4OVNF

Voltage-gated sodium channel 1.5 (nav1.5) c-terminal domain in complex with calmodulin poised for activation
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
146
structure length
146
Chain Sequence
STEPLSEDDFDMFYEIWEKFDPEATQFIEYSVLSDFADALSEPLRIAKPNQISLINMDLPMVSGDRIHCMDILFAFTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSAMVIQRAFRRHLLQRSLKHASFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Regulation of the NaV1.5 cytoplasmic domain by calmodulin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Calmodulin
total genus 34
structure length 146
sequence length 146
chains with identical sequence G, H, I, J
ec nomenclature
pdb deposition date 2013-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ovnF01
1.20.5.1190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces iswi atpase 4ovnF02
1N65A 3I5IB 3KO0A 1YUUA 4YGBB 1NYAA 2JOJA 1JF2A 2MA2A 1WRLA 1X02A 1TN4A 2ZNDA 5HKYA 1LA0A 1MUXA 1Y0VH 3BUNB 1MWNA 2KBMA 3TUYB 1CMGA 1QV1A 3EK4A 2H61A 2FCDA 4OCIA 1SCMC 1F55A 1UURA 4XYNA 1XO5A 1Y6WA 4MLWA 1QTXA 1NSHA 1XFUO 2GGZA 1HT9A 2BL0B 1J7OA 1W7IB 3VRPA 2JU0A 2I18A 1ALWA 1UHJA 3ZNIA 1H4BA 1DF0B 1TIZA 3LL8B 4U8DA 4E68A 2JT3A 3CR4X 1CDLA 2L4HA 1S5GY 3RLZA 2BE4A 4WRIA 4ZCVA 3VROA 5AXIA 1J7QA 2LUCA 2PSRA 5D7FA 1QX2A 1RWYA 2Y5IA 1KSOA 1QASA 3VGOA 1QVIZ 3NSLA 5TNCA 1JWDA 4ORBB 2B1UA 2F8PA 2PRUA 4TNCA 1BMOA 1K8UA 1FBVA 3O6BA 1C07A 1B8CA 1DTLA 2H2KA 5G08A 5CSNA 3BYAA 3PSRA 1N2DA 2GV5A 2MRDA 3CR2A 1KK7Z 2JNFA 1SL8A 5CSFA 2MBXA 1M63B 2AMIA 4QJ4B 3OB2B 4YGDB 2OPOA 1GQMA 2OTGC 1OQPA 2FCEA 1OMDA 4MVFA 1F70A 1KWOC 3CZTX 2O60A 1XYDA 3JTDC 1MR8A 1K2HA 1WLZA 3IQOA 2KAVA 5BPJA 2QPTA 1JF0A 3FWBA 4M2QA 2Y9ZA 1YTZC 1IQ3A 2KFFA 4P2YB 2Y1NA 5I2QA 2CNPA 3KHEA 1G4YR 1EG3A 2JNXA 1G33A 1UHNA 2SCPA 4I5KA 3O78A 3D0YB 3SG3A 2NCPA 1NP8A 1A75B 2M7LA 3PFVA 1FI6A 1K94A 1YX7A 3WXAA 2JWWA 1DJYA 3NSKA 1XVJA 1YUSA 4PE0A 3GOFA 4ICBA 1JSAA 1BR4B 4GGNA 5AANA 1OMRA 4AQIA 5JOLA 4HREE 1XA5A 4PHJA 1BLQA 1PK0D 2CTNA 1BU3A 1TRFA 2I2RE 2M97A 2WOSA 4XJKB 4F0ZB 1KK7Y 2LCPA 4GNKB 3DVJA 2L0PA 2Q4UA 1A75A 3K21A 2PMYA 4C0JA 4DS7A 4CLNA 1MHOA 1SY9A 2GGMA 1YR5A 2LVJA 3CTNA 3LCPC 2E6WA 3DD4A 2OS8B 4ORAB 2LUXA 1OE9B 2VRGA 3AKAA 1K90D 1AJ5A 3EK8A 1EG4A 1CMFA 1RJVA 5B8IB 4CIDA 1BT6A 2KDHA 1UWOA 4JQ0D 2EHBA 2K0JA 1XFXO 2LNKA 2WNDA 2LLSA 1NX3A 5GQQC 1C7VA 1KWOB 4PE7A 2JULA 1Y1AA 1SW8A 1PALA 1LXFC 3CWGA 3F45A 2JQ6A 3A4UB 3SG7A 2BCXA 1ZACA 1NWDA 1TNQA 2JTZA 1PSRA 2PALA 1QX5B 1RK9A 1CLMA 1TNXA 3LLEA 1S6IA 3JVTC 4USLA 2H61C 1CFCA 1J1EA 1QS7A 2LMUA 1BJFA 3AAJA 1L2OB 1KCYA 5I2LA 2M0RA 1J55A 4OVNF 1AUIB 3FIAA 5KTYA 4DUQA 1ZMZA 2Y1MA 2KI4B 1OFCX 3CS1A 1XK4A 5AEQA 2ZNEA 2JZIA 2WCBA 1CLBA 3OX6A 2G9BA 3SJSA 1GGWA 3IQQA 2LLTA 4CFQA 2SASA 3CLNA 1B8LA 2LANA 1CNPA 1SCMB 2L98A 1IRJA 2PASA 3NSOA 1MXLC 1SBJA 4MZLA 1AJ4A 2NZ0A 1B47A 2KBIA 1CB1A 2KOTA 2LP2A 5JJGA 3LK1A 1QXPA 2MJWB 2QACA 2TN4A 3EKJA 4YRUA 3BUMB 1K96A 1OZSA 2P6BB 1JUOA 1ZOTB 2MLFC 4M2OA 1YRUB 4HRHA 2FOTA 1FW4A 1EJ3A 1TCFA 5PALA 1YVLA 4DCKA 1IG5A 1DJHA 1CTRA 1QX7A 3I5GB 3D10A 4I5LB 4N1FA 1V1GA 2K2AA 1KQVA 2O5GA 3SIBA 2K7BA 4AQJA 2WC8A 5HYDA 1M45A 3E3RA 5KU1A 3CR5X 2LVIA 2LV7A 3RM1A 3WNXB 3SG2A 1EL4A 2BE6A 3I5FB 2M1KB 3AKBA 4L9MA 2PVBA 4HSZA 2JXLA 4A4CA 5ER4X 4YBHB 1SKTA 1N0YA 1RFJA 4DRWA 3PATA 5I8NA 2ISDA 3C1VA 2MLEC 2EC6B 1IH0A 5DKQA 3AAKA 1F4QA 1QLKA 1RTP1 1SR6B 4BY5A 1D1OA 3I5GC 3SG6A 1TNPA 2CXJA 1B8RA 4XJKA 1L2OC 1WRZA 3D0YA 1L7ZA 2F2PA 3TS5B 2L50A 2KAXA 4M2PA 1G8IA 1Q80A 1MXEA 2KI4C 1NX1A 4MRYA 4MZKA 1Y1UA 1A29A 2NCOA 3EVRA 4PHKA 3OHMB 1DMOA 1DJWA 3SG4A 3JTDB 5CSJA 1SRAA 2CT9A 2LC5A 2I7AA 1OMVA 2LP3A 1NX0A 1AHRA 4PDZA 1K9PA 1S1EA 2AAOA 2KFGA 1XFYO 2KFHA 2MHHA 2Y9YA 1A03A 1IJ5A 2A4JA 3ICBA 1OSAA 1KSMA 4CPVA 4FTGA 2M29A 3LK0A 4PCWA 3TS5C 2LMTA 2L4IA 2R2IA 1DF0A 4YGCB 1SL7A 3DVKA 3A8RA 2KNEA 3OX5A 5F6TA 2K8MB 1A2XA 2HPSA 2KHNA 3EVUA 5IBWA 1GGZA 1KFUS 1QATA 3M0WA 1KFXL 4YI9A 1YVHA 1E8AA 4GGFC 1OOJA 4WQ3A 4OKHA 4Q04A 2MAZA 2K2FA 1DVIA 1LVCD 3WHUB 3O4YA 5K89A 1PSBA 1K95A 1H8BA 2LM5A 3I5FC 4YI8A 1YRTB 1UHIA 1PRWA 1CFPA 2EGDA 3O2PA 4ZCUA 2KGRA 1R2UA 1PULA 2DOQA 5I2OA 3MSEB 1BR1B 1KQMC 2AUCA 2JTTA 2KQ6A 1SR6C 2WCEA 3HX4A 1K9KA 2K7DA 3FS7A 2BECA 4IL1A 3EK7A 1CFFA 1MF8B 3H4SE 1ALVA 2CCMA 1TOPA 1S36A 1M46A 4NDBA 5HKWA 1CM1A 1M39A 2NLNA 3ZWHA 4AOMA 4BY4A 1RROA 1LKJA 2LMVA 3PN7B 1F8HA 1YUTA 5CSIA 2KQYA 4FQOA 1JBAA 1ODBA 1LA3A 1Y1XA 3CGAA 3IF7A 4MSPA 5KSZA 1SL9A 3TUYC 2Y4QA 1FI5A 3NSIA 5AFPA 1DJGA 4NQGA 5J3XA 2BCBA 1DGUA 1ZUZA 2KI6D 4HRGA 5DKRA 3VRQA 1QLSA 1CM4A 1TTXA 4I5NB 4MBEA 4OV2A 5HLOA 3BUXB 1J7RA 1DJIA 4PE1A 1CDMA 2OTGB 2BL0C 2KI6C 4QJ5B 2LHIA 1RECA 2ZRTA 3PN7C 3OB1B 2JC2A 2BKIB 2F33A 1SCVA 2M8UA 1R6PA 1IWQA 2BCAA 1IJ6A 2BBMA 4YGEB 4A4BA 2KSPA 1MQ1A 2KYFA 2F3ZA 3HCMA 4N1GA 1SNLA 2WCFA 3EKHA 2G2BA 3GK2A 2KYCA 1TNWA 2LLUA 1BOCA 4QJ3B 3BOWA 1GJYA 4DIRA 1QIWA 1AVSA 2FJUB 4NDDA 1ZFSA 2HETA 3TDUA 1IQ5A 1JFJA 4PHMA 2WORA 2BKHB 1DT7B 3VRRA 2LE9B 1WDCC 2BBNA 3I5HC 1SPYA 4C0LA 2COLB 2HF5A 3EVVA 1UHHA 3VRNA 4GGFA 2Q91A 2K7CA 3BUWB 4C0KA 2IS9A 1B4CA 4WQ2A 1M31A 1QIVA 1S5GZ 1SK6D 1HQVA 5ER5A 1F71A 1K9UA 2L2EA 1NCZA 5D69A 4JPZB 1PVAA 1S6CA 2F2OA 4NDCA 2JT0A 5HLVA 3SG5A 2M49B 1IKUA 2K61A 1EXRA 4YGAA 2M7NA 2HQWA 3DVMA 1WDCB 3BXKA 2KAYA 1KFUL 1SYMA 5DKNA 2JRFA 3KF9A 1U5IA 1BG1A 3DVEA 4ETOA 4GUKA 3WHTB 1FF1A 2ZN9A 4R1EA 1JFKA 1U5IB 3PLFB 1CLLA 5CPVA 4MRXA 1DJXA 2JXCA 2LVVA 2EC6C 1XFWO 2NXQA 3GK4X 1UHKA 2LHLA 2M3WA 1S3PA 1AK8A 1JC2A 3QRXA 2F3YA 2HQ8A 3PM8A 4I5JA 2L51A 1NUBA 3I5IC 1KFXS 1W7JB 4GPLB 1AP4A 1V1FA 1B1GA 3TDZA 3TZ1A 4OR9B 3NXAA 1XFVO 2ZKMX 1SMGA 2E30A 1J7PA 4P5OE 1QJTA 1B7TZ 2JT8A 4MN0A 4ORCB 3JVTB 1KK8C 1CDNA 2ZN8A 1QVIY 3BUOB 1PVBA 1WRKA 4CFRA 4N5XA 1IGVA 2OS8C 4UPGA 1K93D 3I5HB 1NPQA 2L5XB 1J1DA 4GFTA 1YURA 1BF5A 3BOWB 2ZFDA 1XK4C 2K7OA 2D8NA 4D1EA 1VRKA 3PALA 4PALA 1A4PA 1DJZA 4MEWA 1KK8B 2KGBC 3GK1A 2RGIA 2M9GA 1FPWA 4PE4A 2V53A 4PHNA 4GAOA 4GBAA 1LINA 1B9AA 3KEVA 1F54A 1CFDA 2I94A 1YX8A 3TDIA 2LAPA 1WY9A 3FWCA 2CBLA 5AERA 1NIWA 5FYXA 1CDPA 1UP5A 1S26D 1WLMA 3SIAA 1EH2A 1OZOA 3BQ3A 1NX2A 2ZRSA 1S6JA 3KPXA 3DF0A 2JPTA 1DGVA 1F4OA 2LVKA 2M1UA 1KQMB 3DF0B 1C7WA 1UUSA 1NCXA 5HKZA 3OP0A 1B7TY 1TCOB 4MZJA 4JWQA 1BODA 1QV0A 1CKKA 1NCYA 1XFZO
chains in the Genus database with same CATH superfamily
2E76C 2OYOA 4PJ0E 3H1LD 3O4XA 2P1JA 3I5IB 5CCGA 1JTHA 3QH9A 4I6MC 4JBZA 2KLEA 1LA0A 3BUNB 1Y0VH 3TUYB 1CMGA 2KBMA 5GTHE 1BE3D 3TNUB 2W6AA 2YKOA 3FXDA 1SCMC 2IFNA 2ZVNB 2NPSB 2K1AA 2WCLA 1QTXA 2GGZA 1J7OA 3LW5J 2QA4P 4I1LA 2JU0A 4OH8B 3L36A 2IPPA 4A7PA 1RE4A 1KN7A 1LWUB 1TIZA 4U8DA 3E1RA 4L74A 5AVVB 1KYOI 4WY4A 5KAFE 1P84H 1GDTA 4ZCVA 3AE3C 5D7FA 2QEOA 3FE8A 1QASA 3L72J 2W27A 3NSLA 5B66H 3MHVA 1JWDA 4ORBB 3BFAA 1N86A 1CZQA 4TNCA 1ZOYC 1DEBA 3CZ1A 3O6BA 1N2DA 2P67A 2V7QH 3CR2A 4HJGH 1KK7Z 5KLVK 3MGNA 2MBXA 2AMIA 4QJ4B 1SQXK 2OPOA 3BRVB 3MD0A 3EWKA 1GQMA 3Q2YA 4WVZA 1OMDA 2QEHA 3R72A 4PV1B 1L0NG 4OZDA 3A0BE 2BCCJ 1J2JB 1K2HA 1WLZA 3Q3DA 5BPJA 4WBAA 2QPTA 1FU1A 1ZXGA 2QVAA 1IFJA 5HL1A 2Y1NA 3T97B 1EG3A 2JNXA 2RMZA 1G33A 2SCPA 1ZRTD 3TF5A 3PTZA 3D0YB 1SFCC 3TGUD 1N7SD 3WXAA 3L75J 1OOGA 3NSKA 3ITKA 1RF0A 1JY3P 1GW3A 4Z1MH 3PM2A 1JSAA 1LJ2A 5AVTB 4HREE 1XA5A 1BLQA 2QIWA 2E43A 1BU3A 2L5GB 1EDJA 2WOSA 4CPGA 3H1LJ 3DVJA 5H2FE 2WSSH 1TWOA 4DS7A 4CLNA 3CC7P 3GG2A 4PT1A 1NJIQ 2JKVA 4U7JA 1GD2E 2E6WA 3TNUA 2XV5A 1J1EB 1AJ5A 1NTME 1RJVA 2KDHA 3L4FA 2EHBA 4YTPC 1NX3A 2WZ7A 1KB9D 4WWIA 3CDNA 1KWOB 4PE7A 3CWGA 2Z4EA 3TYYA 3F45A 1SQQD 2LXBA 1VF5C 1MKMA 4GIFA 3A4UB 1IK9A 2BCXA 1PSRA 2PALA 1QX5B 1GL2D 1USDA 2HODB 1FOSF 2WCMA 1S6IA 4O9BA 1SQPJ 5APVA 3MTUE 1OVVA 1M90Q 4YXDC 4GDOA 1G1JA 1TU3F 2P7JA 3SJSA 1J1DC 3IQQA 4JD9A 1U7JA 3N7HA 2LANA 1IRJA 3NSOA 1SBJA 1L0NJ 1AJ4A 2NZ0A 1Q2NA 5AW4B 3NGVA 1B47A 2P70A 1CB1A 2LP2A 2AEJA 1JB0J 1NTZG 1HF9A 3LK1A 1QXPA 2MJWB 2E75D 1A02F 3BUMB 2PYQA 1OZSA 3IFMA 1ZOTB 4I2LC 2FOTA 1EJ3A 2H7HA 2KLDA 3I5GB 1GL2C 1QX7A 1X9VA 4N1FA 1V1GA 1LTGC 1BSNA 2K7BA 1W2BO 3E3RA 5KU1A 1DD3A 1M1JB 3CR5X 2LVIA 2LV7A 3RM1A 2J58A 4D6TD 4XA4A 3SG2A 1EL4A 1L0NK 1YITP 4L9MA 2JXLA 2KLUA 5C39A 4YBHB 1SKTA 1RFJA 3HD7D 2MLEC 2EC6B 4L75A 4IFDK 2V7QJ 3AAKA 1JY2O 1SQBK 3HTKA 3MUDA 1B8RA 1WRZA 1JCCA 3RK2D 3S1KA 2E42A 2HLOA 2QJKB 2KAXA 4M2PA 2QDIA 1Q80A 2WSFJ 5APXA 4H13D 1LTTC 3H1HE 1ORGA 2NCOA 3C9IA 1DMOA 2M3EA 3D74A 1EZVE 2JWAA 4PD4E 1GU5A 2LP3A 4IJ7A 3B7AA 4LGDE 5KLVD 3D71A 3II6A 3PRJA 1OOHA 1R8EA 1KSMA 4CPVA 3H6PA 1DEKA 1ZRTE 2KIKA 3TS5C 5CJ4A 3LW5H 1IC2A 1NU1D 2HPSA 3EVUA 4YXWH 2QG4A 3RL0B 2FXOA 3SS3A 2B89A 1CSBA 1NTMK 3B8EB 4YI9A 1YVHA 4W7ZA 4GGFC 1T2KD 5APWA 4OKHA 2MAZA 1LVCD 1H8BA 1OXZA 3CZ0A 4PD4H 1YRTB 2IZ0A 3E1IA 1PRWA 2IX7C 4UB6E 2EGDA 2M0BA 2MJZA 2XNDH 2KGRA 2AUCA 2KQ6A 2WC5A 3H32A 1C3YA 3EK7A 1CFFA 2CCMA 1S36A 1URQB 1CM1A 1VQ9P 4AOMA 4BY4A 4NPEA 2SPZA 1LKJA 3HD7C 3PN7B 1F8HA 3N4XA 5CSIA 5CCGC 4DT0A 1FZFA 1SQPE 1MFZA 2Y4QA 2Q1KA 1L0LG 3RBXA 5GTIH 1SLQA 3FWLA 1S5LX 1S1CX 3KDPB 2BCCE 3S0GA 4MBEA 1CM4A 1PPJE 2N1TA 1SP4A 1J7RA 4PE1A 2KI6C 4QJ5B 4L73A 2ZRTA 3AE2C 2BKIB 1M1JA 3AEDC 2M8UA 4N3YB 4F7FA 1SQQE 3VB1A 2WSCJ 1EXIA 2GUVA 1OW6A 3O6QB 2FY8A 1L2PA 2KNCB 1SNLA 3SWFA 3GK2A 2D2CD 1NAYA 1BOCA 1YTZI 3G4SP 3H1HJ 1ZFSA 1JFJA 3CCVP 1YHQP 1RE4C 2BKHB 1DT7B 1USEA 4OGQB 2PFXA 4AUWA 1WDCC 5CBNA 1SPYA 2JEEA 1KV4A 2K7CA 2IS9A 1S5GZ 1QIVA 1EZVI 1URQC 5D69A 3D70A 1BE3J 4NDCA 3R2PA 1EXRA 2M7NA 2PRRA 2FKWB 2OYHB 4KHXA 1BG1A 4ETOA 4GUKA 3WHTB 1G2CA 3BCCJ 2YMYA 2YIUC 1U7MA 5KAIH 5CPVA 2JXCA 2EC6C 2JPOA 3B4SA 2LHLA 1S3PA 2F3YA 2E76B 4I5JA 4N78D 2L51A 4NPDA 5AW0B 3TDZA 3TZ1A 2ZKMX 1VQOP 1NAFA 4UB8H 4P5OE 2NPSD 1KK8C 1NH4A 1G1IA 2LXCB 3M0DA 1NTZK 4CFRA 4N5XA 1IGVA 2OS8C 3I5HB 4N6JA 1QWVA 3L73E 1J1DA 3H1KE 2Y0EA 4EI2A 2YXRB 1XK4C 2D8NA 4D1EA 4PALA 1NTKG 2D2CC 2KGBC 1QX8A 5APSA 1VQKP 2V53A 1YIJP 1CFDA 2I94A 1L0NE 1WY9A 1Q82Q 5CCHD 4INXA 1NIWA 1E79H 2A06D 5FYXA 3V2NA 2ZRSA 2OTJP 1AV1A 1IFMA 2M1UA 2Q3EA 3BVHA 4YPCA 1GL2B 5CJ0A 4IL6X 1VQNP 1LT1A 2N9YB 1JY2P 1BODA 1KILE 1BCCJ 3H1JJ 3O8ZA 1EDIA 2R44A 1XFZO 1SQVD 2FYNB 3QWOC 2P71A 3KO0A 4YGBB 1LTAC 1NYAA 3L70E 4H0LB 2ZNDA 5I2OA 1MFTA 3IAOA 4U3FE 2WT7B 3PH0A 3EK4A 2H61A 2FCDA 5B5EH 4XYNA 1DELA 2OARA 4HKZH 3FE6A 1FBMA 1RE3C 2M8RA 1Y6WA 4W80A 1XFUO 5E79H 3CX5I 5AW9B 5M1BA 1H8AA 2BL0B 1W7IB 3V6IA 2I18A 2WCJA 3U1AA 1OW4A 1ALWA 2WVRA 1DF0B 1GK4A 2A06G 1NTMG 4E68A 4AQRD 3CR4X 1CDLA 2L4HA 2IZ1A 2BE4A 4WRIA 1VPCA 5AXIA 1J7QA 4WY4B 2NPSC 4BXLA 1VDFA 2Y5IA 1QVIZ 5TNCA 1H89A 2JP3A 4PD4I 1HGZA 2Q3IA 1PGPA 5KKZB 1FBVA 1C07A 1B8CA 2H2KA 3PSRA 3EQ2A 2Y0CA 4BWNA 4Y28J 4WY4C 3OB2B 4YGDB 1T3UA 1C3ZA 3JC22 3H32B 5APYA 3AE8C 1F70A 2E74D 1KWOC 1SQVG 3H1IJ 3IQOA 3FWBA 4M2QA 1FDOA 1YTZC 3SFEC 1IQ3A 1Z2CB 2JO1A 3O78A 3D6YA 1X79B 1L4AC 5KJ7C 3CX5D 2NCPA 2FFDA 1H0TA 1NTZE 1PL5A 4W7YA 1HUCA 1YUSA 2YO2A 4PE0A 3S0EA 3VMAA 4WB4A 1KQGB 1BR4B 1BGYG 4UB6H 5AANA 1KILD 2K9JB 2AXCA 4PHJA 1DH3A 2CTNA 1TRFA 2OYIC 4F0ZB 1NTKD 1KK7Y 2R3SA 3R1VA 3SWYA 1N2DC 4GNKB 4IFFA 2L0PA 2C9NY 1GL2A 3P7KA 2HPCA 1MHOA 1QL1A 1YQ4C 5BVZA 1L4AA 1SFCB 3GLMA 2LVJA 1LTSC 2WT7A 1AVYA 1OZHA 1PP9D 2VRGA 3HUSC 3EK8A 2K0JA 2LNKA 1XFXO 2WNDA 2LLSA 2FXPA 4JKTA 5KLIB 2ITAA 2RH0A 1ZMEC 3FGAD 3R4YA 5TISE 2JQ6A 4RESB 3D75A 1EZVG 3VYIA 4D6TE 5FI2A 2E5TA 2WPSA 1ZACA 2JTZA 3L47A 1N7SB 1CLMA 2B9BA 1KZUB 2H61C 1CFCA 3AEAC 1IIOA 1AA0A 2LMUA 1BJFA 1KCYA 3FIAA 1ZMZA 2KI4B 1SQXJ 1OFCX 4KJMA 2IBZE 3A0HH 1UIXA 3K1EA 2HR3A 1CLBA 4NPFX 4BRYA 3H1IG 4TT3H 1CNPA 1SQVJ 1KILC 4MZLA 3CCQP 2FYUE 2KBIA 1T8ZA 3P8MC 2KOTA 4I7ZC 1NGMB 2QACA 2LR2A 5AVQB 2P6BB 2MLFC 3AE9C 1FW4A 1SQPK 5PALA 2W83C 3AE4C 4C7NB 4I5LB 2KP8A 4B86A 3D10A 5I94A 1KILB 2QSIA 3RK3C 2WC8A 3A5TA 3WNXB 3SFDC 1QGKB 1LT9A 1SQPG 3AKBA 3CC2P 3U1CA 4HSZA 1N0YA 3V5BA 2KSEA 4IL6E 1Q90D 2ISDA 3L72D 1IH0A 3CL3D 2O1JA 3SG6A 1TNPA 2CXJA 2L2CA 1L2OC 3D0YA 4GOFA 1L7ZA 1L0LD 1NTMD 3NHIA 1OWAA 2KI4C 4MRYA 4MZKA 2Q6QA 1Y1UA 1N8RQ 5AVYB 4PV1C 3OHMB 2OYHA 3JTDB 4AYCA 1OMVA 1LT9C 2RN0A 1NX0A 4XE5B 3P32A 4PDZA 2KFHA 3A7OA 1A03A 2N1TC 3AE5C 3G3ZA 1OSAA 1SQBE 2M29A 3LK0A 4PCWA 2L4IA 2R2IA 2WC6A 5AVXB 3DVKA 2KNEA 5AVSB 3OX5A 3V4QA 1A2XA 5IBWA 1QATA 2NZ2A 1KFXL 1HBWA 3TSIA 1SSEB 3L4AA 4WQ3A 5AVWB 3EFGA 1VQ5P 3WHUB 3PJSK 1K95A 2ZXXA 2LM5A 3I5FC 3VP8A 4XFJA 2FYUJ 1GZLA 3WUVA 3O2PA 4ZCUA 1NTKJ 3RK3D 4BRYB 1R2UA 1KYOE 2PGDA 3S0FA 1BR1B 1KQMC 1SFCD 3FS7A 3HE5B 1TOPA 5KLVG 1T2KC 5HKWA 1SQXE 1BSHA 3AE6C 3D78A 1SQVK 1YUTA 1GM0A 1H88A 1JBAA 1KB9I 5APTA 3CGAA 1LA3A 5KSZA 3IF7A 3OW2O 3TUYC 1FI5A 1M8OB 5AFPA 1BDDA 3BCCE 5B66E 5J3XA 3NMDA 5AW1B 3VRQA 1QLSA 5AW7B 1NTKK 3BUXB 1DJIA 2OTGB 2LHIA 1T14A 4L76A 3PN7C 2FYUK 3M0DC 2WQYC 1SCVA 1BDCA 1Q7YQ 1R6PA 1IWQA 5CCGD 2BCAA 3CCJP 2BBMA 1SQPD 4YGEB 1D7MA 4A4BA 2KSPA 3HCMA 1K05A 1NTMJ 5BU5A 2WCFA 2G2BA 1J1DB 1TNWA 1CI6B 2Q7CA 4DIRA 1AVSA 4ZNCA 4NDDA 5APQA 4JF7A 4PHMA 1XFRA 3B86A 2BBNA 1ZV8A 3I5HC 3EG5B 3B6XA 3H1LE 3PJIA 2COLB 1VQ6P 3B5NC 1UHHA 3VRNA 4PV1D 2Q91A 4C0KA 3BUWB 1B4CA 2H89C 1SK6D 2KOGA 1K9UA 2OQQA 3HD7B 4H44B 1NCZA 4C46A 1KD1Q 4JPZB 1PVAA 2F2OA 1BCCG 3H1JG 2JT0A 5HLVA 2M49B 1IKUA 4YGAA 3Q5RA 2HQWA 2KAYA 2O01H 3L70G 3TGUJ 4U3FG 3DVEA 5APUA 1JCDA 4R1EA 2E76D 1JFKA 2ZYAA 2FJYA 3PLFB 4H44D 3LIDA 2K88A 4MRXA 2LVVA 2NXQA 2YXQB 4PJ0H 1SVFA 1LTJA 1JC2A 4R4LA 2OTKE 2HQ8A 1M1KQ 3HD7A 1NUBA 3I5IC 2A06E 1W7JB 3L74E 4GPLB 1VQ8P 1B1GA 4OR9B 1ZP0C 5AW6B 2E30A 1B7TZ 1M7LA 1JY3O 3BUOB 2QJPB 2ZYGA 1PVBA 1WRKA 2LKMA 3M9BA 3O6QA 1PZQA 1NYHA 1S5LE 2IBZI 1YQ3C 3CCEP 1P84E 3Q5SA 5AW3B 1YURA 1PP9G 3BOWB 3GHGA 1DQEA 3S0DA 2KZJA 1A4PA 1OW8A 2M5AB 1GTWA 4PHNA 2HYNA 4GBAA 1B9AA 1F54A 1YX8A 1VQPP 3FWCA 1Y8AA 2WSEJ 3I5CA 5EFWB 3CZ2A 1CDPA 1OIPA 3SIAA 1EH2A 3BQ3A 3GHGB 3KPXA 5KAFH 3RL0g 3HE4B 1KYOH 1F4OA 2LVKA 2ZT9B 3VN0A 3DF0B 4RJTA 1UUSA 5HKZA 2N1TB 3L70J 3OP0A 4MZJA 1VQLP 4WY4D 1CKKA 1FE6A 1NCYA 3EFFK 1BE3G 1IZNB 1NU1G 1N65A 2WPVB 1K73Q 1YUUA 3KPEA 2JOJA 1PV3A 1JF2A 2MA2A 1W5CE 1X02A 2J5UA 1TN4A 5HKYA 2YGUA 1MUXA 3MUDC 1MWNA 3V2QA 3W68A 3DZTA 3TGUE 2DW3A 3PHLA 1F55A 2I1KA 1HWTC 1XO5A 4ASWA 3HE4A 4MLWA 1RH5B 2POHA 1NSHA 3B87A 1KFMA 3L71J 1JTHB 1UHJA 3ZNIA 1X0TA 2IDBA 3LL8B 2HPCB 1FDIA 3FX0A 1S5GY 3RLZA 3GMAA 3VROA 3BFBA 1ZLLA 1WRGA 3M9QA 1RWYA 1KSOA 3VGOA 5KJ7A 2B1UA 2F8PA 2PRUA 1BGYD 3CPWO 3VP9A 4U3FD 5CSNA 4D6TG 2GV5A 1AFOA 1FC2C 2I8DA 1OOIX 4Y99B 1SL8A 1N73B 5CSFA 1JO5A 3CABA 1NTZJ 3I56P 2FCEA 3UNWA 5E79E 4ZMDA 5KKZC 2YNYA 1XYDA 1MZ9A 3PP5A 2CPSA 1LT9B 2Y9ZA 5AW2B 4P2YB 5I2QA 1EC5A 2GA1A 5B5EE 3M91A 2FYUG 1NP8A 1A75B 1FI6A 1K94A 2PQLA 2JWWA 4LC1A 4JYCA 3VMXA 5BU8B 1OMRA 4AQIA 5JOLA 2M3BA 4HYTB 3U59A 3T97A 4EYYQ 2M97A 1IK7A 2LCPA 2Q4UA 1A75A 2PMYA 2ZFCA 1SY9A 1RQVA 2KZIA 1YR5A 3OBVA 3LCPC 4ORAB 2LUXA 1FOSE 3A0BH 1K90D 1EG4A 3D77A 1PPJD 2OTLP 5CHXA 2KYVA 2E75B 3L37A 1UWOA 1JNMA 2KK7A 3CC4P 2JULA 3S0BA 1PALA 3DXLA 1LXFC 4C7RA 1DD4A 3SG7A 1TNQA 3MZWB 4H13C 2BASA 3PLNA 3JVTC 3LIEA 1J1EA 3CXHD 1QS7A 5CCHA 1YJWP 3K5BA 3AAJA 3L75G 1DX7A 1M57D 2IBZD 5I2LA 3D73A 1J55A 1AUIB 1NHLA 2ZAEB 4DUQA 4EOTA 3AECC 3CS1A 2R3CA 1LP1B 3S9OA 1XK4A 2JZIA 3OX6A 1NTZD 3CXHI 3MIWA 4H13B 2OYIB 1KTMA 1N7SC 3M9HA 4CFQA 2SASA 3CLNA 2BCCG 2L98A 1XTGB 2PASA 2GM4A 2JWDA 2O3JA 2TN4A 3EKJA 4HRHA 2E75C 1TCFA 2V4HA 5KLVE 2BEQD 1CTRA 1NVOA 3AE7C 1SQXG 1AQTA 2O5GA 2C0XA 2K9YA 1VF5D 2OYIA 2P58A 3A3YB 3L72G 3CX5H 3I5FB 2RKLA 3OGNA 4M3LA 2YKQA 2PVBA 2AEMA 5TJHA 5I8NA 2H8PD 3C1VA 3R1OA 2HFED 2WCKA 3HUSA 1F4QA 1QLKA 1RTP1 4BY5A 1D1OA 4IFMA 2KNCA 2F2PA 3TS5B 1OMIA 5AVRB 1SS1A 4GKGA 3EVRA 4PHKA 3RL0D 3B5ND 1DJWA 1SRAA 2LC5A 2I7AA 1HGVA 4DJGA 1L0LK 3GHGC 5CMZA 3CD6P 1K9PA 2AAOA 2KFGA 2Y9YA 2ZT9C 1IJ5A 2A4JA 1GU4A 1SQQJ 4FTGA 1FZCB 2NRGA 3H1ID 1L4AB 1SFCA 1DF0A 4YGCB 1SL7A 2GTEA 3A8RA 1SQBJ 3B88A 3H1LG 2K8MB 2KHNA 2P10A 2W90A 1GGZA 1KFUS 2R5DA 1E8AA 1OOJA 1G2CB 1Z56A 3H1KJ 1PFIA 4GT1A 1UIIA 1URQA 2A45G 2H8VA 3O4YA 1PSBA 1BCCE 3H1JE 4YI8A 1NU1K 5D3OA 2PP6A 4C7NA 1LWUC 4PD4D 1EZVD 1NOHA 4OGQC 2H43A 1YTZT 1PULA 2DOQA 1Q86Q 3MSEB 3BASA 2WCEA 3HX4A 1SR6C 2A45H 3RK2C 1K9KA 2BECA 1NTKE 2M5AA 1MF8B 1L4AD 4NDBA 3NXSA 2ZJSE 1M39A 2NLNA 4R4MA 4ZKUA 2LMVA 2FYNC 3KHUA 2AXTE 3MP7B 1VQ4P 1ODBA 4MSPA 1SL9A 5GTHH 3NSIA 3VOPA 1DC1A 3L71D 1DJGA 4NQGA 1HJBA 2ERBA 4OWFA 4Y99C 1N73C 2KI6D 4HRGA 4D6TJ 1S72P 1HJ0A 1VQMP 2KUBA 1CDMA 2QJYC 1RECA 5DJTB 5K5GB 1ZN5A 3RL0C 1PP9E 3JSVC 3HUSB 3Q1MA 1IFPA 1LTIC 3E7KA 1OVUA 3GW6A 5AVUB 2WMMA 4N1GA 2QM7A 3EKHA 2KYCA 2LLUA 1OOFA 1U57A 2CK3H 3BOWA 3CMEP 3L71G 1QIWA 2FJUB 3HTKB 4IOIH 1ZR2A 2XKMA 2HETA 2Z5IA 3TDUA 2QJPC 1QVFO 3CWBE 3VRRA 2O01N 2LE9B 4QMAA 1X22A 1KQFB 1KORA 2HF5A 3CCUP 2KB7P 4GGFA 3WU2E 3M06A 1M31A 5DICA 1K04A 3CXHH 5ER5A 1HQVA 3ZDMA 2L2EA 2FFDC 4H0LD 1BE3E 1EDLA 1E5WA 1FZCA 1NU1E 3H1HG 2ZYDA 2K61A 3DVMA 2OGUA 5DKNA 3KF9A 1P84D 2XU6A 3H1KD 2ZN9A 1RF1B 1U5IB 4INWA 1FJPA 1CLLA 4K35A 3P8CD 3RK3E 1AK8A 3WUTA 2N9BA 3DYEA 2BAPA 1KYOD 3AEGC 3RGUA 1EDKA 1XFVO 3CCSP 1RF1A 1PP9J 2JT8A 4MN0A 2D2CB 5H2FH 1WT6A 4IL6H 1OW7A 1GW4A 3B5NA 3NFQA 5KLVJ 2L5XB 2B87A 1BF5A 1QVGO 2O01J 3IN6A 3P8CE 5KLIC 4MEWA 1KK8B 1Z4HA 3GK1A 1Q81Q 2RGIA 2M9GA 1FPWA 4PE4A 3VMZA 1P28A 3KEVA 2QJKC 3C8VA 2LAPA 1MV8A 5AERA 1UP5A 1S26D 1L0LE 1OZOA 1IFDA 1NX2A 4H0LC 1LTJC 3DF0A 3BRTB 2JDIH 3SS4A 1URQD 2N1TD 1C7WA 1NCXA 1B7TY 1TCOB 1S5LH 2WWWA 3CWBJ 3L74D 3KXDA 1SQQG 3A2AA 2WSFH 3G71P 3TDKA 1WRLA 4EDFA 1QV1A 1KB9H 3G6EP 1R5SA 4OCIA 1UURA 4DOJA 3VMYA 1HT9A 1EQ7A 3VRPA 3ABVC 2K60A 4LLHA 1H4BA 3WUUA 5AW8B 4K3AA 2IBZG 3NTNA 2JT3A 2E74C 2H88C 3OAKA 2MKVA 1RF0C 1JMBA 2LUCA 5GTIE 2PSRA 1GMJA 1QX2A 1YYCA 1Y47A 1IJDB 1BMOA 3CCLP 1K8UA 2K3RA 3AEBC 2B88A 1DEEG 1DTLA 5G08A 3BYAA 5FI6A 3L35A 2QEBA 1FJKA 1W2EA 2MRDA 2A45I 1JMMA 2JNFA 3KZIH 1IFNA 1M63B 3Q5PA 2Y0DA 3CCRP 3L75E 2O1KA 2OTGC 1OQPA 2QJYB 4MVFA 3CZTX 2O60A 3JTDC 1MR8A 1L0ND 2R5BA 2KAVA 2WCHA 1JF0A 2KFFA 1KMIZ 2CNPA 3KHEA 1AJYA 2GUSA 1G4YR 1RF1C 4I5KA 1UHNA 1LP1A 1T6AA 3SG3A 2YMKA 1LNQA 2M7LA 3CYZA 3PFVA 1YX7A 1K9MQ 5TISH 2WPQA 3L73G 1DJYA 1FZEA 1XTCC 1XVJA 3BCCD 3H1KG 4RO0A 3GOFA 4ICBA 2YO3A 4GGNA 3FXEA 2FYUD 1FS0E 1R5LA 3CWBD 1NO4A 1PK0D 3L74J 2I2RE 4XJKB 2JJLA 3I55P 1SQBG 4C0JA 2FFDB 3K21A 2IFMA 5KAIE 2GGMA 3L72E 3CTNA 3DD4A 2OS8B 4KT0J 3GF7A 1OE9B 3SS5A 2FXMA 2QRXA 3AKAA 2I1JA 3RK2B 1CMFA 1S9KD 3D6ZA 5B8IB 3DY9A 2KLVA 4CIDA 1BT6A 4JQ0D 3C1LA 1FAVA 2L91A 1N7SA 2KXPB 2K37A 3CX5E 1KQLA 1NKZB 5GQQC 1C7VA 2K9JA 1Y1AA 1SW8A 3TK1A 3RK3B 1TUZA 2QE7H 3IF4A 3SSUA 1N73A 1JY2N 2BNXA 2KS1A 2HODA 1NWDA 1PGJA 1RK9A 1EXJA 1BGYJ 3V4WA 1TNXA 3LLEA 2JR8A 4USLA 2C0WA 1JOCA 1Y9BA 1LTBC 1L2OB 1X8YA 1IO4A 4TLFA 2M0RA 4OVNF 5KTYA 3JCUH 1AVOA 2Y1MA 1W9ZA 3L73D 2WPRA 2WTYA 5AEQA 1FZAA 5DJUB 3L4LA 2ZNEA 2Z5HA 2WCBA 2G9BA 1GGWA 2LLTA 1QLED 2HG5D 2BEZF 1B8LA 2KS1B 3H25A 1SCMB 5KJ7D 3V2RA 1MXLC 3RBZA 2AEFA 3AE1C 3S4RA 2L5YA 3CI9A 5JJGA 3RZSA 4N78E 3QMEA 4YRUA 3FWNA 1K96A 3B5NB 2Q5UA 1JUOA 4M2OA 1RHZB 2G8YA 4HH2A 1YRUB 1JUNA 1KB9E 1YVLA 1TUJA 4DCKA 3B71A 1VL2A 1OX3A 3NHTA 1JY3N 1IG5A 1DJHA 1KQVA 2K2AA 3V2PA 3SIBA 4AQJA 5HYDA 1M45A 3F5HA 4I7ZB 1SQVE 2BE6A 1S4XA 2M1KB 2VRSA 4A4CA 5ER4X 1NWQA 2YIUB 4DRWA 3PATA 1JEKA 5DKQA 1SR6B 2AXTH 1FZGA 1RE3A 3I5GC 4JYBA 4XJKA 1FZCC 2L50A 1YJNP 3BFHA 1NKNA 1G8IA 2QEXP 1MXEA 1NX1A 3IVTA 1A29A 1YJ9P 1HTLC 1QL2A 1KILA 3SG4A 1BGYE 5CSJA 2CT9A 3BATA 3KZIE 1AHRA 2P2UA 1S1EA 2MHHA 1XFYO 3A0HE 1QEXA 3ICBA 3L71E 2LMTA 3CWBG 1VQ7P 2E5YA 1RQUA 5F6TA 2G3AA 3L74G 5AW5B 3M0WA 1ZW0A 1P84I 4FQTA 3WMM0 4Q04A 1ZR4A 1SQXD 2K2FA 1DVIA 3SWKA 3L73J 2ZXEB 5K89A 2ZT9D 2XNXA 3L70D 1IFIA 1UHIA 2J59M 1CFPA 2CPBA 1BCCD 3H1JD 3G9RA 2FYZA 2E74B 2JTTA 5CCHC 3HRNA 2K7DA 4IL1A 3H4SE 1ALVA 1M46A 3D76A 3ZWHA 1LGHB 1RROA 4ASVA 2KQYA 4FQOA 4ZKPA 3R1PA 1Y1XA 1HVVA 4OGQD 3UIAA 1VF5B 4GODA 3IR9A 2BCBA 1DGUA 1ZUZA 5DKRA 3AEFC 3H1IE 3W67A 3CLQA 4OV2A 5HLOA 1TTXA 4I5NB 3GF3A 2FBWC 2BL0C 3CCMP 1K8AQ 3OB1B 2IYOA 2JC2A 1FZBA 2C9LY 2F33A 3HE5A 3JCUE 1H0TB 2PAJA 1IJ6A 1J1EC 2QEVA 1S3JA 1MQ1A 1HH0A 2KYFA 2F3ZA 1JM0A 2UWJE 4U3FJ 3TGUG 2B87B 3Q8IA 4GOEA 2YKPA 4QJ3B 1GJYA 2XDJA 2R32A 1IQ5A 2WORA 1A02J 1LS8A 1KC8Q 1T3JA 2IYPA 1N7LA 1SQQK 4C0LA 3EVVA 2W8ZA 5FI7A 2BCCD 4WQ2A 1GK6A 3OJAB 3KYQA 1F71A 1MUUA 1NU1J 5EL2A 3F89A 4UB8E 1S6CA 1KFNA 1M1JC 3SG5A 2KSJA 1WDCB 3BXKA 3V2LA 3KQGA 1KFUL 1SYMA 4MN4C 2JRFA 1U5IA 3L75D 1FF1A 2WITA 2KPHA 2KI7B 1WMKA 3AEEC 1LWUA 1DJXA 1PIXA 1XFWO 3GK4X 1UHKA 4H44C 2M3WA 1PGQA 3M0AA 3BJHA 3QRXA 2Q9IA 1CW5A 3PM8A 1S9KE 2OYHC 1KFXS 1AP4A 1V1FA 1YI2P 3OA7A 3NXAA 1FDMA 1SMGA 2WSEH 1J7PA 1L0LJ 1QJTA 2W6BA 3WU2H 4HB1A 4ORCB 3JVTB 5AVZB 3CXHE 1PPJG 1CDNA 2WSCH 2ZN8A 3N7NA 1QVIY 3UO9A 4UPGA 1K93D 1NPQA 5L8RJ 4GFTA 1YBKA 5CBOA 2ZVOB 1LTJB 1OVRA 2ZFDA 2K7OA 5KTBA 3VTPC 1VRKA 3PALA 1DJZA 1SQBD 2W6JH 3S0AA 4EIJA 4GAOA 1LINA 1KQSO 1PGOA 3TDIA 1DIPA 2CBLA 3FE9A 1RY3A 1M56D 1AQ5A 2XZRA 1WLMA 4KYNA 2NPSA 4RKUJ 1S6JA 3BCCG 3H1HD 2JPTA 1DGVA 3USSA 1KQMB 1S2EA 4DZOA 4JWQA 2QM8A 1QV0A 1CI6A 3CMAP
chains in the Genus database with same CATH topology
1N65A 3I5IB 3KO0A 1YUUA 4YGBB 1NYAA 2JOJA 1JF2A 2MA2A 1WRLA 1X02A 1TN4A 2ZNDA 5HKYA 1LA0A 1MUXA 1Y0VH 3BUNB 1MWNA 2KBMA 3TUYB 1CMGA 1QV1A 3EK4A 2H61A 2FCDA 4OCIA 1SCMC 1F55A 1UURA 4XYNA 1XO5A 1Y6WA 4MLWA 1QTXA 1NSHA 1XFUO 2GGZA 1HT9A 2BL0B 1J7OA 1W7IB 3VRPA 2JU0A 2I18A 1ALWA 1UHJA 3ZNIA 1H4BA 1DF0B 1TIZA 3LL8B 4U8DA 4E68A 2JT3A 3CR4X 1CDLA 2L4HA 1S5GY 3RLZA 2BE4A 4WRIA 4ZCVA 3VROA 5AXIA 1J7QA 2LUCA 2PSRA 5D7FA 1QX2A 1RWYA 2Y5IA 1KSOA 1QASA 3VGOA 1QVIZ 3NSLA 5TNCA 1JWDA 4ORBB 2B1UA 2F8PA 2PRUA 4TNCA 1BMOA 1K8UA 1FBVA 3O6BA 1C07A 1B8CA 1DTLA 2H2KA 5G08A 5CSNA 3BYAA 3PSRA 1N2DA 2GV5A 2MRDA 3CR2A 1KK7Z 2JNFA 1SL8A 5CSFA 2MBXA 1M63B 2AMIA 4QJ4B 3OB2B 4YGDB 2OPOA 1GQMA 2OTGC 1OQPA 2FCEA 1OMDA 4MVFA 1F70A 1KWOC 3CZTX 2O60A 1XYDA 3JTDC 1MR8A 1K2HA 1WLZA 3IQOA 2KAVA 5BPJA 2QPTA 1JF0A 3FWBA 4M2QA 2Y9ZA 1YTZC 1IQ3A 2KFFA 4P2YB 2Y1NA 5I2QA 2CNPA 3KHEA 1G4YR 1EG3A 2JNXA 1G33A 1UHNA 2SCPA 4I5KA 3O78A 3D0YB 3SG3A 2NCPA 1NP8A 1A75B 2M7LA 3PFVA 1FI6A 1K94A 1YX7A 3WXAA 2JWWA 1DJYA 3NSKA 1XVJA 1YUSA 4PE0A 3GOFA 4ICBA 1JSAA 1BR4B 4GGNA 5AANA 1OMRA 4AQIA 5JOLA 4HREE 1XA5A 4PHJA 1BLQA 1PK0D 2CTNA 1BU3A 1TRFA 2I2RE 2M97A 2WOSA 4XJKB 4F0ZB 1KK7Y 2LCPA 4GNKB 3DVJA 2L0PA 2Q4UA 1A75A 3K21A 2PMYA 4C0JA 4DS7A 4CLNA 1MHOA 1SY9A 2GGMA 1YR5A 2LVJA 3CTNA 3LCPC 2E6WA 3DD4A 2OS8B 4ORAB 2LUXA 1OE9B 2VRGA 3AKAA 1K90D 1AJ5A 3EK8A 1EG4A 1CMFA 1RJVA 5B8IB 4CIDA 1BT6A 2KDHA 1UWOA 4JQ0D 2EHBA 2K0JA 1XFXO 2LNKA 2WNDA 2LLSA 1NX3A 5GQQC 1C7VA 1KWOB 4PE7A 2JULA 1Y1AA 1SW8A 1PALA 1LXFC 3CWGA 3F45A 2JQ6A 3A4UB 3SG7A 2BCXA 1ZACA 1NWDA 1TNQA 2JTZA 1PSRA 2PALA 1QX5B 1RK9A 1CLMA 1TNXA 3LLEA 1S6IA 3JVTC 4USLA 2H61C 1CFCA 1J1EA 1QS7A 2LMUA 1BJFA 3AAJA 1L2OB 1KCYA 5I2LA 2M0RA 1J55A 4OVNF 1AUIB 3FIAA 5KTYA 4DUQA 1ZMZA 2Y1MA 2KI4B 1OFCX 3CS1A 1XK4A 5AEQA 2ZNEA 2JZIA 2WCBA 1CLBA 3OX6A 2G9BA 3SJSA 1GGWA 3IQQA 2LLTA 4CFQA 2SASA 3CLNA 1B8LA 2LANA 1CNPA 1SCMB 2L98A 1IRJA 2PASA 3NSOA 1MXLC 1SBJA 4MZLA 1AJ4A 2NZ0A 1B47A 2KBIA 1CB1A 2KOTA 2LP2A 5JJGA 3LK1A 1QXPA 2MJWB 2QACA 2TN4A 3EKJA 4YRUA 3BUMB 1K96A 1OZSA 2P6BB 1JUOA 1ZOTB 2MLFC 4M2OA 1YRUB 4HRHA 2FOTA 1FW4A 1EJ3A 1TCFA 5PALA 1YVLA 4DCKA 1IG5A 1DJHA 1CTRA 1QX7A 3I5GB 3D10A 4I5LB 4N1FA 1V1GA 2K2AA 1KQVA 2O5GA 3SIBA 2K7BA 4AQJA 2WC8A 5HYDA 1M45A 3E3RA 5KU1A 3CR5X 2LVIA 2LV7A 3RM1A 3WNXB 3SG2A 1EL4A 2BE6A 3I5FB 2M1KB 3AKBA 4L9MA 2PVBA 4HSZA 2JXLA 4A4CA 5ER4X 4YBHB 1SKTA 1N0YA 1RFJA 4DRWA 3PATA 5I8NA 2ISDA 3C1VA 2MLEC 2EC6B 1IH0A 5DKQA 3AAKA 1F4QA 1QLKA 1RTP1 1SR6B 4BY5A 1D1OA 3I5GC 3SG6A 1TNPA 2CXJA 1B8RA 4XJKA 1L2OC 1WRZA 3D0YA 1L7ZA 2F2PA 3TS5B 2L50A 2KAXA 4M2PA 1G8IA 1Q80A 1MXEA 2KI4C 1NX1A 4MRYA 4MZKA 1Y1UA 1A29A 2NCOA 3EVRA 4PHKA 3OHMB 1DMOA 1DJWA 3SG4A 3JTDB 5CSJA 1SRAA 2CT9A 2LC5A 2I7AA 1OMVA 2LP3A 1NX0A 1AHRA 4PDZA 1K9PA 1S1EA 2AAOA 2KFGA 1XFYO 2KFHA 2MHHA 2Y9YA 1A03A 1IJ5A 2A4JA 3ICBA 1OSAA 1KSMA 4CPVA 4FTGA 2M29A 3LK0A 4PCWA 3TS5C 2LMTA 2L4IA 2R2IA 1DF0A 4YGCB 1SL7A 3DVKA 3A8RA 2KNEA 3OX5A 5F6TA 2K8MB 1A2XA 2HPSA 2KHNA 3EVUA 5IBWA 1GGZA 1KFUS 1QATA 3M0WA 1KFXL 4YI9A 1YVHA 1E8AA 4GGFC 1OOJA 4WQ3A 4OKHA 4Q04A 2MAZA 2K2FA 1DVIA 1LVCD 3WHUB 3O4YA 5K89A 1PSBA 1K95A 1H8BA 2LM5A 3I5FC 4YI8A 1YRTB 1UHIA 1PRWA 1CFPA 2EGDA 3O2PA 4ZCUA 2KGRA 1R2UA 1PULA 2DOQA 5I2OA 3MSEB 1BR1B 1KQMC 2AUCA 2JTTA 2KQ6A 1SR6C 2WCEA 3HX4A 1K9KA 2K7DA 3FS7A 2BECA 4IL1A 3EK7A 1CFFA 1MF8B 3H4SE 1ALVA 2CCMA 1TOPA 1S36A 1M46A 4NDBA 5HKWA 1CM1A 1M39A 2NLNA 3ZWHA 4AOMA 4BY4A 1RROA 1LKJA 2LMVA 3PN7B 1F8HA 1YUTA 5CSIA 2KQYA 4FQOA 1JBAA 1ODBA 1LA3A 1Y1XA 3CGAA 3IF7A 4MSPA 5KSZA 1SL9A 3TUYC 2Y4QA 1FI5A 3NSIA 5AFPA 1DJGA 4NQGA 5J3XA 2BCBA 1DGUA 1ZUZA 2KI6D 4HRGA 5DKRA 3VRQA 1QLSA 1CM4A 1TTXA 4I5NB 4MBEA 4OV2A 5HLOA 3BUXB 1J7RA 1DJIA 4PE1A 1CDMA 2OTGB 2BL0C 2KI6C 4QJ5B 2LHIA 1RECA 2ZRTA 3PN7C 3OB1B 2JC2A 2BKIB 2F33A 1SCVA 2M8UA 1R6PA 1IWQA 2BCAA 1IJ6A 2BBMA 4YGEB 4A4BA 2KSPA 1MQ1A 2KYFA 2F3ZA 3HCMA 4N1GA 1SNLA 2WCFA 3EKHA 2G2BA 3GK2A 2KYCA 1TNWA 2LLUA 1BOCA 4QJ3B 3BOWA 1GJYA 4DIRA 1QIWA 1AVSA 2FJUB 4NDDA 1ZFSA 2HETA 3TDUA 1IQ5A 1JFJA 4PHMA 2WORA 2BKHB 1DT7B 3VRRA 2LE9B 1WDCC 2BBNA 3I5HC 1SPYA 4C0LA 2COLB 2HF5A 3EVVA 1UHHA 3VRNA 4GGFA 2Q91A 2K7CA 3BUWB 4C0KA 2IS9A 1B4CA 4WQ2A 1M31A 1QIVA 1S5GZ 1SK6D 1HQVA 5ER5A 1F71A 1K9UA 2L2EA 1NCZA 5D69A 4JPZB 1PVAA 1S6CA 2F2OA 4NDCA 2JT0A 5HLVA 3SG5A 2M49B 1IKUA 2K61A 1EXRA 4YGAA 2M7NA 2HQWA 3DVMA 1WDCB 3BXKA 2KAYA 1KFUL 1SYMA 5DKNA 2JRFA 3KF9A 1U5IA 1BG1A 3DVEA 4ETOA 4GUKA 3WHTB 1FF1A 2ZN9A 4R1EA 1JFKA 1U5IB 3PLFB 1CLLA 5CPVA 4MRXA 1DJXA 2JXCA 2LVVA 2EC6C 1XFWO 2NXQA 3GK4X 1UHKA 2LHLA 2M3WA 1S3PA 1AK8A 1JC2A 3QRXA 2F3YA 2HQ8A 3PM8A 4I5JA 2L51A 1NUBA 3I5IC 1KFXS 1W7JB 4GPLB 1AP4A 1V1FA 1B1GA 3TDZA 3TZ1A 4OR9B 3NXAA 1XFVO 2ZKMX 1SMGA 2E30A 1J7PA 4P5OE 1QJTA 1B7TZ 2JT8A 4MN0A 4ORCB 3JVTB 1KK8C 1CDNA 2ZN8A 1QVIY 3BUOB 1PVBA 1WRKA 4CFRA 4N5XA 1IGVA 2OS8C 4UPGA 1K93D 3I5HB 1NPQA 2L5XB 1J1DA 4GFTA 1YURA 1BF5A 3BOWB 2ZFDA 1XK4C 2K7OA 2D8NA 4D1EA 1VRKA 3PALA 4PALA 1A4PA 1DJZA 4MEWA 1KK8B 2KGBC 3GK1A 2RGIA 2M9GA 1FPWA 4PE4A 2V53A 4PHNA 4GAOA 4GBAA 1LINA 1B9AA 3KEVA 1F54A 1CFDA 2I94A 1YX8A 3TDIA 2LAPA 1WY9A 3FWCA 2CBLA 5AERA 1NIWA 5FYXA 1CDPA 1UP5A 1S26D 1WLMA 3SIAA 1EH2A 1OZOA 3BQ3A 1NX2A 2ZRSA 1S6JA 3KPXA 3DF0A 2JPTA 1DGVA 1F4OA 2LVKA 2M1UA 1KQMB 3DF0B 1C7WA 1UUSA 1NCXA 5HKZA 3OP0A 1B7TY 1TCOB 4MZJA 4JWQA 1BODA 1QV0A 1CKKA 1NCYA 1XFZO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N65 A;  3I5I B;  3KO0 A;  1YUU A;  4YGB B;  1NYA A;  2JOJ A;  1JF2 A;  2MA2 A;  1WRL A;  1X02 A;  1TN4 A;  2ZND A;  5HKY A;  1LA0 A;  1MUX A;  1Y0V H;  3BUN B;  1MWN A;  2KBM A;  3TUY B;  1CMG A;  1QV1 A;  3EK4 A;  2H61 A;  2FCD A;  4OCI A;  1SCM C;  1F55 A;  1UUR A;  4XYN A;  1XO5 A;  1Y6W A;  4MLW A;  1QTX A;  1NSH A;  1XFU O;  2GGZ A;  1HT9 A;  2BL0 B;  1J7O A;  1W7I B;  3VRP A;  2JU0 A;  2I18 A;  1ALW A;  1UHJ A;  3ZNI A;  1H4B A;  1DF0 B;  1TIZ A;  3LL8 B;  4U8D A;  4E68 A;  2JT3 A;  3CR4 X;  1CDL A;  2L4H A;  1S5G Y;  3RLZ A;  2BE4 A;  4WRI A;  4ZCV A;  3VRO A;  5AXI A;  1J7Q A;  2LUC A;  2PSR A;  5D7F A;  1QX2 A;  1RWY A;  2Y5I A;  1KSO A;  1QAS A;  3VGO A;  1QVI Z;  3NSL A;  5TNC A;  1JWD A;  4ORB B;  2B1U A;  2F8P A;  2PRU A;  4TNC A;  1BMO A;  1K8U A;  1FBV A;  3O6B A;  1C07 A;  1B8C A;  1DTL A;  2H2K A;  5G08 A;  5CSN A;  3BYA A;  3PSR A;  1N2D A;  2GV5 A;  2MRD A;  3CR2 A;  1KK7 Z;  2JNF A;  1SL8 A;  5CSF A;  2MBX A;  1M63 B;  2AMI A;  4QJ4 B;  3OB2 B;  4YGD B;  2OPO A;  1GQM A;  2OTG C;  1OQP A;  2FCE A;  1OMD A;  4MVF A;  1F70 A;  1KWO C;  3CZT X;  2O60 A;  1XYD A;  3JTD C;  1MR8 A;  1K2H A;  1WLZ A;  3IQO A;  2KAV A;  5BPJ A;  2QPT A;  1JF0 A;  3FWB A;  4M2Q A;  2Y9Z A;  1YTZ C;  1IQ3 A;  2KFF A;  4P2Y B;  2Y1N A;  5I2Q A;  2CNP A;  3KHE A;  1G4Y R;  1EG3 A;  2JNX A;  1G33 A;  1UHN A;  2SCP A;  4I5K A;  3O78 A;  3D0Y B;  3SG3 A;  2NCP A;  1NP8 A;  1A75 B;  2M7L A;  3PFV A;  1FI6 A;  1K94 A;  1YX7 A;  3WXA A;  2JWW A;  1DJY A;  3NSK A;  1XVJ A;  1YUS A;  4PE0 A;  3GOF A;  4ICB A;  1JSA A;  1BR4 B;  4GGN A;  5AAN A;  1OMR A;  4AQI A;  5JOL A;  4HRE E;  1XA5 A;  4PHJ A;  1BLQ A;  1PK0 D;  2CTN A;  1BU3 A;  1TRF A;  2I2R E;  2M97 A;  2WOS A;  4XJK B;  4F0Z B;  1KK7 Y;  2LCP A;  4GNK B;  3DVJ A;  2L0P A;  2Q4U A;  1A75 A;  3K21 A;  2PMY A;  4C0J A;  4DS7 A;  4CLN A;  1MHO A;  1SY9 A;  2GGM A;  1YR5 A;  2LVJ A;  3CTN A;  3LCP C;  2E6W A;  3DD4 A;  2OS8 B;  4ORA B;  2LUX A;  1OE9 B;  2VRG A;  3AKA A;  1K90 D;  1AJ5 A;  3EK8 A;  1EG4 A;  1CMF A;  1RJV A;  5B8I B;  4CID A;  1BT6 A;  2KDH A;  1UWO A;  4JQ0 D;  2EHB A;  2K0J A;  1XFX O;  2LNK A;  2WND A;  2LLS A;  1NX3 A;  5GQQ C;  1C7V A;  1KWO B;  4PE7 A;  2JUL A;  1Y1A A;  1SW8 A;  1PAL A;  1LXF C;  3CWG A;  3F45 A;  2JQ6 A;  3A4U B;  3SG7 A;  2BCX A;  1ZAC A;  1NWD A;  1TNQ A;  2JTZ A;  1PSR A;  2PAL A;  1QX5 B;  1RK9 A;  1CLM A;  1TNX A;  3LLE A;  1S6I A;  3JVT C;  4USL A;  2H61 C;  1CFC A;  1J1E A;  1QS7 A;  2LMU A;  1BJF A;  3AAJ A;  1L2O B;  1KCY A;  5I2L A;  2M0R A;  1J55 A;  4OVN F;  1AUI B;  3FIA A;  5KTY A;  4DUQ A;  1ZMZ A;  2Y1M A;  2KI4 B;  1OFC X;  3CS1 A;  1XK4 A;  5AEQ A;  2ZNE A;  2JZI A;  2WCB A;  1CLB A;  3OX6 A;  2G9B A;  3SJS A;  1GGW A;  3IQQ A;  2LLT A;  4CFQ A;  2SAS A;  3CLN A;  1B8L A;  2LAN A;  1CNP A;  1SCM B;  2L98 A;  1IRJ A;  2PAS A;  3NSO A;  1MXL C;  1SBJ A;  4MZL A;  1AJ4 A;  2NZ0 A;  1B47 A;  2KBI A;  1CB1 A;  2KOT A;  2LP2 A;  5JJG A;  3LK1 A;  1QXP A;  2MJW B;  2QAC A;  2TN4 A;  3EKJ A;  4YRU A;  3BUM B;  1K96 A;  1OZS A;  2P6B B;  1JUO A;  1ZOT B;  2MLF C;  4M2O A;  1YRU B;  4HRH A;  2FOT A;  1FW4 A;  1EJ3 A;  1TCF A;  5PAL A;  1YVL A;  4DCK A;  1IG5 A;  1DJH A;  1CTR A;  1QX7 A;  3I5G B;  3D10 A;  4I5L B;  4N1F A;  1V1G A;  2K2A A;  1KQV A;  2O5G A;  3SIB A;  2K7B A;  4AQJ A;  2WC8 A;  5HYD A;  1M45 A;  3E3R A;  5KU1 A;  3CR5 X;  2LVI A;  2LV7 A;  3RM1 A;  3WNX B;  3SG2 A;  1EL4 A;  2BE6 A;  3I5F B;  2M1K B;  3AKB A;  4L9M A;  2PVB A;  4HSZ A;  2JXL A;  4A4C A;  5ER4 X;  4YBH B;  1SKT A;  1N0Y A;  1RFJ A;  4DRW A;  3PAT A;  5I8N A;  2ISD A;  3C1V A;  2MLE C;  2EC6 B;  1IH0 A;  5DKQ A;  3AAK A;  1F4Q A;  1QLK A;  1RTP 1;  1SR6 B;  4BY5 A;  1D1O A;  3I5G C;  3SG6 A;  1TNP A;  2CXJ A;  1B8R A;  4XJK A;  1L2O C;  1WRZ A;  3D0Y A;  1L7Z A;  2F2P A;  3TS5 B;  2L50 A;  2KAX A;  4M2P A;  1G8I A;  1Q80 A;  1MXE A;  2KI4 C;  1NX1 A;  4MRY A;  4MZK A;  1Y1U A;  1A29 A;  2NCO A;  3EVR A;  4PHK A;  3OHM B;  1DMO A;  1DJW A;  3SG4 A;  3JTD B;  5CSJ A;  1SRA A;  2CT9 A;  2LC5 A;  2I7A A;  1OMV A;  2LP3 A;  1NX0 A;  1AHR A;  4PDZ A;  1K9P A;  1S1E A;  2AAO A;  2KFG A;  1XFY O;  2KFH A;  2MHH A;  2Y9Y A;  1A03 A;  1IJ5 A;  2A4J A;  3ICB A;  1OSA A;  1KSM A;  4CPV A;  4FTG A;  2M29 A;  3LK0 A;  4PCW A;  3TS5 C;  2LMT A;  2L4I A;  2R2I A;  1DF0 A;  4YGC B;  1SL7 A;  3DVK A;  3A8R A;  2KNE A;  3OX5 A;  5F6T A;  2K8M B;  1A2X A;  2HPS A;  2KHN A;  3EVU A;  5IBW A;  1GGZ A;  1KFU S;  1QAT A;  3M0W A;  1KFX L;  4YI9 A;  1YVH A;  1E8A A;  4GGF C;  1OOJ A;  4WQ3 A;  4OKH A;  4Q04 A;  2MAZ A;  2K2F A;  1DVI A;  1LVC D;  3WHU B;  3O4Y A;  5K89 A;  1PSB A;  1K95 A;  1H8B A;  2LM5 A;  3I5F C;  4YI8 A;  1YRT B;  1UHI A;  1PRW A;  1CFP A;  2EGD A;  3O2P A;  4ZCU A;  2KGR A;  1R2U A;  1PUL A;  2DOQ A;  5I2O A;  3MSE B;  1BR1 B;  1KQM C;  2AUC A;  2JTT A;  2KQ6 A;  1SR6 C;  2WCE A;  3HX4 A;  1K9K A;  2K7D A;  3FS7 A;  2BEC A;  4IL1 A;  3EK7 A;  1CFF A;  1MF8 B;  3H4S E;  1ALV A;  2CCM A;  1TOP A;  1S36 A;  1M46 A;  4NDB A;  5HKW A;  1CM1 A;  1M39 A;  2NLN A;  3ZWH A;  4AOM A;  4BY4 A;  1RRO A;  1LKJ A;  2LMV A;  3PN7 B;  1F8H A;  1YUT A;  5CSI A;  2KQY A;  4FQO A;  1JBA A;  1ODB A;  1LA3 A;  1Y1X A;  3CGA A;  3IF7 A;  4MSP A;  5KSZ A;  1SL9 A;  3TUY C;  2Y4Q A;  1FI5 A;  3NSI A;  5AFP A;  1DJG A;  4NQG A;  5J3X A;  2BCB A;  1DGU A;  1ZUZ A;  2KI6 D;  4HRG A;  5DKR A;  3VRQ A;  1QLS A;  1CM4 A;  1TTX A;  4I5N B;  4MBE A;  4OV2 A;  5HLO A;  3BUX B;  1J7R A;  1DJI A;  4PE1 A;  1CDM A;  2OTG B;  2BL0 C;  2KI6 C;  4QJ5 B;  2LHI A;  1REC A;  2ZRT A;  3PN7 C;  3OB1 B;  2JC2 A;  2BKI B;  2F33 A;  1SCV A;  2M8U A;  1R6P A;  1IWQ A;  2BCA A;  1IJ6 A;  2BBM A;  4YGE B;  4A4B A;  2KSP A;  1MQ1 A;  2KYF A;  2F3Z A;  3HCM A;  4N1G A;  1SNL A;  2WCF A;  3EKH A;  2G2B A;  3GK2 A;  2KYC A;  1TNW A;  2LLU A;  1BOC A;  4QJ3 B;  3BOW A;  1GJY A;  4DIR A;  1QIW A;  1AVS A;  2FJU B;  4NDD A;  1ZFS A;  2HET A;  3TDU A;  1IQ5 A;  1JFJ A;  4PHM A;  2WOR A;  2BKH B;  1DT7 B;  3VRR A;  2LE9 B;  1WDC C;  2BBN A;  3I5H C;  1SPY A;  4C0L A;  2COL B;  2HF5 A;  3EVV A;  1UHH A;  3VRN A;  4GGF A;  2Q91 A;  2K7C A;  3BUW B;  4C0K A;  2IS9 A;  1B4C A;  4WQ2 A;  1M31 A;  1QIV A;  1S5G Z;  1SK6 D;  1HQV A;  5ER5 A;  1F71 A;  1K9U A;  2L2E A;  1NCZ A;  5D69 A;  4JPZ B;  1PVA A;  1S6C A;  2F2O A;  4NDC A;  2JT0 A;  5HLV A;  3SG5 A;  2M49 B;  1IKU A;  2K61 A;  1EXR A;  4YGA A;  2M7N A;  2HQW A;  3DVM A;  1WDC B;  3BXK A;  2KAY A;  1KFU L;  1SYM A;  5DKN A;  2JRF A;  3KF9 A;  1U5I A;  1BG1 A;  3DVE A;  4ETO A;  4GUK A;  3WHT B;  1FF1 A;  2ZN9 A;  4R1E A;  1JFK A;  1U5I B;  3PLF B;  1CLL A;  5CPV A;  4MRX A;  1DJX A;  2JXC A;  2LVV A;  2EC6 C;  1XFW O;  2NXQ A;  3GK4 X;  1UHK A;  2LHL A;  2M3W A;  1S3P A;  1AK8 A;  1JC2 A;  3QRX A;  2F3Y A;  2HQ8 A;  3PM8 A;  4I5J A;  2L51 A;  1NUB A;  3I5I C;  1KFX S;  1W7J B;  4GPL B;  1AP4 A;  1V1F A;  1B1G A;  3TDZ A;  3TZ1 A;  4OR9 B;  3NXA A;  1XFV O;  2ZKM X;  1SMG A;  2E30 A;  1J7P A;  4P5O E;  1QJT A;  1B7T Z;  2JT8 A;  4MN0 A;  4ORC B;  3JVT B;  1KK8 C;  1CDN A;  2ZN8 A;  1QVI Y;  3BUO B;  1PVB A;  1WRK A;  4CFR A;  4N5X A;  1IGV A;  2OS8 C;  4UPG A;  1K93 D;  3I5H B;  1NPQ A;  2L5X B;  1J1D A;  4GFT A;  1YUR A;  1BF5 A;  3BOW B;  2ZFD A;  1XK4 C;  2K7O A;  2D8N A;  4D1E A;  1VRK A;  3PAL A;  4PAL A;  1A4P A;  1DJZ A;  4MEW A;  1KK8 B;  2KGB C;  3GK1 A;  2RGI A;  2M9G A;  1FPW A;  4PE4 A;  2V53 A;  4PHN A;  4GAO A;  4GBA A;  1LIN A;  1B9A A;  3KEV A;  1F54 A;  1CFD A;  2I94 A;  1YX8 A;  3TDI A;  2LAP A;  1WY9 A;  3FWC A;  2CBL A;  5AER A;  1NIW A;  5FYX A;  1CDP A;  1UP5 A;  1S26 D;  1WLM A;  3SIA A;  1EH2 A;  1OZO A;  3BQ3 A;  1NX2 A;  2ZRS A;  1S6J A;  3KPX A;  3DF0 A;  2JPT A;  1DGV A;  1F4O A;  2LVK A;  2M1U A;  1KQM B;  3DF0 B;  1C7W A;  1UUS A;  1NCX A;  5HKZ A;  3OP0 A;  1B7T Y;  1TCO B;  4MZJ A;  4JWQ A;  1BOD A;  1QV0 A;  1CKK A;  1NCY A;  1XFZ O; 
#chains in the Genus database with same CATH topology
 2E76 C;  2OYO A;  4PJ0 E;  3H1L D;  3O4X A;  2P1J A;  3I5I B;  5CCG A;  1JTH A;  3QH9 A;  4I6M C;  4JBZ A;  2KLE A;  1LA0 A;  3BUN B;  1Y0V H;  3TUY B;  1CMG A;  2KBM A;  5GTH E;  1BE3 D;  3TNU B;  2W6A A;  2YKO A;  3FXD A;  1SCM C;  2IFN A;  2ZVN B;  2NPS B;  2K1A A;  2WCL A;  1QTX A;  2GGZ A;  1J7O A;  3LW5 J;  2QA4 P;  4I1L A;  2JU0 A;  4OH8 B;  3L36 A;  2IPP A;  4A7P A;  1RE4 A;  1KN7 A;  1LWU B;  1TIZ A;  4U8D A;  3E1R A;  4L74 A;  5AVV B;  1KYO I;  4WY4 A;  5KAF E;  1P84 H;  1GDT A;  4ZCV A;  3AE3 C;  5D7F A;  2QEO A;  3FE8 A;  1QAS A;  3L72 J;  2W27 A;  3NSL A;  5B66 H;  3MHV A;  1JWD A;  4ORB B;  3BFA A;  1N86 A;  1CZQ A;  4TNC A;  1ZOY C;  1DEB A;  3CZ1 A;  3O6B A;  1N2D A;  2P67 A;  2V7Q H;  3CR2 A;  4HJG H;  1KK7 Z;  5KLV K;  3MGN A;  2MBX A;  2AMI A;  4QJ4 B;  1SQX K;  2OPO A;  3BRV B;  3MD0 A;  3EWK A;  1GQM A;  3Q2Y A;  4WVZ A;  1OMD A;  2QEH A;  3R72 A;  4PV1 B;  1L0N G;  4OZD A;  3A0B E;  2BCC J;  1J2J B;  1K2H A;  1WLZ A;  3Q3D A;  5BPJ A;  4WBA A;  2QPT A;  1FU1 A;  1ZXG A;  2QVA A;  1IFJ A;  5HL1 A;  2Y1N A;  3T97 B;  1EG3 A;  2JNX A;  2RMZ A;  1G33 A;  2SCP A;  1ZRT D;  3TF5 A;  3PTZ A;  3D0Y B;  1SFC C;  3TGU D;  1N7S D;  3WXA A;  3L75 J;  1OOG A;  3NSK A;  3ITK A;  1RF0 A;  1JY3 P;  1GW3 A;  4Z1M H;  3PM2 A;  1JSA A;  1LJ2 A;  5AVT B;  4HRE E;  1XA5 A;  1BLQ A;  2QIW A;  2E43 A;  1BU3 A;  2L5G B;  1EDJ A;  2WOS A;  4CPG A;  3H1L J;  3DVJ A;  5H2F E;  2WSS H;  1TWO A;  4DS7 A;  4CLN A;  3CC7 P;  3GG2 A;  4PT1 A;  1NJI Q;  2JKV A;  4U7J A;  1GD2 E;  2E6W A;  3TNU A;  2XV5 A;  1J1E B;  1AJ5 A;  1NTM E;  1RJV A;  2KDH A;  3L4F A;  2EHB A;  4YTP C;  1NX3 A;  2WZ7 A;  1KB9 D;  4WWI A;  3CDN A;  1KWO B;  4PE7 A;  3CWG A;  2Z4E A;  3TYY A;  3F45 A;  1SQQ D;  2LXB A;  1VF5 C;  1MKM A;  4GIF A;  3A4U B;  1IK9 A;  2BCX A;  1PSR A;  2PAL A;  1QX5 B;  1GL2 D;  1USD A;  2HOD B;  1FOS F;  2WCM A;  1S6I A;  4O9B A;  1SQP J;  5APV A;  3MTU E;  1OVV A;  1M90 Q;  4YXD C;  4GDO A;  1G1J A;  1TU3 F;  2P7J A;  3SJS A;  1J1D C;  3IQQ A;  4JD9 A;  1U7J A;  3N7H A;  2LAN A;  1IRJ A;  3NSO A;  1SBJ A;  1L0N J;  1AJ4 A;  2NZ0 A;  1Q2N A;  5AW4 B;  3NGV A;  1B47 A;  2P70 A;  1CB1 A;  2LP2 A;  2AEJ A;  1JB0 J;  1NTZ G;  1HF9 A;  3LK1 A;  1QXP A;  2MJW B;  2E75 D;  1A02 F;  3BUM B;  2PYQ A;  1OZS A;  3IFM A;  1ZOT B;  4I2L C;  2FOT A;  1EJ3 A;  2H7H A;  2KLD A;  3I5G B;  1GL2 C;  1QX7 A;  1X9V A;  4N1F A;  1V1G A;  1LTG C;  1BSN A;  2K7B A;  1W2B O;  3E3R A;  5KU1 A;  1DD3 A;  1M1J B;  3CR5 X;  2LVI A;  2LV7 A;  3RM1 A;  2J58 A;  4D6T D;  4XA4 A;  3SG2 A;  1EL4 A;  1L0N K;  1YIT P;  4L9M A;  2JXL A;  2KLU A;  5C39 A;  4YBH B;  1SKT A;  1RFJ A;  3HD7 D;  2MLE C;  2EC6 B;  4L75 A;  4IFD K;  2V7Q J;  3AAK A;  1JY2 O;  1SQB K;  3HTK A;  3MUD A;  1B8R A;  1WRZ A;  1JCC A;  3RK2 D;  3S1K A;  2E42 A;  2HLO A;  2QJK B;  2KAX A;  4M2P A;  2QDI A;  1Q80 A;  2WSF J;  5APX A;  4H13 D;  1LTT C;  3H1H E;  1ORG A;  2NCO A;  3C9I A;  1DMO A;  2M3E A;  3D74 A;  1EZV E;  2JWA A;  4PD4 E;  1GU5 A;  2LP3 A;  4IJ7 A;  3B7A A;  4LGD E;  5KLV D;  3D71 A;  3II6 A;  3PRJ A;  1OOH A;  1R8E A;  1KSM A;  4CPV A;  3H6P A;  1DEK A;  1ZRT E;  2KIK A;  3TS5 C;  5CJ4 A;  3LW5 H;  1IC2 A;  1NU1 D;  2HPS A;  3EVU A;  4YXW H;  2QG4 A;  3RL0 B;  2FXO A;  3SS3 A;  2B89 A;  1CSB A;  1NTM K;  3B8E B;  4YI9 A;  1YVH A;  4W7Z A;  4GGF C;  1T2K D;  5APW A;  4OKH A;  2MAZ A;  1LVC D;  1H8B A;  1OXZ A;  3CZ0 A;  4PD4 H;  1YRT B;  2IZ0 A;  3E1I A;  1PRW A;  2IX7 C;  4UB6 E;  2EGD A;  2M0B A;  2MJZ A;  2XND H;  2KGR A;  2AUC A;  2KQ6 A;  2WC5 A;  3H32 A;  1C3Y A;  3EK7 A;  1CFF A;  2CCM A;  1S36 A;  1URQ B;  1CM1 A;  1VQ9 P;  4AOM A;  4BY4 A;  4NPE A;  2SPZ A;  1LKJ A;  3HD7 C;  3PN7 B;  1F8H A;  3N4X A;  5CSI A;  5CCG C;  4DT0 A;  1FZF A;  1SQP E;  1MFZ A;  2Y4Q A;  2Q1K A;  1L0L G;  3RBX A;  5GTI H;  1SLQ A;  3FWL A;  1S5L X;  1S1C X;  3KDP B;  2BCC E;  3S0G A;  4MBE A;  1CM4 A;  1PPJ E;  2N1T A;  1SP4 A;  1J7R A;  4PE1 A;  2KI6 C;  4QJ5 B;  4L73 A;  2ZRT A;  3AE2 C;  2BKI B;  1M1J A;  3AED C;  2M8U A;  4N3Y B;  4F7F A;  1SQQ E;  3VB1 A;  2WSC J;  1EXI A;  2GUV A;  1OW6 A;  3O6Q B;  2FY8 A;  1L2P A;  2KNC B;  1SNL A;  3SWF A;  3GK2 A;  2D2C D;  1NAY A;  1BOC A;  1YTZ I;  3G4S P;  3H1H J;  1ZFS A;  1JFJ A;  3CCV P;  1YHQ P;  1RE4 C;  2BKH B;  1DT7 B;  1USE A;  4OGQ B;  2PFX A;  4AUW A;  1WDC C;  5CBN A;  1SPY A;  2JEE A;  1KV4 A;  2K7C A;  2IS9 A;  1S5G Z;  1QIV A;  1EZV I;  1URQ C;  5D69 A;  3D70 A;  1BE3 J;  4NDC A;  3R2P A;  1EXR A;  2M7N A;  2PRR A;  2FKW B;  2OYH B;  4KHX A;  1BG1 A;  4ETO A;  4GUK A;  3WHT B;  1G2C A;  3BCC J;  2YMY A;  2YIU C;  1U7M A;  5KAI H;  5CPV A;  2JXC A;  2EC6 C;  2JPO A;  3B4S A;  2LHL A;  1S3P A;  2F3Y A;  2E76 B;  4I5J A;  4N78 D;  2L51 A;  4NPD A;  5AW0 B;  3TDZ A;  3TZ1 A;  2ZKM X;  1VQO P;  1NAF A;  4UB8 H;  4P5O E;  2NPS D;  1KK8 C;  1NH4 A;  1G1I A;  2LXC B;  3M0D A;  1NTZ K;  4CFR A;  4N5X A;  1IGV A;  2OS8 C;  3I5H B;  4N6J A;  1QWV A;  3L73 E;  1J1D A;  3H1K E;  2Y0E A;  4EI2 A;  2YXR B;  1XK4 C;  2D8N A;  4D1E A;  4PAL A;  1NTK G;  2D2C C;  2KGB C;  1QX8 A;  5APS A;  1VQK P;  2V53 A;  1YIJ P;  1CFD A;  2I94 A;  1L0N E;  1WY9 A;  1Q82 Q;  5CCH D;  4INX A;  1NIW A;  1E79 H;  2A06 D;  5FYX A;  3V2N A;  2ZRS A;  2OTJ P;  1AV1 A;  1IFM A;  2M1U A;  2Q3E A;  3BVH A;  4YPC A;  1GL2 B;  5CJ0 A;  4IL6 X;  1VQN P;  1LT1 A;  2N9Y B;  1JY2 P;  1BOD A;  1KIL E;  1BCC J;  3H1J J;  3O8Z A;  1EDI A;  2R44 A;  1XFZ O;  1SQV D;  2FYN B;  3QWO C;  2P71 A;  3KO0 A;  4YGB B;  1LTA C;  1NYA A;  3L70 E;  4H0L B;  2ZND A;  5I2O A;  1MFT A;  3IAO A;  4U3F E;  2WT7 B;  3PH0 A;  3EK4 A;  2H61 A;  2FCD A;  5B5E H;  4XYN A;  1DEL A;  2OAR A;  4HKZ H;  3FE6 A;  1FBM A;  1RE3 C;  2M8R A;  1Y6W A;  4W80 A;  1XFU O;  5E79 H;  3CX5 I;  5AW9 B;  5M1B A;  1H8A A;  2BL0 B;  1W7I B;  3V6I A;  2I18 A;  2WCJ A;  3U1A A;  1OW4 A;  1ALW A;  2WVR A;  1DF0 B;  1GK4 A;  2A06 G;  1NTM G;  4E68 A;  4AQR D;  3CR4 X;  1CDL A;  2L4H A;  2IZ1 A;  2BE4 A;  4WRI A;  1VPC A;  5AXI A;  1J7Q A;  4WY4 B;  2NPS C;  4BXL A;  1VDF A;  2Y5I A;  1QVI Z;  5TNC A;  1H89 A;  2JP3 A;  4PD4 I;  1HGZ A;  2Q3I A;  1PGP A;  5KKZ B;  1FBV A;  1C07 A;  1B8C A;  2H2K A;  3PSR A;  3EQ2 A;  2Y0C A;  4BWN A;  4Y28 J;  4WY4 C;  3OB2 B;  4YGD B;  1T3U A;  1C3Z A;  3JC2 2;  3H32 B;  5APY A;  3AE8 C;  1F70 A;  2E74 D;  1KWO C;  1SQV G;  3H1I J;  3IQO A;  3FWB A;  4M2Q A;  1FDO A;  1YTZ C;  3SFE C;  1IQ3 A;  1Z2C B;  2JO1 A;  3O78 A;  3D6Y A;  1X79 B;  1L4A C;  5KJ7 C;  3CX5 D;  2NCP A;  2FFD A;  1H0T A;  1NTZ E;  1PL5 A;  4W7Y A;  1HUC A;  1YUS A;  2YO2 A;  4PE0 A;  3S0E A;  3VMA A;  4WB4 A;  1KQG B;  1BR4 B;  1BGY G;  4UB6 H;  5AAN A;  1KIL D;  2K9J B;  2AXC A;  4PHJ A;  1DH3 A;  2CTN A;  1TRF A;  2OYI C;  4F0Z B;  1NTK D;  1KK7 Y;  2R3S A;  3R1V A;  3SWY A;  1N2D C;  4GNK B;  4IFF A;  2L0P A;  2C9N Y;  1GL2 A;  3P7K A;  2HPC A;  1MHO A;  1QL1 A;  1YQ4 C;  5BVZ A;  1L4A A;  1SFC B;  3GLM A;  2LVJ A;  1LTS C;  2WT7 A;  1AVY A;  1OZH A;  1PP9 D;  2VRG A;  3HUS C;  3EK8 A;  2K0J A;  2LNK A;  1XFX O;  2WND A;  2LLS A;  2FXP A;  4JKT A;  5KLI B;  2ITA A;  2RH0 A;  1ZME C;  3FGA D;  3R4Y A;  5TIS E;  2JQ6 A;  4RES B;  3D75 A;  1EZV G;  3VYI A;  4D6T E;  5FI2 A;  2E5T A;  2WPS A;  1ZAC A;  2JTZ A;  3L47 A;  1N7S B;  1CLM A;  2B9B A;  1KZU B;  2H61 C;  1CFC A;  3AEA C;  1IIO A;  1AA0 A;  2LMU A;  1BJF A;  1KCY A;  3FIA A;  1ZMZ A;  2KI4 B;  1SQX J;  1OFC X;  4KJM A;  2IBZ E;  3A0H H;  1UIX A;  3K1E A;  2HR3 A;  1CLB A;  4NPF X;  4BRY A;  3H1I G;  4TT3 H;  1CNP A;  1SQV J;  1KIL C;  4MZL A;  3CCQ P;  2FYU E;  2KBI A;  1T8Z A;  3P8M C;  2KOT A;  4I7Z C;  1NGM B;  2QAC A;  2LR2 A;  5AVQ B;  2P6B B;  2MLF C;  3AE9 C;  1FW4 A;  1SQP K;  5PAL A;  2W83 C;  3AE4 C;  4C7N B;  4I5L B;  2KP8 A;  4B86 A;  3D10 A;  5I94 A;  1KIL B;  2QSI A;  3RK3 C;  2WC8 A;  3A5T A;  3WNX B;  3SFD C;  1QGK B;  1LT9 A;  1SQP G;  3AKB A;  3CC2 P;  3U1C A;  4HSZ A;  1N0Y A;  3V5B A;  2KSE A;  4IL6 E;  1Q90 D;  2ISD A;  3L72 D;  1IH0 A;  3CL3 D;  2O1J A;  3SG6 A;  1TNP A;  2CXJ A;  2L2C A;  1L2O C;  3D0Y A;  4GOF A;  1L7Z A;  1L0L D;  1NTM D;  3NHI A;  1OWA A;  2KI4 C;  4MRY A;  4MZK A;  2Q6Q A;  1Y1U A;  1N8R Q;  5AVY B;  4PV1 C;  3OHM B;  2OYH A;  3JTD B;  4AYC A;  1OMV A;  1LT9 C;  2RN0 A;  1NX0 A;  4XE5 B;  3P32 A;  4PDZ A;  2KFH A;  3A7O A;  1A03 A;  2N1T C;  3AE5 C;  3G3Z A;  1OSA A;  1SQB E;  2M29 A;  3LK0 A;  4PCW A;  2L4I A;  2R2I A;  2WC6 A;  5AVX B;  3DVK A;  2KNE A;  5AVS B;  3OX5 A;  3V4Q A;  1A2X A;  5IBW A;  1QAT A;  2NZ2 A;  1KFX L;  1HBW A;  3TSI A;  1SSE B;  3L4A A;  4WQ3 A;  5AVW B;  3EFG A;  1VQ5 P;  3WHU B;  3PJS K;  1K95 A;  2ZXX A;  2LM5 A;  3I5F C;  3VP8 A;  4XFJ A;  2FYU J;  1GZL A;  3WUV A;  3O2P A;  4ZCU A;  1NTK J;  3RK3 D;  4BRY B;  1R2U A;  1KYO E;  2PGD A;  3S0F A;  1BR1 B;  1KQM C;  1SFC D;  3FS7 A;  3HE5 B;  1TOP A;  5KLV G;  1T2K C;  5HKW A;  1SQX E;  1BSH A;  3AE6 C;  3D78 A;  1SQV K;  1YUT A;  1GM0 A;  1H88 A;  1JBA A;  1KB9 I;  5APT A;  3CGA A;  1LA3 A;  5KSZ A;  3IF7 A;  3OW2 O;  3TUY C;  1FI5 A;  1M8O B;  5AFP A;  1BDD A;  3BCC E;  5B66 E;  5J3X A;  3NMD A;  5AW1 B;  3VRQ A;  1QLS A;  5AW7 B;  1NTK K;  3BUX B;  1DJI A;  2OTG B;  2LHI A;  1T14 A;  4L76 A;  3PN7 C;  2FYU K;  3M0D C;  2WQY C;  1SCV A;  1BDC A;  1Q7Y Q;  1R6P A;  1IWQ A;  5CCG D;  2BCA A;  3CCJ P;  2BBM A;  1SQP D;  4YGE B;  1D7M A;  4A4B A;  2KSP A;  3HCM A;  1K05 A;  1NTM J;  5BU5 A;  2WCF A;  2G2B A;  1J1D B;  1TNW A;  1CI6 B;  2Q7C A;  4DIR A;  1AVS A;  4ZNC A;  4NDD A;  5APQ A;  4JF7 A;  4PHM A;  1XFR A;  3B86 A;  2BBN A;  1ZV8 A;  3I5H C;  3EG5 B;  3B6X A;  3H1L E;  3PJI A;  2COL B;  1VQ6 P;  3B5N C;  1UHH A;  3VRN A;  4PV1 D;  2Q91 A;  4C0K A;  3BUW B;  1B4C A;  2H89 C;  1SK6 D;  2KOG A;  1K9U A;  2OQQ A;  3HD7 B;  4H44 B;  1NCZ A;  4C46 A;  1KD1 Q;  4JPZ B;  1PVA A;  2F2O A;  1BCC G;  3H1J G;  2JT0 A;  5HLV A;  2M49 B;  1IKU A;  4YGA A;  3Q5R A;  2HQW A;  2KAY A;  2O01 H;  3L70 G;  3TGU J;  4U3F G;  3DVE A;  5APU A;  1JCD A;  4R1E A;  2E76 D;  1JFK A;  2ZYA A;  2FJY A;  3PLF B;  4H44 D;  3LID A;  2K88 A;  4MRX A;  2LVV A;  2NXQ A;  2YXQ B;  4PJ0 H;  1SVF A;  1LTJ A;  1JC2 A;  4R4L A;  2OTK E;  2HQ8 A;  1M1K Q;  3HD7 A;  1NUB A;  3I5I C;  2A06 E;  1W7J B;  3L74 E;  4GPL B;  1VQ8 P;  1B1G A;  4OR9 B;  1ZP0 C;  5AW6 B;  2E30 A;  1B7T Z;  1M7L A;  1JY3 O;  3BUO B;  2QJP B;  2ZYG A;  1PVB A;  1WRK A;  2LKM A;  3M9B A;  3O6Q A;  1PZQ A;  1NYH A;  1S5L E;  2IBZ I;  1YQ3 C;  3CCE P;  1P84 E;  3Q5S A;  5AW3 B;  1YUR A;  1PP9 G;  3BOW B;  3GHG A;  1DQE A;  3S0D A;  2KZJ A;  1A4P A;  1OW8 A;  2M5A B;  1GTW A;  4PHN A;  2HYN A;  4GBA A;  1B9A A;  1F54 A;  1YX8 A;  1VQP P;  3FWC A;  1Y8A A;  2WSE J;  3I5C A;  5EFW B;  3CZ2 A;  1CDP A;  1OIP A;  3SIA A;  1EH2 A;  3BQ3 A;  3GHG B;  3KPX A;  5KAF H;  3RL0 g;  3HE4 B;  1KYO H;  1F4O A;  2LVK A;  2ZT9 B;  3VN0 A;  3DF0 B;  4RJT A;  1UUS A;  5HKZ A;  2N1T B;  3L70 J;  3OP0 A;  4MZJ A;  1VQL P;  4WY4 D;  1CKK A;  1FE6 A;  1NCY A;  3EFF K;  1BE3 G;  1IZN B;  1NU1 G;  1N65 A;  2WPV B;  1K73 Q;  1YUU A;  3KPE A;  2JOJ A;  1PV3 A;  1JF2 A;  2MA2 A;  1W5C E;  1X02 A;  2J5U A;  1TN4 A;  5HKY A;  2YGU A;  1MUX A;  3MUD C;  1MWN A;  3V2Q A;  3W68 A;  3DZT A;  3TGU E;  2DW3 A;  3PHL A;  1F55 A;  2I1K A;  1HWT C;  1XO5 A;  4ASW A;  3HE4 A;  4MLW A;  1RH5 B;  2POH A;  1NSH A;  3B87 A;  1KFM A;  3L71 J;  1JTH B;  1UHJ A;  3ZNI A;  1X0T A;  2IDB A;  3LL8 B;  2HPC B;  1FDI A;  3FX0 A;  1S5G Y;  3RLZ A;  3GMA A;  3VRO A;  3BFB A;  1ZLL A;  1WRG A;  3M9Q A;  1RWY A;  1KSO A;  3VGO A;  5KJ7 A;  2B1U A;  2F8P A;  2PRU A;  1BGY D;  3CPW O;  3VP9 A;  4U3F D;  5CSN A;  4D6T G;  2GV5 A;  1AFO A;  1FC2 C;  2I8D A;  1OOI X;  4Y99 B;  1SL8 A;  1N73 B;  5CSF A;  1JO5 A;  3CAB A;  1NTZ J;  3I56 P;  2FCE A;  3UNW A;  5E79 E;  4ZMD A;  5KKZ C;  2YNY A;  1XYD A;  1MZ9 A;  3PP5 A;  2CPS A;  1LT9 B;  2Y9Z A;  5AW2 B;  4P2Y B;  5I2Q A;  1EC5 A;  2GA1 A;  5B5E E;  3M91 A;  2FYU G;  1NP8 A;  1A75 B;  1FI6 A;  1K94 A;  2PQL A;  2JWW A;  4LC1 A;  4JYC A;  3VMX A;  5BU8 B;  1OMR A;  4AQI A;  5JOL A;  2M3B A;  4HYT B;  3U59 A;  3T97 A;  4EYY Q;  2M97 A;  1IK7 A;  2LCP A;  2Q4U A;  1A75 A;  2PMY A;  2ZFC A;  1SY9 A;  1RQV A;  2KZI A;  1YR5 A;  3OBV A;  3LCP C;  4ORA B;  2LUX A;  1FOS E;  3A0B H;  1K90 D;  1EG4 A;  3D77 A;  1PPJ D;  2OTL P;  5CHX A;  2KYV A;  2E75 B;  3L37 A;  1UWO A;  1JNM A;  2KK7 A;  3CC4 P;  2JUL A;  3S0B A;  1PAL A;  3DXL A;  1LXF C;  4C7R A;  1DD4 A;  3SG7 A;  1TNQ A;  3MZW B;  4H13 C;  2BAS A;  3PLN A;  3JVT C;  3LIE A;  1J1E A;  3CXH D;  1QS7 A;  5CCH A;  1YJW P;  3K5B A;  3AAJ A;  3L75 G;  1DX7 A;  1M57 D;  2IBZ D;  5I2L A;  3D73 A;  1J55 A;  1AUI B;  1NHL A;  2ZAE B;  4DUQ A;  4EOT A;  3AEC C;  3CS1 A;  2R3C A;  1LP1 B;  3S9O A;  1XK4 A;  2JZI A;  3OX6 A;  1NTZ D;  3CXH I;  3MIW A;  4H13 B;  2OYI B;  1KTM A;  1N7S C;  3M9H A;  4CFQ A;  2SAS A;  3CLN A;  2BCC G;  2L98 A;  1XTG B;  2PAS A;  2GM4 A;  2JWD A;  2O3J A;  2TN4 A;  3EKJ A;  4HRH A;  2E75 C;  1TCF A;  2V4H A;  5KLV E;  2BEQ D;  1CTR A;  1NVO A;  3AE7 C;  1SQX G;  1AQT A;  2O5G A;  2C0X A;  2K9Y A;  1VF5 D;  2OYI A;  2P58 A;  3A3Y B;  3L72 G;  3CX5 H;  3I5F B;  2RKL A;  3OGN A;  4M3L A;  2YKQ A;  2PVB A;  2AEM A;  5TJH A;  5I8N A;  2H8P D;  3C1V A;  3R1O A;  2HFE D;  2WCK A;  3HUS A;  1F4Q A;  1QLK A;  1RTP 1;  4BY5 A;  1D1O A;  4IFM A;  2KNC A;  2F2P A;  3TS5 B;  1OMI A;  5AVR B;  1SS1 A;  4GKG A;  3EVR A;  4PHK A;  3RL0 D;  3B5N D;  1DJW A;  1SRA A;  2LC5 A;  2I7A A;  1HGV A;  4DJG A;  1L0L K;  3GHG C;  5CMZ A;  3CD6 P;  1K9P A;  2AAO A;  2KFG A;  2Y9Y A;  2ZT9 C;  1IJ5 A;  2A4J A;  1GU4 A;  1SQQ J;  4FTG A;  1FZC B;  2NRG A;  3H1I D;  1L4A B;  1SFC A;  1DF0 A;  4YGC B;  1SL7 A;  2GTE A;  3A8R A;  1SQB J;  3B88 A;  3H1L G;  2K8M B;  2KHN A;  2P10 A;  2W90 A;  1GGZ A;  1KFU S;  2R5D A;  1E8A A;  1OOJ A;  1G2C B;  1Z56 A;  3H1K J;  1PFI A;  4GT1 A;  1UII A;  1URQ A;  2A45 G;  2H8V A;  3O4Y A;  1PSB A;  1BCC E;  3H1J E;  4YI8 A;  1NU1 K;  5D3O A;  2PP6 A;  4C7N A;  1LWU C;  4PD4 D;  1EZV D;  1NOH A;  4OGQ C;  2H43 A;  1YTZ T;  1PUL A;  2DOQ A;  1Q86 Q;  3MSE B;  3BAS A;  2WCE A;  3HX4 A;  1SR6 C;  2A45 H;  3RK2 C;  1K9K A;  2BEC A;  1NTK E;  2M5A A;  1MF8 B;  1L4A D;  4NDB A;  3NXS A;  2ZJS E;  1M39 A;  2NLN A;  4R4M A;  4ZKU A;  2LMV A;  2FYN C;  3KHU A;  2AXT E;  3MP7 B;  1VQ4 P;  1ODB A;  4MSP A;  1SL9 A;  5GTH H;  3NSI A;  3VOP A;  1DC1 A;  3L71 D;  1DJG A;  4NQG A;  1HJB A;  2ERB A;  4OWF A;  4Y99 C;  1N73 C;  2KI6 D;  4HRG A;  4D6T J;  1S72 P;  1HJ0 A;  1VQM P;  2KUB A;  1CDM A;  2QJY C;  1REC A;  5DJT B;  5K5G B;  1ZN5 A;  3RL0 C;  1PP9 E;  3JSV C;  3HUS B;  3Q1M A;  1IFP A;  1LTI C;  3E7K A;  1OVU A;  3GW6 A;  5AVU B;  2WMM A;  4N1G A;  2QM7 A;  3EKH A;  2KYC A;  2LLU A;  1OOF A;  1U57 A;  2CK3 H;  3BOW A;  3CME P;  3L71 G;  1QIW A;  2FJU B;  3HTK B;  4IOI H;  1ZR2 A;  2XKM A;  2HET A;  2Z5I A;  3TDU A;  2QJP C;  1QVF O;  3CWB E;  3VRR A;  2O01 N;  2LE9 B;  4QMA A;  1X22 A;  1KQF B;  1KOR A;  2HF5 A;  3CCU P;  2KB7 P;  4GGF A;  3WU2 E;  3M06 A;  1M31 A;  5DIC A;  1K04 A;  3CXH H;  5ER5 A;  1HQV A;  3ZDM A;  2L2E A;  2FFD C;  4H0L D;  1BE3 E;  1EDL A;  1E5W A;  1FZC A;  1NU1 E;  3H1H G;  2ZYD A;  2K61 A;  3DVM A;  2OGU A;  5DKN A;  3KF9 A;  1P84 D;  2XU6 A;  3H1K D;  2ZN9 A;  1RF1 B;  1U5I B;  4INW A;  1FJP A;  1CLL A;  4K35 A;  3P8C D;  3RK3 E;  1AK8 A;  3WUT A;  2N9B A;  3DYE A;  2BAP A;  1KYO D;  3AEG C;  3RGU A;  1EDK A;  1XFV O;  3CCS P;  1RF1 A;  1PP9 J;  2JT8 A;  4MN0 A;  2D2C B;  5H2F H;  1WT6 A;  4IL6 H;  1OW7 A;  1GW4 A;  3B5N A;  3NFQ A;  5KLV J;  2L5X B;  2B87 A;  1BF5 A;  1QVG O;  2O01 J;  3IN6 A;  3P8C E;  5KLI C;  4MEW A;  1KK8 B;  1Z4H A;  3GK1 A;  1Q81 Q;  2RGI A;  2M9G A;  1FPW A;  4PE4 A;  3VMZ A;  1P28 A;  3KEV A;  2QJK C;  3C8V A;  2LAP A;  1MV8 A;  5AER A;  1UP5 A;  1S26 D;  1L0L E;  1OZO A;  1IFD A;  1NX2 A;  4H0L C;  1LTJ C;  3DF0 A;  3BRT B;  2JDI H;  3SS4 A;  1URQ D;  2N1T D;  1C7W A;  1NCX A;  1B7T Y;  1TCO B;  1S5L H;  2WWW A;  3CWB J;  3L74 D;  3KXD A;  1SQQ G;  3A2A A;  2WSF H;  3G71 P;  3TDK A;  1WRL A;  4EDF A;  1QV1 A;  1KB9 H;  3G6E P;  1R5S A;  4OCI A;  1UUR A;  4DOJ A;  3VMY A;  1HT9 A;  1EQ7 A;  3VRP A;  3ABV C;  2K60 A;  4LLH A;  1H4B A;  3WUU A;  5AW8 B;  4K3A A;  2IBZ G;  3NTN A;  2JT3 A;  2E74 C;  2H88 C;  3OAK A;  2MKV A;  1RF0 C;  1JMB A;  2LUC A;  5GTI E;  2PSR A;  1GMJ A;  1QX2 A;  1YYC A;  1Y47 A;  1IJD B;  1BMO A;  3CCL P;  1K8U A;  2K3R A;  3AEB C;  2B88 A;  1DEE G;  1DTL A;  5G08 A;  3BYA A;  5FI6 A;  3L35 A;  2QEB A;  1FJK A;  1W2E A;  2MRD A;  2A45 I;  1JMM A;  2JNF A;  3KZI H;  1IFN A;  1M63 B;  3Q5P A;  2Y0D A;  3CCR P;  3L75 E;  2O1K A;  2OTG C;  1OQP A;  2QJY B;  4MVF A;  3CZT X;  2O60 A;  3JTD C;  1MR8 A;  1L0N D;  2R5B A;  2KAV A;  2WCH A;  1JF0 A;  2KFF A;  1KMI Z;  2CNP A;  3KHE A;  1AJY A;  2GUS A;  1G4Y R;  1RF1 C;  4I5K A;  1UHN A;  1LP1 A;  1T6A A;  3SG3 A;  2YMK A;  1LNQ A;  2M7L A;  3CYZ A;  3PFV A;  1YX7 A;  1K9M Q;  5TIS H;  2WPQ A;  3L73 G;  1DJY A;  1FZE A;  1XTC C;  1XVJ A;  3BCC D;  3H1K G;  4RO0 A;  3GOF A;  4ICB A;  2YO3 A;  4GGN A;  3FXE A;  2FYU D;  1FS0 E;  1R5L A;  3CWB D;  1NO4 A;  1PK0 D;  3L74 J;  2I2R E;  4XJK B;  2JJL A;  3I55 P;  1SQB G;  4C0J A;  2FFD B;  3K21 A;  2IFM A;  5KAI E;  2GGM A;  3L72 E;  3CTN A;  3DD4 A;  2OS8 B;  4KT0 J;  3GF7 A;  1OE9 B;  3SS5 A;  2FXM A;  2QRX A;  3AKA A;  2I1J A;  3RK2 B;  1CMF A;  1S9K D;  3D6Z A;  5B8I B;  3DY9 A;  2KLV A;  4CID A;  1BT6 A;  4JQ0 D;  3C1L A;  1FAV A;  2L91 A;  1N7S A;  2KXP B;  2K37 A;  3CX5 E;  1KQL A;  1NKZ B;  5GQQ C;  1C7V A;  2K9J A;  1Y1A A;  1SW8 A;  3TK1 A;  3RK3 B;  1TUZ A;  2QE7 H;  3IF4 A;  3SSU A;  1N73 A;  1JY2 N;  2BNX A;  2KS1 A;  2HOD A;  1NWD A;  1PGJ A;  1RK9 A;  1EXJ A;  1BGY J;  3V4W A;  1TNX A;  3LLE A;  2JR8 A;  4USL A;  2C0W A;  1JOC A;  1Y9B A;  1LTB C;  1L2O B;  1X8Y A;  1IO4 A;  4TLF A;  2M0R A;  4OVN F;  5KTY A;  3JCU H;  1AVO A;  2Y1M A;  1W9Z A;  3L73 D;  2WPR A;  2WTY A;  5AEQ A;  1FZA A;  5DJU B;  3L4L A;  2ZNE A;  2Z5H A;  2WCB A;  2G9B A;  1GGW A;  2LLT A;  1QLE D;  2HG5 D;  2BEZ F;  1B8L A;  2KS1 B;  3H25 A;  1SCM B;  5KJ7 D;  3V2R A;  1MXL C;  3RBZ A;  2AEF A;  3AE1 C;  3S4R A;  2L5Y A;  3CI9 A;  5JJG A;  3RZS A;  4N78 E;  3QME A;  4YRU A;  3FWN A;  1K96 A;  3B5N B;  2Q5U A;  1JUO A;  4M2O A;  1RHZ B;  2G8Y A;  4HH2 A;  1YRU B;  1JUN A;  1KB9 E;  1YVL A;  1TUJ A;  4DCK A;  3B71 A;  1VL2 A;  1OX3 A;  3NHT A;  1JY3 N;  1IG5 A;  1DJH A;  1KQV A;  2K2A A;  3V2P A;  3SIB A;  4AQJ A;  5HYD A;  1M45 A;  3F5H A;  4I7Z B;  1SQV E;  2BE6 A;  1S4X A;  2M1K B;  2VRS A;  4A4C A;  5ER4 X;  1NWQ A;  2YIU B;  4DRW A;  3PAT A;  1JEK A;  5DKQ A;  1SR6 B;  2AXT H;  1FZG A;  1RE3 A;  3I5G C;  4JYB A;  4XJK A;  1FZC C;  2L50 A;  1YJN P;  3BFH A;  1NKN A;  1G8I A;  2QEX P;  1MXE A;  1NX1 A;  3IVT A;  1A29 A;  1YJ9 P;  1HTL C;  1QL2 A;  1KIL A;  3SG4 A;  1BGY E;  5CSJ A;  2CT9 A;  3BAT A;  3KZI E;  1AHR A;  2P2U A;  1S1E A;  2MHH A;  1XFY O;  3A0H E;  1QEX A;  3ICB A;  3L71 E;  2LMT A;  3CWB G;  1VQ7 P;  2E5Y A;  1RQU A;  5F6T A;  2G3A A;  3L74 G;  5AW5 B;  3M0W A;  1ZW0 A;  1P84 I;  4FQT A;  3WMM 0;  4Q04 A;  1ZR4 A;  1SQX D;  2K2F A;  1DVI A;  3SWK A;  3L73 J;  2ZXE B;  5K89 A;  2ZT9 D;  2XNX A;  3L70 D;  1IFI A;  1UHI A;  2J59 M;  1CFP A;  2CPB A;  1BCC D;  3H1J D;  3G9R A;  2FYZ A;  2E74 B;  2JTT A;  5CCH C;  3HRN A;  2K7D A;  4IL1 A;  3H4S E;  1ALV A;  1M46 A;  3D76 A;  3ZWH A;  1LGH B;  1RRO A;  4ASV A;  2KQY A;  4FQO A;  4ZKP A;  3R1P A;  1Y1X A;  1HVV A;  4OGQ D;  3UIA A;  1VF5 B;  4GOD A;  3IR9 A;  2BCB A;  1DGU A;  1ZUZ A;  5DKR A;  3AEF C;  3H1I E;  3W67 A;  3CLQ A;  4OV2 A;  5HLO A;  1TTX A;  4I5N B;  3GF3 A;  2FBW C;  2BL0 C;  3CCM P;  1K8A Q;  3OB1 B;  2IYO A;  2JC2 A;  1FZB A;  2C9L Y;  2F33 A;  3HE5 A;  3JCU E;  1H0T B;  2PAJ A;  1IJ6 A;  1J1E C;  2QEV A;  1S3J A;  1MQ1 A;  1HH0 A;  2KYF A;  2F3Z A;  1JM0 A;  2UWJ E;  4U3F J;  3TGU G;  2B87 B;  3Q8I A;  4GOE A;  2YKP A;  4QJ3 B;  1GJY A;  2XDJ A;  2R32 A;  1IQ5 A;  2WOR A;  1A02 J;  1LS8 A;  1KC8 Q;  1T3J A;  2IYP A;  1N7L A;  1SQQ K;  4C0L A;  3EVV A;  2W8Z A;  5FI7 A;  2BCC D;  4WQ2 A;  1GK6 A;  3OJA B;  3KYQ A;  1F71 A;  1MUU A;  1NU1 J;  5EL2 A;  3F89 A;  4UB8 E;  1S6C A;  1KFN A;  1M1J C;  3SG5 A;  2KSJ A;  1WDC B;  3BXK A;  3V2L A;  3KQG A;  1KFU L;  1SYM A;  4MN4 C;  2JRF A;  1U5I A;  3L75 D;  1FF1 A;  2WIT A;  2KPH A;  2KI7 B;  1WMK A;  3AEE C;  1LWU A;  1DJX A;  1PIX A;  1XFW O;  3GK4 X;  1UHK A;  4H44 C;  2M3W A;  1PGQ A;  3M0A A;  3BJH A;  3QRX A;  2Q9I A;  1CW5 A;  3PM8 A;  1S9K E;  2OYH C;  1KFX S;  1AP4 A;  1V1F A;  1YI2 P;  3OA7 A;  3NXA A;  1FDM A;  1SMG A;  2WSE H;  1J7P A;  1L0L J;  1QJT A;  2W6B A;  3WU2 H;  4HB1 A;  4ORC B;  3JVT B;  5AVZ B;  3CXH E;  1PPJ G;  1CDN A;  2WSC H;  2ZN8 A;  3N7N A;  1QVI Y;  3UO9 A;  4UPG A;  1K93 D;  1NPQ A;  5L8R J;  4GFT A;  1YBK A;  5CBO A;  2ZVO B;  1LTJ B;  1OVR A;  2ZFD A;  2K7O A;  5KTB A;  3VTP C;  1VRK A;  3PAL A;  1DJZ A;  1SQB D;  2W6J H;  3S0A A;  4EIJ A;  4GAO A;  1LIN A;  1KQS O;  1PGO A;  3TDI A;  1DIP A;  2CBL A;  3FE9 A;  1RY3 A;  1M56 D;  1AQ5 A;  2XZR A;  1WLM A;  4KYN A;  2NPS A;  4RKU J;  1S6J A;  3BCC G;  3H1H D;  2JPT A;  1DGV A;  3USS A;  1KQM B;  1S2E A;  4DZO A;  4JWQ A;  2QM8 A;  1QV0 A;  1CI6 A;  3CMA P; 
#chains in the Genus database with same CATH homology
 1N65 A;  3I5I B;  3KO0 A;  1YUU A;  4YGB B;  1NYA A;  2JOJ A;  1JF2 A;  2MA2 A;  1WRL A;  1X02 A;  1TN4 A;  2ZND A;  5HKY A;  1LA0 A;  1MUX A;  1Y0V H;  3BUN B;  1MWN A;  2KBM A;  3TUY B;  1CMG A;  1QV1 A;  3EK4 A;  2H61 A;  2FCD A;  4OCI A;  1SCM C;  1F55 A;  1UUR A;  4XYN A;  1XO5 A;  1Y6W A;  4MLW A;  1QTX A;  1NSH A;  1XFU O;  2GGZ A;  1HT9 A;  2BL0 B;  1J7O A;  1W7I B;  3VRP A;  2JU0 A;  2I18 A;  1ALW A;  1UHJ A;  3ZNI A;  1H4B A;  1DF0 B;  1TIZ A;  3LL8 B;  4U8D A;  4E68 A;  2JT3 A;  3CR4 X;  1CDL A;  2L4H A;  1S5G Y;  3RLZ A;  2BE4 A;  4WRI A;  4ZCV A;  3VRO A;  5AXI A;  1J7Q A;  2LUC A;  2PSR A;  5D7F A;  1QX2 A;  1RWY A;  2Y5I A;  1KSO A;  1QAS A;  3VGO A;  1QVI Z;  3NSL A;  5TNC A;  1JWD A;  4ORB B;  2B1U A;  2F8P A;  2PRU A;  4TNC A;  1BMO A;  1K8U A;  1FBV A;  3O6B A;  1C07 A;  1B8C A;  1DTL A;  2H2K A;  5G08 A;  5CSN A;  3BYA A;  3PSR A;  1N2D A;  2GV5 A;  2MRD A;  3CR2 A;  1KK7 Z;  2JNF A;  1SL8 A;  5CSF A;  2MBX A;  1M63 B;  2AMI A;  4QJ4 B;  3OB2 B;  4YGD B;  2OPO A;  1GQM A;  2OTG C;  1OQP A;  2FCE A;  1OMD A;  4MVF A;  1F70 A;  1KWO C;  3CZT X;  2O60 A;  1XYD A;  3JTD C;  1MR8 A;  1K2H A;  1WLZ A;  3IQO A;  2KAV A;  5BPJ A;  2QPT A;  1JF0 A;  3FWB A;  4M2Q A;  2Y9Z A;  1YTZ C;  1IQ3 A;  2KFF A;  4P2Y B;  2Y1N A;  5I2Q A;  2CNP A;  3KHE A;  1G4Y R;  1EG3 A;  2JNX A;  1G33 A;  1UHN A;  2SCP A;  4I5K A;  3O78 A;  3D0Y B;  3SG3 A;  2NCP A;  1NP8 A;  1A75 B;  2M7L A;  3PFV A;  1FI6 A;  1K94 A;  1YX7 A;  3WXA A;  2JWW A;  1DJY A;  3NSK A;  1XVJ A;  1YUS A;  4PE0 A;  3GOF A;  4ICB A;  1JSA A;  1BR4 B;  4GGN A;  5AAN A;  1OMR A;  4AQI A;  5JOL A;  4HRE E;  1XA5 A;  4PHJ A;  1BLQ A;  1PK0 D;  2CTN A;  1BU3 A;  1TRF A;  2I2R E;  2M97 A;  2WOS A;  4XJK B;  4F0Z B;  1KK7 Y;  2LCP A;  4GNK B;  3DVJ A;  2L0P A;  2Q4U A;  1A75 A;  3K21 A;  2PMY A;  4C0J A;  4DS7 A;  4CLN A;  1MHO A;  1SY9 A;  2GGM A;  1YR5 A;  2LVJ A;  3CTN A;  3LCP C;  2E6W A;  3DD4 A;  2OS8 B;  4ORA B;  2LUX A;  1OE9 B;  2VRG A;  3AKA A;  1K90 D;  1AJ5 A;  3EK8 A;  1EG4 A;  1CMF A;  1RJV A;  5B8I B;  4CID A;  1BT6 A;  2KDH A;  1UWO A;  4JQ0 D;  2EHB A;  2K0J A;  1XFX O;  2LNK A;  2WND A;  2LLS A;  1NX3 A;  5GQQ C;  1C7V A;  1KWO B;  4PE7 A;  2JUL A;  1Y1A A;  1SW8 A;  1PAL A;  1LXF C;  3CWG A;  3F45 A;  2JQ6 A;  3A4U B;  3SG7 A;  2BCX A;  1ZAC A;  1NWD A;  1TNQ A;  2JTZ A;  1PSR A;  2PAL A;  1QX5 B;  1RK9 A;  1CLM A;  1TNX A;  3LLE A;  1S6I A;  3JVT C;  4USL A;  2H61 C;  1CFC A;  1J1E A;  1QS7 A;  2LMU A;  1BJF A;  3AAJ A;  1L2O B;  1KCY A;  5I2L A;  2M0R A;  1J55 A;  4OVN F;  1AUI B;  3FIA A;  5KTY A;  4DUQ A;  1ZMZ A;  2Y1M A;  2KI4 B;  1OFC X;  3CS1 A;  1XK4 A;  5AEQ A;  2ZNE A;  2JZI A;  2WCB A;  1CLB A;  3OX6 A;  2G9B A;  3SJS A;  1GGW A;  3IQQ A;  2LLT A;  4CFQ A;  2SAS A;  3CLN A;  1B8L A;  2LAN A;  1CNP A;  1SCM B;  2L98 A;  1IRJ A;  2PAS A;  3NSO A;  1MXL C;  1SBJ A;  4MZL A;  1AJ4 A;  2NZ0 A;  1B47 A;  2KBI A;  1CB1 A;  2KOT A;  2LP2 A;  5JJG A;  3LK1 A;  1QXP A;  2MJW B;  2QAC A;  2TN4 A;  3EKJ A;  4YRU A;  3BUM B;  1K96 A;  1OZS A;  2P6B B;  1JUO A;  1ZOT B;  2MLF C;  4M2O A;  1YRU B;  4HRH A;  2FOT A;  1FW4 A;  1EJ3 A;  1TCF A;  5PAL A;  1YVL A;  4DCK A;  1IG5 A;  1DJH A;  1CTR A;  1QX7 A;  3I5G B;  3D10 A;  4I5L B;  4N1F A;  1V1G A;  2K2A A;  1KQV A;  2O5G A;  3SIB A;  2K7B A;  4AQJ A;  2WC8 A;  5HYD A;  1M45 A;  3E3R A;  5KU1 A;  3CR5 X;  2LVI A;  2LV7 A;  3RM1 A;  3WNX B;  3SG2 A;  1EL4 A;  2BE6 A;  3I5F B;  2M1K B;  3AKB A;  4L9M A;  2PVB A;  4HSZ A;  2JXL A;  4A4C A;  5ER4 X;  4YBH B;  1SKT A;  1N0Y A;  1RFJ A;  4DRW A;  3PAT A;  5I8N A;  2ISD A;  3C1V A;  2MLE C;  2EC6 B;  1IH0 A;  5DKQ A;  3AAK A;  1F4Q A;  1QLK A;  1RTP 1;  1SR6 B;  4BY5 A;  1D1O A;  3I5G C;  3SG6 A;  1TNP A;  2CXJ A;  1B8R A;  4XJK A;  1L2O C;  1WRZ A;  3D0Y A;  1L7Z A;  2F2P A;  3TS5 B;  2L50 A;  2KAX A;  4M2P A;  1G8I A;  1Q80 A;  1MXE A;  2KI4 C;  1NX1 A;  4MRY A;  4MZK A;  1Y1U A;  1A29 A;  2NCO A;  3EVR A;  4PHK A;  3OHM B;  1DMO A;  1DJW A;  3SG4 A;  3JTD B;  5CSJ A;  1SRA A;  2CT9 A;  2LC5 A;  2I7A A;  1OMV A;  2LP3 A;  1NX0 A;  1AHR A;  4PDZ A;  1K9P A;  1S1E A;  2AAO A;  2KFG A;  1XFY O;  2KFH A;  2MHH A;  2Y9Y A;  1A03 A;  1IJ5 A;  2A4J A;  3ICB A;  1OSA A;  1KSM A;  4CPV A;  4FTG A;  2M29 A;  3LK0 A;  4PCW A;  3TS5 C;  2LMT A;  2L4I A;  2R2I A;  1DF0 A;  4YGC B;  1SL7 A;  3DVK A;  3A8R A;  2KNE A;  3OX5 A;  5F6T A;  2K8M B;  1A2X A;  2HPS A;  2KHN A;  3EVU A;  5IBW A;  1GGZ A;  1KFU S;  1QAT A;  3M0W A;  1KFX L;  4YI9 A;  1YVH A;  1E8A A;  4GGF C;  1OOJ A;  4WQ3 A;  4OKH A;  4Q04 A;  2MAZ A;  2K2F A;  1DVI A;  1LVC D;  3WHU B;  3O4Y A;  5K89 A;  1PSB A;  1K95 A;  1H8B A;  2LM5 A;  3I5F C;  4YI8 A;  1YRT B;  1UHI A;  1PRW A;  1CFP A;  2EGD A;  3O2P A;  4ZCU A;  2KGR A;  1R2U A;  1PUL A;  2DOQ A;  5I2O A;  3MSE B;  1BR1 B;  1KQM C;  2AUC A;  2JTT A;  2KQ6 A;  1SR6 C;  2WCE A;  3HX4 A;  1K9K A;  2K7D A;  3FS7 A;  2BEC A;  4IL1 A;  3EK7 A;  1CFF A;  1MF8 B;  3H4S E;  1ALV A;  2CCM A;  1TOP A;  1S36 A;  1M46 A;  4NDB A;  5HKW A;  1CM1 A;  1M39 A;  2NLN A;  3ZWH A;  4AOM A;  4BY4 A;  1RRO A;  1LKJ A;  2LMV A;  3PN7 B;  1F8H A;  1YUT A;  5CSI A;  2KQY A;  4FQO A;  1JBA A;  1ODB A;  1LA3 A;  1Y1X A;  3CGA A;  3IF7 A;  4MSP A;  5KSZ A;  1SL9 A;  3TUY C;  2Y4Q A;  1FI5 A;  3NSI A;  5AFP A;  1DJG A;  4NQG A;  5J3X A;  2BCB A;  1DGU A;  1ZUZ A;  2KI6 D;  4HRG A;  5DKR A;  3VRQ A;  1QLS A;  1CM4 A;  1TTX A;  4I5N B;  4MBE A;  4OV2 A;  5HLO A;  3BUX B;  1J7R A;  1DJI A;  4PE1 A;  1CDM A;  2OTG B;  2BL0 C;  2KI6 C;  4QJ5 B;  2LHI A;  1REC A;  2ZRT A;  3PN7 C;  3OB1 B;  2JC2 A;  2BKI B;  2F33 A;  1SCV A;  2M8U A;  1R6P A;  1IWQ A;  2BCA A;  1IJ6 A;  2BBM A;  4YGE B;  4A4B A;  2KSP A;  1MQ1 A;  2KYF A;  2F3Z A;  3HCM A;  4N1G A;  1SNL A;  2WCF A;  3EKH A;  2G2B A;  3GK2 A;  2KYC A;  1TNW A;  2LLU A;  1BOC A;  4QJ3 B;  3BOW A;  1GJY A;  4DIR A;  1QIW A;  1AVS A;  2FJU B;  4NDD A;  1ZFS A;  2HET A;  3TDU A;  1IQ5 A;  1JFJ A;  4PHM A;  2WOR A;  2BKH B;  1DT7 B;  3VRR A;  2LE9 B;  1WDC C;  2BBN A;  3I5H C;  1SPY A;  4C0L A;  2COL B;  2HF5 A;  3EVV A;  1UHH A;  3VRN A;  4GGF A;  2Q91 A;  2K7C A;  3BUW B;  4C0K A;  2IS9 A;  1B4C A;  4WQ2 A;  1M31 A;  1QIV A;  1S5G Z;  1SK6 D;  1HQV A;  5ER5 A;  1F71 A;  1K9U A;  2L2E A;  1NCZ A;  5D69 A;  4JPZ B;  1PVA A;  1S6C A;  2F2O A;  4NDC A;  2JT0 A;  5HLV A;  3SG5 A;  2M49 B;  1IKU A;  2K61 A;  1EXR A;  4YGA A;  2M7N A;  2HQW A;  3DVM A;  1WDC B;  3BXK A;  2KAY A;  1KFU L;  1SYM A;  5DKN A;  2JRF A;  3KF9 A;  1U5I A;  1BG1 A;  3DVE A;  4ETO A;  4GUK A;  3WHT B;  1FF1 A;  2ZN9 A;  4R1E A;  1JFK A;  1U5I B;  3PLF B;  1CLL A;  5CPV A;  4MRX A;  1DJX A;  2JXC A;  2LVV A;  2EC6 C;  1XFW O;  2NXQ A;  3GK4 X;  1UHK A;  2LHL A;  2M3W A;  1S3P A;  1AK8 A;  1JC2 A;  3QRX A;  2F3Y A;  2HQ8 A;  3PM8 A;  4I5J A;  2L51 A;  1NUB A;  3I5I C;  1KFX S;  1W7J B;  4GPL B;  1AP4 A;  1V1F A;  1B1G A;  3TDZ A;  3TZ1 A;  4OR9 B;  3NXA A;  1XFV O;  2ZKM X;  1SMG A;  2E30 A;  1J7P A;  4P5O E;  1QJT A;  1B7T Z;  2JT8 A;  4MN0 A;  4ORC B;  3JVT B;  1KK8 C;  1CDN A;  2ZN8 A;  1QVI Y;  3BUO B;  1PVB A;  1WRK A;  4CFR A;  4N5X A;  1IGV A;  2OS8 C;  4UPG A;  1K93 D;  3I5H B;  1NPQ A;  2L5X B;  1J1D A;  4GFT A;  1YUR A;  1BF5 A;  3BOW B;  2ZFD A;  1XK4 C;  2K7O A;  2D8N A;  4D1E A;  1VRK A;  3PAL A;  4PAL A;  1A4P A;  1DJZ A;  4MEW A;  1KK8 B;  2KGB C;  3GK1 A;  2RGI A;  2M9G A;  1FPW A;  4PE4 A;  2V53 A;  4PHN A;  4GAO A;  4GBA A;  1LIN A;  1B9A A;  3KEV A;  1F54 A;  1CFD A;  2I94 A;  1YX8 A;  3TDI A;  2LAP A;  1WY9 A;  3FWC A;  2CBL A;  5AER A;  1NIW A;  5FYX A;  1CDP A;  1UP5 A;  1S26 D;  1WLM A;  3SIA A;  1EH2 A;  1OZO A;  3BQ3 A;  1NX2 A;  2ZRS A;  1S6J A;  3KPX A;  3DF0 A;  2JPT A;  1DGV A;  1F4O A;  2LVK A;  2M1U A;  1KQM B;  3DF0 B;  1C7W A;  1UUS A;  1NCX A;  5HKZ A;  3OP0 A;  1B7T Y;  1TCO B;  4MZJ A;  4JWQ A;  1BOD A;  1QV0 A;  1CKK A;  1NCY A;  1XFZ O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...