3NGVA

Crystal structure of anst-d7l1
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
296
structure length
296
Chain Sequence
QPWKALDAEQALYVYKRCYEDHLPSGSDRKTYMTLWNAWRLEPNDAITHCYAKCVLTGLQIYDPQENAFKSDRIPVQYQAYKTITQSKQKEVTEYQKALAAANAKSGSCVDLYNAYLPVHNRFVNLSRQLYHGTVEGAAKIYAAMPEIKQKGESFHAYCEKRAWKGNKQSEWKNGRRYKLTGSPELKDAIDCIFRGLRYMDDTGLKVDEIVRDFNLINKSELEPEVRSVLASCKGSEAYDYYVCLVNSRLKQHFKNAFDFHELRSADYAYLLRGKVYENPEKVKEEMKKLNTTVHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D7 protein
publication title The function and three-dimensional structure of a thromboxane a(2)/cysteinyl leukotriene-binding protein from the saliva of a mosquito vector of the malaria parasite.
pubmed doi rcsb
source organism Anopheles stephensi
molecule tags Transport protein
total genus 113
structure length 296
sequence length 296
ec nomenclature ec 5.99.1.2: Transferred entry: 5.6.2.2.
pdb deposition date 2010-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3ngvA02
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3ngvA01
1ORGA 3RZSA 1DQEA 3DYEA 2WCJA 1LS8A 3QMEA 4JD9A 2P70A 3V2LA 2PQLA 3BFBA 4FQTA 2L2CA 3L4AA 3B88A 3S0EA 3PJIA 3CZ2A 3B6XA 3DY9A 5EL2A 1OOHA 2QEBA 1T14A 2H8VA 3D78A 3N7HA 4INXA 3VB1A 2QEOA 3CZ0A 3R72A 3NHIA 3DZTA 2GTEA 3OGNA 3R1PA 3CDNA 3NGVA 2QDIA 1OW4A 2WCKA 3L4LA 3BFHA 3D74A 3S0GA 1GM0A 3D75A 2WC5A 2WCLA 2P71A 3B86A 1OOGA 3DXLA 3S0DA 4F7FA 2WCHA 3R1OA 3CABA 2FJYA 2KPHA 3Q8IA 3CZ1A 1QWVA 2WCMA 1C3ZA 3D76A 2QEVA 3FE6A 1P28A 3S0BA 1TUJA 3K1EA 3FE9A 3BFAA 1TWOA 2ERBA 3BJHA 1OOIX 4INWA 4PT1A 2WC6A 1XFRA 3R1VA 3B7AA 3S0FA 2QEHA 3B87A 3L47A 5DICA 3CYZA 3FE8A 1C3YA 3D77A 3S0AA 2JPOA 3NHTA 4OZDA 1OOFA 3D73A
chains in the Genus database with same CATH superfamily
1IWQA 5AXIA 1F70A 4GGFC 2Y1NA 2WCJA 4JD9A 1AVSA 2KLEA 3PM8A 3AKBA 1B8RA 4A4BA 4R1EA 1B7TZ 3I5GC 1DC1A 1CB1A 5J3XA 1BLQA 2PQLA 1Y0VH 5DKRA 1UURA 1KSOA 2HPSA 5CSIA 3B88A 4NQGA 1CTRA 4AQJA 1ALVA 2KAYA 3NSKA 3ZNIA 5I2QA 3CZ2A 3B6XA 1SR6C 4MSPA 2LP3A 2M97A 1MHOA 2MJWB 1D1OA 5EL2A 2KI6C 1SCMC 1DEKA 2LAPA 2LLUA 1PK0D 1DVIA 2H8VA 1FPWA 1WLZA 3D78A 3AAJA 3N7HA 4QJ4B 2K61A 1CFDA 1GQMA 3VB1A 2BKHB 4CFQA 4KYNA 1BF5A 2HF5A 4MRYA 2COLB 2Q4UA 1BT6A 4FQOA 3JTDC 1NSHA 2KI4B 1ZOTB 3NHIA 2LM5A 2AMIA 1K9UA 1JC2A 4GGNA 3CDNA 3CWGA 2ZRSA 1SYMA 5ER4X 4F0ZB 4WRIA 2MLEC 1C7WA 1QTXA 2I2RE 2L4HA 3L4LA 1X02A 3VRRA 4GGFA 1BR4B 1S26D 1YR5A 2D8NA 3D74A 4YGEB 3FS7A 4XJKA 1YUSA 1LXFC 1S5GZ 2GGZA 3PATA 1NX2A 3ICBA 4MZLA 3VRNA 2QPTA 2WCLA 3VRPA 3LL8B 1MXLC 4L9MA 5I2OA 4MLWA 1OOGA 1OZOA 1YX8A 3NSIA 4PALA 3RLZA 3S0DA 1A75A 1DJHA 1J7QA 1G33A 1JUOA 3I5HC 1ZFSA 1A03A 1EG3A 1IGVA 2FJYA 2JOJA 2PMYA 3CR5X 2KPHA 1DMOA 1EH2A 3Q8IA 1OMDA 4HRGA 4PHJA 1B1GA 2BAPA 3CZ1A 1LA0A 2LCPA 1B8LA 4PCWA 1CM1A 4E68A 2WCMA 1C3ZA 1QV0A 1TCOB 4PDZA 4Q04A 1SL7A 3O2PA 2L50A 2ZNDA 1IJ6A 1TUJA 1AUIB 5HLOA 2PALA 3BFAA 1SY9A 2LMVA 5DKQA 1LINA 1NWDA 3LK0A 2LLSA 2JWWA 1LA3A 1FI5A 1PSBA 1UHNA 3GK2A 1CDMA 3BJHA 3F45A 3KF9A 3VROA 2MLFC 5I2LA 1RROA 3EVVA 3EVUA 4PT1A 3A8RA 1KK8C 1KWOC 5DKNA 1QXPA 2BL0B 1EL4A 1MR8A 2VRGA 3BYAA 3KO0A 1KFXL 1WLMA 3R1VA 4I5KA 1B8CA 5CSFA 2OS8B 1Z2CB 1H8BA 2WC8A 3B87A 4JPZB 1F4QA 1KQMC 1L7ZA 1TNWA 5JJGA 3FE8A 4IL1A 3BUOB 3S0AA 2Q91A 1IKUA 1C3YA 1TCFA 2OTGC 1EJ3A 3OX6A 1TRFA 4OVNF 2Y1MA 4ETOA 2FOTA 3PM2A 2JTZA 1NUBA 2JXCA 4A4CA 3NHTA 4UPGA 1HT9A 1OSAA 2LHLA 1TN4A 2KGBC 2M0RA 1KFXS 3FWBA 1IRJA 4PE1A 2NLNA 3I5FB 4P2YB 2I18A 3QMEA 4PHNA 3A4UB 2P70A 3NSOA 5D69A 1F71A 2K60A 3V2LA 3BQ3A 1J1EA 4YGBB 1DF0B 4FQTA 4YGCB 1BMOA 1K94A 3DF0A 2LLTA 1OMRA 5AFPA 3UO9A 1PVAA 1WDCB 1K96A 1OMVA 1EG4A 3CZTX 2JRFA 3DY9A 1NCXA 5F6TA 2JT3A 1U5IA 2Y5IA 2EC6C 1IJ5A 1DTLA 1WRZA 1DELA 2ZN9A 2NZ0A 1TTXA 1DJXA 1OQPA 2V53A 3LLEA 4HSZA 2JNFA 4CFRA 2KOTA 1BU3A 4TNCA 1YRTB 2FJUB 3KEVA 1OE9B 1PRWA 3CZ0A 1XVJA 1S3PA 4CIDA 5B8IB 1CM4A 3OB2B 3SG4A 4I5JA 2BNXA 3SG7A 3DZTA 1CDNA 4MBEA 1SSEB 2GTEA 2KBIA 4PHKA 4D1EA 1KFUL 3I5IB 2QDIA 5BPJA 1SNLA 1QJTA 1Y1AA 2WCKA 4N1GA 1BOCA 1G8IA 1SMGA 1Q80A 3TUYC 3QRXA 2K7DA 1J1DA 4DIRA 4GBAA 1GM0A 2M29A 1CDLA 3TS5C 3HX4A 2KFHA 1C07A 2BCBA 2O5GA 3PN7C 4YBHB 5D7FA 2JC2A 2M9GA 1CMFA 1FF1A 3B86A 4C0LA 4PHMA 1DJYA 3JVTC 2WCHA 2EGDA 1UHJA 3EG5B 2M7LA 1ZUZA 1H4BA 3PFVA 2LVJA 2WCFA 3CGAA 5PALA 4MRXA 1TIZA 1XFUO 2LMUA 1OZSA 1QWVA 1RFJA 3OP0A 1XFXO 2PVBA 1NCZA 4NDBA 2KHNA 4DUQA 1SW8A 2G2BA 1IG5A 2KBMA 1QV1A 3TDUA 1WRLA 2E30A 1QS7A 3FIAA 4XJKB 2K7BA 2HQWA 1NP8A 3TDZA 4QJ5B 1DT7B 1NX3A 3I5GB 2KAXA 2MA2A 4YI9A 1AP4A 1DGVA 4USLA 4ZCVA 1XA5A 2LC5A 1M46A 2LUXA 2NCOA 3SIBA 3WHTB 1A75B 2KDHA 1G4YR 5CSNA 3CR2A 4INWA 3D0YA 2AAOA 1R6PA 3CR4X 1J7PA 1SL8A 1SKTA 1DJZA 1WRKA 1DGUA 1SR6B 1XFRA 3FWCA 2F2OA 4AQIA 1UUSA 1DJWA 2QEHA 3S0FA 1SCMB 2JXLA 4DRWA 3CYZA 2M1KB 4IJ7A 3D77A 3SS4A 1CMGA 1UWOA 1M63B 2PYQA 5AERA 1CFFA 2K8MB 1Y1UA 1JF0A 4M2PA 1YRUB 2BCAA 2F3YA 3KHEA 2DOQA 1FBVA 2P6BB 3O6BA 4OZDA 2ZFDA 3JTDB 1IH0A 2FCEA 3SG3A 3RZSA 2KQ6A 3EKHA 1SK6D 3SG6A 4GFTA 2ZNEA 2L0PA 5AEQA 3BUWB 2Y4QA 2JQ6A 2E6WA 2GGMA 3DVEA 1SBJA 1QIWA 3O4XA 4CLNA 3NXAA 3BFBA 4MN0A 3I5FC 1SRAA 1QIVA 3L4AA 3WNXB 1LVCD 1GJYA 1W7JB 1XFYO 1YUUA 3S0EA 2ISDA 1CDPA 1QVIY 1PSRA 1VRKA 2KFFA 5HKWA 2CTNA 1OOHA 2JNXA 2QEBA 1WDCC 3TDIA 2JZIA 4YGAA 3I5HB 2WORA 1JF2A 2KQYA 1JFKA 1F8HA 4WQ3A 2BE6A 1N0YA 2F33A 1L2OC 1RTP1 1F55A 2QEOA 1QATA 1S6JA 4JWQA 2LHIA 2LE9B 2ZKMX 3BOWB 4GPLB 2WCEA 2AUCA 3DF0B 2KYFA 3PSRA 2KSPA 4N5XA 3PALA 3OGNA 3D10A 3HCMA 2MRDA 3NSLA 4M2OA 3SS3A 4DCKA 2WCBA 1SPYA 1DJGA 1CNPA 2FCDA 1K93D 2CXJA 1OW4A 1TNPA 2MHHA 1KSMA 4BY4A 1U5IB 1UHKA 2K7CA 1MF8B 2QACA 1S6CA 1LKJA 2BE4A 2L5XB 1AJ4A 3GK1A 1KK8B 1KWOB 2LANA 4C0KA 1M31A 3D75A 2WC5A 3KPXA 2SASA 1MXEA 4N1FA 2P71A 4P5OE 4CPVA 1S36A 5FI2A 2M1UA 1CLBA 4GUKA 1KQMB 3PLFB 4ORBB 1YTZC 3CABA 1NCYA 1CFPA 2H2KA 2OTGB 2GV5A 3OX5A 5GQQC 3VRQA 2F3ZA 2ZRTA 2CNPA 1CLLA 1YURA 4YGDB 2HETA 4ZCUA 2KI4C 1XK4C 1NPQA 2PASA 3D76A 3FE6A 1P28A 2F2PA 3K1EA 1UP5A 3FE9A 3LK1A 3S0BA 5HKYA 1BODA 4I5NB 3M0WA 4C0JA 1NYAA 2CT9A 1F54A 2HQ8A 1Z4HA 1TUZA 4DS7A 3DVMA 2B1UA 4YI8A 2NXQA 3IQQA 3IVTA 1QASA 4M2QA 3GK4X 1CKKA 1K2HA 1QVIZ 1NIWA 1J7RA 1RWYA 2M49B 2R2IA 3DVJA 1KFUS 1F4OA 3EK8A 1ALWA 3GOFA 1JWDA 5I94A 2LP2A 1XFWO 2JT8A 2JULA 1A4PA 1ZACA 2SCPA 5FYXA 5KTYA 2WC6A 1MQ1A 1XFZO 3ZWHA 1KQVA 3MSEB 5I8NA 2PRUA 3B7AA 2WNDA 4PE7A 3UNWA 1K8UA 1TOPA 2EC6B 2KFGA 4PE4A 2I94A 3H4SE 2OPOA 3L47A 3WXAA 1FW4A 3AAKA 1QLSA 2LVVA 1YUTA 4OV2A 4AOMA 1KK7Y 1NX0A 1NX1A 2KAVA 3SJSA 5CPVA 3RM1A 1IIOA 3VGOA 5FI6A 1YX7A 1BJFA 2I7AA 3DD4A 5TNCA 3IQOA 2TN4A 5G08A 1ORGA 1DQEA 2YGUA 3D0YB 4OKHA 1HQVA 2L4IA 2L98A 2BBNA 3DYEA 2M7NA 4I5LB 1LS8A 4MEWA 5IBWA 1K9PA 5CSJA 1AHRA 1MUXA 2L2EA 1TNQA 1PALA 3O4YA 1TNXA 1YVLA 1OOJA 1DJIA 2L2CA 1XK4A 1IQ5A 3TUYB 3OHMB 3DVKA 1N65A 1XFVO 3PJIA 2RGIA 3TS5B 1PVBA 2BL0C 1A29A 3PN7B 1GGWA 2BECA 1V1FA 1V1GA 1T14A 2OS8C 2CBLA 2F8PA 3JVTB 4ORAB 3BUNB 1AJ5A 5HKZA 4INXA 1PULA 1J7OA 1JBAA 1XYDA 3R72A 1KCYA 5KU1A 3CS1A 1M45A 2IS9A 3LCPC 1Y1XA 2L5YA 2M3WA 1B9AA 1RK9A 3R1PA 3NGVA 2JPTA 1JFJA 1CLMA 2O60A 2WOSA 1XO5A 1N2DA 3IF7A 3EVRA 4MZJA 1YVHA 1GGZA 3AKAA 2LNKA 3EK7A 4FTGA 2K2AA 5K89A 2KYCA 1B7TY 3OBVA 3O78A 2M8UA 3BFHA 3EK4A 1K95A 3OB1B 1QX5B 2LV7A 4NDDA 5FI7A 5JOLA 4MZKA 1ODBA 4PE0A 3S0GA 2H61C 2L51A 3SS5A 2KNEA 4BY5A 2G9BA 3BXKA 2MBXA 1SL9A 2KGRA 3BUXB 2K7OA 4WQ2A 1C7VA 2JU0A 1AK8A 1KK7Z 3DXLA 4F7FA 3SIAA 5HYDA 2BCXA 3TZ1A 1QX2A 3CLNA 3R1OA 1UHHA 2BKIB 2NCPA 3K21A 2MAZA 1WY9A 1BR1B 1EXRA 2JT0A 1MWNA 1R2UA 1FI6A 1K9KA 1RJVA 1QX7A 1S1EA 3C1VA 5HLVA 1IQ3A 2QEVA 2JTTA 4QJ3B 5KSZA 1S6IA 4HREE 5HL1A 3I5IC 1TWOA 1W9ZA 4GAOA 4JKTA 5AANA 4U8DA 2ERBA 4OR9B 1B47A 2EHBA 1B4CA 1UHIA 2ZN8A 1RECA 4GNKB 2K2FA 1OOIX 2LVKA 1JSAA 4HRHA 2BBMA 3CTNA 3BOWA 2KLDA 3SG2A 4YRUA 1BG1A 1QLKA 2K0JA 3SG5A 1ZMZA 4XYNA 5ER5A 4ORCB 2KI6D 1A2XA 1DF0A 1K90D 2A4JA 3WHUB 1S5GY 4ICBA 5DICA 1Y6WA 4NDCA 4MVFA 2LMTA 2PSRA 1W7IB 4JQ0D 2H61A 2JPOA 2LUCA 1L2OB 3EKJA 2LVIA 2CCMA 1J55A 3E3RA 1M39A 1CFCA 1SCVA 1E8AA 3BUMB 1OOFA 5D3OA 3D73A 4OCIA
chains in the Genus database with same CATH topology
1ORGA 3RZSA 1DQEA 3DYEA 2WCJA 1LS8A 3QMEA 4JD9A 2P70A 3V2LA 2PQLA 3BFBA 4FQTA 2L2CA 3L4AA 3B88A 3S0EA 3PJIA 3CZ2A 3B6XA 3DY9A 5EL2A 1OOHA 2QEBA 1T14A 2H8VA 3D78A 3N7HA 4INXA 3VB1A 2QEOA 3CZ0A 3R72A 3NHIA 3DZTA 2GTEA 3OGNA 3R1PA 3CDNA 3NGVA 2QDIA 1OW4A 2WCKA 3L4LA 3BFHA 3D74A 3S0GA 1GM0A 3D75A 2WC5A 2WCLA 2P71A 3B86A 1OOGA 3DXLA 3S0DA 4F7FA 2WCHA 3R1OA 3CABA 2FJYA 2KPHA 3Q8IA 3CZ1A 1QWVA 2WCMA 1C3ZA 3D76A 2QEVA 3FE6A 1P28A 3S0BA 1TUJA 3K1EA 3FE9A 3BFAA 1TWOA 2ERBA 3BJHA 1OOIX 4INWA 4PT1A 2WC6A 1XFRA 3R1VA 3B7AA 3S0FA 2QEHA 3B87A 3L47A 5DICA 3CYZA 3FE8A 1C3YA 3D77A 3S0AA 2JPOA 3NHTA 4OZDA 1OOFA 3D73A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ORG A;  3RZS A;  1DQE A;  3DYE A;  2WCJ A;  1LS8 A;  3QME A;  4JD9 A;  2P70 A;  3V2L A;  2PQL A;  3BFB A;  4FQT A;  2L2C A;  3L4A A;  3B88 A;  3S0E A;  3PJI A;  3CZ2 A;  3B6X A;  3DY9 A;  5EL2 A;  1OOH A;  2QEB A;  1T14 A;  2H8V A;  3D78 A;  3N7H A;  4INX A;  3VB1 A;  2QEO A;  3CZ0 A;  3R72 A;  3NHI A;  3DZT A;  2GTE A;  3OGN A;  3R1P A;  3CDN A;  3NGV A;  2QDI A;  1OW4 A;  2WCK A;  3L4L A;  3BFH A;  3D74 A;  3S0G A;  1GM0 A;  3D75 A;  2WC5 A;  2WCL A;  2P71 A;  3B86 A;  1OOG A;  3DXL A;  3S0D A;  4F7F A;  2WCH A;  3R1O A;  3CAB A;  2FJY A;  2KPH A;  3Q8I A;  3CZ1 A;  1QWV A;  2WCM A;  1C3Z A;  3D76 A;  2QEV A;  3FE6 A;  1P28 A;  3S0B A;  1TUJ A;  3K1E A;  3FE9 A;  3BFA A;  1TWO A;  2ERB A;  3BJH A;  1OOI X;  4INW A;  4PT1 A;  2WC6 A;  1XFR A;  3R1V A;  3B7A A;  3S0F A;  2QEH A;  3B87 A;  3L47 A;  5DIC A;  3CYZ A;  3FE8 A;  1C3Y A;  3D77 A;  3S0A A;  2JPO A;  3NHT A;  4OZD A;  1OOF A;  3D73 A; 
#chains in the Genus database with same CATH topology
 1IWQ A;  5AXI A;  1F70 A;  4GGF C;  2Y1N A;  2WCJ A;  4JD9 A;  1AVS A;  2KLE A;  3PM8 A;  3AKB A;  1B8R A;  4A4B A;  4R1E A;  1B7T Z;  3I5G C;  1DC1 A;  1CB1 A;  5J3X A;  1BLQ A;  2PQL A;  1Y0V H;  5DKR A;  1UUR A;  1KSO A;  2HPS A;  5CSI A;  3B88 A;  4NQG A;  1CTR A;  4AQJ A;  1ALV A;  2KAY A;  3NSK A;  3ZNI A;  5I2Q A;  3CZ2 A;  3B6X A;  1SR6 C;  4MSP A;  2LP3 A;  2M97 A;  1MHO A;  2MJW B;  1D1O A;  5EL2 A;  2KI6 C;  1SCM C;  1DEK A;  2LAP A;  2LLU A;  1PK0 D;  1DVI A;  2H8V A;  1FPW A;  1WLZ A;  3D78 A;  3AAJ A;  3N7H A;  4QJ4 B;  2K61 A;  1CFD A;  1GQM A;  3VB1 A;  2BKH B;  4CFQ A;  4KYN A;  1BF5 A;  2HF5 A;  4MRY A;  2COL B;  2Q4U A;  1BT6 A;  4FQO A;  3JTD C;  1NSH A;  2KI4 B;  1ZOT B;  3NHI A;  2LM5 A;  2AMI A;  1K9U A;  1JC2 A;  4GGN A;  3CDN A;  3CWG A;  2ZRS A;  1SYM A;  5ER4 X;  4F0Z B;  4WRI A;  2MLE C;  1C7W A;  1QTX A;  2I2R E;  2L4H A;  3L4L A;  1X02 A;  3VRR A;  4GGF A;  1BR4 B;  1S26 D;  1YR5 A;  2D8N A;  3D74 A;  4YGE B;  3FS7 A;  4XJK A;  1YUS A;  1LXF C;  1S5G Z;  2GGZ A;  3PAT A;  1NX2 A;  3ICB A;  4MZL A;  3VRN A;  2QPT A;  2WCL A;  3VRP A;  3LL8 B;  1MXL C;  4L9M A;  5I2O A;  4MLW A;  1OOG A;  1OZO A;  1YX8 A;  3NSI A;  4PAL A;  3RLZ A;  3S0D A;  1A75 A;  1DJH A;  1J7Q A;  1G33 A;  1JUO A;  3I5H C;  1ZFS A;  1A03 A;  1EG3 A;  1IGV A;  2FJY A;  2JOJ A;  2PMY A;  3CR5 X;  2KPH A;  1DMO A;  1EH2 A;  3Q8I A;  1OMD A;  4HRG A;  4PHJ A;  1B1G A;  2BAP A;  3CZ1 A;  1LA0 A;  2LCP A;  1B8L A;  4PCW A;  1CM1 A;  4E68 A;  2WCM A;  1C3Z A;  1QV0 A;  1TCO B;  4PDZ A;  4Q04 A;  1SL7 A;  3O2P A;  2L50 A;  2ZND A;  1IJ6 A;  1TUJ A;  1AUI B;  5HLO A;  2PAL A;  3BFA A;  1SY9 A;  2LMV A;  5DKQ A;  1LIN A;  1NWD A;  3LK0 A;  2LLS A;  2JWW A;  1LA3 A;  1FI5 A;  1PSB A;  1UHN A;  3GK2 A;  1CDM A;  3BJH A;  3F45 A;  3KF9 A;  3VRO A;  2MLF C;  5I2L A;  1RRO A;  3EVV A;  3EVU A;  4PT1 A;  3A8R A;  1KK8 C;  1KWO C;  5DKN A;  1QXP A;  2BL0 B;  1EL4 A;  1MR8 A;  2VRG A;  3BYA A;  3KO0 A;  1KFX L;  1WLM A;  3R1V A;  4I5K A;  1B8C A;  5CSF A;  2OS8 B;  1Z2C B;  1H8B A;  2WC8 A;  3B87 A;  4JPZ B;  1F4Q A;  1KQM C;  1L7Z A;  1TNW A;  5JJG A;  3FE8 A;  4IL1 A;  3BUO B;  3S0A A;  2Q91 A;  1IKU A;  1C3Y A;  1TCF A;  2OTG C;  1EJ3 A;  3OX6 A;  1TRF A;  4OVN F;  2Y1M A;  4ETO A;  2FOT A;  3PM2 A;  2JTZ A;  1NUB A;  2JXC A;  4A4C A;  3NHT A;  4UPG A;  1HT9 A;  1OSA A;  2LHL A;  1TN4 A;  2KGB C;  2M0R A;  1KFX S;  3FWB A;  1IRJ A;  4PE1 A;  2NLN A;  3I5F B;  4P2Y B;  2I18 A;  3QME A;  4PHN A;  3A4U B;  2P70 A;  3NSO A;  5D69 A;  1F71 A;  2K60 A;  3V2L A;  3BQ3 A;  1J1E A;  4YGB B;  1DF0 B;  4FQT A;  4YGC B;  1BMO A;  1K94 A;  3DF0 A;  2LLT A;  1OMR A;  5AFP A;  3UO9 A;  1PVA A;  1WDC B;  1K96 A;  1OMV A;  1EG4 A;  3CZT X;  2JRF A;  3DY9 A;  1NCX A;  5F6T A;  2JT3 A;  1U5I A;  2Y5I A;  2EC6 C;  1IJ5 A;  1DTL A;  1WRZ A;  1DEL A;  2ZN9 A;  2NZ0 A;  1TTX A;  1DJX A;  1OQP A;  2V53 A;  3LLE A;  4HSZ A;  2JNF A;  4CFR A;  2KOT A;  1BU3 A;  4TNC A;  1YRT B;  2FJU B;  3KEV A;  1OE9 B;  1PRW A;  3CZ0 A;  1XVJ A;  1S3P A;  4CID A;  5B8I B;  1CM4 A;  3OB2 B;  3SG4 A;  4I5J A;  2BNX A;  3SG7 A;  3DZT A;  1CDN A;  4MBE A;  1SSE B;  2GTE A;  2KBI A;  4PHK A;  4D1E A;  1KFU L;  3I5I B;  2QDI A;  5BPJ A;  1SNL A;  1QJT A;  1Y1A A;  2WCK A;  4N1G A;  1BOC A;  1G8I A;  1SMG A;  1Q80 A;  3TUY C;  3QRX A;  2K7D A;  1J1D A;  4DIR A;  4GBA A;  1GM0 A;  2M29 A;  1CDL A;  3TS5 C;  3HX4 A;  2KFH A;  1C07 A;  2BCB A;  2O5G A;  3PN7 C;  4YBH B;  5D7F A;  2JC2 A;  2M9G A;  1CMF A;  1FF1 A;  3B86 A;  4C0L A;  4PHM A;  1DJY A;  3JVT C;  2WCH A;  2EGD A;  1UHJ A;  3EG5 B;  2M7L A;  1ZUZ A;  1H4B A;  3PFV A;  2LVJ A;  2WCF A;  3CGA A;  5PAL A;  4MRX A;  1TIZ A;  1XFU O;  2LMU A;  1OZS A;  1QWV A;  1RFJ A;  3OP0 A;  1XFX O;  2PVB A;  1NCZ A;  4NDB A;  2KHN A;  4DUQ A;  1SW8 A;  2G2B A;  1IG5 A;  2KBM A;  1QV1 A;  3TDU A;  1WRL A;  2E30 A;  1QS7 A;  3FIA A;  4XJK B;  2K7B A;  2HQW A;  1NP8 A;  3TDZ A;  4QJ5 B;  1DT7 B;  1NX3 A;  3I5G B;  2KAX A;  2MA2 A;  4YI9 A;  1AP4 A;  1DGV A;  4USL A;  4ZCV A;  1XA5 A;  2LC5 A;  1M46 A;  2LUX A;  2NCO A;  3SIB A;  3WHT B;  1A75 B;  2KDH A;  1G4Y R;  5CSN A;  3CR2 A;  4INW A;  3D0Y A;  2AAO A;  1R6P A;  3CR4 X;  1J7P A;  1SL8 A;  1SKT A;  1DJZ A;  1WRK A;  1DGU A;  1SR6 B;  1XFR A;  3FWC A;  2F2O A;  4AQI A;  1UUS A;  1DJW A;  2QEH A;  3S0F A;  1SCM B;  2JXL A;  4DRW A;  3CYZ A;  2M1K B;  4IJ7 A;  3D77 A;  3SS4 A;  1CMG A;  1UWO A;  1M63 B;  2PYQ A;  5AER A;  1CFF A;  2K8M B;  1Y1U A;  1JF0 A;  4M2P A;  1YRU B;  2BCA A;  2F3Y A;  3KHE A;  2DOQ A;  1FBV A;  2P6B B;  3O6B A;  4OZD A;  2ZFD A;  3JTD B;  1IH0 A;  2FCE A;  3SG3 A;  3RZS A;  2KQ6 A;  3EKH A;  1SK6 D;  3SG6 A;  4GFT A;  2ZNE A;  2L0P A;  5AEQ A;  3BUW B;  2Y4Q A;  2JQ6 A;  2E6W A;  2GGM A;  3DVE A;  1SBJ A;  1QIW A;  3O4X A;  4CLN A;  3NXA A;  3BFB A;  4MN0 A;  3I5F C;  1SRA A;  1QIV A;  3L4A A;  3WNX B;  1LVC D;  1GJY A;  1W7J B;  1XFY O;  1YUU A;  3S0E A;  2ISD A;  1CDP A;  1QVI Y;  1PSR A;  1VRK A;  2KFF A;  5HKW A;  2CTN A;  1OOH A;  2JNX A;  2QEB A;  1WDC C;  3TDI A;  2JZI A;  4YGA A;  3I5H B;  2WOR A;  1JF2 A;  2KQY A;  1JFK A;  1F8H A;  4WQ3 A;  2BE6 A;  1N0Y A;  2F33 A;  1L2O C;  1RTP 1;  1F55 A;  2QEO A;  1QAT A;  1S6J A;  4JWQ A;  2LHI A;  2LE9 B;  2ZKM X;  3BOW B;  4GPL B;  2WCE A;  2AUC A;  3DF0 B;  2KYF A;  3PSR A;  2KSP A;  4N5X A;  3PAL A;  3OGN A;  3D10 A;  3HCM A;  2MRD A;  3NSL A;  4M2O A;  3SS3 A;  4DCK A;  2WCB A;  1SPY A;  1DJG A;  1CNP A;  2FCD A;  1K93 D;  2CXJ A;  1OW4 A;  1TNP A;  2MHH A;  1KSM A;  4BY4 A;  1U5I B;  1UHK A;  2K7C A;  1MF8 B;  2QAC A;  1S6C A;  1LKJ A;  2BE4 A;  2L5X B;  1AJ4 A;  3GK1 A;  1KK8 B;  1KWO B;  2LAN A;  4C0K A;  1M31 A;  3D75 A;  2WC5 A;  3KPX A;  2SAS A;  1MXE A;  4N1F A;  2P71 A;  4P5O E;  4CPV A;  1S36 A;  5FI2 A;  2M1U A;  1CLB A;  4GUK A;  1KQM B;  3PLF B;  4ORB B;  1YTZ C;  3CAB A;  1NCY A;  1CFP A;  2H2K A;  2OTG B;  2GV5 A;  3OX5 A;  5GQQ C;  3VRQ A;  2F3Z A;  2ZRT A;  2CNP A;  1CLL A;  1YUR A;  4YGD B;  2HET A;  4ZCU A;  2KI4 C;  1XK4 C;  1NPQ A;  2PAS A;  3D76 A;  3FE6 A;  1P28 A;  2F2P A;  3K1E A;  1UP5 A;  3FE9 A;  3LK1 A;  3S0B A;  5HKY A;  1BOD A;  4I5N B;  3M0W A;  4C0J A;  1NYA A;  2CT9 A;  1F54 A;  2HQ8 A;  1Z4H A;  1TUZ A;  4DS7 A;  3DVM A;  2B1U A;  4YI8 A;  2NXQ A;  3IQQ A;  3IVT A;  1QAS A;  4M2Q A;  3GK4 X;  1CKK A;  1K2H A;  1QVI Z;  1NIW A;  1J7R A;  1RWY A;  2M49 B;  2R2I A;  3DVJ A;  1KFU S;  1F4O A;  3EK8 A;  1ALW A;  3GOF A;  1JWD A;  5I94 A;  2LP2 A;  1XFW O;  2JT8 A;  2JUL A;  1A4P A;  1ZAC A;  2SCP A;  5FYX A;  5KTY A;  2WC6 A;  1MQ1 A;  1XFZ O;  3ZWH A;  1KQV A;  3MSE B;  5I8N A;  2PRU A;  3B7A A;  2WND A;  4PE7 A;  3UNW A;  1K8U A;  1TOP A;  2EC6 B;  2KFG A;  4PE4 A;  2I94 A;  3H4S E;  2OPO A;  3L47 A;  3WXA A;  1FW4 A;  3AAK A;  1QLS A;  2LVV A;  1YUT A;  4OV2 A;  4AOM A;  1KK7 Y;  1NX0 A;  1NX1 A;  2KAV A;  3SJS A;  5CPV A;  3RM1 A;  1IIO A;  3VGO A;  5FI6 A;  1YX7 A;  1BJF A;  2I7A A;  3DD4 A;  5TNC A;  3IQO A;  2TN4 A;  5G08 A;  1ORG A;  1DQE A;  2YGU A;  3D0Y B;  4OKH A;  1HQV A;  2L4I A;  2L98 A;  2BBN A;  3DYE A;  2M7N A;  4I5L B;  1LS8 A;  4MEW A;  5IBW A;  1K9P A;  5CSJ A;  1AHR A;  1MUX A;  2L2E A;  1TNQ A;  1PAL A;  3O4Y A;  1TNX A;  1YVL A;  1OOJ A;  1DJI A;  2L2C A;  1XK4 A;  1IQ5 A;  3TUY B;  3OHM B;  3DVK A;  1N65 A;  1XFV O;  3PJI A;  2RGI A;  3TS5 B;  1PVB A;  2BL0 C;  1A29 A;  3PN7 B;  1GGW A;  2BEC A;  1V1F A;  1V1G A;  1T14 A;  2OS8 C;  2CBL A;  2F8P A;  3JVT B;  4ORA B;  3BUN B;  1AJ5 A;  5HKZ A;  4INX A;  1PUL A;  1J7O A;  1JBA A;  1XYD A;  3R72 A;  1KCY A;  5KU1 A;  3CS1 A;  1M45 A;  2IS9 A;  3LCP C;  1Y1X A;  2L5Y A;  2M3W A;  1B9A A;  1RK9 A;  3R1P A;  3NGV A;  2JPT A;  1JFJ A;  1CLM A;  2O60 A;  2WOS A;  1XO5 A;  1N2D A;  3IF7 A;  3EVR A;  4MZJ A;  1YVH A;  1GGZ A;  3AKA A;  2LNK A;  3EK7 A;  4FTG A;  2K2A A;  5K89 A;  2KYC A;  1B7T Y;  3OBV A;  3O78 A;  2M8U A;  3BFH A;  3EK4 A;  1K95 A;  3OB1 B;  1QX5 B;  2LV7 A;  4NDD A;  5FI7 A;  5JOL A;  4MZK A;  1ODB A;  4PE0 A;  3S0G A;  2H61 C;  2L51 A;  3SS5 A;  2KNE A;  4BY5 A;  2G9B A;  3BXK A;  2MBX A;  1SL9 A;  2KGR A;  3BUX B;  2K7O A;  4WQ2 A;  1C7V A;  2JU0 A;  1AK8 A;  1KK7 Z;  3DXL A;  4F7F A;  3SIA A;  5HYD A;  2BCX A;  3TZ1 A;  1QX2 A;  3CLN A;  3R1O A;  1UHH A;  2BKI B;  2NCP A;  3K21 A;  2MAZ A;  1WY9 A;  1BR1 B;  1EXR A;  2JT0 A;  1MWN A;  1R2U A;  1FI6 A;  1K9K A;  1RJV A;  1QX7 A;  1S1E A;  3C1V A;  5HLV A;  1IQ3 A;  2QEV A;  2JTT A;  4QJ3 B;  5KSZ A;  1S6I A;  4HRE E;  5HL1 A;  3I5I C;  1TWO A;  1W9Z A;  4GAO A;  4JKT A;  5AAN A;  4U8D A;  2ERB A;  4OR9 B;  1B47 A;  2EHB A;  1B4C A;  1UHI A;  2ZN8 A;  1REC A;  4GNK B;  2K2F A;  1OOI X;  2LVK A;  1JSA A;  4HRH A;  2BBM A;  3CTN A;  3BOW A;  2KLD A;  3SG2 A;  4YRU A;  1BG1 A;  1QLK A;  2K0J A;  3SG5 A;  1ZMZ A;  4XYN A;  5ER5 A;  4ORC B;  2KI6 D;  1A2X A;  1DF0 A;  1K90 D;  2A4J A;  3WHU B;  1S5G Y;  4ICB A;  5DIC A;  1Y6W A;  4NDC A;  4MVF A;  2LMT A;  2PSR A;  1W7I B;  4JQ0 D;  2H61 A;  2JPO A;  2LUC A;  1L2O B;  3EKJ A;  2LVI A;  2CCM A;  1J55 A;  3E3R A;  1M39 A;  1CFC A;  1SCV A;  1E8A A;  3BUM B;  1OOF A;  5D3O A;  3D73 A;  4OCI A; 
#chains in the Genus database with same CATH homology
 1ORG A;  3RZS A;  1DQE A;  3DYE A;  2WCJ A;  1LS8 A;  3QME A;  4JD9 A;  2P70 A;  3V2L A;  2PQL A;  3BFB A;  4FQT A;  2L2C A;  3L4A A;  3B88 A;  3S0E A;  3PJI A;  3CZ2 A;  3B6X A;  3DY9 A;  5EL2 A;  1OOH A;  2QEB A;  1T14 A;  2H8V A;  3D78 A;  3N7H A;  4INX A;  3VB1 A;  2QEO A;  3CZ0 A;  3R72 A;  3NHI A;  3DZT A;  2GTE A;  3OGN A;  3R1P A;  3CDN A;  3NGV A;  2QDI A;  1OW4 A;  2WCK A;  3L4L A;  3BFH A;  3D74 A;  3S0G A;  1GM0 A;  3D75 A;  2WC5 A;  2WCL A;  2P71 A;  3B86 A;  1OOG A;  3DXL A;  3S0D A;  4F7F A;  2WCH A;  3R1O A;  3CAB A;  2FJY A;  2KPH A;  3Q8I A;  3CZ1 A;  1QWV A;  2WCM A;  1C3Z A;  3D76 A;  2QEV A;  3FE6 A;  1P28 A;  3S0B A;  1TUJ A;  3K1E A;  3FE9 A;  3BFA A;  1TWO A;  2ERB A;  3BJH A;  1OOI X;  4INW A;  4PT1 A;  2WC6 A;  1XFR A;  3R1V A;  3B7A A;  3S0F A;  2QEH A;  3B87 A;  3L47 A;  5DIC A;  3CYZ A;  3FE8 A;  1C3Y A;  3D77 A;  3S0A A;  2JPO A;  3NHT A;  4OZD A;  1OOF A;  3D73 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...