4OVNF

Voltage-gated sodium channel 1.5 (nav1.5) c-terminal domain in complex with calmodulin poised for activation
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
146
structure length
146
Chain Sequence
b'STEPLSEDDFDMFYEIWEKFDPEATQFIEYSVLSDFADALSEPLRIAKPNQISLINMDLPMVSGDRIHCMDILFAFTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSAMVIQRAFRRHLLQRSLKHASFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Calmodulin
publication title Regulation of the NaV1.5 cytoplasmic domain by calmodulin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 34
structure length 146
sequence length 146
chains with identical sequence G, H, I, J
ec nomenclature
pdb deposition date 2013-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ovnF01
1.20.5.1190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces iswi atpase 4ovnF02
4OCIA 1K94A 3F45A 2LUCA 3KF9A 2BL0B 2EHBA 2JTTA 4YGBB 1CLBA 3BUMB 1SR6B 1EG4A 1K9UA 2CTNA 5B8IB 1W7IB 3O78A 1B8LA 2KAXA 3BUXB 3TDZA 2KYCA 1B1GA 2JOJA 4NDDA 1WDCC 1SYMA 3BUWB 3SG3A 1LA3A 2JZIA 3GOFA 2PALA 2MLFC 1MXEA 4N1FA 3SG6A 4MZJA 1DJYA 1GJYA 4MZLA 4PHNA 2JRFA 1QLKA 5JJGA 5DKRA 1JFJA 4DS7A 4I5LB 1RTP1 5CSFA 2K8MB 2LVJA 5FYXA 1KFXS 1ZOTB 1TOPA 1XFVO 4MBEA 3FS7A 1SCVA 1XA5A 2LP3A 3I5FB 4YGAA 1DVIA 2KGBC 5AXIA 1DGVA 1R6PA 1BMOA 1QV1A 1NCXA 3A4UB 4PE7A 5KU1A 2LLSA 3PSRA 3TDUA 1EH2A 3NSIA 1E8AA 1KSMA 4E68A 4HRHA 1SPYA 1J7QA 3CTNA 1YVHA 2EC6C 2JXLA 2L4HA 1MUXA 4ORAB 2HF5A 1FF1A 2JC2A 4ORBB 1M39A 1DTLA 1CFDA 2H61C 2I18A 2OTGC 3SG4A 2KQ6A 2M9GA 1EXRA 1UUSA 3SG2A 1KK8B 4YGEB 1UHJA 1G8IA 2KAYA 4I5NB 2WCEA 4Q04A 3BUNB 1YX8A 2BBMA 3BQ3A 3KO0A 2LC5A 4XJKB 2F3YA 2KYFA 1IH0A 4I5JA 1WRKA 3DVMA 1L2OC 1OMDA 1DJWA 4QJ3B 1TTXA 5JOLA 2AUCA 1OZSA 2F3ZA 2JT0A 2PMYA 1S6CA 4FQOA 4MRYA 1DGUA 3K21A 4PHKA 2K7OA 1KFUL 3CR4X 3O2PA 1LVCD 1SY9A 1AJ4A 5CSIA 2L51A 2Y9YA 2F8PA 1S6IA 1JF0A 3I5IB 1DJHA 1F8HA 1H8BA 2KAVA 1BU3A 4OV2A 2NXQA 4PALA 2JPTA 1KQMC 1SL9A 5I2OA 1CDNA 1QS7A 2FCEA 1A03A 4JPZB 2P6BB 3O6BA 2BBNA 3DVKA 5HKWA 2O60A 2BECA 3TUYB 1XFUO 4PE4A 1GQMA 4JWQA 4NDBA 1SL8A 2HETA 1SK6D 1YRUB 4AQIA 2M1UA 4PCWA 2LE9B 3PN7C 4JQ0D 1ALVA 3OHMB 4WRIA 3EKHA 5GQQC 1DMOA 1NUBA 1K9KA 3CLNA 1AP4A 1KWOB 2NZ0A 3PATA 3QRXA 2M97A 4USLA 5AANA 1M45A 3NSKA 4A4CA 1IQ3A 3I5HC 1J7OA 1QIVA 2KNEA 2LHIA 1DF0B 2M7NA 1DF0A 2A4JA 1RROA 3E3RA 1PSRA 1ALWA 4CFQA 1KSOA 3RM1A 1B8RA 2IS9A 5D7FA 3ZWHA 1QASA 3MSEB 1PVBA 1TIZA 1F71A 4ETOA 1NIWA 1QVIY 1VRKA 1UWOA 3CS1A 3OX6A 4PE0A 1KCYA 3BYAA 1B4CA 4NDCA 5AFPA 1NX2A 1X02A 3EK8A 5K89A 1XVJA 1DT7B 1JBAA 4DCKA 2WC8A 2WCBA 5HYDA 2JTZA 1AUIB 1PVAA 1QX2A 2F2PA 4BY4A 2M3WA 1KK7Z 2Y9ZA 5CSNA 3D10A 1CM4A 2F2OA 2JULA 1XFXO 1DJIA 2Y5IA 3JTDC 2BKIB 2KGRA 2M49B 2LVVA 5ER4X 1NX0A 2ZNDA 2NCPA 1F70A 3FWCA 1B7TZ 3AKBA 4N1GA 1Y1UA 1YUUA 4M2PA 1NCZA 1UHKA 2KOTA 3AAJA 3LLEA 2BCBA 3SJSA 1YURA 1S36A 4MEWA 4PHMA 3CR5X 1K2HA 1SL7A 4HSZA 4N5XA 4DUQA 3KHEA 1R2UA 2LCPA 2O5GA 1B47A 5KTYA 3I5GC 4MRXA 1CLMA 1CLLA 2K2FA 3NSLA 3VGOA 1XFWO 1SKTA 5I8NA 1WY9A 2K61A 1TNWA 3EVVA 4ZCUA 1XK4C 5HLOA 1M31A 3TZ1A 1DJXA 3EKJA 1N65A 2QACA 3SIAA 2KFHA 1GGZA 3VRPA 3BOWB 1Q80A 3BOWA 1HT9A 2MAZA 2CCMA 3H4SE 4ZCVA 2L2EA 3I5HB 3C1VA 2JU0A 2AMIA 4PE1A 3SIBA 4OVNF 3OX5A 5F6TA 2KFFA 1CDPA 1TN4A 1S6JA 2ZRTA 4WQ3A 1FI5A 5CPVA 1RFJA 1BF5A 1QIWA 3OB1B 4M2OA 1GGWA 1JSAA 4GUKA 2E6WA 2I94A 1YX7A 1WRLA 2LM5A 2FOTA 2KI4C 3TDIA 3TS5C 4HRGA 2LAPA 2LLUA 3LK1A 3AKAA 1PSBA 2PRUA 4GGFC 1CM1A 5HLVA 2LP2A 4MSPA 3VRNA 1RECA 2BE6A 2JT3A 2OS8C 2HPSA 4P2YB 2LNKA 4FTGA 1YUTA 1BLQA 2LUXA 2M0RA 1G4YR 4MZKA 5D69A 1HQVA 1FW4A 2Q91A 3JVTC 2TN4A 2Y1NA 1SCMC 3WHUB 4DIRA 1QV0A 4AQJA 3VRRA 4QJ5B 1WLZA 5J3XA 1A29A 4PHJA 4WQ2A 1S1EA 1QJTA 1BODA 2I7AA 1WDCB 1WRZA 1CB1A 1YR5A 1YTZC 2LMVA 4MN0A 1OZOA 2MA2A 2JT8A 3OP0A 1JUOA 2BKHB 2LMUA 3EVUA 4MVFA 4YI9A 3FIAA 1FPWA 2LANA 2M7LA 3BXKA 3DF0B 5CSJA 3DF0A 1Y0VH 2RGIA 2BL0C 4GNKB 3DVJA 4C0JA 1H4BA 1KFUS 2PVBA 2HQWA 1EJ3A 2MRDA 2M1KB 1PRWA 3CGAA 3WNXB 1BR4B 5DKNA 4UPGA 4CFRA 4L9MA 2EC6B 2CXJA 1TRFA 1YVLA 4C0LA 4NQGA 1NX1A 2KHNA 1B8CA 3SG7A 2JNXA 1TCOB 1W7JB 2OTGB 3A8RA 2H2KA 1XO5A 2H61A 2L0PA 4YI8A 3LL8B 1J7PA 1AVSA 2K2AA 2K7BA 2KI6C 1SBJA 2LHLA 2MLEC 4GAOA 4PDZA 4C0KA 3I5FC 1QATA 1AHRA 1CTRA 2KI6D 1QTXA 4CIDA 1LXFC 3SG5A 4GGFA 1L2OB 3CZTX 3VROA 2WOSA 3O4YA 1BT6A 1TNPA 1AJ5A 1S5GZ 4D1EA 1QXPA 2DOQA 1UHNA 3KEVA 5KSZA 1FBVA 2NCOA 2V53A 2WNDA 1K8UA 1M63B 2I2RE 1BOCA 1MHOA 1EG3A 1KQMB 1TCFA 3PALA 3RLZA 1A2XA 1KFXL 1OMVA 2JXCA 4HREE 1IKUA 4QJ4B 1BG1A 1MQ1A 3FWBA 3CWGA 1J7RA 2B1UA 4M2QA 3HX4A 1IGVA 2EGDA 1U5IA 3EVRA 2BCAA 3WXAA 4A4BA 1YRTB 2CT9A 4GPLB 1MXLC 3NXAA 1IWQA 4I5KA 2BE4A 1JWDA 3PFVA 3M0WA 3PN7B 2MBXA 1Y1AA 1SW8A 1UP5A 3I5IC 5TNCA 3EK4A 3GK1A 5DKQA 1F4OA 1ZUZA 1FI6A 1C07A 2ZNEA 1A4PA 1PK0D 3GK4X 1NSHA 1K93D 3EK7A 4GBAA 1J1EA 2D8NA 1MR8A 3PLFB 4DRWA 3TUYC 2VRGA 1DJGA 1K95A 2M8UA 1F55A 1MWNA 1NWDA 3DVEA 1CFFA 4YGDB 1SNLA 2KFGA 3ZNIA 1S5GY 1KK7Y 1YUSA 1XFZO 2JWWA 2WORA 1KWOC 3ICBA 2ZN8A 4XYNA 2LLTA 2GV5A 2MHHA 4AOMA 1XYDA 2M29A 4TNCA 2PSRA 3PM8A 1CMFA 1F54A 1NP8A 1CDMA 1B7TY 1TNXA 1IJ5A 4ICBA 2F33A 1AK8A 1PULA 1IG5A 2ZN9A 2G2BA 3JTDB 4R1EA 5AERA 1OQPA 2CNPA 4GGNA 2SASA 2CBLA 3BUOB 1JFKA 3GK2A 1IQ5A 1DJZA 1NYAA 2ISDA 3NSOA 3KPXA 1OE9B 4XJKA 2JQ6A 2PASA 2HQ8A 2K0JA 1OSAA 2FJUB 4YBHB 3IF7A 2L4IA 1QVIZ 1BR1B 3I5GB 2LMTA 1K90D 1IJ6A 4MLWA 1J1DA 1N0YA 2OPOA 1ZACA 2E30A 2LVKA 1XK4A 1RK9A 2KBMA 4OR9B 4CLNA 1SMGA 1S26D 2SCPA 3LCPC 3DD4A 2GGZA 1J55A 1UHIA 3AAKA 1L7ZA 2Y1MA 1SR6C 1JC2A 1CFCA 3D0YB 3D0YA 3IQOA 4P5OE 3CR2A 1LA0A 4IL1A 4F0ZB 1OOJA 1CMGA 1NX3A 1C7WA 1Y6WA 1OMRA 2Q4UA 2K7DA 4OKHA 1N2DA 1V1GA 2KQYA 1A75B 2L50A 1QLSA 1A75A 1CDLA 1ZMZA 2Y4QA 2G9BA 5PALA 2KI4B 3OB2B 2ZRSA 3TS5B 5I2QA 1ZFSA 2L5XB 2K7CA 2FCDA 1BJFA 4ORCB 1TNQA 2NLNA 5G08A 5AEQA 3VRQA 2JNFA 3HCMA 2COLB 5HKYA 1MF8B 4U8DA 1SRAA 1JF2A 1M46A 2ZFDA 5ER5A 2WCFA 1XFYO 2OS8B 4GFTA 2LV7A 2LVIA 2KBIA 1RJVA 1NCYA 1LKJA 2ZKMX 5BPJA 1RWYA 1K9PA 3JVTB 2QPTA 1UHHA 3IQQA 1OFCX 1NPQA 1SCMB 1WLMA 5IBWA 1PALA 1KK8C 1D1OA 1IRJA 1EL4A 1KQVA 4YRUA 1C7VA 1ODBA 2AAOA 1K96A 5I2LA 2L98A 4CPVA 1CNPA 2BCXA 3LK0A 1S3PA 2GGMA 1UURA 1F4QA 1V1FA 1CFPA 1CKKA 5HKZA 1U5IB 3WHTB 2KDHA 1QX5B 4BY5A 2KSPA 4YGCB 1G33A 1Y1XA 1B9AA 2MJWB 1LINA 1QX7A 2R2IA
chains in the Genus database with same CATH superfamily
1BGYD 2AEJA 2YXQB 2EHBA 5KLVD 4B86A 1CLBA 1YHQP 5APWA 1S2EA 1OW4A 2KSEA 3TDZA 1B1GA 2WCKA 1UIIA 3BUWB 3K1EA 2JZIA 2WCLA 2MLFC 1GJYA 1JFJA 5JJGA 1QLKA 2QJYB 2FY8A 2G8YA 1S72P 1RTP1 2MJZA 3KZIH 1FZCB 5CSFA 2K8MB 1KFXS 3V6IA 1TOPA 3FS7A 1SCVA 2ZT9D 3I5FB 4YGAA 3H6PA 1AVYA 1DQEA 1SFCB 3AE2C 5KU1A 1NTZE 1RE3A 1SFCA 2L2CA 2LLSA 1AQTA 3E1RA 1E8AA 1R5LA 1KSMA 4HRHA 5GTHH 1YIJP 3VMXA 1YVHA 1RF0A 1LP1A 3I5CA 2QEXP 2JXLA 1H88A 2LXBA 1SLQA 2BAPA 1M39A 1KQGB 2V7QH 1KK8B 4YGEB 2IPPA 1G8IA 1FE6A 3W68A 2WPRA 2WCEA 1HUCA 1KMIZ 2BBMA 3BQ3A 2LC5A 2E75B 4UB6E 1IH0A 1SQVK 5KAIE 1WRKA 4L76A 1SQQK 4QJ3B 2YXRB 2PMYA 1S6CA 2KZIA 3QMEA 3K21A 3L70E 3V4WA 3CR4X 3UO9A 3H1LD 5AW1B 1DJHA 1F8HA 1BU3A 2NXQA 2JPTA 1KQMC 2KIKA 3BJHA 2A45I 2P67A 2BBNA 3DVKA 5HKWA 4PD4E 2WVRA 4PE4A 1YRUB 2E74C 5KLIB 3SWYA 3RK3B 2ERBA 4WRIA 3EKHA 1DMOA 4NPEA 1X22A 3CLNA 1AP4A 1KWOB 1URQB 1SQPG 2NZ0A 1URQA 2YKQA 2M97A 1ZXGA 3UIAA 3CCMP 1QIVA 1NTKJ 1PSRA 4ASVA 4HB1A 2AEMA 3ZWHA 5D7FA 1QASA 1DC1A 1GK6A 3PP5A 2OYHB 3CC2P 1TIZA 2OYHA 5EL2A 2J58A 4ETOA 2K37A 1NGMB 1VRKA 3OX6A 3B7AA 4UB6H 1IFIA 4CPGA 5KAIH 2D2CD 1B4CA 3E7KA 1L0NG 1DT7B 1ZN5A 1XVJA 1TUZA 3KPEA 4DCKA 2WC8A 2JPOA 1AUIB 1ZOYC 2F2PA 2G3AA 3P8CD 1KK7Z 1PGQA 3JTDC 5B5EE 2W6AA 3WUTA 2NPSC 1NX0A 4C46A 1F70A 2YO3A 1NAFA 2HODB 3O4XA 2BCBA 1A02F 2HODA 3AEFC 4L74A 3D6ZA 1K2HA 4N5XA 4PD4H 1R2UA 2O5GA 1B47A 3GHGC 2L5YA 3VGOA 5I8NA 1L4AD 3BFAA 3H1LE 2IYPA 3TGUE 3EVVA 1H8AA 1XK4C 1IO4A 3M9QA 2QACA 1PPJD 3V5BA 1JY2N 2KFHA 1GGZA 4H0LC 2MAZA 2R3SA 1YJWP 1L0LG 2A06G 2PAJA 1XTGB 2KFFA 1TN4A 1QLED 2ZRTA 3G6EP 1LTIC 1QIWA 4N6JA 1GGWA 3D77A 2O1KA 4H44C 2PGDA 2LM5A 3AEDC 1PP9G 1KQLA 2XNDH 3AE9C 2LLUA 2O3JA 1PSBA 1JUNA 3CX5E 4JD9A 4MSPA 1CSBA 3L74E 3SFDC 4FTGA 1YUTA 1HQVA 1FW4A 2Q91A 2WCJA 3L72J 4GIFA 3WHUB 1QV0A 4GDOA 2WSCJ 1WLZA 1JTHA 2FYUD 1A29A 4PHJA 1S1EA 2I7AA 1WRZA 1CB1A 1NTKG 2MA2A 2KYVA 1U7JA 3P8CE 1JUOA 2M3BA 3CZ0A 1FDIA 4YI9A 4D6TG 3FE8A 3LIEA 3BXKA 3DF0B 1S5LX 3DF0A 1TU3F 1GL2D 2BCCJ 2BL0C 2PVBA 2IBZD 3MUDC 1TWOA 3CGAA 5DKNA 1JCCA 1SQPK 4R4LA 2R44A 4W7ZA 1SQVE 3AE1C 3SG7A 2OYOA 1FZBA 5APXA 1SQQE 1TCOB 1NTMJ 3LL8B 1NJIQ 3D78A 1PPJE 1SQXJ 3CCUP 2MLEC 5AVXB 1QATA 1AHRA 1CTRA 4LC1A 4GGFA 1SQBG 1N7SC 2N1TC 3L73D 4JBZA 4ASWA 3H1IJ 2WOSA 1KB9D 1EDJA 5M1BA 1BT6A 1L0NK 1SFCD 3B5NC 1LS8A 1AJ5A 1S5GZ 5FI7A 4D1EA 1QXPA 2DOQA 1UHNA 4PJ0H 1JMMA 3H1HJ 2V53A 2KNCB 2BASA 1M63B 1OZHA 3JC22 1BOCA 1EG3A 1KQMB 3BCCD 2M3EA 1A2XA 2QIWA 5B66H 2JXCA 4HREE 1M90Q 4I1LA 2KPHA 1ZLLA 1IGVA 1U5IA 1VQ9P 3WXAA 1YRTB 4WWIA 1VF5C 2RH0A 3NXAA 2E74B 1DEEG 3H1KJ 1JWDA 3BASA 2MBXA 1Y1AA 2JO1A 3FE6A 1KYOI 3MGNA 3N7NA 5DKQA 1ZUZA 2Q3EA 5KAFE 1JB0J 1FI6A 1BE3J 1C07A 3WMM0 3NHTA 2QG4A 2W6BA 2QE7H 3HD7D 1L0LK 2XZRA 5C39A 3TUYC 1K95A 2QEHA 1F55A 2E43A 3GF7A 1SNLA 2POHA 3M0AA 4HYTB 1KK7Y 2JWWA 1XFZO 1EXIA 3V2PA 3RK3D 1QGKB 2XNXA 1BGYG 2WC5A 1BCCJ 2MHHA 4AOMA 1S1CX 1F54A 1URQD 2FJYA 5KLVG 1AK8A 1A02J 3JTDB 4R1EA 1SQPD 1RHZB 4N78D 2CNPA 2NPSB 3PJIA 5CCHD 4UB8E 1JFKA 4EOTA 3N7HA 1IQ5A 2ISDA 1EDIA 2M8RA 1KFMA 3KPXA 2K9JB 2HQ8A 3B88A 4RO0A 1T3UA 1KB9E 3GHGB 1BR1B 3S0AA 1J1DA 2OPOA 1NTKK 1XK4A 2QA4P 1VQKP 4CLNA 1SMGA 3DYEA 1KILD 3LCPC 4H0LB 3BCCE 3AAKA 1D7MA 3L4FA 2Y1MA 1ZR4A 1JC2A 1NU1J 1ZMEC 3IAOA 1CI6B 2AXTE 3AE3C 4P5OE 1OOHA 1CI6A 4KHXA 1XTCC 4IL1A 1YJNP 5APSA 5KJ7D 2KQYA 1ZMZA 2Y4QA 3H1HG 1LJ2A 4H44B 2O01N 1ZFSA 1KN7A 3MIWA 2FXMA 3TK1A 1TNQA 3A0BE 5AEQA 2JNFA 3HCMA 1FZGA 3GW6A 4U8DA 1SRAA 1R5SA 3AE5C 2WCFA 1XFYO 1SQBK 2LV7A 2LVIA 1NCYA 3FWNA 1LKJA 1WRGA 1K9PA 1FJKA 2QPTA 1Q86Q 3IQQA 3UNWA 2WPVB 1KK8C 1K04A 3VMZA 2IFMA 1K96A 5I2LA 1PFIA 2QJKC 2L98A 1JM0A 2E75C 1BE3G 2BCXA 4H13D 1F4QA 1JY3N 3BRVB 1QX5B 4BY5A 1VQ5P 2XDJA 1SQPE 1G33A 1Y1XA 1B9AA 5CBOA 5AVUB 1SSEB 4PV1C 3KF9A 2BL0B 1C3ZA 2JTTA 3BUMB 1SR6B 1K9UA 2QEVA 1W7IB 4Y99C 2KAXA 1WDCC 3FXDA 1Q82Q 3GOFA 1D1OA 4MZLA 2JRFA 4I5LB 2HR3A 2OARA 2R32A 3WUUA 1L0NE 2ZFCA 2K88A 3Q1MA 1XFVO 1KILE 3RL0C 1XA5A 1NTKD 1FU1A 1NO4A 1CW5A 1EH2A 3NSIA 1DH3A 1OWAA 3CTNA 2EC6C 1MUXA 3AE7C 1FDMA 5KLVK 2JC2A 4ORBB 2I18A 1CFDA 2H61C 3SG4A 2Z4EA 2KQ6A 1W2EA 3Q2YA 1FZEA 4IFDK 1M7LA 3KO0A 4U3FJ 1JO5A 1TTXA 1N73A 3S4RA 1VF5B 1DGUA 1KFUL 1K9MQ 2HPCB 2ZXXA 4U7JA 1AJ4A 5CSIA 2L51A 2Y9YA 2NRGA 1VQMP 3TSIA 5BU8B 2QSIA 2VRSA 3RL0g 2A06E 2P71A 4PALA 1OOFA 3D6YA 3C8VA 1CDNA 5AVWB 5AVTB 2FCEA 3QWOC 3S0FA 2W27A 4JPZB 1PP9E 2BECA 3TUYB 4INWA 2WMMA 1SL8A 1SK6D 4AQIA 2M1UA 3EG5B 2HFED 2B87A 3PN7C 4JQ0D 3N4XA 1ALVA 3OHMB 2E74D 2Z5IA 2YMKA 4GODA 3CXHD 2JR8A 1ORGA 5APQA 3NSKA 4I6MC 2LHIA 2KNEA 2M7NA 2A4JA 1RROA 2FYUG 1ALWA 1KSOA 3VB1A 1B8RA 2R5BA 3HUSA 2LR2A 3L37A 1Q81Q 3RGUA 2WSEJ 4K3AA 1F71A 3AE6C 1NTKE 4DJGA 3A0HE 3BYAA 4NDCA 3BRTB 1X02A 1M1JA 1JBAA 1P28A 4D6TE 2P1JA 3GMAA 1XFRA 3L72D 2KSJA 2H43A 2IBZG 2L91A 1XFXO 1DJIA 2M49B 1FC2C 3L75J 4M2PA 2NPSD 3RK2C 3Q5RA 1X8YA 1YURA 3L71J 5KTYA 1S5LE 3I5GC 1CLLA 2BCCD 3OA7A 1HBWA 1XFWO 3FX0A 4IL6H 3AE8C 3L73G 4JYBA 1M31A 1SQBE 2V4HA 1FS0E 5AW7B 3PLNA 3VRPA 1P84H 3BOWB 3BOWA 4U3FG 1HT9A 2CCMA 3H4SE 3I5HB 1NTMD 4PD4I 3C1VA 4H0LD 1OIPA 3DY9A 1SQXD 1LP1B 3BCCG 2OTKE 1EDKA 1N2DC 4WQ3A 3EWKA 2CK3H 2P10A 5CPVA 4M2OA 3L35A 3H1ID 3S0DA 4EYYQ 2I94A 1U57A 3TDIA 2QJKB 3CXHE 4H44D 1M1KQ 1PZQA 4GGFC 1GW3A 1CM1A 3H1HD 4Z1MH 1OOIX 1RECA 2W8ZA 3B4SA 3HE4B 3Q5SA 3HE4A 1PIXA 1G4YR 3ZDMA 4PV1B 3JVTC 2TN4A 3D76A 1QX8A 1EZVI 3AEBC 3LIDA 2CPSA 3A5TA 2Y1NA 2Q6QA 4DIRA 3VRRA 5H2FE 5J3XA 4Y99B 3LW5H 3A2AA 3H1JJ 3H1KD 1QJTA 1WDCB 4XA4A 1GK4A 4IFFA 1YR5A 2LMVA 4MN0A 1RQUA 3L72E 5CCGA 3AEGC 2NZ2A 2LXCB 1N86A 2LMUA 1BE3D 2LANA 1BGYE 2M7LA 3RL0B 4AQRD 4YXWH 4GOEA 5CJ4A 1Y0VH 5KLVE 4GNKB 4RJTA 5CBNA 2M1KB 4L9MA 2EC6B 3SS4A 2XKMA 5CMZA 4NQGA 1FBMA 1B8CA 2I1JA 2O1JA 1AJYA 1W7JB 3A8RA 3OAKA 2H61A 3OBVA 2L0PA 2FYUK 1BCCD 2K2AA 2K7BA 4QMAA 2KI6C 1W2BO 1PGJA 1DD3A 1E79H 4GAOA 4PDZA 4C0KA 5AVVB 3EFGA 2YKPA 1QTXA 3L71G 2I1KA 2V7QJ 2N1TD 1N7SD 1TNPA 3CCQP 3MZWB 1JCDA 3B5ND 4C7NB 4MN4C 3D75A 4C7NA 2K60A 3CLQA 4PT1A 4QJ4B 1BG1A 1JY2O 3CWGA 3H1HE 2ZVNB 4FQTA 3S1KA 2BCAA 4A4BA 1HGVA 4I5KA 1J1DC 4A7PA 3LW5J 2GTEA 1NU1D 3PN7B 1VF5D 3CMAP 3I5IC 5TNCA 4OGQB 3M9BA 3GK1A 1U7MA 5AVRB 1GMJA 1HGZA 1YITP 1A4PA 3TF5A 1J1EA 1IK7A 3PLFB 2OYIC 1YBKA 1NTZJ 3EFFK 1BE3E 2QM8A 1T8ZA 3DVEA 1IFPA 3ZNIA 2KFGA 2JWDA 2KLUA 2WORA 3BATA 3H1JG 2Q9IA 1NWQA 1IFNA 2LLTA 2GV5A 1IFMA 4TNCA 3AECC 1NP8A 4ICBA 5B5EH 3S0BA 2CBLA 3U59A 1SP4A 3BUOB 1G1JA 5L8RJ 3MP7B 3RK2B 1JTHB 3L70J 1LT9A 4XJKA 2JQ6A 4NPDA 2K0JA 1OSAA 3NXSA 4YBHB 5APUA 1VQ6P 5BU5A 3I5GB 2XV5A 2LMTA 2GA1A 4MLWA 2E30A 1RK9A 2PYQA 3ITKA 2GGZA 1J55A 1UHIA 4WY4C 1SR6C 3FWLA 1CFCA 2KZJA 3CCEP 4INXA 1MKMA 3FGAD 2Q4UA 4OKHA 1N2DA 5TJHA 4GT1A 1CDLA 2G9BA 2Y0EA 5PALA 2ZRSA 2K7CA 2FCDA 3CC4P 3CX5H 4L73A 4TT3H 1MF8B 1JF2A 1M46A 4KT0J 3V2NA 5APTA 1RJVA 1MUUA 1SVFA 3MD0A 4U3FD 3JVTB 1N8RQ 1NAYA 1OFCX 1OVRA 1IRJA 1EL4A 3HRNA 5GTIE 4CPVA 1KYOD 1S3PA 2GGMA 3L36A 4YPCA 1CFPA 1CKKA 2E75D 1N73C 1U5IB 2C9LY 2MJWB 1LINA 1W9ZA 4OCIA 2H8PD 1K94A 3F45A 3AEEC 3SWKA 4YGBB 4PV1D 2FYUE 2CTNA 3TGUJ 2KLEA 1LNQA 3CWBJ 2WQYC 3BUXB 5APYA 1SYMA 4K35A 3SG3A 4DT0A 2PALA 1MXEA 1ZV8A 1IJDB 1DJYA 4PHNA 4DS7A 5AW4B 1AVOA 2Y0DA 2LVJA 1ZOTB 5KKZB 1AQ5A 3L72G 4MBEA 1LTBC 1LT1A 5AXIA 3GF3A 2KOGA 1DGVA 1BMOA 5BVZA 2IFNA 4JF7A 4PE7A 3RL0D 2QJPC 2IBZE 4ZKUA 3TDUA 1YQ4C 1NYHA 1S3JA 2L4HA 4ORAB 2HF5A 1OX3A 1OMIA 1S9KD 1Z2CB 3RZSA 3HUSC 2OTGC 2WCMA 5AVQB 1UUSA 5GTIH 2KAYA 4Q04A 1QL2A 1UIXA 2BCCG 2Q1KA 3L74J 3V4QA 4EIJA 4I5JA 3R1PA 5E79E 2IZ1A 3L73E 3CCLP 4DZOA 1M1JC 1OMDA 5JOLA 2F3ZA 1OZSA 1NKZB 2JT0A 2K7OA 3NMDA 1J1DB 3CCSP 3O2PA 1JY2P 5AW0B 4U3FE 4BRYB 1NTMG 3TYYA 4BRYA 3I5IB 1S6IA 3L71D 1AA0A 3Q8IA 2KAVA 1SQXG 1ZRTD 1LTAC 5KAFH 2ZYAA 1SL9A 5I2OA 1QS7A 2MKVA 1KYOE 3CL3D 3H1IG 1Y9BA 2ZYDA 2P6BB 3O6BA 1VQPP 2H89C 2B9BA 2JEEA 2OYIB 1GQMA 3G71P 4NDBA 2OYIA 2HETA 2A45G 4PCWA 5AVSB 3M9HA 3D74A 2P7JA 4EI2A 5GQQC 1SQVJ 3PATA 1SQQJ 2B88A 4USLA 1M45A 2OQQA 1IQ3A 3I5HC 1DF0B 1Q7YQ 1DF0A 3NTNA 3E3RA 3RM1A 1Q90D 1VQ8P 3H1KG 1JY3O 3MSEB 1PVBA 4UB8H 1VQNP 2JJLA 1UWOA 1IFDA 2P58A 3RK3E 5FI2A 5AFPA 2KUBA 5K89A 3EK8A 1DD4A 1KB9H 1FOSE 2GUVA 5HYDA 3R1OA 2WSFH 2JTZA 1DX7A 1PVAA 4RKUJ 2ZJSE 3C1LA 2Y9ZA 5CSNA 2BEQD 3H1JD 2JULA 2BKIB 4N78E 1YTZT 2KGRA 1VL2A 2LVVA 1H0TB 1H0TA 2ZNDA 3Q3DA 2NCPA 4WY4B 1QEXA 4WY4A 1B7TZ 3AKBA 4N1GA 3AE4C 1VDFA 1Y1UA 1YUUA 1PGOA 1NCZA 5DJTB 1UHKA 3AAJA 3LLEA 2W6JH 2AXTH 1S36A 4MEWA 4PHMA 1KD1Q 1BCCG 3WU2E 3RK2D 1PGPA 1K73Q 3KHEA 1BSNA 2LCPA 5CCGC 1T2KC 4MRXA 3NSLA 3IN6A 1WY9A 3B87A 2YKOA 1DJXA 2O01H 3L71E 1RE4A 3CCVP 3A0BH 1HH0A 1Q80A 1P84D 1KV4A 1L2PA 2FYZA 3HD7C 4PE1A 2AMIA 5F6TA 1CDPA 1S6JA 1GU4A 1Q2NA 1FI5A 4W7YA 1GTWA 1BF5A 2YIUC 3OB1B 1JSAA 4IFMA 1EC5A 4GUKA 1YX7A 2KI4C 1P84I 3CCJP 2LAPA 2H8VA 3LK1A 2JDIH 3H32B 2PRUA 1NU1G 3H32A 3JCUE 5AW8B 1MFTA 1N73B 1DIPA 1LTGC 1G2CA 1GU5A 1PV3A 3M0DA 2JT3A 1HVVA 2HPSA 4P2YB 2Z5HA 2LNKA 1HJ0A 3U1CA 1BLQA 3HE5B 3HE5A 2M0RA 4MZKA 1EXJA 5D69A 1KQSO 1QVFO 2PP6A 3T97A 1SCMC 1NTMK 1GD2E 1SQXK 2P70A 1ZW0A 1BODA 1LTTC 4KJMA 1HWTC 1L4AA 1OW8A 2JP3A 2KLDA 4XFJA 3OP0A 2FFDC 2KP8A 4JYCA 3H1JE 3IVTA 2B87B 3USSA 2P2UA 4RESB 5CSJA 3I55P 4OGQC 2WT7B 2RGIA 3DVJA 1H4BA 2WT7A 2QJPB 1KFUS 2HQWA 1NTZD 1PRWA 3P7KA 1BR4B 3SS5A 4UPGA 1GDTA 2O01J 4C0LA 1YVLA 1Y8AA 1NX1A 1KC8Q 2KHNA 1J1EC 2SPZA 3GG2A 3HUSB 2OTGB 2H2KA 1XO5A 2FXOA 3O6QA 3KZIE 3R2PA 3TNUB 1SBJA 3TNUA 2LHLA 2DW3A 1LTSC 3S9OA 2CPBA 2KI6D 2WSSH 3OW2O 1LXFC 3IFMA 1M1JB 5AVYB 3CZTX 3VROA 2PQLA 3O4YA 1JEKA 1C3YA 5GTHE 3KDPB 3L70D 3ABVC 2N9YB 1GM0A 5KSZA 1FBVA 2NCOA 1YQ3C 1OW7A 2WNDA 4DOJA 3D70A 2Q5UA 1MHOA 3RLZA 4H13C 5CHXA 1LT9C 2J59M 3NGVA 1KFXL 1IKUA 3KYQA 1MQ1A 3FWBA 1RY3A 4JKTA 1QWVA 2Q7CA 3EVRA 4PD4D 1S4XA 1OVVA 5AW6B 4GPLB 1MXLC 2KS1B 2KS1A 3M0WA 3A3YB 1SW8A 3QH9A 1JOCA 3U1AA 1H89A 1L0NJ 3GK4X 3KXDA 1VQ7P 4XE5B 2D8NA 1MR8A 1NHLA 2VRGA 1LTJC 3RBXA 1FZCA 2FBWC 1WMKA 1CFFA 4F7FA 1YJ9P 3A0HH 2QDIA 1JY3P 1EZVD 1G1IA 3FXEA 3ICBA 1KFNA 2HG5D 4XYNA 4OH8B 1IK9A 1X9VA 2YNYA 2PSRA 3PM8A 2QEOA 1NU1K 1CDMA 1B7TY 1JMBA 1PULA 1DEKA 1IG5A 3VP8A 2ZN9A 2QRXA 1OQPA 3R1VA 1FDOA 1NYAA 1DJZA 1EDLA 1OE9B 1USEA 2PASA 2FXPA 4BWNA 3SS3A 2L4IA 1L0LJ 1S5LH 1QVIZ 4LLHA 1MFZA 1IJ6A 2BNXA 1VQ4P 1E5WA 1N0YA 2LVKA 3TGUD 2BEZF 3CWBD 2L5GB 2KBMA 3OJAB 1S26D 3VMYA 2SCPA 3H25A 1RH5B 1PP9J 2RKLA 1L7ZA 5KTBA 2QM7A 3G3ZA 3D0YB 3HD7B 4WY4D 5AW3B 3D0YA 3IQOA 3HD7A 1LA0A 1OOJA 1NX3A 1C7WA 1Y6WA 5AW9B 2BCCE 2OTLP 2K7DA 1V1GA 3PHLA 4W80A 2YIUB 1A75B 3RBZA 1A75A 2WWWA 3L75G 2KI4B 5KKZC 2L5XB 3CXHH 1BJFA 4ORCB 3G9RA 3VRQA 3B71A 2COLB 1BDCA 3CX5D 1OOGA 1NTME 2ZFDA 5ER5A 1HJBA 5TISE 1T6AA 4GFTA 1SQXE 3A7OA 2KBIA 3L74D 5CCHA 2ZKMX 2E76C 1GZLA 1NVOA 4D6TJ 3DZTA 3H1IE 1NPQA 1SCMB 1WLMA 5H2FH 3VTPC 1KQVA 4YRUA 3CX5I 1EZVE 2AAOA 2AXCA 2K3RA 1AFOA 3LK0A 3GLMA 1V1FA 1HTLC 5HKZA 2WSCH 3WHTB 2E5TA 2KDHA 2FFDB 2FFDA 2AEFA 3D73A 1KILB 2KSPA 1KILA 3CD6P 1J7QA 1QX7A 4ZNCA 2LUCA 1RQVA 5APVA 2QEBA 4I7ZC 1EG4A 5B8IB 3H1KE 3O78A 1B8LA 1SQBJ 2KYCA 2JOJA 4NDDA 2ZAEB 5KJ7A 3SWFA 1LA3A 4OZDA 1J1EB 4N1FA 3SG6A 4MZJA 1SQVD 3PJSK 5DKRA 1VPCA 1SQQD 3W67A 2FYNC 2ZT9C 3CWBE 5FYXA 3PM2A 3FE9A 2LP3A 3VYIA 1DVIA 2KGBC 2C0WA 3CPWO 1R6PA 5HL1A 2WZ7A 1QV1A 1NCXA 3A4UB 4IL6X 4ZKPA 2PFXA 3F89A 5TISH 3PSRA 1PL5A 3MHVA 4E68A 1SPYA 1FF1A 3B6XA 4Y28J 1DTLA 2E5YA 2M9GA 1BCCE 1EXRA 3SG2A 3KQGA 1UHJA 2KI7B 1RF1C 2YO2A 4I5NB 4H13B 3BUNB 2YGUA 1YX8A 1LT9B 4XJKB 2F3YA 1ZP0C 2KYFA 2QVAA 5AW2B 1FZFA 2A45H 3VN0A 3DVMA 1L2OC 4TLFA 1DJWA 2AUCA 4FQOA 3CABA 1DEBA 4MRYA 2GUSA 3P32A 4PHKA 3G4SP 4GOFA 4BXLA 2FKWB 1LVCD 2ZVOB 1SY9A 2F8PA 1JF0A 1H8BA 4WBAA 4PJ0E 4OV2A 4AUWA 3JSVC 1Y47A 3CCRP 1EQ7A 3CYZA 4YXDC 5B66E 3Q5PA 1A03A 1BGYJ 1FJPA 2M0BA 1R8EA 2OGUA 5KLVJ 2O60A 5AVZB 1XFUO 1LTJB 3D71A 4JWQA 1LTJA 1NU1E 2LE9B 1RE4C 2N9BA 1USDA 4R4MA 1NUBA 1K9KA 1K05A 1WT6A 2E42A 3QRXA 4N3YB 5D3OA 3VP9A 4EDFA 5AANA 4A4CA 1YYCA 4IOIH 2IX7C 1J7OA 1KQFB 3L4AA 1YTZI 2WITA 4CFQA 2IS9A 4LGDE 3DXLA 1T3JA 4HH2A 1Z4HA 1M56D 1IC2A 3R4YA 1NIWA 1QVIY 2D2CC 3CS1A 5CJ0A 1FAVA 3V2LA 3V2RA 4PE0A 3S0GA 2IBZI 1KCYA 1NX2A 2KK7A 1M8OB 2WCBA 1LWUC 3M0DC 1QX2A 4BY4A 3IF4A 2M3WA 1NTZG 3D10A 1CM4A 2F2OA 2Y5IA 1NKNA 5ER4X 2KNCA 3FWCA 2KB7P 2JWAA 1KTMA 2KOTA 2I8DA 3H1LJ 3SJSA 1KB9I 5AW5B 3CR5X 1SL7A 4HSZA 4DUQA 1L4AC 1CLMA 1VQLP 2K2FA 1SKTA 5CCGD 2K61A 1TNWA 4ZCUA 1T2KD 5HLOA 3TZ1A 3EKJA 1N65A 1K8AQ 2W90A 3SIAA 1X0TA 5EFWB 3L70G 3SFEC 3SSUA 5K5GB 3VOPA 1NH4A 4ZCVA 2L2EA 1T14A 2H88C 2JU0A 3SIBA 4OVNF 3OX5A 3C9IA 2E76B 3CC7P 3CZ2A 3NHIA 3M06A 1RFJA 3CZ1A 2E6WA 3CDNA 1WRLA 2FOTA 3TS5C 4HRGA 2OTJP 1BDDA 3AKAA 1QL1A 2WPSA 3B86A 2R5DA 2J5UA 5HLVA 4C7RA 2LP2A 3VRNA 3L75D 2BE6A 2OS8C 2GM4A 3L4LA 2LUXA 1J2JB 2NPSA 4I7ZB 4AQJA 4HKZH 4QJ5B 3PRJA 4WQ2A 2K9JA 5DICA 1FOSF 1YTZC 2ZYGA 1OZOA 3GHGA 1EZVG 2JT8A 2WPQA 2FYNB 4AYCA 2ZT9B 2BKHB 4MVFA 3EVUA 1KZUB 1SS1A 1GL2C 3FIAA 1FPWA 1L0ND 4C0JA 4OGQD 1EJ3A 2MRDA 3BVHA 3WNXB 5DJUB 3BFHA 4CFRA 2CXJA 2ITAA 1TRFA 3CMEP 2JNXA 3BFBA 2QJYC 2B89A 4YI8A 1FZCC 1J7PA 4IJ7A 1AVSA 1RF1B 1RF1A 2K1AA 2KXPB 3TDKA 1IIOA 3I5FC 4CIDA 3H1LG 5E79H 3TGUG 3SG5A 1KORA 3CWBG 1L2OB 3HTKB 1SFCC 3HTKA 1RE3C 4WB4A 4WVZA 2RMZA 1RF0C 2HYNA 3KEVA 1FZAA 1S9KE 1X79B 1L0LD 1K8UA 1TUJA 2I2RE 1NTZK 2A06D 1TCFA 3PALA 1N7LA 3MTUE 5I94A 1KYOH 4M3LA 1QVGO 1OMVA 2LKMA 1M57D 1J7RA 2B1UA 3R72A 4M2QA 2R3CA 3HX4A 1W5CE 3L75E 1NOHA 4ZMDA 2EGDA 2Q3IA 1PP9D 2CT9A 2FYUJ 3PTZA 4I2LC 1IWQA 2BE4A 3PFVA 3II6A 1UP5A 1YI2P 3EK4A 3L74G 2C9NY 1ZRTE 2WCHA 2IZ0A 1F4OA 1OW6A 3MUDA 2ZNEA 3OGNA 1PK0D 3PH0A 1NSHA 1K93D 3EK7A 4GBAA 3IR9A 3S0EA 4DRWA 1OXZA 2W83C 1DJGA 1Z56A 2M8UA 4L75A 1MWNA 1NWDA 2D2CB 5KLIC 3RK3C 4YGDB 2IDBA 1S5GY 3VMAA 1YUSA 3CI9A 2YMYA 1URQC 1KWOC 1N7SB 2N1TB 1LGHB 2N1TA 2ZN8A 1N7SA 3F5HA 4OWFA 2WSEH 2C0XA 4GKGA 4D6TD 1G2CB 1LWUB 1XYDA 2M29A 1CMFA 1LWUA 3B5NB 2JKVA 3B5NA 1TNXA 2IYOA 1IJ5A 2F33A 5CCHC 2G2BA 5AERA 3L73J 4GGNA 2SASA 2HLOA 2OYHC 3T97B 1SQVG 2WSFJ 3GK2A 3WUVA 5FI6A 3NSOA 2PRRA 2WTYA 1SQQG 3WU2H 1VQOP 2FJUB 3M91A 3IF7A 1L4AB 1PPJG 1K90D 3BCCJ 3AEAC 1HF9A 3E1IA 1MV8A 2M5AB 1ZACA 1KILC 2HPCA 2M5AA 1SQBD 4OR9B 2Y0CA 3K5BA 1L0LE 3V2QA 3DD4A 1DELA 2K9YA 3I56P 3CR2A 5KJ7C 4F0ZB 1CMGA 4O9BA 2UWJE 4HJGH 1OMRA 3B8EB 1MZ9A 1IZNB 3KHUA 4YTPC 3O6QB 2L50A 1QLSA 3O8ZA 4IL6E 2KLVA 3OB2B 3TS5B 1JNMA 5I2QA 1ZR2A 2NLNA 5G08A 2RN0A 3JCUH 1P84E 5HKYA 4NPFX 3NFQA 2OS8B 2XU6A 5BPJA 1RWYA 2ZXEB 1CZQA 1UHHA 3L47A 2E76D 5IBWA 3CXHI 1PALA 1GW4A 1C7VA 1ODBA 1OVUA 1SQPJ 1IFJA 1CNPA 1BSHA 1UURA 4KYNA 1AV1A 2WC6A 3EQ2A 3P8MC 4YGCB 1GL2B 1GL2A 2H7HA 2R2IA
chains in the Genus database with same CATH topology
4OCIA 1K94A 3F45A 2LUCA 3KF9A 2BL0B 2EHBA 2JTTA 4YGBB 1CLBA 3BUMB 1SR6B 1EG4A 1K9UA 2CTNA 5B8IB 1W7IB 3O78A 1B8LA 2KAXA 3BUXB 3TDZA 2KYCA 1B1GA 2JOJA 4NDDA 1WDCC 1SYMA 3BUWB 3SG3A 1LA3A 2JZIA 3GOFA 2PALA 2MLFC 1MXEA 4N1FA 3SG6A 4MZJA 1DJYA 1GJYA 4MZLA 4PHNA 2JRFA 1QLKA 5JJGA 5DKRA 1JFJA 4DS7A 4I5LB 1RTP1 5CSFA 2K8MB 2LVJA 5FYXA 1KFXS 1ZOTB 1TOPA 1XFVO 4MBEA 3FS7A 1SCVA 1XA5A 2LP3A 3I5FB 4YGAA 1DVIA 2KGBC 5AXIA 1DGVA 1R6PA 1BMOA 1QV1A 1NCXA 3A4UB 4PE7A 5KU1A 2LLSA 3PSRA 3TDUA 1EH2A 3NSIA 1E8AA 1KSMA 4E68A 4HRHA 1SPYA 1J7QA 3CTNA 1YVHA 2EC6C 2JXLA 2L4HA 1MUXA 4ORAB 2HF5A 1FF1A 2JC2A 4ORBB 1M39A 1DTLA 1CFDA 2H61C 2I18A 2OTGC 3SG4A 2KQ6A 2M9GA 1EXRA 1UUSA 3SG2A 1KK8B 4YGEB 1UHJA 1G8IA 2KAYA 4I5NB 2WCEA 4Q04A 3BUNB 1YX8A 2BBMA 3BQ3A 3KO0A 2LC5A 4XJKB 2F3YA 2KYFA 1IH0A 4I5JA 1WRKA 3DVMA 1L2OC 1OMDA 1DJWA 4QJ3B 1TTXA 5JOLA 2AUCA 1OZSA 2F3ZA 2JT0A 2PMYA 1S6CA 4FQOA 4MRYA 1DGUA 3K21A 4PHKA 2K7OA 1KFUL 3CR4X 3O2PA 1LVCD 1SY9A 1AJ4A 5CSIA 2L51A 2Y9YA 2F8PA 1S6IA 1JF0A 3I5IB 1DJHA 1F8HA 1H8BA 2KAVA 1BU3A 4OV2A 2NXQA 4PALA 2JPTA 1KQMC 1SL9A 5I2OA 1CDNA 1QS7A 2FCEA 1A03A 4JPZB 2P6BB 3O6BA 2BBNA 3DVKA 5HKWA 2O60A 2BECA 3TUYB 1XFUO 4PE4A 1GQMA 4JWQA 4NDBA 1SL8A 2HETA 1SK6D 1YRUB 4AQIA 2M1UA 4PCWA 2LE9B 3PN7C 4JQ0D 1ALVA 3OHMB 4WRIA 3EKHA 5GQQC 1DMOA 1NUBA 1K9KA 3CLNA 1AP4A 1KWOB 2NZ0A 3PATA 3QRXA 2M97A 4USLA 5AANA 1M45A 3NSKA 4A4CA 1IQ3A 3I5HC 1J7OA 1QIVA 2KNEA 2LHIA 1DF0B 2M7NA 1DF0A 2A4JA 1RROA 3E3RA 1PSRA 1ALWA 4CFQA 1KSOA 3RM1A 1B8RA 2IS9A 5D7FA 3ZWHA 1QASA 3MSEB 1PVBA 1TIZA 1F71A 4ETOA 1NIWA 1QVIY 1VRKA 1UWOA 3CS1A 3OX6A 4PE0A 1KCYA 3BYAA 1B4CA 4NDCA 5AFPA 1NX2A 1X02A 3EK8A 5K89A 1XVJA 1DT7B 1JBAA 4DCKA 2WC8A 2WCBA 5HYDA 2JTZA 1AUIB 1PVAA 1QX2A 2F2PA 4BY4A 2M3WA 1KK7Z 2Y9ZA 5CSNA 3D10A 1CM4A 2F2OA 2JULA 1XFXO 1DJIA 2Y5IA 3JTDC 2BKIB 2KGRA 2M49B 2LVVA 5ER4X 1NX0A 2ZNDA 2NCPA 1F70A 3FWCA 1B7TZ 3AKBA 4N1GA 1Y1UA 1YUUA 4M2PA 1NCZA 1UHKA 2KOTA 3AAJA 3LLEA 2BCBA 3SJSA 1YURA 1S36A 4MEWA 4PHMA 3CR5X 1K2HA 1SL7A 4HSZA 4N5XA 4DUQA 3KHEA 1R2UA 2LCPA 2O5GA 1B47A 5KTYA 3I5GC 4MRXA 1CLMA 1CLLA 2K2FA 3NSLA 3VGOA 1XFWO 1SKTA 5I8NA 1WY9A 2K61A 1TNWA 3EVVA 4ZCUA 1XK4C 5HLOA 1M31A 3TZ1A 1DJXA 3EKJA 1N65A 2QACA 3SIAA 2KFHA 1GGZA 3VRPA 3BOWB 1Q80A 3BOWA 1HT9A 2MAZA 2CCMA 3H4SE 4ZCVA 2L2EA 3I5HB 3C1VA 2JU0A 2AMIA 4PE1A 3SIBA 4OVNF 3OX5A 5F6TA 2KFFA 1CDPA 1TN4A 1S6JA 2ZRTA 4WQ3A 1FI5A 5CPVA 1RFJA 1BF5A 1QIWA 3OB1B 4M2OA 1GGWA 1JSAA 4GUKA 2E6WA 2I94A 1YX7A 1WRLA 2LM5A 2FOTA 2KI4C 3TDIA 3TS5C 4HRGA 2LAPA 2LLUA 3LK1A 3AKAA 1PSBA 2PRUA 4GGFC 1CM1A 5HLVA 2LP2A 4MSPA 3VRNA 1RECA 2BE6A 2JT3A 2OS8C 2HPSA 4P2YB 2LNKA 4FTGA 1YUTA 1BLQA 2LUXA 2M0RA 1G4YR 4MZKA 5D69A 1HQVA 1FW4A 2Q91A 3JVTC 2TN4A 2Y1NA 1SCMC 3WHUB 4DIRA 1QV0A 4AQJA 3VRRA 4QJ5B 1WLZA 5J3XA 1A29A 4PHJA 4WQ2A 1S1EA 1QJTA 1BODA 2I7AA 1WDCB 1WRZA 1CB1A 1YR5A 1YTZC 2LMVA 4MN0A 1OZOA 2MA2A 2JT8A 3OP0A 1JUOA 2BKHB 2LMUA 3EVUA 4MVFA 4YI9A 3FIAA 1FPWA 2LANA 2M7LA 3BXKA 3DF0B 5CSJA 3DF0A 1Y0VH 2RGIA 2BL0C 4GNKB 3DVJA 4C0JA 1H4BA 1KFUS 2PVBA 2HQWA 1EJ3A 2MRDA 2M1KB 1PRWA 3CGAA 3WNXB 1BR4B 5DKNA 4UPGA 4CFRA 4L9MA 2EC6B 2CXJA 1TRFA 1YVLA 4C0LA 4NQGA 1NX1A 2KHNA 1B8CA 3SG7A 2JNXA 1TCOB 1W7JB 2OTGB 3A8RA 2H2KA 1XO5A 2H61A 2L0PA 4YI8A 3LL8B 1J7PA 1AVSA 2K2AA 2K7BA 2KI6C 1SBJA 2LHLA 2MLEC 4GAOA 4PDZA 4C0KA 3I5FC 1QATA 1AHRA 1CTRA 2KI6D 1QTXA 4CIDA 1LXFC 3SG5A 4GGFA 1L2OB 3CZTX 3VROA 2WOSA 3O4YA 1BT6A 1TNPA 1AJ5A 1S5GZ 4D1EA 1QXPA 2DOQA 1UHNA 3KEVA 5KSZA 1FBVA 2NCOA 2V53A 2WNDA 1K8UA 1M63B 2I2RE 1BOCA 1MHOA 1EG3A 1KQMB 1TCFA 3PALA 3RLZA 1A2XA 1KFXL 1OMVA 2JXCA 4HREE 1IKUA 4QJ4B 1BG1A 1MQ1A 3FWBA 3CWGA 1J7RA 2B1UA 4M2QA 3HX4A 1IGVA 2EGDA 1U5IA 3EVRA 2BCAA 3WXAA 4A4BA 1YRTB 2CT9A 4GPLB 1MXLC 3NXAA 1IWQA 4I5KA 2BE4A 1JWDA 3PFVA 3M0WA 3PN7B 2MBXA 1Y1AA 1SW8A 1UP5A 3I5IC 5TNCA 3EK4A 3GK1A 5DKQA 1F4OA 1ZUZA 1FI6A 1C07A 2ZNEA 1A4PA 1PK0D 3GK4X 1NSHA 1K93D 3EK7A 4GBAA 1J1EA 2D8NA 1MR8A 3PLFB 4DRWA 3TUYC 2VRGA 1DJGA 1K95A 2M8UA 1F55A 1MWNA 1NWDA 3DVEA 1CFFA 4YGDB 1SNLA 2KFGA 3ZNIA 1S5GY 1KK7Y 1YUSA 1XFZO 2JWWA 2WORA 1KWOC 3ICBA 2ZN8A 4XYNA 2LLTA 2GV5A 2MHHA 4AOMA 1XYDA 2M29A 4TNCA 2PSRA 3PM8A 1CMFA 1F54A 1NP8A 1CDMA 1B7TY 1TNXA 1IJ5A 4ICBA 2F33A 1AK8A 1PULA 1IG5A 2ZN9A 2G2BA 3JTDB 4R1EA 5AERA 1OQPA 2CNPA 4GGNA 2SASA 2CBLA 3BUOB 1JFKA 3GK2A 1IQ5A 1DJZA 1NYAA 2ISDA 3NSOA 3KPXA 1OE9B 4XJKA 2JQ6A 2PASA 2HQ8A 2K0JA 1OSAA 2FJUB 4YBHB 3IF7A 2L4IA 1QVIZ 1BR1B 3I5GB 2LMTA 1K90D 1IJ6A 4MLWA 1J1DA 1N0YA 2OPOA 1ZACA 2E30A 2LVKA 1XK4A 1RK9A 2KBMA 4OR9B 4CLNA 1SMGA 1S26D 2SCPA 3LCPC 3DD4A 2GGZA 1J55A 1UHIA 3AAKA 1L7ZA 2Y1MA 1SR6C 1JC2A 1CFCA 3D0YB 3D0YA 3IQOA 4P5OE 3CR2A 1LA0A 4IL1A 4F0ZB 1OOJA 1CMGA 1NX3A 1C7WA 1Y6WA 1OMRA 2Q4UA 2K7DA 4OKHA 1N2DA 1V1GA 2KQYA 1A75B 2L50A 1QLSA 1A75A 1CDLA 1ZMZA 2Y4QA 2G9BA 5PALA 2KI4B 3OB2B 2ZRSA 3TS5B 5I2QA 1ZFSA 2L5XB 2K7CA 2FCDA 1BJFA 4ORCB 1TNQA 2NLNA 5G08A 5AEQA 3VRQA 2JNFA 3HCMA 2COLB 5HKYA 1MF8B 4U8DA 1SRAA 1JF2A 1M46A 2ZFDA 5ER5A 2WCFA 1XFYO 2OS8B 4GFTA 2LV7A 2LVIA 2KBIA 1RJVA 1NCYA 1LKJA 2ZKMX 5BPJA 1RWYA 1K9PA 3JVTB 2QPTA 1UHHA 3IQQA 1OFCX 1NPQA 1SCMB 1WLMA 5IBWA 1PALA 1KK8C 1D1OA 1IRJA 1EL4A 1KQVA 4YRUA 1C7VA 1ODBA 2AAOA 1K96A 5I2LA 2L98A 4CPVA 1CNPA 2BCXA 3LK0A 1S3PA 2GGMA 1UURA 1F4QA 1V1FA 1CFPA 1CKKA 5HKZA 1U5IB 3WHTB 2KDHA 1QX5B 4BY5A 2KSPA 4YGCB 1G33A 1Y1XA 1B9AA 2MJWB 1LINA 1QX7A 2R2IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OCI A;  1K94 A;  3F45 A;  2LUC A;  3KF9 A;  2BL0 B;  2EHB A;  2JTT A;  4YGB B;  1CLB A;  3BUM B;  1SR6 B;  1EG4 A;  1K9U A;  2CTN A;  5B8I B;  1W7I B;  3O78 A;  1B8L A;  2KAX A;  3BUX B;  3TDZ A;  2KYC A;  1B1G A;  2JOJ A;  4NDD A;  1WDC C;  1SYM A;  3BUW B;  3SG3 A;  1LA3 A;  2JZI A;  3GOF A;  2PAL A;  2MLF C;  1MXE A;  4N1F A;  3SG6 A;  4MZJ A;  1DJY A;  1GJY A;  4MZL A;  4PHN A;  2JRF A;  1QLK A;  5JJG A;  5DKR A;  1JFJ A;  4DS7 A;  4I5L B;  1RTP 1;  5CSF A;  2K8M B;  2LVJ A;  5FYX A;  1KFX S;  1ZOT B;  1TOP A;  1XFV O;  4MBE A;  3FS7 A;  1SCV A;  1XA5 A;  2LP3 A;  3I5F B;  4YGA A;  1DVI A;  2KGB C;  5AXI A;  1DGV A;  1R6P A;  1BMO A;  1QV1 A;  1NCX A;  3A4U B;  4PE7 A;  5KU1 A;  2LLS A;  3PSR A;  3TDU A;  1EH2 A;  3NSI A;  1E8A A;  1KSM A;  4E68 A;  4HRH A;  1SPY A;  1J7Q A;  3CTN A;  1YVH A;  2EC6 C;  2JXL A;  2L4H A;  1MUX A;  4ORA B;  2HF5 A;  1FF1 A;  2JC2 A;  4ORB B;  1M39 A;  1DTL A;  1CFD A;  2H61 C;  2I18 A;  2OTG C;  3SG4 A;  2KQ6 A;  2M9G A;  1EXR A;  1UUS A;  3SG2 A;  1KK8 B;  4YGE B;  1UHJ A;  1G8I A;  2KAY A;  4I5N B;  2WCE A;  4Q04 A;  3BUN B;  1YX8 A;  2BBM A;  3BQ3 A;  3KO0 A;  2LC5 A;  4XJK B;  2F3Y A;  2KYF A;  1IH0 A;  4I5J A;  1WRK A;  3DVM A;  1L2O C;  1OMD A;  1DJW A;  4QJ3 B;  1TTX A;  5JOL A;  2AUC A;  1OZS A;  2F3Z A;  2JT0 A;  2PMY A;  1S6C A;  4FQO A;  4MRY A;  1DGU A;  3K21 A;  4PHK A;  2K7O A;  1KFU L;  3CR4 X;  3O2P A;  1LVC D;  1SY9 A;  1AJ4 A;  5CSI A;  2L51 A;  2Y9Y A;  2F8P A;  1S6I A;  1JF0 A;  3I5I B;  1DJH A;  1F8H A;  1H8B A;  2KAV A;  1BU3 A;  4OV2 A;  2NXQ A;  4PAL A;  2JPT A;  1KQM C;  1SL9 A;  5I2O A;  1CDN A;  1QS7 A;  2FCE A;  1A03 A;  4JPZ B;  2P6B B;  3O6B A;  2BBN A;  3DVK A;  5HKW A;  2O60 A;  2BEC A;  3TUY B;  1XFU O;  4PE4 A;  1GQM A;  4JWQ A;  4NDB A;  1SL8 A;  2HET A;  1SK6 D;  1YRU B;  4AQI A;  2M1U A;  4PCW A;  2LE9 B;  3PN7 C;  4JQ0 D;  1ALV A;  3OHM B;  4WRI A;  3EKH A;  5GQQ C;  1DMO A;  1NUB A;  1K9K A;  3CLN A;  1AP4 A;  1KWO B;  2NZ0 A;  3PAT A;  3QRX A;  2M97 A;  4USL A;  5AAN A;  1M45 A;  3NSK A;  4A4C A;  1IQ3 A;  3I5H C;  1J7O A;  1QIV A;  2KNE A;  2LHI A;  1DF0 B;  2M7N A;  1DF0 A;  2A4J A;  1RRO A;  3E3R A;  1PSR A;  1ALW A;  4CFQ A;  1KSO A;  3RM1 A;  1B8R A;  2IS9 A;  5D7F A;  3ZWH A;  1QAS A;  3MSE B;  1PVB A;  1TIZ A;  1F71 A;  4ETO A;  1NIW A;  1QVI Y;  1VRK A;  1UWO A;  3CS1 A;  3OX6 A;  4PE0 A;  1KCY A;  3BYA A;  1B4C A;  4NDC A;  5AFP A;  1NX2 A;  1X02 A;  3EK8 A;  5K89 A;  1XVJ A;  1DT7 B;  1JBA A;  4DCK A;  2WC8 A;  2WCB A;  5HYD A;  2JTZ A;  1AUI B;  1PVA A;  1QX2 A;  2F2P A;  4BY4 A;  2M3W A;  1KK7 Z;  2Y9Z A;  5CSN A;  3D10 A;  1CM4 A;  2F2O A;  2JUL A;  1XFX O;  1DJI A;  2Y5I A;  3JTD C;  2BKI B;  2KGR A;  2M49 B;  2LVV A;  5ER4 X;  1NX0 A;  2ZND A;  2NCP A;  1F70 A;  3FWC A;  1B7T Z;  3AKB A;  4N1G A;  1Y1U A;  1YUU A;  4M2P A;  1NCZ A;  1UHK A;  2KOT A;  3AAJ A;  3LLE A;  2BCB A;  3SJS A;  1YUR A;  1S36 A;  4MEW A;  4PHM A;  3CR5 X;  1K2H A;  1SL7 A;  4HSZ A;  4N5X A;  4DUQ A;  3KHE A;  1R2U A;  2LCP A;  2O5G A;  1B47 A;  5KTY A;  3I5G C;  4MRX A;  1CLM A;  1CLL A;  2K2F A;  3NSL A;  3VGO A;  1XFW O;  1SKT A;  5I8N A;  1WY9 A;  2K61 A;  1TNW A;  3EVV A;  4ZCU A;  1XK4 C;  5HLO A;  1M31 A;  3TZ1 A;  1DJX A;  3EKJ A;  1N65 A;  2QAC A;  3SIA A;  2KFH A;  1GGZ A;  3VRP A;  3BOW B;  1Q80 A;  3BOW A;  1HT9 A;  2MAZ A;  2CCM A;  3H4S E;  4ZCV A;  2L2E A;  3I5H B;  3C1V A;  2JU0 A;  2AMI A;  4PE1 A;  3SIB A;  4OVN F;  3OX5 A;  5F6T A;  2KFF A;  1CDP A;  1TN4 A;  1S6J A;  2ZRT A;  4WQ3 A;  1FI5 A;  5CPV A;  1RFJ A;  1BF5 A;  1QIW A;  3OB1 B;  4M2O A;  1GGW A;  1JSA A;  4GUK A;  2E6W A;  2I94 A;  1YX7 A;  1WRL A;  2LM5 A;  2FOT A;  2KI4 C;  3TDI A;  3TS5 C;  4HRG A;  2LAP A;  2LLU A;  3LK1 A;  3AKA A;  1PSB A;  2PRU A;  4GGF C;  1CM1 A;  5HLV A;  2LP2 A;  4MSP A;  3VRN A;  1REC A;  2BE6 A;  2JT3 A;  2OS8 C;  2HPS A;  4P2Y B;  2LNK A;  4FTG A;  1YUT A;  1BLQ A;  2LUX A;  2M0R A;  1G4Y R;  4MZK A;  5D69 A;  1HQV A;  1FW4 A;  2Q91 A;  3JVT C;  2TN4 A;  2Y1N A;  1SCM C;  3WHU B;  4DIR A;  1QV0 A;  4AQJ A;  3VRR A;  4QJ5 B;  1WLZ A;  5J3X A;  1A29 A;  4PHJ A;  4WQ2 A;  1S1E A;  1QJT A;  1BOD A;  2I7A A;  1WDC B;  1WRZ A;  1CB1 A;  1YR5 A;  1YTZ C;  2LMV A;  4MN0 A;  1OZO A;  2MA2 A;  2JT8 A;  3OP0 A;  1JUO A;  2BKH B;  2LMU A;  3EVU A;  4MVF A;  4YI9 A;  3FIA A;  1FPW A;  2LAN A;  2M7L A;  3BXK A;  3DF0 B;  5CSJ A;  3DF0 A;  1Y0V H;  2RGI A;  2BL0 C;  4GNK B;  3DVJ A;  4C0J A;  1H4B A;  1KFU S;  2PVB A;  2HQW A;  1EJ3 A;  2MRD A;  2M1K B;  1PRW A;  3CGA A;  3WNX B;  1BR4 B;  5DKN A;  4UPG A;  4CFR A;  4L9M A;  2EC6 B;  2CXJ A;  1TRF A;  1YVL A;  4C0L A;  4NQG A;  1NX1 A;  2KHN A;  1B8C A;  3SG7 A;  2JNX A;  1TCO B;  1W7J B;  2OTG B;  3A8R A;  2H2K A;  1XO5 A;  2H61 A;  2L0P A;  4YI8 A;  3LL8 B;  1J7P A;  1AVS A;  2K2A A;  2K7B A;  2KI6 C;  1SBJ A;  2LHL A;  2MLE C;  4GAO A;  4PDZ A;  4C0K A;  3I5F C;  1QAT A;  1AHR A;  1CTR A;  2KI6 D;  1QTX A;  4CID A;  1LXF C;  3SG5 A;  4GGF A;  1L2O B;  3CZT X;  3VRO A;  2WOS A;  3O4Y A;  1BT6 A;  1TNP A;  1AJ5 A;  1S5G Z;  4D1E A;  1QXP A;  2DOQ A;  1UHN A;  3KEV A;  5KSZ A;  1FBV A;  2NCO A;  2V53 A;  2WND A;  1K8U A;  1M63 B;  2I2R E;  1BOC A;  1MHO A;  1EG3 A;  1KQM B;  1TCF A;  3PAL A;  3RLZ A;  1A2X A;  1KFX L;  1OMV A;  2JXC A;  4HRE E;  1IKU A;  4QJ4 B;  1BG1 A;  1MQ1 A;  3FWB A;  3CWG A;  1J7R A;  2B1U A;  4M2Q A;  3HX4 A;  1IGV A;  2EGD A;  1U5I A;  3EVR A;  2BCA A;  3WXA A;  4A4B A;  1YRT B;  2CT9 A;  4GPL B;  1MXL C;  3NXA A;  1IWQ A;  4I5K A;  2BE4 A;  1JWD A;  3PFV A;  3M0W A;  3PN7 B;  2MBX A;  1Y1A A;  1SW8 A;  1UP5 A;  3I5I C;  5TNC A;  3EK4 A;  3GK1 A;  5DKQ A;  1F4O A;  1ZUZ A;  1FI6 A;  1C07 A;  2ZNE A;  1A4P A;  1PK0 D;  3GK4 X;  1NSH A;  1K93 D;  3EK7 A;  4GBA A;  1J1E A;  2D8N A;  1MR8 A;  3PLF B;  4DRW A;  3TUY C;  2VRG A;  1DJG A;  1K95 A;  2M8U A;  1F55 A;  1MWN A;  1NWD A;  3DVE A;  1CFF A;  4YGD B;  1SNL A;  2KFG A;  3ZNI A;  1S5G Y;  1KK7 Y;  1YUS A;  1XFZ O;  2JWW A;  2WOR A;  1KWO C;  3ICB A;  2ZN8 A;  4XYN A;  2LLT A;  2GV5 A;  2MHH A;  4AOM A;  1XYD A;  2M29 A;  4TNC A;  2PSR A;  3PM8 A;  1CMF A;  1F54 A;  1NP8 A;  1CDM A;  1B7T Y;  1TNX A;  1IJ5 A;  4ICB A;  2F33 A;  1AK8 A;  1PUL A;  1IG5 A;  2ZN9 A;  2G2B A;  3JTD B;  4R1E A;  5AER A;  1OQP A;  2CNP A;  4GGN A;  2SAS A;  2CBL A;  3BUO B;  1JFK A;  3GK2 A;  1IQ5 A;  1DJZ A;  1NYA A;  2ISD A;  3NSO A;  3KPX A;  1OE9 B;  4XJK A;  2JQ6 A;  2PAS A;  2HQ8 A;  2K0J A;  1OSA A;  2FJU B;  4YBH B;  3IF7 A;  2L4I A;  1QVI Z;  1BR1 B;  3I5G B;  2LMT A;  1K90 D;  1IJ6 A;  4MLW A;  1J1D A;  1N0Y A;  2OPO A;  1ZAC A;  2E30 A;  2LVK A;  1XK4 A;  1RK9 A;  2KBM A;  4OR9 B;  4CLN A;  1SMG A;  1S26 D;  2SCP A;  3LCP C;  3DD4 A;  2GGZ A;  1J55 A;  1UHI A;  3AAK A;  1L7Z A;  2Y1M A;  1SR6 C;  1JC2 A;  1CFC A;  3D0Y B;  3D0Y A;  3IQO A;  4P5O E;  3CR2 A;  1LA0 A;  4IL1 A;  4F0Z B;  1OOJ A;  1CMG A;  1NX3 A;  1C7W A;  1Y6W A;  1OMR A;  2Q4U A;  2K7D A;  4OKH A;  1N2D A;  1V1G A;  2KQY A;  1A75 B;  2L50 A;  1QLS A;  1A75 A;  1CDL A;  1ZMZ A;  2Y4Q A;  2G9B A;  5PAL A;  2KI4 B;  3OB2 B;  2ZRS A;  3TS5 B;  5I2Q A;  1ZFS A;  2L5X B;  2K7C A;  2FCD A;  1BJF A;  4ORC B;  1TNQ A;  2NLN A;  5G08 A;  5AEQ A;  3VRQ A;  2JNF A;  3HCM A;  2COL B;  5HKY A;  1MF8 B;  4U8D A;  1SRA A;  1JF2 A;  1M46 A;  2ZFD A;  5ER5 A;  2WCF A;  1XFY O;  2OS8 B;  4GFT A;  2LV7 A;  2LVI A;  2KBI A;  1RJV A;  1NCY A;  1LKJ A;  2ZKM X;  5BPJ A;  1RWY A;  1K9P A;  3JVT B;  2QPT A;  1UHH A;  3IQQ A;  1OFC X;  1NPQ A;  1SCM B;  1WLM A;  5IBW A;  1PAL A;  1KK8 C;  1D1O A;  1IRJ A;  1EL4 A;  1KQV A;  4YRU A;  1C7V A;  1ODB A;  2AAO A;  1K96 A;  5I2L A;  2L98 A;  4CPV A;  1CNP A;  2BCX A;  3LK0 A;  1S3P A;  2GGM A;  1UUR A;  1F4Q A;  1V1F A;  1CFP A;  1CKK A;  5HKZ A;  1U5I B;  3WHT B;  2KDH A;  1QX5 B;  4BY5 A;  2KSP A;  4YGC B;  1G33 A;  1Y1X A;  1B9A A;  2MJW B;  1LIN A;  1QX7 A;  2R2I A; 
#chains in the Genus database with same CATH topology
 1BGY D;  2AEJ A;  2YXQ B;  2EHB A;  5KLV D;  4B86 A;  1CLB A;  1YHQ P;  5APW A;  1S2E A;  1OW4 A;  2KSE A;  3TDZ A;  1B1G A;  2WCK A;  1UII A;  3BUW B;  3K1E A;  2JZI A;  2WCL A;  2MLF C;  1GJY A;  1JFJ A;  5JJG A;  1QLK A;  2QJY B;  2FY8 A;  2G8Y A;  1S72 P;  1RTP 1;  2MJZ A;  3KZI H;  1FZC B;  5CSF A;  2K8M B;  1KFX S;  3V6I A;  1TOP A;  3FS7 A;  1SCV A;  2ZT9 D;  3I5F B;  4YGA A;  3H6P A;  1AVY A;  1DQE A;  1SFC B;  3AE2 C;  5KU1 A;  1NTZ E;  1RE3 A;  1SFC A;  2L2C A;  2LLS A;  1AQT A;  3E1R A;  1E8A A;  1R5L A;  1KSM A;  4HRH A;  5GTH H;  1YIJ P;  3VMX A;  1YVH A;  1RF0 A;  1LP1 A;  3I5C A;  2QEX P;  2JXL A;  1H88 A;  2LXB A;  1SLQ A;  2BAP A;  1M39 A;  1KQG B;  2V7Q H;  1KK8 B;  4YGE B;  2IPP A;  1G8I A;  1FE6 A;  3W68 A;  2WPR A;  2WCE A;  1HUC A;  1KMI Z;  2BBM A;  3BQ3 A;  2LC5 A;  2E75 B;  4UB6 E;  1IH0 A;  1SQV K;  5KAI E;  1WRK A;  4L76 A;  1SQQ K;  4QJ3 B;  2YXR B;  2PMY A;  1S6C A;  2KZI A;  3QME A;  3K21 A;  3L70 E;  3V4W A;  3CR4 X;  3UO9 A;  3H1L D;  5AW1 B;  1DJH A;  1F8H A;  1BU3 A;  2NXQ A;  2JPT A;  1KQM C;  2KIK A;  3BJH A;  2A45 I;  2P67 A;  2BBN A;  3DVK A;  5HKW A;  4PD4 E;  2WVR A;  4PE4 A;  1YRU B;  2E74 C;  5KLI B;  3SWY A;  3RK3 B;  2ERB A;  4WRI A;  3EKH A;  1DMO A;  4NPE A;  1X22 A;  3CLN A;  1AP4 A;  1KWO B;  1URQ B;  1SQP G;  2NZ0 A;  1URQ A;  2YKQ A;  2M97 A;  1ZXG A;  3UIA A;  3CCM P;  1QIV A;  1NTK J;  1PSR A;  4ASV A;  4HB1 A;  2AEM A;  3ZWH A;  5D7F A;  1QAS A;  1DC1 A;  1GK6 A;  3PP5 A;  2OYH B;  3CC2 P;  1TIZ A;  2OYH A;  5EL2 A;  2J58 A;  4ETO A;  2K37 A;  1NGM B;  1VRK A;  3OX6 A;  3B7A A;  4UB6 H;  1IFI A;  4CPG A;  5KAI H;  2D2C D;  1B4C A;  3E7K A;  1L0N G;  1DT7 B;  1ZN5 A;  1XVJ A;  1TUZ A;  3KPE A;  4DCK A;  2WC8 A;  2JPO A;  1AUI B;  1ZOY C;  2F2P A;  2G3A A;  3P8C D;  1KK7 Z;  1PGQ A;  3JTD C;  5B5E E;  2W6A A;  3WUT A;  2NPS C;  1NX0 A;  4C46 A;  1F70 A;  2YO3 A;  1NAF A;  2HOD B;  3O4X A;  2BCB A;  1A02 F;  2HOD A;  3AEF C;  4L74 A;  3D6Z A;  1K2H A;  4N5X A;  4PD4 H;  1R2U A;  2O5G A;  1B47 A;  3GHG C;  2L5Y A;  3VGO A;  5I8N A;  1L4A D;  3BFA A;  3H1L E;  2IYP A;  3TGU E;  3EVV A;  1H8A A;  1XK4 C;  1IO4 A;  3M9Q A;  2QAC A;  1PPJ D;  3V5B A;  1JY2 N;  2KFH A;  1GGZ A;  4H0L C;  2MAZ A;  2R3S A;  1YJW P;  1L0L G;  2A06 G;  2PAJ A;  1XTG B;  2KFF A;  1TN4 A;  1QLE D;  2ZRT A;  3G6E P;  1LTI C;  1QIW A;  4N6J A;  1GGW A;  3D77 A;  2O1K A;  4H44 C;  2PGD A;  2LM5 A;  3AED C;  1PP9 G;  1KQL A;  2XND H;  3AE9 C;  2LLU A;  2O3J A;  1PSB A;  1JUN A;  3CX5 E;  4JD9 A;  4MSP A;  1CSB A;  3L74 E;  3SFD C;  4FTG A;  1YUT A;  1HQV A;  1FW4 A;  2Q91 A;  2WCJ A;  3L72 J;  4GIF A;  3WHU B;  1QV0 A;  4GDO A;  2WSC J;  1WLZ A;  1JTH A;  2FYU D;  1A29 A;  4PHJ A;  1S1E A;  2I7A A;  1WRZ A;  1CB1 A;  1NTK G;  2MA2 A;  2KYV A;  1U7J A;  3P8C E;  1JUO A;  2M3B A;  3CZ0 A;  1FDI A;  4YI9 A;  4D6T G;  3FE8 A;  3LIE A;  3BXK A;  3DF0 B;  1S5L X;  3DF0 A;  1TU3 F;  1GL2 D;  2BCC J;  2BL0 C;  2PVB A;  2IBZ D;  3MUD C;  1TWO A;  3CGA A;  5DKN A;  1JCC A;  1SQP K;  4R4L A;  2R44 A;  4W7Z A;  1SQV E;  3AE1 C;  3SG7 A;  2OYO A;  1FZB A;  5APX A;  1SQQ E;  1TCO B;  1NTM J;  3LL8 B;  1NJI Q;  3D78 A;  1PPJ E;  1SQX J;  3CCU P;  2MLE C;  5AVX B;  1QAT A;  1AHR A;  1CTR A;  4LC1 A;  4GGF A;  1SQB G;  1N7S C;  2N1T C;  3L73 D;  4JBZ A;  4ASW A;  3H1I J;  2WOS A;  1KB9 D;  1EDJ A;  5M1B A;  1BT6 A;  1L0N K;  1SFC D;  3B5N C;  1LS8 A;  1AJ5 A;  1S5G Z;  5FI7 A;  4D1E A;  1QXP A;  2DOQ A;  1UHN A;  4PJ0 H;  1JMM A;  3H1H J;  2V53 A;  2KNC B;  2BAS A;  1M63 B;  1OZH A;  3JC2 2;  1BOC A;  1EG3 A;  1KQM B;  3BCC D;  2M3E A;  1A2X A;  2QIW A;  5B66 H;  2JXC A;  4HRE E;  1M90 Q;  4I1L A;  2KPH A;  1ZLL A;  1IGV A;  1U5I A;  1VQ9 P;  3WXA A;  1YRT B;  4WWI A;  1VF5 C;  2RH0 A;  3NXA A;  2E74 B;  1DEE G;  3H1K J;  1JWD A;  3BAS A;  2MBX A;  1Y1A A;  2JO1 A;  3FE6 A;  1KYO I;  3MGN A;  3N7N A;  5DKQ A;  1ZUZ A;  2Q3E A;  5KAF E;  1JB0 J;  1FI6 A;  1BE3 J;  1C07 A;  3WMM 0;  3NHT A;  2QG4 A;  2W6B A;  2QE7 H;  3HD7 D;  1L0L K;  2XZR A;  5C39 A;  3TUY C;  1K95 A;  2QEH A;  1F55 A;  2E43 A;  3GF7 A;  1SNL A;  2POH A;  3M0A A;  4HYT B;  1KK7 Y;  2JWW A;  1XFZ O;  1EXI A;  3V2P A;  3RK3 D;  1QGK B;  2XNX A;  1BGY G;  2WC5 A;  1BCC J;  2MHH A;  4AOM A;  1S1C X;  1F54 A;  1URQ D;  2FJY A;  5KLV G;  1AK8 A;  1A02 J;  3JTD B;  4R1E A;  1SQP D;  1RHZ B;  4N78 D;  2CNP A;  2NPS B;  3PJI A;  5CCH D;  4UB8 E;  1JFK A;  4EOT A;  3N7H A;  1IQ5 A;  2ISD A;  1EDI A;  2M8R A;  1KFM A;  3KPX A;  2K9J B;  2HQ8 A;  3B88 A;  4RO0 A;  1T3U A;  1KB9 E;  3GHG B;  1BR1 B;  3S0A A;  1J1D A;  2OPO A;  1NTK K;  1XK4 A;  2QA4 P;  1VQK P;  4CLN A;  1SMG A;  3DYE A;  1KIL D;  3LCP C;  4H0L B;  3BCC E;  3AAK A;  1D7M A;  3L4F A;  2Y1M A;  1ZR4 A;  1JC2 A;  1NU1 J;  1ZME C;  3IAO A;  1CI6 B;  2AXT E;  3AE3 C;  4P5O E;  1OOH A;  1CI6 A;  4KHX A;  1XTC C;  4IL1 A;  1YJN P;  5APS A;  5KJ7 D;  2KQY A;  1ZMZ A;  2Y4Q A;  3H1H G;  1LJ2 A;  4H44 B;  2O01 N;  1ZFS A;  1KN7 A;  3MIW A;  2FXM A;  3TK1 A;  1TNQ A;  3A0B E;  5AEQ A;  2JNF A;  3HCM A;  1FZG A;  3GW6 A;  4U8D A;  1SRA A;  1R5S A;  3AE5 C;  2WCF A;  1XFY O;  1SQB K;  2LV7 A;  2LVI A;  1NCY A;  3FWN A;  1LKJ A;  1WRG A;  1K9P A;  1FJK A;  2QPT A;  1Q86 Q;  3IQQ A;  3UNW A;  2WPV B;  1KK8 C;  1K04 A;  3VMZ A;  2IFM A;  1K96 A;  5I2L A;  1PFI A;  2QJK C;  2L98 A;  1JM0 A;  2E75 C;  1BE3 G;  2BCX A;  4H13 D;  1F4Q A;  1JY3 N;  3BRV B;  1QX5 B;  4BY5 A;  1VQ5 P;  2XDJ A;  1SQP E;  1G33 A;  1Y1X A;  1B9A A;  5CBO A;  5AVU B;  1SSE B;  4PV1 C;  3KF9 A;  2BL0 B;  1C3Z A;  2JTT A;  3BUM B;  1SR6 B;  1K9U A;  2QEV A;  1W7I B;  4Y99 C;  2KAX A;  1WDC C;  3FXD A;  1Q82 Q;  3GOF A;  1D1O A;  4MZL A;  2JRF A;  4I5L B;  2HR3 A;  2OAR A;  2R32 A;  3WUU A;  1L0N E;  2ZFC A;  2K88 A;  3Q1M A;  1XFV O;  1KIL E;  3RL0 C;  1XA5 A;  1NTK D;  1FU1 A;  1NO4 A;  1CW5 A;  1EH2 A;  3NSI A;  1DH3 A;  1OWA A;  3CTN A;  2EC6 C;  1MUX A;  3AE7 C;  1FDM A;  5KLV K;  2JC2 A;  4ORB B;  2I18 A;  1CFD A;  2H61 C;  3SG4 A;  2Z4E A;  2KQ6 A;  1W2E A;  3Q2Y A;  1FZE A;  4IFD K;  1M7L A;  3KO0 A;  4U3F J;  1JO5 A;  1TTX A;  1N73 A;  3S4R A;  1VF5 B;  1DGU A;  1KFU L;  1K9M Q;  2HPC B;  2ZXX A;  4U7J A;  1AJ4 A;  5CSI A;  2L51 A;  2Y9Y A;  2NRG A;  1VQM P;  3TSI A;  5BU8 B;  2QSI A;  2VRS A;  3RL0 g;  2A06 E;  2P71 A;  4PAL A;  1OOF A;  3D6Y A;  3C8V A;  1CDN A;  5AVW B;  5AVT B;  2FCE A;  3QWO C;  3S0F A;  2W27 A;  4JPZ B;  1PP9 E;  2BEC A;  3TUY B;  4INW A;  2WMM A;  1SL8 A;  1SK6 D;  4AQI A;  2M1U A;  3EG5 B;  2HFE D;  2B87 A;  3PN7 C;  4JQ0 D;  3N4X A;  1ALV A;  3OHM B;  2E74 D;  2Z5I A;  2YMK A;  4GOD A;  3CXH D;  2JR8 A;  1ORG A;  5APQ A;  3NSK A;  4I6M C;  2LHI A;  2KNE A;  2M7N A;  2A4J A;  1RRO A;  2FYU G;  1ALW A;  1KSO A;  3VB1 A;  1B8R A;  2R5B A;  3HUS A;  2LR2 A;  3L37 A;  1Q81 Q;  3RGU A;  2WSE J;  4K3A A;  1F71 A;  3AE6 C;  1NTK E;  4DJG A;  3A0H E;  3BYA A;  4NDC A;  3BRT B;  1X02 A;  1M1J A;  1JBA A;  1P28 A;  4D6T E;  2P1J A;  3GMA A;  1XFR A;  3L72 D;  2KSJ A;  2H43 A;  2IBZ G;  2L91 A;  1XFX O;  1DJI A;  2M49 B;  1FC2 C;  3L75 J;  4M2P A;  2NPS D;  3RK2 C;  3Q5R A;  1X8Y A;  1YUR A;  3L71 J;  5KTY A;  1S5L E;  3I5G C;  1CLL A;  2BCC D;  3OA7 A;  1HBW A;  1XFW O;  3FX0 A;  4IL6 H;  3AE8 C;  3L73 G;  4JYB A;  1M31 A;  1SQB E;  2V4H A;  1FS0 E;  5AW7 B;  3PLN A;  3VRP A;  1P84 H;  3BOW B;  3BOW A;  4U3F G;  1HT9 A;  2CCM A;  3H4S E;  3I5H B;  1NTM D;  4PD4 I;  3C1V A;  4H0L D;  1OIP A;  3DY9 A;  1SQX D;  1LP1 B;  3BCC G;  2OTK E;  1EDK A;  1N2D C;  4WQ3 A;  3EWK A;  2CK3 H;  2P10 A;  5CPV A;  4M2O A;  3L35 A;  3H1I D;  3S0D A;  4EYY Q;  2I94 A;  1U57 A;  3TDI A;  2QJK B;  3CXH E;  4H44 D;  1M1K Q;  1PZQ A;  4GGF C;  1GW3 A;  1CM1 A;  3H1H D;  4Z1M H;  1OOI X;  1REC A;  2W8Z A;  3B4S A;  3HE4 B;  3Q5S A;  3HE4 A;  1PIX A;  1G4Y R;  3ZDM A;  4PV1 B;  3JVT C;  2TN4 A;  3D76 A;  1QX8 A;  1EZV I;  3AEB C;  3LID A;  2CPS A;  3A5T A;  2Y1N A;  2Q6Q A;  4DIR A;  3VRR A;  5H2F E;  5J3X A;  4Y99 B;  3LW5 H;  3A2A A;  3H1J J;  3H1K D;  1QJT A;  1WDC B;  4XA4 A;  1GK4 A;  4IFF A;  1YR5 A;  2LMV A;  4MN0 A;  1RQU A;  3L72 E;  5CCG A;  3AEG C;  2NZ2 A;  2LXC B;  1N86 A;  2LMU A;  1BE3 D;  2LAN A;  1BGY E;  2M7L A;  3RL0 B;  4AQR D;  4YXW H;  4GOE A;  5CJ4 A;  1Y0V H;  5KLV E;  4GNK B;  4RJT A;  5CBN A;  2M1K B;  4L9M A;  2EC6 B;  3SS4 A;  2XKM A;  5CMZ A;  4NQG A;  1FBM A;  1B8C A;  2I1J A;  2O1J A;  1AJY A;  1W7J B;  3A8R A;  3OAK A;  2H61 A;  3OBV A;  2L0P A;  2FYU K;  1BCC D;  2K2A A;  2K7B A;  4QMA A;  2KI6 C;  1W2B O;  1PGJ A;  1DD3 A;  1E79 H;  4GAO A;  4PDZ A;  4C0K A;  5AVV B;  3EFG A;  2YKP A;  1QTX A;  3L71 G;  2I1K A;  2V7Q J;  2N1T D;  1N7S D;  1TNP A;  3CCQ P;  3MZW B;  1JCD A;  3B5N D;  4C7N B;  4MN4 C;  3D75 A;  4C7N A;  2K60 A;  3CLQ A;  4PT1 A;  4QJ4 B;  1BG1 A;  1JY2 O;  3CWG A;  3H1H E;  2ZVN B;  4FQT A;  3S1K A;  2BCA A;  4A4B A;  1HGV A;  4I5K A;  1J1D C;  4A7P A;  3LW5 J;  2GTE A;  1NU1 D;  3PN7 B;  1VF5 D;  3CMA P;  3I5I C;  5TNC A;  4OGQ B;  3M9B A;  3GK1 A;  1U7M A;  5AVR B;  1GMJ A;  1HGZ A;  1YIT P;  1A4P A;  3TF5 A;  1J1E A;  1IK7 A;  3PLF B;  2OYI C;  1YBK A;  1NTZ J;  3EFF K;  1BE3 E;  2QM8 A;  1T8Z A;  3DVE A;  1IFP A;  3ZNI A;  2KFG A;  2JWD A;  2KLU A;  2WOR A;  3BAT A;  3H1J G;  2Q9I A;  1NWQ A;  1IFN A;  2LLT A;  2GV5 A;  1IFM A;  4TNC A;  3AEC C;  1NP8 A;  4ICB A;  5B5E H;  3S0B A;  2CBL A;  3U59 A;  1SP4 A;  3BUO B;  1G1J A;  5L8R J;  3MP7 B;  3RK2 B;  1JTH B;  3L70 J;  1LT9 A;  4XJK A;  2JQ6 A;  4NPD A;  2K0J A;  1OSA A;  3NXS A;  4YBH B;  5APU A;  1VQ6 P;  5BU5 A;  3I5G B;  2XV5 A;  2LMT A;  2GA1 A;  4MLW A;  2E30 A;  1RK9 A;  2PYQ A;  3ITK A;  2GGZ A;  1J55 A;  1UHI A;  4WY4 C;  1SR6 C;  3FWL A;  1CFC A;  2KZJ A;  3CCE P;  4INX A;  1MKM A;  3FGA D;  2Q4U A;  4OKH A;  1N2D A;  5TJH A;  4GT1 A;  1CDL A;  2G9B A;  2Y0E A;  5PAL A;  2ZRS A;  2K7C A;  2FCD A;  3CC4 P;  3CX5 H;  4L73 A;  4TT3 H;  1MF8 B;  1JF2 A;  1M46 A;  4KT0 J;  3V2N A;  5APT A;  1RJV A;  1MUU A;  1SVF A;  3MD0 A;  4U3F D;  3JVT B;  1N8R Q;  1NAY A;  1OFC X;  1OVR A;  1IRJ A;  1EL4 A;  3HRN A;  5GTI E;  4CPV A;  1KYO D;  1S3P A;  2GGM A;  3L36 A;  4YPC A;  1CFP A;  1CKK A;  2E75 D;  1N73 C;  1U5I B;  2C9L Y;  2MJW B;  1LIN A;  1W9Z A;  4OCI A;  2H8P D;  1K94 A;  3F45 A;  3AEE C;  3SWK A;  4YGB B;  4PV1 D;  2FYU E;  2CTN A;  3TGU J;  2KLE A;  1LNQ A;  3CWB J;  2WQY C;  3BUX B;  5APY A;  1SYM A;  4K35 A;  3SG3 A;  4DT0 A;  2PAL A;  1MXE A;  1ZV8 A;  1IJD B;  1DJY A;  4PHN A;  4DS7 A;  5AW4 B;  1AVO A;  2Y0D A;  2LVJ A;  1ZOT B;  5KKZ B;  1AQ5 A;  3L72 G;  4MBE A;  1LTB C;  1LT1 A;  5AXI A;  3GF3 A;  2KOG A;  1DGV A;  1BMO A;  5BVZ A;  2IFN A;  4JF7 A;  4PE7 A;  3RL0 D;  2QJP C;  2IBZ E;  4ZKU A;  3TDU A;  1YQ4 C;  1NYH A;  1S3J A;  2L4H A;  4ORA B;  2HF5 A;  1OX3 A;  1OMI A;  1S9K D;  1Z2C B;  3RZS A;  3HUS C;  2OTG C;  2WCM A;  5AVQ B;  1UUS A;  5GTI H;  2KAY A;  4Q04 A;  1QL2 A;  1UIX A;  2BCC G;  2Q1K A;  3L74 J;  3V4Q A;  4EIJ A;  4I5J A;  3R1P A;  5E79 E;  2IZ1 A;  3L73 E;  3CCL P;  4DZO A;  1M1J C;  1OMD A;  5JOL A;  2F3Z A;  1OZS A;  1NKZ B;  2JT0 A;  2K7O A;  3NMD A;  1J1D B;  3CCS P;  3O2P A;  1JY2 P;  5AW0 B;  4U3F E;  4BRY B;  1NTM G;  3TYY A;  4BRY A;  3I5I B;  1S6I A;  3L71 D;  1AA0 A;  3Q8I A;  2KAV A;  1SQX G;  1ZRT D;  1LTA C;  5KAF H;  2ZYA A;  1SL9 A;  5I2O A;  1QS7 A;  2MKV A;  1KYO E;  3CL3 D;  3H1I G;  1Y9B A;  2ZYD A;  2P6B B;  3O6B A;  1VQP P;  2H89 C;  2B9B A;  2JEE A;  2OYI B;  1GQM A;  3G71 P;  4NDB A;  2OYI A;  2HET A;  2A45 G;  4PCW A;  5AVS B;  3M9H A;  3D74 A;  2P7J A;  4EI2 A;  5GQQ C;  1SQV J;  3PAT A;  1SQQ J;  2B88 A;  4USL A;  1M45 A;  2OQQ A;  1IQ3 A;  3I5H C;  1DF0 B;  1Q7Y Q;  1DF0 A;  3NTN A;  3E3R A;  3RM1 A;  1Q90 D;  1VQ8 P;  3H1K G;  1JY3 O;  3MSE B;  1PVB A;  4UB8 H;  1VQN P;  2JJL A;  1UWO A;  1IFD A;  2P58 A;  3RK3 E;  5FI2 A;  5AFP A;  2KUB A;  5K89 A;  3EK8 A;  1DD4 A;  1KB9 H;  1FOS E;  2GUV A;  5HYD A;  3R1O A;  2WSF H;  2JTZ A;  1DX7 A;  1PVA A;  4RKU J;  2ZJS E;  3C1L A;  2Y9Z A;  5CSN A;  2BEQ D;  3H1J D;  2JUL A;  2BKI B;  4N78 E;  1YTZ T;  2KGR A;  1VL2 A;  2LVV A;  1H0T B;  1H0T A;  2ZND A;  3Q3D A;  2NCP A;  4WY4 B;  1QEX A;  4WY4 A;  1B7T Z;  3AKB A;  4N1G A;  3AE4 C;  1VDF A;  1Y1U A;  1YUU A;  1PGO A;  1NCZ A;  5DJT B;  1UHK A;  3AAJ A;  3LLE A;  2W6J H;  2AXT H;  1S36 A;  4MEW A;  4PHM A;  1KD1 Q;  1BCC G;  3WU2 E;  3RK2 D;  1PGP A;  1K73 Q;  3KHE A;  1BSN A;  2LCP A;  5CCG C;  1T2K C;  4MRX A;  3NSL A;  3IN6 A;  1WY9 A;  3B87 A;  2YKO A;  1DJX A;  2O01 H;  3L71 E;  1RE4 A;  3CCV P;  3A0B H;  1HH0 A;  1Q80 A;  1P84 D;  1KV4 A;  1L2P A;  2FYZ A;  3HD7 C;  4PE1 A;  2AMI A;  5F6T A;  1CDP A;  1S6J A;  1GU4 A;  1Q2N A;  1FI5 A;  4W7Y A;  1GTW A;  1BF5 A;  2YIU C;  3OB1 B;  1JSA A;  4IFM A;  1EC5 A;  4GUK A;  1YX7 A;  2KI4 C;  1P84 I;  3CCJ P;  2LAP A;  2H8V A;  3LK1 A;  2JDI H;  3H32 B;  2PRU A;  1NU1 G;  3H32 A;  3JCU E;  5AW8 B;  1MFT A;  1N73 B;  1DIP A;  1LTG C;  1G2C A;  1GU5 A;  1PV3 A;  3M0D A;  2JT3 A;  1HVV A;  2HPS A;  4P2Y B;  2Z5H A;  2LNK A;  1HJ0 A;  3U1C A;  1BLQ A;  3HE5 B;  3HE5 A;  2M0R A;  4MZK A;  1EXJ A;  5D69 A;  1KQS O;  1QVF O;  2PP6 A;  3T97 A;  1SCM C;  1NTM K;  1GD2 E;  1SQX K;  2P70 A;  1ZW0 A;  1BOD A;  1LTT C;  4KJM A;  1HWT C;  1L4A A;  1OW8 A;  2JP3 A;  2KLD A;  4XFJ A;  3OP0 A;  2FFD C;  2KP8 A;  4JYC A;  3H1J E;  3IVT A;  2B87 B;  3USS A;  2P2U A;  4RES B;  5CSJ A;  3I55 P;  4OGQ C;  2WT7 B;  2RGI A;  3DVJ A;  1H4B A;  2WT7 A;  2QJP B;  1KFU S;  2HQW A;  1NTZ D;  1PRW A;  3P7K A;  1BR4 B;  3SS5 A;  4UPG A;  1GDT A;  2O01 J;  4C0L A;  1YVL A;  1Y8A A;  1NX1 A;  1KC8 Q;  2KHN A;  1J1E C;  2SPZ A;  3GG2 A;  3HUS B;  2OTG B;  2H2K A;  1XO5 A;  2FXO A;  3O6Q A;  3KZI E;  3R2P A;  3TNU B;  1SBJ A;  3TNU A;  2LHL A;  2DW3 A;  1LTS C;  3S9O A;  2CPB A;  2KI6 D;  2WSS H;  3OW2 O;  1LXF C;  3IFM A;  1M1J B;  5AVY B;  3CZT X;  3VRO A;  2PQL A;  3O4Y A;  1JEK A;  1C3Y A;  5GTH E;  3KDP B;  3L70 D;  3ABV C;  2N9Y B;  1GM0 A;  5KSZ A;  1FBV A;  2NCO A;  1YQ3 C;  1OW7 A;  2WND A;  4DOJ A;  3D70 A;  2Q5U A;  1MHO A;  3RLZ A;  4H13 C;  5CHX A;  1LT9 C;  2J59 M;  3NGV A;  1KFX L;  1IKU A;  3KYQ A;  1MQ1 A;  3FWB A;  1RY3 A;  4JKT A;  1QWV A;  2Q7C A;  3EVR A;  4PD4 D;  1S4X A;  1OVV A;  5AW6 B;  4GPL B;  1MXL C;  2KS1 B;  2KS1 A;  3M0W A;  3A3Y B;  1SW8 A;  3QH9 A;  1JOC A;  3U1A A;  1H89 A;  1L0N J;  3GK4 X;  3KXD A;  1VQ7 P;  4XE5 B;  2D8N A;  1MR8 A;  1NHL A;  2VRG A;  1LTJ C;  3RBX A;  1FZC A;  2FBW C;  1WMK A;  1CFF A;  4F7F A;  1YJ9 P;  3A0H H;  2QDI A;  1JY3 P;  1EZV D;  1G1I A;  3FXE A;  3ICB A;  1KFN A;  2HG5 D;  4XYN A;  4OH8 B;  1IK9 A;  1X9V A;  2YNY A;  2PSR A;  3PM8 A;  2QEO A;  1NU1 K;  1CDM A;  1B7T Y;  1JMB A;  1PUL A;  1DEK A;  1IG5 A;  3VP8 A;  2ZN9 A;  2QRX A;  1OQP A;  3R1V A;  1FDO A;  1NYA A;  1DJZ A;  1EDL A;  1OE9 B;  1USE A;  2PAS A;  2FXP A;  4BWN A;  3SS3 A;  2L4I A;  1L0L J;  1S5L H;  1QVI Z;  4LLH A;  1MFZ A;  1IJ6 A;  2BNX A;  1VQ4 P;  1E5W A;  1N0Y A;  2LVK A;  3TGU D;  2BEZ F;  3CWB D;  2L5G B;  2KBM A;  3OJA B;  1S26 D;  3VMY A;  2SCP A;  3H25 A;  1RH5 B;  1PP9 J;  2RKL A;  1L7Z A;  5KTB A;  2QM7 A;  3G3Z A;  3D0Y B;  3HD7 B;  4WY4 D;  5AW3 B;  3D0Y A;  3IQO A;  3HD7 A;  1LA0 A;  1OOJ A;  1NX3 A;  1C7W A;  1Y6W A;  5AW9 B;  2BCC E;  2OTL P;  2K7D A;  1V1G A;  3PHL A;  4W80 A;  2YIU B;  1A75 B;  3RBZ A;  1A75 A;  2WWW A;  3L75 G;  2KI4 B;  5KKZ C;  2L5X B;  3CXH H;  1BJF A;  4ORC B;  3G9R A;  3VRQ A;  3B71 A;  2COL B;  1BDC A;  3CX5 D;  1OOG A;  1NTM E;  2ZFD A;  5ER5 A;  1HJB A;  5TIS E;  1T6A A;  4GFT A;  1SQX E;  3A7O A;  2KBI A;  3L74 D;  5CCH A;  2ZKM X;  2E76 C;  1GZL A;  1NVO A;  4D6T J;  3DZT A;  3H1I E;  1NPQ A;  1SCM B;  1WLM A;  5H2F H;  3VTP C;  1KQV A;  4YRU A;  3CX5 I;  1EZV E;  2AAO A;  2AXC A;  2K3R A;  1AFO A;  3LK0 A;  3GLM A;  1V1F A;  1HTL C;  5HKZ A;  2WSC H;  3WHT B;  2E5T A;  2KDH A;  2FFD B;  2FFD A;  2AEF A;  3D73 A;  1KIL B;  2KSP A;  1KIL A;  3CD6 P;  1J7Q A;  1QX7 A;  4ZNC A;  2LUC A;  1RQV A;  5APV A;  2QEB A;  4I7Z C;  1EG4 A;  5B8I B;  3H1K E;  3O78 A;  1B8L A;  1SQB J;  2KYC A;  2JOJ A;  4NDD A;  2ZAE B;  5KJ7 A;  3SWF A;  1LA3 A;  4OZD A;  1J1E B;  4N1F A;  3SG6 A;  4MZJ A;  1SQV D;  3PJS K;  5DKR A;  1VPC A;  1SQQ D;  3W67 A;  2FYN C;  2ZT9 C;  3CWB E;  5FYX A;  3PM2 A;  3FE9 A;  2LP3 A;  3VYI A;  1DVI A;  2KGB C;  2C0W A;  3CPW O;  1R6P A;  5HL1 A;  2WZ7 A;  1QV1 A;  1NCX A;  3A4U B;  4IL6 X;  4ZKP A;  2PFX A;  3F89 A;  5TIS H;  3PSR A;  1PL5 A;  3MHV A;  4E68 A;  1SPY A;  1FF1 A;  3B6X A;  4Y28 J;  1DTL A;  2E5Y A;  2M9G A;  1BCC E;  1EXR A;  3SG2 A;  3KQG A;  1UHJ A;  2KI7 B;  1RF1 C;  2YO2 A;  4I5N B;  4H13 B;  3BUN B;  2YGU A;  1YX8 A;  1LT9 B;  4XJK B;  2F3Y A;  1ZP0 C;  2KYF A;  2QVA A;  5AW2 B;  1FZF A;  2A45 H;  3VN0 A;  3DVM A;  1L2O C;  4TLF A;  1DJW A;  2AUC A;  4FQO A;  3CAB A;  1DEB A;  4MRY A;  2GUS A;  3P32 A;  4PHK A;  3G4S P;  4GOF A;  4BXL A;  2FKW B;  1LVC D;  2ZVO B;  1SY9 A;  2F8P A;  1JF0 A;  1H8B A;  4WBA A;  4PJ0 E;  4OV2 A;  4AUW A;  3JSV C;  1Y47 A;  3CCR P;  1EQ7 A;  3CYZ A;  4YXD C;  5B66 E;  3Q5P A;  1A03 A;  1BGY J;  1FJP A;  2M0B A;  1R8E A;  2OGU A;  5KLV J;  2O60 A;  5AVZ B;  1XFU O;  1LTJ B;  3D71 A;  4JWQ A;  1LTJ A;  1NU1 E;  2LE9 B;  1RE4 C;  2N9B A;  1USD A;  4R4M A;  1NUB A;  1K9K A;  1K05 A;  1WT6 A;  2E42 A;  3QRX A;  4N3Y B;  5D3O A;  3VP9 A;  4EDF A;  5AAN A;  4A4C A;  1YYC A;  4IOI H;  2IX7 C;  1J7O A;  1KQF B;  3L4A A;  1YTZ I;  2WIT A;  4CFQ A;  2IS9 A;  4LGD E;  3DXL A;  1T3J A;  4HH2 A;  1Z4H A;  1M56 D;  1IC2 A;  3R4Y A;  1NIW A;  1QVI Y;  2D2C C;  3CS1 A;  5CJ0 A;  1FAV A;  3V2L A;  3V2R A;  4PE0 A;  3S0G A;  2IBZ I;  1KCY A;  1NX2 A;  2KK7 A;  1M8O B;  2WCB A;  1LWU C;  3M0D C;  1QX2 A;  4BY4 A;  3IF4 A;  2M3W A;  1NTZ G;  3D10 A;  1CM4 A;  2F2O A;  2Y5I A;  1NKN A;  5ER4 X;  2KNC A;  3FWC A;  2KB7 P;  2JWA A;  1KTM A;  2KOT A;  2I8D A;  3H1L J;  3SJS A;  1KB9 I;  5AW5 B;  3CR5 X;  1SL7 A;  4HSZ A;  4DUQ A;  1L4A C;  1CLM A;  1VQL P;  2K2F A;  1SKT A;  5CCG D;  2K61 A;  1TNW A;  4ZCU A;  1T2K D;  5HLO A;  3TZ1 A;  3EKJ A;  1N65 A;  1K8A Q;  2W90 A;  3SIA A;  1X0T A;  5EFW B;  3L70 G;  3SFE C;  3SSU A;  5K5G B;  3VOP A;  1NH4 A;  4ZCV A;  2L2E A;  1T14 A;  2H88 C;  2JU0 A;  3SIB A;  4OVN F;  3OX5 A;  3C9I A;  2E76 B;  3CC7 P;  3CZ2 A;  3NHI A;  3M06 A;  1RFJ A;  3CZ1 A;  2E6W A;  3CDN A;  1WRL A;  2FOT A;  3TS5 C;  4HRG A;  2OTJ P;  1BDD A;  3AKA A;  1QL1 A;  2WPS A;  3B86 A;  2R5D A;  2J5U A;  5HLV A;  4C7R A;  2LP2 A;  3VRN A;  3L75 D;  2BE6 A;  2OS8 C;  2GM4 A;  3L4L A;  2LUX A;  1J2J B;  2NPS A;  4I7Z B;  4AQJ A;  4HKZ H;  4QJ5 B;  3PRJ A;  4WQ2 A;  2K9J A;  5DIC A;  1FOS F;  1YTZ C;  2ZYG A;  1OZO A;  3GHG A;  1EZV G;  2JT8 A;  2WPQ A;  2FYN B;  4AYC A;  2ZT9 B;  2BKH B;  4MVF A;  3EVU A;  1KZU B;  1SS1 A;  1GL2 C;  3FIA A;  1FPW A;  1L0N D;  4C0J A;  4OGQ D;  1EJ3 A;  2MRD A;  3BVH A;  3WNX B;  5DJU B;  3BFH A;  4CFR A;  2CXJ A;  2ITA A;  1TRF A;  3CME P;  2JNX A;  3BFB A;  2QJY C;  2B89 A;  4YI8 A;  1FZC C;  1J7P A;  4IJ7 A;  1AVS A;  1RF1 B;  1RF1 A;  2K1A A;  2KXP B;  3TDK A;  1IIO A;  3I5F C;  4CID A;  3H1L G;  5E79 H;  3TGU G;  3SG5 A;  1KOR A;  3CWB G;  1L2O B;  3HTK B;  1SFC C;  3HTK A;  1RE3 C;  4WB4 A;  4WVZ A;  2RMZ A;  1RF0 C;  2HYN A;  3KEV A;  1FZA A;  1S9K E;  1X79 B;  1L0L D;  1K8U A;  1TUJ A;  2I2R E;  1NTZ K;  2A06 D;  1TCF A;  3PAL A;  1N7L A;  3MTU E;  5I94 A;  1KYO H;  4M3L A;  1QVG O;  1OMV A;  2LKM A;  1M57 D;  1J7R A;  2B1U A;  3R72 A;  4M2Q A;  2R3C A;  3HX4 A;  1W5C E;  3L75 E;  1NOH A;  4ZMD A;  2EGD A;  2Q3I A;  1PP9 D;  2CT9 A;  2FYU J;  3PTZ A;  4I2L C;  1IWQ A;  2BE4 A;  3PFV A;  3II6 A;  1UP5 A;  1YI2 P;  3EK4 A;  3L74 G;  2C9N Y;  1ZRT E;  2WCH A;  2IZ0 A;  1F4O A;  1OW6 A;  3MUD A;  2ZNE A;  3OGN A;  1PK0 D;  3PH0 A;  1NSH A;  1K93 D;  3EK7 A;  4GBA A;  3IR9 A;  3S0E A;  4DRW A;  1OXZ A;  2W83 C;  1DJG A;  1Z56 A;  2M8U A;  4L75 A;  1MWN A;  1NWD A;  2D2C B;  5KLI C;  3RK3 C;  4YGD B;  2IDB A;  1S5G Y;  3VMA A;  1YUS A;  3CI9 A;  2YMY A;  1URQ C;  1KWO C;  1N7S B;  2N1T B;  1LGH B;  2N1T A;  2ZN8 A;  1N7S A;  3F5H A;  4OWF A;  2WSE H;  2C0X A;  4GKG A;  4D6T D;  1G2C B;  1LWU B;  1XYD A;  2M29 A;  1CMF A;  1LWU A;  3B5N B;  2JKV A;  3B5N A;  1TNX A;  2IYO A;  1IJ5 A;  2F33 A;  5CCH C;  2G2B A;  5AER A;  3L73 J;  4GGN A;  2SAS A;  2HLO A;  2OYH C;  3T97 B;  1SQV G;  2WSF J;  3GK2 A;  3WUV A;  5FI6 A;  3NSO A;  2PRR A;  2WTY A;  1SQQ G;  3WU2 H;  1VQO P;  2FJU B;  3M91 A;  3IF7 A;  1L4A B;  1PPJ G;  1K90 D;  3BCC J;  3AEA C;  1HF9 A;  3E1I A;  1MV8 A;  2M5A B;  1ZAC A;  1KIL C;  2HPC A;  2M5A A;  1SQB D;  4OR9 B;  2Y0C A;  3K5B A;  1L0L E;  3V2Q A;  3DD4 A;  1DEL A;  2K9Y A;  3I56 P;  3CR2 A;  5KJ7 C;  4F0Z B;  1CMG A;  4O9B A;  2UWJ E;  4HJG H;  1OMR A;  3B8E B;  1MZ9 A;  1IZN B;  3KHU A;  4YTP C;  3O6Q B;  2L50 A;  1QLS A;  3O8Z A;  4IL6 E;  2KLV A;  3OB2 B;  3TS5 B;  1JNM A;  5I2Q A;  1ZR2 A;  2NLN A;  5G08 A;  2RN0 A;  3JCU H;  1P84 E;  5HKY A;  4NPF X;  3NFQ A;  2OS8 B;  2XU6 A;  5BPJ A;  1RWY A;  2ZXE B;  1CZQ A;  1UHH A;  3L47 A;  2E76 D;  5IBW A;  3CXH I;  1PAL A;  1GW4 A;  1C7V A;  1ODB A;  1OVU A;  1SQP J;  1IFJ A;  1CNP A;  1BSH A;  1UUR A;  4KYN A;  1AV1 A;  2WC6 A;  3EQ2 A;  3P8M C;  4YGC B;  1GL2 B;  1GL2 A;  2H7H A;  2R2I A; 
#chains in the Genus database with same CATH homology
 4OCI A;  1K94 A;  3F45 A;  2LUC A;  3KF9 A;  2BL0 B;  2EHB A;  2JTT A;  4YGB B;  1CLB A;  3BUM B;  1SR6 B;  1EG4 A;  1K9U A;  2CTN A;  5B8I B;  1W7I B;  3O78 A;  1B8L A;  2KAX A;  3BUX B;  3TDZ A;  2KYC A;  1B1G A;  2JOJ A;  4NDD A;  1WDC C;  1SYM A;  3BUW B;  3SG3 A;  1LA3 A;  2JZI A;  3GOF A;  2PAL A;  2MLF C;  1MXE A;  4N1F A;  3SG6 A;  4MZJ A;  1DJY A;  1GJY A;  4MZL A;  4PHN A;  2JRF A;  1QLK A;  5JJG A;  5DKR A;  1JFJ A;  4DS7 A;  4I5L B;  1RTP 1;  5CSF A;  2K8M B;  2LVJ A;  5FYX A;  1KFX S;  1ZOT B;  1TOP A;  1XFV O;  4MBE A;  3FS7 A;  1SCV A;  1XA5 A;  2LP3 A;  3I5F B;  4YGA A;  1DVI A;  2KGB C;  5AXI A;  1DGV A;  1R6P A;  1BMO A;  1QV1 A;  1NCX A;  3A4U B;  4PE7 A;  5KU1 A;  2LLS A;  3PSR A;  3TDU A;  1EH2 A;  3NSI A;  1E8A A;  1KSM A;  4E68 A;  4HRH A;  1SPY A;  1J7Q A;  3CTN A;  1YVH A;  2EC6 C;  2JXL A;  2L4H A;  1MUX A;  4ORA B;  2HF5 A;  1FF1 A;  2JC2 A;  4ORB B;  1M39 A;  1DTL A;  1CFD A;  2H61 C;  2I18 A;  2OTG C;  3SG4 A;  2KQ6 A;  2M9G A;  1EXR A;  1UUS A;  3SG2 A;  1KK8 B;  4YGE B;  1UHJ A;  1G8I A;  2KAY A;  4I5N B;  2WCE A;  4Q04 A;  3BUN B;  1YX8 A;  2BBM A;  3BQ3 A;  3KO0 A;  2LC5 A;  4XJK B;  2F3Y A;  2KYF A;  1IH0 A;  4I5J A;  1WRK A;  3DVM A;  1L2O C;  1OMD A;  1DJW A;  4QJ3 B;  1TTX A;  5JOL A;  2AUC A;  1OZS A;  2F3Z A;  2JT0 A;  2PMY A;  1S6C A;  4FQO A;  4MRY A;  1DGU A;  3K21 A;  4PHK A;  2K7O A;  1KFU L;  3CR4 X;  3O2P A;  1LVC D;  1SY9 A;  1AJ4 A;  5CSI A;  2L51 A;  2Y9Y A;  2F8P A;  1S6I A;  1JF0 A;  3I5I B;  1DJH A;  1F8H A;  1H8B A;  2KAV A;  1BU3 A;  4OV2 A;  2NXQ A;  4PAL A;  2JPT A;  1KQM C;  1SL9 A;  5I2O A;  1CDN A;  1QS7 A;  2FCE A;  1A03 A;  4JPZ B;  2P6B B;  3O6B A;  2BBN A;  3DVK A;  5HKW A;  2O60 A;  2BEC A;  3TUY B;  1XFU O;  4PE4 A;  1GQM A;  4JWQ A;  4NDB A;  1SL8 A;  2HET A;  1SK6 D;  1YRU B;  4AQI A;  2M1U A;  4PCW A;  2LE9 B;  3PN7 C;  4JQ0 D;  1ALV A;  3OHM B;  4WRI A;  3EKH A;  5GQQ C;  1DMO A;  1NUB A;  1K9K A;  3CLN A;  1AP4 A;  1KWO B;  2NZ0 A;  3PAT A;  3QRX A;  2M97 A;  4USL A;  5AAN A;  1M45 A;  3NSK A;  4A4C A;  1IQ3 A;  3I5H C;  1J7O A;  1QIV A;  2KNE A;  2LHI A;  1DF0 B;  2M7N A;  1DF0 A;  2A4J A;  1RRO A;  3E3R A;  1PSR A;  1ALW A;  4CFQ A;  1KSO A;  3RM1 A;  1B8R A;  2IS9 A;  5D7F A;  3ZWH A;  1QAS A;  3MSE B;  1PVB A;  1TIZ A;  1F71 A;  4ETO A;  1NIW A;  1QVI Y;  1VRK A;  1UWO A;  3CS1 A;  3OX6 A;  4PE0 A;  1KCY A;  3BYA A;  1B4C A;  4NDC A;  5AFP A;  1NX2 A;  1X02 A;  3EK8 A;  5K89 A;  1XVJ A;  1DT7 B;  1JBA A;  4DCK A;  2WC8 A;  2WCB A;  5HYD A;  2JTZ A;  1AUI B;  1PVA A;  1QX2 A;  2F2P A;  4BY4 A;  2M3W A;  1KK7 Z;  2Y9Z A;  5CSN A;  3D10 A;  1CM4 A;  2F2O A;  2JUL A;  1XFX O;  1DJI A;  2Y5I A;  3JTD C;  2BKI B;  2KGR A;  2M49 B;  2LVV A;  5ER4 X;  1NX0 A;  2ZND A;  2NCP A;  1F70 A;  3FWC A;  1B7T Z;  3AKB A;  4N1G A;  1Y1U A;  1YUU A;  4M2P A;  1NCZ A;  1UHK A;  2KOT A;  3AAJ A;  3LLE A;  2BCB A;  3SJS A;  1YUR A;  1S36 A;  4MEW A;  4PHM A;  3CR5 X;  1K2H A;  1SL7 A;  4HSZ A;  4N5X A;  4DUQ A;  3KHE A;  1R2U A;  2LCP A;  2O5G A;  1B47 A;  5KTY A;  3I5G C;  4MRX A;  1CLM A;  1CLL A;  2K2F A;  3NSL A;  3VGO A;  1XFW O;  1SKT A;  5I8N A;  1WY9 A;  2K61 A;  1TNW A;  3EVV A;  4ZCU A;  1XK4 C;  5HLO A;  1M31 A;  3TZ1 A;  1DJX A;  3EKJ A;  1N65 A;  2QAC A;  3SIA A;  2KFH A;  1GGZ A;  3VRP A;  3BOW B;  1Q80 A;  3BOW A;  1HT9 A;  2MAZ A;  2CCM A;  3H4S E;  4ZCV A;  2L2E A;  3I5H B;  3C1V A;  2JU0 A;  2AMI A;  4PE1 A;  3SIB A;  4OVN F;  3OX5 A;  5F6T A;  2KFF A;  1CDP A;  1TN4 A;  1S6J A;  2ZRT A;  4WQ3 A;  1FI5 A;  5CPV A;  1RFJ A;  1BF5 A;  1QIW A;  3OB1 B;  4M2O A;  1GGW A;  1JSA A;  4GUK A;  2E6W A;  2I94 A;  1YX7 A;  1WRL A;  2LM5 A;  2FOT A;  2KI4 C;  3TDI A;  3TS5 C;  4HRG A;  2LAP A;  2LLU A;  3LK1 A;  3AKA A;  1PSB A;  2PRU A;  4GGF C;  1CM1 A;  5HLV A;  2LP2 A;  4MSP A;  3VRN A;  1REC A;  2BE6 A;  2JT3 A;  2OS8 C;  2HPS A;  4P2Y B;  2LNK A;  4FTG A;  1YUT A;  1BLQ A;  2LUX A;  2M0R A;  1G4Y R;  4MZK A;  5D69 A;  1HQV A;  1FW4 A;  2Q91 A;  3JVT C;  2TN4 A;  2Y1N A;  1SCM C;  3WHU B;  4DIR A;  1QV0 A;  4AQJ A;  3VRR A;  4QJ5 B;  1WLZ A;  5J3X A;  1A29 A;  4PHJ A;  4WQ2 A;  1S1E A;  1QJT A;  1BOD A;  2I7A A;  1WDC B;  1WRZ A;  1CB1 A;  1YR5 A;  1YTZ C;  2LMV A;  4MN0 A;  1OZO A;  2MA2 A;  2JT8 A;  3OP0 A;  1JUO A;  2BKH B;  2LMU A;  3EVU A;  4MVF A;  4YI9 A;  3FIA A;  1FPW A;  2LAN A;  2M7L A;  3BXK A;  3DF0 B;  5CSJ A;  3DF0 A;  1Y0V H;  2RGI A;  2BL0 C;  4GNK B;  3DVJ A;  4C0J A;  1H4B A;  1KFU S;  2PVB A;  2HQW A;  1EJ3 A;  2MRD A;  2M1K B;  1PRW A;  3CGA A;  3WNX B;  1BR4 B;  5DKN A;  4UPG A;  4CFR A;  4L9M A;  2EC6 B;  2CXJ A;  1TRF A;  1YVL A;  4C0L A;  4NQG A;  1NX1 A;  2KHN A;  1B8C A;  3SG7 A;  2JNX A;  1TCO B;  1W7J B;  2OTG B;  3A8R A;  2H2K A;  1XO5 A;  2H61 A;  2L0P A;  4YI8 A;  3LL8 B;  1J7P A;  1AVS A;  2K2A A;  2K7B A;  2KI6 C;  1SBJ A;  2LHL A;  2MLE C;  4GAO A;  4PDZ A;  4C0K A;  3I5F C;  1QAT A;  1AHR A;  1CTR A;  2KI6 D;  1QTX A;  4CID A;  1LXF C;  3SG5 A;  4GGF A;  1L2O B;  3CZT X;  3VRO A;  2WOS A;  3O4Y A;  1BT6 A;  1TNP A;  1AJ5 A;  1S5G Z;  4D1E A;  1QXP A;  2DOQ A;  1UHN A;  3KEV A;  5KSZ A;  1FBV A;  2NCO A;  2V53 A;  2WND A;  1K8U A;  1M63 B;  2I2R E;  1BOC A;  1MHO A;  1EG3 A;  1KQM B;  1TCF A;  3PAL A;  3RLZ A;  1A2X A;  1KFX L;  1OMV A;  2JXC A;  4HRE E;  1IKU A;  4QJ4 B;  1BG1 A;  1MQ1 A;  3FWB A;  3CWG A;  1J7R A;  2B1U A;  4M2Q A;  3HX4 A;  1IGV A;  2EGD A;  1U5I A;  3EVR A;  2BCA A;  3WXA A;  4A4B A;  1YRT B;  2CT9 A;  4GPL B;  1MXL C;  3NXA A;  1IWQ A;  4I5K A;  2BE4 A;  1JWD A;  3PFV A;  3M0W A;  3PN7 B;  2MBX A;  1Y1A A;  1SW8 A;  1UP5 A;  3I5I C;  5TNC A;  3EK4 A;  3GK1 A;  5DKQ A;  1F4O A;  1ZUZ A;  1FI6 A;  1C07 A;  2ZNE A;  1A4P A;  1PK0 D;  3GK4 X;  1NSH A;  1K93 D;  3EK7 A;  4GBA A;  1J1E A;  2D8N A;  1MR8 A;  3PLF B;  4DRW A;  3TUY C;  2VRG A;  1DJG A;  1K95 A;  2M8U A;  1F55 A;  1MWN A;  1NWD A;  3DVE A;  1CFF A;  4YGD B;  1SNL A;  2KFG A;  3ZNI A;  1S5G Y;  1KK7 Y;  1YUS A;  1XFZ O;  2JWW A;  2WOR A;  1KWO C;  3ICB A;  2ZN8 A;  4XYN A;  2LLT A;  2GV5 A;  2MHH A;  4AOM A;  1XYD A;  2M29 A;  4TNC A;  2PSR A;  3PM8 A;  1CMF A;  1F54 A;  1NP8 A;  1CDM A;  1B7T Y;  1TNX A;  1IJ5 A;  4ICB A;  2F33 A;  1AK8 A;  1PUL A;  1IG5 A;  2ZN9 A;  2G2B A;  3JTD B;  4R1E A;  5AER A;  1OQP A;  2CNP A;  4GGN A;  2SAS A;  2CBL A;  3BUO B;  1JFK A;  3GK2 A;  1IQ5 A;  1DJZ A;  1NYA A;  2ISD A;  3NSO A;  3KPX A;  1OE9 B;  4XJK A;  2JQ6 A;  2PAS A;  2HQ8 A;  2K0J A;  1OSA A;  2FJU B;  4YBH B;  3IF7 A;  2L4I A;  1QVI Z;  1BR1 B;  3I5G B;  2LMT A;  1K90 D;  1IJ6 A;  4MLW A;  1J1D A;  1N0Y A;  2OPO A;  1ZAC A;  2E30 A;  2LVK A;  1XK4 A;  1RK9 A;  2KBM A;  4OR9 B;  4CLN A;  1SMG A;  1S26 D;  2SCP A;  3LCP C;  3DD4 A;  2GGZ A;  1J55 A;  1UHI A;  3AAK A;  1L7Z A;  2Y1M A;  1SR6 C;  1JC2 A;  1CFC A;  3D0Y B;  3D0Y A;  3IQO A;  4P5O E;  3CR2 A;  1LA0 A;  4IL1 A;  4F0Z B;  1OOJ A;  1CMG A;  1NX3 A;  1C7W A;  1Y6W A;  1OMR A;  2Q4U A;  2K7D A;  4OKH A;  1N2D A;  1V1G A;  2KQY A;  1A75 B;  2L50 A;  1QLS A;  1A75 A;  1CDL A;  1ZMZ A;  2Y4Q A;  2G9B A;  5PAL A;  2KI4 B;  3OB2 B;  2ZRS A;  3TS5 B;  5I2Q A;  1ZFS A;  2L5X B;  2K7C A;  2FCD A;  1BJF A;  4ORC B;  1TNQ A;  2NLN A;  5G08 A;  5AEQ A;  3VRQ A;  2JNF A;  3HCM A;  2COL B;  5HKY A;  1MF8 B;  4U8D A;  1SRA A;  1JF2 A;  1M46 A;  2ZFD A;  5ER5 A;  2WCF A;  1XFY O;  2OS8 B;  4GFT A;  2LV7 A;  2LVI A;  2KBI A;  1RJV A;  1NCY A;  1LKJ A;  2ZKM X;  5BPJ A;  1RWY A;  1K9P A;  3JVT B;  2QPT A;  1UHH A;  3IQQ A;  1OFC X;  1NPQ A;  1SCM B;  1WLM A;  5IBW A;  1PAL A;  1KK8 C;  1D1O A;  1IRJ A;  1EL4 A;  1KQV A;  4YRU A;  1C7V A;  1ODB A;  2AAO A;  1K96 A;  5I2L A;  2L98 A;  4CPV A;  1CNP A;  2BCX A;  3LK0 A;  1S3P A;  2GGM A;  1UUR A;  1F4Q A;  1V1F A;  1CFP A;  1CKK A;  5HKZ A;  1U5I B;  3WHT B;  2KDH A;  1QX5 B;  4BY5 A;  2KSP A;  4YGC B;  1G33 A;  1Y1X A;  1B9A A;  2MJW B;  1LIN A;  1QX7 A;  2R2I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...