4OVNF

Voltage-gated sodium channel 1.5 (nav1.5) c-terminal domain in complex with calmodulin poised for activation
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
146
structure length
146
Chain Sequence
STEPLSEDDFDMFYEIWEKFDPEATQFIEYSVLSDFADALSEPLRIAKPNQISLINMDLPMVSGDRIHCMDILFAFTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSAMVIQRAFRRHLLQRSLKHASFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Calmodulin
publication title Regulation of the NaV1.5 cytoplasmic domain by calmodulin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 34
structure length 146
sequence length 146
chains with identical sequence G, H, I, J
ec nomenclature
pdb deposition date 2013-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ovnF01
1.20.5.1190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces iswi atpase 4ovnF02
1ZMZA 2BCXA 2M0RA 1U5IB 1RWYA 3D10A 1DJIA 1EL4A 4GUKA 2B1UA 2HQWA 3DD4A 2O5GA 1NCYA 2ZN9A 1A29A 1PSRA 1OOJA 1PSBA 1K9PA 2MAZA 4HRHA 1KFXS 2EC6B 2JT0A 1SL7A 3BXKA 1IH0A 1CLBA 2ZN8A 1M45A 3PM8A 2OS8C 1XVJA 3TS5B 1R2UA 2L98A 1NCZA 2Y1MA 3AAKA 4FTGA 1BLQA 1YURA 2KI6C 3I5IB 3JTDB 1M31A 1ZFSA 1JF2A 1KQVA 4NDBA 5CSNA 1DVIA 4MZKA 3VRRA 1NSHA 2PALA 1OFCX 1B7TZ 1C7VA 2ISDA 1CTRA 2CNPA 2JPTA 1IQ5A 1ZACA 3TUYB 2LP2A 3FWBA 1DJGA 1U5IA 2M7LA 1WDCB 4P2YB 2MA2A 1XFUO 2G2BA 1UHJA 1CMFA 2LVIA 3CLNA 2BKHB 3D0YB 1CNPA 1WRKA 2EC6C 4YGDB 2JQ6A 1NUBA 2F2OA 1B9AA 1Q80A 1Y6WA 2D8NA 2PRUA 3TS5C 3QRXA 3SIAA 3FIAA 2AUCA 3I5FB 4QJ5B 4PHJA 5PALA 1DJZA 3JVTB 1B8LA 2P6BB 4R1EA 4CPVA 3I5IC 2CT9A 3JTDC 3PATA 2LM5A 2Y4QA 1YTZC 5B8IB 1FF1A 3BUOB 2JOJA 3PN7B 1IJ5A 4OKHA 4MN0A 1ALVA 1WRLA 4YBHB 1YUSA 1N65A 1UUSA 3CR4X 3TUYC 2GGMA 4MVFA 2BL0B 1K95A 2HF5A 1S36A 4IL1A 1WDCC 2Y5IA 5D7FA 3ZWHA 2LP3A 3CWGA 2F3YA 4FQOA 4GFTA 1A75B 1W7IB 2MHHA 1DGUA 1TOPA 2BCBA 3SIBA 2JXLA 1FW4A 1QATA 1AHRA 1IWQA 3CGAA 2FOTA 3LLEA 4PHNA 1DJHA 1QVIY 2ZRTA 4ZCUA 1H4BA 4M2QA 2M49B 3I5FC 5GQQC 3HCMA 3OHMB 1V1FA 3JVTC 2HQ8A 2I2RE 2G9BA 2LLUA 1MWNA 2TN4A 1HQVA 1K8UA 1QX2A 1ODBA 3A4UB 3VROA 1TN4A 3HX4A 4PE7A 3A8RA 1BODA 4CFQA 1L2OB 2KAVA 4C0KA 4OV2A 3PN7C 4DUQA 1BF5A 2BKIB 1JFJA 3PALA 1CB1A 1B7TY 2ZNDA 3LK0A 2KBIA 4M2OA 4DCKA 3BYAA 1QIVA 2BL0C 4DRWA 1D1OA 2LC5A 4ORBB 1XFVO 1DJXA 1B8RA 1TCOB 2K7BA 3GK2A 1YR5A 2OPOA 3WHTB 1ALWA 1KK7Z 5HYDA 1WLMA 1JBAA 2KOTA 1NPQA 4JQ0D 1QIWA 2KFFA 1SMGA 1J1EA 3CZTX 1A75A 4JWQA 1UWOA 4L9MA 3GOFA 4I5NB 3LCPC 2KFGA 3ZNIA 1G33A 1J7QA 3IQOA 5JJGA 1LA0A 4PE1A 4AQIA 1BOCA 1OMDA 2HPSA 1LKJA 4UPGA 1QV0A 1LVCD 2PVBA 1OMVA 4ORAB 4WQ2A 1B4CA 1AJ4A 3BUXB 2LLTA 1B8CA 1JSAA 1BT6A 3VRQA 4E68A 1L2OC 3BUMB 4M2PA 5AEQA 1NIWA 3WHUB 1KCYA 1K93D 5TNCA 2JNFA 2GGZA 1F54A 1NX3A 3O78A 4D1EA 1N0YA 1J55A 2GV5A 2I18A 2K0JA 4MZLA 2WORA 3EVRA 2JNXA 2KGBC 1LXFC 1NP8A 5HLVA 3TZ1A 1F71A 4N1FA 2FCEA 1SL8A 5FYXA 4Q04A 1PULA 4N5XA 2JXCA 1RK9A 1QJTA 1RJVA 1L7ZA 1M39A 1RROA 2BCAA 3I5GB 4PHKA 2JTZA 1J7OA 2JZIA 4NDDA 1Y0VH 1F55A 2KI6D 1YVHA 2KSPA 2WCBA 1E8AA 3FS7A 4PDZA 4HREE 3AAJA 2LMTA 2L5XB 2M3WA 2NXQA 1QS7A 1K9KA 2KGRA 1SCMC 1EJ3A 2BBMA 2Y1NA 4WRIA 4MBEA 4GGFC 2K2AA 1W7JB 5KU1A 4YGAA 1SY9A 4GGFA 4U8DA 3DVMA 4BY4A 2ZFDA 5ER4X 4PCWA 1XYDA 2PMYA 5KTYA 2VRGA 3VRPA 4USLA 1KQMB 1NYAA 2A4JA 3GK1A 2KAXA 1CDPA 1IQ3A 4C0JA 1S5GZ 1KK7Y 3I5GC 2Q4UA 3OP0A 3CTNA 1MXEA 3AKBA 1MXLC 2COLB 1IKUA 2MLFC 2I7AA 1PVAA 1IJ6A 2L50A 2JU0A 2WNDA 1YUUA 1QLKA 3TDIA 2CTNA 5G08A 4OCIA 1F4OA 1UURA 4YGEB 1QXPA 1TNXA 3LL8B 1K96A 3WNXB 1CLMA 5AERA 2SASA 1KFUS 5AANA 1X02A 1OQPA 1SK6D 1JFKA 2HETA 5DKRA 1M63B 3TDZA 3VGOA 1SPYA 1A2XA 3NSLA 3M0WA 4JPZB 1FI5A 2WCFA 3KHEA 1GGWA 1KQMC 1XFYO 2PSRA 2LVKA 5DKQA 1NCXA 3D0YA 3SG4A 1YVLA 2FJUB 5AXIA 5ER5A 5BPJA 4N1GA 2F8PA 4P5OE 2M8UA 2M9GA 1A4PA 2O60A 1G4YR 1XFWO 3PLFB 1OSAA 1EG3A 1AP4A 2LUCA 2OTGB 3IF7A 2SCPA 4I5KA 5AFPA 1JWDA 3EKJA 1SYMA 2ZRSA 2K2FA 2EGDA 2BBNA 2BECA 2LUXA 1TNWA 3EK7A 1S3PA 2MRDA 1QLSA 3SG7A 1YX8A 2WOSA 2LVVA 4ORCB 1EH2A 1J1DA 2R2IA 1KK8B 5CSIA 1EXRA 1Y1UA 1KSOA 1XFXO 2F2PA 2L4IA 1JC2A 1BR4B 1YRTB 4YGCB 2KAYA 4CIDA 1XK4C 3I5HB 1S6IA 1VRKA 2IS9A 5I2OA 1J7RA 2BE6A 4XJKB 1XK4A 1N2DA 2H61C 1DTLA 1CDMA 2MLEC 1UHIA 3ICBA 2H61A 4BY5A 1S5GY 1TRFA 1TIZA 3KEVA 1K9UA 4PHMA 1R6PA 4GBAA 1UHHA 2FCDA 3TDUA 2LCPA 2OTGC 2E30A 2QACA 1K90D 1LA3A 3O6BA 4MSPA 3DF0B 2JT3A 5HKWA 3DVKA 3E3RA 4ZCVA 1SR6B 1YRUB 2KYCA 4WQ3A 1B1GA 1AK8A 2LLSA 1SL9A 1BMOA 1PVBA 3RLZA 2E6WA 1LINA 3CR5X 3BOWB 4OR9B 2LV7A 1KK8C 2K61A 5D69A 2Q91A 2LE9B 4HRGA 1PK0D 1H8BA 1TCFA 2WCEA 1B47A 4F0ZB 3I5HC 1MHOA 2M97A 4I5LB 3F45A 2KI4B 3BUNB 1A03A 1FBVA 2JC2A 3MSEB 4XJKA 1Y1AA 1C07A 1OMRA 1QTXA 3DVEA 4XYNA 2M1UA 2K8MB 2WC8A 4YGBB 3C1VA 1MQ1A 5HKZA 2KNEA 3RM1A 2K7DA 1DGVA 3O4YA 1CDNA 4DIRA 4MZJA 1SNLA 2V53A 2LNKA 2CXJA 1PRWA 4ICBA 4NQGA 1CFFA 1GJYA 3DF0A 1SR6C 2M1KB 1SKTA 3SJSA 3H4SE 4AOMA 3EK4A 3SG2A 1QVIZ 1UHKA 2F3ZA 2KQ6A 2JTTA 1K2HA 1MF8B 5I8NA 1ZUZA 1CKKA 3BOWA 1F70A 2M7NA 4C0LA 2AMIA 1OZOA 1CFPA 2KQYA 1OE9B 3FWCA 2PASA 1KFXL 1M46A 1WLZA 3KPXA 3OX5A 2KI4C 1CDLA 4QJ3B 1QX7A 2LVJA 1BU3A 1S6CA 1MR8A 2MJWB 1QX5B 5CSFA 4AQJA 3K21A 5CPVA 1TTXA 1JUOA 1SBJA 2K7OA 1BG1A 1IRJA 3CR2A 1WRZA 1WY9A 3EVVA 1MUXA 2K7CA 1CFCA 1IGVA 2LMVA 4A4CA 5HLOA 1GGZA 1NX0A 2I94A 5F6TA 5I2QA 1BR1B 4A4BA 2L2EA 5IBWA 2CBLA 1CLLA 1UP5A 2JWWA 1DF0B 3LK1A 2KDHA 5K89A 1K94A 2RGIA 3WXAA 2LHIA 2LANA 5J3XA 4GPLB 4GAOA 3EKHA 1CM1A 1YUTA 4MEWA 4PE0A 3SG5A 1PALA 1YX7A 2NZ0A 1KWOB 1RTP1 4PE4A 1S1EA 2KFHA 3OB1B 4MLWA 1NX1A 1SCVA 1SRAA 3NSIA 2LMUA 5I2LA 2L4HA 1DJWA 1TNPA 2EHBA 5KSZA 2KBMA 2NCOA 2QPTA 2BE4A 3NSOA 4YI9A 2ZNEA 1ZOTB 2KHNA 2NLNA 2KYFA 1BJFA 1XFZO 2F33A 1DJYA 1DMOA 1AJ5A 5JOLA 1JF0A 3DVJA 4GNKB 3CS1A 4CLNA 1KFUL 4MRYA 1DT7B 1CFDA 4YI8A 1IG5A 2NCPA 1DF0A 2H2KA 1GQMA 2ZKMX 3OB2B 3BUWB 1QV1A 1QASA 4I5JA 1RFJA 5CSJA 4YRUA 1NX2A 4QJ4B 2Y9ZA 1G8IA 1KWOC 1SW8A 3NXAA 1OZSA 1Y1XA 1S26D 3O2PA 1KSMA 3KO0A 4MRXA 1RECA 1FPWA 3NSKA 1XO5A 2AAOA 4GGNA 1EG4A 4TNCA 3BQ3A 1XA5A 3PFVA 3SG3A 3KF9A 2Y9YA 1NWDA 3OX6A 2L51A 1C7WA 2M29A 4PALA 1AVSA 4CFRA 1FI6A 4OVNF 1CMGA 2LHLA 4DS7A 1J7PA 4HSZA 2L0PA 1AUIB 2LAPA 1S6JA 1HT9A 2OS8B 3EK8A 4ETOA 1V1GA 2CCMA 3GK4X 3PSRA 2MBXA 3EVUA 3VRNA 5HKYA 1UHNA 2JT8A 5DKNA 1F8HA 1F4QA 2JRFA 4NDCA 2JULA 3AKAA 1CM4A 1TNQA 1SCMB 2DOQA 3SG6A 3IQQA
chains in the Genus database with same CATH superfamily
4GUKA 1RWYA 1EL4A 2HQWA 3DD4A 2PFXA 2ZN9A 1A29A 1PSRA 3WU2E 2XV5A 1PSBA 2WITA 2JPOA 3L71D 5APWA 2EC6B 1NWQA 3AEFC 4XFJA 1L0NE 1R2UA 1KTMA 3IAOA 1OZHA 4FQTA 4Y99C 2Q7CA 1OIPA 5AVRB 1S3JA 1URQA 3P8CE 1JF2A 1KQVA 3KDPB 4NDBA 1BE3D 2IDBA 1RHZB 1L0ND 2E74B 2R3SA 3CWBG 2PALA 1B7TZ 1LTJB 1CTRA 5BU5A 4IFMA 1IQ5A 1ZACA 3FWBA 3P8CD 4IOIH 1VF5B 1XFUO 2G2BA 5KLVE 2WCHA 2LVIA 2A45I 2BKHB 3D0YB 4JF7A 3Q5PA 2EC6C 1FDMA 4YGDB 4ZMDA 3I56P 1Y6WA 3HE5A 3SIAA 3CC2P 1FC2C 2QRXA 2GM4A 4PHJA 1GMJA 1B8LA 3CMEP 4R1EA 5EL2A 3SS5A 4CPVA 4OZDA 3GHGB 1ZRTD 1NU1K 4UB8H 3SSUA 2E74C 4OKHA 4MN0A 1WRLA 4M3LA 3T97A 1SQBJ 2GGMA 2BL0B 2XU6A 1K95A 1S36A 5D7FA 1VF5C 3ZWHA 1P28A 1Z56A 2F3YA 1J1EB 2W90A 1S5LH 1A75B 2MHHA 3W68A 5C39A 1AHRA 4PHNA 4L74A 2ZRTA 3L71G 5APUA 4M2QA 2KYVA 4JYCA 3HCMA 2KNCA 1HUCA 1K8UA 1QX2A 2P2UA 4PD4H 1ZR4A 2KS1A 3GHGC 3PJIA 1BODA 4CFQA 1PGPA 4OV2A 2WTYA 5AW6B 1BF5A 3M06A 1VQNP 1GW3A 1HGVA 1IFNA 1GU4A 1L0NG 5KAFE 3PALA 2KUBA 3L75E 1AFOA 3BYAA 2BL0C 3HD7A 1KN7A 1B8RA 1OOIX 1TCOB 5TJHA 1J1EC 1WLMA 1KQSO 2KOTA 3AE1C 3CZTX 4JWQA 4I5NB 2KFGA 3ZNIA 2IBZI 5JJGA 2ZVOB 2HPSA 2K3RA 2Y0EA 2OQQA 4PV1D 2A06E 2PVBA 1OMVA 1NGMB 3D70A 2IYOA 1L0LJ 1OOGA 3VMZA 3BUMB 2A06D 2JNFA 1F54A 3O78A 4D1EA 1N0YA 2I18A 2WORA 2KGBC 1LXFC 3TZ1A 1MKMA 3PLNA 1QJTA 1SQXE 3BASA 1M39A 2QM7A 2JTZA 1Y47A 2JZIA 4NDDA 1JY2P 1E8AA 2HODB 2WPSA 1CW5A 3H1IE 2M3WA 3M0DC 3L70D 2KGRA 2NPSA 3N7NA 1DIPA 1HTLC 4GGFC 3CCVP 3H1ID 4YGAA 3FE6A 2ZFDA 4PCWA 5KTYA 1VPCA 1CDPA 2FYUJ 2WPVB 5B66E 1KK7Y 2Q4UA 3DY9A 2COLB 2I7AA 2HR3A 1A02F 2WNDA 1YUUA 1QLKA 3L75G 2CTNA 4OCIA 3OJAB 2C9LY 1HVVA 3AE4C 2KXPB 2OYHB 1QXPA 4IJ7A 1LTAC 1SFCA 1K96A 3WNXB 1EXJA 1VQKP 2WCJA 1CLMA 2PRRA 1PZQA 3KYQA 4NPEA 1X02A 1OQPA 2GTEA 4H13D 2HETA 1S5LX 2H8VA 2A06G 2RN0A 1FI5A 3KHEA 1GGWA 2YGUA 5DKQA 2IZ0A 2RH0A 5ER5A 5BPJA 1DD3A 2M9GA 2P70A 3AE9C 3L74D 1NTKK 3VTPC 1NTME 3IF7A 4I5KA 3EKJA 1SYMA 2ZRSA 2K2FA 1KILE 2EGDA 2BECA 2AEFA 1TNWA 1S3PA 1SLQA 2OYHC 1LGHB 3SG7A 1SQXG 2LVVA 3L70G 1EH2A 3AEAC 3L71J 1OW4A 2K9JB 2WSSH 3RL0B 2KAYA 1N2DC 1VRKA 4L76A 2BE6A 3H1IG 2FXOA 1BGYE 2ZVNB 4IL6E 1Z4HA 1PPJE 4BY5A 1FZAA 2QE7H 1TRFA 1TIZA 3KEVA 1K9UA 3W67A 4PHMA 1R8EA 4GBAA 1KQGB 1BE3J 5AW5B 3B86A 2JT3A 2HPCB 1AA0A 2OYIB 1LT9B 2FYNB 1AQTA 2R5BA 4IFDK 1PVBA 2E6WA 1LINA 3CR5X 3AE7C 3BOWB 2LV7A 4N3YB 3B88A 3VB1A 1QL1A 4PD4D 3RL0C 4HRGA 3B5NA 1KB9E 1A03A 2KSEA 3FWLA 5GTIH 3DVEA 2WC8A 5HKZA 1S72P 3RK3B 2KNEA 1PGQA 1N8RQ 4UB6E 2N1TB 2WMMA 1DGVA 3O4YA 1CDNA 4YPCA 2OYIC 5AVTB 2M1KB 1BSNA 1SKTA 4JKTA 1LT9C 3BATA 3MUDA 4GKGA 1H0TA 3EK4A 2FYNC 1C3YA 1QVIZ 1K2HA 1KFMA 5CCHC 3Q8IA 5DJUB 5I8NA 1F70A 3O6QA 1LT1A 5AW0B 3MD0A 1BCCD 2ZAEB 2PP6A 1WLZA 4OH8B 3KPXA 3ZDMA 2D2CD 4EDFA 3H1JE 1QX7A 2XNXA 1MR8A 4KHXA 5TISH 1N73B 4AQJA 1TTXA 2WWWA 3RK3C 1JUOA 1SBJA 1BG1A 2N1TC 1IK7A 1AVYA 1IRJA 1FDOA 3H1HD 3CMAP 2WSCH 3CXHH 1MUXA 3BFHA 1U57A 4RO0A 1CFCA 5F6TA 3H32B 3S9OA 1PPJG 2IFNA 2CBLA 1M57D 1UP5A 5K89A 1K94A 3G71P 3NFQA 1OOHA 5J3XA 4XE5B 2P10A 4GAOA 1RE4C 3OGNA 2NZ0A 1RTP1 2KFHA 3OB1B 3MZWB 1NX1A 2P1JA 3CL3D 3NSIA 1N73C 3BCCD 3G3ZA 5I2LA 2EHBA 5KSZA 2BCCE 3B6XA 2FJYA 2KYFA 3LW5J 4DT0A 4EOTA 2BEQD 1DMOA 2ZFCA 1JF0A 4I7ZB 4R4MA 1JMMA 1NU1D 1QLED 2ZKMX 2BCCD 5CCGD 3Q2YA 3HUSB 4PV1B 3BUWB 1KILA 1L4AA 3L73J 4JYBA 1YQ4C 3V5BA 1OZSA 1BCCG 3O2PA 1KSMA 2R5DA 1RECA 3WU2H 3NSKA 1XO5A 2AAOA 4GGNA 2KLDA 3L70J 3BQ3A 3M9HA 2BASA 3II6A 3PFVA 3SG3A 3KF9A 1LP1A 2Y9YA 3OX6A 2L51A 1C7WA 1LWUA 3AE3C 4PALA 1FI6A 1GL2A 3H1HG 4OVNF 1CMGA 2P7JA 4K3AA 2OS8B 1VQOP 3EK8A 3H1JG 1SQBE 2POHA 2ZXXA 2CCMA 3GK4X 4I7ZC 3EVUA 5HKYA 2KK7A 3HUSC 4PV1C 1SQQK 2JEEA 1SQPK 3NHIA 2JRFA 1NKZB 3IQQA 5APQA 5B5EE 1U5IB 2QEOA 3D10A 1DJIA 2B1UA 1K8AQ 1T3UA 2Q3EA 3L72D 1NTZD 1OOJA 1MFZA 2K88A 2Q6QA 1K9PA 2MAZA 4HRHA 3BCCG 1KFXS 2LXBA 2JT0A 1SL7A 3BXKA 1IH0A 1JTHB 2OS8C 1XVJA 3BRTB 3OBVA 2QEBA 2GA1A 1NCZA 1BLQA 1URQD 1KYOI 4BRYB 3A0HE 3V2LA 3I5IB 1M31A 3CPWO 1NU1G 1NVOA 5M1BA 5K5GB 1YIJP 2BCCG 1P84E 3Q1MA 3L74J 2KLEA 3VRRA 1NSHA 3H1KE 1SQVK 1C7VA 1SS1A 2B87A 2CNPA 3HE4B 1R5LA 4PJ0E 1DJGA 2J59M 2WT7B 3KHUA 2AXCA 4P2YB 2WC6A 4H13B 1UHJA 1CMFA 2FFDC 2HG5D 2VRSA 3H6PA 2JQ6A 5FI2A 1G2CB 1T6AA 3FIAA 3I5FB 4QJ5B 2JP3A 2N9BA 1DJZA 4B86A 4ZKUA 5CMZA 3FE9A 3TDKA 2QM8A 3I5IC 2CT9A 3PATA 3O4XA 1YTZC 5B8IB 3GW6A 3CX5E 3BUOB 1JB0J 4YTPC 1M1KQ 3PN7B 3AE2C 5KAFH 4YBHB 1YUSA 1N65A 3VMAA 4MVFA 1BSHA 1PP9E 3S0FA 1KV4A 4H13C 3CWGA 4FQOA 1EZVE 1DGUA 3L72G 3D76A 1QVIY 4ZCUA 2M49B 3I5FC 3OHMB 1OVVA 1Q90D 3CXHD 3TGUE 3CWBD 1ODBA 3A4UB 1YYCA 4INXA 4PE7A 1PFIA 3GHGA 1L2OB 4JD9A 2KAVA 3UO9A 3V2NA 3PN7C 3M91A 3HD7D 1NTKE 3EG5B 1CB1A 1OVRA 4DCKA 1D1OA 4GODA 1QIVA 3KZIE 4ORBB 1X9VA 1DJXA 1YR5A 2OPOA 1KK7Z 5I94A 3G9RA 4D6TD 1J1EA 1NTKD 1A75A 3CCLP 3GOFA 4NPDA 1G33A 1FZBA 3IQOA 1OMDA 1BCCJ 1LKJA 4UPGA 3DXLA 1Q81Q 2LKMA 4L75A 1AJ4A 5AW4B 2HFED 1L2OC 1NIWA 3I5CA 1K93D 3JCUE 1QGKB 5BVZA 1YJ9P 3H1HJ 1IFJA 1FZEA 2B88A 1RH5B 2M3EA 2GV5A 2K0JA 4MZLA 3P32A 2BEZF 1JNMA 2FCEA 1SL8A 5B66H 1KZUB 3E1IA 4Q04A 4N5XA 3E1RA 4PHKA 2D2CB 1J7OA 1YVHA 3OW2O 3CZ2A 4HREE 1PP9G 2QJKB 2NPSD 3KXDA 1EZVG 3M0DA 1K9KA 3D71A 1SCMC 3VP8A 4I6MC 4DOJA 1M56D 4GGFA 4BY4A 1W2EA 1XYDA 3RK3E 3VOPA 4USLA 3GK1A 2A4JA 1IQ3A 4C0JA 3WUTA 1N7SB 3B8EB 3U59A 3G4SP 2D2CC 4D6TG 4IFFA 3GF3A 1IKUA 1NTKG 4JBZA 5KLVD 3U1CA 1DH3A 1PVAA 2JU0A 3B71A 3TDIA 3Q3DA 5G08A 2HODA 2KOGA 1SFCD 2QJKC 2YNYA 1QEXA 1M8OB 2WQYC 1UURA 1VQPP 1N7LA 1U7MA 3VYIA 1LTJC 5AANA 4KT0J 2IX7C 5DKRA 3TDZA 3VGOA 4BWNA 2V4HA 1SPYA 5APVA 3M0WA 3CCRP 2WCFA 4IL6H 1T2KC 2PSRA 3SG4A 4A7PA 2FJUB 2E75D 1ZR2A 1N7SC 2F8PA 2E43A 1PGJA 2O60A 3O8ZA 1G4YR 1XFWO 3RZSA 1OSAA 2HYNA 2LUXA 3WUUA 3HTKB 2OYHA 3L72J 1NTZJ 4ORCB 1SQBK 2R2IA 5AVZB 5CSIA 1EXRA 1XFXO 2YXRB 1FOSE 1BR4B 1KQFB 4ASVA 1K05A 1KB9H 4EI2A 1S6IA 5I2OA 5CCGC 3S0DA 4TT3H 3VMYA 1N2DA 3OAKA 3L75D 4OGQD 4UB6H 2BNXA 1UHHA 2M0BA 1WRGA 1QX8A 5KLVG 3A3YB 3RK2D 1GW4A 3B4SA 1IFDA 3FXEA 2LLSA 3QWOC 1AJYA 4C7NB 3NMDA 1DX7A 2K61A 3A7OA 1DQEA 5CBOA 3MIWA 2Q91A 2LE9B 1TCFA 2ZYGA 4LGDE 3WUVA 1B47A 4NPFX 1MHOA 2K9JA 1BDDA 1KQLA 4OWFA 2KI4B 3BUNB 2YMYA 1OMRA 1QTXA 3V2RA 5L8RJ 4XYNA 2M1UA 1MQ1A 2K7DA 1SQQE 4DIRA 1SQPE 1L0LK 1SQXD 3H25A 2HPCA 3SJSA 2OYIA 2H43A 1KYOE 1OW8A 1LT9A 2JTTA 2L5GB 2WCLA 1ZUZA 1CKKA 3BOWA 5CCHA 4WY4B 3L35A 1LTGC 5DJTB 1CFPA 1RE3C 3R1OA 2V7QH 2PASA 1NOHA 1JMBA 1RF0C 3OX5A 2KI4C 2ZYAA 4QJ3B 2WSCJ 1S6CA 1GU5A 3CWBJ 1Q86Q 5CSFA 1YBKA 3K21A 2FY8A 1YJNP 3TF5A 2K7OA 3CR2A 3RBZA 2Z4EA 1IO4A 3EVVA 2N1TA 4Z1MH 2K7CA 1IGVA 1SQVE 5HLOA 5I2QA 1NX0A 3U1AA 2L2EA 4LLHA 1DF0B 3LK1A 2J5UA 2KNCB 3IF4A 3CLQA 1OW6A 3AEDC 1NHLA 4D6TJ 4WY4C 3WXAA 3R4YA 4IL6X 3F5HA 2WVRA 3LIDA 2FYUK 1CM1A 4MEWA 3SWKA 2ZT9D 1RE4A 4PE4A 1S1EA 2PQLA 5APXA 2OTKE 4HB1A 1FZCB 1X79B 2LMUA 2L4HA 5KTBA 1N73A 4WB4A 2ZNEA 1BJFA 1NTMD 2PGDA 1DJYA 3TSIA 1OMIA 1DD4A 4GNKB 2H88C 3CS1A 1DT7B 3H32A 4GDOA 1CFDA 1KILD 1IG5A 1L4AD 2NCPA 1SQQG 3M0AA 1RFJA 1SQPG 2ERBA 4YRUA 4YXWH 1NX2A 2LR2A 3ABVC 3CCUP 3NXAA 1SW8A 1JM0A 5B5EH 1Y1XA 4MRXA 1FPWA 1FZCC 3FWNA 4TNCA 1L0NJ 2CPSA 1BGYD 2IFMA 1PPJD 3C1LA 2IZ1A 3R2PA 3SS4A 2M29A 1J7PA 1HT9A 3CYZA 3S4RA 4I2LC 2K9YA 2R3CA 3PSRA 3A0HH 5E79E 1FE6A 2FKWB 2JT8A 1FJPA 3FE8A 2WSFH 1P84H 2OTJP 1EDKA 3HUSA 2NPSB 5KLVJ 2O01N 1TNQA 2Z5HA 3TNUB 2Q5UA 4PJ0H 2M0RA 1LTIC 2WZ7A 1NCYA 1KB9D 1UIXA 1OW7A 1R5SA 5KLIB 1MFTA 3L4LA 1VQLP 2O3JA 3PM8A 2L98A 2Y1MA 3AAKA 1NTMG 4XA4A 3ITKA 2Z5IA 1ZFSA 2E76D 3CX5H 4U3FE 5CSNA 3MGNA 1DVIA 2B89A 4O9BA 2Q1KA 3CD6P 2ISDA 2FYZA 1U5IA 1WDCB 2G8YA 1TU3F 2QG4A 3EQ2A 3H1JD 1YTZT 2DW3A 5KLIC 1CNPA 1BGYG 3EFGA 3H1LE 2FFDA 1M1JB 5DICA 2W6JH 2XKMA 1NUBA 2F2OA 1B9AA 3QRXA 2WPQA 2AUCA 1JTHA 5PALA 2E5TA 4KJMA 3TK1A 4BXLA 1LJ2A 3L75J 4BRYA 2YO2A 3C8VA 2LM5A 5GTHE 1FF1A 5KJ7D 3NGVA 1IJ5A 4N78E 3KZIH 3CR4X 2HF5A 1OWAA 1VF5D 4IL1A 3HE4A 1WDCC 2WT7A 2LP3A 3AEBC 1W7IB 2BCBA 2R44A 1FW4A 1M1JC 3D74A 2FOTA 3V4WA 3LLEA 1VQ7P 3PM2A 1G2CA 1GZLA 1V1FA 4OGQB 3AE5C 2I2RE 2LLUA 2G9BA 2IPPA 1MWNA 2TN4A 1HQVA 1ZP0C 2YKOA 3VROA 3CCSP 1TN4A 3HX4A 3A8RA 3RK2B 3JCUH 1ZOYC 4GIFA 1ZMEC 1SQXJ 2ZNDA 2KBIA 4M2OA 4ZKPA 2LC5A 3Q5SA 4ZNCA 3A0BE 5AW9B 1J2JB 1CZQA 3CDNA 2K7BA 1ZLLA 2IBZE 2MKVA 3WHTB 1ALWA 5HYDA 1H89A 1PGOA 1JBAA 4U3FG 1Z2CB 2KFFA 3MTUE 1SMGA 3H1IJ 1JO5A 1UWOA 3BRVB 3CI9A 1T14A 1J7QA 1FS0E 4RKUJ 1LA0A 4MN4C 2W6BA 1VQ6P 4YXDC 1QV0A 2KZJA 3R1VA 1HGZA 3OA7A 4WQ2A 4ORAB 3BUXB 2NZ2A 1SQBD 1BT6A 4KYNA 1A02J 3VRQA 3RK2C 3USSA 4M2PA 3WHUB 1IIOA 1RY3A 5AW8B 5TNCA 3SS3A 1NX3A 2K37A 4WVZA 1J55A 5AVYB 2G3AA 3EVRA 2JNXA 3TYYA 1NP8A 3V2QA 1F71A 3GG2A 3JSVC 1FZFA 1RK9A 1RJVA 1RROA 2BCAA 1IFPA 5KAIE 1Y0VH 1F55A 5APTA 2KI6D 3FS7A 3N7HA 2E5YA 2QDIA 1HH0A 2IYPA 1QS7A 4N6JA 2ZXEB 1YHQP 3S0AA 5AVVB 3L47A 4MBEA 5AVXB 1W7JB 1SY9A 1L0LE 1P84D 3VRPA 1NTMJ 3H1KD 1KQMB 3A2AA 1NJIQ 3D73A 1NAYA 2SPZA 2ZT9B 2QSIA 3EWKA 2XZRA 3CTNA 2O01H 1QWVA 3AKBA 1MXLC 2H8PD 3V6IA 2MLFC 1IJ6A 2P58A 4W7YA 3PH0A 1F4OA 2JWDA 2N9YB 2IBZG 5FI7A 2HLOA 4YGEB 3LL8B 1J1DB 1FAVA 3R72A 1AQ5A 1BGYJ 1SQBG 5AERA 2SASA 4QMAA 1KFUS 1T3JA 1LTJA 1JFKA 3CX5D 2WCMA 4JPZB 2KIKA 3M9BA 1JUNA 1KQMC 2KZIA 2LVKA 1NCXA 3D0YA 3RBXA 1YVLA 5AXIA 2ZT9C 4P5OE 2UWJE 2ZYDA 1PP9D 3CC4P 1N7SA 5H2FE 2LUCA 2OTGB 1EZVD 5AFPA 2FYUE 3R1PA 2JJLA 3DZTA 2QVAA 4C46A 3BFBA 2MRDA 1QLSA 1J1DC 1YX8A 3QMEA 3L4AA 3TGUD 1KK8B 1Y1UA 2F2PA 1KSOA 1S9KE 1JC2A 4CIDA 3BJHA 1XK4C 2IS9A 1J7RA 1MV8A 2YKQA 4XJKB 1K73Q 2H61C 5CCGA 1DTLA 5D3OA 1IZNB 2JWAA 1CDMA 2MLEC 1UHIA 2Y0DA 3WMM0 3H1KG 1K04A 3CZ0A 1S5GY 4W7ZA 4C7RA 1NKNA 3G6EP 2FCDA 1N86A 3TDUA 2LCPA 2OTGC 2E30A 2QACA 4MSPA 1LA3A 3O6BA 4R4LA 3DF0B 5HKWA 1L0LG 3DVKA 3E3RA 4ZCVA 1SR6B 1YRUB 2KYCA 1KYOH 3CCEP 4WQ3A 1B1GA 1SL9A 1BMOA 3RLZA 3L37A 3AEGC 4PD4I 4OR9B 3HTKA 1KK8C 3H1JJ 4WBAA 1ZXGA 2WCEA 4WWIA 4F0ZB 3F45A 5AW2B 3NHTA 2E76B 2WCKA 1OVUA 3P8MC 1X0TA 2PYQA 1USDA 3L71E 1QVFO 1C3ZA 1KB9I 3C1VA 3PTZA 3RM1A 4MZJA 2B9BA 2V53A 3VN0A 4EYYQ 3CCJP 4NQGA 1SR6C 1DEKA 3H4SE 2CK3H 3BCCJ 3SG2A 1UHKA 2AEMA 2F3ZA 5CCHD 1BE3E 2V7QJ 3RL0g 2LXCB 1MF8B 3SWYA 2AXTE 1FJKA 4C7NA 4C0LA 1AVOA 1FDIA 2YMKA 3TGUG 1RF1B 3FWCA 1CI6B 2FYUG 1KFXL 1RE3A 2GUSA 4H44D 2C9NY 2ITAA 1NU1J 1KORA 2E76C 1CDLA 3GMAA 2BCCJ 1RF0A 2LVJA 1NH4A 2MJWB 3RK3D 4F7FA 2N1TD 5CPVA 3MP7B 1S1CX 1KC8Q 1WY9A 3K1EA 1TUZA 4A4CA 2LMVA 1ZRTE 2KI7B 1GGZA 2I94A 2C0XA 1BR1B 2W83C 1CLLA 2JWWA 4DJGA 1HJBA 2RGIA 2RKLA 1RF1C 5AVUB 2Q9IA 1H8AA 4WY4A 4GPLB 1YUTA 3SG5A 4PE0A 1PALA 1YX7A 3HRNA 4I1LA 4MLWA 5KJ7C 1SRAA 2M5AB 1IK9A 1S2EA 2CPBA 1JY3P 1S4XA 1DJWA 1NAFA 2O1JA 2ZJSE 5AW7B 1TNPA 2KBMA 2OGUA 2WSEH 2BE4A 1ZOTB 2KHNA 2NLNA 1GTWA 1W5CE 1XFZO 2F33A 1HWTC 1AJ5A 5JOLA 5AVWB 1L2PA 3DVJA 5E79H 3PP5A 1KFUL 1QL2A 4ASWA 1DF0A 2H2KA 1GQMA 3GLMA 2KP8A 4I5JA 1QASA 5CSJA 1W2BO 1FOSF 1S26D 3KO0A 1BE3G 1MZ9A 5AW3B 4HJGH 1EG4A 5KKZB 3CCMP 1FZCA 3DYEA 1EC5A 1NO4A 4CFRA 1AVSA 1NTZK 4DS7A 1VQ4P 1S6JA 4AUWA 1FU1A 2WSFJ 3PJSK 4W80A 3VRNA 3B5ND 2M8RA 3H1KJ 5FI6A 1URQB 5EFWB 2K1AA 3EFFK 5DKNA 1JEKA 1Q82Q 1OX3A 2WPRA 1F4QA 3V4QA 4NDCA 3AKAA 3D6ZA 1K9MQ 5AVQB 1CM4A 2A45H 1LTBC 2DOQA 3SG6A 1ZMZA 2BCXA 3D78A 2O5GA 3S0EA 3L73E 5KKZC 2I1JA 2E42A 1D7MA 3KPEA 1IC2A 4H0LD 4HYTB 3HE5B 1CLBA 2ZN8A 3FXDA 1M45A 3TS5B 3L70E 1SQQD 4CPGA 3L73D 4FTGA 4L73A 1SQPD 2JDIH 1H88A 1DEBA 1YURA 1URQC 2KI6C 3JTDB 3FGAD 2KPHA 5GTHH 1KYOD 2MJZA 1VQ8P 3SFEC 1PP9J 2XNDH 4HH2A 4MZKA 1GD2E 3BFAA 3IN6A 3T97B 1OFCX 3B87A 2FXMA 5CJ4A 2JPTA 3TUYB 3TNUA 2LP2A 1P84I 3L36A 3VMXA 2M7LA 2MA2A 3CZ1A 3CLNA 1Y9BA 3TGUJ 1AV1A 1WRKA 1SP4A 1Q80A 2D8NA 2PRUA 3TS5C 4U7JA 2YO3A 3JVTB 2KS1B 1NTKJ 2P6BB 3JTDC 1JCCA 1SQVD 2Y4QA 2QJYB 5CJ0A 1DC1A 2JOJA 1YQ3C 3GF7A 1ALVA 5AVSB 3HD7B 1UUSA 1MUUA 3TUYC 3A0BH 3CX5I 4LC1A 2Y5IA 3L74E 4GFTA 1TOPA 3CABA 3SIBA 2JXLA 1QATA 1IWQA 3CGAA 4K35A 1RQUA 1EDIA 1DJHA 2K60A 1H4BA 1M1JA 1YJWP 3CXHI 1EZVI 5GQQC 4GOEA 3JVTC 2HQ8A 2Y0CA 1Q7YQ 3PHLA 3L73G 1XTCC 2QJYC 5BU8B 4C0KA 4UB8E 4DUQA 1JFJA 2BKIB 3HD7C 1B7TY 1HJ0A 3LK0A 1VQ5P 4DRWA 1GL2D 1XFVO 2KLVA 1IJDB 3GK2A 2OYOA 1FZGA 4HKZH 1X8YA 1NPQA 4JQ0D 5KAIH 1QIWA 4PT1A 1S5LE 1TWOA 4L9MA 1ORGA 3LCPC 4PE1A 4AQIA 1BOCA 3AE6C 3SWFA 2H7HA 1LVCD 1B4CA 1PV3A 4PD4E 2LLTA 1B8CA 1SSEB 1JSAA 1IFIA 4E68A 3KQGA 1SQVG 5AEQA 1KCYA 3SFDC 2O1KA 1EQ7A 1OXZA 2GGZA 1L0NK 4RJTA 1VL2A 1JY3N 5HLVA 4N1FA 5FYXA 5HL1A 3B7AA 1PULA 1E79H 2JXCA 1UIIA 1L7ZA 3I5GB 4H44B 1TUJA 2QEHA 2KSPA 1DELA 2WCBA 4PDZA 3NTNA 1Q2NA 2J58A 2YIUB 3AAJA 2I8DA 3LIEA 2LMTA 2L5XB 1SFCB 2NRGA 3L74G 1PIXA 2NXQA 2NPSC 5KLVK 1OOFA 2QA4P 5APYA 1BCCE 1EJ3A 2BBMA 1T8ZA 2Y1NA 4WRIA 1KD1Q 2K2AA 4U3FD 1JY3O 5KU1A 4U8DA 3DVMA 5ER4X 1GDTA 2PMYA 2QJPB 2VRGA 2O01J 1LNQA 1NYAA 2KAXA 3NXSA 1S5GZ 3H1HE 3I5GC 4H44C 2E75B 3OP0A 1VQMP 1MXEA 2I1KA 5H2FH 2GUVA 2L50A 1CSBA 3H1LD 2YIUC 1SFCC 2E74D 4TLFA 1TNXA 4INWA 3M9QA 2P71A 1SK6D 3C9IA 1M63B 3S0BA 1A2XA 3NSLA 2QJPC 1T2KD 3BCCE 1XFYO 1EDJA 4N78D 1N7SD 4N1GA 2E75C 2M8UA 1A4PA 3BVHA 3PLFB 3VP9A 1EG3A 1WT6A 1AP4A 5CHXA 2SCPA 1JY2N 1JWDA 1QVGO 2RMZA 1NU1E 1GK4A 2BBNA 1USEA 3F89A 3EK7A 2L5YA 2QIWA 2WOSA 1G1JA 1J1DA 2L4IA 1YRTB 4YGCB 3B5NB 3D75A 2BAPA 3UNWA 1DEEG 3QH9A 3I5HB 1X22A 1SQQJ 1XK4A 1SQPJ 2L2CA 4AQRD 3ICBA 4EIJA 2H61A 2A45G 1JY2O 2IBZD 1R6PA 4OGQC 3D77A 1K90D 1H0TB 2FXPA 3H1LG 1HBWA 1AK8A 3AECC 2P67A 4H0LB 1SQXK 1GK6A 2AXTH 2R32A 3O6QB 5CBNA 5D69A 1PK0D 3S0GA 1H8BA 3B5NC 3L4FA 3I5HC 1XTGB 2M97A 4I5LB 3UIAA 1G1IA 3L72E 1NTZE 1FBVA 2JC2A 3MSEB 4XJKA 1Y1AA 1C07A 3AE8C 3IVTA 1SQVJ 1RQVA 2KSJA 2K8MB 4YGBB 1SNLA 3FX0A 2LNKA 2CXJA 1PRWA 4ICBA 1CFFA 3MUDC 1GJYA 3DF0A 2FFDB 3RGUA 2YKPA 1W9ZA 4AOMA 5APSA 4H0LC 2KQ6A 4AYCA 2M3BA 2QEXP 2M7NA 2AMIA 1OZOA 2KQYA 1OE9B 1M46A 1LS8A 3I55P 1BU3A 1L0LD 1QX5B 4GT1A 3IFMA 5GTIE 1M7LA 2JO1A 1WRZA 2YXQB 3A5TA 3P7KA 1BDCA 3D6YA 1XFRA 1E5WA 3K5BA 5IBWA 4A4BA 3CCQP 2KDHA 4WY4D 2Q3IA 2QEVA 1KILB 1M90Q 1YTZI 3E7KA 1VQ9P 1L4AB 1NTMK 2LHIA 3CC7P 1YITP 2LANA 1KMIZ 1RF1A 3EKHA 4GOFA 2JKVA 1CI6A 1KWOB 1HF9A 1U7JA 1LTTC 1VDFA 2KLUA 5AW1B 1EDLA 1SCVA 2WSEJ 5KJ7A 5TISE 4Y28J 1LP1B 2H89C 1LWUB 2JR8A 1GL2B 2NCOA 2QPTA 3NSOA 4YI9A 3CXHE 3CWBE 1NTZG 2OTLP 1FBMA 2C0WA 1IFMA 1YI2P 2FYUD 2OARA 4CLNA 4MRYA 4YI8A 4DZOA 3LW5H 1GM0A 1KILC 2AEJA 1KFNA 1L4AC 3PRJA 3OB2B 1LTSC 3IR9A 2WC5A 1QV1A 3JC22 1ZV8A 4QJ4B 2Y9ZA 1G8IA 1KWOC 1S9KD 1NYHA 4D6TE 3AEEC 1Y8AA 1PL5A 1JCDA 3N4XA 1EXIA 2XDJA 2KB7P 2M5AA 1ZW0A 1XA5A 1JOCA 1LWUC 2W27A 4RESB 1GL2C 2W8ZA 1NWDA 1WMKA 3V2PA 2LHLA 4U3FJ 4HSZA 2L0PA 1AUIB 2LAPA 2PAJA 2W6AA 4ETOA 1V1GA 2MBXA 4Y99B 3RL0D 2FBWC 1SVFA 3S1KA 1UHNA 1ZN5A 2L91A 3MHVA 1F8HA 2JULA 2B87B 1SCMB 3Q5RA 3H1LJ
chains in the Genus database with same CATH topology
1ZMZA 2BCXA 2M0RA 1U5IB 1RWYA 3D10A 1DJIA 1EL4A 4GUKA 2B1UA 2HQWA 3DD4A 2O5GA 1NCYA 2ZN9A 1A29A 1PSRA 1OOJA 1PSBA 1K9PA 2MAZA 4HRHA 1KFXS 2EC6B 2JT0A 1SL7A 3BXKA 1IH0A 1CLBA 2ZN8A 1M45A 3PM8A 2OS8C 1XVJA 3TS5B 1R2UA 2L98A 1NCZA 2Y1MA 3AAKA 4FTGA 1BLQA 1YURA 2KI6C 3I5IB 3JTDB 1M31A 1ZFSA 1JF2A 1KQVA 4NDBA 5CSNA 1DVIA 4MZKA 3VRRA 1NSHA 2PALA 1OFCX 1B7TZ 1C7VA 2ISDA 1CTRA 2CNPA 2JPTA 1IQ5A 1ZACA 3TUYB 2LP2A 3FWBA 1DJGA 1U5IA 2M7LA 1WDCB 4P2YB 2MA2A 1XFUO 2G2BA 1UHJA 1CMFA 2LVIA 3CLNA 2BKHB 3D0YB 1CNPA 1WRKA 2EC6C 4YGDB 2JQ6A 1NUBA 2F2OA 1B9AA 1Q80A 1Y6WA 2D8NA 2PRUA 3TS5C 3QRXA 3SIAA 3FIAA 2AUCA 3I5FB 4QJ5B 4PHJA 5PALA 1DJZA 3JVTB 1B8LA 2P6BB 4R1EA 4CPVA 3I5IC 2CT9A 3JTDC 3PATA 2LM5A 2Y4QA 1YTZC 5B8IB 1FF1A 3BUOB 2JOJA 3PN7B 1IJ5A 4OKHA 4MN0A 1ALVA 1WRLA 4YBHB 1YUSA 1N65A 1UUSA 3CR4X 3TUYC 2GGMA 4MVFA 2BL0B 1K95A 2HF5A 1S36A 4IL1A 1WDCC 2Y5IA 5D7FA 3ZWHA 2LP3A 3CWGA 2F3YA 4FQOA 4GFTA 1A75B 1W7IB 2MHHA 1DGUA 1TOPA 2BCBA 3SIBA 2JXLA 1FW4A 1QATA 1AHRA 1IWQA 3CGAA 2FOTA 3LLEA 4PHNA 1DJHA 1QVIY 2ZRTA 4ZCUA 1H4BA 4M2QA 2M49B 3I5FC 5GQQC 3HCMA 3OHMB 1V1FA 3JVTC 2HQ8A 2I2RE 2G9BA 2LLUA 1MWNA 2TN4A 1HQVA 1K8UA 1QX2A 1ODBA 3A4UB 3VROA 1TN4A 3HX4A 4PE7A 3A8RA 1BODA 4CFQA 1L2OB 2KAVA 4C0KA 4OV2A 3PN7C 4DUQA 1BF5A 2BKIB 1JFJA 3PALA 1CB1A 1B7TY 2ZNDA 3LK0A 2KBIA 4M2OA 4DCKA 3BYAA 1QIVA 2BL0C 4DRWA 1D1OA 2LC5A 4ORBB 1XFVO 1DJXA 1B8RA 1TCOB 2K7BA 3GK2A 1YR5A 2OPOA 3WHTB 1ALWA 1KK7Z 5HYDA 1WLMA 1JBAA 2KOTA 1NPQA 4JQ0D 1QIWA 2KFFA 1SMGA 1J1EA 3CZTX 1A75A 4JWQA 1UWOA 4L9MA 3GOFA 4I5NB 3LCPC 2KFGA 3ZNIA 1G33A 1J7QA 3IQOA 5JJGA 1LA0A 4PE1A 4AQIA 1BOCA 1OMDA 2HPSA 1LKJA 4UPGA 1QV0A 1LVCD 2PVBA 1OMVA 4ORAB 4WQ2A 1B4CA 1AJ4A 3BUXB 2LLTA 1B8CA 1JSAA 1BT6A 3VRQA 4E68A 1L2OC 3BUMB 4M2PA 5AEQA 1NIWA 3WHUB 1KCYA 1K93D 5TNCA 2JNFA 2GGZA 1F54A 1NX3A 3O78A 4D1EA 1N0YA 1J55A 2GV5A 2I18A 2K0JA 4MZLA 2WORA 3EVRA 2JNXA 2KGBC 1LXFC 1NP8A 5HLVA 3TZ1A 1F71A 4N1FA 2FCEA 1SL8A 5FYXA 4Q04A 1PULA 4N5XA 2JXCA 1RK9A 1QJTA 1RJVA 1L7ZA 1M39A 1RROA 2BCAA 3I5GB 4PHKA 2JTZA 1J7OA 2JZIA 4NDDA 1Y0VH 1F55A 2KI6D 1YVHA 2KSPA 2WCBA 1E8AA 3FS7A 4PDZA 4HREE 3AAJA 2LMTA 2L5XB 2M3WA 2NXQA 1QS7A 1K9KA 2KGRA 1SCMC 1EJ3A 2BBMA 2Y1NA 4WRIA 4MBEA 4GGFC 2K2AA 1W7JB 5KU1A 4YGAA 1SY9A 4GGFA 4U8DA 3DVMA 4BY4A 2ZFDA 5ER4X 4PCWA 1XYDA 2PMYA 5KTYA 2VRGA 3VRPA 4USLA 1KQMB 1NYAA 2A4JA 3GK1A 2KAXA 1CDPA 1IQ3A 4C0JA 1S5GZ 1KK7Y 3I5GC 2Q4UA 3OP0A 3CTNA 1MXEA 3AKBA 1MXLC 2COLB 1IKUA 2MLFC 2I7AA 1PVAA 1IJ6A 2L50A 2JU0A 2WNDA 1YUUA 1QLKA 3TDIA 2CTNA 5G08A 4OCIA 1F4OA 1UURA 4YGEB 1QXPA 1TNXA 3LL8B 1K96A 3WNXB 1CLMA 5AERA 2SASA 1KFUS 5AANA 1X02A 1OQPA 1SK6D 1JFKA 2HETA 5DKRA 1M63B 3TDZA 3VGOA 1SPYA 1A2XA 3NSLA 3M0WA 4JPZB 1FI5A 2WCFA 3KHEA 1GGWA 1KQMC 1XFYO 2PSRA 2LVKA 5DKQA 1NCXA 3D0YA 3SG4A 1YVLA 2FJUB 5AXIA 5ER5A 5BPJA 4N1GA 2F8PA 4P5OE 2M8UA 2M9GA 1A4PA 2O60A 1G4YR 1XFWO 3PLFB 1OSAA 1EG3A 1AP4A 2LUCA 2OTGB 3IF7A 2SCPA 4I5KA 5AFPA 1JWDA 3EKJA 1SYMA 2ZRSA 2K2FA 2EGDA 2BBNA 2BECA 2LUXA 1TNWA 3EK7A 1S3PA 2MRDA 1QLSA 3SG7A 1YX8A 2WOSA 2LVVA 4ORCB 1EH2A 1J1DA 2R2IA 1KK8B 5CSIA 1EXRA 1Y1UA 1KSOA 1XFXO 2F2PA 2L4IA 1JC2A 1BR4B 1YRTB 4YGCB 2KAYA 4CIDA 1XK4C 3I5HB 1S6IA 1VRKA 2IS9A 5I2OA 1J7RA 2BE6A 4XJKB 1XK4A 1N2DA 2H61C 1DTLA 1CDMA 2MLEC 1UHIA 3ICBA 2H61A 4BY5A 1S5GY 1TRFA 1TIZA 3KEVA 1K9UA 4PHMA 1R6PA 4GBAA 1UHHA 2FCDA 3TDUA 2LCPA 2OTGC 2E30A 2QACA 1K90D 1LA3A 3O6BA 4MSPA 3DF0B 2JT3A 5HKWA 3DVKA 3E3RA 4ZCVA 1SR6B 1YRUB 2KYCA 4WQ3A 1B1GA 1AK8A 2LLSA 1SL9A 1BMOA 1PVBA 3RLZA 2E6WA 1LINA 3CR5X 3BOWB 4OR9B 2LV7A 1KK8C 2K61A 5D69A 2Q91A 2LE9B 4HRGA 1PK0D 1H8BA 1TCFA 2WCEA 1B47A 4F0ZB 3I5HC 1MHOA 2M97A 4I5LB 3F45A 2KI4B 3BUNB 1A03A 1FBVA 2JC2A 3MSEB 4XJKA 1Y1AA 1C07A 1OMRA 1QTXA 3DVEA 4XYNA 2M1UA 2K8MB 2WC8A 4YGBB 3C1VA 1MQ1A 5HKZA 2KNEA 3RM1A 2K7DA 1DGVA 3O4YA 1CDNA 4DIRA 4MZJA 1SNLA 2V53A 2LNKA 2CXJA 1PRWA 4ICBA 4NQGA 1CFFA 1GJYA 3DF0A 1SR6C 2M1KB 1SKTA 3SJSA 3H4SE 4AOMA 3EK4A 3SG2A 1QVIZ 1UHKA 2F3ZA 2KQ6A 2JTTA 1K2HA 1MF8B 5I8NA 1ZUZA 1CKKA 3BOWA 1F70A 2M7NA 4C0LA 2AMIA 1OZOA 1CFPA 2KQYA 1OE9B 3FWCA 2PASA 1KFXL 1M46A 1WLZA 3KPXA 3OX5A 2KI4C 1CDLA 4QJ3B 1QX7A 2LVJA 1BU3A 1S6CA 1MR8A 2MJWB 1QX5B 5CSFA 4AQJA 3K21A 5CPVA 1TTXA 1JUOA 1SBJA 2K7OA 1BG1A 1IRJA 3CR2A 1WRZA 1WY9A 3EVVA 1MUXA 2K7CA 1CFCA 1IGVA 2LMVA 4A4CA 5HLOA 1GGZA 1NX0A 2I94A 5F6TA 5I2QA 1BR1B 4A4BA 2L2EA 5IBWA 2CBLA 1CLLA 1UP5A 2JWWA 1DF0B 3LK1A 2KDHA 5K89A 1K94A 2RGIA 3WXAA 2LHIA 2LANA 5J3XA 4GPLB 4GAOA 3EKHA 1CM1A 1YUTA 4MEWA 4PE0A 3SG5A 1PALA 1YX7A 2NZ0A 1KWOB 1RTP1 4PE4A 1S1EA 2KFHA 3OB1B 4MLWA 1NX1A 1SCVA 1SRAA 3NSIA 2LMUA 5I2LA 2L4HA 1DJWA 1TNPA 2EHBA 5KSZA 2KBMA 2NCOA 2QPTA 2BE4A 3NSOA 4YI9A 2ZNEA 1ZOTB 2KHNA 2NLNA 2KYFA 1BJFA 1XFZO 2F33A 1DJYA 1DMOA 1AJ5A 5JOLA 1JF0A 3DVJA 4GNKB 3CS1A 4CLNA 1KFUL 4MRYA 1DT7B 1CFDA 4YI8A 1IG5A 2NCPA 1DF0A 2H2KA 1GQMA 2ZKMX 3OB2B 3BUWB 1QV1A 1QASA 4I5JA 1RFJA 5CSJA 4YRUA 1NX2A 4QJ4B 2Y9ZA 1G8IA 1KWOC 1SW8A 3NXAA 1OZSA 1Y1XA 1S26D 3O2PA 1KSMA 3KO0A 4MRXA 1RECA 1FPWA 3NSKA 1XO5A 2AAOA 4GGNA 1EG4A 4TNCA 3BQ3A 1XA5A 3PFVA 3SG3A 3KF9A 2Y9YA 1NWDA 3OX6A 2L51A 1C7WA 2M29A 4PALA 1AVSA 4CFRA 1FI6A 4OVNF 1CMGA 2LHLA 4DS7A 1J7PA 4HSZA 2L0PA 1AUIB 2LAPA 1S6JA 1HT9A 2OS8B 3EK8A 4ETOA 1V1GA 2CCMA 3GK4X 3PSRA 2MBXA 3EVUA 3VRNA 5HKYA 1UHNA 2JT8A 5DKNA 1F8HA 1F4QA 2JRFA 4NDCA 2JULA 3AKAA 1CM4A 1TNQA 1SCMB 2DOQA 3SG6A 3IQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZMZ A;  2BCX A;  2M0R A;  1U5I B;  1RWY A;  3D10 A;  1DJI A;  1EL4 A;  4GUK A;  2B1U A;  2HQW A;  3DD4 A;  2O5G A;  1NCY A;  2ZN9 A;  1A29 A;  1PSR A;  1OOJ A;  1PSB A;  1K9P A;  2MAZ A;  4HRH A;  1KFX S;  2EC6 B;  2JT0 A;  1SL7 A;  3BXK A;  1IH0 A;  1CLB A;  2ZN8 A;  1M45 A;  3PM8 A;  2OS8 C;  1XVJ A;  3TS5 B;  1R2U A;  2L98 A;  1NCZ A;  2Y1M A;  3AAK A;  4FTG A;  1BLQ A;  1YUR A;  2KI6 C;  3I5I B;  3JTD B;  1M31 A;  1ZFS A;  1JF2 A;  1KQV A;  4NDB A;  5CSN A;  1DVI A;  4MZK A;  3VRR A;  1NSH A;  2PAL A;  1OFC X;  1B7T Z;  1C7V A;  2ISD A;  1CTR A;  2CNP A;  2JPT A;  1IQ5 A;  1ZAC A;  3TUY B;  2LP2 A;  3FWB A;  1DJG A;  1U5I A;  2M7L A;  1WDC B;  4P2Y B;  2MA2 A;  1XFU O;  2G2B A;  1UHJ A;  1CMF A;  2LVI A;  3CLN A;  2BKH B;  3D0Y B;  1CNP A;  1WRK A;  2EC6 C;  4YGD B;  2JQ6 A;  1NUB A;  2F2O A;  1B9A A;  1Q80 A;  1Y6W A;  2D8N A;  2PRU A;  3TS5 C;  3QRX A;  3SIA A;  3FIA A;  2AUC A;  3I5F B;  4QJ5 B;  4PHJ A;  5PAL A;  1DJZ A;  3JVT B;  1B8L A;  2P6B B;  4R1E A;  4CPV A;  3I5I C;  2CT9 A;  3JTD C;  3PAT A;  2LM5 A;  2Y4Q A;  1YTZ C;  5B8I B;  1FF1 A;  3BUO B;  2JOJ A;  3PN7 B;  1IJ5 A;  4OKH A;  4MN0 A;  1ALV A;  1WRL A;  4YBH B;  1YUS A;  1N65 A;  1UUS A;  3CR4 X;  3TUY C;  2GGM A;  4MVF A;  2BL0 B;  1K95 A;  2HF5 A;  1S36 A;  4IL1 A;  1WDC C;  2Y5I A;  5D7F A;  3ZWH A;  2LP3 A;  3CWG A;  2F3Y A;  4FQO A;  4GFT A;  1A75 B;  1W7I B;  2MHH A;  1DGU A;  1TOP A;  2BCB A;  3SIB A;  2JXL A;  1FW4 A;  1QAT A;  1AHR A;  1IWQ A;  3CGA A;  2FOT A;  3LLE A;  4PHN A;  1DJH A;  1QVI Y;  2ZRT A;  4ZCU A;  1H4B A;  4M2Q A;  2M49 B;  3I5F C;  5GQQ C;  3HCM A;  3OHM B;  1V1F A;  3JVT C;  2HQ8 A;  2I2R E;  2G9B A;  2LLU A;  1MWN A;  2TN4 A;  1HQV A;  1K8U A;  1QX2 A;  1ODB A;  3A4U B;  3VRO A;  1TN4 A;  3HX4 A;  4PE7 A;  3A8R A;  1BOD A;  4CFQ A;  1L2O B;  2KAV A;  4C0K A;  4OV2 A;  3PN7 C;  4DUQ A;  1BF5 A;  2BKI B;  1JFJ A;  3PAL A;  1CB1 A;  1B7T Y;  2ZND A;  3LK0 A;  2KBI A;  4M2O A;  4DCK A;  3BYA A;  1QIV A;  2BL0 C;  4DRW A;  1D1O A;  2LC5 A;  4ORB B;  1XFV O;  1DJX A;  1B8R A;  1TCO B;  2K7B A;  3GK2 A;  1YR5 A;  2OPO A;  3WHT B;  1ALW A;  1KK7 Z;  5HYD A;  1WLM A;  1JBA A;  2KOT A;  1NPQ A;  4JQ0 D;  1QIW A;  2KFF A;  1SMG A;  1J1E A;  3CZT X;  1A75 A;  4JWQ A;  1UWO A;  4L9M A;  3GOF A;  4I5N B;  3LCP C;  2KFG A;  3ZNI A;  1G33 A;  1J7Q A;  3IQO A;  5JJG A;  1LA0 A;  4PE1 A;  4AQI A;  1BOC A;  1OMD A;  2HPS A;  1LKJ A;  4UPG A;  1QV0 A;  1LVC D;  2PVB A;  1OMV A;  4ORA B;  4WQ2 A;  1B4C A;  1AJ4 A;  3BUX B;  2LLT A;  1B8C A;  1JSA A;  1BT6 A;  3VRQ A;  4E68 A;  1L2O C;  3BUM B;  4M2P A;  5AEQ A;  1NIW A;  3WHU B;  1KCY A;  1K93 D;  5TNC A;  2JNF A;  2GGZ A;  1F54 A;  1NX3 A;  3O78 A;  4D1E A;  1N0Y A;  1J55 A;  2GV5 A;  2I18 A;  2K0J A;  4MZL A;  2WOR A;  3EVR A;  2JNX A;  2KGB C;  1LXF C;  1NP8 A;  5HLV A;  3TZ1 A;  1F71 A;  4N1F A;  2FCE A;  1SL8 A;  5FYX A;  4Q04 A;  1PUL A;  4N5X A;  2JXC A;  1RK9 A;  1QJT A;  1RJV A;  1L7Z A;  1M39 A;  1RRO A;  2BCA A;  3I5G B;  4PHK A;  2JTZ A;  1J7O A;  2JZI A;  4NDD A;  1Y0V H;  1F55 A;  2KI6 D;  1YVH A;  2KSP A;  2WCB A;  1E8A A;  3FS7 A;  4PDZ A;  4HRE E;  3AAJ A;  2LMT A;  2L5X B;  2M3W A;  2NXQ A;  1QS7 A;  1K9K A;  2KGR A;  1SCM C;  1EJ3 A;  2BBM A;  2Y1N A;  4WRI A;  4MBE A;  4GGF C;  2K2A A;  1W7J B;  5KU1 A;  4YGA A;  1SY9 A;  4GGF A;  4U8D A;  3DVM A;  4BY4 A;  2ZFD A;  5ER4 X;  4PCW A;  1XYD A;  2PMY A;  5KTY A;  2VRG A;  3VRP A;  4USL A;  1KQM B;  1NYA A;  2A4J A;  3GK1 A;  2KAX A;  1CDP A;  1IQ3 A;  4C0J A;  1S5G Z;  1KK7 Y;  3I5G C;  2Q4U A;  3OP0 A;  3CTN A;  1MXE A;  3AKB A;  1MXL C;  2COL B;  1IKU A;  2MLF C;  2I7A A;  1PVA A;  1IJ6 A;  2L50 A;  2JU0 A;  2WND A;  1YUU A;  1QLK A;  3TDI A;  2CTN A;  5G08 A;  4OCI A;  1F4O A;  1UUR A;  4YGE B;  1QXP A;  1TNX A;  3LL8 B;  1K96 A;  3WNX B;  1CLM A;  5AER A;  2SAS A;  1KFU S;  5AAN A;  1X02 A;  1OQP A;  1SK6 D;  1JFK A;  2HET A;  5DKR A;  1M63 B;  3TDZ A;  3VGO A;  1SPY A;  1A2X A;  3NSL A;  3M0W A;  4JPZ B;  1FI5 A;  2WCF A;  3KHE A;  1GGW A;  1KQM C;  1XFY O;  2PSR A;  2LVK A;  5DKQ A;  1NCX A;  3D0Y A;  3SG4 A;  1YVL A;  2FJU B;  5AXI A;  5ER5 A;  5BPJ A;  4N1G A;  2F8P A;  4P5O E;  2M8U A;  2M9G A;  1A4P A;  2O60 A;  1G4Y R;  1XFW O;  3PLF B;  1OSA A;  1EG3 A;  1AP4 A;  2LUC A;  2OTG B;  3IF7 A;  2SCP A;  4I5K A;  5AFP A;  1JWD A;  3EKJ A;  1SYM A;  2ZRS A;  2K2F A;  2EGD A;  2BBN A;  2BEC A;  2LUX A;  1TNW A;  3EK7 A;  1S3P A;  2MRD A;  1QLS A;  3SG7 A;  1YX8 A;  2WOS A;  2LVV A;  4ORC B;  1EH2 A;  1J1D A;  2R2I A;  1KK8 B;  5CSI A;  1EXR A;  1Y1U A;  1KSO A;  1XFX O;  2F2P A;  2L4I A;  1JC2 A;  1BR4 B;  1YRT B;  4YGC B;  2KAY A;  4CID A;  1XK4 C;  3I5H B;  1S6I A;  1VRK A;  2IS9 A;  5I2O A;  1J7R A;  2BE6 A;  4XJK B;  1XK4 A;  1N2D A;  2H61 C;  1DTL A;  1CDM A;  2MLE C;  1UHI A;  3ICB A;  2H61 A;  4BY5 A;  1S5G Y;  1TRF A;  1TIZ A;  3KEV A;  1K9U A;  4PHM A;  1R6P A;  4GBA A;  1UHH A;  2FCD A;  3TDU A;  2LCP A;  2OTG C;  2E30 A;  2QAC A;  1K90 D;  1LA3 A;  3O6B A;  4MSP A;  3DF0 B;  2JT3 A;  5HKW A;  3DVK A;  3E3R A;  4ZCV A;  1SR6 B;  1YRU B;  2KYC A;  4WQ3 A;  1B1G A;  1AK8 A;  2LLS A;  1SL9 A;  1BMO A;  1PVB A;  3RLZ A;  2E6W A;  1LIN A;  3CR5 X;  3BOW B;  4OR9 B;  2LV7 A;  1KK8 C;  2K61 A;  5D69 A;  2Q91 A;  2LE9 B;  4HRG A;  1PK0 D;  1H8B A;  1TCF A;  2WCE A;  1B47 A;  4F0Z B;  3I5H C;  1MHO A;  2M97 A;  4I5L B;  3F45 A;  2KI4 B;  3BUN B;  1A03 A;  1FBV A;  2JC2 A;  3MSE B;  4XJK A;  1Y1A A;  1C07 A;  1OMR A;  1QTX A;  3DVE A;  4XYN A;  2M1U A;  2K8M B;  2WC8 A;  4YGB B;  3C1V A;  1MQ1 A;  5HKZ A;  2KNE A;  3RM1 A;  2K7D A;  1DGV A;  3O4Y A;  1CDN A;  4DIR A;  4MZJ A;  1SNL A;  2V53 A;  2LNK A;  2CXJ A;  1PRW A;  4ICB A;  4NQG A;  1CFF A;  1GJY A;  3DF0 A;  1SR6 C;  2M1K B;  1SKT A;  3SJS A;  3H4S E;  4AOM A;  3EK4 A;  3SG2 A;  1QVI Z;  1UHK A;  2F3Z A;  2KQ6 A;  2JTT A;  1K2H A;  1MF8 B;  5I8N A;  1ZUZ A;  1CKK A;  3BOW A;  1F70 A;  2M7N A;  4C0L A;  2AMI A;  1OZO A;  1CFP A;  2KQY A;  1OE9 B;  3FWC A;  2PAS A;  1KFX L;  1M46 A;  1WLZ A;  3KPX A;  3OX5 A;  2KI4 C;  1CDL A;  4QJ3 B;  1QX7 A;  2LVJ A;  1BU3 A;  1S6C A;  1MR8 A;  2MJW B;  1QX5 B;  5CSF A;  4AQJ A;  3K21 A;  5CPV A;  1TTX A;  1JUO A;  1SBJ A;  2K7O A;  1BG1 A;  1IRJ A;  3CR2 A;  1WRZ A;  1WY9 A;  3EVV A;  1MUX A;  2K7C A;  1CFC A;  1IGV A;  2LMV A;  4A4C A;  5HLO A;  1GGZ A;  1NX0 A;  2I94 A;  5F6T A;  5I2Q A;  1BR1 B;  4A4B A;  2L2E A;  5IBW A;  2CBL A;  1CLL A;  1UP5 A;  2JWW A;  1DF0 B;  3LK1 A;  2KDH A;  5K89 A;  1K94 A;  2RGI A;  3WXA A;  2LHI A;  2LAN A;  5J3X A;  4GPL B;  4GAO A;  3EKH A;  1CM1 A;  1YUT A;  4MEW A;  4PE0 A;  3SG5 A;  1PAL A;  1YX7 A;  2NZ0 A;  1KWO B;  1RTP 1;  4PE4 A;  1S1E A;  2KFH A;  3OB1 B;  4MLW A;  1NX1 A;  1SCV A;  1SRA A;  3NSI A;  2LMU A;  5I2L A;  2L4H A;  1DJW A;  1TNP A;  2EHB A;  5KSZ A;  2KBM A;  2NCO A;  2QPT A;  2BE4 A;  3NSO A;  4YI9 A;  2ZNE A;  1ZOT B;  2KHN A;  2NLN A;  2KYF A;  1BJF A;  1XFZ O;  2F33 A;  1DJY A;  1DMO A;  1AJ5 A;  5JOL A;  1JF0 A;  3DVJ A;  4GNK B;  3CS1 A;  4CLN A;  1KFU L;  4MRY A;  1DT7 B;  1CFD A;  4YI8 A;  1IG5 A;  2NCP A;  1DF0 A;  2H2K A;  1GQM A;  2ZKM X;  3OB2 B;  3BUW B;  1QV1 A;  1QAS A;  4I5J A;  1RFJ A;  5CSJ A;  4YRU A;  1NX2 A;  4QJ4 B;  2Y9Z A;  1G8I A;  1KWO C;  1SW8 A;  3NXA A;  1OZS A;  1Y1X A;  1S26 D;  3O2P A;  1KSM A;  3KO0 A;  4MRX A;  1REC A;  1FPW A;  3NSK A;  1XO5 A;  2AAO A;  4GGN A;  1EG4 A;  4TNC A;  3BQ3 A;  1XA5 A;  3PFV A;  3SG3 A;  3KF9 A;  2Y9Y A;  1NWD A;  3OX6 A;  2L51 A;  1C7W A;  2M29 A;  4PAL A;  1AVS A;  4CFR A;  1FI6 A;  4OVN F;  1CMG A;  2LHL A;  4DS7 A;  1J7P A;  4HSZ A;  2L0P A;  1AUI B;  2LAP A;  1S6J A;  1HT9 A;  2OS8 B;  3EK8 A;  4ETO A;  1V1G A;  2CCM A;  3GK4 X;  3PSR A;  2MBX A;  3EVU A;  3VRN A;  5HKY A;  1UHN A;  2JT8 A;  5DKN A;  1F8H A;  1F4Q A;  2JRF A;  4NDC A;  2JUL A;  3AKA A;  1CM4 A;  1TNQ A;  1SCM B;  2DOQ A;  3SG6 A;  3IQQ A; 
#chains in the Genus database with same CATH topology
 4GUK A;  1RWY A;  1EL4 A;  2HQW A;  3DD4 A;  2PFX A;  2ZN9 A;  1A29 A;  1PSR A;  3WU2 E;  2XV5 A;  1PSB A;  2WIT A;  2JPO A;  3L71 D;  5APW A;  2EC6 B;  1NWQ A;  3AEF C;  4XFJ A;  1L0N E;  1R2U A;  1KTM A;  3IAO A;  1OZH A;  4FQT A;  4Y99 C;  2Q7C A;  1OIP A;  5AVR B;  1S3J A;  1URQ A;  3P8C E;  1JF2 A;  1KQV A;  3KDP B;  4NDB A;  1BE3 D;  2IDB A;  1RHZ B;  1L0N D;  2E74 B;  2R3S A;  3CWB G;  2PAL A;  1B7T Z;  1LTJ B;  1CTR A;  5BU5 A;  4IFM A;  1IQ5 A;  1ZAC A;  3FWB A;  3P8C D;  4IOI H;  1VF5 B;  1XFU O;  2G2B A;  5KLV E;  2WCH A;  2LVI A;  2A45 I;  2BKH B;  3D0Y B;  4JF7 A;  3Q5P A;  2EC6 C;  1FDM A;  4YGD B;  4ZMD A;  3I56 P;  1Y6W A;  3HE5 A;  3SIA A;  3CC2 P;  1FC2 C;  2QRX A;  2GM4 A;  4PHJ A;  1GMJ A;  1B8L A;  3CME P;  4R1E A;  5EL2 A;  3SS5 A;  4CPV A;  4OZD A;  3GHG B;  1ZRT D;  1NU1 K;  4UB8 H;  3SSU A;  2E74 C;  4OKH A;  4MN0 A;  1WRL A;  4M3L A;  3T97 A;  1SQB J;  2GGM A;  2BL0 B;  2XU6 A;  1K95 A;  1S36 A;  5D7F A;  1VF5 C;  3ZWH A;  1P28 A;  1Z56 A;  2F3Y A;  1J1E B;  2W90 A;  1S5L H;  1A75 B;  2MHH A;  3W68 A;  5C39 A;  1AHR A;  4PHN A;  4L74 A;  2ZRT A;  3L71 G;  5APU A;  4M2Q A;  2KYV A;  4JYC A;  3HCM A;  2KNC A;  1HUC A;  1K8U A;  1QX2 A;  2P2U A;  4PD4 H;  1ZR4 A;  2KS1 A;  3GHG C;  3PJI A;  1BOD A;  4CFQ A;  1PGP A;  4OV2 A;  2WTY A;  5AW6 B;  1BF5 A;  3M06 A;  1VQN P;  1GW3 A;  1HGV A;  1IFN A;  1GU4 A;  1L0N G;  5KAF E;  3PAL A;  2KUB A;  3L75 E;  1AFO A;  3BYA A;  2BL0 C;  3HD7 A;  1KN7 A;  1B8R A;  1OOI X;  1TCO B;  5TJH A;  1J1E C;  1WLM A;  1KQS O;  2KOT A;  3AE1 C;  3CZT X;  4JWQ A;  4I5N B;  2KFG A;  3ZNI A;  2IBZ I;  5JJG A;  2ZVO B;  2HPS A;  2K3R A;  2Y0E A;  2OQQ A;  4PV1 D;  2A06 E;  2PVB A;  1OMV A;  1NGM B;  3D70 A;  2IYO A;  1L0L J;  1OOG A;  3VMZ A;  3BUM B;  2A06 D;  2JNF A;  1F54 A;  3O78 A;  4D1E A;  1N0Y A;  2I18 A;  2WOR A;  2KGB C;  1LXF C;  3TZ1 A;  1MKM A;  3PLN A;  1QJT A;  1SQX E;  3BAS A;  1M39 A;  2QM7 A;  2JTZ A;  1Y47 A;  2JZI A;  4NDD A;  1JY2 P;  1E8A A;  2HOD B;  2WPS A;  1CW5 A;  3H1I E;  2M3W A;  3M0D C;  3L70 D;  2KGR A;  2NPS A;  3N7N A;  1DIP A;  1HTL C;  4GGF C;  3CCV P;  3H1I D;  4YGA A;  3FE6 A;  2ZFD A;  4PCW A;  5KTY A;  1VPC A;  1CDP A;  2FYU J;  2WPV B;  5B66 E;  1KK7 Y;  2Q4U A;  3DY9 A;  2COL B;  2I7A A;  2HR3 A;  1A02 F;  2WND A;  1YUU A;  1QLK A;  3L75 G;  2CTN A;  4OCI A;  3OJA B;  2C9L Y;  1HVV A;  3AE4 C;  2KXP B;  2OYH B;  1QXP A;  4IJ7 A;  1LTA C;  1SFC A;  1K96 A;  3WNX B;  1EXJ A;  1VQK P;  2WCJ A;  1CLM A;  2PRR A;  1PZQ A;  3KYQ A;  4NPE A;  1X02 A;  1OQP A;  2GTE A;  4H13 D;  2HET A;  1S5L X;  2H8V A;  2A06 G;  2RN0 A;  1FI5 A;  3KHE A;  1GGW A;  2YGU A;  5DKQ A;  2IZ0 A;  2RH0 A;  5ER5 A;  5BPJ A;  1DD3 A;  2M9G A;  2P70 A;  3AE9 C;  3L74 D;  1NTK K;  3VTP C;  1NTM E;  3IF7 A;  4I5K A;  3EKJ A;  1SYM A;  2ZRS A;  2K2F A;  1KIL E;  2EGD A;  2BEC A;  2AEF A;  1TNW A;  1S3P A;  1SLQ A;  2OYH C;  1LGH B;  3SG7 A;  1SQX G;  2LVV A;  3L70 G;  1EH2 A;  3AEA C;  3L71 J;  1OW4 A;  2K9J B;  2WSS H;  3RL0 B;  2KAY A;  1N2D C;  1VRK A;  4L76 A;  2BE6 A;  3H1I G;  2FXO A;  1BGY E;  2ZVN B;  4IL6 E;  1Z4H A;  1PPJ E;  4BY5 A;  1FZA A;  2QE7 H;  1TRF A;  1TIZ A;  3KEV A;  1K9U A;  3W67 A;  4PHM A;  1R8E A;  4GBA A;  1KQG B;  1BE3 J;  5AW5 B;  3B86 A;  2JT3 A;  2HPC B;  1AA0 A;  2OYI B;  1LT9 B;  2FYN B;  1AQT A;  2R5B A;  4IFD K;  1PVB A;  2E6W A;  1LIN A;  3CR5 X;  3AE7 C;  3BOW B;  2LV7 A;  4N3Y B;  3B88 A;  3VB1 A;  1QL1 A;  4PD4 D;  3RL0 C;  4HRG A;  3B5N A;  1KB9 E;  1A03 A;  2KSE A;  3FWL A;  5GTI H;  3DVE A;  2WC8 A;  5HKZ A;  1S72 P;  3RK3 B;  2KNE A;  1PGQ A;  1N8R Q;  4UB6 E;  2N1T B;  2WMM A;  1DGV A;  3O4Y A;  1CDN A;  4YPC A;  2OYI C;  5AVT B;  2M1K B;  1BSN A;  1SKT A;  4JKT A;  1LT9 C;  3BAT A;  3MUD A;  4GKG A;  1H0T A;  3EK4 A;  2FYN C;  1C3Y A;  1QVI Z;  1K2H A;  1KFM A;  5CCH C;  3Q8I A;  5DJU B;  5I8N A;  1F70 A;  3O6Q A;  1LT1 A;  5AW0 B;  3MD0 A;  1BCC D;  2ZAE B;  2PP6 A;  1WLZ A;  4OH8 B;  3KPX A;  3ZDM A;  2D2C D;  4EDF A;  3H1J E;  1QX7 A;  2XNX A;  1MR8 A;  4KHX A;  5TIS H;  1N73 B;  4AQJ A;  1TTX A;  2WWW A;  3RK3 C;  1JUO A;  1SBJ A;  1BG1 A;  2N1T C;  1IK7 A;  1AVY A;  1IRJ A;  1FDO A;  3H1H D;  3CMA P;  2WSC H;  3CXH H;  1MUX A;  3BFH A;  1U57 A;  4RO0 A;  1CFC A;  5F6T A;  3H32 B;  3S9O A;  1PPJ G;  2IFN A;  2CBL A;  1M57 D;  1UP5 A;  5K89 A;  1K94 A;  3G71 P;  3NFQ A;  1OOH A;  5J3X A;  4XE5 B;  2P10 A;  4GAO A;  1RE4 C;  3OGN A;  2NZ0 A;  1RTP 1;  2KFH A;  3OB1 B;  3MZW B;  1NX1 A;  2P1J A;  3CL3 D;  3NSI A;  1N73 C;  3BCC D;  3G3Z A;  5I2L A;  2EHB A;  5KSZ A;  2BCC E;  3B6X A;  2FJY A;  2KYF A;  3LW5 J;  4DT0 A;  4EOT A;  2BEQ D;  1DMO A;  2ZFC A;  1JF0 A;  4I7Z B;  4R4M A;  1JMM A;  1NU1 D;  1QLE D;  2ZKM X;  2BCC D;  5CCG D;  3Q2Y A;  3HUS B;  4PV1 B;  3BUW B;  1KIL A;  1L4A A;  3L73 J;  4JYB A;  1YQ4 C;  3V5B A;  1OZS A;  1BCC G;  3O2P A;  1KSM A;  2R5D A;  1REC A;  3WU2 H;  3NSK A;  1XO5 A;  2AAO A;  4GGN A;  2KLD A;  3L70 J;  3BQ3 A;  3M9H A;  2BAS A;  3II6 A;  3PFV A;  3SG3 A;  3KF9 A;  1LP1 A;  2Y9Y A;  3OX6 A;  2L51 A;  1C7W A;  1LWU A;  3AE3 C;  4PAL A;  1FI6 A;  1GL2 A;  3H1H G;  4OVN F;  1CMG A;  2P7J A;  4K3A A;  2OS8 B;  1VQO P;  3EK8 A;  3H1J G;  1SQB E;  2POH A;  2ZXX A;  2CCM A;  3GK4 X;  4I7Z C;  3EVU A;  5HKY A;  2KK7 A;  3HUS C;  4PV1 C;  1SQQ K;  2JEE A;  1SQP K;  3NHI A;  2JRF A;  1NKZ B;  3IQQ A;  5APQ A;  5B5E E;  1U5I B;  2QEO A;  3D10 A;  1DJI A;  2B1U A;  1K8A Q;  1T3U A;  2Q3E A;  3L72 D;  1NTZ D;  1OOJ A;  1MFZ A;  2K88 A;  2Q6Q A;  1K9P A;  2MAZ A;  4HRH A;  3BCC G;  1KFX S;  2LXB A;  2JT0 A;  1SL7 A;  3BXK A;  1IH0 A;  1JTH B;  2OS8 C;  1XVJ A;  3BRT B;  3OBV A;  2QEB A;  2GA1 A;  1NCZ A;  1BLQ A;  1URQ D;  1KYO I;  4BRY B;  3A0H E;  3V2L A;  3I5I B;  1M31 A;  3CPW O;  1NU1 G;  1NVO A;  5M1B A;  5K5G B;  1YIJ P;  2BCC G;  1P84 E;  3Q1M A;  3L74 J;  2KLE A;  3VRR A;  1NSH A;  3H1K E;  1SQV K;  1C7V A;  1SS1 A;  2B87 A;  2CNP A;  3HE4 B;  1R5L A;  4PJ0 E;  1DJG A;  2J59 M;  2WT7 B;  3KHU A;  2AXC A;  4P2Y B;  2WC6 A;  4H13 B;  1UHJ A;  1CMF A;  2FFD C;  2HG5 D;  2VRS A;  3H6P A;  2JQ6 A;  5FI2 A;  1G2C B;  1T6A A;  3FIA A;  3I5F B;  4QJ5 B;  2JP3 A;  2N9B A;  1DJZ A;  4B86 A;  4ZKU A;  5CMZ A;  3FE9 A;  3TDK A;  2QM8 A;  3I5I C;  2CT9 A;  3PAT A;  3O4X A;  1YTZ C;  5B8I B;  3GW6 A;  3CX5 E;  3BUO B;  1JB0 J;  4YTP C;  1M1K Q;  3PN7 B;  3AE2 C;  5KAF H;  4YBH B;  1YUS A;  1N65 A;  3VMA A;  4MVF A;  1BSH A;  1PP9 E;  3S0F A;  1KV4 A;  4H13 C;  3CWG A;  4FQO A;  1EZV E;  1DGU A;  3L72 G;  3D76 A;  1QVI Y;  4ZCU A;  2M49 B;  3I5F C;  3OHM B;  1OVV A;  1Q90 D;  3CXH D;  3TGU E;  3CWB D;  1ODB A;  3A4U B;  1YYC A;  4INX A;  4PE7 A;  1PFI A;  3GHG A;  1L2O B;  4JD9 A;  2KAV A;  3UO9 A;  3V2N A;  3PN7 C;  3M91 A;  3HD7 D;  1NTK E;  3EG5 B;  1CB1 A;  1OVR A;  4DCK A;  1D1O A;  4GOD A;  1QIV A;  3KZI E;  4ORB B;  1X9V A;  1DJX A;  1YR5 A;  2OPO A;  1KK7 Z;  5I94 A;  3G9R A;  4D6T D;  1J1E A;  1NTK D;  1A75 A;  3CCL P;  3GOF A;  4NPD A;  1G33 A;  1FZB A;  3IQO A;  1OMD A;  1BCC J;  1LKJ A;  4UPG A;  3DXL A;  1Q81 Q;  2LKM A;  4L75 A;  1AJ4 A;  5AW4 B;  2HFE D;  1L2O C;  1NIW A;  3I5C A;  1K93 D;  3JCU E;  1QGK B;  5BVZ A;  1YJ9 P;  3H1H J;  1IFJ A;  1FZE A;  2B88 A;  1RH5 B;  2M3E A;  2GV5 A;  2K0J A;  4MZL A;  3P32 A;  2BEZ F;  1JNM A;  2FCE A;  1SL8 A;  5B66 H;  1KZU B;  3E1I A;  4Q04 A;  4N5X A;  3E1R A;  4PHK A;  2D2C B;  1J7O A;  1YVH A;  3OW2 O;  3CZ2 A;  4HRE E;  1PP9 G;  2QJK B;  2NPS D;  3KXD A;  1EZV G;  3M0D A;  1K9K A;  3D71 A;  1SCM C;  3VP8 A;  4I6M C;  4DOJ A;  1M56 D;  4GGF A;  4BY4 A;  1W2E A;  1XYD A;  3RK3 E;  3VOP A;  4USL A;  3GK1 A;  2A4J A;  1IQ3 A;  4C0J A;  3WUT A;  1N7S B;  3B8E B;  3U59 A;  3G4S P;  2D2C C;  4D6T G;  4IFF A;  3GF3 A;  1IKU A;  1NTK G;  4JBZ A;  5KLV D;  3U1C A;  1DH3 A;  1PVA A;  2JU0 A;  3B71 A;  3TDI A;  3Q3D A;  5G08 A;  2HOD A;  2KOG A;  1SFC D;  2QJK C;  2YNY A;  1QEX A;  1M8O B;  2WQY C;  1UUR A;  1VQP P;  1N7L A;  1U7M A;  3VYI A;  1LTJ C;  5AAN A;  4KT0 J;  2IX7 C;  5DKR A;  3TDZ A;  3VGO A;  4BWN A;  2V4H A;  1SPY A;  5APV A;  3M0W A;  3CCR P;  2WCF A;  4IL6 H;  1T2K C;  2PSR A;  3SG4 A;  4A7P A;  2FJU B;  2E75 D;  1ZR2 A;  1N7S C;  2F8P A;  2E43 A;  1PGJ A;  2O60 A;  3O8Z A;  1G4Y R;  1XFW O;  3RZS A;  1OSA A;  2HYN A;  2LUX A;  3WUU A;  3HTK B;  2OYH A;  3L72 J;  1NTZ J;  4ORC B;  1SQB K;  2R2I A;  5AVZ B;  5CSI A;  1EXR A;  1XFX O;  2YXR B;  1FOS E;  1BR4 B;  1KQF B;  4ASV A;  1K05 A;  1KB9 H;  4EI2 A;  1S6I A;  5I2O A;  5CCG C;  3S0D A;  4TT3 H;  3VMY A;  1N2D A;  3OAK A;  3L75 D;  4OGQ D;  4UB6 H;  2BNX A;  1UHH A;  2M0B A;  1WRG A;  1QX8 A;  5KLV G;  3A3Y B;  3RK2 D;  1GW4 A;  3B4S A;  1IFD A;  3FXE A;  2LLS A;  3QWO C;  1AJY A;  4C7N B;  3NMD A;  1DX7 A;  2K61 A;  3A7O A;  1DQE A;  5CBO A;  3MIW A;  2Q91 A;  2LE9 B;  1TCF A;  2ZYG A;  4LGD E;  3WUV A;  1B47 A;  4NPF X;  1MHO A;  2K9J A;  1BDD A;  1KQL A;  4OWF A;  2KI4 B;  3BUN B;  2YMY A;  1OMR A;  1QTX A;  3V2R A;  5L8R J;  4XYN A;  2M1U A;  1MQ1 A;  2K7D A;  1SQQ E;  4DIR A;  1SQP E;  1L0L K;  1SQX D;  3H25 A;  2HPC A;  3SJS A;  2OYI A;  2H43 A;  1KYO E;  1OW8 A;  1LT9 A;  2JTT A;  2L5G B;  2WCL A;  1ZUZ A;  1CKK A;  3BOW A;  5CCH A;  4WY4 B;  3L35 A;  1LTG C;  5DJT B;  1CFP A;  1RE3 C;  3R1O A;  2V7Q H;  2PAS A;  1NOH A;  1JMB A;  1RF0 C;  3OX5 A;  2KI4 C;  2ZYA A;  4QJ3 B;  2WSC J;  1S6C A;  1GU5 A;  3CWB J;  1Q86 Q;  5CSF A;  1YBK A;  3K21 A;  2FY8 A;  1YJN P;  3TF5 A;  2K7O A;  3CR2 A;  3RBZ A;  2Z4E A;  1IO4 A;  3EVV A;  2N1T A;  4Z1M H;  2K7C A;  1IGV A;  1SQV E;  5HLO A;  5I2Q A;  1NX0 A;  3U1A A;  2L2E A;  4LLH A;  1DF0 B;  3LK1 A;  2J5U A;  2KNC B;  3IF4 A;  3CLQ A;  1OW6 A;  3AED C;  1NHL A;  4D6T J;  4WY4 C;  3WXA A;  3R4Y A;  4IL6 X;  3F5H A;  2WVR A;  3LID A;  2FYU K;  1CM1 A;  4MEW A;  3SWK A;  2ZT9 D;  1RE4 A;  4PE4 A;  1S1E A;  2PQL A;  5APX A;  2OTK E;  4HB1 A;  1FZC B;  1X79 B;  2LMU A;  2L4H A;  5KTB A;  1N73 A;  4WB4 A;  2ZNE A;  1BJF A;  1NTM D;  2PGD A;  1DJY A;  3TSI A;  1OMI A;  1DD4 A;  4GNK B;  2H88 C;  3CS1 A;  1DT7 B;  3H32 A;  4GDO A;  1CFD A;  1KIL D;  1IG5 A;  1L4A D;  2NCP A;  1SQQ G;  3M0A A;  1RFJ A;  1SQP G;  2ERB A;  4YRU A;  4YXW H;  1NX2 A;  2LR2 A;  3ABV C;  3CCU P;  3NXA A;  1SW8 A;  1JM0 A;  5B5E H;  1Y1X A;  4MRX A;  1FPW A;  1FZC C;  3FWN A;  4TNC A;  1L0N J;  2CPS A;  1BGY D;  2IFM A;  1PPJ D;  3C1L A;  2IZ1 A;  3R2P A;  3SS4 A;  2M29 A;  1J7P A;  1HT9 A;  3CYZ A;  3S4R A;  4I2L C;  2K9Y A;  2R3C A;  3PSR A;  3A0H H;  5E79 E;  1FE6 A;  2FKW B;  2JT8 A;  1FJP A;  3FE8 A;  2WSF H;  1P84 H;  2OTJ P;  1EDK A;  3HUS A;  2NPS B;  5KLV J;  2O01 N;  1TNQ A;  2Z5H A;  3TNU B;  2Q5U A;  4PJ0 H;  2M0R A;  1LTI C;  2WZ7 A;  1NCY A;  1KB9 D;  1UIX A;  1OW7 A;  1R5S A;  5KLI B;  1MFT A;  3L4L A;  1VQL P;  2O3J A;  3PM8 A;  2L98 A;  2Y1M A;  3AAK A;  1NTM G;  4XA4 A;  3ITK A;  2Z5I A;  1ZFS A;  2E76 D;  3CX5 H;  4U3F E;  5CSN A;  3MGN A;  1DVI A;  2B89 A;  4O9B A;  2Q1K A;  3CD6 P;  2ISD A;  2FYZ A;  1U5I A;  1WDC B;  2G8Y A;  1TU3 F;  2QG4 A;  3EQ2 A;  3H1J D;  1YTZ T;  2DW3 A;  5KLI C;  1CNP A;  1BGY G;  3EFG A;  3H1L E;  2FFD A;  1M1J B;  5DIC A;  2W6J H;  2XKM A;  1NUB A;  2F2O A;  1B9A A;  3QRX A;  2WPQ A;  2AUC A;  1JTH A;  5PAL A;  2E5T A;  4KJM A;  3TK1 A;  4BXL A;  1LJ2 A;  3L75 J;  4BRY A;  2YO2 A;  3C8V A;  2LM5 A;  5GTH E;  1FF1 A;  5KJ7 D;  3NGV A;  1IJ5 A;  4N78 E;  3KZI H;  3CR4 X;  2HF5 A;  1OWA A;  1VF5 D;  4IL1 A;  3HE4 A;  1WDC C;  2WT7 A;  2LP3 A;  3AEB C;  1W7I B;  2BCB A;  2R44 A;  1FW4 A;  1M1J C;  3D74 A;  2FOT A;  3V4W A;  3LLE A;  1VQ7 P;  3PM2 A;  1G2C A;  1GZL A;  1V1F A;  4OGQ B;  3AE5 C;  2I2R E;  2LLU A;  2G9B A;  2IPP A;  1MWN A;  2TN4 A;  1HQV A;  1ZP0 C;  2YKO A;  3VRO A;  3CCS P;  1TN4 A;  3HX4 A;  3A8R A;  3RK2 B;  3JCU H;  1ZOY C;  4GIF A;  1ZME C;  1SQX J;  2ZND A;  2KBI A;  4M2O A;  4ZKP A;  2LC5 A;  3Q5S A;  4ZNC A;  3A0B E;  5AW9 B;  1J2J B;  1CZQ A;  3CDN A;  2K7B A;  1ZLL A;  2IBZ E;  2MKV A;  3WHT B;  1ALW A;  5HYD A;  1H89 A;  1PGO A;  1JBA A;  4U3F G;  1Z2C B;  2KFF A;  3MTU E;  1SMG A;  3H1I J;  1JO5 A;  1UWO A;  3BRV B;  3CI9 A;  1T14 A;  1J7Q A;  1FS0 E;  4RKU J;  1LA0 A;  4MN4 C;  2W6B A;  1VQ6 P;  4YXD C;  1QV0 A;  2KZJ A;  3R1V A;  1HGZ A;  3OA7 A;  4WQ2 A;  4ORA B;  3BUX B;  2NZ2 A;  1SQB D;  1BT6 A;  4KYN A;  1A02 J;  3VRQ A;  3RK2 C;  3USS A;  4M2P A;  3WHU B;  1IIO A;  1RY3 A;  5AW8 B;  5TNC A;  3SS3 A;  1NX3 A;  2K37 A;  4WVZ A;  1J55 A;  5AVY B;  2G3A A;  3EVR A;  2JNX A;  3TYY A;  1NP8 A;  3V2Q A;  1F71 A;  3GG2 A;  3JSV C;  1FZF A;  1RK9 A;  1RJV A;  1RRO A;  2BCA A;  1IFP A;  5KAI E;  1Y0V H;  1F55 A;  5APT A;  2KI6 D;  3FS7 A;  3N7H A;  2E5Y A;  2QDI A;  1HH0 A;  2IYP A;  1QS7 A;  4N6J A;  2ZXE B;  1YHQ P;  3S0A A;  5AVV B;  3L47 A;  4MBE A;  5AVX B;  1W7J B;  1SY9 A;  1L0L E;  1P84 D;  3VRP A;  1NTM J;  3H1K D;  1KQM B;  3A2A A;  1NJI Q;  3D73 A;  1NAY A;  2SPZ A;  2ZT9 B;  2QSI A;  3EWK A;  2XZR A;  3CTN A;  2O01 H;  1QWV A;  3AKB A;  1MXL C;  2H8P D;  3V6I A;  2MLF C;  1IJ6 A;  2P58 A;  4W7Y A;  3PH0 A;  1F4O A;  2JWD A;  2N9Y B;  2IBZ G;  5FI7 A;  2HLO A;  4YGE B;  3LL8 B;  1J1D B;  1FAV A;  3R72 A;  1AQ5 A;  1BGY J;  1SQB G;  5AER A;  2SAS A;  4QMA A;  1KFU S;  1T3J A;  1LTJ A;  1JFK A;  3CX5 D;  2WCM A;  4JPZ B;  2KIK A;  3M9B A;  1JUN A;  1KQM C;  2KZI A;  2LVK A;  1NCX A;  3D0Y A;  3RBX A;  1YVL A;  5AXI A;  2ZT9 C;  4P5O E;  2UWJ E;  2ZYD A;  1PP9 D;  3CC4 P;  1N7S A;  5H2F E;  2LUC A;  2OTG B;  1EZV D;  5AFP A;  2FYU E;  3R1P A;  2JJL A;  3DZT A;  2QVA A;  4C46 A;  3BFB A;  2MRD A;  1QLS A;  1J1D C;  1YX8 A;  3QME A;  3L4A A;  3TGU D;  1KK8 B;  1Y1U A;  2F2P A;  1KSO A;  1S9K E;  1JC2 A;  4CID A;  3BJH A;  1XK4 C;  2IS9 A;  1J7R A;  1MV8 A;  2YKQ A;  4XJK B;  1K73 Q;  2H61 C;  5CCG A;  1DTL A;  5D3O A;  1IZN B;  2JWA A;  1CDM A;  2MLE C;  1UHI A;  2Y0D A;  3WMM 0;  3H1K G;  1K04 A;  3CZ0 A;  1S5G Y;  4W7Z A;  4C7R A;  1NKN A;  3G6E P;  2FCD A;  1N86 A;  3TDU A;  2LCP A;  2OTG C;  2E30 A;  2QAC A;  4MSP A;  1LA3 A;  3O6B A;  4R4L A;  3DF0 B;  5HKW A;  1L0L G;  3DVK A;  3E3R A;  4ZCV A;  1SR6 B;  1YRU B;  2KYC A;  1KYO H;  3CCE P;  4WQ3 A;  1B1G A;  1SL9 A;  1BMO A;  3RLZ A;  3L37 A;  3AEG C;  4PD4 I;  4OR9 B;  3HTK A;  1KK8 C;  3H1J J;  4WBA A;  1ZXG A;  2WCE A;  4WWI A;  4F0Z B;  3F45 A;  5AW2 B;  3NHT A;  2E76 B;  2WCK A;  1OVU A;  3P8M C;  1X0T A;  2PYQ A;  1USD A;  3L71 E;  1QVF O;  1C3Z A;  1KB9 I;  3C1V A;  3PTZ A;  3RM1 A;  4MZJ A;  2B9B A;  2V53 A;  3VN0 A;  4EYY Q;  3CCJ P;  4NQG A;  1SR6 C;  1DEK A;  3H4S E;  2CK3 H;  3BCC J;  3SG2 A;  1UHK A;  2AEM A;  2F3Z A;  5CCH D;  1BE3 E;  2V7Q J;  3RL0 g;  2LXC B;  1MF8 B;  3SWY A;  2AXT E;  1FJK A;  4C7N A;  4C0L A;  1AVO A;  1FDI A;  2YMK A;  3TGU G;  1RF1 B;  3FWC A;  1CI6 B;  2FYU G;  1KFX L;  1RE3 A;  2GUS A;  4H44 D;  2C9N Y;  2ITA A;  1NU1 J;  1KOR A;  2E76 C;  1CDL A;  3GMA A;  2BCC J;  1RF0 A;  2LVJ A;  1NH4 A;  2MJW B;  3RK3 D;  4F7F A;  2N1T D;  5CPV A;  3MP7 B;  1S1C X;  1KC8 Q;  1WY9 A;  3K1E A;  1TUZ A;  4A4C A;  2LMV A;  1ZRT E;  2KI7 B;  1GGZ A;  2I94 A;  2C0X A;  1BR1 B;  2W83 C;  1CLL A;  2JWW A;  4DJG A;  1HJB A;  2RGI A;  2RKL A;  1RF1 C;  5AVU B;  2Q9I A;  1H8A A;  4WY4 A;  4GPL B;  1YUT A;  3SG5 A;  4PE0 A;  1PAL A;  1YX7 A;  3HRN A;  4I1L A;  4MLW A;  5KJ7 C;  1SRA A;  2M5A B;  1IK9 A;  1S2E A;  2CPB A;  1JY3 P;  1S4X A;  1DJW A;  1NAF A;  2O1J A;  2ZJS E;  5AW7 B;  1TNP A;  2KBM A;  2OGU A;  2WSE H;  2BE4 A;  1ZOT B;  2KHN A;  2NLN A;  1GTW A;  1W5C E;  1XFZ O;  2F33 A;  1HWT C;  1AJ5 A;  5JOL A;  5AVW B;  1L2P A;  3DVJ A;  5E79 H;  3PP5 A;  1KFU L;  1QL2 A;  4ASW A;  1DF0 A;  2H2K A;  1GQM A;  3GLM A;  2KP8 A;  4I5J A;  1QAS A;  5CSJ A;  1W2B O;  1FOS F;  1S26 D;  3KO0 A;  1BE3 G;  1MZ9 A;  5AW3 B;  4HJG H;  1EG4 A;  5KKZ B;  3CCM P;  1FZC A;  3DYE A;  1EC5 A;  1NO4 A;  4CFR A;  1AVS A;  1NTZ K;  4DS7 A;  1VQ4 P;  1S6J A;  4AUW A;  1FU1 A;  2WSF J;  3PJS K;  4W80 A;  3VRN A;  3B5N D;  2M8R A;  3H1K J;  5FI6 A;  1URQ B;  5EFW B;  2K1A A;  3EFF K;  5DKN A;  1JEK A;  1Q82 Q;  1OX3 A;  2WPR A;  1F4Q A;  3V4Q A;  4NDC A;  3AKA A;  3D6Z A;  1K9M Q;  5AVQ B;  1CM4 A;  2A45 H;  1LTB C;  2DOQ A;  3SG6 A;  1ZMZ A;  2BCX A;  3D78 A;  2O5G A;  3S0E A;  3L73 E;  5KKZ C;  2I1J A;  2E42 A;  1D7M A;  3KPE A;  1IC2 A;  4H0L D;  4HYT B;  3HE5 B;  1CLB A;  2ZN8 A;  3FXD A;  1M45 A;  3TS5 B;  3L70 E;  1SQQ D;  4CPG A;  3L73 D;  4FTG A;  4L73 A;  1SQP D;  2JDI H;  1H88 A;  1DEB A;  1YUR A;  1URQ C;  2KI6 C;  3JTD B;  3FGA D;  2KPH A;  5GTH H;  1KYO D;  2MJZ A;  1VQ8 P;  3SFE C;  1PP9 J;  2XND H;  4HH2 A;  4MZK A;  1GD2 E;  3BFA A;  3IN6 A;  3T97 B;  1OFC X;  3B87 A;  2FXM A;  5CJ4 A;  2JPT A;  3TUY B;  3TNU A;  2LP2 A;  1P84 I;  3L36 A;  3VMX A;  2M7L A;  2MA2 A;  3CZ1 A;  3CLN A;  1Y9B A;  3TGU J;  1AV1 A;  1WRK A;  1SP4 A;  1Q80 A;  2D8N A;  2PRU A;  3TS5 C;  4U7J A;  2YO3 A;  3JVT B;  2KS1 B;  1NTK J;  2P6B B;  3JTD C;  1JCC A;  1SQV D;  2Y4Q A;  2QJY B;  5CJ0 A;  1DC1 A;  2JOJ A;  1YQ3 C;  3GF7 A;  1ALV A;  5AVS B;  3HD7 B;  1UUS A;  1MUU A;  3TUY C;  3A0B H;  3CX5 I;  4LC1 A;  2Y5I A;  3L74 E;  4GFT A;  1TOP A;  3CAB A;  3SIB A;  2JXL A;  1QAT A;  1IWQ A;  3CGA A;  4K35 A;  1RQU A;  1EDI A;  1DJH A;  2K60 A;  1H4B A;  1M1J A;  1YJW P;  3CXH I;  1EZV I;  5GQQ C;  4GOE A;  3JVT C;  2HQ8 A;  2Y0C A;  1Q7Y Q;  3PHL A;  3L73 G;  1XTC C;  2QJY C;  5BU8 B;  4C0K A;  4UB8 E;  4DUQ A;  1JFJ A;  2BKI B;  3HD7 C;  1B7T Y;  1HJ0 A;  3LK0 A;  1VQ5 P;  4DRW A;  1GL2 D;  1XFV O;  2KLV A;  1IJD B;  3GK2 A;  2OYO A;  1FZG A;  4HKZ H;  1X8Y A;  1NPQ A;  4JQ0 D;  5KAI H;  1QIW A;  4PT1 A;  1S5L E;  1TWO A;  4L9M A;  1ORG A;  3LCP C;  4PE1 A;  4AQI A;  1BOC A;  3AE6 C;  3SWF A;  2H7H A;  1LVC D;  1B4C A;  1PV3 A;  4PD4 E;  2LLT A;  1B8C A;  1SSE B;  1JSA A;  1IFI A;  4E68 A;  3KQG A;  1SQV G;  5AEQ A;  1KCY A;  3SFD C;  2O1K A;  1EQ7 A;  1OXZ A;  2GGZ A;  1L0N K;  4RJT A;  1VL2 A;  1JY3 N;  5HLV A;  4N1F A;  5FYX A;  5HL1 A;  3B7A A;  1PUL A;  1E79 H;  2JXC A;  1UII A;  1L7Z A;  3I5G B;  4H44 B;  1TUJ A;  2QEH A;  2KSP A;  1DEL A;  2WCB A;  4PDZ A;  3NTN A;  1Q2N A;  2J58 A;  2YIU B;  3AAJ A;  2I8D A;  3LIE A;  2LMT A;  2L5X B;  1SFC B;  2NRG A;  3L74 G;  1PIX A;  2NXQ A;  2NPS C;  5KLV K;  1OOF A;  2QA4 P;  5APY A;  1BCC E;  1EJ3 A;  2BBM A;  1T8Z A;  2Y1N A;  4WRI A;  1KD1 Q;  2K2A A;  4U3F D;  1JY3 O;  5KU1 A;  4U8D A;  3DVM A;  5ER4 X;  1GDT A;  2PMY A;  2QJP B;  2VRG A;  2O01 J;  1LNQ A;  1NYA A;  2KAX A;  3NXS A;  1S5G Z;  3H1H E;  3I5G C;  4H44 C;  2E75 B;  3OP0 A;  1VQM P;  1MXE A;  2I1K A;  5H2F H;  2GUV A;  2L50 A;  1CSB A;  3H1L D;  2YIU C;  1SFC C;  2E74 D;  4TLF A;  1TNX A;  4INW A;  3M9Q A;  2P71 A;  1SK6 D;  3C9I A;  1M63 B;  3S0B A;  1A2X A;  3NSL A;  2QJP C;  1T2K D;  3BCC E;  1XFY O;  1EDJ A;  4N78 D;  1N7S D;  4N1G A;  2E75 C;  2M8U A;  1A4P A;  3BVH A;  3PLF B;  3VP9 A;  1EG3 A;  1WT6 A;  1AP4 A;  5CHX A;  2SCP A;  1JY2 N;  1JWD A;  1QVG O;  2RMZ A;  1NU1 E;  1GK4 A;  2BBN A;  1USE A;  3F89 A;  3EK7 A;  2L5Y A;  2QIW A;  2WOS A;  1G1J A;  1J1D A;  2L4I A;  1YRT B;  4YGC B;  3B5N B;  3D75 A;  2BAP A;  3UNW A;  1DEE G;  3QH9 A;  3I5H B;  1X22 A;  1SQQ J;  1XK4 A;  1SQP J;  2L2C A;  4AQR D;  3ICB A;  4EIJ A;  2H61 A;  2A45 G;  1JY2 O;  2IBZ D;  1R6P A;  4OGQ C;  3D77 A;  1K90 D;  1H0T B;  2FXP A;  3H1L G;  1HBW A;  1AK8 A;  3AEC C;  2P67 A;  4H0L B;  1SQX K;  1GK6 A;  2AXT H;  2R32 A;  3O6Q B;  5CBN A;  5D69 A;  1PK0 D;  3S0G A;  1H8B A;  3B5N C;  3L4F A;  3I5H C;  1XTG B;  2M97 A;  4I5L B;  3UIA A;  1G1I A;  3L72 E;  1NTZ E;  1FBV A;  2JC2 A;  3MSE B;  4XJK A;  1Y1A A;  1C07 A;  3AE8 C;  3IVT A;  1SQV J;  1RQV A;  2KSJ A;  2K8M B;  4YGB B;  1SNL A;  3FX0 A;  2LNK A;  2CXJ A;  1PRW A;  4ICB A;  1CFF A;  3MUD C;  1GJY A;  3DF0 A;  2FFD B;  3RGU A;  2YKP A;  1W9Z A;  4AOM A;  5APS A;  4H0L C;  2KQ6 A;  4AYC A;  2M3B A;  2QEX P;  2M7N A;  2AMI A;  1OZO A;  2KQY A;  1OE9 B;  1M46 A;  1LS8 A;  3I55 P;  1BU3 A;  1L0L D;  1QX5 B;  4GT1 A;  3IFM A;  5GTI E;  1M7L A;  2JO1 A;  1WRZ A;  2YXQ B;  3A5T A;  3P7K A;  1BDC A;  3D6Y A;  1XFR A;  1E5W A;  3K5B A;  5IBW A;  4A4B A;  3CCQ P;  2KDH A;  4WY4 D;  2Q3I A;  2QEV A;  1KIL B;  1M90 Q;  1YTZ I;  3E7K A;  1VQ9 P;  1L4A B;  1NTM K;  2LHI A;  3CC7 P;  1YIT P;  2LAN A;  1KMI Z;  1RF1 A;  3EKH A;  4GOF A;  2JKV A;  1CI6 A;  1KWO B;  1HF9 A;  1U7J A;  1LTT C;  1VDF A;  2KLU A;  5AW1 B;  1EDL A;  1SCV A;  2WSE J;  5KJ7 A;  5TIS E;  4Y28 J;  1LP1 B;  2H89 C;  1LWU B;  2JR8 A;  1GL2 B;  2NCO A;  2QPT A;  3NSO A;  4YI9 A;  3CXH E;  3CWB E;  1NTZ G;  2OTL P;  1FBM A;  2C0W A;  1IFM A;  1YI2 P;  2FYU D;  2OAR A;  4CLN A;  4MRY A;  4YI8 A;  4DZO A;  3LW5 H;  1GM0 A;  1KIL C;  2AEJ A;  1KFN A;  1L4A C;  3PRJ A;  3OB2 B;  1LTS C;  3IR9 A;  2WC5 A;  1QV1 A;  3JC2 2;  1ZV8 A;  4QJ4 B;  2Y9Z A;  1G8I A;  1KWO C;  1S9K D;  1NYH A;  4D6T E;  3AEE C;  1Y8A A;  1PL5 A;  1JCD A;  3N4X A;  1EXI A;  2XDJ A;  2KB7 P;  2M5A A;  1ZW0 A;  1XA5 A;  1JOC A;  1LWU C;  2W27 A;  4RES B;  1GL2 C;  2W8Z A;  1NWD A;  1WMK A;  3V2P A;  2LHL A;  4U3F J;  4HSZ A;  2L0P A;  1AUI B;  2LAP A;  2PAJ A;  2W6A A;  4ETO A;  1V1G A;  2MBX A;  4Y99 B;  3RL0 D;  2FBW C;  1SVF A;  3S1K A;  1UHN A;  1ZN5 A;  2L91 A;  3MHV A;  1F8H A;  2JUL A;  2B87 B;  1SCM B;  3Q5R A;  3H1L J; 
#chains in the Genus database with same CATH homology
 1ZMZ A;  2BCX A;  2M0R A;  1U5I B;  1RWY A;  3D10 A;  1DJI A;  1EL4 A;  4GUK A;  2B1U A;  2HQW A;  3DD4 A;  2O5G A;  1NCY A;  2ZN9 A;  1A29 A;  1PSR A;  1OOJ A;  1PSB A;  1K9P A;  2MAZ A;  4HRH A;  1KFX S;  2EC6 B;  2JT0 A;  1SL7 A;  3BXK A;  1IH0 A;  1CLB A;  2ZN8 A;  1M45 A;  3PM8 A;  2OS8 C;  1XVJ A;  3TS5 B;  1R2U A;  2L98 A;  1NCZ A;  2Y1M A;  3AAK A;  4FTG A;  1BLQ A;  1YUR A;  2KI6 C;  3I5I B;  3JTD B;  1M31 A;  1ZFS A;  1JF2 A;  1KQV A;  4NDB A;  5CSN A;  1DVI A;  4MZK A;  3VRR A;  1NSH A;  2PAL A;  1OFC X;  1B7T Z;  1C7V A;  2ISD A;  1CTR A;  2CNP A;  2JPT A;  1IQ5 A;  1ZAC A;  3TUY B;  2LP2 A;  3FWB A;  1DJG A;  1U5I A;  2M7L A;  1WDC B;  4P2Y B;  2MA2 A;  1XFU O;  2G2B A;  1UHJ A;  1CMF A;  2LVI A;  3CLN A;  2BKH B;  3D0Y B;  1CNP A;  1WRK A;  2EC6 C;  4YGD B;  2JQ6 A;  1NUB A;  2F2O A;  1B9A A;  1Q80 A;  1Y6W A;  2D8N A;  2PRU A;  3TS5 C;  3QRX A;  3SIA A;  3FIA A;  2AUC A;  3I5F B;  4QJ5 B;  4PHJ A;  5PAL A;  1DJZ A;  3JVT B;  1B8L A;  2P6B B;  4R1E A;  4CPV A;  3I5I C;  2CT9 A;  3JTD C;  3PAT A;  2LM5 A;  2Y4Q A;  1YTZ C;  5B8I B;  1FF1 A;  3BUO B;  2JOJ A;  3PN7 B;  1IJ5 A;  4OKH A;  4MN0 A;  1ALV A;  1WRL A;  4YBH B;  1YUS A;  1N65 A;  1UUS A;  3CR4 X;  3TUY C;  2GGM A;  4MVF A;  2BL0 B;  1K95 A;  2HF5 A;  1S36 A;  4IL1 A;  1WDC C;  2Y5I A;  5D7F A;  3ZWH A;  2LP3 A;  3CWG A;  2F3Y A;  4FQO A;  4GFT A;  1A75 B;  1W7I B;  2MHH A;  1DGU A;  1TOP A;  2BCB A;  3SIB A;  2JXL A;  1FW4 A;  1QAT A;  1AHR A;  1IWQ A;  3CGA A;  2FOT A;  3LLE A;  4PHN A;  1DJH A;  1QVI Y;  2ZRT A;  4ZCU A;  1H4B A;  4M2Q A;  2M49 B;  3I5F C;  5GQQ C;  3HCM A;  3OHM B;  1V1F A;  3JVT C;  2HQ8 A;  2I2R E;  2G9B A;  2LLU A;  1MWN A;  2TN4 A;  1HQV A;  1K8U A;  1QX2 A;  1ODB A;  3A4U B;  3VRO A;  1TN4 A;  3HX4 A;  4PE7 A;  3A8R A;  1BOD A;  4CFQ A;  1L2O B;  2KAV A;  4C0K A;  4OV2 A;  3PN7 C;  4DUQ A;  1BF5 A;  2BKI B;  1JFJ A;  3PAL A;  1CB1 A;  1B7T Y;  2ZND A;  3LK0 A;  2KBI A;  4M2O A;  4DCK A;  3BYA A;  1QIV A;  2BL0 C;  4DRW A;  1D1O A;  2LC5 A;  4ORB B;  1XFV O;  1DJX A;  1B8R A;  1TCO B;  2K7B A;  3GK2 A;  1YR5 A;  2OPO A;  3WHT B;  1ALW A;  1KK7 Z;  5HYD A;  1WLM A;  1JBA A;  2KOT A;  1NPQ A;  4JQ0 D;  1QIW A;  2KFF A;  1SMG A;  1J1E A;  3CZT X;  1A75 A;  4JWQ A;  1UWO A;  4L9M A;  3GOF A;  4I5N B;  3LCP C;  2KFG A;  3ZNI A;  1G33 A;  1J7Q A;  3IQO A;  5JJG A;  1LA0 A;  4PE1 A;  4AQI A;  1BOC A;  1OMD A;  2HPS A;  1LKJ A;  4UPG A;  1QV0 A;  1LVC D;  2PVB A;  1OMV A;  4ORA B;  4WQ2 A;  1B4C A;  1AJ4 A;  3BUX B;  2LLT A;  1B8C A;  1JSA A;  1BT6 A;  3VRQ A;  4E68 A;  1L2O C;  3BUM B;  4M2P A;  5AEQ A;  1NIW A;  3WHU B;  1KCY A;  1K93 D;  5TNC A;  2JNF A;  2GGZ A;  1F54 A;  1NX3 A;  3O78 A;  4D1E A;  1N0Y A;  1J55 A;  2GV5 A;  2I18 A;  2K0J A;  4MZL A;  2WOR A;  3EVR A;  2JNX A;  2KGB C;  1LXF C;  1NP8 A;  5HLV A;  3TZ1 A;  1F71 A;  4N1F A;  2FCE A;  1SL8 A;  5FYX A;  4Q04 A;  1PUL A;  4N5X A;  2JXC A;  1RK9 A;  1QJT A;  1RJV A;  1L7Z A;  1M39 A;  1RRO A;  2BCA A;  3I5G B;  4PHK A;  2JTZ A;  1J7O A;  2JZI A;  4NDD A;  1Y0V H;  1F55 A;  2KI6 D;  1YVH A;  2KSP A;  2WCB A;  1E8A A;  3FS7 A;  4PDZ A;  4HRE E;  3AAJ A;  2LMT A;  2L5X B;  2M3W A;  2NXQ A;  1QS7 A;  1K9K A;  2KGR A;  1SCM C;  1EJ3 A;  2BBM A;  2Y1N A;  4WRI A;  4MBE A;  4GGF C;  2K2A A;  1W7J B;  5KU1 A;  4YGA A;  1SY9 A;  4GGF A;  4U8D A;  3DVM A;  4BY4 A;  2ZFD A;  5ER4 X;  4PCW A;  1XYD A;  2PMY A;  5KTY A;  2VRG A;  3VRP A;  4USL A;  1KQM B;  1NYA A;  2A4J A;  3GK1 A;  2KAX A;  1CDP A;  1IQ3 A;  4C0J A;  1S5G Z;  1KK7 Y;  3I5G C;  2Q4U A;  3OP0 A;  3CTN A;  1MXE A;  3AKB A;  1MXL C;  2COL B;  1IKU A;  2MLF C;  2I7A A;  1PVA A;  1IJ6 A;  2L50 A;  2JU0 A;  2WND A;  1YUU A;  1QLK A;  3TDI A;  2CTN A;  5G08 A;  4OCI A;  1F4O A;  1UUR A;  4YGE B;  1QXP A;  1TNX A;  3LL8 B;  1K96 A;  3WNX B;  1CLM A;  5AER A;  2SAS A;  1KFU S;  5AAN A;  1X02 A;  1OQP A;  1SK6 D;  1JFK A;  2HET A;  5DKR A;  1M63 B;  3TDZ A;  3VGO A;  1SPY A;  1A2X A;  3NSL A;  3M0W A;  4JPZ B;  1FI5 A;  2WCF A;  3KHE A;  1GGW A;  1KQM C;  1XFY O;  2PSR A;  2LVK A;  5DKQ A;  1NCX A;  3D0Y A;  3SG4 A;  1YVL A;  2FJU B;  5AXI A;  5ER5 A;  5BPJ A;  4N1G A;  2F8P A;  4P5O E;  2M8U A;  2M9G A;  1A4P A;  2O60 A;  1G4Y R;  1XFW O;  3PLF B;  1OSA A;  1EG3 A;  1AP4 A;  2LUC A;  2OTG B;  3IF7 A;  2SCP A;  4I5K A;  5AFP A;  1JWD A;  3EKJ A;  1SYM A;  2ZRS A;  2K2F A;  2EGD A;  2BBN A;  2BEC A;  2LUX A;  1TNW A;  3EK7 A;  1S3P A;  2MRD A;  1QLS A;  3SG7 A;  1YX8 A;  2WOS A;  2LVV A;  4ORC B;  1EH2 A;  1J1D A;  2R2I A;  1KK8 B;  5CSI A;  1EXR A;  1Y1U A;  1KSO A;  1XFX O;  2F2P A;  2L4I A;  1JC2 A;  1BR4 B;  1YRT B;  4YGC B;  2KAY A;  4CID A;  1XK4 C;  3I5H B;  1S6I A;  1VRK A;  2IS9 A;  5I2O A;  1J7R A;  2BE6 A;  4XJK B;  1XK4 A;  1N2D A;  2H61 C;  1DTL A;  1CDM A;  2MLE C;  1UHI A;  3ICB A;  2H61 A;  4BY5 A;  1S5G Y;  1TRF A;  1TIZ A;  3KEV A;  1K9U A;  4PHM A;  1R6P A;  4GBA A;  1UHH A;  2FCD A;  3TDU A;  2LCP A;  2OTG C;  2E30 A;  2QAC A;  1K90 D;  1LA3 A;  3O6B A;  4MSP A;  3DF0 B;  2JT3 A;  5HKW A;  3DVK A;  3E3R A;  4ZCV A;  1SR6 B;  1YRU B;  2KYC A;  4WQ3 A;  1B1G A;  1AK8 A;  2LLS A;  1SL9 A;  1BMO A;  1PVB A;  3RLZ A;  2E6W A;  1LIN A;  3CR5 X;  3BOW B;  4OR9 B;  2LV7 A;  1KK8 C;  2K61 A;  5D69 A;  2Q91 A;  2LE9 B;  4HRG A;  1PK0 D;  1H8B A;  1TCF A;  2WCE A;  1B47 A;  4F0Z B;  3I5H C;  1MHO A;  2M97 A;  4I5L B;  3F45 A;  2KI4 B;  3BUN B;  1A03 A;  1FBV A;  2JC2 A;  3MSE B;  4XJK A;  1Y1A A;  1C07 A;  1OMR A;  1QTX A;  3DVE A;  4XYN A;  2M1U A;  2K8M B;  2WC8 A;  4YGB B;  3C1V A;  1MQ1 A;  5HKZ A;  2KNE A;  3RM1 A;  2K7D A;  1DGV A;  3O4Y A;  1CDN A;  4DIR A;  4MZJ A;  1SNL A;  2V53 A;  2LNK A;  2CXJ A;  1PRW A;  4ICB A;  4NQG A;  1CFF A;  1GJY A;  3DF0 A;  1SR6 C;  2M1K B;  1SKT A;  3SJS A;  3H4S E;  4AOM A;  3EK4 A;  3SG2 A;  1QVI Z;  1UHK A;  2F3Z A;  2KQ6 A;  2JTT A;  1K2H A;  1MF8 B;  5I8N A;  1ZUZ A;  1CKK A;  3BOW A;  1F70 A;  2M7N A;  4C0L A;  2AMI A;  1OZO A;  1CFP A;  2KQY A;  1OE9 B;  3FWC A;  2PAS A;  1KFX L;  1M46 A;  1WLZ A;  3KPX A;  3OX5 A;  2KI4 C;  1CDL A;  4QJ3 B;  1QX7 A;  2LVJ A;  1BU3 A;  1S6C A;  1MR8 A;  2MJW B;  1QX5 B;  5CSF A;  4AQJ A;  3K21 A;  5CPV A;  1TTX A;  1JUO A;  1SBJ A;  2K7O A;  1BG1 A;  1IRJ A;  3CR2 A;  1WRZ A;  1WY9 A;  3EVV A;  1MUX A;  2K7C A;  1CFC A;  1IGV A;  2LMV A;  4A4C A;  5HLO A;  1GGZ A;  1NX0 A;  2I94 A;  5F6T A;  5I2Q A;  1BR1 B;  4A4B A;  2L2E A;  5IBW A;  2CBL A;  1CLL A;  1UP5 A;  2JWW A;  1DF0 B;  3LK1 A;  2KDH A;  5K89 A;  1K94 A;  2RGI A;  3WXA A;  2LHI A;  2LAN A;  5J3X A;  4GPL B;  4GAO A;  3EKH A;  1CM1 A;  1YUT A;  4MEW A;  4PE0 A;  3SG5 A;  1PAL A;  1YX7 A;  2NZ0 A;  1KWO B;  1RTP 1;  4PE4 A;  1S1E A;  2KFH A;  3OB1 B;  4MLW A;  1NX1 A;  1SCV A;  1SRA A;  3NSI A;  2LMU A;  5I2L A;  2L4H A;  1DJW A;  1TNP A;  2EHB A;  5KSZ A;  2KBM A;  2NCO A;  2QPT A;  2BE4 A;  3NSO A;  4YI9 A;  2ZNE A;  1ZOT B;  2KHN A;  2NLN A;  2KYF A;  1BJF A;  1XFZ O;  2F33 A;  1DJY A;  1DMO A;  1AJ5 A;  5JOL A;  1JF0 A;  3DVJ A;  4GNK B;  3CS1 A;  4CLN A;  1KFU L;  4MRY A;  1DT7 B;  1CFD A;  4YI8 A;  1IG5 A;  2NCP A;  1DF0 A;  2H2K A;  1GQM A;  2ZKM X;  3OB2 B;  3BUW B;  1QV1 A;  1QAS A;  4I5J A;  1RFJ A;  5CSJ A;  4YRU A;  1NX2 A;  4QJ4 B;  2Y9Z A;  1G8I A;  1KWO C;  1SW8 A;  3NXA A;  1OZS A;  1Y1X A;  1S26 D;  3O2P A;  1KSM A;  3KO0 A;  4MRX A;  1REC A;  1FPW A;  3NSK A;  1XO5 A;  2AAO A;  4GGN A;  1EG4 A;  4TNC A;  3BQ3 A;  1XA5 A;  3PFV A;  3SG3 A;  3KF9 A;  2Y9Y A;  1NWD A;  3OX6 A;  2L51 A;  1C7W A;  2M29 A;  4PAL A;  1AVS A;  4CFR A;  1FI6 A;  4OVN F;  1CMG A;  2LHL A;  4DS7 A;  1J7P A;  4HSZ A;  2L0P A;  1AUI B;  2LAP A;  1S6J A;  1HT9 A;  2OS8 B;  3EK8 A;  4ETO A;  1V1G A;  2CCM A;  3GK4 X;  3PSR A;  2MBX A;  3EVU A;  3VRN A;  5HKY A;  1UHN A;  2JT8 A;  5DKN A;  1F8H A;  1F4Q A;  2JRF A;  4NDC A;  2JUL A;  3AKA A;  1CM4 A;  1TNQ A;  1SCM B;  2DOQ A;  3SG6 A;  3IQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...