3NGVA

Crystal structure of anst-d7l1
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
296
structure length
296
Chain Sequence
b'QPWKALDAEQALYVYKRCYEDHLPSGSDRKTYMTLWNAWRLEPNDAITHCYAKCVLTGLQIYDPQENAFKSDRIPVQYQAYKTITQSKQKEVTEYQKALAAANAKSGSCVDLYNAYLPVHNRFVNLSRQLYHGTVEGAAKIYAAMPEIKQKGESFHAYCEKRAWKGNKQSEWKNGRRYKLTGSPELKDAIDCIFRGLRYMDDTGLKVDEIVRDFNLINKSELEPEVRSVLASCKGSEAYDYYVCLVNSRLKQHFKNAFDFHELRSADYAYLLRGKVYENPEKVKEEMKKLNTTVHF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D7 protein
publication title The function and three-dimensional structure of a thromboxane a(2)/cysteinyl leukotriene-binding protein from the saliva of a mosquito vector of the malaria parasite.
pubmed doi rcsb
source organism Anopheles stephensi
molecule tags Transport protein
total genus 113
structure length 296
sequence length 296
ec nomenclature ec 5.99.1.2: Transferred entry: 5.6.2.2.
pdb deposition date 2010-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3ngvA02
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3ngvA01
1LS8A 2PQLA 3D74A 3S0GA 1TWOA 2JPOA 3BJHA 1T14A 1GM0A 3OGNA 3NHIA 3CABA 3CZ0A 1OOHA 3D73A 2WC6A 4JD9A 5EL2A 3R1VA 3S0EA 3S0BA 1XFRA 3D75A 2WCLA 3RZSA 2WC5A 3PJIA 3CDNA 1P28A 3FE6A 3BFHA 1OOGA 3DXLA 3N7HA 5DICA 3V2LA 2QDIA 3L4LA 3L4AA 2WCHA 3D78A 3S0AA 3BFBA 2GTEA 3FE9A 3QMEA 1DQEA 1ORGA 3VB1A 2FJYA 3B87A 3D77A 2QEVA 1OW4A 4INWA 1TUJA 3NGVA 2QEOA 3R1PA 3DY9A 4INXA 3BFAA 3DYEA 3CZ2A 2P70A 1C3ZA 2WCJA 2QEHA 3B88A 2ERBA 2P71A 2WCKA 3R72A 3B7AA 1QWVA 3L47A 2L2CA 2H8VA 2QEBA 3R1OA 4F7FA 3CZ1A 3Q8IA 4PT1A 2KPHA 1OOIX 3B6XA 3K1EA 1C3YA 3S0DA 3FE8A 3S0FA 3CYZA 3NHTA 4OZDA 3B86A 4FQTA 3D76A 1OOFA 3DZTA 2WCMA
chains in the Genus database with same CATH superfamily
1IJ5A 3D10A 1J7PA 1XFYO 1SCVA 1B8CA 2MLEC 1IWQA 3D74A 2R2IA 4I5LB 1T14A 2HPSA 3IQQA 4Q04A 1SL7A 3NHIA 2OTGC 3CZ0A 2G2BA 3C1VA 1B47A 1WDCB 2SASA 1NP8A 1SW8A 5D7FA 5EL2A 3KHEA 1S6CA 3BUXB 3S0EA 3I5HC 1YX7A 3D75A 5FI7A 1BR4B 1QVIZ 5CSJA 1OZSA 3VROA 1Y1XA 3RZSA 1C7VA 2GGZA 1S5GY 2KSPA 3CDNA 1IH0A 1BODA 1OOGA 4PHJA 1U5IB 1LXFC 1Y0VH 3O6BA 1N65A 1MHOA 3L4LA 5DKNA 1G33A 1RK9A 1A4PA 2LANA 3DVJA 3TUYC 1NPQA 2H61C 4PHMA 3D78A 1G8IA 4QJ3B 4A4CA 2JZIA 1PVBA 3AKAA 1MQ1A 3O2PA 2GTEA 2JTZA 1CM4A 2Y5IA 3A4UB 2KI6D 1MXEA 4DS7A 3SS5A 2LE9B 1L2OC 1JF2A 3PFVA 1DF0A 2Y1MA 4DUQA 2BCBA 2I2RE 2JU0A 1GGWA 1C7WA 4MBEA 1CLLA 1RROA 4ORCB 3VRRA 3FWCA 3FWBA 4MZLA 1XK4A 2NCOA 1ZOTB 2KQ6A 2BE4A 1DJGA 2WOSA 5DKQA 3LCPC 1NSHA 4INXA 4C0JA 1DMOA 1UUSA 1SMGA 1IJ6A 1MF8B 3I5IB 2LMUA 5I2OA 2LP2A 2LNKA 1SK6D 3CR4X 3DVMA 1KWOC 2ZFDA 4C0LA 2HQWA 5FYXA 1XK4C 4YRUA 3LLEA 3ZNIA 4OVNF 3NXAA 4QJ4B 2CXJA 2CTNA 3JTDB 3D0YA 5AERA 1C3ZA 4MRYA 1F71A 1F54A 2K61A 2QEHA 2Q91A 1W9ZA 2L5XB 2P71A 2K2FA 2WCKA 3IF7A 2OPOA 1J7RA 1NX1A 1CMFA 2MRDA 1H4BA 3GOFA 1B8RA 1NUBA 2RGIA 2M1UA 2AAOA 3BUWB 3NSIA 2ZRTA 5CSNA 4PE0A 2LMTA 4PALA 3PN7C 4GPLB 4MLWA 2FOTA 1OMVA 4QJ5B 1SCMC 1B9AA 1JFJA 1XFXO 2KLDA 1G4YR 2KPHA 2KBIA 1OOIX 3B6XA 2WC8A 5FI2A 1FI6A 1V1GA 4IL1A 3DD4A 1OZOA 1SYMA 1B7TZ 2JT0A 3TDUA 1CFDA 1CDLA 1F4QA 2JRFA 2MA2A 5KU1A 1KSMA 4E68A 1JC2A 4MN0A 1RWYA 1UHJA 1YRUB 1ZUZA 2JXCA 3PLFB 3BOWA 3B86A 2K7OA 2I18A 4GGFA 4PE7A 2M7LA 1VRKA 1DJXA 1WDCC 2NXQA 1QV1A 2BCXA 4I5NB 1U5IA 1LA0A 3O78A 4NDCA 2L0PA 2TN4A 1YUTA 2BL0B 1FF1A 1LS8A 2PQLA 4D1EA 1MUXA 3PATA 4I5JA 3WHUB 2H2KA 4MRXA 1YRTB 1TWOA 1L7ZA 1XFZO 2PMYA 2WCBA 4PDZA 5CSIA 5J3XA 3SS4A 3VGOA 1Y1UA 1K9UA 1GM0A 3OGNA 1A75A 3CABA 5ER4X 5JOLA 1K9PA 1JBAA 1Z2CB 1KCYA 3SIAA 3PM8A 4JD9A 1F70A 1TCFA 4CFQA 1N2DA 5HL1A 1EXRA 1K8UA 1KK7Y 2LLSA 3VRPA 1BT6A 2WC5A 1ALVA 2HQ8A 4ORBB 3TDIA 4CFRA 5I94A 1P28A 1OMDA 1QLSA 3BFHA 3FE6A 4M2QA 4PHKA 3DXLA 2FJUB 2O5GA 4JKTA 1CFFA 1KK8B 1NIWA 3VRQA 4ZCUA 1BJFA 3KO0A 2L51A 4FQOA 1J7OA 3LK1A 1PULA 1QIVA 2WCHA 2L98A 5JJGA 1DVIA 3BXKA 1KSOA 1TN4A 2G9BA 1BF5A 2KI6C 1CTRA 1Y1AA 5D3OA 3BFBA 2L5YA 3KEVA 3EVVA 1IRJA 1MR8A 3EK7A 4MZJA 3FE9A 1CKKA 2MLFC 1AHRA 3K21A 1PK0D 2LP3A 3RM1A 2NLNA 3D77A 2ZNEA 2JXLA 1QX7A 1OOJA 2QEVA 2I7AA 5HLOA 3BOWB 1DGVA 2VRGA 1OW4A 1R6PA 2GGMA 3MSEB 3JTDC 1YUSA 4MZKA 1BR1B 3DY9A 1AP4A 2PVBA 1FI5A 1A29A 1K9KA 1QLKA 3SIBA 2LV7A 1AVSA 1JFKA 2F2PA 2FCEA 3CZ2A 4YGBB 2LVKA 4HRHA 2EC6B 2KI4B 3O4YA 1A75B 2JPTA 4PE1A 1PSRA 3KF9A 3WXAA 1KFXL 5KSZA 1HT9A 2WORA 1EH2A 1IQ5A 1YVLA 2MJWB 4GGNA 1F8HA 1YR5A 1QVIY 3B88A 3R72A 1BMOA 1QWVA 1BG1A 3RLZA 2LLUA 5K89A 2HF5A 1AUIB 2F8PA 2CNPA 4U8DA 1BLQA 1M63B 2QPTA 2KAXA 2L2CA 2H8VA 3BUNB 1SR6B 4M2OA 4OKHA 2KGBC 3LK0A 3CZ1A 1TNPA 1K93D 3Q8IA 5TNCA 1IQ3A 1KQVA 1MXLC 5AANA 1YTZC 3IQOA 2KNEA 4NQGA 2ZKMX 4N1FA 2Y1NA 2BL0C 3H4SE 1B4CA 2BNXA 2LC5A 1XFVO 3DVEA 4HRGA 1DGUA 1TNQA 3FE8A 3PSRA 4TNCA 5D69A 3CYZA 4OZDA 1BU3A 1UWOA 1F55A 1SRAA 1N0YA 4FQTA 3I5FB 3OX5A 4M2PA 2KBMA 4JPZB 2M7NA 1QASA 1F4OA 1J55A 1NX2A 4JWQA 3IVTA 4AQIA 2L2EA 3S0GA 1GGZA 2JPOA 3EKJA 2Y4QA 2M3WA 1DJZA 1QJTA 2JT3A 3BJHA 2K7BA 1DTLA 1ODBA 1X02A 2KYCA 3EK8A 2ZRSA 1CM1A 1KQMB 1OOHA 5I2LA 1KK8C 1QV0A 4YBHB 1UURA 1WRLA 3R1VA 1CDPA 1UHHA 2BKHB 1XFRA 3BYAA 4YI9A 2WCLA 5HKWA 3BQ3A 2KGRA 3CGAA 3PJIA 1CFCA 2CT9A 2KDHA 3SG6A 2SCPA 2CBLA 2IS9A 3ZWHA 5KTYA 1AJ4A 2L4IA 2M8UA 2NZ0A 4GNKB 5CPVA 3CLNA 2DOQA 3EKHA 4OCIA 5F6TA 3I5GB 2BAPA 1K95A 2K7DA 1Q80A 1B7TY 3OB2B 3TS5B 4GGFC 1RECA 3CZTX 1EG3A 3HX4A 1ZFSA 2OS8B 3CS1A 3QMEA 3SJSA 5DKRA 4YI8A 3LL8B 4MSPA 4BY4A 1CDNA 2WNDA 2FJYA 3B87A 3JVTB 4NDBA 1AK8A 2K2AA 3TDZA 4ICBA 1AJ5A 2AMIA 2EC6C 4ETOA 4YGCB 4ZCVA 2KI4C 1OSAA 5FI6A 2KHNA 1ALWA 1IKUA 1TUJA 2LVVA 2KFGA 2B1UA 2QEOA 2V53A 3NGVA 2KYFA 1JSAA 1TIZA 4GFTA 1K94A 3DVKA 1NX3A 1JWDA 4MEWA 4KYNA 1W7IB 3KPXA 2L4HA 4CLNA 4JQ0D 2PASA 2O60A 3BFAA 1NCYA 3WNXB 1KFUL 2LM5A 2F2OA 1Y6WA 4GUKA 4IJ7A 2F3YA 3OX6A 3GK1A 3SS3A 1UHNA 4XYNA 3EVRA 3NSLA 1SR6C 1M39A 4FTGA 1SSEB 2WCJA 1EL4A 2EGDA 2ERBA 3I5IC 1CMGA 4CPVA 1LVCD 1YVHA 3FIAA 1RTP1 1QX5B 1TNWA 3VRNA 1B8LA 2KFHA 2LAPA 1UP5A 4CIDA 1QX2A 1ZACA 1DT7B 1S5GZ 1NX0A 2BBNA 1R2UA 2LVIA 2K8MB 1IG5A 2LCPA 3HCMA 2K60A 1V1FA 1M31A 1TUZA 3EVUA 3NSOA 5G08A 4F7FA 1XFWO 2WCFA 4HREE 1IGVA 2GV5A 2YGUA 1SL8A 3I5FC 5CSFA 1SL9A 2KQYA 1RJVA 1SNLA 1J1DA 1QXPA 3BUOB 1IIOA 1OMRA 4WRIA 2ISDA 4ORAB 1B1GA 4UPGA 3S0DA 3S0FA 1S6IA 2KFFA 1W7JB 2JQ6A 2H61A 3PALA 2EHBA 1J7QA 2WCEA 1SBJA 1KQMC 1SPYA 2M29A 1OOFA 5HLVA 3BUMB 4DIRA 3DZTA 2L50A 1KFUS 1PALA 2M9GA 2MHHA 2CCMA 2D8NA 1OE9B 1FW4A 1K96A 2QACA 1MWNA 3OHMB 4N1GA 4OV2A 1A03A 2JNFA 1LA3A 4A4BA 2F3ZA 1J1EA 2FCDA 2E30A 1DELA 3FS7A 3DF0A 4PHNA 2ZN8A 2K0JA 3CWGA 2BBMA 1RFJA 2LHIA 4P5OE 3D73A 2LHLA 2WC6A 4AOMA 1YURA 1YX8A 1XFUO 3S0BA 1S1EA 2A4JA 4HSZA 4N5XA 3GK2A 1S26D 1UHIA 2JOJA 3I5GC 3OP0A 1EJ3A 2M1KB 5HKZA 5HKYA 2M97A 4R1EA 3TS5C 4BY5A 4C0KA 2OTGB 1WRKA 2OS8C 1LKJA 3N7HA 3SG3A 3UNWA 1QS7A 2JNXA 5DICA 1TTXA 3PM2A 4P2YB 2QDIA 3V2LA 2E6WA 4AQJA 4DCKA 2JC2A 3JVTC 2LUCA 1CLBA 3L4AA 4WQ2A 4MVFA 3I5HB 3CTNA 2PRUA 2ZN9A 4DRWA 3S0AA 1KFXS 1S6JA 1GQMA 1NCZA 2BE6A 5I8NA 1UHKA 1JF0A 1XA5A 1DQEA 1ORGA 1TCOB 3VB1A 2AUCA 5ER5A 2KLEA 1GJYA 2LMVA 2MAZA 5I2QA 1DJIA 1QIWA 2KOTA 3TUYB 2KAYA 1OQPA 1LINA 1XYDA 1DJYA 2BKIB 4L9MA 2HETA 4XJKA 1C07A 1TOPA 1JUOA 4INWA 2LVJA 3TZ1A 1D1OA 2BECA 3ICBA 2K7CA 5B8IB 3R1PA 1CNPA 1NCXA 3EG5B 1TNXA 2PALA 3SG4A 3O4XA 2PYQA 3SG5A 1L2OB 2M49B 4I5KA 3UO9A 1XO5A 1DJWA 3DYEA 1WLZA 3E3RA 3OB1B 1EG4A 5AXIA 2I94A 1NWDA 1M45A 2P70A 1M46A 4YGEB 5AFPA 1HQVA 3DF0B 3EK4A 3SG2A 4PE4A 1TRFA 1CB1A 1FBVA 1DF0B 2ZNDA 2Q4UA 4GAOA 3B7AA 2LUXA 2P6BB 1KK7Z 1KWOB 1WY9A 1DEKA 3OBVA 5GQQC 1DJHA 4NDDA 3AKBA 5IBWA 3CR2A 3L47A 2JULA 4F0ZB 2PSRA 1CFPA 1YUUA 1FPWA 2F33A 3SG7A 1K90D 1ZMZA 4YGAA 2QEBA 3R1OA 1DC1A 2JTTA 4GBAA 1BOCA 4PT1A 3QRXA 3CR5X 1H8BA 2COLB 1S36A 1S3PA 2JT8A 3F45A 1Z4HA 3GK4X 3NSKA 3K1EA 1CLMA 1C3YA 1SY9A 3D0YB 1K2HA 1E8AA 1PVAA 1QTXA 1NYAA 1WLMA 2BCAA 1XVJA 2LLTA 2NCPA 3AAJA 3PN7B 5HYDA 1PRWA 2JWWA 3NHTA 2KAVA 3AAKA 1SCMB 3M0WA 5AEQA 2MBXA 1CDMA 4WQ3A 1QATA 2M0RA 4USLA 1A2XA 4OR9B 3D76A 1WRZA 5PALA 1PSBA 4YGDB 4XJKB 5BPJA 3A8RA 1SKTA 4PCWA 2WCMA 3WHTB
chains in the Genus database with same CATH topology
1LS8A 2PQLA 3D74A 3S0GA 1TWOA 2JPOA 3BJHA 1T14A 1GM0A 3OGNA 3NHIA 3CABA 3CZ0A 1OOHA 3D73A 2WC6A 4JD9A 5EL2A 3R1VA 3S0EA 3S0BA 1XFRA 3D75A 2WCLA 3RZSA 2WC5A 3PJIA 3CDNA 1P28A 3FE6A 3BFHA 1OOGA 3DXLA 3N7HA 5DICA 3V2LA 2QDIA 3L4LA 3L4AA 2WCHA 3D78A 3S0AA 3BFBA 2GTEA 3FE9A 3QMEA 1DQEA 1ORGA 3VB1A 2FJYA 3B87A 3D77A 2QEVA 1OW4A 4INWA 1TUJA 3NGVA 2QEOA 3R1PA 3DY9A 4INXA 3BFAA 3DYEA 3CZ2A 2P70A 1C3ZA 2WCJA 2QEHA 3B88A 2ERBA 2P71A 2WCKA 3R72A 3B7AA 1QWVA 3L47A 2L2CA 2H8VA 2QEBA 3R1OA 4F7FA 3CZ1A 3Q8IA 4PT1A 2KPHA 1OOIX 3B6XA 3K1EA 1C3YA 3S0DA 3FE8A 3S0FA 3CYZA 3NHTA 4OZDA 3B86A 4FQTA 3D76A 1OOFA 3DZTA 2WCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LS8 A;  2PQL A;  3D74 A;  3S0G A;  1TWO A;  2JPO A;  3BJH A;  1T14 A;  1GM0 A;  3OGN A;  3NHI A;  3CAB A;  3CZ0 A;  1OOH A;  3D73 A;  2WC6 A;  4JD9 A;  5EL2 A;  3R1V A;  3S0E A;  3S0B A;  1XFR A;  3D75 A;  2WCL A;  3RZS A;  2WC5 A;  3PJI A;  3CDN A;  1P28 A;  3FE6 A;  3BFH A;  1OOG A;  3DXL A;  3N7H A;  5DIC A;  3V2L A;  2QDI A;  3L4L A;  3L4A A;  2WCH A;  3D78 A;  3S0A A;  3BFB A;  2GTE A;  3FE9 A;  3QME A;  1DQE A;  1ORG A;  3VB1 A;  2FJY A;  3B87 A;  3D77 A;  2QEV A;  1OW4 A;  4INW A;  1TUJ A;  3NGV A;  2QEO A;  3R1P A;  3DY9 A;  4INX A;  3BFA A;  3DYE A;  3CZ2 A;  2P70 A;  1C3Z A;  2WCJ A;  2QEH A;  3B88 A;  2ERB A;  2P71 A;  2WCK A;  3R72 A;  3B7A A;  1QWV A;  3L47 A;  2L2C A;  2H8V A;  2QEB A;  3R1O A;  4F7F A;  3CZ1 A;  3Q8I A;  4PT1 A;  2KPH A;  1OOI X;  3B6X A;  3K1E A;  1C3Y A;  3S0D A;  3FE8 A;  3S0F A;  3CYZ A;  3NHT A;  4OZD A;  3B86 A;  4FQT A;  3D76 A;  1OOF A;  3DZT A;  2WCM A; 
#chains in the Genus database with same CATH topology
 1IJ5 A;  3D10 A;  1J7P A;  1XFY O;  1SCV A;  1B8C A;  2MLE C;  1IWQ A;  3D74 A;  2R2I A;  4I5L B;  1T14 A;  2HPS A;  3IQQ A;  4Q04 A;  1SL7 A;  3NHI A;  2OTG C;  3CZ0 A;  2G2B A;  3C1V A;  1B47 A;  1WDC B;  2SAS A;  1NP8 A;  1SW8 A;  5D7F A;  5EL2 A;  3KHE A;  1S6C A;  3BUX B;  3S0E A;  3I5H C;  1YX7 A;  3D75 A;  5FI7 A;  1BR4 B;  1QVI Z;  5CSJ A;  1OZS A;  3VRO A;  1Y1X A;  3RZS A;  1C7V A;  2GGZ A;  1S5G Y;  2KSP A;  3CDN A;  1IH0 A;  1BOD A;  1OOG A;  4PHJ A;  1U5I B;  1LXF C;  1Y0V H;  3O6B A;  1N65 A;  1MHO A;  3L4L A;  5DKN A;  1G33 A;  1RK9 A;  1A4P A;  2LAN A;  3DVJ A;  3TUY C;  1NPQ A;  2H61 C;  4PHM A;  3D78 A;  1G8I A;  4QJ3 B;  4A4C A;  2JZI A;  1PVB A;  3AKA A;  1MQ1 A;  3O2P A;  2GTE A;  2JTZ A;  1CM4 A;  2Y5I A;  3A4U B;  2KI6 D;  1MXE A;  4DS7 A;  3SS5 A;  2LE9 B;  1L2O C;  1JF2 A;  3PFV A;  1DF0 A;  2Y1M A;  4DUQ A;  2BCB A;  2I2R E;  2JU0 A;  1GGW A;  1C7W A;  4MBE A;  1CLL A;  1RRO A;  4ORC B;  3VRR A;  3FWC A;  3FWB A;  4MZL A;  1XK4 A;  2NCO A;  1ZOT B;  2KQ6 A;  2BE4 A;  1DJG A;  2WOS A;  5DKQ A;  3LCP C;  1NSH A;  4INX A;  4C0J A;  1DMO A;  1UUS A;  1SMG A;  1IJ6 A;  1MF8 B;  3I5I B;  2LMU A;  5I2O A;  2LP2 A;  2LNK A;  1SK6 D;  3CR4 X;  3DVM A;  1KWO C;  2ZFD A;  4C0L A;  2HQW A;  5FYX A;  1XK4 C;  4YRU A;  3LLE A;  3ZNI A;  4OVN F;  3NXA A;  4QJ4 B;  2CXJ A;  2CTN A;  3JTD B;  3D0Y A;  5AER A;  1C3Z A;  4MRY A;  1F71 A;  1F54 A;  2K61 A;  2QEH A;  2Q91 A;  1W9Z A;  2L5X B;  2P71 A;  2K2F A;  2WCK A;  3IF7 A;  2OPO A;  1J7R A;  1NX1 A;  1CMF A;  2MRD A;  1H4B A;  3GOF A;  1B8R A;  1NUB A;  2RGI A;  2M1U A;  2AAO A;  3BUW B;  3NSI A;  2ZRT A;  5CSN A;  4PE0 A;  2LMT A;  4PAL A;  3PN7 C;  4GPL B;  4MLW A;  2FOT A;  1OMV A;  4QJ5 B;  1SCM C;  1B9A A;  1JFJ A;  1XFX O;  2KLD A;  1G4Y R;  2KPH A;  2KBI A;  1OOI X;  3B6X A;  2WC8 A;  5FI2 A;  1FI6 A;  1V1G A;  4IL1 A;  3DD4 A;  1OZO A;  1SYM A;  1B7T Z;  2JT0 A;  3TDU A;  1CFD A;  1CDL A;  1F4Q A;  2JRF A;  2MA2 A;  5KU1 A;  1KSM A;  4E68 A;  1JC2 A;  4MN0 A;  1RWY A;  1UHJ A;  1YRU B;  1ZUZ A;  2JXC A;  3PLF B;  3BOW A;  3B86 A;  2K7O A;  2I18 A;  4GGF A;  4PE7 A;  2M7L A;  1VRK A;  1DJX A;  1WDC C;  2NXQ A;  1QV1 A;  2BCX A;  4I5N B;  1U5I A;  1LA0 A;  3O78 A;  4NDC A;  2L0P A;  2TN4 A;  1YUT A;  2BL0 B;  1FF1 A;  1LS8 A;  2PQL A;  4D1E A;  1MUX A;  3PAT A;  4I5J A;  3WHU B;  2H2K A;  4MRX A;  1YRT B;  1TWO A;  1L7Z A;  1XFZ O;  2PMY A;  2WCB A;  4PDZ A;  5CSI A;  5J3X A;  3SS4 A;  3VGO A;  1Y1U A;  1K9U A;  1GM0 A;  3OGN A;  1A75 A;  3CAB A;  5ER4 X;  5JOL A;  1K9P A;  1JBA A;  1Z2C B;  1KCY A;  3SIA A;  3PM8 A;  4JD9 A;  1F70 A;  1TCF A;  4CFQ A;  1N2D A;  5HL1 A;  1EXR A;  1K8U A;  1KK7 Y;  2LLS A;  3VRP A;  1BT6 A;  2WC5 A;  1ALV A;  2HQ8 A;  4ORB B;  3TDI A;  4CFR A;  5I94 A;  1P28 A;  1OMD A;  1QLS A;  3BFH A;  3FE6 A;  4M2Q A;  4PHK A;  3DXL A;  2FJU B;  2O5G A;  4JKT A;  1CFF A;  1KK8 B;  1NIW A;  3VRQ A;  4ZCU A;  1BJF A;  3KO0 A;  2L51 A;  4FQO A;  1J7O A;  3LK1 A;  1PUL A;  1QIV A;  2WCH A;  2L98 A;  5JJG A;  1DVI A;  3BXK A;  1KSO A;  1TN4 A;  2G9B A;  1BF5 A;  2KI6 C;  1CTR A;  1Y1A A;  5D3O A;  3BFB A;  2L5Y A;  3KEV A;  3EVV A;  1IRJ A;  1MR8 A;  3EK7 A;  4MZJ A;  3FE9 A;  1CKK A;  2MLF C;  1AHR A;  3K21 A;  1PK0 D;  2LP3 A;  3RM1 A;  2NLN A;  3D77 A;  2ZNE A;  2JXL A;  1QX7 A;  1OOJ A;  2QEV A;  2I7A A;  5HLO A;  3BOW B;  1DGV A;  2VRG A;  1OW4 A;  1R6P A;  2GGM A;  3MSE B;  3JTD C;  1YUS A;  4MZK A;  1BR1 B;  3DY9 A;  1AP4 A;  2PVB A;  1FI5 A;  1A29 A;  1K9K A;  1QLK A;  3SIB A;  2LV7 A;  1AVS A;  1JFK A;  2F2P A;  2FCE A;  3CZ2 A;  4YGB B;  2LVK A;  4HRH A;  2EC6 B;  2KI4 B;  3O4Y A;  1A75 B;  2JPT A;  4PE1 A;  1PSR A;  3KF9 A;  3WXA A;  1KFX L;  5KSZ A;  1HT9 A;  2WOR A;  1EH2 A;  1IQ5 A;  1YVL A;  2MJW B;  4GGN A;  1F8H A;  1YR5 A;  1QVI Y;  3B88 A;  3R72 A;  1BMO A;  1QWV A;  1BG1 A;  3RLZ A;  2LLU A;  5K89 A;  2HF5 A;  1AUI B;  2F8P A;  2CNP A;  4U8D A;  1BLQ A;  1M63 B;  2QPT A;  2KAX A;  2L2C A;  2H8V A;  3BUN B;  1SR6 B;  4M2O A;  4OKH A;  2KGB C;  3LK0 A;  3CZ1 A;  1TNP A;  1K93 D;  3Q8I A;  5TNC A;  1IQ3 A;  1KQV A;  1MXL C;  5AAN A;  1YTZ C;  3IQO A;  2KNE A;  4NQG A;  2ZKM X;  4N1F A;  2Y1N A;  2BL0 C;  3H4S E;  1B4C A;  2BNX A;  2LC5 A;  1XFV O;  3DVE A;  4HRG A;  1DGU A;  1TNQ A;  3FE8 A;  3PSR A;  4TNC A;  5D69 A;  3CYZ A;  4OZD A;  1BU3 A;  1UWO A;  1F55 A;  1SRA A;  1N0Y A;  4FQT A;  3I5F B;  3OX5 A;  4M2P A;  2KBM A;  4JPZ B;  2M7N A;  1QAS A;  1F4O A;  1J55 A;  1NX2 A;  4JWQ A;  3IVT A;  4AQI A;  2L2E A;  3S0G A;  1GGZ A;  2JPO A;  3EKJ A;  2Y4Q A;  2M3W A;  1DJZ A;  1QJT A;  2JT3 A;  3BJH A;  2K7B A;  1DTL A;  1ODB A;  1X02 A;  2KYC A;  3EK8 A;  2ZRS A;  1CM1 A;  1KQM B;  1OOH A;  5I2L A;  1KK8 C;  1QV0 A;  4YBH B;  1UUR A;  1WRL A;  3R1V A;  1CDP A;  1UHH A;  2BKH B;  1XFR A;  3BYA A;  4YI9 A;  2WCL A;  5HKW A;  3BQ3 A;  2KGR A;  3CGA A;  3PJI A;  1CFC A;  2CT9 A;  2KDH A;  3SG6 A;  2SCP A;  2CBL A;  2IS9 A;  3ZWH A;  5KTY A;  1AJ4 A;  2L4I A;  2M8U A;  2NZ0 A;  4GNK B;  5CPV A;  3CLN A;  2DOQ A;  3EKH A;  4OCI A;  5F6T A;  3I5G B;  2BAP A;  1K95 A;  2K7D A;  1Q80 A;  1B7T Y;  3OB2 B;  3TS5 B;  4GGF C;  1REC A;  3CZT X;  1EG3 A;  3HX4 A;  1ZFS A;  2OS8 B;  3CS1 A;  3QME A;  3SJS A;  5DKR A;  4YI8 A;  3LL8 B;  4MSP A;  4BY4 A;  1CDN A;  2WND A;  2FJY A;  3B87 A;  3JVT B;  4NDB A;  1AK8 A;  2K2A A;  3TDZ A;  4ICB A;  1AJ5 A;  2AMI A;  2EC6 C;  4ETO A;  4YGC B;  4ZCV A;  2KI4 C;  1OSA A;  5FI6 A;  2KHN A;  1ALW A;  1IKU A;  1TUJ A;  2LVV A;  2KFG A;  2B1U A;  2QEO A;  2V53 A;  3NGV A;  2KYF A;  1JSA A;  1TIZ A;  4GFT A;  1K94 A;  3DVK A;  1NX3 A;  1JWD A;  4MEW A;  4KYN A;  1W7I B;  3KPX A;  2L4H A;  4CLN A;  4JQ0 D;  2PAS A;  2O60 A;  3BFA A;  1NCY A;  3WNX B;  1KFU L;  2LM5 A;  2F2O A;  1Y6W A;  4GUK A;  4IJ7 A;  2F3Y A;  3OX6 A;  3GK1 A;  3SS3 A;  1UHN A;  4XYN A;  3EVR A;  3NSL A;  1SR6 C;  1M39 A;  4FTG A;  1SSE B;  2WCJ A;  1EL4 A;  2EGD A;  2ERB A;  3I5I C;  1CMG A;  4CPV A;  1LVC D;  1YVH A;  3FIA A;  1RTP 1;  1QX5 B;  1TNW A;  3VRN A;  1B8L A;  2KFH A;  2LAP A;  1UP5 A;  4CID A;  1QX2 A;  1ZAC A;  1DT7 B;  1S5G Z;  1NX0 A;  2BBN A;  1R2U A;  2LVI A;  2K8M B;  1IG5 A;  2LCP A;  3HCM A;  2K60 A;  1V1F A;  1M31 A;  1TUZ A;  3EVU A;  3NSO A;  5G08 A;  4F7F A;  1XFW O;  2WCF A;  4HRE E;  1IGV A;  2GV5 A;  2YGU A;  1SL8 A;  3I5F C;  5CSF A;  1SL9 A;  2KQY A;  1RJV A;  1SNL A;  1J1D A;  1QXP A;  3BUO B;  1IIO A;  1OMR A;  4WRI A;  2ISD A;  4ORA B;  1B1G A;  4UPG A;  3S0D A;  3S0F A;  1S6I A;  2KFF A;  1W7J B;  2JQ6 A;  2H61 A;  3PAL A;  2EHB A;  1J7Q A;  2WCE A;  1SBJ A;  1KQM C;  1SPY A;  2M29 A;  1OOF A;  5HLV A;  3BUM B;  4DIR A;  3DZT A;  2L50 A;  1KFU S;  1PAL A;  2M9G A;  2MHH A;  2CCM A;  2D8N A;  1OE9 B;  1FW4 A;  1K96 A;  2QAC A;  1MWN A;  3OHM B;  4N1G A;  4OV2 A;  1A03 A;  2JNF A;  1LA3 A;  4A4B A;  2F3Z A;  1J1E A;  2FCD A;  2E30 A;  1DEL A;  3FS7 A;  3DF0 A;  4PHN A;  2ZN8 A;  2K0J A;  3CWG A;  2BBM A;  1RFJ A;  2LHI A;  4P5O E;  3D73 A;  2LHL A;  2WC6 A;  4AOM A;  1YUR A;  1YX8 A;  1XFU O;  3S0B A;  1S1E A;  2A4J A;  4HSZ A;  4N5X A;  3GK2 A;  1S26 D;  1UHI A;  2JOJ A;  3I5G C;  3OP0 A;  1EJ3 A;  2M1K B;  5HKZ A;  5HKY A;  2M97 A;  4R1E A;  3TS5 C;  4BY5 A;  4C0K A;  2OTG B;  1WRK A;  2OS8 C;  1LKJ A;  3N7H A;  3SG3 A;  3UNW A;  1QS7 A;  2JNX A;  5DIC A;  1TTX A;  3PM2 A;  4P2Y B;  2QDI A;  3V2L A;  2E6W A;  4AQJ A;  4DCK A;  2JC2 A;  3JVT C;  2LUC A;  1CLB A;  3L4A A;  4WQ2 A;  4MVF A;  3I5H B;  3CTN A;  2PRU A;  2ZN9 A;  4DRW A;  3S0A A;  1KFX S;  1S6J A;  1GQM A;  1NCZ A;  2BE6 A;  5I8N A;  1UHK A;  1JF0 A;  1XA5 A;  1DQE A;  1ORG A;  1TCO B;  3VB1 A;  2AUC A;  5ER5 A;  2KLE A;  1GJY A;  2LMV A;  2MAZ A;  5I2Q A;  1DJI A;  1QIW A;  2KOT A;  3TUY B;  2KAY A;  1OQP A;  1LIN A;  1XYD A;  1DJY A;  2BKI B;  4L9M A;  2HET A;  4XJK A;  1C07 A;  1TOP A;  1JUO A;  4INW A;  2LVJ A;  3TZ1 A;  1D1O A;  2BEC A;  3ICB A;  2K7C A;  5B8I B;  3R1P A;  1CNP A;  1NCX A;  3EG5 B;  1TNX A;  2PAL A;  3SG4 A;  3O4X A;  2PYQ A;  3SG5 A;  1L2O B;  2M49 B;  4I5K A;  3UO9 A;  1XO5 A;  1DJW A;  3DYE A;  1WLZ A;  3E3R A;  3OB1 B;  1EG4 A;  5AXI A;  2I94 A;  1NWD A;  1M45 A;  2P70 A;  1M46 A;  4YGE B;  5AFP A;  1HQV A;  3DF0 B;  3EK4 A;  3SG2 A;  4PE4 A;  1TRF A;  1CB1 A;  1FBV A;  1DF0 B;  2ZND A;  2Q4U A;  4GAO A;  3B7A A;  2LUX A;  2P6B B;  1KK7 Z;  1KWO B;  1WY9 A;  1DEK A;  3OBV A;  5GQQ C;  1DJH A;  4NDD A;  3AKB A;  5IBW A;  3CR2 A;  3L47 A;  2JUL A;  4F0Z B;  2PSR A;  1CFP A;  1YUU A;  1FPW A;  2F33 A;  3SG7 A;  1K90 D;  1ZMZ A;  4YGA A;  2QEB A;  3R1O A;  1DC1 A;  2JTT A;  4GBA A;  1BOC A;  4PT1 A;  3QRX A;  3CR5 X;  1H8B A;  2COL B;  1S36 A;  1S3P A;  2JT8 A;  3F45 A;  1Z4H A;  3GK4 X;  3NSK A;  3K1E A;  1CLM A;  1C3Y A;  1SY9 A;  3D0Y B;  1K2H A;  1E8A A;  1PVA A;  1QTX A;  1NYA A;  1WLM A;  2BCA A;  1XVJ A;  2LLT A;  2NCP A;  3AAJ A;  3PN7 B;  5HYD A;  1PRW A;  2JWW A;  3NHT A;  2KAV A;  3AAK A;  1SCM B;  3M0W A;  5AEQ A;  2MBX A;  1CDM A;  4WQ3 A;  1QAT A;  2M0R A;  4USL A;  1A2X A;  4OR9 B;  3D76 A;  1WRZ A;  5PAL A;  1PSB A;  4YGD B;  4XJK B;  5BPJ A;  3A8R A;  1SKT A;  4PCW A;  2WCM A;  3WHT B; 
#chains in the Genus database with same CATH homology
 1LS8 A;  2PQL A;  3D74 A;  3S0G A;  1TWO A;  2JPO A;  3BJH A;  1T14 A;  1GM0 A;  3OGN A;  3NHI A;  3CAB A;  3CZ0 A;  1OOH A;  3D73 A;  2WC6 A;  4JD9 A;  5EL2 A;  3R1V A;  3S0E A;  3S0B A;  1XFR A;  3D75 A;  2WCL A;  3RZS A;  2WC5 A;  3PJI A;  3CDN A;  1P28 A;  3FE6 A;  3BFH A;  1OOG A;  3DXL A;  3N7H A;  5DIC A;  3V2L A;  2QDI A;  3L4L A;  3L4A A;  2WCH A;  3D78 A;  3S0A A;  3BFB A;  2GTE A;  3FE9 A;  3QME A;  1DQE A;  1ORG A;  3VB1 A;  2FJY A;  3B87 A;  3D77 A;  2QEV A;  1OW4 A;  4INW A;  1TUJ A;  3NGV A;  2QEO A;  3R1P A;  3DY9 A;  4INX A;  3BFA A;  3DYE A;  3CZ2 A;  2P70 A;  1C3Z A;  2WCJ A;  2QEH A;  3B88 A;  2ERB A;  2P71 A;  2WCK A;  3R72 A;  3B7A A;  1QWV A;  3L47 A;  2L2C A;  2H8V A;  2QEB A;  3R1O A;  4F7F A;  3CZ1 A;  3Q8I A;  4PT1 A;  2KPH A;  1OOI X;  3B6X A;  3K1E A;  1C3Y A;  3S0D A;  3FE8 A;  3S0F A;  3CYZ A;  3NHT A;  4OZD A;  3B86 A;  4FQT A;  3D76 A;  1OOF A;  3DZT A;  2WCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...