4OVNF

Voltage-gated sodium channel 1.5 (nav1.5) c-terminal domain in complex with calmodulin poised for activation
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
146
structure length
146
Chain Sequence
STEPLSEDDFDMFYEIWEKFDPEATQFIEYSVLSDFADALSEPLRIAKPNQISLINMDLPMVSGDRIHCMDILFAFTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSAMVIQRAFRRHLLQRSLKHASFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords Calmodulin
publication title Regulation of the NaV1.5 cytoplasmic domain by calmodulin.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 146
sequence length 146
chains with identical sequence G, H, I, J
ec nomenclature
pdb deposition date 2013-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ovnF01
1.20.5.1190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces iswi atpase 4ovnF02
2TN4A 1WDCB 1XFWO 2BBNA 4I5LB 1QVIZ 4WQ3A 4MSPA 1CFFA 2CXJA 1XK4A 4QJ4B 2KGBC 1FF1A 1YUSA 1KK7Z 4C0LA 3BUOB 1NX0A 2KGRA 2KQYA 1WY9A 2L4HA 2M9GA 3TS5C 1QX2A 1LA3A 1SCVA 2L4IA 5IBWA 1CMGA 1K93D 1A4PA 2K7DA 1JFKA 1RFJA 2LMUA 5D7FA 1B7TZ 1MXLC 2MLFC 1Y1UA 1IJ5A 3HX4A 3O4YA 1KFUS 1TNWA 1RECA 3LK0A 2BBMA 4GNKB 1QJTA 2AAOA 2KI4B 1CKKA 4NDDA 3VRNA 1IQ3A 3O2PA 1PSBA 2LE9B 1PVAA 2NXQA 2FCDA 2KI6D 1NX3A 2F2OA 1BR4B 2H2KA 1U5IB 3CLNA 1K90D 2ISDA 4BY5A 1F54A 1S1EA 1KCYA 1AJ4A 1A75B 1SL9A 1FBVA 2BCAA 1UHIA 4CPVA 2JNFA 4OKHA 2F8PA 2LV7A 1NUBA 1N65A 1QXPA 1CFDA 1YVHA 2KDHA 2KYCA 1BT6A 2LC5A 3MSEB 4HRHA 1M45A 2JULA 2JXLA 2ZFDA 1EG3A 3BXKA 5DKQA 1FI5A 2Y5IA 3WHTB 1EG4A 4YRUA 4OV2A 1W7JB 1TN4A 3EVRA 5CSNA 1IRJA 1WLZA 1PK0D 3EVUA 3M0WA 1J7OA 3DVEA 4XJKA 1HQVA 1JFJA 2EGDA 1OOJA 3BOWA 1HT9A 2M3WA 3DF0A 2ZN9A 4NDCA 2HETA 2OTGC 3EK8A 1OSAA 4MN0A 3ICBA 1BR1B 1TOPA 2LUCA 2O5GA 1NCXA 4HREE 1KQVA 3RM1A 2JT8A 2I18A 4CLNA 2JZIA 4P2YB 1YRTB 1QVIY 3TDUA 2WOSA 5CPVA 1DJGA 2F33A 2HPSA 3CTNA 3FS7A 1PULA 1KK7Y 2NCOA 4PE0A 4DIRA 2V53A 2MA2A 1CLMA 1S5GZ 5AXIA 3RLZA 1TCFA 5D69A 5I8NA 2A4JA 1H8BA 1SY9A 1LVCD 1ZOTB 2BL0C 2QPTA 2LLSA 3EVVA 1B7TY 1S3PA 1CDNA 5JJGA 1ALWA 1DJWA 1QX7A 2RGIA 4MZLA 3BUNB 1KSMA 1L2OC 4P5OE 4CFQA 4JWQA 1J7RA 1DJYA 2L50A 4C0KA 2PRUA 1DT7B 1XYDA 1KFUL 1UHNA 1SR6C 4ETOA 3VRPA 3LLEA 2G2BA 1OMVA 1TNQA 3PLFB 1F8HA 1DJHA 2B1UA 1CM4A 2K7OA 3LK1A 2KHNA 4M2PA 4YGBB 2NLNA 3H4SE 2KYFA 1SKTA 2LVJA 4GFTA 4YGAA 3C1VA 5HKZA 4YI9A 4I5NB 1XFXO 1PALA 4OR9B 1TIZA 1GQMA 2LAPA 3OB1B 5JOLA 2L2EA 2BECA 2MRDA 2ZNEA 3DVJA 4N1GA 3TS5B 2I7AA 4YBHB 2BCBA 1XVJA 5CSIA 1TNPA 3D0YA 1WLMA 1UURA 1NX1A 2LP2A 2PVBA 1TNXA 2M7NA 3TDIA 2O60A 4PHKA 4YGEB 2CNPA 1OZOA 3CR2A 3KPXA 3IQQA 1ZUZA 1OFCX 3AKAA 4ORCB 2KBMA 1OMRA 1MWNA 2HF5A 4PHNA 2QACA 4YGDB 2KSPA 1QIVA 1Y1AA 3I5IB 3PN7B 5F6TA 1LA0A 1QV0A 3O6BA 2LP3A 1SNLA 1RWYA 4XJKB 2PASA 1K96A 1A03A 2BE4A 3JVTC 3QRXA 1J7PA 1B8CA 2MLEC 1KK8B 3CZTX 3BOWB 1BF5A 4ICBA 2L98A 1SCMC 3DF0B 2K7BA 3NSLA 1CLBA 2KAVA 2M7LA 1CB1A 1Q80A 3WNXB 1S5GY 3CGAA 3LCPC 1ZACA 1E8AA 1TCOB 3GK2A 1CTRA 1L7ZA 1NYAA 1XA5A 1JF0A 1M39A 2LANA 1S26D 1RK9A 2WCFA 2CTNA 1WRZA 2JWWA 2LLTA 1B47A 2BKHB 2BE6A 3BUMB 4TNCA 3NXAA 5AFPA 3ZNIA 1X02A 2JQ6A 2LCPA 1NCYA 1JUOA 4GGFC 3TDZA 1RROA 1IGVA 1V1GA 1AVSA 3SG4A 5CSFA 1F4OA 1EH2A 3I5GC 2IS9A 1F70A 1AJ5A 2OTGB 2F3ZA 1FI6A 1K8UA 1UP5A 1QATA 3OHMB 1J55A 1CFCA 1YUTA 3NSIA 1EL4A 1CLLA 1QS7A 4I5JA 4QJ5B 2SCPA 4DCKA 4MBEA 1AP4A 1C7WA 2OS8B 4CFRA 1M31A 1YR5A 3NSOA 4I5KA 2WCEA 1KSOA 4E68A 2LMTA 3CR5X 5PALA 1S6JA 1QV1A 3EK7A 3PALA 4GGFA 1IJ6A 3TUYC 1YURA 4GPLB 2PALA 1YVLA 2EC6C 2JT3A 1JBAA 1M63B 1LKJA 2I94A 4AQIA 2BL0B 3BQ3A 5GQQC 1KFXS 1OQPA 2LMVA 2MHHA 2FOTA 1C07A 1XFZO 4HSZA 4GBAA 1KWOC 4JQ0D 4NDBA 1L2OB 3CS1A 2H61C 1G33A 1A29A 1B8RA 1DJIA 2Y4QA 1BLQA 4CIDA 2M1UA 1OMDA 2ZRTA 3PFVA 1C7VA 1JWDA 2FCEA 4ORAB 1MHOA 2M97A 2JTTA 3JTDC 3AKBA 1K9PA 4A4BA 2F3YA 1QASA 1H4BA 1SR6B 1IWQA 2Q4UA 2BKIB 4N1FA 4WRIA 1U5IA 5CSJA 5I2LA 4MEWA 1YUUA 3HCMA 1KQMC 1BU3A 2Y9ZA 1DJXA 1A75A 2LVKA 3I5FC 3NSKA 1DJZA 2F2PA 1YTZC 1IKUA 1IG5A 2LVIA 1GGWA 2LUXA 3OB2B 2FJUB 1EXRA 3E3RA 1MF8B 3A8RA 1UHHA 1CDPA 2M49B 4WQ2A 2H61A 1GGZA 5AEQA 1JF2A 1XFYO 4PALA 3WHUB 3PATA 4FTGA 3DVKA 2OPOA 2GV5A 1K9UA 2LHLA 2Y1MA 2ZN8A 1QLSA 1S36A 2JPTA 2GGZA 1M46A 1F55A 1A2XA 1QLKA 2ZRSA 3EKHA 2SASA 2KFFA 1SBJA 2BCXA 2PSRA 5HKWA 2KAXA 3BUXB 2JT0A 1SYMA 1J1EA 2CT9A 3AAJA 4DS7A 1B9AA 1GJYA 2LVVA 3CR4X 2VRGA 1QIWA 1B8LA 1IQ5A 1UHKA 1VRKA 1OZSA 3FIAA 1EJ3A 2M8UA 2P6BB 1TRFA 2K2AA 4ZCVA 2EHBA 2NZ0A 2JNXA 4OVNF 1DTLA 3GOFA 5KU1A 3I5HC 3PM8A 2M0RA 4QJ3B 2KBIA 1DGVA 1SCMB 1DMOA 1ODBA 1DF0A 4M2OA 1N2DA 2WC8A 3SG5A 1AK8A 1WRKA 3TZ1A 3BYAA 4XYNA 3SG2A 5BPJA 2ZNDA 5TNCA 3VROA 1BMOA 2LM5A 1K2HA 4R1EA 5FYXA 1SL7A 2M1KB 1K95A 2K2FA 4PHMA 4MZKA 1PRWA 1KFXL 1WDCC 2JTZA 4OCIA 1YX8A 4U8DA 4ZCUA 2K0JA 3SIAA 5I2OA 1BOCA 2PMYA 3FWBA 4A4CA 4DRWA 4PE7A 2Y1NA 1IH0A 3CWGA 3I5GB 4ORBB 1AUIB 1SPYA 1QX5B 1BJFA 3LL8B 3SJSA 2NCPA 5KTYA 4AQJA 2CCMA 4Q04A 1OE9B 1Y0VH 3KF9A 1BODA 1XFUO 2MBXA 1CFPA 3SG6A 3D10A 2KOTA 1N0YA 1XO5A 3I5IC 3GK1A 3PN7C 1FW4A 5HLOA 5K89A 1LXFC 3SG3A 3AAKA 1BG1A 1UHJA 2LLUA 2L51A 4YGCB 2JOJA 1SMGA 2CBLA 2KI4C 1CDMA 3K21A 1Y1XA 2E6WA 3EKJA 1PVBA 3SIBA 1KK8C 3VRQA 4MZJA 1NIWA 3FWCA 3TUYB 3OX6A 2EC6B 4MVFA 1B1GA 1QTXA 2LNKA 2HQWA 1DVIA 1CMFA 3KEVA 1Y6WA 1ZFSA 3A4UB 5I2QA 1K94A 1KWOB 4C0JA 4D1EA 1CDLA 2KQ6A 2M29A 4PDZA 1NSHA 2LHIA 2KI6C 1F71A 1SK6D 3VRRA 4AOMA 5G08A 2KFGA 2DOQA 1B4CA 3BUWB 3JTDB 1NWDA 5ER5A 3ZWHA 1AHRA 3F45A 1R6PA 5J3XA 1D1OA 3DVMA 2JXCA 1NCZA 1KQMB 3OP0A 3SG7A 1S6IA 3I5FB 1ALVA 3EK4A 4MRXA 1J7QA 1MXEA 5AANA 3GK4X 3D0YB 1JSAA 1JC2A 2L0PA 1TTXA 2WORA 3O78A 1SL8A 4NQGA 4USLA 5HLVA 1WRLA 1PSRA 1RJVA 2KNEA 3PSRA 4N5XA 5KSZA 2Y9YA 5HYDA 1XFVO 3KO0A 5HKYA 1UUSA 2HQ8A 2K61A 2JU0A 2ZKMX 2OS8C 1DGUA 1G4YR 4PE1A 1FPWA 1MQ1A 3KHEA 4YI8A 1NX2A 1W7IB 4DUQA 5AERA 2JRFA 1DF0B 5DKRA 1ZMZA 4UPGA 2WNDA 4L9MA 2K8MB 1K9KA 2D8NA 2G9BA 1F4QA 1LINA 4F0ZB 1J1DA 4IL1A 1G8IA 3IQOA 3VGOA 2Q91A 1UWOA 1NPQA 1R2UA 4PE4A 5B8IB 1MUXA 5ER4X 3DD4A 1CNPA 3I5HB 1XK4C 4MRYA 1MR8A 2R2IA 2JC2A 2AUCA 2WCBA 4GAOA 4GUKA 4FQOA 1CM1A 4PCWA 4GGNA 4M2QA 1SW8A 1SRAA 2COLB 2E30A 1S6CA 4MLWA 2GGMA 4BY4A 1YX7A 2KFHA 3IF7A 3JVTB 4JPZB 1RTP1 2I2RE 1NP8A 1V1FA 5DKNA 2MJWB 2L5XB 2AMIA 4HRGA 4PHJA 3OX5A 2MAZA 2K7CA 1YRUB 2KAYA 3WXAA
chains in the Genus database with same CATH superfamily
4H13B 1WDCB 1HJ0A 5CBNA 1ORGA 4MSPA 5AW0B 2KGBC 2KLVA 3TNUA 1OWAA 2E74B 2K88A 1JO5A 4C0LA 3AEEC 3BUOB 1NX0A 2K3RA 2KSEA 3S0AA 1FE6A 4AQRD 2L4HA 3TS5C 2PFXA 4QMAA 1VQPP 1GU5A 1K93D 3AE9C 1RFJA 1SSEB 5TJHA 1OXZA 1ZRTD 2NZ2A 2QJYC 3O4YA 1KFUS 1T6AA 1Z2CB 1KZUB 3CWBE 2BBMA 3D74A 4GNKB 3O6QB 2PGDA 2C9NY 3MIWA 1PVAA 3BFAA 1NX3A 2ISDA 3JC22 1GW3A 3O8ZA 2I8DA 3BRTB 3LW5H 3Q5RA 3C8VA 3L71G 1CFDA 2LC5A 4HRHA 4WY4D 4YXDC 3PRJA 2BEZF 3D76A 1EDIA 2JULA 1FI5A 1BCCE 4Y99B 3RL0g 2Y5IA 5KLVD 1SQQE 4OV2A 1YTZT 4O9BA 3I55P 1X22A 2YIUC 2P71A 3QWOC 5B66H 1WLZA 3V2LA 1PK0D 3CZ2A 3DVEA 3TK1A 1HJBA 3AEDC 4K3AA 3VMAA 2IYPA 1T2KD 3BOWA 2M3WA 2FYUK 3P8CE 2ZN9A 3VYIA 3C9IA 3OGNA 5APWA 1JB0J 3WMM0 4I1LA 2VRSA 2RKLA 1KQVA 3RM1A 3FWNA 5CJ0A 5K5GB 2KSJA 3TDUA 2WOSA 1ZW0A 4IFMA 2IBZD 4HB1A 1OVUA 2V53A 3CCRP 2IZ1A 3B86A 3RLZA 2QM7A 3AE2C 2BCCG 5D69A 5I8NA 1H8BA 2L5GB 3H1KE 2LLSA 3L73G 1B7TY 2KZJA 3MP7B 1ALWA 4LLHA 1XTCC 1L2OC 4P5OE 2POHA 1J7RA 1JUNA 1XYDA 1EDLA 2OQQA 4ETOA 1NU1J 3VRPA 1YQ3C 1SQBG 2WC6A 2L2CA 4GFTA 3CZ1A 4YI9A 4I5NB 1JY2O 3L70D 1TIZA 4OGQC 4N1GA 3TS5B 3L74D 2I7AA 1OVRA 3H1HG 1XVJA 1OOIX 1JNMA 4I2LC 2IBZI 1TNXA 2I1KA 3AECC 1OZOA 2QJYB 3IQQA 1GW4A 1OFCX 2LR2A 4EIJA 3T97B 2ZYAA 2KBMA 1LTSC 1IK7A 1MWNA 2NPSC 4PHNA 3NMDA 3PTZA 1S9KE 1VQ4P 2WVRA 2LKMA 1QIVA 1LA0A 5KLVK 3O6BA 2WSEH 3CWBD 1TUZA 2PASA 1M90Q 1GZLA 3Q5SA 1OZHA 3BOWB 1SCMC 2K7BA 1CLBA 2KAVA 4LGDE 1ZACA 5APTA 1E79H 1XA5A 1GTWA 1OMIA 1K04A 1M39A 1T14A 2NPSA 3KXDA 3HTKA 1YIJP 1RK9A 2KXPB 2BE6A 3BUMB 1BCCD 1JUOA 4GGFC 1RROA 1IGVA 3SG4A 5KJ7C 1UIXA 2QJPB 1S3JA 3G6EP 2IS9A 3GMAA 1UP5A 3M0DC 3EG5B 1CFCA 4PD4E 1NU1E 4QJ5B 4DCKA 1Q2NA 1AP4A 3A7OA 4CFRA 1M31A 1YR5A 3HD7D 4I5KA 2OYHC 2WCEA 4BRYA 1NWQA 1FDIA 3SFEC 1G2CA 3EK7A 4GGFA 1IJ6A 5KJ7A 4Z1MH 3JCUH 1JBAA 1FBMA 5BVZA 3BQ3A 1PL5A 1OQPA 1KN7A 2FOTA 1C07A 1XFZO 4GBAA 2R5BA 4KT0J 1L2OB 3M0DA 3VB1A 1B8RA 1DJIA 5H2FH 4CIDA 3SWKA 4H44D 3E7KA 4HYTB 1LWUC 3RK2D 1C3YA 3H1KD 3Q3DA 3EFGA 2W8ZA 1IIOA 2WITA 2KYVA 4WRIA 3L71J 2OYHA 3S9OA 2Y9ZA 1BU3A 1OOFA 1DJXA 1DC1A 1L0LG 1ZOYC 1DJZA 3VP9A 5KKZB 2LVIA 1T8ZA 3L75G 3OB2B 1UHHA 4WQ2A 4OGQB 4JKTA 1N86A 1L4AD 1LWUA 3WHUB 3B7AA 1GK6A 2YKQA 2FJYA 2GV5A 3CLQA 1M46A 1F55A 1QLKA 2ZRSA 2FYNC 2L91A 4HH2A 2Q7CA 2BCXA 5HKWA 2E76D 1SYMA 3UNWA 2CT9A 3H25A 1GJYA 2NPSB 1B8LA 1UHKA 1VRKA 4C7NB 2M8UA 4W7YA 1TRFA 2FKWB 2KNCB 3PM2A 3GOFA 1NTKG 2M5AA 1K9MQ 2M0RA 3II6A 1S9KD 2YO3A 3CX5E 4W7ZA 1SCMB 1DMOA 1G1IA 1ODBA 1DF0A 3ITKA 1AJYA 1SQQK 1GD2E 2E43A 4XYNA 1PGJA 2WC5A 1BMOA 3A2AA 5FYXA 1JY3O 2R32A 2E5YA 2K2FA 4BRYB 4MZKA 2JTZA 4U8DA 3SIAA 2K0JA 1SQBJ 4W80A 1GL2C 1BGYE 4PE7A 3KDPB 1AVOA 3DZTA 5KTYA 2N1TC 4ZMDA 3RK3C 4PV1D 2WPSA 1BODA 1ZP0C 1PP9G 2MBXA 1CFPA 3GLMA 3L71E 1N0YA 3GK1A 2WSCJ 1FW4A 3S0BA 3H1HJ 2LLUA 3B5NC 2OYHB 2CBLA 2YMYA 1N8RQ 2HODA 4PD4D 1NU1D 4RESB 3VRQA 1GL2A 1B1GA 2Q1KA 1OX3A 3KEVA 4DOJA 1ZFSA 2N1TA 5AW5B 1CDLA 2KQ6A 2P58A 2W83C 2KI6C 1NYHA 1LWUB 3M9BA 2KFGA 2A45G 2FFDB 3BUWB 5ER5A 2GA1A 1NTME 3B88A 3B5NA 3H1JG 1NTZG 1YQ4C 1JOCA 3EK4A 1SQXG 3S0DA 3CCEP 1MXEA 4GT1A 1PPJG 3GK4X 2KS1A 1DH3A 2L0PA 3O78A 4NQGA 4USLA 5KSZA 1IFIA 3OAKA 1GU4A 1RJVA 5HKYA 2O01N 3B8EB 1JY2N 1QWVA 2OS8C 1DGUA 1X0TA 4OWFA 5KTBA 2FYNB 2XZRA 1DD4A 1DF0B 4C7RA 4PD4I 1GM0A 3MGNA 4L9MA 4H0LD 2Q6QA 1KQSO 1JY3P 1VF5C 1K9KA 4IL6X 2O1JA 2HYNA 3V2PA 3MZWB 2AXTH 2R5DA 3PLNA 5ER4X 1A02J 2Q9IA 1T3UA 2O01H 3O4XA 1CNPA 1MR8A 4ZKUA 4UB8E 4GAOA 5AVVB 1CM1A 3H1HE 2N9YB 1SW8A 2O1KA 2C0XA 3W67A 4H13D 2E75C 3HUSC 1RTP1 2I2RE 1NP8A 1V1FA 5DKNA 3CX5D 2L5XB 2AMIA 4PHJA 3OX5A 2MAZA 1VQ6P 2K7CA 1M1JC 2E74D 4NDBA 4YGCB 1Q90D 2H88C 3FXEA 1XFWO 4I5LB 2HODB 4WQ3A 1CFFA 2GUSA 2M3BA 2CXJA 3CXHH 1NU1K 1KK7Z 1VQOP 2KGRA 2KQYA 3A0HE 2PYQA 2M9GA 2N1TB 4N3YB 1QX2A 5IBWA 1CMGA 3G71P 2K7DA 1BGYD 3HUSA 4JD9A 4GIFA 2E42A 1NJIQ 2Z5IA 3U1AA 3B5NB 1TNWA 1RECA 1M1JA 2AAOA 1K73Q 4NDDA 3H1IE 2OYIC 2KS1B 5AVQB 2NXQA 4JF7A 1BR4B 1HH0A 2HG5D 4BY5A 1KCYA 2IX7C 1RQUA 1A75B 2AEFA 1HWTC 1OVVA 2LV7A 1NTKJ 1URQC 4PT1A 1QXPA 1YVHA 2PP6A 5BU5A 3MSEB 4PJ0H 5AW7B 3CX5I 3BXKA 2JXLA 1EZVG 5FI2A 1JCCA 4JBZA 3G3ZA 1FZCB 2AXCA 2PQLA 1QVFO 1EG4A 3IVTA 4OZDA 1KFNA 1TN4A 2OYIA 1NTMD 1HQVA 1LGHB 4D6TG 5GTIE 3BASA 1J2JB 2FXMA 1MKMA 2L5YA 1X79B 2JEEA 1FZAA 1URQA 3DF0A 1SFCC 3DXLA 1OSAA 4MN0A 3V2NA 1YI2P 1TOPA 2O5GA 2JT8A 1YRTB 1QVIY 2BNXA 1KILC 1KFMA 4DIRA 3CCJP 3FS7A 2YNYA 1S5GZ 2A4JA 1SY9A 2Y0CA 1LVCD 1ZOTB 2BL0C 1S3PA 1CDNA 1SFCA 2RGIA 4K35A 1QVGO 3WU2E 2PRUA 1DIPA 2PAJA 1SR6C 1KILA 1KYOH 3FWLA 1Q7YQ 2E75B 3HUSB 1AVYA 1OMVA 1OW6A 1TNQA 3PLFB 1F8HA 1YTZI 2B1UA 2HFED 2KHNA 4YGBB 2K9JA 2W6BA 1SKTA 1NTZJ 3C1VA 2A06G 5E79E 1JY3N 1SQXJ 1U7MA 1XTGB 4OR9B 1GQMA 3OB1B 5JOLA 2ITAA 3NHTA 4INXA 3DVJA 4YBHB 2KLEA 3D0YA 3TGUG 1WLMA 1UURA 5KLIC 1N73C 4JYBA 3TDIA 2KPHA 4PHKA 2CNPA 3CR2A 3KPXA 3CCLP 1ZUZA 4UB6E 1OW7A 2K37A 1MZ9A 1IK9A 3I5IB 3PN7B 3VP8A 5F6TA 5AW2B 2OYIB 2OGUA 1SNLA 3BRVB 3QMEA 1A03A 2BE4A 1J7PA 1NTMK 2MLEC 3H1ID 1KK8B 3CZTX 1URQB 3IF4A 2LXBA 4M3LA 3DF0B 1N73A 2M7LA 1RF1C 3WNXB 3LCPC 2Y0DA 1E8AA 5AVRB 1CTRA 2Z4EA 4XE5B 2YKOA 2LANA 2CTNA 2LLTA 2BKHB 2FXOA 3ABVC 2B87A 4YTPC 3NXAA 5AFPA 3ZNIA 1X02A 1Z56A 1LNQA 1V1GA 5D3OA 5APYA 1F4OA 1P84E 1L0NE 1EH2A 2RMZA 3I5GC 1F70A 3L72E 1SFCB 2F3ZA 1RF1A 3OHMB 2Q5UA 1IO4A 1OOHA 3H1LE 1CLLA 3HE5A 1VQ5P 3LW5J 1C7WA 1KILB 3CI9A 1RE3C 3NSOA 2E5TA 4IL6H 1VL2A 1NTZE 2KUBA 1KSOA 5GTHE 5PALA 3PALA 2K9JB 3TUYC 2PALA 1PPJE 1YVLA 2EC6C 1LP1A 1M63B 1LKJA 2BL0B 4HSZA 4JQ0D 3CS1A 2H61C 2H43A 2OTLP 1BLQA 1WRGA 1FS0E 4WY4C 1G1JA 3PFVA 3N7NA 1HGZA 3JTDC 1K9PA 4A4BA 1QASA 1SR6B 3L37A 2Q4UA 4N1FA 1RE3A 1U5IA 2QA4P 3TNUB 1KQMC 1S2EA 1M1KQ 3L4LA 3NSKA 2YKPA 2F2PA 1J1EC 3PHLA 3AE4C 4ASWA 4PD4H 4OGQD 2H8VA 3M06A 1IG5A 5L8RJ 2LUXA 2FJUB 2KZIA 1MF8B 1PFIA 3IR9A 3V2RA 4ZKPA 1H88A 2H61A 3D77A 4WY4A 5AEQA 1XFYO 4PALA 4EDFA 5FI6A 4DT0A 1N7SC 3DVKA 3B71A 1HTLC 2M8RA 2LHLA 1JCDA 5KLIB 2GGZA 1N73B 2XDJA 5C39A 1A2XA 3EKHA 2WQYC 2KFFA 2NPSD 1SBJA 3Q1MA 2KAXA 1VQ9P 1TWOA 1J1EA 3MHVA 4DS7A 1B9AA 3U59A 2VRGA 1VQKP 5AVWB 3D6ZA 2D2CC 4ZCVA 2GM4A 2XNDH 2WWWA 4OVNF 3R2PA 2FYUG 1H0TA 3PM8A 1GDTA 1DD3A 1N7SA 3AEGC 2ZT9C 1JM0A 2XU6A 2JP3A 1DGVA 3HRNA 1RF1B 2WC8A 5BPJA 3HE5B 3RK3E 2ZNDA 3CYZA 1PIXA 1K2HA 1LT9C 5AVZB 1XFRA 5KJ7D 3AEBC 1KV4A 4PHMA 1PRWA 1KFXL 5I2OA 1NKZB 1A02F 3OW2O 1LP1B 5B66E 3I5GB 1SPYA 1BJFA 1SQVG 3SJSA 2YIUB 4BWNA 2QG4A 4IJ7A 2CCMA 4Q04A 3S0FA 1XFUO 1FOSF 3W68A 3BJHA 3D10A 3E1RA 1P84D 1XO5A 5K89A 1L0ND 1HGVA 3TGUJ 1LT9A 1SQQD 3L72D 1BG1A 2W90A 3CX5H 2JOJA 1SMGA 2KI4C 3H1LD 1Y1XA 3SIBA 2G8YA 3TUYB 1NIWA 3OX6A 2EC6B 4MVFA 3P7KA 2LNKA 4XFJA 1DVIA 1Q82Q 2BAPA 3P8CD 3AE6C 3D71A 1NTZD 3A4UB 5I2QA 2H8PD 2V7QH 4PDZA 1JY2P 2LHIA 4I6MC 1PPJD 4AOMA 1R5LA 2DOQA 3GHGC 3JTDB 1NWDA 2QSIA 3GF7A 1R6PA 5J3XA 2KLDA 3DVMA 1FZFA 1NCZA 1KQMB 1KB9E 2YGUA 3SG7A 5M1BA 3TDKA 1J1EB 5KLVG 1J7QA 1FU1A 2J59M 4CFQA 1WRLA 3PSRA 4N5XA 1UUSA 4RO0A 3IFMA 2XKMA 1P84I 4PE1A 1N7SB 3GHGA 3KHEA 2Q3IA 1W2EA 1NX2A 1FAVA 3E1IA 3M9HA 2WNDA 2K8MB 2A45I 1ZV8A 2IBZG 2HPCA 2QEBA 3G9RA 4Y28J 2HLOA 1R2UA 1W9ZA 5B8IB 2A06E 3F89A 2CPSA 1K8AQ 4MRYA 2ZT9B 2JC2A 3HTKB 2QEOA 5CCHD 2AUCA 2WCBA 4GUKA 4PCWA 4GGNA 3TGUE 2W27A 3CC2P 1SRAA 2COLB 1S6CA 2BCCJ 5CCGD 3L73J 5CMZA 3S4RA 1L0NK 1TU3F 3Q5PA 3B6XA 1PGQA 1YRUB 3WXAA 2BBNA 3M0AA 3BCCG 5APVA 2N1TD 2KLUA 4U3FG 3DY9A 3RGUA 3KZIE 1FDMA 1YUSA 3S1KA 1PV3A 3L70G 5AVTB 5B5EE 1AQTA 2L4IA 1LA3A 5DJTB 3L74G 1A4PA 1G2CB 1NTZK 3B5ND 2E76C 5D7FA 1B7TZ 1MXLC 1SP4A 5AW4B 1Y1UA 1IJ5A 4UB8H 1YHQP 1QJTA 2KI4B 3VRNA 1IQ3A 3O2PA 1PSBA 2LE9B 3RL0C 3EQ2A 1NH4A 1S5LE 2KI6D 2F2OA 3CLNA 1K90D 1F54A 2QIWA 3JCUE 1S1EA 3RBZA 1AJ4A 3CWBG 1ZMEC 2BCAA 4CPVA 4OKHA 1Z4HA 2F8PA 3VOPA 1NUBA 1N65A 2KDHA 3Q8IA 2KYCA 1RH5B 1LTGC 1BT6A 3GHGB 5BU8B 3MUDC 2ZFDA 2JO1A 5DKQA 3CCQP 3WHTB 1QX8A 2M3EA 4YRUA 1USDA 5AVUB 3EVRA 3L4AA 2HPCB 2K60A 3M0WA 3EVUA 1J7OA 5AW9B 1KILE 1EC5A 1KB9D 1MUUA 1CI6A 1NVOA 3NXSA 2WSFH 1OOJA 4PV1C 4NDCA 2HETA 2OTGC 3EK8A 2N9BA 4A7PA 3ZDMA 2C9LY 3ICBA 3MUDA 3D6YA 2LUCA 2BCCE 1SQVJ 1PGPA 1KTMA 4OH8B 3L73E 1HVVA 2M5AB 3NFQA 5CPVA 2HPSA 4PE0A 5APUA 1PULA 2I1JA 4IFFA 1TCFA 3BFBA 1N7LA 2H89C 1M56D 2KB7P 1ZLLA 1CSBA 2QPTA 1X9VA 1QX7A 1GK4A 1W5CE 1SQBE 4JWQA 2E75D 1DJYA 2L50A 3C1LA 3M91A 4C0KA 3SSUA 5GTIH 1KFUL 1UHNA 3SWFA 3H1KG 3LIDA 2J5UA 2G2BA 2WZ7A 1CM4A 2K7OA 4M2PA 1BE3G 4ZNCA 2NLNA 3L47A 1KB9I 3TGUD 1SQPG 2LVJA 1WMKA 3CCMP 4YGAA 4EOTA 2R3CA 3L35A 2LAPA 5CBOA 2L2EA 2BECA 2MRDA 2OTKE 1D7MA 2BCBA 5CSIA 1TNPA 1L0LJ 2O01J 1AFOA 1U57A 1NX1A 2LP2A 1GL2B 3R1PA 2FBWC 2M7NA 4H0LC 2O60A 2NRGA 4YXWH 4YGEB 3NHIA 4NPDA 3L75J 3QH9A 3CZ0A 2W6JH 4ORCB 3RK3B 1OMRA 2QACA 2QEXP 2KSPA 1Y1AA 1LTTC 2LP3A 1SLQA 1URQD 3VMYA 1QL1A 3G4SP 1CI6B 3JVTC 4GOEA 3MD0A 3L71D 1SQVE 1BF5A 4ICBA 5E79H 1OW4A 5CJ4A 1CB1A 2UWJE 1TCOB 3AE7C 1NYAA 1L7ZA 5AVSB 2ZXXA 2E74C 2KIKA 2Z5HA 1WRZA 1KMIZ 2LXCB 1Y8AA 4TNCA 1BDCA 1KQFB 2JQ6A 1SFCD 3LIEA 3TYYA 4UB6H 3SFDC 1HF9A 1DEKA 2ZYGA 3AEAC 3BCCJ 1BSNA 2JWDA 2WPVB 4U3FJ 2OTGB 3AE5C 1J55A 1KILD 1YUTA 2KOGA 3NSIA 3L70J 4I5JA 1QS7A 1IFPA 3L74J 2RH0A 4C46A 2OS8B 1ZR4A 1FOSE 5DJUB 4E68A 3CR5X 2M0BA 1S6JA 2BCCD 1YURA 1NU1G 2JT3A 2I94A 4AQIA 3L73D 1PP9J 2YXQB 4R4MA 2MHHA 1VF5B 3UIAA 3P32A 3KYQA 1KWOC 3VROA 3O6QA 1L0LE 1A29A 4HJGH 5TISE 2QM8A 2ZRTA 4KYNA 1JWDA 2WPRA 4NPFX 1VQ8P 4ORAB 1DQEA 2M97A 3L75E 3AKBA 1P84H 1H4BA 1IWQA 5I2LA 4MEWA 1YUUA 3HCMA 1SQBD 2LVKA 3I5FC 1YTZC 3OBVA 1QGKB 3E3RA 1CDPA 2YO2A 5GTHH 3CXHE 2P1JA 3H1HD 1M1JB 3H1JJ 3PATA 4FTGA 2Q3EA 2OYOA 2WCHA 5DICA 2Y1MA 2ZN8A 1QEXA 1S5LX 5APQA 2WCJA 3AE3C 3BUXB 1NTKE 2JT0A 3CCUP 5KAIE 2LVVA 3PJIA 3CR4X 2JR8A 1OZSA 1SS1A 1EJ3A 2BASA 4YPCA 3BCCE 1ZR2A 2NZ0A 2QE7H 4GKGA 1Q81Q 4U3FE 2YXRB 5KU1A 3I5HC 3GW6A 1JMBA 3D78A 3R1OA 1NOHA 3SG5A 1OIPA 1MV8A 3TZ1A 3BYAA 4PJ0E 5TNCA 2LM5A 1SQVD 4R1EA 1RE4C 3H1KJ 2M1KB 3CC4P 1PP9E 4ZCUA 1BOCA 1BE3J 2PMYA 3FWBA 4A4CA 2IFMA 4DRWA 1SQPJ 3V2QA 4IFDK 1IH0A 4ORBB 1AUIB 1DEEG 1QX5B 4AQJA 4TT3H 3KF9A 1RQVA 3SG6A 5HLOA 4EYYQ 3UO9A 3KPEA 1BGYG 4N78E 1RE4A 3AAKA 1UHJA 2QEVA 2L51A 2IYOA 2ZXEB 3VN0A 2RN0A 2E6WA 3EKJA 1SQBK 1QTXA 2QEHA 1DEBA 2HQWA 3USSA 3CMEP 1Y6WA 5AW8B 1FZGA 3H1JE 1KWOB 4C0JA 3T97A 1SQXE 2GUVA 1B4CA 3ZWHA 4FQTA 1JMMA 1WT6A 1FC2C 2GTEA 1SVFA 1D1OA 5FI7A 1IC2A 3KHUA 4KJMA 2JXCA 1L0LD 3TSIA 1NHLA 3R4YA 1S6IA 3I5FB 3A3YB 1KYOE 2QJPC 2JKVA 3A0BE 4N6JA 3L75D 3VMXA 3D0YB 3JSVC 4BXLA 1J1DC 4F7FA 1JC2A 2WORA 1UIIA 1SL8A 2OTJP 2KNEA 2P67A 1NTMG 1IFMA 1AV1A 1N7SD 2IPPA 2Y9YA 5HYDA 3KO0A 1PZQA 3R72A 5KAFE 1S1CX 2ZKMX 3P8MC 1YJWP 1ZN5A 4L75A 4DZOA 4YI8A 1W7IB 3A5TA 2J58A 3CC7P 2JRFA 1T2KC 4MN4C 3FE6A 4L76A 2PRRA 4UPGA 3CXHD 1EQ7A 4D6TJ 2D2CD 1QLED 1F4QA 1LINA 2B9BA 3N7HA 1J1DA 1G8IA 1BE3E 3VGOA 2Q91A 3L36A 1UWOA 2ZT9D 1SQPE 1SQVK 4WBAA 1NTKD 4PE4A 1MUXA 1KB9H 2P2UA 3HE4A 1U7JA 4CPGA 3I5HB 1XK4C 1W2BO 2B87B 1USEA 3CDNA 3BCCD 4U3FD 5KKZC 4BY4A 3M9QA 4MLWA 2GGMA 1YX7A 2KFHA 4JPZB 2V4HA 1Y9BA 2H7HA 2ZJSE 2TN4A 2G3AA 4HKZH 1H8AA 1QVIZ 2WSSH 1XK4A 4QJ4B 3EWKA 1FF1A 2DW3A 1TUJA 4L73A 1KORA 3CCVP 2AEMA 2XV5A 4WWIA 3FX0A 1OOGA 1WY9A 4EI2A 1EXIA 1SCVA 1PP9D 3CXHI 1DELA 1JFKA 3R1VA 1RHZB 2LMUA 3SS3A 2KI7B 2MLFC 3HX4A 3LK0A 2WSEJ 1CW5A 4AUWA 1C3ZA 2BEQD 1L0LK 3K1EA 4IL6E 5AW6B 1PGOA 3FE8A 4N78D 2FCDA 2H2KA 1EZVE 2B88A 1U5IB 1VQMP 1SL9A 1FBVA 1T3JA 1UHIA 2JNFA 3KQGA 1NAFA 2R3SA 4C7NA 3H1IG 3KZIH 2KK7A 1M45A 2KNCA 4D6TE 1EG3A 1CZQA 3H1JD 5AW3B 5B5EH 1SQXD 4WY4B 3SWYA 1W7JB 1VQNP 1DX7A 1S72P 5CSNA 2WCKA 1IRJA 1J1DB 4XJKA 1JFJA 2EGDA 1KYOD 1NAYA 3HE4B 1FDOA 1LTAC 1HT9A 3CABA 1NTKK 2CK3H 3WUUA 1BR1B 3V5BA 1S5LH 4HREE 1NCXA 2I18A 4CLNA 1M8OB 2JZIA 2V7QJ 3FXDA 5AVXB 4P2YB 2W6AA 4TLFA 1H0TB 1LTIC 1DJGA 2F33A 3CTNA 2NCOA 1KK7Y 1BGYJ 4RJTA 3DYEA 2MA2A 3WUVA 1CLMA 5AXIA 3D70A 1LS8A 3HD7C 3WUTA 2FFDC 1Y47A 3AE8C 3EVVA 1EDKA 5JJGA 2AEJA 1DJWA 4MZLA 3BUNB 1KSMA 1BE3D 3PH0A 3Q2YA 2ERBA 1SQPD 2IZ0A 2D2CB 3GF3A 3VMZA 1DT7B 1IFDA 4L74A 3PJSK 3LLEA 4H44C 1MFZA 1RF0C 1DJHA 3RK2C 3LK1A 1R5SA 3V6IA 2MKVA 3H4SE 3HD7A 2KYFA 2FFDA 1KYOI 1LTBC 5HKZA 2FYZA 1EXJA 1XFXO 1PALA 1IZNB 1LT9B 3GG2A 2XNXA 5APXA 1GL2D 1ZXGA 2ZNEA 1NTMJ 1VQ7P 1JTHA 1AQ5A 2HR3A 3RK3D 1FZEA 2PVBA 3CD6P 1RF0A 3D73A 1VDFA 1L4AC 3BFHA 3AKAA 3RL0D 5I94A 2ZVNB 2HF5A 4YGDB 3H32A 4WB4A 1SQXK 1QV0A 1RWYA 1R8EA 4GDOA 2B89A 4XJKB 1K96A 2IDBA 5CCHC 1IFNA 5CHXA 3QRXA 1B8CA 2JDIH 2WSCH 1M57D 2WCLA 2L98A 3NSLA 2JJLA 1L4AA 1EZVD 1Q80A 5CCGC 1LTJC 1S5GY 3CGAA 3GK2A 1JF0A 2ZAEB 1S26D 2FYUJ 2WCFA 1YITP 2JWWA 1B47A 3SS5A 3I56P 2YMKA 5H2FE 4D6TD 2LCPA 1NCYA 3TDZA 3H6PA 3A0HH 5CCHA 1AVSA 5CSFA 4JYCA 3I5CA 4IOIH 1M7LA 1X8YA 2JWAA 1AJ5A 1FI6A 1K8UA 1QATA 3PP5A 5CCGA 1LTJA 1EL4A 2P10A 2SCPA 1BCCG 2WTYA 4MBEA 2ZYDA 2QJKC 1SQPK 1L0NG 2R44A 3CPWO 1SQQG 1HUCA 3L72G 3V4WA 2QVAA 2LMTA 1VF5D 2Y0EA 1QV1A 4GPLB 3H1LG 1NO4A 3HD7B 2QDIA 2QRXA 5GQQC 1KFXS 2LMVA 4LC1A 1EZVI 2CPBA 1G33A 3CMAP 2Y4QA 2WT7A 1FZCC 2M1UA 3B4SA 1OMDA 2ZFCA 3V4QA 1C7VA 2FCEA 1VPCA 1JTHB 1MHOA 2WSFJ 2JTTA 2ZVOB 2F3YA 3N4XA 4NPEA 2BKIB 5CSJA 3H1IJ 2P7JA 4H44B 1A75A 3RK2B 4ASVA 1IKUA 2C0WA 2A06D 2WMMA 1GGWA 1EXRA 3H32B 3A8RA 2M49B 1BDDA 1FZCA 5AVYB 3CL3D 1GGZA 1JF2A 1S4XA 3U1CA 1KQGB 2OPOA 1QL2A 1K9UA 1QLSA 1S36A 5KLVJ 2JPTA 2SASA 1L4AB 3FE9A 2PSRA 1N2DC 2FYUE 3OJAB 3AAJA 5TISH 1YBKA 1MFTA 1QIWA 1LJ2A 5EFWB 1NGMB 2E76B 1IQ5A 3FIAA 5AW1B 4GODA 2P6BB 1IFJA 2O3JA 2K2AA 1FJKA 2EHBA 2JNXA 2FY8A 1DTLA 4INWA 4QJ3B 3WU2H 2KBIA 4KHXA 2P70A 3RL0B 2MJZA 4M2OA 1YJNP 1N2DA 3BVHA 1LTJB 1AK8A 1WRKA 4I7ZC 1P28A 3IN6A 1YJ9P 3SG2A 3L4FA 3S0EA 4AYCA 1FZBA 1SL7A 1K95A 4H13C 1WDCC 4OCIA 1YX8A 1AA0A 1RY3A 3NGVA 5KAIH 2Y1NA 4U7JA 3CWGA 1ZRTE 3LL8B 2NCPA 2WCMA 1OE9B 1Y0VH 2WT7B 1L2PA 2KOTA 3SS4A 3I5IC 3PN7C 2QJKB 1LXFC 3SG3A 4PV1B 1HBWA 3VTPC 3CCSP 1CDMA 3K21A 1EDJA 1JEKA 1PVBA 1KK8C 4MZJA 1IJDB 3FWCA 4GOFA 5APSA 1CMFA 3OA7A 4WVZA 3RZSA 3BATA 2K9YA 1K94A 4D1EA 1KQLA 2M29A 1NSHA 5KLVE 1F71A 3AEFC 1SK6D 3VRRA 5G08A 1AHRA 3F45A 2AXTE 4RKUJ 1OW8A 3TF5A 4Y99C 1LT1A 2OARA 2FXPA 3OP0A 1ALVA 4MRXA 1NKNA 2IFNA 3CWBJ 1GMJA 5AANA 1BSHA 5HLVA 1TTXA 3EFFK 1CKKA 1FJPA 5EL2A 1VQLP 1PSRA 1XFVO 3D75A 2HQ8A 2K61A 2JU0A 3RBXA 1KC8Q 1G4YR 2IBZE 2JPOA 1FPWA 1MQ1A 2A45H 3FGAD 3AE1C 3F5HA 4DUQA 5AERA 2WPQA 5DKRA 3IAOA 2K1AA 1ZMZA 4B86A 3K5BA 1BCCJ 2D8NA 2G9BA 2KP8A 3MTUE 3B87A 4F0ZB 5HL1A 1E5WA 4IL1A 1L0NJ 3IQOA 1SQQJ 4H0LB 3L72J 4R4LA 1NPQA 2FYUD 1Q86Q 3S0GA 3DD4A 2SPZA 4DJGA 3H1LJ 2R2IA 3A0BH 1YYCA 4XA4A 4FQOA 4M2QA 2E30A 4I7ZB 5KAFH 3IF7A 3JVTB 1K05A 3L70E 2MJWB 1H89A 4HRGA 1KD1Q 1JSAA 3NTNA 2KAYA 3L74E
chains in the Genus database with same CATH topology
2TN4A 1WDCB 1XFWO 2BBNA 4I5LB 1QVIZ 4WQ3A 4MSPA 1CFFA 2CXJA 1XK4A 4QJ4B 2KGBC 1FF1A 1YUSA 1KK7Z 4C0LA 3BUOB 1NX0A 2KGRA 2KQYA 1WY9A 2L4HA 2M9GA 3TS5C 1QX2A 1LA3A 1SCVA 2L4IA 5IBWA 1CMGA 1K93D 1A4PA 2K7DA 1JFKA 1RFJA 2LMUA 5D7FA 1B7TZ 1MXLC 2MLFC 1Y1UA 1IJ5A 3HX4A 3O4YA 1KFUS 1TNWA 1RECA 3LK0A 2BBMA 4GNKB 1QJTA 2AAOA 2KI4B 1CKKA 4NDDA 3VRNA 1IQ3A 3O2PA 1PSBA 2LE9B 1PVAA 2NXQA 2FCDA 2KI6D 1NX3A 2F2OA 1BR4B 2H2KA 1U5IB 3CLNA 1K90D 2ISDA 4BY5A 1F54A 1S1EA 1KCYA 1AJ4A 1A75B 1SL9A 1FBVA 2BCAA 1UHIA 4CPVA 2JNFA 4OKHA 2F8PA 2LV7A 1NUBA 1N65A 1QXPA 1CFDA 1YVHA 2KDHA 2KYCA 1BT6A 2LC5A 3MSEB 4HRHA 1M45A 2JULA 2JXLA 2ZFDA 1EG3A 3BXKA 5DKQA 1FI5A 2Y5IA 3WHTB 1EG4A 4YRUA 4OV2A 1W7JB 1TN4A 3EVRA 5CSNA 1IRJA 1WLZA 1PK0D 3EVUA 3M0WA 1J7OA 3DVEA 4XJKA 1HQVA 1JFJA 2EGDA 1OOJA 3BOWA 1HT9A 2M3WA 3DF0A 2ZN9A 4NDCA 2HETA 2OTGC 3EK8A 1OSAA 4MN0A 3ICBA 1BR1B 1TOPA 2LUCA 2O5GA 1NCXA 4HREE 1KQVA 3RM1A 2JT8A 2I18A 4CLNA 2JZIA 4P2YB 1YRTB 1QVIY 3TDUA 2WOSA 5CPVA 1DJGA 2F33A 2HPSA 3CTNA 3FS7A 1PULA 1KK7Y 2NCOA 4PE0A 4DIRA 2V53A 2MA2A 1CLMA 1S5GZ 5AXIA 3RLZA 1TCFA 5D69A 5I8NA 2A4JA 1H8BA 1SY9A 1LVCD 1ZOTB 2BL0C 2QPTA 2LLSA 3EVVA 1B7TY 1S3PA 1CDNA 5JJGA 1ALWA 1DJWA 1QX7A 2RGIA 4MZLA 3BUNB 1KSMA 1L2OC 4P5OE 4CFQA 4JWQA 1J7RA 1DJYA 2L50A 4C0KA 2PRUA 1DT7B 1XYDA 1KFUL 1UHNA 1SR6C 4ETOA 3VRPA 3LLEA 2G2BA 1OMVA 1TNQA 3PLFB 1F8HA 1DJHA 2B1UA 1CM4A 2K7OA 3LK1A 2KHNA 4M2PA 4YGBB 2NLNA 3H4SE 2KYFA 1SKTA 2LVJA 4GFTA 4YGAA 3C1VA 5HKZA 4YI9A 4I5NB 1XFXO 1PALA 4OR9B 1TIZA 1GQMA 2LAPA 3OB1B 5JOLA 2L2EA 2BECA 2MRDA 2ZNEA 3DVJA 4N1GA 3TS5B 2I7AA 4YBHB 2BCBA 1XVJA 5CSIA 1TNPA 3D0YA 1WLMA 1UURA 1NX1A 2LP2A 2PVBA 1TNXA 2M7NA 3TDIA 2O60A 4PHKA 4YGEB 2CNPA 1OZOA 3CR2A 3KPXA 3IQQA 1ZUZA 1OFCX 3AKAA 4ORCB 2KBMA 1OMRA 1MWNA 2HF5A 4PHNA 2QACA 4YGDB 2KSPA 1QIVA 1Y1AA 3I5IB 3PN7B 5F6TA 1LA0A 1QV0A 3O6BA 2LP3A 1SNLA 1RWYA 4XJKB 2PASA 1K96A 1A03A 2BE4A 3JVTC 3QRXA 1J7PA 1B8CA 2MLEC 1KK8B 3CZTX 3BOWB 1BF5A 4ICBA 2L98A 1SCMC 3DF0B 2K7BA 3NSLA 1CLBA 2KAVA 2M7LA 1CB1A 1Q80A 3WNXB 1S5GY 3CGAA 3LCPC 1ZACA 1E8AA 1TCOB 3GK2A 1CTRA 1L7ZA 1NYAA 1XA5A 1JF0A 1M39A 2LANA 1S26D 1RK9A 2WCFA 2CTNA 1WRZA 2JWWA 2LLTA 1B47A 2BKHB 2BE6A 3BUMB 4TNCA 3NXAA 5AFPA 3ZNIA 1X02A 2JQ6A 2LCPA 1NCYA 1JUOA 4GGFC 3TDZA 1RROA 1IGVA 1V1GA 1AVSA 3SG4A 5CSFA 1F4OA 1EH2A 3I5GC 2IS9A 1F70A 1AJ5A 2OTGB 2F3ZA 1FI6A 1K8UA 1UP5A 1QATA 3OHMB 1J55A 1CFCA 1YUTA 3NSIA 1EL4A 1CLLA 1QS7A 4I5JA 4QJ5B 2SCPA 4DCKA 4MBEA 1AP4A 1C7WA 2OS8B 4CFRA 1M31A 1YR5A 3NSOA 4I5KA 2WCEA 1KSOA 4E68A 2LMTA 3CR5X 5PALA 1S6JA 1QV1A 3EK7A 3PALA 4GGFA 1IJ6A 3TUYC 1YURA 4GPLB 2PALA 1YVLA 2EC6C 2JT3A 1JBAA 1M63B 1LKJA 2I94A 4AQIA 2BL0B 3BQ3A 5GQQC 1KFXS 1OQPA 2LMVA 2MHHA 2FOTA 1C07A 1XFZO 4HSZA 4GBAA 1KWOC 4JQ0D 4NDBA 1L2OB 3CS1A 2H61C 1G33A 1A29A 1B8RA 1DJIA 2Y4QA 1BLQA 4CIDA 2M1UA 1OMDA 2ZRTA 3PFVA 1C7VA 1JWDA 2FCEA 4ORAB 1MHOA 2M97A 2JTTA 3JTDC 3AKBA 1K9PA 4A4BA 2F3YA 1QASA 1H4BA 1SR6B 1IWQA 2Q4UA 2BKIB 4N1FA 4WRIA 1U5IA 5CSJA 5I2LA 4MEWA 1YUUA 3HCMA 1KQMC 1BU3A 2Y9ZA 1DJXA 1A75A 2LVKA 3I5FC 3NSKA 1DJZA 2F2PA 1YTZC 1IKUA 1IG5A 2LVIA 1GGWA 2LUXA 3OB2B 2FJUB 1EXRA 3E3RA 1MF8B 3A8RA 1UHHA 1CDPA 2M49B 4WQ2A 2H61A 1GGZA 5AEQA 1JF2A 1XFYO 4PALA 3WHUB 3PATA 4FTGA 3DVKA 2OPOA 2GV5A 1K9UA 2LHLA 2Y1MA 2ZN8A 1QLSA 1S36A 2JPTA 2GGZA 1M46A 1F55A 1A2XA 1QLKA 2ZRSA 3EKHA 2SASA 2KFFA 1SBJA 2BCXA 2PSRA 5HKWA 2KAXA 3BUXB 2JT0A 1SYMA 1J1EA 2CT9A 3AAJA 4DS7A 1B9AA 1GJYA 2LVVA 3CR4X 2VRGA 1QIWA 1B8LA 1IQ5A 1UHKA 1VRKA 1OZSA 3FIAA 1EJ3A 2M8UA 2P6BB 1TRFA 2K2AA 4ZCVA 2EHBA 2NZ0A 2JNXA 4OVNF 1DTLA 3GOFA 5KU1A 3I5HC 3PM8A 2M0RA 4QJ3B 2KBIA 1DGVA 1SCMB 1DMOA 1ODBA 1DF0A 4M2OA 1N2DA 2WC8A 3SG5A 1AK8A 1WRKA 3TZ1A 3BYAA 4XYNA 3SG2A 5BPJA 2ZNDA 5TNCA 3VROA 1BMOA 2LM5A 1K2HA 4R1EA 5FYXA 1SL7A 2M1KB 1K95A 2K2FA 4PHMA 4MZKA 1PRWA 1KFXL 1WDCC 2JTZA 4OCIA 1YX8A 4U8DA 4ZCUA 2K0JA 3SIAA 5I2OA 1BOCA 2PMYA 3FWBA 4A4CA 4DRWA 4PE7A 2Y1NA 1IH0A 3CWGA 3I5GB 4ORBB 1AUIB 1SPYA 1QX5B 1BJFA 3LL8B 3SJSA 2NCPA 5KTYA 4AQJA 2CCMA 4Q04A 1OE9B 1Y0VH 3KF9A 1BODA 1XFUO 2MBXA 1CFPA 3SG6A 3D10A 2KOTA 1N0YA 1XO5A 3I5IC 3GK1A 3PN7C 1FW4A 5HLOA 5K89A 1LXFC 3SG3A 3AAKA 1BG1A 1UHJA 2LLUA 2L51A 4YGCB 2JOJA 1SMGA 2CBLA 2KI4C 1CDMA 3K21A 1Y1XA 2E6WA 3EKJA 1PVBA 3SIBA 1KK8C 3VRQA 4MZJA 1NIWA 3FWCA 3TUYB 3OX6A 2EC6B 4MVFA 1B1GA 1QTXA 2LNKA 2HQWA 1DVIA 1CMFA 3KEVA 1Y6WA 1ZFSA 3A4UB 5I2QA 1K94A 1KWOB 4C0JA 4D1EA 1CDLA 2KQ6A 2M29A 4PDZA 1NSHA 2LHIA 2KI6C 1F71A 1SK6D 3VRRA 4AOMA 5G08A 2KFGA 2DOQA 1B4CA 3BUWB 3JTDB 1NWDA 5ER5A 3ZWHA 1AHRA 3F45A 1R6PA 5J3XA 1D1OA 3DVMA 2JXCA 1NCZA 1KQMB 3OP0A 3SG7A 1S6IA 3I5FB 1ALVA 3EK4A 4MRXA 1J7QA 1MXEA 5AANA 3GK4X 3D0YB 1JSAA 1JC2A 2L0PA 1TTXA 2WORA 3O78A 1SL8A 4NQGA 4USLA 5HLVA 1WRLA 1PSRA 1RJVA 2KNEA 3PSRA 4N5XA 5KSZA 2Y9YA 5HYDA 1XFVO 3KO0A 5HKYA 1UUSA 2HQ8A 2K61A 2JU0A 2ZKMX 2OS8C 1DGUA 1G4YR 4PE1A 1FPWA 1MQ1A 3KHEA 4YI8A 1NX2A 1W7IB 4DUQA 5AERA 2JRFA 1DF0B 5DKRA 1ZMZA 4UPGA 2WNDA 4L9MA 2K8MB 1K9KA 2D8NA 2G9BA 1F4QA 1LINA 4F0ZB 1J1DA 4IL1A 1G8IA 3IQOA 3VGOA 2Q91A 1UWOA 1NPQA 1R2UA 4PE4A 5B8IB 1MUXA 5ER4X 3DD4A 1CNPA 3I5HB 1XK4C 4MRYA 1MR8A 2R2IA 2JC2A 2AUCA 2WCBA 4GAOA 4GUKA 4FQOA 1CM1A 4PCWA 4GGNA 4M2QA 1SW8A 1SRAA 2COLB 2E30A 1S6CA 4MLWA 2GGMA 4BY4A 1YX7A 2KFHA 3IF7A 3JVTB 4JPZB 1RTP1 2I2RE 1NP8A 1V1FA 5DKNA 2MJWB 2L5XB 2AMIA 4HRGA 4PHJA 3OX5A 2MAZA 2K7CA 1YRUB 2KAYA 3WXAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2TN4 A;  1WDC B;  1XFW O;  2BBN A;  4I5L B;  1QVI Z;  4WQ3 A;  4MSP A;  1CFF A;  2CXJ A;  1XK4 A;  4QJ4 B;  2KGB C;  1FF1 A;  1YUS A;  1KK7 Z;  4C0L A;  3BUO B;  1NX0 A;  2KGR A;  2KQY A;  1WY9 A;  2L4H A;  2M9G A;  3TS5 C;  1QX2 A;  1LA3 A;  1SCV A;  2L4I A;  5IBW A;  1CMG A;  1K93 D;  1A4P A;  2K7D A;  1JFK A;  1RFJ A;  2LMU A;  5D7F A;  1B7T Z;  1MXL C;  2MLF C;  1Y1U A;  1IJ5 A;  3HX4 A;  3O4Y A;  1KFU S;  1TNW A;  1REC A;  3LK0 A;  2BBM A;  4GNK B;  1QJT A;  2AAO A;  2KI4 B;  1CKK A;  4NDD A;  3VRN A;  1IQ3 A;  3O2P A;  1PSB A;  2LE9 B;  1PVA A;  2NXQ A;  2FCD A;  2KI6 D;  1NX3 A;  2F2O A;  1BR4 B;  2H2K A;  1U5I B;  3CLN A;  1K90 D;  2ISD A;  4BY5 A;  1F54 A;  1S1E A;  1KCY A;  1AJ4 A;  1A75 B;  1SL9 A;  1FBV A;  2BCA A;  1UHI A;  4CPV A;  2JNF A;  4OKH A;  2F8P A;  2LV7 A;  1NUB A;  1N65 A;  1QXP A;  1CFD A;  1YVH A;  2KDH A;  2KYC A;  1BT6 A;  2LC5 A;  3MSE B;  4HRH A;  1M45 A;  2JUL A;  2JXL A;  2ZFD A;  1EG3 A;  3BXK A;  5DKQ A;  1FI5 A;  2Y5I A;  3WHT B;  1EG4 A;  4YRU A;  4OV2 A;  1W7J B;  1TN4 A;  3EVR A;  5CSN A;  1IRJ A;  1WLZ A;  1PK0 D;  3EVU A;  3M0W A;  1J7O A;  3DVE A;  4XJK A;  1HQV A;  1JFJ A;  2EGD A;  1OOJ A;  3BOW A;  1HT9 A;  2M3W A;  3DF0 A;  2ZN9 A;  4NDC A;  2HET A;  2OTG C;  3EK8 A;  1OSA A;  4MN0 A;  3ICB A;  1BR1 B;  1TOP A;  2LUC A;  2O5G A;  1NCX A;  4HRE E;  1KQV A;  3RM1 A;  2JT8 A;  2I18 A;  4CLN A;  2JZI A;  4P2Y B;  1YRT B;  1QVI Y;  3TDU A;  2WOS A;  5CPV A;  1DJG A;  2F33 A;  2HPS A;  3CTN A;  3FS7 A;  1PUL A;  1KK7 Y;  2NCO A;  4PE0 A;  4DIR A;  2V53 A;  2MA2 A;  1CLM A;  1S5G Z;  5AXI A;  3RLZ A;  1TCF A;  5D69 A;  5I8N A;  2A4J A;  1H8B A;  1SY9 A;  1LVC D;  1ZOT B;  2BL0 C;  2QPT A;  2LLS A;  3EVV A;  1B7T Y;  1S3P A;  1CDN A;  5JJG A;  1ALW A;  1DJW A;  1QX7 A;  2RGI A;  4MZL A;  3BUN B;  1KSM A;  1L2O C;  4P5O E;  4CFQ A;  4JWQ A;  1J7R A;  1DJY A;  2L50 A;  4C0K A;  2PRU A;  1DT7 B;  1XYD A;  1KFU L;  1UHN A;  1SR6 C;  4ETO A;  3VRP A;  3LLE A;  2G2B A;  1OMV A;  1TNQ A;  3PLF B;  1F8H A;  1DJH A;  2B1U A;  1CM4 A;  2K7O A;  3LK1 A;  2KHN A;  4M2P A;  4YGB B;  2NLN A;  3H4S E;  2KYF A;  1SKT A;  2LVJ A;  4GFT A;  4YGA A;  3C1V A;  5HKZ A;  4YI9 A;  4I5N B;  1XFX O;  1PAL A;  4OR9 B;  1TIZ A;  1GQM A;  2LAP A;  3OB1 B;  5JOL A;  2L2E A;  2BEC A;  2MRD A;  2ZNE A;  3DVJ A;  4N1G A;  3TS5 B;  2I7A A;  4YBH B;  2BCB A;  1XVJ A;  5CSI A;  1TNP A;  3D0Y A;  1WLM A;  1UUR A;  1NX1 A;  2LP2 A;  2PVB A;  1TNX A;  2M7N A;  3TDI A;  2O60 A;  4PHK A;  4YGE B;  2CNP A;  1OZO A;  3CR2 A;  3KPX A;  3IQQ A;  1ZUZ A;  1OFC X;  3AKA A;  4ORC B;  2KBM A;  1OMR A;  1MWN A;  2HF5 A;  4PHN A;  2QAC A;  4YGD B;  2KSP A;  1QIV A;  1Y1A A;  3I5I B;  3PN7 B;  5F6T A;  1LA0 A;  1QV0 A;  3O6B A;  2LP3 A;  1SNL A;  1RWY A;  4XJK B;  2PAS A;  1K96 A;  1A03 A;  2BE4 A;  3JVT C;  3QRX A;  1J7P A;  1B8C A;  2MLE C;  1KK8 B;  3CZT X;  3BOW B;  1BF5 A;  4ICB A;  2L98 A;  1SCM C;  3DF0 B;  2K7B A;  3NSL A;  1CLB A;  2KAV A;  2M7L A;  1CB1 A;  1Q80 A;  3WNX B;  1S5G Y;  3CGA A;  3LCP C;  1ZAC A;  1E8A A;  1TCO B;  3GK2 A;  1CTR A;  1L7Z A;  1NYA A;  1XA5 A;  1JF0 A;  1M39 A;  2LAN A;  1S26 D;  1RK9 A;  2WCF A;  2CTN A;  1WRZ A;  2JWW A;  2LLT A;  1B47 A;  2BKH B;  2BE6 A;  3BUM B;  4TNC A;  3NXA A;  5AFP A;  3ZNI A;  1X02 A;  2JQ6 A;  2LCP A;  1NCY A;  1JUO A;  4GGF C;  3TDZ A;  1RRO A;  1IGV A;  1V1G A;  1AVS A;  3SG4 A;  5CSF A;  1F4O A;  1EH2 A;  3I5G C;  2IS9 A;  1F70 A;  1AJ5 A;  2OTG B;  2F3Z A;  1FI6 A;  1K8U A;  1UP5 A;  1QAT A;  3OHM B;  1J55 A;  1CFC A;  1YUT A;  3NSI A;  1EL4 A;  1CLL A;  1QS7 A;  4I5J A;  4QJ5 B;  2SCP A;  4DCK A;  4MBE A;  1AP4 A;  1C7W A;  2OS8 B;  4CFR A;  1M31 A;  1YR5 A;  3NSO A;  4I5K A;  2WCE A;  1KSO A;  4E68 A;  2LMT A;  3CR5 X;  5PAL A;  1S6J A;  1QV1 A;  3EK7 A;  3PAL A;  4GGF A;  1IJ6 A;  3TUY C;  1YUR A;  4GPL B;  2PAL A;  1YVL A;  2EC6 C;  2JT3 A;  1JBA A;  1M63 B;  1LKJ A;  2I94 A;  4AQI A;  2BL0 B;  3BQ3 A;  5GQQ C;  1KFX S;  1OQP A;  2LMV A;  2MHH A;  2FOT A;  1C07 A;  1XFZ O;  4HSZ A;  4GBA A;  1KWO C;  4JQ0 D;  4NDB A;  1L2O B;  3CS1 A;  2H61 C;  1G33 A;  1A29 A;  1B8R A;  1DJI A;  2Y4Q A;  1BLQ A;  4CID A;  2M1U A;  1OMD A;  2ZRT A;  3PFV A;  1C7V A;  1JWD A;  2FCE A;  4ORA B;  1MHO A;  2M97 A;  2JTT A;  3JTD C;  3AKB A;  1K9P A;  4A4B A;  2F3Y A;  1QAS A;  1H4B A;  1SR6 B;  1IWQ A;  2Q4U A;  2BKI B;  4N1F A;  4WRI A;  1U5I A;  5CSJ A;  5I2L A;  4MEW A;  1YUU A;  3HCM A;  1KQM C;  1BU3 A;  2Y9Z A;  1DJX A;  1A75 A;  2LVK A;  3I5F C;  3NSK A;  1DJZ A;  2F2P A;  1YTZ C;  1IKU A;  1IG5 A;  2LVI A;  1GGW A;  2LUX A;  3OB2 B;  2FJU B;  1EXR A;  3E3R A;  1MF8 B;  3A8R A;  1UHH A;  1CDP A;  2M49 B;  4WQ2 A;  2H61 A;  1GGZ A;  5AEQ A;  1JF2 A;  1XFY O;  4PAL A;  3WHU B;  3PAT A;  4FTG A;  3DVK A;  2OPO A;  2GV5 A;  1K9U A;  2LHL A;  2Y1M A;  2ZN8 A;  1QLS A;  1S36 A;  2JPT A;  2GGZ A;  1M46 A;  1F55 A;  1A2X A;  1QLK A;  2ZRS A;  3EKH A;  2SAS A;  2KFF A;  1SBJ A;  2BCX A;  2PSR A;  5HKW A;  2KAX A;  3BUX B;  2JT0 A;  1SYM A;  1J1E A;  2CT9 A;  3AAJ A;  4DS7 A;  1B9A A;  1GJY A;  2LVV A;  3CR4 X;  2VRG A;  1QIW A;  1B8L A;  1IQ5 A;  1UHK A;  1VRK A;  1OZS A;  3FIA A;  1EJ3 A;  2M8U A;  2P6B B;  1TRF A;  2K2A A;  4ZCV A;  2EHB A;  2NZ0 A;  2JNX A;  4OVN F;  1DTL A;  3GOF A;  5KU1 A;  3I5H C;  3PM8 A;  2M0R A;  4QJ3 B;  2KBI A;  1DGV A;  1SCM B;  1DMO A;  1ODB A;  1DF0 A;  4M2O A;  1N2D A;  2WC8 A;  3SG5 A;  1AK8 A;  1WRK A;  3TZ1 A;  3BYA A;  4XYN A;  3SG2 A;  5BPJ A;  2ZND A;  5TNC A;  3VRO A;  1BMO A;  2LM5 A;  1K2H A;  4R1E A;  5FYX A;  1SL7 A;  2M1K B;  1K95 A;  2K2F A;  4PHM A;  4MZK A;  1PRW A;  1KFX L;  1WDC C;  2JTZ A;  4OCI A;  1YX8 A;  4U8D A;  4ZCU A;  2K0J A;  3SIA A;  5I2O A;  1BOC A;  2PMY A;  3FWB A;  4A4C A;  4DRW A;  4PE7 A;  2Y1N A;  1IH0 A;  3CWG A;  3I5G B;  4ORB B;  1AUI B;  1SPY A;  1QX5 B;  1BJF A;  3LL8 B;  3SJS A;  2NCP A;  5KTY A;  4AQJ A;  2CCM A;  4Q04 A;  1OE9 B;  1Y0V H;  3KF9 A;  1BOD A;  1XFU O;  2MBX A;  1CFP A;  3SG6 A;  3D10 A;  2KOT A;  1N0Y A;  1XO5 A;  3I5I C;  3GK1 A;  3PN7 C;  1FW4 A;  5HLO A;  5K89 A;  1LXF C;  3SG3 A;  3AAK A;  1BG1 A;  1UHJ A;  2LLU A;  2L51 A;  4YGC B;  2JOJ A;  1SMG A;  2CBL A;  2KI4 C;  1CDM A;  3K21 A;  1Y1X A;  2E6W A;  3EKJ A;  1PVB A;  3SIB A;  1KK8 C;  3VRQ A;  4MZJ A;  1NIW A;  3FWC A;  3TUY B;  3OX6 A;  2EC6 B;  4MVF A;  1B1G A;  1QTX A;  2LNK A;  2HQW A;  1DVI A;  1CMF A;  3KEV A;  1Y6W A;  1ZFS A;  3A4U B;  5I2Q A;  1K94 A;  1KWO B;  4C0J A;  4D1E A;  1CDL A;  2KQ6 A;  2M29 A;  4PDZ A;  1NSH A;  2LHI A;  2KI6 C;  1F71 A;  1SK6 D;  3VRR A;  4AOM A;  5G08 A;  2KFG A;  2DOQ A;  1B4C A;  3BUW B;  3JTD B;  1NWD A;  5ER5 A;  3ZWH A;  1AHR A;  3F45 A;  1R6P A;  5J3X A;  1D1O A;  3DVM A;  2JXC A;  1NCZ A;  1KQM B;  3OP0 A;  3SG7 A;  1S6I A;  3I5F B;  1ALV A;  3EK4 A;  4MRX A;  1J7Q A;  1MXE A;  5AAN A;  3GK4 X;  3D0Y B;  1JSA A;  1JC2 A;  2L0P A;  1TTX A;  2WOR A;  3O78 A;  1SL8 A;  4NQG A;  4USL A;  5HLV A;  1WRL A;  1PSR A;  1RJV A;  2KNE A;  3PSR A;  4N5X A;  5KSZ A;  2Y9Y A;  5HYD A;  1XFV O;  3KO0 A;  5HKY A;  1UUS A;  2HQ8 A;  2K61 A;  2JU0 A;  2ZKM X;  2OS8 C;  1DGU A;  1G4Y R;  4PE1 A;  1FPW A;  1MQ1 A;  3KHE A;  4YI8 A;  1NX2 A;  1W7I B;  4DUQ A;  5AER A;  2JRF A;  1DF0 B;  5DKR A;  1ZMZ A;  4UPG A;  2WND A;  4L9M A;  2K8M B;  1K9K A;  2D8N A;  2G9B A;  1F4Q A;  1LIN A;  4F0Z B;  1J1D A;  4IL1 A;  1G8I A;  3IQO A;  3VGO A;  2Q91 A;  1UWO A;  1NPQ A;  1R2U A;  4PE4 A;  5B8I B;  1MUX A;  5ER4 X;  3DD4 A;  1CNP A;  3I5H B;  1XK4 C;  4MRY A;  1MR8 A;  2R2I A;  2JC2 A;  2AUC A;  2WCB A;  4GAO A;  4GUK A;  4FQO A;  1CM1 A;  4PCW A;  4GGN A;  4M2Q A;  1SW8 A;  1SRA A;  2COL B;  2E30 A;  1S6C A;  4MLW A;  2GGM A;  4BY4 A;  1YX7 A;  2KFH A;  3IF7 A;  3JVT B;  4JPZ B;  1RTP 1;  2I2R E;  1NP8 A;  1V1F A;  5DKN A;  2MJW B;  2L5X B;  2AMI A;  4HRG A;  4PHJ A;  3OX5 A;  2MAZ A;  2K7C A;  1YRU B;  2KAY A;  3WXA A; 
#chains in the Genus database with same CATH topology
 4H13 B;  1WDC B;  1HJ0 A;  5CBN A;  1ORG A;  4MSP A;  5AW0 B;  2KGB C;  2KLV A;  3TNU A;  1OWA A;  2E74 B;  2K88 A;  1JO5 A;  4C0L A;  3AEE C;  3BUO B;  1NX0 A;  2K3R A;  2KSE A;  3S0A A;  1FE6 A;  4AQR D;  2L4H A;  3TS5 C;  2PFX A;  4QMA A;  1VQP P;  1GU5 A;  1K93 D;  3AE9 C;  1RFJ A;  1SSE B;  5TJH A;  1OXZ A;  1ZRT D;  2NZ2 A;  2QJY C;  3O4Y A;  1KFU S;  1T6A A;  1Z2C B;  1KZU B;  3CWB E;  2BBM A;  3D74 A;  4GNK B;  3O6Q B;  2PGD A;  2C9N Y;  3MIW A;  1PVA A;  3BFA A;  1NX3 A;  2ISD A;  3JC2 2;  1GW3 A;  3O8Z A;  2I8D A;  3BRT B;  3LW5 H;  3Q5R A;  3C8V A;  3L71 G;  1CFD A;  2LC5 A;  4HRH A;  4WY4 D;  4YXD C;  3PRJ A;  2BEZ F;  3D76 A;  1EDI A;  2JUL A;  1FI5 A;  1BCC E;  4Y99 B;  3RL0 g;  2Y5I A;  5KLV D;  1SQQ E;  4OV2 A;  1YTZ T;  4O9B A;  3I55 P;  1X22 A;  2YIU C;  2P71 A;  3QWO C;  5B66 H;  1WLZ A;  3V2L A;  1PK0 D;  3CZ2 A;  3DVE A;  3TK1 A;  1HJB A;  3AED C;  4K3A A;  3VMA A;  2IYP A;  1T2K D;  3BOW A;  2M3W A;  2FYU K;  3P8C E;  2ZN9 A;  3VYI A;  3C9I A;  3OGN A;  5APW A;  1JB0 J;  3WMM 0;  4I1L A;  2VRS A;  2RKL A;  1KQV A;  3RM1 A;  3FWN A;  5CJ0 A;  5K5G B;  2KSJ A;  3TDU A;  2WOS A;  1ZW0 A;  4IFM A;  2IBZ D;  4HB1 A;  1OVU A;  2V53 A;  3CCR P;  2IZ1 A;  3B86 A;  3RLZ A;  2QM7 A;  3AE2 C;  2BCC G;  5D69 A;  5I8N A;  1H8B A;  2L5G B;  3H1K E;  2LLS A;  3L73 G;  1B7T Y;  2KZJ A;  3MP7 B;  1ALW A;  4LLH A;  1XTC C;  1L2O C;  4P5O E;  2POH A;  1J7R A;  1JUN A;  1XYD A;  1EDL A;  2OQQ A;  4ETO A;  1NU1 J;  3VRP A;  1YQ3 C;  1SQB G;  2WC6 A;  2L2C A;  4GFT A;  3CZ1 A;  4YI9 A;  4I5N B;  1JY2 O;  3L70 D;  1TIZ A;  4OGQ C;  4N1G A;  3TS5 B;  3L74 D;  2I7A A;  1OVR A;  3H1H G;  1XVJ A;  1OOI X;  1JNM A;  4I2L C;  2IBZ I;  1TNX A;  2I1K A;  3AEC C;  1OZO A;  2QJY B;  3IQQ A;  1GW4 A;  1OFC X;  2LR2 A;  4EIJ A;  3T97 B;  2ZYA A;  2KBM A;  1LTS C;  1IK7 A;  1MWN A;  2NPS C;  4PHN A;  3NMD A;  3PTZ A;  1S9K E;  1VQ4 P;  2WVR A;  2LKM A;  1QIV A;  1LA0 A;  5KLV K;  3O6B A;  2WSE H;  3CWB D;  1TUZ A;  2PAS A;  1M90 Q;  1GZL A;  3Q5S A;  1OZH A;  3BOW B;  1SCM C;  2K7B A;  1CLB A;  2KAV A;  4LGD E;  1ZAC A;  5APT A;  1E79 H;  1XA5 A;  1GTW A;  1OMI A;  1K04 A;  1M39 A;  1T14 A;  2NPS A;  3KXD A;  3HTK A;  1YIJ P;  1RK9 A;  2KXP B;  2BE6 A;  3BUM B;  1BCC D;  1JUO A;  4GGF C;  1RRO A;  1IGV A;  3SG4 A;  5KJ7 C;  1UIX A;  2QJP B;  1S3J A;  3G6E P;  2IS9 A;  3GMA A;  1UP5 A;  3M0D C;  3EG5 B;  1CFC A;  4PD4 E;  1NU1 E;  4QJ5 B;  4DCK A;  1Q2N A;  1AP4 A;  3A7O A;  4CFR A;  1M31 A;  1YR5 A;  3HD7 D;  4I5K A;  2OYH C;  2WCE A;  4BRY A;  1NWQ A;  1FDI A;  3SFE C;  1G2C A;  3EK7 A;  4GGF A;  1IJ6 A;  5KJ7 A;  4Z1M H;  3JCU H;  1JBA A;  1FBM A;  5BVZ A;  3BQ3 A;  1PL5 A;  1OQP A;  1KN7 A;  2FOT A;  1C07 A;  1XFZ O;  4GBA A;  2R5B A;  4KT0 J;  1L2O B;  3M0D A;  3VB1 A;  1B8R A;  1DJI A;  5H2F H;  4CID A;  3SWK A;  4H44 D;  3E7K A;  4HYT B;  1LWU C;  3RK2 D;  1C3Y A;  3H1K D;  3Q3D A;  3EFG A;  2W8Z A;  1IIO A;  2WIT A;  2KYV A;  4WRI A;  3L71 J;  2OYH A;  3S9O A;  2Y9Z A;  1BU3 A;  1OOF A;  1DJX A;  1DC1 A;  1L0L G;  1ZOY C;  1DJZ A;  3VP9 A;  5KKZ B;  2LVI A;  1T8Z A;  3L75 G;  3OB2 B;  1UHH A;  4WQ2 A;  4OGQ B;  4JKT A;  1N86 A;  1L4A D;  1LWU A;  3WHU B;  3B7A A;  1GK6 A;  2YKQ A;  2FJY A;  2GV5 A;  3CLQ A;  1M46 A;  1F55 A;  1QLK A;  2ZRS A;  2FYN C;  2L91 A;  4HH2 A;  2Q7C A;  2BCX A;  5HKW A;  2E76 D;  1SYM A;  3UNW A;  2CT9 A;  3H25 A;  1GJY A;  2NPS B;  1B8L A;  1UHK A;  1VRK A;  4C7N B;  2M8U A;  4W7Y A;  1TRF A;  2FKW B;  2KNC B;  3PM2 A;  3GOF A;  1NTK G;  2M5A A;  1K9M Q;  2M0R A;  3II6 A;  1S9K D;  2YO3 A;  3CX5 E;  4W7Z A;  1SCM B;  1DMO A;  1G1I A;  1ODB A;  1DF0 A;  3ITK A;  1AJY A;  1SQQ K;  1GD2 E;  2E43 A;  4XYN A;  1PGJ A;  2WC5 A;  1BMO A;  3A2A A;  5FYX A;  1JY3 O;  2R32 A;  2E5Y A;  2K2F A;  4BRY B;  4MZK A;  2JTZ A;  4U8D A;  3SIA A;  2K0J A;  1SQB J;  4W80 A;  1GL2 C;  1BGY E;  4PE7 A;  3KDP B;  1AVO A;  3DZT A;  5KTY A;  2N1T C;  4ZMD A;  3RK3 C;  4PV1 D;  2WPS A;  1BOD A;  1ZP0 C;  1PP9 G;  2MBX A;  1CFP A;  3GLM A;  3L71 E;  1N0Y A;  3GK1 A;  2WSC J;  1FW4 A;  3S0B A;  3H1H J;  2LLU A;  3B5N C;  2OYH B;  2CBL A;  2YMY A;  1N8R Q;  2HOD A;  4PD4 D;  1NU1 D;  4RES B;  3VRQ A;  1GL2 A;  1B1G A;  2Q1K A;  1OX3 A;  3KEV A;  4DOJ A;  1ZFS A;  2N1T A;  5AW5 B;  1CDL A;  2KQ6 A;  2P58 A;  2W83 C;  2KI6 C;  1NYH A;  1LWU B;  3M9B A;  2KFG A;  2A45 G;  2FFD B;  3BUW B;  5ER5 A;  2GA1 A;  1NTM E;  3B88 A;  3B5N A;  3H1J G;  1NTZ G;  1YQ4 C;  1JOC A;  3EK4 A;  1SQX G;  3S0D A;  3CCE P;  1MXE A;  4GT1 A;  1PPJ G;  3GK4 X;  2KS1 A;  1DH3 A;  2L0P A;  3O78 A;  4NQG A;  4USL A;  5KSZ A;  1IFI A;  3OAK A;  1GU4 A;  1RJV A;  5HKY A;  2O01 N;  3B8E B;  1JY2 N;  1QWV A;  2OS8 C;  1DGU A;  1X0T A;  4OWF A;  5KTB A;  2FYN B;  2XZR A;  1DD4 A;  1DF0 B;  4C7R A;  4PD4 I;  1GM0 A;  3MGN A;  4L9M A;  4H0L D;  2Q6Q A;  1KQS O;  1JY3 P;  1VF5 C;  1K9K A;  4IL6 X;  2O1J A;  2HYN A;  3V2P A;  3MZW B;  2AXT H;  2R5D A;  3PLN A;  5ER4 X;  1A02 J;  2Q9I A;  1T3U A;  2O01 H;  3O4X A;  1CNP A;  1MR8 A;  4ZKU A;  4UB8 E;  4GAO A;  5AVV B;  1CM1 A;  3H1H E;  2N9Y B;  1SW8 A;  2O1K A;  2C0X A;  3W67 A;  4H13 D;  2E75 C;  3HUS C;  1RTP 1;  2I2R E;  1NP8 A;  1V1F A;  5DKN A;  3CX5 D;  2L5X B;  2AMI A;  4PHJ A;  3OX5 A;  2MAZ A;  1VQ6 P;  2K7C A;  1M1J C;  2E74 D;  4NDB A;  4YGC B;  1Q90 D;  2H88 C;  3FXE A;  1XFW O;  4I5L B;  2HOD B;  4WQ3 A;  1CFF A;  2GUS A;  2M3B A;  2CXJ A;  3CXH H;  1NU1 K;  1KK7 Z;  1VQO P;  2KGR A;  2KQY A;  3A0H E;  2PYQ A;  2M9G A;  2N1T B;  4N3Y B;  1QX2 A;  5IBW A;  1CMG A;  3G71 P;  2K7D A;  1BGY D;  3HUS A;  4JD9 A;  4GIF A;  2E42 A;  1NJI Q;  2Z5I A;  3U1A A;  3B5N B;  1TNW A;  1REC A;  1M1J A;  2AAO A;  1K73 Q;  4NDD A;  3H1I E;  2OYI C;  2KS1 B;  5AVQ B;  2NXQ A;  4JF7 A;  1BR4 B;  1HH0 A;  2HG5 D;  4BY5 A;  1KCY A;  2IX7 C;  1RQU A;  1A75 B;  2AEF A;  1HWT C;  1OVV A;  2LV7 A;  1NTK J;  1URQ C;  4PT1 A;  1QXP A;  1YVH A;  2PP6 A;  5BU5 A;  3MSE B;  4PJ0 H;  5AW7 B;  3CX5 I;  3BXK A;  2JXL A;  1EZV G;  5FI2 A;  1JCC A;  4JBZ A;  3G3Z A;  1FZC B;  2AXC A;  2PQL A;  1QVF O;  1EG4 A;  3IVT A;  4OZD A;  1KFN A;  1TN4 A;  2OYI A;  1NTM D;  1HQV A;  1LGH B;  4D6T G;  5GTI E;  3BAS A;  1J2J B;  2FXM A;  1MKM A;  2L5Y A;  1X79 B;  2JEE A;  1FZA A;  1URQ A;  3DF0 A;  1SFC C;  3DXL A;  1OSA A;  4MN0 A;  3V2N A;  1YI2 P;  1TOP A;  2O5G A;  2JT8 A;  1YRT B;  1QVI Y;  2BNX A;  1KIL C;  1KFM A;  4DIR A;  3CCJ P;  3FS7 A;  2YNY A;  1S5G Z;  2A4J A;  1SY9 A;  2Y0C A;  1LVC D;  1ZOT B;  2BL0 C;  1S3P A;  1CDN A;  1SFC A;  2RGI A;  4K35 A;  1QVG O;  3WU2 E;  2PRU A;  1DIP A;  2PAJ A;  1SR6 C;  1KIL A;  1KYO H;  3FWL A;  1Q7Y Q;  2E75 B;  3HUS B;  1AVY A;  1OMV A;  1OW6 A;  1TNQ A;  3PLF B;  1F8H A;  1YTZ I;  2B1U A;  2HFE D;  2KHN A;  4YGB B;  2K9J A;  2W6B A;  1SKT A;  1NTZ J;  3C1V A;  2A06 G;  5E79 E;  1JY3 N;  1SQX J;  1U7M A;  1XTG B;  4OR9 B;  1GQM A;  3OB1 B;  5JOL A;  2ITA A;  3NHT A;  4INX A;  3DVJ A;  4YBH B;  2KLE A;  3D0Y A;  3TGU G;  1WLM A;  1UUR A;  5KLI C;  1N73 C;  4JYB A;  3TDI A;  2KPH A;  4PHK A;  2CNP A;  3CR2 A;  3KPX A;  3CCL P;  1ZUZ A;  4UB6 E;  1OW7 A;  2K37 A;  1MZ9 A;  1IK9 A;  3I5I B;  3PN7 B;  3VP8 A;  5F6T A;  5AW2 B;  2OYI B;  2OGU A;  1SNL A;  3BRV B;  3QME A;  1A03 A;  2BE4 A;  1J7P A;  1NTM K;  2MLE C;  3H1I D;  1KK8 B;  3CZT X;  1URQ B;  3IF4 A;  2LXB A;  4M3L A;  3DF0 B;  1N73 A;  2M7L A;  1RF1 C;  3WNX B;  3LCP C;  2Y0D A;  1E8A A;  5AVR B;  1CTR A;  2Z4E A;  4XE5 B;  2YKO A;  2LAN A;  2CTN A;  2LLT A;  2BKH B;  2FXO A;  3ABV C;  2B87 A;  4YTP C;  3NXA A;  5AFP A;  3ZNI A;  1X02 A;  1Z56 A;  1LNQ A;  1V1G A;  5D3O A;  5APY A;  1F4O A;  1P84 E;  1L0N E;  1EH2 A;  2RMZ A;  3I5G C;  1F70 A;  3L72 E;  1SFC B;  2F3Z A;  1RF1 A;  3OHM B;  2Q5U A;  1IO4 A;  1OOH A;  3H1L E;  1CLL A;  3HE5 A;  1VQ5 P;  3LW5 J;  1C7W A;  1KIL B;  3CI9 A;  1RE3 C;  3NSO A;  2E5T A;  4IL6 H;  1VL2 A;  1NTZ E;  2KUB A;  1KSO A;  5GTH E;  5PAL A;  3PAL A;  2K9J B;  3TUY C;  2PAL A;  1PPJ E;  1YVL A;  2EC6 C;  1LP1 A;  1M63 B;  1LKJ A;  2BL0 B;  4HSZ A;  4JQ0 D;  3CS1 A;  2H61 C;  2H43 A;  2OTL P;  1BLQ A;  1WRG A;  1FS0 E;  4WY4 C;  1G1J A;  3PFV A;  3N7N A;  1HGZ A;  3JTD C;  1K9P A;  4A4B A;  1QAS A;  1SR6 B;  3L37 A;  2Q4U A;  4N1F A;  1RE3 A;  1U5I A;  2QA4 P;  3TNU B;  1KQM C;  1S2E A;  1M1K Q;  3L4L A;  3NSK A;  2YKP A;  2F2P A;  1J1E C;  3PHL A;  3AE4 C;  4ASW A;  4PD4 H;  4OGQ D;  2H8V A;  3M06 A;  1IG5 A;  5L8R J;  2LUX A;  2FJU B;  2KZI A;  1MF8 B;  1PFI A;  3IR9 A;  3V2R A;  4ZKP A;  1H88 A;  2H61 A;  3D77 A;  4WY4 A;  5AEQ A;  1XFY O;  4PAL A;  4EDF A;  5FI6 A;  4DT0 A;  1N7S C;  3DVK A;  3B71 A;  1HTL C;  2M8R A;  2LHL A;  1JCD A;  5KLI B;  2GGZ A;  1N73 B;  2XDJ A;  5C39 A;  1A2X A;  3EKH A;  2WQY C;  2KFF A;  2NPS D;  1SBJ A;  3Q1M A;  2KAX A;  1VQ9 P;  1TWO A;  1J1E A;  3MHV A;  4DS7 A;  1B9A A;  3U59 A;  2VRG A;  1VQK P;  5AVW B;  3D6Z A;  2D2C C;  4ZCV A;  2GM4 A;  2XND H;  2WWW A;  4OVN F;  3R2P A;  2FYU G;  1H0T A;  3PM8 A;  1GDT A;  1DD3 A;  1N7S A;  3AEG C;  2ZT9 C;  1JM0 A;  2XU6 A;  2JP3 A;  1DGV A;  3HRN A;  1RF1 B;  2WC8 A;  5BPJ A;  3HE5 B;  3RK3 E;  2ZND A;  3CYZ A;  1PIX A;  1K2H A;  1LT9 C;  5AVZ B;  1XFR A;  5KJ7 D;  3AEB C;  1KV4 A;  4PHM A;  1PRW A;  1KFX L;  5I2O A;  1NKZ B;  1A02 F;  3OW2 O;  1LP1 B;  5B66 E;  3I5G B;  1SPY A;  1BJF A;  1SQV G;  3SJS A;  2YIU B;  4BWN A;  2QG4 A;  4IJ7 A;  2CCM A;  4Q04 A;  3S0F A;  1XFU O;  1FOS F;  3W68 A;  3BJH A;  3D10 A;  3E1R A;  1P84 D;  1XO5 A;  5K89 A;  1L0N D;  1HGV A;  3TGU J;  1LT9 A;  1SQQ D;  3L72 D;  1BG1 A;  2W90 A;  3CX5 H;  2JOJ A;  1SMG A;  2KI4 C;  3H1L D;  1Y1X A;  3SIB A;  2G8Y A;  3TUY B;  1NIW A;  3OX6 A;  2EC6 B;  4MVF A;  3P7K A;  2LNK A;  4XFJ A;  1DVI A;  1Q82 Q;  2BAP A;  3P8C D;  3AE6 C;  3D71 A;  1NTZ D;  3A4U B;  5I2Q A;  2H8P D;  2V7Q H;  4PDZ A;  1JY2 P;  2LHI A;  4I6M C;  1PPJ D;  4AOM A;  1R5L A;  2DOQ A;  3GHG C;  3JTD B;  1NWD A;  2QSI A;  3GF7 A;  1R6P A;  5J3X A;  2KLD A;  3DVM A;  1FZF A;  1NCZ A;  1KQM B;  1KB9 E;  2YGU A;  3SG7 A;  5M1B A;  3TDK A;  1J1E B;  5KLV G;  1J7Q A;  1FU1 A;  2J59 M;  4CFQ A;  1WRL A;  3PSR A;  4N5X A;  1UUS A;  4RO0 A;  3IFM A;  2XKM A;  1P84 I;  4PE1 A;  1N7S B;  3GHG A;  3KHE A;  2Q3I A;  1W2E A;  1NX2 A;  1FAV A;  3E1I A;  3M9H A;  2WND A;  2K8M B;  2A45 I;  1ZV8 A;  2IBZ G;  2HPC A;  2QEB A;  3G9R A;  4Y28 J;  2HLO A;  1R2U A;  1W9Z A;  5B8I B;  2A06 E;  3F89 A;  2CPS A;  1K8A Q;  4MRY A;  2ZT9 B;  2JC2 A;  3HTK B;  2QEO A;  5CCH D;  2AUC A;  2WCB A;  4GUK A;  4PCW A;  4GGN A;  3TGU E;  2W27 A;  3CC2 P;  1SRA A;  2COL B;  1S6C A;  2BCC J;  5CCG D;  3L73 J;  5CMZ A;  3S4R A;  1L0N K;  1TU3 F;  3Q5P A;  3B6X A;  1PGQ A;  1YRU B;  3WXA A;  2BBN A;  3M0A A;  3BCC G;  5APV A;  2N1T D;  2KLU A;  4U3F G;  3DY9 A;  3RGU A;  3KZI E;  1FDM A;  1YUS A;  3S1K A;  1PV3 A;  3L70 G;  5AVT B;  5B5E E;  1AQT A;  2L4I A;  1LA3 A;  5DJT B;  3L74 G;  1A4P A;  1G2C B;  1NTZ K;  3B5N D;  2E76 C;  5D7F A;  1B7T Z;  1MXL C;  1SP4 A;  5AW4 B;  1Y1U A;  1IJ5 A;  4UB8 H;  1YHQ P;  1QJT A;  2KI4 B;  3VRN A;  1IQ3 A;  3O2P A;  1PSB A;  2LE9 B;  3RL0 C;  3EQ2 A;  1NH4 A;  1S5L E;  2KI6 D;  2F2O A;  3CLN A;  1K90 D;  1F54 A;  2QIW A;  3JCU E;  1S1E A;  3RBZ A;  1AJ4 A;  3CWB G;  1ZME C;  2BCA A;  4CPV A;  4OKH A;  1Z4H A;  2F8P A;  3VOP A;  1NUB A;  1N65 A;  2KDH A;  3Q8I A;  2KYC A;  1RH5 B;  1LTG C;  1BT6 A;  3GHG B;  5BU8 B;  3MUD C;  2ZFD A;  2JO1 A;  5DKQ A;  3CCQ P;  3WHT B;  1QX8 A;  2M3E A;  4YRU A;  1USD A;  5AVU B;  3EVR A;  3L4A A;  2HPC B;  2K60 A;  3M0W A;  3EVU A;  1J7O A;  5AW9 B;  1KIL E;  1EC5 A;  1KB9 D;  1MUU A;  1CI6 A;  1NVO A;  3NXS A;  2WSF H;  1OOJ A;  4PV1 C;  4NDC A;  2HET A;  2OTG C;  3EK8 A;  2N9B A;  4A7P A;  3ZDM A;  2C9L Y;  3ICB A;  3MUD A;  3D6Y A;  2LUC A;  2BCC E;  1SQV J;  1PGP A;  1KTM A;  4OH8 B;  3L73 E;  1HVV A;  2M5A B;  3NFQ A;  5CPV A;  2HPS A;  4PE0 A;  5APU A;  1PUL A;  2I1J A;  4IFF A;  1TCF A;  3BFB A;  1N7L A;  2H89 C;  1M56 D;  2KB7 P;  1ZLL A;  1CSB A;  2QPT A;  1X9V A;  1QX7 A;  1GK4 A;  1W5C E;  1SQB E;  4JWQ A;  2E75 D;  1DJY A;  2L50 A;  3C1L A;  3M91 A;  4C0K A;  3SSU A;  5GTI H;  1KFU L;  1UHN A;  3SWF A;  3H1K G;  3LID A;  2J5U A;  2G2B A;  2WZ7 A;  1CM4 A;  2K7O A;  4M2P A;  1BE3 G;  4ZNC A;  2NLN A;  3L47 A;  1KB9 I;  3TGU D;  1SQP G;  2LVJ A;  1WMK A;  3CCM P;  4YGA A;  4EOT A;  2R3C A;  3L35 A;  2LAP A;  5CBO A;  2L2E A;  2BEC A;  2MRD A;  2OTK E;  1D7M A;  2BCB A;  5CSI A;  1TNP A;  1L0L J;  2O01 J;  1AFO A;  1U57 A;  1NX1 A;  2LP2 A;  1GL2 B;  3R1P A;  2FBW C;  2M7N A;  4H0L C;  2O60 A;  2NRG A;  4YXW H;  4YGE B;  3NHI A;  4NPD A;  3L75 J;  3QH9 A;  3CZ0 A;  2W6J H;  4ORC B;  3RK3 B;  1OMR A;  2QAC A;  2QEX P;  2KSP A;  1Y1A A;  1LTT C;  2LP3 A;  1SLQ A;  1URQ D;  3VMY A;  1QL1 A;  3G4S P;  1CI6 B;  3JVT C;  4GOE A;  3MD0 A;  3L71 D;  1SQV E;  1BF5 A;  4ICB A;  5E79 H;  1OW4 A;  5CJ4 A;  1CB1 A;  2UWJ E;  1TCO B;  3AE7 C;  1NYA A;  1L7Z A;  5AVS B;  2ZXX A;  2E74 C;  2KIK A;  2Z5H A;  1WRZ A;  1KMI Z;  2LXC B;  1Y8A A;  4TNC A;  1BDC A;  1KQF B;  2JQ6 A;  1SFC D;  3LIE A;  3TYY A;  4UB6 H;  3SFD C;  1HF9 A;  1DEK A;  2ZYG A;  3AEA C;  3BCC J;  1BSN A;  2JWD A;  2WPV B;  4U3F J;  2OTG B;  3AE5 C;  1J55 A;  1KIL D;  1YUT A;  2KOG A;  3NSI A;  3L70 J;  4I5J A;  1QS7 A;  1IFP A;  3L74 J;  2RH0 A;  4C46 A;  2OS8 B;  1ZR4 A;  1FOS E;  5DJU B;  4E68 A;  3CR5 X;  2M0B A;  1S6J A;  2BCC D;  1YUR A;  1NU1 G;  2JT3 A;  2I94 A;  4AQI A;  3L73 D;  1PP9 J;  2YXQ B;  4R4M A;  2MHH A;  1VF5 B;  3UIA A;  3P32 A;  3KYQ A;  1KWO C;  3VRO A;  3O6Q A;  1L0L E;  1A29 A;  4HJG H;  5TIS E;  2QM8 A;  2ZRT A;  4KYN A;  1JWD A;  2WPR A;  4NPF X;  1VQ8 P;  4ORA B;  1DQE A;  2M97 A;  3L75 E;  3AKB A;  1P84 H;  1H4B A;  1IWQ A;  5I2L A;  4MEW A;  1YUU A;  3HCM A;  1SQB D;  2LVK A;  3I5F C;  1YTZ C;  3OBV A;  1QGK B;  3E3R A;  1CDP A;  2YO2 A;  5GTH H;  3CXH E;  2P1J A;  3H1H D;  1M1J B;  3H1J J;  3PAT A;  4FTG A;  2Q3E A;  2OYO A;  2WCH A;  5DIC A;  2Y1M A;  2ZN8 A;  1QEX A;  1S5L X;  5APQ A;  2WCJ A;  3AE3 C;  3BUX B;  1NTK E;  2JT0 A;  3CCU P;  5KAI E;  2LVV A;  3PJI A;  3CR4 X;  2JR8 A;  1OZS A;  1SS1 A;  1EJ3 A;  2BAS A;  4YPC A;  3BCC E;  1ZR2 A;  2NZ0 A;  2QE7 H;  4GKG A;  1Q81 Q;  4U3F E;  2YXR B;  5KU1 A;  3I5H C;  3GW6 A;  1JMB A;  3D78 A;  3R1O A;  1NOH A;  3SG5 A;  1OIP A;  1MV8 A;  3TZ1 A;  3BYA A;  4PJ0 E;  5TNC A;  2LM5 A;  1SQV D;  4R1E A;  1RE4 C;  3H1K J;  2M1K B;  3CC4 P;  1PP9 E;  4ZCU A;  1BOC A;  1BE3 J;  2PMY A;  3FWB A;  4A4C A;  2IFM A;  4DRW A;  1SQP J;  3V2Q A;  4IFD K;  1IH0 A;  4ORB B;  1AUI B;  1DEE G;  1QX5 B;  4AQJ A;  4TT3 H;  3KF9 A;  1RQV A;  3SG6 A;  5HLO A;  4EYY Q;  3UO9 A;  3KPE A;  1BGY G;  4N78 E;  1RE4 A;  3AAK A;  1UHJ A;  2QEV A;  2L51 A;  2IYO A;  2ZXE B;  3VN0 A;  2RN0 A;  2E6W A;  3EKJ A;  1SQB K;  1QTX A;  2QEH A;  1DEB A;  2HQW A;  3USS A;  3CME P;  1Y6W A;  5AW8 B;  1FZG A;  3H1J E;  1KWO B;  4C0J A;  3T97 A;  1SQX E;  2GUV A;  1B4C A;  3ZWH A;  4FQT A;  1JMM A;  1WT6 A;  1FC2 C;  2GTE A;  1SVF A;  1D1O A;  5FI7 A;  1IC2 A;  3KHU A;  4KJM A;  2JXC A;  1L0L D;  3TSI A;  1NHL A;  3R4Y A;  1S6I A;  3I5F B;  3A3Y B;  1KYO E;  2QJP C;  2JKV A;  3A0B E;  4N6J A;  3L75 D;  3VMX A;  3D0Y B;  3JSV C;  4BXL A;  1J1D C;  4F7F A;  1JC2 A;  2WOR A;  1UII A;  1SL8 A;  2OTJ P;  2KNE A;  2P67 A;  1NTM G;  1IFM A;  1AV1 A;  1N7S D;  2IPP A;  2Y9Y A;  5HYD A;  3KO0 A;  1PZQ A;  3R72 A;  5KAF E;  1S1C X;  2ZKM X;  3P8M C;  1YJW P;  1ZN5 A;  4L75 A;  4DZO A;  4YI8 A;  1W7I B;  3A5T A;  2J58 A;  3CC7 P;  2JRF A;  1T2K C;  4MN4 C;  3FE6 A;  4L76 A;  2PRR A;  4UPG A;  3CXH D;  1EQ7 A;  4D6T J;  2D2C D;  1QLE D;  1F4Q A;  1LIN A;  2B9B A;  3N7H A;  1J1D A;  1G8I A;  1BE3 E;  3VGO A;  2Q91 A;  3L36 A;  1UWO A;  2ZT9 D;  1SQP E;  1SQV K;  4WBA A;  1NTK D;  4PE4 A;  1MUX A;  1KB9 H;  2P2U A;  3HE4 A;  1U7J A;  4CPG A;  3I5H B;  1XK4 C;  1W2B O;  2B87 B;  1USE A;  3CDN A;  3BCC D;  4U3F D;  5KKZ C;  4BY4 A;  3M9Q A;  4MLW A;  2GGM A;  1YX7 A;  2KFH A;  4JPZ B;  2V4H A;  1Y9B A;  2H7H A;  2ZJS E;  2TN4 A;  2G3A A;  4HKZ H;  1H8A A;  1QVI Z;  2WSS H;  1XK4 A;  4QJ4 B;  3EWK A;  1FF1 A;  2DW3 A;  1TUJ A;  4L73 A;  1KOR A;  3CCV P;  2AEM A;  2XV5 A;  4WWI A;  3FX0 A;  1OOG A;  1WY9 A;  4EI2 A;  1EXI A;  1SCV A;  1PP9 D;  3CXH I;  1DEL A;  1JFK A;  3R1V A;  1RHZ B;  2LMU A;  3SS3 A;  2KI7 B;  2MLF C;  3HX4 A;  3LK0 A;  2WSE J;  1CW5 A;  4AUW A;  1C3Z A;  2BEQ D;  1L0L K;  3K1E A;  4IL6 E;  5AW6 B;  1PGO A;  3FE8 A;  4N78 D;  2FCD A;  2H2K A;  1EZV E;  2B88 A;  1U5I B;  1VQM P;  1SL9 A;  1FBV A;  1T3J A;  1UHI A;  2JNF A;  3KQG A;  1NAF A;  2R3S A;  4C7N A;  3H1I G;  3KZI H;  2KK7 A;  1M45 A;  2KNC A;  4D6T E;  1EG3 A;  1CZQ A;  3H1J D;  5AW3 B;  5B5E H;  1SQX D;  4WY4 B;  3SWY A;  1W7J B;  1VQN P;  1DX7 A;  1S72 P;  5CSN A;  2WCK A;  1IRJ A;  1J1D B;  4XJK A;  1JFJ A;  2EGD A;  1KYO D;  1NAY A;  3HE4 B;  1FDO A;  1LTA C;  1HT9 A;  3CAB A;  1NTK K;  2CK3 H;  3WUU A;  1BR1 B;  3V5B A;  1S5L H;  4HRE E;  1NCX A;  2I18 A;  4CLN A;  1M8O B;  2JZI A;  2V7Q J;  3FXD A;  5AVX B;  4P2Y B;  2W6A A;  4TLF A;  1H0T B;  1LTI C;  1DJG A;  2F33 A;  3CTN A;  2NCO A;  1KK7 Y;  1BGY J;  4RJT A;  3DYE A;  2MA2 A;  3WUV A;  1CLM A;  5AXI A;  3D70 A;  1LS8 A;  3HD7 C;  3WUT A;  2FFD C;  1Y47 A;  3AE8 C;  3EVV A;  1EDK A;  5JJG A;  2AEJ A;  1DJW A;  4MZL A;  3BUN B;  1KSM A;  1BE3 D;  3PH0 A;  3Q2Y A;  2ERB A;  1SQP D;  2IZ0 A;  2D2C B;  3GF3 A;  3VMZ A;  1DT7 B;  1IFD A;  4L74 A;  3PJS K;  3LLE A;  4H44 C;  1MFZ A;  1RF0 C;  1DJH A;  3RK2 C;  3LK1 A;  1R5S A;  3V6I A;  2MKV A;  3H4S E;  3HD7 A;  2KYF A;  2FFD A;  1KYO I;  1LTB C;  5HKZ A;  2FYZ A;  1EXJ A;  1XFX O;  1PAL A;  1IZN B;  1LT9 B;  3GG2 A;  2XNX A;  5APX A;  1GL2 D;  1ZXG A;  2ZNE A;  1NTM J;  1VQ7 P;  1JTH A;  1AQ5 A;  2HR3 A;  3RK3 D;  1FZE A;  2PVB A;  3CD6 P;  1RF0 A;  3D73 A;  1VDF A;  1L4A C;  3BFH A;  3AKA A;  3RL0 D;  5I94 A;  2ZVN B;  2HF5 A;  4YGD B;  3H32 A;  4WB4 A;  1SQX K;  1QV0 A;  1RWY A;  1R8E A;  4GDO A;  2B89 A;  4XJK B;  1K96 A;  2IDB A;  5CCH C;  1IFN A;  5CHX A;  3QRX A;  1B8C A;  2JDI H;  2WSC H;  1M57 D;  2WCL A;  2L98 A;  3NSL A;  2JJL A;  1L4A A;  1EZV D;  1Q80 A;  5CCG C;  1LTJ C;  1S5G Y;  3CGA A;  3GK2 A;  1JF0 A;  2ZAE B;  1S26 D;  2FYU J;  2WCF A;  1YIT P;  2JWW A;  1B47 A;  3SS5 A;  3I56 P;  2YMK A;  5H2F E;  4D6T D;  2LCP A;  1NCY A;  3TDZ A;  3H6P A;  3A0H H;  5CCH A;  1AVS A;  5CSF A;  4JYC A;  3I5C A;  4IOI H;  1M7L A;  1X8Y A;  2JWA A;  1AJ5 A;  1FI6 A;  1K8U A;  1QAT A;  3PP5 A;  5CCG A;  1LTJ A;  1EL4 A;  2P10 A;  2SCP A;  1BCC G;  2WTY A;  4MBE A;  2ZYD A;  2QJK C;  1SQP K;  1L0N G;  2R44 A;  3CPW O;  1SQQ G;  1HUC A;  3L72 G;  3V4W A;  2QVA A;  2LMT A;  1VF5 D;  2Y0E A;  1QV1 A;  4GPL B;  3H1L G;  1NO4 A;  3HD7 B;  2QDI A;  2QRX A;  5GQQ C;  1KFX S;  2LMV A;  4LC1 A;  1EZV I;  2CPB A;  1G33 A;  3CMA P;  2Y4Q A;  2WT7 A;  1FZC C;  2M1U A;  3B4S A;  1OMD A;  2ZFC A;  3V4Q A;  1C7V A;  2FCE A;  1VPC A;  1JTH B;  1MHO A;  2WSF J;  2JTT A;  2ZVO B;  2F3Y A;  3N4X A;  4NPE A;  2BKI B;  5CSJ A;  3H1I J;  2P7J A;  4H44 B;  1A75 A;  3RK2 B;  4ASV A;  1IKU A;  2C0W A;  2A06 D;  2WMM A;  1GGW A;  1EXR A;  3H32 B;  3A8R A;  2M49 B;  1BDD A;  1FZC A;  5AVY B;  3CL3 D;  1GGZ A;  1JF2 A;  1S4X A;  3U1C A;  1KQG B;  2OPO A;  1QL2 A;  1K9U A;  1QLS A;  1S36 A;  5KLV J;  2JPT A;  2SAS A;  1L4A B;  3FE9 A;  2PSR A;  1N2D C;  2FYU E;  3OJA B;  3AAJ A;  5TIS H;  1YBK A;  1MFT A;  1QIW A;  1LJ2 A;  5EFW B;  1NGM B;  2E76 B;  1IQ5 A;  3FIA A;  5AW1 B;  4GOD A;  2P6B B;  1IFJ A;  2O3J A;  2K2A A;  1FJK A;  2EHB A;  2JNX A;  2FY8 A;  1DTL A;  4INW A;  4QJ3 B;  3WU2 H;  2KBI A;  4KHX A;  2P70 A;  3RL0 B;  2MJZ A;  4M2O A;  1YJN P;  1N2D A;  3BVH A;  1LTJ B;  1AK8 A;  1WRK A;  4I7Z C;  1P28 A;  3IN6 A;  1YJ9 P;  3SG2 A;  3L4F A;  3S0E A;  4AYC A;  1FZB A;  1SL7 A;  1K95 A;  4H13 C;  1WDC C;  4OCI A;  1YX8 A;  1AA0 A;  1RY3 A;  3NGV A;  5KAI H;  2Y1N A;  4U7J A;  3CWG A;  1ZRT E;  3LL8 B;  2NCP A;  2WCM A;  1OE9 B;  1Y0V H;  2WT7 B;  1L2P A;  2KOT A;  3SS4 A;  3I5I C;  3PN7 C;  2QJK B;  1LXF C;  3SG3 A;  4PV1 B;  1HBW A;  3VTP C;  3CCS P;  1CDM A;  3K21 A;  1EDJ A;  1JEK A;  1PVB A;  1KK8 C;  4MZJ A;  1IJD B;  3FWC A;  4GOF A;  5APS A;  1CMF A;  3OA7 A;  4WVZ A;  3RZS A;  3BAT A;  2K9Y A;  1K94 A;  4D1E A;  1KQL A;  2M29 A;  1NSH A;  5KLV E;  1F71 A;  3AEF C;  1SK6 D;  3VRR A;  5G08 A;  1AHR A;  3F45 A;  2AXT E;  4RKU J;  1OW8 A;  3TF5 A;  4Y99 C;  1LT1 A;  2OAR A;  2FXP A;  3OP0 A;  1ALV A;  4MRX A;  1NKN A;  2IFN A;  3CWB J;  1GMJ A;  5AAN A;  1BSH A;  5HLV A;  1TTX A;  3EFF K;  1CKK A;  1FJP A;  5EL2 A;  1VQL P;  1PSR A;  1XFV O;  3D75 A;  2HQ8 A;  2K61 A;  2JU0 A;  3RBX A;  1KC8 Q;  1G4Y R;  2IBZ E;  2JPO A;  1FPW A;  1MQ1 A;  2A45 H;  3FGA D;  3AE1 C;  3F5H A;  4DUQ A;  5AER A;  2WPQ A;  5DKR A;  3IAO A;  2K1A A;  1ZMZ A;  4B86 A;  3K5B A;  1BCC J;  2D8N A;  2G9B A;  2KP8 A;  3MTU E;  3B87 A;  4F0Z B;  5HL1 A;  1E5W A;  4IL1 A;  1L0N J;  3IQO A;  1SQQ J;  4H0L B;  3L72 J;  4R4L A;  1NPQ A;  2FYU D;  1Q86 Q;  3S0G A;  3DD4 A;  2SPZ A;  4DJG A;  3H1L J;  2R2I A;  3A0B H;  1YYC A;  4XA4 A;  4FQO A;  4M2Q A;  2E30 A;  4I7Z B;  5KAF H;  3IF7 A;  3JVT B;  1K05 A;  3L70 E;  2MJW B;  1H89 A;  4HRG A;  1KD1 Q;  1JSA A;  3NTN A;  2KAY A;  3L74 E; 
#chains in the Genus database with same CATH homology
 2TN4 A;  1WDC B;  1XFW O;  2BBN A;  4I5L B;  1QVI Z;  4WQ3 A;  4MSP A;  1CFF A;  2CXJ A;  1XK4 A;  4QJ4 B;  2KGB C;  1FF1 A;  1YUS A;  1KK7 Z;  4C0L A;  3BUO B;  1NX0 A;  2KGR A;  2KQY A;  1WY9 A;  2L4H A;  2M9G A;  3TS5 C;  1QX2 A;  1LA3 A;  1SCV A;  2L4I A;  5IBW A;  1CMG A;  1K93 D;  1A4P A;  2K7D A;  1JFK A;  1RFJ A;  2LMU A;  5D7F A;  1B7T Z;  1MXL C;  2MLF C;  1Y1U A;  1IJ5 A;  3HX4 A;  3O4Y A;  1KFU S;  1TNW A;  1REC A;  3LK0 A;  2BBM A;  4GNK B;  1QJT A;  2AAO A;  2KI4 B;  1CKK A;  4NDD A;  3VRN A;  1IQ3 A;  3O2P A;  1PSB A;  2LE9 B;  1PVA A;  2NXQ A;  2FCD A;  2KI6 D;  1NX3 A;  2F2O A;  1BR4 B;  2H2K A;  1U5I B;  3CLN A;  1K90 D;  2ISD A;  4BY5 A;  1F54 A;  1S1E A;  1KCY A;  1AJ4 A;  1A75 B;  1SL9 A;  1FBV A;  2BCA A;  1UHI A;  4CPV A;  2JNF A;  4OKH A;  2F8P A;  2LV7 A;  1NUB A;  1N65 A;  1QXP A;  1CFD A;  1YVH A;  2KDH A;  2KYC A;  1BT6 A;  2LC5 A;  3MSE B;  4HRH A;  1M45 A;  2JUL A;  2JXL A;  2ZFD A;  1EG3 A;  3BXK A;  5DKQ A;  1FI5 A;  2Y5I A;  3WHT B;  1EG4 A;  4YRU A;  4OV2 A;  1W7J B;  1TN4 A;  3EVR A;  5CSN A;  1IRJ A;  1WLZ A;  1PK0 D;  3EVU A;  3M0W A;  1J7O A;  3DVE A;  4XJK A;  1HQV A;  1JFJ A;  2EGD A;  1OOJ A;  3BOW A;  1HT9 A;  2M3W A;  3DF0 A;  2ZN9 A;  4NDC A;  2HET A;  2OTG C;  3EK8 A;  1OSA A;  4MN0 A;  3ICB A;  1BR1 B;  1TOP A;  2LUC A;  2O5G A;  1NCX A;  4HRE E;  1KQV A;  3RM1 A;  2JT8 A;  2I18 A;  4CLN A;  2JZI A;  4P2Y B;  1YRT B;  1QVI Y;  3TDU A;  2WOS A;  5CPV A;  1DJG A;  2F33 A;  2HPS A;  3CTN A;  3FS7 A;  1PUL A;  1KK7 Y;  2NCO A;  4PE0 A;  4DIR A;  2V53 A;  2MA2 A;  1CLM A;  1S5G Z;  5AXI A;  3RLZ A;  1TCF A;  5D69 A;  5I8N A;  2A4J A;  1H8B A;  1SY9 A;  1LVC D;  1ZOT B;  2BL0 C;  2QPT A;  2LLS A;  3EVV A;  1B7T Y;  1S3P A;  1CDN A;  5JJG A;  1ALW A;  1DJW A;  1QX7 A;  2RGI A;  4MZL A;  3BUN B;  1KSM A;  1L2O C;  4P5O E;  4CFQ A;  4JWQ A;  1J7R A;  1DJY A;  2L50 A;  4C0K A;  2PRU A;  1DT7 B;  1XYD A;  1KFU L;  1UHN A;  1SR6 C;  4ETO A;  3VRP A;  3LLE A;  2G2B A;  1OMV A;  1TNQ A;  3PLF B;  1F8H A;  1DJH A;  2B1U A;  1CM4 A;  2K7O A;  3LK1 A;  2KHN A;  4M2P A;  4YGB B;  2NLN A;  3H4S E;  2KYF A;  1SKT A;  2LVJ A;  4GFT A;  4YGA A;  3C1V A;  5HKZ A;  4YI9 A;  4I5N B;  1XFX O;  1PAL A;  4OR9 B;  1TIZ A;  1GQM A;  2LAP A;  3OB1 B;  5JOL A;  2L2E A;  2BEC A;  2MRD A;  2ZNE A;  3DVJ A;  4N1G A;  3TS5 B;  2I7A A;  4YBH B;  2BCB A;  1XVJ A;  5CSI A;  1TNP A;  3D0Y A;  1WLM A;  1UUR A;  1NX1 A;  2LP2 A;  2PVB A;  1TNX A;  2M7N A;  3TDI A;  2O60 A;  4PHK A;  4YGE B;  2CNP A;  1OZO A;  3CR2 A;  3KPX A;  3IQQ A;  1ZUZ A;  1OFC X;  3AKA A;  4ORC B;  2KBM A;  1OMR A;  1MWN A;  2HF5 A;  4PHN A;  2QAC A;  4YGD B;  2KSP A;  1QIV A;  1Y1A A;  3I5I B;  3PN7 B;  5F6T A;  1LA0 A;  1QV0 A;  3O6B A;  2LP3 A;  1SNL A;  1RWY A;  4XJK B;  2PAS A;  1K96 A;  1A03 A;  2BE4 A;  3JVT C;  3QRX A;  1J7P A;  1B8C A;  2MLE C;  1KK8 B;  3CZT X;  3BOW B;  1BF5 A;  4ICB A;  2L98 A;  1SCM C;  3DF0 B;  2K7B A;  3NSL A;  1CLB A;  2KAV A;  2M7L A;  1CB1 A;  1Q80 A;  3WNX B;  1S5G Y;  3CGA A;  3LCP C;  1ZAC A;  1E8A A;  1TCO B;  3GK2 A;  1CTR A;  1L7Z A;  1NYA A;  1XA5 A;  1JF0 A;  1M39 A;  2LAN A;  1S26 D;  1RK9 A;  2WCF A;  2CTN A;  1WRZ A;  2JWW A;  2LLT A;  1B47 A;  2BKH B;  2BE6 A;  3BUM B;  4TNC A;  3NXA A;  5AFP A;  3ZNI A;  1X02 A;  2JQ6 A;  2LCP A;  1NCY A;  1JUO A;  4GGF C;  3TDZ A;  1RRO A;  1IGV A;  1V1G A;  1AVS A;  3SG4 A;  5CSF A;  1F4O A;  1EH2 A;  3I5G C;  2IS9 A;  1F70 A;  1AJ5 A;  2OTG B;  2F3Z A;  1FI6 A;  1K8U A;  1UP5 A;  1QAT A;  3OHM B;  1J55 A;  1CFC A;  1YUT A;  3NSI A;  1EL4 A;  1CLL A;  1QS7 A;  4I5J A;  4QJ5 B;  2SCP A;  4DCK A;  4MBE A;  1AP4 A;  1C7W A;  2OS8 B;  4CFR A;  1M31 A;  1YR5 A;  3NSO A;  4I5K A;  2WCE A;  1KSO A;  4E68 A;  2LMT A;  3CR5 X;  5PAL A;  1S6J A;  1QV1 A;  3EK7 A;  3PAL A;  4GGF A;  1IJ6 A;  3TUY C;  1YUR A;  4GPL B;  2PAL A;  1YVL A;  2EC6 C;  2JT3 A;  1JBA A;  1M63 B;  1LKJ A;  2I94 A;  4AQI A;  2BL0 B;  3BQ3 A;  5GQQ C;  1KFX S;  1OQP A;  2LMV A;  2MHH A;  2FOT A;  1C07 A;  1XFZ O;  4HSZ A;  4GBA A;  1KWO C;  4JQ0 D;  4NDB A;  1L2O B;  3CS1 A;  2H61 C;  1G33 A;  1A29 A;  1B8R A;  1DJI A;  2Y4Q A;  1BLQ A;  4CID A;  2M1U A;  1OMD A;  2ZRT A;  3PFV A;  1C7V A;  1JWD A;  2FCE A;  4ORA B;  1MHO A;  2M97 A;  2JTT A;  3JTD C;  3AKB A;  1K9P A;  4A4B A;  2F3Y A;  1QAS A;  1H4B A;  1SR6 B;  1IWQ A;  2Q4U A;  2BKI B;  4N1F A;  4WRI A;  1U5I A;  5CSJ A;  5I2L A;  4MEW A;  1YUU A;  3HCM A;  1KQM C;  1BU3 A;  2Y9Z A;  1DJX A;  1A75 A;  2LVK A;  3I5F C;  3NSK A;  1DJZ A;  2F2P A;  1YTZ C;  1IKU A;  1IG5 A;  2LVI A;  1GGW A;  2LUX A;  3OB2 B;  2FJU B;  1EXR A;  3E3R A;  1MF8 B;  3A8R A;  1UHH A;  1CDP A;  2M49 B;  4WQ2 A;  2H61 A;  1GGZ A;  5AEQ A;  1JF2 A;  1XFY O;  4PAL A;  3WHU B;  3PAT A;  4FTG A;  3DVK A;  2OPO A;  2GV5 A;  1K9U A;  2LHL A;  2Y1M A;  2ZN8 A;  1QLS A;  1S36 A;  2JPT A;  2GGZ A;  1M46 A;  1F55 A;  1A2X A;  1QLK A;  2ZRS A;  3EKH A;  2SAS A;  2KFF A;  1SBJ A;  2BCX A;  2PSR A;  5HKW A;  2KAX A;  3BUX B;  2JT0 A;  1SYM A;  1J1E A;  2CT9 A;  3AAJ A;  4DS7 A;  1B9A A;  1GJY A;  2LVV A;  3CR4 X;  2VRG A;  1QIW A;  1B8L A;  1IQ5 A;  1UHK A;  1VRK A;  1OZS A;  3FIA A;  1EJ3 A;  2M8U A;  2P6B B;  1TRF A;  2K2A A;  4ZCV A;  2EHB A;  2NZ0 A;  2JNX A;  4OVN F;  1DTL A;  3GOF A;  5KU1 A;  3I5H C;  3PM8 A;  2M0R A;  4QJ3 B;  2KBI A;  1DGV A;  1SCM B;  1DMO A;  1ODB A;  1DF0 A;  4M2O A;  1N2D A;  2WC8 A;  3SG5 A;  1AK8 A;  1WRK A;  3TZ1 A;  3BYA A;  4XYN A;  3SG2 A;  5BPJ A;  2ZND A;  5TNC A;  3VRO A;  1BMO A;  2LM5 A;  1K2H A;  4R1E A;  5FYX A;  1SL7 A;  2M1K B;  1K95 A;  2K2F A;  4PHM A;  4MZK A;  1PRW A;  1KFX L;  1WDC C;  2JTZ A;  4OCI A;  1YX8 A;  4U8D A;  4ZCU A;  2K0J A;  3SIA A;  5I2O A;  1BOC A;  2PMY A;  3FWB A;  4A4C A;  4DRW A;  4PE7 A;  2Y1N A;  1IH0 A;  3CWG A;  3I5G B;  4ORB B;  1AUI B;  1SPY A;  1QX5 B;  1BJF A;  3LL8 B;  3SJS A;  2NCP A;  5KTY A;  4AQJ A;  2CCM A;  4Q04 A;  1OE9 B;  1Y0V H;  3KF9 A;  1BOD A;  1XFU O;  2MBX A;  1CFP A;  3SG6 A;  3D10 A;  2KOT A;  1N0Y A;  1XO5 A;  3I5I C;  3GK1 A;  3PN7 C;  1FW4 A;  5HLO A;  5K89 A;  1LXF C;  3SG3 A;  3AAK A;  1BG1 A;  1UHJ A;  2LLU A;  2L51 A;  4YGC B;  2JOJ A;  1SMG A;  2CBL A;  2KI4 C;  1CDM A;  3K21 A;  1Y1X A;  2E6W A;  3EKJ A;  1PVB A;  3SIB A;  1KK8 C;  3VRQ A;  4MZJ A;  1NIW A;  3FWC A;  3TUY B;  3OX6 A;  2EC6 B;  4MVF A;  1B1G A;  1QTX A;  2LNK A;  2HQW A;  1DVI A;  1CMF A;  3KEV A;  1Y6W A;  1ZFS A;  3A4U B;  5I2Q A;  1K94 A;  1KWO B;  4C0J A;  4D1E A;  1CDL A;  2KQ6 A;  2M29 A;  4PDZ A;  1NSH A;  2LHI A;  2KI6 C;  1F71 A;  1SK6 D;  3VRR A;  4AOM A;  5G08 A;  2KFG A;  2DOQ A;  1B4C A;  3BUW B;  3JTD B;  1NWD A;  5ER5 A;  3ZWH A;  1AHR A;  3F45 A;  1R6P A;  5J3X A;  1D1O A;  3DVM A;  2JXC A;  1NCZ A;  1KQM B;  3OP0 A;  3SG7 A;  1S6I A;  3I5F B;  1ALV A;  3EK4 A;  4MRX A;  1J7Q A;  1MXE A;  5AAN A;  3GK4 X;  3D0Y B;  1JSA A;  1JC2 A;  2L0P A;  1TTX A;  2WOR A;  3O78 A;  1SL8 A;  4NQG A;  4USL A;  5HLV A;  1WRL A;  1PSR A;  1RJV A;  2KNE A;  3PSR A;  4N5X A;  5KSZ A;  2Y9Y A;  5HYD A;  1XFV O;  3KO0 A;  5HKY A;  1UUS A;  2HQ8 A;  2K61 A;  2JU0 A;  2ZKM X;  2OS8 C;  1DGU A;  1G4Y R;  4PE1 A;  1FPW A;  1MQ1 A;  3KHE A;  4YI8 A;  1NX2 A;  1W7I B;  4DUQ A;  5AER A;  2JRF A;  1DF0 B;  5DKR A;  1ZMZ A;  4UPG A;  2WND A;  4L9M A;  2K8M B;  1K9K A;  2D8N A;  2G9B A;  1F4Q A;  1LIN A;  4F0Z B;  1J1D A;  4IL1 A;  1G8I A;  3IQO A;  3VGO A;  2Q91 A;  1UWO A;  1NPQ A;  1R2U A;  4PE4 A;  5B8I B;  1MUX A;  5ER4 X;  3DD4 A;  1CNP A;  3I5H B;  1XK4 C;  4MRY A;  1MR8 A;  2R2I A;  2JC2 A;  2AUC A;  2WCB A;  4GAO A;  4GUK A;  4FQO A;  1CM1 A;  4PCW A;  4GGN A;  4M2Q A;  1SW8 A;  1SRA A;  2COL B;  2E30 A;  1S6C A;  4MLW A;  2GGM A;  4BY4 A;  1YX7 A;  2KFH A;  3IF7 A;  3JVT B;  4JPZ B;  1RTP 1;  2I2R E;  1NP8 A;  1V1F A;  5DKN A;  2MJW B;  2L5X B;  2AMI A;  4HRG A;  4PHJ A;  3OX5 A;  2MAZ A;  2K7C A;  1YRU B;  2KAY A;  3WXA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...