36A 3I5IB 1UP5A 4UPGA 2M1KB 1IKUA 4HRHA 1X02A 1JWDA 1AK8A 2I7AA 1W7IB 2MJWB 4YGDB 2PMYA 4F0ZB 4DIRA 4MRXA 3D0YA 2HPSA 2HQ8A 1SMGA 3DF0B 1B9AA 2EC6B 1BU3A 1M45A 1EXRA 1NCYA 1KQMC 1QLKA 4PHJA 5AFPA 1FF1A 2JNFA 3OB2B 1KCYA 1QXPA 1EH2A 3SG5A 3OX5A 1Q80A 3TUYC 3IQQA 2KI6D 1CDLA 1YVLA 4BY4A 1SPYA 1YUUA 2WC8A 3I5HB 2F3ZA 4NDDA 5HLVA 3JTDC 1SY9A 2RGIA 5CPVA 1BMOA 4MLWA 1R2UA 1PVAA 2M7NA 1B7TY 3CTNA 1YURA 4BY5A 2LLTA 3QRXA 2CTNA 1IGVA 1PK0D 3IF7A 4PE1A 5DKQA 1YUTA 2KI6C 1JBAA 4OR9B 2GGMA 3TDUA 3DVMA 1CDNA 1AJ4A 2LHLA 1BT6A 2M1UA 1YR5A 3MSEB 2LP3A 2ZFDA 1OSAA 1VRKA 2JTTA 1WRZA 2BL0C 1SW8A 1DJYA 3BQ3A 1J1DA 1CFDA 3PN7C 3E3RA 2FJUB 1XYDA 3SIAA 2I18A 3BUOB 4U8DA 1TOPA 1FBVA 3O4YA 2M97A 2ZN9A 1TNWA 2KDHA 2LVKA 2BBNA 1BG1A 2A4JA 1CFFA 3DVEA 2L4HA 5KSZA 5BPJA 2H61C 1B7TZ 2LM5A 4C0JA 2B1UA 1QATA 1CKKA 1JFJA 1G8IA 1S26D 4MZJA 1QVIY 4D1EA 1BR4B 1TTXA 1IQ5A 3PSRA 4P2YB 2L50A 3AKAA 1MF8B 3KHEA 1XFUO 1CMFA 3BUNB 3GK2A 2WOSA 1KFUL 2OTGC 1KK7Y 2M0RA 2KQYA 3NSIA 5HYDA 1B4CA 1WDCB 2WCBA 1DF0B 1L2OB 2F33A 4MZKA 3TUYB 3JVTB 2F3YA 1CMGA 1DMOA 2MA2A 1S1EA 1CLMA 1OMRA 1S6CA 1U5IB 5HKWA 2JT0A 4PE4A 3DD4A 3I5GC 2GV5A 4DS7A 2PVBA 1MXLC 1DJGA 1QVIZ 5D7FA 2NZ0A 3GK4X 4XJKB 4TNCA 4AQJA 3VRPA 3WNXB 2MAZA 1K9KA 2E6WA 3A8RA 4C0LA 2KBMA 3PALA 1QX5B 1JC2A 4QJ5B 1KK7Z 2V53A 2G2BA 4FTGA 2JNXA 4I5JA 1KWOB 4YGCB 1AHRA 2QACA 4MN0A 4A4CA 3PN7B 4R1EA 1XO5A 1A03A 1QS7A 1DF0A 1BLQA 1N65A 1UUSA 2WCFA 1TN4A 2EGDA 4CPVA 1S6JA 1B8LA 3CS1A 2NLNA 2M8UA 3AAKA 1K96A 1GJYA 4MRYA 1J7QA 2ISDA 1U5IA 2PASA 1B47A 3D0YB 4DCKA 4C0KA 1GQMA 3TZ1A 4MEWA 2KGBC 3PLFB 3M0WA 1M46A 3LK0A 1F4QA 3ZWHA 4JPZB 1YVHA 1EG4A 2EHBA 3CZTX 2LVVA 3H4SE 2L98A 1KK8B 5ER4X 1J55A 1M63B 4PHMA 4CFRA 1XFYO 2KAYA 1DT7B 4HREE 1PRWA 4N5XA 1DGVA 1TCFA 1CTRA 4ORBB 1PSBA 4DUQA 2LUCA 1V1GA 3SG3A 2JU0A 2LC5A 1RECA 5TNCA 5AEQA 1HT9A 1N2DA 3LK1A 2KYCA 1IG5A 1OZSA 3FS7A 1K93D 1F71A 2JOJA 1QJTA 4PE7A 1H8BA 2I2RE 2WCEA 1BR1B 1NWDA 2L2EA 4ORAB 1TIZA 3D10A 1K9PA 3O2PA 1SK6D 2KAVA 3NSLA 1SCMC 1NIWA 2K7OA 2H2KA 2LVIA 1Y1AA 4M2QA 1IQ3A 1AJ5A 2JZIA 2KOTA 2O5GA 1LKJA 3WXAA 2KI4B 1RROA 2KSPA 1ZACA 4YI9A 1PVBA 1XFVO 4GGNA 2BCAA 4PDZA 3BOWA 1NCXA 1DGUA 1V1FA 1DVIA 3AAJA 1F54A 3FWBA 3PM8A 4HSZA 4JQ0D 1J7RA 3C1VA 5AANA 1JUOA 3EK4A 1WLZA 3EVUA 1FW4A 1EG3A 4WQ3A 4OCIA 3TS5C 5I2LA 3ICBA 1WLMA 3SG4A 2JXCA 3I5FC 1UURA 2BECA 3AKBA 1CLBA 1SL8A 1SR6C 4PE0A 2OS8C 4Q04A 1A2XA 2JRFA 1SRAA 1BODA 4N1FA 2Y5IA 2WORA 5PALA 1ZOTB 3O6BA 4GGFC 1ZMZA 1Y0VH 3CGAA 1XFZO 3ZNIA 2LAPA 1TRFA 4I5NB 2ZKMX 1D1OA 1XK4A 2NCOA 1KQMB 1CLLA 2BKIB 1IJ6A 2LMTA 4L9MA 4USLA 2Y1NA 3GOFA 1NCZA 1UHNA 4MSPA 3EK7A 1F4OA 1GGWA 2M29A 3HX4A 1C7VA 1J7OA 1QIVA 2LCPA 2M7LA 1QLSA 1OOJA 1SCVA 1WRLA 2FCEA 4P5OE 2Q4UA 1TNXA
chains in the Genus database with same CATH superfamily
1RFJA 3JTDB 2KHNA 1FPWA 1DJHA 3NHTA 2GTEA 3CABA 3GK1A 2ZNDA 1J1EA 3VB1A 2WCJA 1OW4A 3SJSA 2QDIA 1SBJA 2LVJA 3EKHA 1OOGA 2KAXA 1KSOA 3BUWB 1B8CA 4PHNA 4OKHA 5I8NA 2LV7A 4CLNA 1L7ZA 1TNQA 1DJIA 1S3PA 3NSOA 4ZCVA 1XFWO 2BL0B 3CR4X 5HLOA 1ALVA 3A4UB 3TS5B 5FI7A 1SSEB 1XA5A 1W7JB 4ICBA 4AQIA 4GFTA 3K21A 1ORGA 2CCMA 2NCPA 1OOIX 3R1VA 4GUKA 3FE8A 5F6TA 3SG7A 4F7FA 3SG6A 3TDZA 2BCBA 2K60A 3I5IC 1NYAA 3B86A 4MVFA 5JOLA 3OX6A 5CSNA 1YRUB 1IH0A 1OE9B 1CB1A 2LMUA 2JT8A 3IQOA 1NUBA 1SNLA 2K0JA 3NSKA 1CDMA 1G4YR 2F8PA 2KYFA 1DTLA 2Y1MA 3CLNA 2K7CA 2QPTA 1CDPA 1WRKA 2LHIA 2MHHA 4AOMA 1YUSA 2M3WA 2WCKA 2AUCA 1JF0A 1K2HA 3FWCA 1NX2A 4CIDA 1CFPA 4JD9A 3RM1A 1B8RA 1QTXA 3VRQA 2OTGB 1LINA 1EL4A 1QX2A 2KFGA 5I2OA 3B6XA 5D69A 1AUIB 1B1GA 1M39A 3TDIA 3O78A 1E8AA 1FI6A 4PCWA 4MZLA 5JJGA 2D8NA 4N1GA 2BBMA 5CSFA 4YGEB 5EL2A 5GQQC 3BOWB 3LCPC 2PSRA 1ZFSA 3I5GB 4YI8A 1DJXA 3KO0A 3EVVA 2E30A 2R2IA 2H61A 2LLUA 2DOQA 1MHOA 1FI5A 2JTZA 2HQWA 2I94A 4OZDA 1OMVA 3B88A 1MXEA 3OB1B 1RJVA 3S0GA 1MR8A 5HKZA 2TN4A 5CSJA 2HF5A 2L0PA 1CM1A 4GGFA 5AXIA 2F2OA 4JWQA 2M9GA 3UO9A 4M2OA 5K89A 2AMIA 1MQ1A 2GGZA 2P71A 1OMDA 1DJZA 5J3XA 2NXQA 1K8UA 1M31A 5KU1A 1XFXO 1Y1UA 4M2PA 4GBAA 1GM0A 1IIOA 1UHIA 4ZCUA 4XYNA 1Y6WA 4IJ7A 1MUXA 1ODBA 2KBIA 2KFHA 2OPOA 3BFBA 1Y1XA 3VRRA 2CNPA 3OBVA 5ER5A 1NSHA 1UHHA 2KQ6A 3SS5A 4WRIA 1NP8A 3KEVA 1F55A 2MBXA 1WDCC 2BNXA 2JPTA 3B87A 5DICA 1L2OC 1IWQA 5G08A 2L51A 1KFUS 3JVTC 1NPQA 1S5GY 4MBEA 3SIBA 2JQ6A 3OHMB 3CR5X 1UHKA 2LNKA 2BE6A 1C3ZA 1TNPA 3L4AA 2ZN8A 1UHJA 2IS9A 2BKHB 1GGZA 1QX7A 3BUMB 3VGOA 1AP4A 2WCLA 1OZOA 2M49B 1K90D 1YX7A 3DVKA 1BJFA 3N7HA 1NX3A 2QEBA 3LL8B 2MLFC 4GPLB 3D73A 2LE9B 3D74A 4A4BA 3DF0A 1KWOC 2P6BB 3D77A 1S5GZ 5FYXA 1F70A 5KTYA 2LANA 3EKJA 1YX8A 2L5XB 4I5LB 1ALWA 5HL1A 2KGRA 4OV2A 3S0EA 1JFKA 1LXFC 1SCMB 1IJ5A 2JXLA 1YRTB 3CZ1A 3CYZA 4NQGA 2JULA 3SG2A 1KSMA 2MLEC 2H8VA 4YGAA 2LMVA 1AVSA 1K9UA 4GAOA 1BF5A 1KFXS 2WNDA 3RLZA 2HETA 1LA3A 5I94A 1XVJA 5CSIA 3QMEA 2Y4QA 2COLB 1PALA 2ZRSA 2Q91A 2JT3A 3CR2A 1KK8C 1RK9A 5DKRA 1SKTA 3HCMA 3KF9A 3KPXA 3EVRA 1HQVA 2PALA 3OP0A 1RTP1 1SL9A 1LVCD 1J7PA 5AERA 2KNEA 3SS4A 1EJ3A 2K7DA 2AAOA 2L4IA 3D75A 1CM4A 3CWGA 4NDBA 2PRUA 1NX0A 1A29A 1OQPA 3PFVA 1MWNA 4HRGA 2F2PA 2CXJA 1R6PA 1K94A 1ZUZA 2SASA 1DJWA 3I5FB 3VRNA 5B8IB 1A75B 1Z2CB 2CBLA 1SR6B 2O60A 2OS8B 1C7WA 1IRJA 1S6IA 2KFFA 3WHTB 1QIWA 3PATA 4PHKA 3BXKA 2K2FA 3F45A 2EC6C 1G33A 3NXAA 1RWYA 2LUXA 3EK8A 4DRWA 4YGBB 1CFCA 4QJ4B 4E68A 2FJYA 1LA0A 4NDCA 1K95A 1UWOA 1C07A 2BCXA 2FOTA 2ZNEA 3DVJA 1SL7A 1PSRA 2FCDA 3I5HC 1WY9A 2KI4C 2K7BA 3R72A 4ETOA 1QV0A 1KFXL 2SCPA 3DZTA 2JWWA 1F8HA 4I5KA 2VRGA 5I2QA 1A75A 5DKNA 1PULA 1XK4C 2K2AA 3FIAA 2G9BA 3WHUB 3B7AA 4PALA 2CT9A 1BOCA 1SYMA 2BE4A 4IL1A 3BYAA 3NGVA 4XJKA 1QASA 3CZ0A 4ORCB 4YBHB 1CNPA 3BUXB 1N0YA 2LLSA 1JF2A 4GNKB 4QJ3B 1TUZA 2WCHA 5HKYA 1TCOB 4FQOA 2MRDA 1A4PA 1QV1A 1KQVA 3VROA 2YGUA 2QEOA 2K8MB 2LP2A 1H4BA 1OOHA 3LLEA 2K61A 1YTZC 3DY9A 2JC2A 4OVNF 2ZRTA 4YRUA 4WQ2A 4CFQA 5IBWA 1JSAA 1NX1A 1S36A 3I5IB 1UP5A 4UPGA 2M1KB 1IKUA 4HRHA 1X02A 1JWDA 1AK8A 2I7AA 1W7IB 2MJWB 4YGDB 2PMYA 4FQTA 5FI2A 4F0ZB 4DIRA 3FE6A 4MRXA 3D0YA 2HPSA 2HQ8A 1SMGA 3DF0B 1B9AA 2EC6B 1BU3A 1M45A 1EXRA 1NCYA 1KQMC 1QLKA 4PHJA 5FI6A 5AFPA 1FF1A 2JNFA 3OB2B 1KCYA 1QXPA 1EH2A 3SG5A 3OX5A 1Q80A 3TUYC 3IQQA 2KI6D 1CDLA 1YVLA 4BY4A 1SPYA 1YUUA 2WC8A 3I5HB 3PJIA 2F3ZA 4NDDA 4INXA 5HLVA 3JTDC 1SY9A 2RGIA 5CPVA 1BMOA 4MLWA 1R2UA 1PVAA 2M7NA 1B7TY 2QEHA 1YURA 3CTNA 2LLTA 3EG5B 4BY5A 1LS8A 3QRXA 2CTNA 1IGVA 1PK0D 3IF7A 4PE1A 5DKQA 1YUTA 2KI6C 1JBAA 4OR9B 3PM2A 2GGMA 3TDUA 3DVMA 1CDNA 3O4XA 1AJ4A 2LHLA 1BT6A 2JPOA 1YR5A 2M1UA 3MSEB 2LP3A 2ZFDA 1OSAA 1VRKA 2JTTA 1WRZA 3R1OA 2BL0C 2L2CA 1SW8A 1DJYA 3BQ3A 1J1DA 3V2LA 1CFDA 3PN7C 3E3RA 2FJUB 1XYDA 2ERBA 2I18A 3BUOB 4U8DA 3SIAA 1TOPA 1FBVA 3O4YA 2M97A 2ZN9A 1TNWA 2KDHA 2LVKA 2BBNA 3BJHA 2A4JA 1BG1A 3DVEA 1CFFA 2L4HA 5KSZA 5BPJA 2H61C 1B7TZ 2LM5A 4C0JA 3S0FA 2B1UA 1QATA 3CZ2A 1QWVA 1CKKA 1JFJA 1G8IA 1S26D 4MZJA 3CDNA 1QVIY 4D1EA 1DC1A 1BR4B 1TTXA 1IQ5A 2WC6A 3DXLA 3IVTA 3PSRA 4P2YB 2KPHA 1P28A 2L50A 1MF8B 3AKAA 1XFUO 3DYEA 3KHEA 4INWA 1CMFA 3BUNB 3GK2A 2WOSA 1KFUL 2OTGC 1KK7Y 2M0RA 2KQYA 3NSIA 5HYDA 1B4CA 1WDCB 3SS3A 2WCBA 1DF0B 1L2OB 2F33A 4MZKA 3TUYB 3JVTB 2F3YA 2PYQA 1CMGA 1DMOA 3OGNA 2MA2A 3RZSA 1S1EA 1CLMA 1OMRA 1S6CA 1U5IB 5HKWA 2JT0A 4PE4A 3DD4A 3I5GC 2GV5A 4DS7A 2PVBA 1MXLC 1DJGA 1QVIZ 2PQLA 2NZ0A 5D7FA 3GK4X 4XJKB 4TNCA 4AQJA 3VRPA 3WNXB 2MAZA 1K9KA 2E6WA 3A8RA 4C0LA 2KBMA 3PALA 1QX5B 1JC2A 4QJ5B 1KK7Z 2V53A 2G2BA 4FTGA 1Z4HA 2JNXA 4I5JA 1KWOB 4YGCB 1AHRA 2QACA 4MN0A 2P70A 4A4CA 3PN7B 4R1EA 1XO5A 1A03A 1QS7A 2QEVA 1DF0A 1BLQA 1N65A 1UUSA 2WCFA 1TN4A 2EGDA 1TWOA 1S6JA 1B8LA 2BAPA 4CPVA 3CS1A 2NLNA 2M8UA 3AAKA 1K96A 1GJYA 4MRYA 1OOFA 1J7QA 1TUJA 2ISDA 1U5IA 2PASA 1B47A 3D0YB 3L47A 4C0KA 4DCKA 1GQMA 3TZ1A 4MEWA 2KGBC 3PLFB 3M0WA 1M46A 3LK0A 3UNWA 3K1EA 1F4QA 3ZWHA 4JPZB 1YVHA 1EG4A 2EHBA 3CZTX 2KLEA 2LVVA 3H4SE 2L98A 1KK8B 3NHIA 5ER4X 1C3YA 1J55A 1M63B 4PHMA 4CFRA 1XFYO 2KAYA 1DELA 1DT7B 4HREE 1PRWA 4N5XA 1DGVA 1TCFA 1CTRA 4ORBB 1PSBA 4DUQA 2LUCA 2L5YA 1V1GA 3SG3A 2JU0A 2LC5A 3BFHA 1RECA 3D76A 2KLDA 5TNCA 5AEQA 1HT9A 1N2DA 3LK1A 2KYCA 1IG5A 1OZSA 3FS7A 4PT1A 1K93D 1T14A 1F71A 2JOJA 1QJTA 4PE7A 1H8BA 2I2RE 2WCEA 1BR1B 1NWDA 2L2EA 4ORAB 1TIZA 3D10A 1K9PA 3O2PA 1SK6D 2KAVA 3S0BA 3NSLA 1SCMC 1W9ZA 1NIWA 2K7OA 4KYNA 2H2KA 1XFRA 2LVIA 1Y1AA 4M2QA 1IQ3A 1AJ5A 2JZIA 2KOTA 2O5GA 1LKJA 3WXAA 2KI4B 1RROA 2KSPA 1ZACA 4JKTA 4YI9A 1PVBA 3D78A 1XFVO 4GGNA 2BCAA 4PDZA 3BOWA 1NCXA 1DGUA 1V1FA 1DVIA 1DQEA 3AAJA 1F54A 3FWBA 3PM8A 4HSZA 4JQ0D 1J7RA 3C1VA 5AANA 2WCMA 1JUOA 3EK4A 1WLZA 3EVUA 1FW4A 1EG3A 4WQ3A 4OCIA 3TS5C 5I2LA 3ICBA 1WLMA 3SG4A 2WC5A 2JXCA 3I5FC 3S0AA 1UURA 3L4LA 2BECA 3AKBA 3Q8IA 1CLBA 3BFAA 1SL8A 1SR6C 4PE0A 2OS8C 3R1PA 4Q04A 1A2XA 2JRFA 1SRAA 1BODA 4N1FA 2Y5IA 2WORA 5PALA 1ZOTB 5D3OA 3O6BA 4GGFC 1ZMZA 1Y0VH 3CGAA 1XFZO 3S0DA 3ZNIA 2LAPA 1TRFA 4I5NB 2ZKMX 1D1OA 1XK4A 2NCOA 1KQMB 1CLLA 2BKIB 1IJ6A 2LMTA 4L9MA 4USLA 2Y1NA 3GOFA 1DEKA 1NCZA 1UHNA 3FE9A 4MSPA 3EK7A 1F4OA 1GGWA 2M29A 3HX4A 1C7VA 1J7OA 1QIVA 2LCPA 2M7LA 1QLSA 1OOJA 1SCVA 1WRLA 2FCEA 4P5OE 2Q4UA 1TNXA
chains in the Genus database with same CATH topology
1RFJA 3JTDB 2KHNA 1FPWA 1DJHA 3GK1A 2ZNDA 1J1EA 3SJSA 1SBJA 2LVJA 3EKHA 2KAXA 1KSOA 3BUWB 1B8CA 4PHNA 4OKHA 5I8NA 2LV7A 4CLNA 1L7ZA 1TNQA 1DJIA 1S3PA 3NSOA 4ZCVA 1XFWO 2BL0B 3CR4X 5HLOA 1ALVA 3A4UB 3TS5B 1XA5A 4AQIA 1W7JB 4ICBA 4GFTA 3K21A 5F6TA 2CCMA 2NCPA 4GUKA 3SG7A 3SG6A 3TDZA 2BCBA 3I5IC 1NYAA 4MVFA 5JOLA 3OX6A 5CSNA 1YRUB 1IH0A 1OE9B 1CB1A 2LMUA 2JT8A 3IQOA 1NUBA 1SNLA 2K0JA 3NSKA 1CDMA 1G4YR 2F8PA 2KYFA 1DTLA 2Y1MA 3CLNA 2K7CA 2QPTA 1CDPA 1WRKA 2LHIA 2MHHA 4AOMA 1YUSA 2M3WA 1K2HA 2AUCA 1JF0A 3FWCA 1NX2A 4CIDA 1CFPA 3RM1A 3VRQA 1B8RA 1QTXA 2OTGB 1LINA 1EL4A 1QX2A 2KFGA 5I2OA 5D69A 1AUIB 1B1GA 1M39A 3TDIA 3O78A 1E8AA 1FI6A 4PCWA 4MZLA 5JJGA 2D8NA 4N1GA 2BBMA 5CSFA 4YGEB 5GQQC 3BOWB 3LCPC 2PSRA 1ZFSA 3I5GB 4YI8A 1DJXA 3KO0A 3EVVA 2E30A 2R2IA 2H61A 2LLUA 2DOQA 1MHOA 1FI5A 2JTZA 2HQWA 2I94A 1OMVA 1MXEA 3OB1B 1RJVA 1MR8A 5HKZA 2TN4A 5CSJA 2HF5A 2L0PA 1CM1A 4GGFA 5AXIA 2F2OA 4JWQA 2M9GA 5K89A 4M2OA 2AMIA 1MQ1A 2GGZA 1OMDA 1DJZA 5J3XA 2NXQA 1K8UA 1M31A 5KU1A 1XFXO 1Y1UA 4M2PA 4GBAA 1UHIA 4ZCUA 4XYNA 1Y6WA 1MUXA 1ODBA 2KBIA 2KFHA 2OPOA 1Y1XA 3VRRA 2CNPA 5ER5A 1NSHA 1UHHA 2KQ6A 4WRIA 1NP8A 3KEVA 1F55A 2MBXA 1WDCC 2JPTA 1L2OC 1IWQA 5G08A 2L51A 1KFUS 3JVTC 1NPQA 1S5GY 4MBEA 3SIBA 2JQ6A 3OHMB 3CR5X 1UHKA 2LNKA 2BE6A 1TNPA 2ZN8A 1UHJA 2IS9A 2BKHB 1GGZA 1QX7A 3BUMB 3VGOA 1AP4A 1OZOA 2M49B 1K90D 1YX7A 3DVKA 1BJFA 1NX3A 3LL8B 2MLFC 4GPLB 2LE9B 4A4BA 3DF0A 1KWOC 2P6BB 1S5GZ 5FYXA 1F70A 5KTYA 2LANA 3EKJA 1YX8A 2L5XB 4I5LB 1ALWA 2KGRA 4OV2A 1JFKA 1LXFC 1SCMB 1IJ5A 2JXLA 1YRTB 4NQGA 2JULA 3SG2A 1KSMA 2MLEC 4YGAA 2LMVA 1AVSA 1K9UA 4GAOA 1BF5A 1KFXS 2WNDA 3RLZA 2HETA 1LA3A 1XVJA 5CSIA 2Y4QA 2COLB 1PALA 2ZRSA 2Q91A 2JT3A 3CR2A 1KK8C 1RK9A 5DKRA 1SKTA 3HCMA 3KF9A 3KPXA 3EVRA 1HQVA 2PALA 3OP0A 1RTP1 1SL9A 1LVCD 1J7PA 5AERA 2KNEA 1EJ3A 2K7DA 2AAOA 2L4IA 1CM4A 3CWGA 4NDBA 2PRUA 1NX0A 1A29A 1OQPA 3PFVA 1MWNA 4HRGA 2F2PA 2CXJA 1R6PA 1K94A 1ZUZA 2SASA 1DJWA 3I5FB 3VRNA 5B8IB 1A75B 2CBLA 1SR6B 2O60A 2OS8B 1C7WA 1IRJA 1S6IA 2KFFA 3WHTB 1QIWA 3PATA 4PHKA 3BXKA 2K2FA 3F45A 2EC6C 1G33A 3NXAA 1RWYA 2LUXA 3EK8A 4DRWA 4YGBB 1CFCA 4QJ4B 4E68A 1LA0A 4NDCA 1K95A 1UWOA 1C07A 2BCXA 2FOTA 2ZNEA 3DVJA 1SL7A 1PSRA 2FCDA 3I5HC 1WY9A 2KI4C 2K7BA 4ETOA 1QV0A 1KFXL 2SCPA 2JWWA 1F8HA 4I5KA 2VRGA 5I2QA 1A75A 5DKNA 1PULA 1XK4C 2K2AA 3FIAA 2G9BA 3WHUB 4PALA 1BOCA 2CT9A 1SYMA 2BE4A 4IL1A 3BYAA 4XJKA 4YBHB 1QASA 4ORCB 1CNPA 3BUXB 1N0YA 2LLSA 1JF2A 4GNKB 4QJ3B 5HKYA 1TCOB 4FQOA 2MRDA 1A4PA 1QV1A 1KQVA 3VROA 2K8MB 2LP2A 1H4BA 3LLEA 2K61A 1YTZC 2JC2A 4OVNF 2ZRTA 4YRUA 4WQ2A 4CFQA 5IBWA 1JSAA 1NX1A 1S36A 3I5IB 1UP5A 4UPGA 2M1KB 1IKUA 4HRHA 1X02A 1JWDA 1AK8A 2I7AA 1W7IB 2MJWB 4YGDB 2PMYA 4F0ZB 4DIRA 4MRXA 3D0YA 2HPSA 2HQ8A 1SMGA 3DF0B 1B9AA 2EC6B 1BU3A 1M45A 1EXRA 1NCYA 1KQMC 1QLKA 4PHJA 5AFPA 1FF1A 2JNFA 3OB2B 1KCYA 1QXPA 1EH2A 3SG5A 3OX5A 1Q80A 3TUYC 3IQQA 2KI6D 1CDLA 1YVLA 4BY4A 1SPYA 1YUUA 2WC8A 3I5HB 2F3ZA 4NDDA 5HLVA 3JTDC 1SY9A 2RGIA 5CPVA 1BMOA 4MLWA 1R2UA 1PVAA 2M7NA 1B7TY 3CTNA 1YURA 4BY5A 2LLTA 3QRXA 2CTNA 1IGVA 1PK0D 3IF7A 4PE1A 5DKQA 1YUTA 2KI6C 1JBAA 4OR9B 2GGMA 3TDUA 3DVMA 1CDNA 1AJ4A 2LHLA 1BT6A 2M1UA 1YR5A 3MSEB 2LP3A 2ZFDA 1OSAA 1VRKA 2JTTA 1WRZA 2BL0C 1SW8A 1DJYA 3BQ3A 1J1DA 1CFDA 3PN7C 3E3RA 2FJUB 1XYDA 3SIAA 2I18A 3BUOB 4U8DA 1TOPA 1FBVA 3O4YA 2M97A 2ZN9A 1TNWA 2KDHA 2LVKA 2BBNA 1BG1A 2A4JA 1CFFA 3DVEA 2L4HA 5KSZA 5BPJA 2H61C 1B7TZ 2LM5A 4C0JA 2B1UA 1QATA 1CKKA 1JFJA 1G8IA 1S26D 4MZJA 1QVIY 4D1EA 1BR4B 1TTXA 1IQ5A 3PSRA 4P2YB 2L50A 3AKAA 1MF8B 3KHEA 1XFUO 1CMFA 3BUNB 3GK2A 2WOSA 1KFUL 2OTGC 1KK7Y 2M0RA 2KQYA 3NSIA 5HYDA 1B4CA 1WDCB 2WCBA 1DF0B 1L2OB 2F33A 4MZKA 3TUYB 3JVTB 2F3YA 1CMGA 1DMOA 2MA2A 1S1EA 1CLMA 1OMRA 1S6CA 1U5IB 5HKWA 2JT0A 4PE4A 3DD4A 3I5GC 2GV5A 4DS7A 2PVBA 1MXLC 1DJGA 1QVIZ 5D7FA 2NZ0A 3GK4X 4XJKB 4TNCA 4AQJA 3VRPA 3WNXB 2MAZA 1K9KA 2E6WA 3A8RA 4C0LA 2KBMA 3PALA 1QX5B 1JC2A 4QJ5B 1KK7Z 2V53A 2G2BA 4FTGA 2JNXA 4I5JA 1KWOB 4YGCB 1AHRA 2QACA 4MN0A 4A4CA 3PN7B 4R1EA 1XO5A 1A03A 1QS7A 1DF0A 1BLQA 1N65A 1UUSA 2WCFA 1TN4A 2EGDA 4CPVA 1S6JA 1B8LA 3CS1A 2NLNA 2M8UA 3AAKA 1K96A 1GJYA 4MRYA 1J7QA 2ISDA 1U5IA 2PASA 1B47A 3D0YB 4DCKA 4C0KA 1GQMA 3TZ1A 4MEWA 2KGBC 3PLFB 3M0WA 1M46A 3LK0A 1F4QA 3ZWHA 4JPZB 1YVHA 1EG4A 2EHBA 3CZTX 2LVVA 3H4SE 2L98A 1KK8B 5ER4X 1J55A 1M63B 4PHMA 4CFRA 1XFYO 2KAYA 1DT7B 4HREE 1PRWA 4N5XA 1DGVA 1TCFA 1CTRA 4ORBB 1PSBA 4DUQA 2LUCA 1V1GA 3SG3A 2JU0A 2LC5A 1RECA 5TNCA 5AEQA 1HT9A 1N2DA 3LK1A 2KYCA 1IG5A 1OZSA 3FS7A 1K93D 1F71A 2JOJA 1QJTA 4PE7A 1H8BA 2I2RE 2WCEA 1BR1B 1NWDA 2L2EA 4ORAB 1TIZA 3D10A 1K9PA 3O2PA 1SK6D 2KAVA 3NSLA 1SCMC 1NIWA 2K7OA 2H2KA 2LVIA 1Y1AA 4M2QA 1IQ3A 1AJ5A 2JZIA 2KOTA 2O5GA 1LKJA 3WXAA 2KI4B 1RROA 2KSPA 1ZACA 4YI9A 1PVBA 1XFVO 4GGNA 2BCAA 4PDZA 3BOWA 1NCXA 1DGUA 1V1FA 1DVIA 3AAJA 1F54A 3FWBA 3PM8A 4HSZA 4JQ0D 1J7RA 3C1VA 5AANA 1JUOA 3EK4A 1WLZA 3EVUA 1FW4A 1EG3A 4WQ3A 4OCIA 3TS5C 5I2LA 3ICBA 1WLMA 3SG4A 2JXCA 3I5FC 1UURA 2BECA 3AKBA 1CLBA 1SL8A 1SR6C 4PE0A 2OS8C 4Q04A 1A2XA 2JRFA 1SRAA 1BODA 4N1FA 2Y5IA 2WORA 5PALA 1ZOTB 3O6BA 4GGFC 1ZMZA 1Y0VH 3CGAA 1XFZO 3ZNIA 2LAPA 1TRFA 4I5NB 2ZKMX 1D1OA 1XK4A 2NCOA 1KQMB 1CLLA 2BKIB 1IJ6A 2LMTA 4L9MA 4USLA 2Y1NA 3GOFA 1NCZA 1UHNA 4MSPA 3EK7A 1F4OA 1GGWA 2M29A 3HX4A 1C7VA 1J7OA 1QIVA 2LCPA 2M7LA 1QLSA 1OOJA 1SCVA 1WRLA 2FCEA 4P5OE 2Q4UA 1TNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RFJ A;  3JTD B;  2KHN A;  1FPW A;  1DJH A;  3GK1 A;  2ZND A;  1J1E A;  3SJS A;  1SBJ A;  2LVJ A;  3EKH A;  2KAX A;  1KSO A;  3BUW B;  1B8C A;  4PHN A;  4OKH A;  5I8N A;  2LV7 A;  4CLN A;  1L7Z A;  1TNQ A;  1DJI A;  1S3P A;  3NSO A;  4ZCV A;  1XFW O;  2BL0 B;  3CR4 X;  5HLO A;  1ALV A;  3A4U B;  3TS5 B;  1XA5 A;  4AQI A;  1W7J B;  4ICB A;  4GFT A;  3K21 A;  5F6T A;  2CCM A;  2NCP A;  4GUK A;  3SG7 A;  3SG6 A;  3TDZ A;  2BCB A;  3I5I C;  1NYA A;  4MVF A;  5JOL A;  3OX6 A;  5CSN A;  1YRU B;  1IH0 A;  1OE9 B;  1CB1 A;  2LMU A;  2JT8 A;  3IQO A;  1NUB A;  1SNL A;  2K0J A;  3NSK A;  1CDM A;  1G4Y R;  2F8P A;  2KYF A;  1DTL A;  2Y1M A;  3CLN A;  2K7C A;  2QPT A;  1CDP A;  1WRK A;  2LHI A;  2MHH A;  4AOM A;  1YUS A;  2M3W A;  1K2H A;  2AUC A;  1JF0 A;  3FWC A;  1NX2 A;  4CID A;  1CFP A;  3RM1 A;  3VRQ A;  1B8R A;  1QTX A;  2OTG B;  1LIN A;  1EL4 A;  1QX2 A;  2KFG A;  5I2O A;  5D69 A;  1AUI B;  1B1G A;  1M39 A;  3TDI A;  3O78 A;  1E8A A;  1FI6 A;  4PCW A;  4MZL A;  5JJG A;  2D8N A;  4N1G A;  2BBM A;  5CSF A;  4YGE B;  5GQQ C;  3BOW B;  3LCP C;  2PSR A;  1ZFS A;  3I5G B;  4YI8 A;  1DJX A;  3KO0 A;  3EVV A;  2E30 A;  2R2I A;  2H61 A;  2LLU A;  2DOQ A;  1MHO A;  1FI5 A;  2JTZ A;  2HQW A;  2I94 A;  1OMV A;  1MXE A;  3OB1 B;  1RJV A;  1MR8 A;  5HKZ A;  2TN4 A;  5CSJ A;  2HF5 A;  2L0P A;  1CM1 A;  4GGF A;  5AXI A;  2F2O A;  4JWQ A;  2M9G A;  5K89 A;  4M2O A;  2AMI A;  1MQ1 A;  2GGZ A;  1OMD A;  1DJZ A;  5J3X A;  2NXQ A;  1K8U A;  1M31 A;  5KU1 A;  1XFX O;  1Y1U A;  4M2P A;  4GBA A;  1UHI A;  4ZCU A;  4XYN A;  1Y6W A;  1MUX A;  1ODB A;  2KBI A;  2KFH A;  2OPO A;  1Y1X A;  3VRR A;  2CNP A;  5ER5 A;  1NSH A;  1UHH A;  2KQ6 A;  4WRI A;  1NP8 A;  3KEV A;  1F55 A;  2MBX A;  1WDC C;  2JPT A;  1L2O C;  1IWQ A;  5G08 A;  2L51 A;  1KFU S;  3JVT C;  1NPQ A;  1S5G Y;  4MBE A;  3SIB A;  2JQ6 A;  3OHM B;  3CR5 X;  1UHK A;  2LNK A;  2BE6 A;  1TNP A;  2ZN8 A;  1UHJ A;  2IS9 A;  2BKH B;  1GGZ A;  1QX7 A;  3BUM B;  3VGO A;  1AP4 A;  1OZO A;  2M49 B;  1K90 D;  1YX7 A;  3DVK A;  1BJF A;  1NX3 A;  3LL8 B;  2MLF C;  4GPL B;  2LE9 B;  4A4B A;  3DF0 A;  1KWO C;  2P6B B;  1S5G Z;  5FYX A;  1F70 A;  5KTY A;  2LAN A;  3EKJ A;  1YX8 A;  2L5X B;  4I5L B;  1ALW A;  2KGR A;  4OV2 A;  1JFK A;  1LXF C;  1SCM B;  1IJ5 A;  2JXL A;  1YRT B;  4NQG A;  2JUL A;  3SG2 A;  1KSM A;  2MLE C;  4YGA A;  2LMV A;  1AVS A;  1K9U A;  4GAO A;  1BF5 A;  1KFX S;  2WND A;  3RLZ A;  2HET A;  1LA3 A;  1XVJ A;  5CSI A;  2Y4Q A;  2COL B;  1PAL A;  2ZRS A;  2Q91 A;  2JT3 A;  3CR2 A;  1KK8 C;  1RK9 A;  5DKR A;  1SKT A;  3HCM A;  3KF9 A;  3KPX A;  3EVR A;  1HQV A;  2PAL A;  3OP0 A;  1RTP 1;  1SL9 A;  1LVC D;  1J7P A;  5AER A;  2KNE A;  1EJ3 A;  2K7D A;  2AAO A;  2L4I A;  1CM4 A;  3CWG A;  4NDB A;  2PRU A;  1NX0 A;  1A29 A;  1OQP A;  3PFV A;  1MWN A;  4HRG A;  2F2P A;  2CXJ A;  1R6P A;  1K94 A;  1ZUZ A;  2SAS A;  1DJW A;  3I5F B;  3VRN A;  5B8I B;  1A75 B;  2CBL A;  1SR6 B;  2O60 A;  2OS8 B;  1C7W A;  1IRJ A;  1S6I A;  2KFF A;  3WHT B;  1QIW A;  3PAT A;  4PHK A;  3BXK A;  2K2F A;  3F45 A;  2EC6 C;  1G33 A;  3NXA A;  1RWY A;  2LUX A;  3EK8 A;  4DRW A;  4YGB B;  1CFC A;  4QJ4 B;  4E68 A;  1LA0 A;  4NDC A;  1K95 A;  1UWO A;  1C07 A;  2BCX A;  2FOT A;  2ZNE A;  3DVJ A;  1SL7 A;  1PSR A;  2FCD A;  3I5H C;  1WY9 A;  2KI4 C;  2K7B A;  4ETO A;  1QV0 A;  1KFX L;  2SCP A;  2JWW A;  1F8H A;  4I5K A;  2VRG A;  5I2Q A;  1A75 A;  5DKN A;  1PUL A;  1XK4 C;  2K2A A;  3FIA A;  2G9B A;  3WHU B;  4PAL A;  1BOC A;  2CT9 A;  1SYM A;  2BE4 A;  4IL1 A;  3BYA A;  4XJK A;  4YBH B;  1QAS A;  4ORC B;  1CNP A;  3BUX B;  1N0Y A;  2LLS A;  1JF2 A;  4GNK B;  4QJ3 B;  5HKY A;  1TCO B;  4FQO A;  2MRD A;  1A4P A;  1QV1 A;  1KQV A;  3VRO A;  2K8M B;  2LP2 A;  1H4B A;  3LLE A;  2K61 A;  1YTZ C;  2JC2 A;  4OVN F;  2ZRT A;  4YRU A;  4WQ2 A;  4CFQ A;  5IBW A;  1JSA A;  1NX1 A;  1S36 A;  3I5I B;  1UP5 A;  4UPG A;  2M1K B;  1IKU A;  4HRH A;  1X02 A;  1JWD A;  1AK8 A;  2I7A A;  1W7I B;  2MJW B;  4YGD B;  2PMY A;  4F0Z B;  4DIR A;  4MRX A;  3D0Y A;  2HPS A;  2HQ8 A;  1SMG A;  3DF0 B;  1B9A A;  2EC6 B;  1BU3 A;  1M45 A;  1EXR A;  1NCY A;  1KQM C;  1QLK A;  4PHJ A;  5AFP A;  1FF1 A;  2JNF A;  3OB2 B;  1KCY A;  1QXP A;  1EH2 A;  3SG5 A;  3OX5 A;  1Q80 A;  3TUY C;  3IQQ A;  2KI6 D;  1CDL A;  1YVL A;  4BY4 A;  1SPY A;  1YUU A;  2WC8 A;  3I5H B;  2F3Z A;  4NDD A;  5HLV A;  3JTD C;  1SY9 A;  2RGI A;  5CPV A;  1BMO A;  4MLW A;  1R2U A;  1PVA A;  2M7N A;  1B7T Y;  3CTN A;  1YUR A;  4BY5 A;  2LLT A;  3QRX A;  2CTN A;  1IGV A;  1PK0 D;  3IF7 A;  4PE1 A;  5DKQ A;  1YUT A;  2KI6 C;  1JBA A;  4OR9 B;  2GGM A;  3TDU A;  3DVM A;  1CDN A;  1AJ4 A;  2LHL A;  1BT6 A;  2M1U A;  1YR5 A;  3MSE B;  2LP3 A;  2ZFD A;  1OSA A;  1VRK A;  2JTT A;  1WRZ A;  2BL0 C;  1SW8 A;  1DJY A;  3BQ3 A;  1J1D A;  1CFD A;  3PN7 C;  3E3R A;  2FJU B;  1XYD A;  3SIA A;  2I18 A;  3BUO B;  4U8D A;  1TOP A;  1FBV A;  3O4Y A;  2M97 A;  2ZN9 A;  1TNW A;  2KDH A;  2LVK A;  2BBN A;  1BG1 A;  2A4J A;  1CFF A;  3DVE A;  2L4H A;  5KSZ A;  5BPJ A;  2H61 C;  1B7T Z;  2LM5 A;  4C0J A;  2B1U A;  1QAT A;  1CKK A;  1JFJ A;  1G8I A;  1S26 D;  4MZJ A;  1QVI Y;  4D1E A;  1BR4 B;  1TTX A;  1IQ5 A;  3PSR A;  4P2Y B;  2L50 A;  3AKA A;  1MF8 B;  3KHE A;  1XFU O;  1CMF A;  3BUN B;  3GK2 A;  2WOS A;  1KFU L;  2OTG C;  1KK7 Y;  2M0R A;  2KQY A;  3NSI A;  5HYD A;  1B4C A;  1WDC B;  2WCB A;  1DF0 B;  1L2O B;  2F33 A;  4MZK A;  3TUY B;  3JVT B;  2F3Y A;  1CMG A;  1DMO A;  2MA2 A;  1S1E A;  1CLM A;  1OMR A;  1S6C A;  1U5I B;  5HKW A;  2JT0 A;  4PE4 A;  3DD4 A;  3I5G C;  2GV5 A;  4DS7 A;  2PVB A;  1MXL C;  1DJG A;  1QVI Z;  5D7F A;  2NZ0 A;  3GK4 X;  4XJK B;  4TNC A;  4AQJ A;  3VRP A;  3WNX B;  2MAZ A;  1K9K A;  2E6W A;  3A8R A;  4C0L A;  2KBM A;  3PAL A;  1QX5 B;  1JC2 A;  4QJ5 B;  1KK7 Z;  2V53 A;  2G2B A;  4FTG A;  2JNX A;  4I5J A;  1KWO B;  4YGC B;  1AHR A;  2QAC A;  4MN0 A;  4A4C A;  3PN7 B;  4R1E A;  1XO5 A;  1A03 A;  1QS7 A;  1DF0 A;  1BLQ A;  1N65 A;  1UUS A;  2WCF A;  1TN4 A;  2EGD A;  4CPV A;  1S6J A;  1B8L A;  3CS1 A;  2NLN A;  2M8U A;  3AAK A;  1K96 A;  1GJY A;  4MRY A;  1J7Q A;  2ISD A;  1U5I A;  2PAS A;  1B47 A;  3D0Y B;  4DCK A;  4C0K A;  1GQM A;  3TZ1 A;  4MEW A;  2KGB C;  3PLF B;  3M0W A;  1M46 A;  3LK0 A;  1F4Q A;  3ZWH A;  4JPZ B;  1YVH A;  1EG4 A;  2EHB A;  3CZT X;  2LVV A;  3H4S E;  2L98 A;  1KK8 B;  5ER4 X;  1J55 A;  1M63 B;  4PHM A;  4CFR A;  1XFY O;  2KAY A;  1DT7 B;  4HRE E;  1PRW A;  4N5X A;  1DGV A;  1TCF A;  1CTR A;  4ORB B;  1PSB A;  4DUQ A;  2LUC A;  1V1G A;  3SG3 A;  2JU0 A;  2LC5 A;  1REC A;  5TNC A;  5AEQ A;  1HT9 A;  1N2D A;  3LK1 A;  2KYC A;  1IG5 A;  1OZS A;  3FS7 A;  1K93 D;  1F71 A;  2JOJ A;  1QJT A;  4PE7 A;  1H8B A;  2I2R E;  2WCE A;  1BR1 B;  1NWD A;  2L2E A;  4ORA B;  1TIZ A;  3D10 A;  1K9P A;  3O2P A;  1SK6 D;  2KAV A;  3NSL A;  1SCM C;  1NIW A;  2K7O A;  2H2K A;  2LVI A;  1Y1A A;  4M2Q A;  1IQ3 A;  1AJ5 A;  2JZI A;  2KOT A;  2O5G A;  1LKJ A;  3WXA A;  2KI4 B;  1RRO A;  2KSP A;  1ZAC A;  4YI9 A;  1PVB A;  1XFV O;  4GGN A;  2BCA A;  4PDZ A;  3BOW A;  1NCX A;  1DGU A;  1V1F A;  1DVI A;  3AAJ A;  1F54 A;  3FWB A;  3PM8 A;  4HSZ A;  4JQ0 D;  1J7R A;  3C1V A;  5AAN A;  1JUO A;  3EK4 A;  1WLZ A;  3EVU A;  1FW4 A;  1EG3 A;  4WQ3 A;  4OCI A;  3TS5 C;  5I2L A;  3ICB A;  1WLM A;  3SG4 A;  2JXC A;  3I5F C;  1UUR A;  2BEC A;  3AKB A;  1CLB A;  1SL8 A;  1SR6 C;  4PE0 A;  2OS8 C;  4Q04 A;  1A2X A;  2JRF A;  1SRA A;  1BOD A;  4N1F A;  2Y5I A;  2WOR A;  5PAL A;  1ZOT B;  3O6B A;  4GGF C;  1ZMZ A;  1Y0V H;  3CGA A;  1XFZ O;  3ZNI A;  2LAP A;  1TRF A;  4I5N B;  2ZKM X;  1D1O A;  1XK4 A;  2NCO A;  1KQM B;  1CLL A;  2BKI B;  1IJ6 A;  2LMT A;  4L9M A;  4USL A;  2Y1N A;  3GOF A;  1NCZ A;  1UHN A;  4MSP A;  3EK7 A;  1F4O A;  1GGW A;  2M29 A;  3HX4 A;  1C7V A;  1J7O A;  1QIV A;  2LCP A;  2M7L A;  1QLS A;  1OOJ A;  1SCV A;  1WRL A;  2FCE A;  4P5O E;  2Q4U A;  1TNX A; 
#chains in the Genus database with same CATH topology
 1RFJ A;  3JTD B;  2KHN A;  1FPW A;  1DJH A;  3NHT A;  2GTE A;  3CAB A;  3GK1 A;  2ZND A;  1J1E A;  3VB1 A;  2WCJ A;  1OW4 A;  3SJS A;  2QDI A;  1SBJ A;  2LVJ A;  3EKH A;  1OOG A;  2KAX A;  1KSO A;  3BUW B;  1B8C A;  4PHN A;  4OKH A;  5I8N A;  2LV7 A;  4CLN A;  1L7Z A;  1TNQ A;  1DJI A;  1S3P A;  3NSO A;  4ZCV A;  1XFW O;  2BL0 B;  3CR4 X;  5HLO A;  1ALV A;  3A4U B;  3TS5 B;  5FI7 A;  1SSE B;  1XA5 A;  1W7J B;  4ICB A;  4AQI A;  4GFT A;  3K21 A;  1ORG A;  2CCM A;  2NCP A;  1OOI X;  3R1V A;  4GUK A;  3FE8 A;  5F6T A;  3SG7 A;  4F7F A;  3SG6 A;  3TDZ A;  2BCB A;  2K60 A;  3I5I C;  1NYA A;  3B86 A;  4MVF A;  5JOL A;  3OX6 A;  5CSN A;  1YRU B;  1IH0 A;  1OE9 B;  1CB1 A;  2LMU A;  2JT8 A;  3IQO A;  1NUB A;  1SNL A;  2K0J A;  3NSK A;  1CDM A;  1G4Y R;  2F8P A;  2KYF A;  1DTL A;  2Y1M A;  3CLN A;  2K7C A;  2QPT A;  1CDP A;  1WRK A;  2LHI A;  2MHH A;  4AOM A;  1YUS A;  2M3W A;  2WCK A;  2AUC A;  1JF0 A;  1K2H A;  3FWC A;  1NX2 A;  4CID A;  1CFP A;  4JD9 A;  3RM1 A;  1B8R A;  1QTX A;  3VRQ A;  2OTG B;  1LIN A;  1EL4 A;  1QX2 A;  2KFG A;  5I2O A;  3B6X A;  5D69 A;  1AUI B;  1B1G A;  1M39 A;  3TDI A;  3O78 A;  1E8A A;  1FI6 A;  4PCW A;  4MZL A;  5JJG A;  2D8N A;  4N1G A;  2BBM A;  5CSF A;  4YGE B;  5EL2 A;  5GQQ C;  3BOW B;  3LCP C;  2PSR A;  1ZFS A;  3I5G B;  4YI8 A;  1DJX A;  3KO0 A;  3EVV A;  2E30 A;  2R2I A;  2H61 A;  2LLU A;  2DOQ A;  1MHO A;  1FI5 A;  2JTZ A;  2HQW A;  2I94 A;  4OZD A;  1OMV A;  3B88 A;  1MXE A;  3OB1 B;  1RJV A;  3S0G A;  1MR8 A;  5HKZ A;  2TN4 A;  5CSJ A;  2HF5 A;  2L0P A;  1CM1 A;  4GGF A;  5AXI A;  2F2O A;  4JWQ A;  2M9G A;  3UO9 A;  4M2O A;  5K89 A;  2AMI A;  1MQ1 A;  2GGZ A;  2P71 A;  1OMD A;  1DJZ A;  5J3X A;  2NXQ A;  1K8U A;  1M31 A;  5KU1 A;  1XFX O;  1Y1U A;  4M2P A;  4GBA A;  1GM0 A;  1IIO A;  1UHI A;  4ZCU A;  4XYN A;  1Y6W A;  4IJ7 A;  1MUX A;  1ODB A;  2KBI A;  2KFH A;  2OPO A;  3BFB A;  1Y1X A;  3VRR A;  2CNP A;  3OBV A;  5ER5 A;  1NSH A;  1UHH A;  2KQ6 A;  3SS5 A;  4WRI A;  1NP8 A;  3KEV A;  1F55 A;  2MBX A;  1WDC C;  2BNX A;  2JPT A;  3B87 A;  5DIC A;  1L2O C;  1IWQ A;  5G08 A;  2L51 A;  1KFU S;  3JVT C;  1NPQ A;  1S5G Y;  4MBE A;  3SIB A;  2JQ6 A;  3OHM B;  3CR5 X;  1UHK A;  2LNK A;  2BE6 A;  1C3Z A;  1TNP A;  3L4A A;  2ZN8 A;  1UHJ A;  2IS9 A;  2BKH B;  1GGZ A;  1QX7 A;  3BUM B;  3VGO A;  1AP4 A;  2WCL A;  1OZO A;  2M49 B;  1K90 D;  1YX7 A;  3DVK A;  1BJF A;  3N7H A;  1NX3 A;  2QEB A;  3LL8 B;  2MLF C;  4GPL B;  3D73 A;  2LE9 B;  3D74 A;  4A4B A;  3DF0 A;  1KWO C;  2P6B B;  3D77 A;  1S5G Z;  5FYX A;  1F70 A;  5KTY A;  2LAN A;  3EKJ A;  1YX8 A;  2L5X B;  4I5L B;  1ALW A;  5HL1 A;  2KGR A;  4OV2 A;  3S0E A;  1JFK A;  1LXF C;  1SCM B;  1IJ5 A;  2JXL A;  1YRT B;  3CZ1 A;  3CYZ A;  4NQG A;  2JUL A;  3SG2 A;  1KSM A;  2MLE C;  2H8V A;  4YGA A;  2LMV A;  1AVS A;  1K9U A;  4GAO A;  1BF5 A;  1KFX S;  2WND A;  3RLZ A;  2HET A;  1LA3 A;  5I94 A;  1XVJ A;  5CSI A;  3QME A;  2Y4Q A;  2COL B;  1PAL A;  2ZRS A;  2Q91 A;  2JT3 A;  3CR2 A;  1KK8 C;  1RK9 A;  5DKR A;  1SKT A;  3HCM A;  3KF9 A;  3KPX A;  3EVR A;  1HQV A;  2PAL A;  3OP0 A;  1RTP 1;  1SL9 A;  1LVC D;  1J7P A;  5AER A;  2KNE A;  3SS4 A;  1EJ3 A;  2K7D A;  2AAO A;  2L4I A;  3D75 A;  1CM4 A;  3CWG A;  4NDB A;  2PRU A;  1NX0 A;  1A29 A;  1OQP A;  3PFV A;  1MWN A;  4HRG A;  2F2P A;  2CXJ A;  1R6P A;  1K94 A;  1ZUZ A;  2SAS A;  1DJW A;  3I5F B;  3VRN A;  5B8I B;  1A75 B;  1Z2C B;  2CBL A;  1SR6 B;  2O60 A;  2OS8 B;  1C7W A;  1IRJ A;  1S6I A;  2KFF A;  3WHT B;  1QIW A;  3PAT A;  4PHK A;  3BXK A;  2K2F A;  3F45 A;  2EC6 C;  1G33 A;  3NXA A;  1RWY A;  2LUX A;  3EK8 A;  4DRW A;  4YGB B;  1CFC A;  4QJ4 B;  4E68 A;  2FJY A;  1LA0 A;  4NDC A;  1K95 A;  1UWO A;  1C07 A;  2BCX A;  2FOT A;  2ZNE A;  3DVJ A;  1SL7 A;  1PSR A;  2FCD A;  3I5H C;  1WY9 A;  2KI4 C;  2K7B A;  3R72 A;  4ETO A;  1QV0 A;  1KFX L;  2SCP A;  3DZT A;  2JWW A;  1F8H A;  4I5K A;  2VRG A;  5I2Q A;  1A75 A;  5DKN A;  1PUL A;  1XK4 C;  2K2A A;  3FIA A;  2G9B A;  3WHU B;  3B7A A;  4PAL A;  2CT9 A;  1BOC A;  1SYM A;  2BE4 A;  4IL1 A;  3BYA A;  3NGV A;  4XJK A;  1QAS A;  3CZ0 A;  4ORC B;  4YBH B;  1CNP A;  3BUX B;  1N0Y A;  2LLS A;  1JF2 A;  4GNK B;  4QJ3 B;  1TUZ A;  2WCH A;  5HKY A;  1TCO B;  4FQO A;  2MRD A;  1A4P A;  1QV1 A;  1KQV A;  3VRO A;  2YGU A;  2QEO A;  2K8M B;  2LP2 A;  1H4B A;  1OOH A;  3LLE A;  2K61 A;  1YTZ C;  3DY9 A;  2JC2 A;  4OVN F;  2ZRT A;  4YRU A;  4WQ2 A;  4CFQ A;  5IBW A;  1JSA A;  1NX1 A;  1S36 A;  3I5I B;  1UP5 A;  4UPG A;  2M1K B;  1IKU A;  4HRH A;  1X02 A;  1JWD A;  1AK8 A;  2I7A A;  1W7I B;  2MJW B;  4YGD B;  2PMY A;  4FQT A;  5FI2 A;  4F0Z B;  4DIR A;  3FE6 A;  4MRX A;  3D0Y A;  2HPS A;  2HQ8 A;  1SMG A;  3DF0 B;  1B9A A;  2EC6 B;  1BU3 A;  1M45 A;  1EXR A;  1NCY A;  1KQM C;  1QLK A;  4PHJ A;  5FI6 A;  5AFP A;  1FF1 A;  2JNF A;  3OB2 B;  1KCY A;  1QXP A;  1EH2 A;  3SG5 A;  3OX5 A;  1Q80 A;  3TUY C;  3IQQ A;  2KI6 D;  1CDL A;  1YVL A;  4BY4 A;  1SPY A;  1YUU A;  2WC8 A;  3I5H B;  3PJI A;  2F3Z A;  4NDD A;  4INX A;  5HLV A;  3JTD C;  1SY9 A;  2RGI A;  5CPV A;  1BMO A;  4MLW A;  1R2U A;  1PVA A;  2M7N A;  1B7T Y;  2QEH A;  1YUR A;  3CTN A;  2LLT A;  3EG5 B;  4BY5 A;  1LS8 A;  3QRX A;  2CTN A;  1IGV A;  1PK0 D;  3IF7 A;  4PE1 A;  5DKQ A;  1YUT A;  2KI6 C;  1JBA A;  4OR9 B;  3PM2 A;  2GGM A;  3TDU A;  3DVM A;  1CDN A;  3O4X A;  1AJ4 A;  2LHL A;  1BT6 A;  2JPO A;  1YR5 A;  2M1U A;  3MSE B;  2LP3 A;  2ZFD A;  1OSA A;  1VRK A;  2JTT A;  1WRZ A;  3R1O A;  2BL0 C;  2L2C A;  1SW8 A;  1DJY A;  3BQ3 A;  1J1D A;  3V2L A;  1CFD A;  3PN7 C;  3E3R A;  2FJU B;  1XYD A;  2ERB A;  2I18 A;  3BUO B;  4U8D A;  3SIA A;  1TOP A;  1FBV A;  3O4Y A;  2M97 A;  2ZN9 A;  1TNW A;  2KDH A;  2LVK A;  2BBN A;  3BJH A;  2A4J A;  1BG1 A;  3DVE A;  1CFF A;  2L4H A;  5KSZ A;  5BPJ A;  2H61 C;  1B7T Z;  2LM5 A;  4C0J A;  3S0F A;  2B1U A;  1QAT A;  3CZ2 A;  1QWV A;  1CKK A;  1JFJ A;  1G8I A;  1S26 D;  4MZJ A;  3CDN A;  1QVI Y;  4D1E A;  1DC1 A;  1BR4 B;  1TTX A;  1IQ5 A;  2WC6 A;  3DXL A;  3IVT A;  3PSR A;  4P2Y B;  2KPH A;  1P28 A;  2L50 A;  1MF8 B;  3AKA A;  1XFU O;  3DYE A;  3KHE A;  4INW A;  1CMF A;  3BUN B;  3GK2 A;  2WOS A;  1KFU L;  2OTG C;  1KK7 Y;  2M0R A;  2KQY A;  3NSI A;  5HYD A;  1B4C A;  1WDC B;  3SS3 A;  2WCB A;  1DF0 B;  1L2O B;  2F33 A;  4MZK A;  3TUY B;  3JVT B;  2F3Y A;  2PYQ A;  1CMG A;  1DMO A;  3OGN A;  2MA2 A;  3RZS A;  1S1E A;  1CLM A;  1OMR A;  1S6C A;  1U5I B;  5HKW A;  2JT0 A;  4PE4 A;  3DD4 A;  3I5G C;  2GV5 A;  4DS7 A;  2PVB A;  1MXL C;  1DJG A;  1QVI Z;  2PQL A;  2NZ0 A;  5D7F A;  3GK4 X;  4XJK B;  4TNC A;  4AQJ A;  3VRP A;  3WNX B;  2MAZ A;  1K9K A;  2E6W A;  3A8R A;  4C0L A;  2KBM A;  3PAL A;  1QX5 B;  1JC2 A;  4QJ5 B;  1KK7 Z;  2V53 A;  2G2B A;  4FTG A;  1Z4H A;  2JNX A;  4I5J A;  1KWO B;  4YGC B;  1AHR A;  2QAC A;  4MN0 A;  2P70 A;  4A4C A;  3PN7 B;  4R1E A;  1XO5 A;  1A03 A;  1QS7 A;  2QEV A;  1DF0 A;  1BLQ A;  1N65 A;  1UUS A;  2WCF A;  1TN4 A;  2EGD A;  1TWO A;  1S6J A;  1B8L A;  2BAP A;  4CPV A;  3CS1 A;  2NLN A;  2M8U A;  3AAK A;  1K96 A;  1GJY A;  4MRY A;  1OOF A;  1J7Q A;  1TUJ A;  2ISD A;  1U5I A;  2PAS A;  1B47 A;  3D0Y B;  3L47 A;  4C0K A;  4DCK A;  1GQM A;  3TZ1 A;  4MEW A;  2KGB C;  3PLF B;  3M0W A;  1M46 A;  3LK0 A;  3UNW A;  3K1E A;  1F4Q A;  3ZWH A;  4JPZ B;  1YVH A;  1EG4 A;  2EHB A;  3CZT X;  2KLE A;  2LVV A;  3H4S E;  2L98 A;  1KK8 B;  3NHI A;  5ER4 X;  1C3Y A;  1J55 A;  1M63 B;  4PHM A;  4CFR A;  1XFY O;  2KAY A;  1DEL A;  1DT7 B;  4HRE E;  1PRW A;  4N5X A;  1DGV A;  1TCF A;  1CTR A;  4ORB B;  1PSB A;  4DUQ A;  2LUC A;  2L5Y A;  1V1G A;  3SG3 A;  2JU0 A;  2LC5 A;  3BFH A;  1REC A;  3D76 A;  2KLD A;  5TNC A;  5AEQ A;  1HT9 A;  1N2D A;  3LK1 A;  2KYC A;  1IG5 A;  1OZS A;  3FS7 A;  4PT1 A;  1K93 D;  1T14 A;  1F71 A;  2JOJ A;  1QJT A;  4PE7 A;  1H8B A;  2I2R E;  2WCE A;  1BR1 B;  1NWD A;  2L2E A;  4ORA B;  1TIZ A;  3D10 A;  1K9P A;  3O2P A;  1SK6 D;  2KAV A;  3S0B A;  3NSL A;  1SCM C;  1W9Z A;  1NIW A;  2K7O A;  4KYN A;  2H2K A;  1XFR A;  2LVI A;  1Y1A A;  4M2Q A;  1IQ3 A;  1AJ5 A;  2JZI A;  2KOT A;  2O5G A;  1LKJ A;  3WXA A;  2KI4 B;  1RRO A;  2KSP A;  1ZAC A;  4JKT A;  4YI9 A;  1PVB A;  3D78 A;  1XFV O;  4GGN A;  2BCA A;  4PDZ A;  3BOW A;  1NCX A;  1DGU A;  1V1F A;  1DVI A;  1DQE A;  3AAJ A;  1F54 A;  3FWB A;  3PM8 A;  4HSZ A;  4JQ0 D;  1J7R A;  3C1V A;  5AAN A;  2WCM A;  1JUO A;  3EK4 A;  1WLZ A;  3EVU A;  1FW4 A;  1EG3 A;  4WQ3 A;  4OCI A;  3TS5 C;  5I2L A;  3ICB A;  1WLM A;  3SG4 A;  2WC5 A;  2JXC A;  3I5F C;  3S0A A;  1UUR A;  3L4L A;  2BEC A;  3AKB A;  3Q8I A;  1CLB A;  3BFA A;  1SL8 A;  1SR6 C;  4PE0 A;  2OS8 C;  3R1P A;  4Q04 A;  1A2X A;  2JRF A;  1SRA A;  1BOD A;  4N1F A;  2Y5I A;  2WOR A;  5PAL A;  1ZOT B;  5D3O A;  3O6B A;  4GGF C;  1ZMZ A;  1Y0V H;  3CGA A;  1XFZ O;  3S0D A;  3ZNI A;  2LAP A;  1TRF A;  4I5N B;  2ZKM X;  1D1O A;  1XK4 A;  2NCO A;  1KQM B;  1CLL A;  2BKI B;  1IJ6 A;  2LMT A;  4L9M A;  4USL A;  2Y1N A;  3GOF A;  1DEK A;  1NCZ A;  1UHN A;  3FE9 A;  4MSP A;  3EK7 A;  1F4O A;  1GGW A;  2M29 A;  3HX4 A;  1C7V A;  1J7O A;  1QIV A;  2LCP A;  2M7L A;  1QLS A;  1OOJ A;  1SCV A;  1WRL A;  2FCE A;  4P5O E;  2Q4U A;  1TNX A; 
#chains in the Genus database with same CATH homology
 1RFJ A;  3JTD B;  2KHN A;  1FPW A;  1DJH A;  3GK1 A;  2ZND A;  1J1E A;  3SJS A;  1SBJ A;  2LVJ A;  3EKH A;  2KAX A;  1KSO A;  3BUW B;  1B8C A;  4PHN A;  4OKH A;  5I8N A;  2LV7 A;  4CLN A;  1L7Z A;  1TNQ A;  1DJI A;  1S3P A;  3NSO A;  4ZCV A;  1XFW O;  2BL0 B;  3CR4 X;  5HLO A;  1ALV A;  3A4U B;  3TS5 B;  1XA5 A;  4AQI A;  1W7J B;  4ICB A;  4GFT A;  3K21 A;  5F6T A;  2CCM A;  2NCP A;  4GUK A;  3SG7 A;  3SG6 A;  3TDZ A;  2BCB A;  3I5I C;  1NYA A;  4MVF A;  5JOL A;  3OX6 A;  5CSN A;  1YRU B;  1IH0 A;  1OE9 B;  1CB1 A;  2LMU A;  2JT8 A;  3IQO A;  1NUB A;  1SNL A;  2K0J A;  3NSK A;  1CDM A;  1G4Y R;  2F8P A;  2KYF A;  1DTL A;  2Y1M A;  3CLN A;  2K7C A;  2QPT A;  1CDP A;  1WRK A;  2LHI A;  2MHH A;  4AOM A;  1YUS A;  2M3W A;  1K2H A;  2AUC A;  1JF0 A;  3FWC A;  1NX2 A;  4CID A;  1CFP A;  3RM1 A;  3VRQ A;  1B8R A;  1QTX A;  2OTG B;  1LIN A;  1EL4 A;  1QX2 A;  2KFG A;  5I2O A;  5D69 A;  1AUI B;  1B1G A;  1M39 A;  3TDI A;  3O78 A;  1E8A A;  1FI6 A;  4PCW A;  4MZL A;  5JJG A;  2D8N A;  4N1G A;  2BBM A;  5CSF A;  4YGE B;  5GQQ C;  3BOW B;  3LCP C;  2PSR A;  1ZFS A;  3I5G B;  4YI8 A;  1DJX A;  3KO0 A;  3EVV A;  2E30 A;  2R2I A;  2H61 A;  2LLU A;  2DOQ A;  1MHO A;  1FI5 A;  2JTZ A;  2HQW A;  2I94 A;  1OMV A;  1MXE A;  3OB1 B;  1RJV A;  1MR8 A;  5HKZ A;  2TN4 A;  5CSJ A;  2HF5 A;  2L0P A;  1CM1 A;  4GGF A;  5AXI A;  2F2O A;  4JWQ A;  2M9G A;  5K89 A;  4M2O A;  2AMI A;  1MQ1 A;  2GGZ A;  1OMD A;  1DJZ A;  5J3X A;  2NXQ A;  1K8U A;  1M31 A;  5KU1 A;  1XFX O;  1Y1U A;  4M2P A;  4GBA A;  1UHI A;  4ZCU A;  4XYN A;  1Y6W A;  1MUX A;  1ODB A;  2KBI A;  2KFH A;  2OPO A;  1Y1X A;  3VRR A;  2CNP A;  5ER5 A;  1NSH A;  1UHH A;  2KQ6 A;  4WRI A;  1NP8 A;  3KEV A;  1F55 A;  2MBX A;  1WDC C;  2JPT A;  1L2O C;  1IWQ A;  5G08 A;  2L51 A;  1KFU S;  3JVT C;  1NPQ A;  1S5G Y;  4MBE A;  3SIB A;  2JQ6 A;  3OHM B;  3CR5 X;  1UHK A;  2LNK A;  2BE6 A;  1TNP A;  2ZN8 A;  1UHJ A;  2IS9 A;  2BKH B;  1GGZ A;  1QX7 A;  3BUM B;  3VGO A;  1AP4 A;  1OZO A;  2M49 B;  1K90 D;  1YX7 A;  3DVK A;  1BJF A;  1NX3 A;  3LL8 B;  2MLF C;  4GPL B;  2LE9 B;  4A4B A;  3DF0 A;  1KWO C;  2P6B B;  1S5G Z;  5FYX A;  1F70 A;  5KTY A;  2LAN A;  3EKJ A;  1YX8 A;  2L5X B;  4I5L B;  1ALW A;  2KGR A;  4OV2 A;  1JFK A;  1LXF C;  1SCM B;  1IJ5 A;  2JXL A;  1YRT B;  4NQG A;  2JUL A;  3SG2 A;  1KSM A;  2MLE C;  4YGA A;  2LMV A;  1AVS A;  1K9U A;  4GAO A;  1BF5 A;  1KFX S;  2WND A;  3RLZ A;  2HET A;  1LA3 A;  1XVJ A;  5CSI A;  2Y4Q A;  2COL B;  1PAL A;  2ZRS A;  2Q91 A;  2JT3 A;  3CR2 A;  1KK8 C;  1RK9 A;  5DKR A;  1SKT A;  3HCM A;  3KF9 A;  3KPX A;  3EVR A;  1HQV A;  2PAL A;  3OP0 A;  1RTP 1;  1SL9 A;  1LVC D;  1J7P A;  5AER A;  2KNE A;  1EJ3 A;  2K7D A;  2AAO A;  2L4I A;  1CM4 A;  3CWG A;  4NDB A;  2PRU A;  1NX0 A;  1A29 A;  1OQP A;  3PFV A;  1MWN A;  4HRG A;  2F2P A;  2CXJ A;  1R6P A;  1K94 A;  1ZUZ A;  2SAS A;  1DJW A;  3I5F B;  3VRN A;  5B8I B;  1A75 B;  2CBL A;  1SR6 B;  2O60 A;  2OS8 B;  1C7W A;  1IRJ A;  1S6I A;  2KFF A;  3WHT B;  1QIW A;  3PAT A;  4PHK A;  3BXK A;  2K2F A;  3F45 A;  2EC6 C;  1G33 A;  3NXA A;  1RWY A;  2LUX A;  3EK8 A;  4DRW A;  4YGB B;  1CFC A;  4QJ4 B;  4E68 A;  1LA0 A;  4NDC A;  1K95 A;  1UWO A;  1C07 A;  2BCX A;  2FOT A;  2ZNE A;  3DVJ A;  1SL7 A;  1PSR A;  2FCD A;  3I5H C;  1WY9 A;  2KI4 C;  2K7B A;  4ETO A;  1QV0 A;  1KFX L;  2SCP A;  2JWW A;  1F8H A;  4I5K A;  2VRG A;  5I2Q A;  1A75 A;  5DKN A;  1PUL A;  1XK4 C;  2K2A A;  3FIA A;  2G9B A;  3WHU B;  4PAL A;  1BOC A;  2CT9 A;  1SYM A;  2BE4 A;  4IL1 A;  3BYA A;  4XJK A;  4YBH B;  1QAS A;  4ORC B;  1CNP A;  3BUX B;  1N0Y A;  2LLS A;  1JF2 A;  4GNK B;  4QJ3 B;  5HKY A;  1TCO B;  4FQO A;  2MRD A;  1A4P A;  1QV1 A;  1KQV A;  3VRO A;  2K8M B;  2LP2 A;  1H4B A;  3LLE A;  2K61 A;  1YTZ C;  2JC2 A;  4OVN F;  2ZRT A;  4YRU A;  4WQ2 A;  4CFQ A;  5IBW A;  1JSA A;  1NX1 A;  1S36 A;  3I5I B;  1UP5 A;  4UPG A;  2M1K B;  1IKU A;  4HRH A;  1X02 A;  1JWD A;  1AK8 A;  2I7A A;  1W7I B;  2MJW B;  4YGD B;  2PMY A;  4F0Z B;  4DIR A;  4MRX A;  3D0Y A;  2HPS A;  2HQ8 A;  1SMG A;  3DF0 B;  1B9A A;  2EC6 B;  1BU3 A;  1M45 A;  1EXR A;  1NCY A;  1KQM C;  1QLK A;  4PHJ A;  5AFP A;  1FF1 A;  2JNF A;  3OB2 B;  1KCY A;  1QXP A;  1EH2 A;  3SG5 A;  3OX5 A;  1Q80 A;  3TUY C;  3IQQ A;  2KI6 D;  1CDL A;  1YVL A;  4BY4 A;  1SPY A;  1YUU A;  2WC8 A;  3I5H B;  2F3Z A;  4NDD A;  5HLV A;  3JTD C;  1SY9 A;  2RGI A;  5CPV A;  1BMO A;  4MLW A;  1R2U A;  1PVA A;  2M7N A;  1B7T Y;  3CTN A;  1YUR A;  4BY5 A;  2LLT A;  3QRX A;  2CTN A;  1IGV A;  1PK0 D;  3IF7 A;  4PE1 A;  5DKQ A;  1YUT A;  2KI6 C;  1JBA A;  4OR9 B;  2GGM A;  3TDU A;  3DVM A;  1CDN A;  1AJ4 A;  2LHL A;  1BT6 A;  2M1U A;  1YR5 A;  3MSE B;  2LP3 A;  2ZFD A;  1OSA A;  1VRK A;  2JTT A;  1WRZ A;  2BL0 C;  1SW8 A;  1DJY A;  3BQ3 A;  1J1D A;  1CFD A;  3PN7 C;  3E3R A;  2FJU B;  1XYD A;  3SIA A;  2I18 A;  3BUO B;  4U8D A;  1TOP A;  1FBV A;  3O4Y A;  2M97 A;  2ZN9 A;  1TNW A;  2KDH A;  2LVK A;  2BBN A;  1BG1 A;  2A4J A;  1CFF A;  3DVE A;  2L4H A;  5KSZ A;  5BPJ A;  2H61 C;  1B7T Z;  2LM5 A;  4C0J A;  2B1U A;  1QAT A;  1CKK A;  1JFJ A;  1G8I A;  1S26 D;  4MZJ A;  1QVI Y;  4D1E A;  1BR4 B;  1TTX A;  1IQ5 A;  3PSR A;  4P2Y B;  2L50 A;  3AKA A;  1MF8 B;  3KHE A;  1XFU O;  1CMF A;  3BUN B;  3GK2 A;  2WOS A;  1KFU L;  2OTG C;  1KK7 Y;  2M0R A;  2KQY A;  3NSI A;  5HYD A;  1B4C A;  1WDC B;  2WCB A;  1DF0 B;  1L2O B;  2F33 A;  4MZK A;  3TUY B;  3JVT B;  2F3Y A;  1CMG A;  1DMO A;  2MA2 A;  1S1E A;  1CLM A;  1OMR A;  1S6C A;  1U5I B;  5HKW A;  2JT0 A;  4PE4 A;  3DD4 A;  3I5G C;  2GV5 A;  4DS7 A;  2PVB A;  1MXL C;  1DJG A;  1QVI Z;  5D7F A;  2NZ0 A;  3GK4 X;  4XJK B;  4TNC A;  4AQJ A;  3VRP A;  3WNX B;  2MAZ A;  1K9K A;  2E6W A;  3A8R A;  4C0L A;  2KBM A;  3PAL A;  1QX5 B;  1JC2 A;  4QJ5 B;  1KK7 Z;  2V53 A;  2G2B A;  4FTG A;  2JNX A;  4I5J A;  1KWO B;  4YGC B;  1AHR A;  2QAC A;  4MN0 A;  4A4C A;  3PN7 B;  4R1E A;  1XO5 A;  1A03 A;  1QS7 A;  1DF0 A;  1BLQ A;  1N65 A;  1UUS A;  2WCF A;  1TN4 A;  2EGD A;  4CPV A;  1S6J A;  1B8L A;  3CS1 A;  2NLN A;  2M8U A;  3AAK A;  1K96 A;  1GJY A;  4MRY A;  1J7Q A;  2ISD A;  1U5I A;  2PAS A;  1B47 A;  3D0Y B;  4DCK A;  4C0K A;  1GQM A;  3TZ1 A;  4MEW A;  2KGB C;  3PLF B;  3M0W A;  1M46 A;  3LK0 A;  1F4Q A;  3ZWH A;  4JPZ B;  1YVH A;  1EG4 A;  2EHB A;  3CZT X;  2LVV A;  3H4S E;  2L98 A;  1KK8 B;  5ER4 X;  1J55 A;  1M63 B;  4PHM A;  4CFR A;  1XFY O;  2KAY A;  1DT7 B;  4HRE E;  1PRW A;  4N5X A;  1DGV A;  1TCF A;  1CTR A;  4ORB B;  1PSB A;  4DUQ A;  2LUC A;  1V1G A;  3SG3 A;  2JU0 A;  2LC5 A;  1REC A;  5TNC A;  5AEQ A;  1HT9 A;  1N2D A;  3LK1 A;  2KYC A;  1IG5 A;  1OZS A;  3FS7 A;  1K93 D;  1F71 A;  2JOJ A;  1QJT A;  4PE7 A;  1H8B A;  2I2R E;  2WCE A;  1BR1 B;  1NWD A;  2L2E A;  4ORA B;  1TIZ A;  3D10 A;  1K9P A;  3O2P A;  1SK6 D;  2KAV A;  3NSL A;  1SCM C;  1NIW A;  2K7O A;  2H2K A;  2LVI A;  1Y1A A;  4M2Q A;  1IQ3 A;  1AJ5 A;  2JZI A;  2KOT A;  2O5G A;  1LKJ A;  3WXA A;  2KI4 B;  1RRO A;  2KSP A;  1ZAC A;  4YI9 A;  1PVB A;  1XFV O;  4GGN A;  2BCA A;  4PDZ A;  3BOW A;  1NCX A;  1DGU A;  1V1F A;  1DVI A;  3AAJ A;  1F54 A;  3FWB A;  3PM8 A;  4HSZ A;  4JQ0 D;  1J7R A;  3C1V A;  5AAN A;  1JUO A;  3EK4 A;  1WLZ A;  3EVU A;  1FW4 A;  1EG3 A;  4WQ3 A;  4OCI A;  3TS5 C;  5I2L A;  3ICB A;  1WLM A;  3SG4 A;  2JXC A;  3I5F C;  1UUR A;  2BEC A;  3AKB A;  1CLB A;  1SL8 A;  1SR6 C;  4PE0 A;  2OS8 C;  4Q04 A;  1A2X A;  2JRF A;  1SRA A;  1BOD A;  4N1F A;  2Y5I A;  2WOR A;  5PAL A;  1ZOT B;  3O6B A;  4GGF C;  1ZMZ A;  1Y0V H;  3CGA A;  1XFZ O;  3ZNI A;  2LAP A;  1TRF A;  4I5N B;  2ZKM X;  1D1O A;  1XK4 A;  2NCO A;  1KQM B;  1CLL A;  2BKI B;  1IJ6 A;  2LMT A;  4L9M A;  4USL A;  2Y1N A;  3GOF A;  1NCZ A;  1UHN A;  4MSP A;  3EK7 A;  1F4O A;  1GGW A;  2M29 A;  3HX4 A;  1C7V A;  1J7O A;  1QIV A;  2LCP A;  2M7L A;  1QLS A;  1OOJ A;  1SCV A;  1WRL A;  2FCE A;  4P5O E;  2Q4U A;  1TNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...