4OVNF

Voltage-gated sodium channel 1.5 (nav1.5) c-terminal domain in complex with calmodulin poised for activation
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
146
structure length
146
Chain Sequence
b'STEPLSEDDFDMFYEIWEKFDPEATQFIEYSVLSDFADALSEPLRIAKPNQISLINMDLPMVSGDRIHCMDILFAFTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSAMVIQRAFRRHLLQRSLKHASFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Calmodulin
publication title Regulation of the NaV1.5 cytoplasmic domain by calmodulin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 34
structure length 146
sequence length 146
chains with identical sequence G, H, I, J
ec nomenclature
pdb deposition date 2013-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ovnF01
1.20.5.1190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces iswi atpase 4ovnF02
2CBLA 3DD4A 4OVNF 1BOCA 2G9BA 2Y9YA 1DGVA 1M63B 1PULA 1DT7B 3DVMA 5KU1A 1L2OB 2PRUA 2KHNA 1YUUA 1QASA 2AUCA 4QJ3B 1SL9A 1WRZA 4M2OA 2LV7A 1S3PA 1LKJA 1OSAA 1K2HA 2MA2A 2TN4A 5AEQA 1QXPA 1KK8C 4PE0A 1M46A 2HETA 1YURA 4HSZA 1YTZC 4JQ0D 4ORAB 5CSFA 1OE9B 1JFKA 1KFXS 2VRGA 3RM1A 3HCMA 2PVBA 5J3XA 1AVSA 2HPSA 1TCOB 1CFPA 5HLVA 3FS7A 2JNXA 3DF0B 1GJYA 2BECA 3GK2A 4C0JA 1J1EA 5I2OA 3EVRA 1H4BA 1GQMA 2F8PA 2KAVA 2KGRA 2LMVA 2LC5A 3EVUA 2WC8A 2MLFC 2PASA 3PM8A 2K8MB 1UHNA 1ZACA 2ZFDA 4MVFA 5JJGA 2LMUA 1EG3A 3VRQA 1EL4A 2LAPA 1FF1A 2LVVA 2K7OA 3CGAA 3AAKA 1K9UA 3BUMB 4PDZA 4XJKB 1LVCD 4QJ4B 1PVAA 1AHRA 2MLEC 3SG5A 5BPJA 4MZLA 1WRKA 3PATA 1KSMA 1W7JB 3DF0A 1DJHA 5HKYA 3O2PA 1CDMA 3NXAA 3BOWB 3AAJA 4NDBA 3CTNA 2L2EA 2LLTA 4PHNA 4A4CA 2L4HA 2LHLA 5D7FA 1XFVO 2M49B 2NLNA 3VRNA 1KFUS 1JUOA 2LHIA 2PSRA 1B7TY 2MAZA 3WHTB 1A03A 1TCFA 4ZCUA 4ICBA 1OMDA 2H61C 1K96A 1S5GY 1F70A 1F54A 2P6BB 1R2UA 4BY5A 1NUBA 1CFCA 1QATA 1ZUZA 3AKAA 4XJKA 4BY4A 1QLKA 1CDNA 1S6JA 1W7IB 1Y1XA 5D69A 1YR5A 2L4IA 2IS9A 1OFCX 5JOLA 2L50A 1SRAA 3FIAA 5CSNA 3BOWA 4U8DA 1ALWA 1RROA 3DVJA 3FWBA 1CKKA 1A4PA 2I2RE 1OQPA 3LL8B 2QPTA 4NQGA 5AXIA 1JF0A 1IG5A 1SBJA 1JF2A 5CSJA 1F55A 1PSBA 5DKRA 3WHUB 5ER4X 4HRGA 3GK1A 5CPVA 1B4CA 1AUIB 4YGBB 3I5HC 3D0YB 1BODA 2M29A 4OR9B 4GGNA 1UUSA 1J7QA 1QVIZ 2H61A 1RK9A 1SKTA 3I5HB 4GGFC 1TIZA 1PVBA 1IQ3A 4MRYA 1M45A 1DJWA 1F4OA 1LINA 2JC2A 2WNDA 2E30A 3OP0A 3O4YA 4DS7A 4AQJA 1DJYA 1ZMZA 5IBWA 1DJIA 3PFVA 2KQYA 3PN7C 4I5JA 4DUQA 4YGAA 3JTDC 2M7NA 2NCOA 3O6BA 3PN7B 1NSHA 5DKQA 3FWCA 1RTP1 1EXRA 1FW4A 1DMOA 3JTDB 1KQVA 1DJXA 3IF7A 2CXJA 5PALA 4CFRA 2JT8A 3D0YA 1IH0A 2ZN9A 2BCXA 3F45A 1XK4C 2CCMA 5I8NA 2I7AA 1QIVA 4MSPA 1J7OA 3K21A 2SCPA 1HT9A 2OS8C 3WNXB 1ALVA 1TOPA 3ZWHA 1BU3A 4DIRA 1BMOA 4GGFA 1A75A 1UHJA 2JU0A 4D1EA 2OS8B 5GQQC 1Y6WA 2K61A 3E3RA 1L2OC 1QV1A 1OMVA 1WY9A 2ZRSA 1FPWA 2G2BA 4JWQA 1SW8A 3CLNA 3OB2B 1NCYA 1K95A 3CR4X 1U5IA 5I2QA 1FI5A 1IWQA 3A4UB 3SG4A 1YVHA 2NXQA 1ZOTB 1YUTA 1K8UA 2KYCA 2RGIA 4UPGA 1XK4A 2F33A 1XFXO 2LVIA 1IGVA 2V53A 3CR5X 1Y1UA 3ICBA 2LP2A 1V1GA 2JTTA 1PK0D 4WQ2A 4OCIA 4PE1A 1YX8A 2COLB 1PRWA 4ETOA 3BUWB 1J1DA 4HREE 2KNEA 2LCPA 2LLSA 2M9GA 1H8BA 1DF0B 4MN0A 3LK0A 1OZOA 1XFWO 2Y1NA 4GPLB 1CB1A 3QRXA 2JOJA 1UHHA 1F8HA 1JFJA 2LNKA 4MLWA 1CLBA 5F6TA 2JULA 1NCZA 2M8UA 1KCYA 1QLSA 1SNLA 1SK6D 1G33A 4GBAA 1MHOA 3PALA 4F0ZB 2L51A 3TS5C 1F71A 4PHJA 1K94A 1VRKA 3I5GC 3TS5B 1AJ5A 1LA3A 1QX2A 2Q91A 1BF5A 5B8IB 2L5XB 1EG4A 3NSKA 1DF0A 1KQMC 3I5GB 1NYAA 1R6PA 4FQOA 3SG6A 2KOTA 4PALA 2F3YA 4OV2A 2FOTA 4MRXA 2I18A 1KQMB 2AAOA 2Q4UA 4PCWA 2FCEA 1N65A 3C1VA 2H2KA 2KFFA 1Y0VH 1KK7Z 4YGDB 1TNXA 1RJVA 3SG7A 4QJ5B 1J7PA 1Q80A 3KEVA 4N1GA 4MZJA 4I5LB 1M31A 1QVIY 1DJGA 3LCPC 1XA5A 1KSOA 3M0WA 5I2LA 2BBMA 2BCBA 2K7BA 2MHHA 2L0PA 1DGUA 5HYDA 3LK1A 1NX2A 1BR4B 1DTLA 4FTGA 1FBVA 3BXKA 2I94A 4JPZB 1S36A 1CMGA 1SMGA 4CIDA 2WCFA 5G08A 1AK8A 2PMYA 3EKJA 1JWDA 1B8CA 4PHMA 2M7LA 1JSAA 2KBIA 1QTXA 4CLNA 1MUXA 1ODBA 4C0KA 1NX1A 5AANA 2BL0C 4N5XA 2Y1MA 1NP8A 2JNFA 1PALA 1DVIA 1PSRA 1CDPA 4HRHA 2BL0B 2HQ8A 2K7CA 3GK4X 1KFXL 2JTZA 3HX4A 4GFTA 2LUCA 1OMRA 2EC6C 1JC2A 4A4BA 1BT6A 3BUXB 1X02A 3AKBA 1GGWA 1LA0A 2EC6B 2KFGA 1GGZA 4TNCA 2LLUA 3EVVA 1N0YA 3LLEA 2L98A 1CNPA 2ISDA 1L7ZA 1CM4A 3WXAA 1IQ5A 1S26D 4WQ3A 4WRIA 5CSIA 2QACA 1S6CA 2B1UA 1B8LA 3KF9A 2ZNEA 4MBEA 2ZRTA 2KFHA 4YBHB 1C7VA 4C0LA 1K9KA 2M97A 3NSLA 1K9PA 4DRWA 3TUYC 1SPYA 5K89A 2SASA 1CDLA 1CLLA 3SIAA 1UURA 3KO0A 2F2PA 4P2YB 4YGCB 3TUYB 2LUXA 2M3WA 1CMFA 1UP5A 4MZKA 5AERA 2KGBC 5HLOA 1NX0A 2KI6D 3MSEB 4NDCA 4ORCB 3EK7A 2JPTA 1NCXA 1MF8B 1KFUL 2WCBA 3JVTC 1EH2A 2Y9ZA 3IQQA 2NCPA 2OPOA 1G4YR 4USLA 3H4SE 3I5FC 1IRJA 3JVTB 3EK4A 4IL1A 1Y1AA 1TNPA 1UHKA 3I5FB 2WORA 3NSOA 2F3ZA 4N1FA 4R1EA 2M1KB 4I5KA 1XFUO 4AOMA 2MRDA 2LVKA 1OOJA 2BKHB 2ZKMX 4PE4A 2LANA 2K0JA 1K90D 1QV0A 1NWDA 3KPXA 4YI8A 1B9AA 1BR1B 2EGDA 2JXCA 3CZTX 3OB1B 5DKNA 2FCDA 1DJZA 2CTNA 2LE9B 2BE4A 1QX5B 1IJ6A 2AMIA 2GGMA 1KK8B 3I5IC 4NDDA 2BBNA 1XYDA 1UWOA 1KK7Y 1SCVA 1CTRA 3I5IB 3PLFB 3VRPA 2NZ0A 3OHMB 1LXFC 2KSPA 1BJFA 1SL8A 1MXEA 1XO5A 3KHEA 3SG2A 1N2DA 4YGEB 4Q04A 3SIBA 1AP4A 3CS1A 4XYNA 1TN4A 2BKIB 2JWWA 1A2XA 2HF5A 3NSIA 3OX5A 2ZNDA 3RLZA 1MXLC 4CPVA 2ZN8A 2JRFA 1V1FA 1CFFA 2KI6C 1B47A 4M2QA 1D1OA 4P5OE 1B1GA 3A8RA 1XVJA 2LM5A 1OZSA 1CLMA 1YUSA 3CWGA 2DOQA 2KAYA 3OX6A 1K93D 1RECA 1YRTB 3BQ3A 1YRUB 1TRFA 1TTXA 2KI4C 5ER5A 1J55A 4CFQA 1BLQA 3BUOB 2BCAA 3TDZA 2KI4B 1CM1A 1B8RA 1C07A 3DVKA 2E6WA 3TDIA 1BG1A 1MWNA 1QJTA 2M0RA 3D10A 1F4QA 4DCKA 5KTYA 2MJWB 1MR8A 1NIWA 2LP3A 1SL7A 2KYFA 1S6IA 2KAXA 1IKUA 1G8IA 1FI6A 1SCMC 1XFZO 2WOSA 4E68A 3IQOA 2M1UA 1WDCC 4PE7A 3CR2A 5AFPA 1XFYO 1QIWA 1SCMB 3O78A 3BUNB 2CNPA 1RFJA 4YRUA 1SYMA 1WDCB 1WLZA 1WLMA 4OKHA 3TDUA 1NPQA 4ZCVA 1JBAA 2GV5A 4GAOA 2K2FA 2JQ6A 2JT0A 1B7TZ 1SR6C 1QS7A 2K2AA 1IJ5A 1NX3A 4GNKB 2HQWA 1S5GZ 5FYXA 2PALA 1ZFSA 3SJSA 4AQIA 1SR6B 3VRRA 2OTGC 2A4JA 4ORBB 5KSZA 1TNWA 2R2IA 3PSRA 3SG3A 2OTGB 1C7WA 2KBMA 3GOFA 5HKZA 2MBXA 4M2PA 2F2OA 2LMTA 4L9MA 2FJUB 1A75B 1E8AA 1KWOC 3BYAA 3VGOA 2CT9A 3EKHA 3TZ1A 1TNQA 1KWOB 2K7DA 1S1EA 4GUKA 4MEWA 2KQ6A 1AJ4A 1YVLA 2KDHA 1UHIA 1SY9A 1MQ1A 2JXLA 1YX7A 3DVEA 1EJ3A 2BE6A 1M39A 3EK8A 5TNCA 1U5IB 4PHKA 2O5GA 1CFDA 2LVJA 2Y5IA 2JT3A 4I5NB 1A29A 2Y4QA 1HQVA 2GGZA 1J7RA 1QX7A 2JZIA 1WRLA 4YI9A 2O60A 2WCEA 5HKWA 3VROA 3ZNIA 2D8NA 2EHBA 1RWYA
chains in the Genus database with same CATH superfamily
4GKGA 2LKMA 1OOHA 1BOCA 2Y9YA 3V2QA 2ZVNB 1DGVA 1Q86Q 5B66E 4CPGA 1M63B 1PULA 2WSEJ 1DT7B 1K9MQ 1J1DB 4GOFA 2PRUA 2KHNA 2BEQD 5CMZA 3A0BH 3W67A 4D6TD 1SL9A 3SFDC 3L75G 1S3PA 3PHLA 2TN4A 2RMZA 1L2PA 3SS4A 1JFKA 3P8MC 4IL6E 3M9BA 4TLFA 3HD7C 2BECA 1L4AD 1NU1D 3HTKA 1J1EA 4DT0A 5I2OA 1H4BA 1RH5B 5AVTB 2KGRA 1SQBD 3EVUA 1KD1Q 2MLFC 1JB0J 1SQQG 3KQGA 3LW5J 1GK6A 4KYNA 1GW3A 2ZFDA 4YTPC 4MVFA 5JJGA 1ZV8A 1EG3A 3VRQA 1EL4A 2M3EA 2N1TC 1LJ2A 2K7OA 4TT3H 3BUMB 4YPCA 1LVCD 1USDA 4D6TE 1GW4A 1WRKA 5HKYA 1KSMA 3O2PA 1CDMA 2FYZA 3D71A 3KHUA 3D75A 2FKWB 4NDBA 2L2EA 2LLTA 4PHNA 2L4HA 5D7FA 1NU1J 1X22A 3VRNA 1M1JC 1JUOA 2LHIA 2MAZA 3WHTB 2GUSA 5AVXB 4ZCUA 1L0LG 1K96A 4BY5A 2Y0CA 2C9NY 1SQBE 2FFDC 1BGYD 2ZVOB 2R5DA 1W7IB 1YR5A 2L4IA 2IS9A 3FIAA 5CSNA 4U8DA 2O3JA 1ALWA 3DVJA 3EWKA 1AQ5A 5D3OA 2V7QH 3U1CA 2OTLP 2FJYA 1SBJA 1URQA 1PSBA 1IFNA 4HRGA 5KKZB 4NPDA 1AUIB 4YGBB 1L4AC 1SVFA 4PV1B 4Y99B 1BODA 3P8CD 3PLNA 5AVYB 2KYVA 1UUSA 3CPWO 1IFJA 1QVIZ 2OYIB 1NH4A 3I5HB 3B5ND 1PVBA 1BGYJ 3OP0A 3O4YA 2W27A 3DZTA 5IBWA 1U7MA 2Z5IA 5DICA 2WC5A 2QE7H 1RY3A 3PN7C 2JWDA 1BGYE 2KSJA 2NCOA 1NSHA 1RTP1 1DMOA 1OW7A 2QJYC 3H1LG 1NTMD 1IH0A 3BVHA 2BCXA 1ZN5A 2CCMA 1NAFA 4MSPA 3CCUP 2SCPA 2QSIA 3ZWHA 2ZT9B 4GGFA 1YYCA 2JR8A 2OS8B 5GQQC 5KLVD 3P8CE 3E3RA 1PGQA 1LTAC 4R4MA 1A02F 2NPSD 1OMVA 1SW8A 1NCYA 5AW5B 3AE7C 1HWTC 5I2QA 1FI5A 3A4UB 3SG4A 4MN4C 5DJTB 3M0DA 1JY2O 3B6XA 2RGIA 1JY2P 2BEZF 1KILA 1XK4A 1H8AA 1IGVA 3CR5X 1NTME 4KT0J 1KMIZ 1PRWA 4ETOA 2H89C 1FOSE 1J1DA 3B7AA 4D6TG 1EC5A 1Q7YQ 1H8BA 2RKLA 3CWBD 2KXPB 3S0BA 1DF0B 5AW8B 3LK0A 1S4XA 1OZOA 1DEKA 4U7JA 1GL2B 5KLVE 3A0HH 2Z4EA 4FQTA 4GT1A 1JFJA 2LNKA 1K05A 4MLWA 1Z2CB 2JWAA 2OARA 2JULA 1QLSA 1SK6D 1G33A 5APWA 1SQBG 3Q5RA 4L73A 2ZJSE 1IFPA 2KSEA 1AJ5A 1QX2A 3NSKA 3L70D 1L0NK 3N4XA 1NYAA 4RO0A 2R32A 4DJGA 3M91A 1CSBA 5I94A 2NPSC 1N65A 2H2KA 2KFFA 3CX5H 3PH0A 1VQ9P 2J5UA 2KP8A 2FYUD 4YGDB 1RJVA 3CWBE 3CC4P 1Q80A 3KEVA 5AW3B 1G1IA 1RHZB 1UIXA 3OGNA 3H1HD 3I56P 1M31A 1BE3J 2XKMA 1DJGA 3N7NA 1NTZD 4JYCA 1KSOA 2BCBA 2L0PA 3VYIA 1M57D 2QJKC 1CMGA 3L70J 5G08A 1AK8A 2E76B 1PP9D 4PHMA 2M7LA 1ZW0A 3KPEA 1MUXA 4C0KA 3L70E 1S2EA 4N5XA 3JCUH 1NP8A 2B87A 2OQQA 3HUSC 2BL0B 1R5SA 3H1HJ 2K7CA 4IOIH 3V4WA 1D7MA 2E42A 2FYUE 2EC6C 1JC2A 1BT6A 3BUXB 2L91A 4H44D 3WUUA 3RK2B 3SWYA 1DX7A 1NTZE 1N0YA 3DY9A 1CNPA 5CCHA 2ISDA 1CM4A 3D6ZA 3UO9A 2Q3IA 2QACA 5AVUB 1N7SC 2K60A 2ZNEA 1PP9E 2KFHA 2B88A 3CDNA 3TUYC 2C0WA 4I7ZB 1NTMG 3B8EB 5K89A 1CDLA 5K5GB 3SIAA 1DD4A 4P2YB 3CCSP 2LUXA 2P71A 4MZKA 3JC22 2KGBC 1NO4A 4ORCB 2G3AA 2Y0EA 3CCMP 2V4HA 2OYHB 2A06D 5KLVG 2OPOA 3RL0D 2Y0DA 3JVTB 4IL1A 3PP5A 3I5FB 2D2CD 1AFOA 1YJWP 4N1FA 4R1EA 5AVRB 2G8YA 2I8DA 2P58A 5B5EH 1SQQK 1OOJA 2WCMA 3GF7A 2ZKMX 3D73A 1KB9H 2K0JA 1EDIA 5AVZB 5AW7B 3CZTX 4H44C 3L71J 5HL1A 3FGAD 2JKVA 2GUVA 4HB1A 3R1OA 1KK8B 4NDDA 1KK7Y 1SCVA 3CWBG 2XU6A 2A06E 2NZ0A 3L74J 3VOPA 1MXEA 2WITA 3BASA 3F5HA 1OWAA 1L0LK 1OW4A 2QM7A 4UB8H 4WBAA 2WC6A 3CZ2A 1LS8A 1TN4A 1MZ9A 2LXBA 2HF5A 2WWWA 1W2EA 3HE5A 3MHVA 3FE9A 1CFFA 1V1FA 3NFQA 2KUBA 1D1OA 1B1GA 1XVJA 1CLMA 1YUSA 2DOQA 1K93D 3H1KJ 5ER5A 3RL0C 3NGVA 3FWNA 2KI4B 2FYUG 2D2CC 3AEEC 2M0RA 2KYFA 2KAXA 1IKUA 1G8IA 1FI6A 1SCMC 1IC2A 5KJ7D 1OX3A 3IQOA 4F7FA 1NTZG 3CR2A 3GF3A 3KZIH 1RF1C 3PTZA 1OIPA 1L0NJ 2FYNC 2Q7CA 1LWUB 2JQ6A 1LTGC 1PP9G 2K2AA 4GNKB 1LTJB 2HQWA 5CCGD 2E43A 2PALA 3SJSA 4AQIA 1SR6B 2OTGC 2A4JA 5KSZA 1TNWA 3Q8IA 1S1CX 3GOFA 1A02J 2IPPA 2F2OA 2E5TA 3U1AA 1N8RQ 1FBMA 2FJUB 2KS1A 1KWOC 1E8AA 3E1RA 2YMYA 1W2BO 2WPRA 2CT9A 1IFIA 1S1EA 5EL2A 2BE6A 1M39A 4H0LC 2XDJA 2Y5IA 3S9OA 1A29A 2GGZA 3S1KA 3VROA 1C3YA 5TISH 2KPHA 2AEMA 2EHBA 1PPJD 2PP6A 2BNXA 3DD4A 1NAYA 1EZVD 1TUJA 3AE5C 2G9BA 1JY2N 5KJ7C 1M56D 3G3ZA 5KU1A 4PD4I 3FXEA 1L2OB 4C7NA 3CMEP 3HTKB 1J1EB 3JSVC 2A06G 2KZJA 3G4SP 1NJIQ 3IFMA 4M2OA 2P7JA 4I6MC 1OSAA 5CCGC 1QXPA 2YMKA 1M46A 1SQBK 5E79H 1YTZC 1FZCB 3CD6P 1SQQD 2WPVB 1TCOB 4PJ0E 3IF4A 4PV1D 3OBVA 3FS7A 3L75J 3GK2A 2E75B 1PPJE 3D78A 1EZVE 2LC5A 2WC8A 2UWJE 2PASA 3PM8A 4GDOA 2LMUA 2WSFJ 3RL0g 1Y9BA 4PDZA 1K9UA 2MKVA 1LP1B 1AHRA 2ERBA 1L0LD 2MLEC 2IYPA 1SQQJ 5KLIC 4MZLA 3PATA 1W7JB 3DF0A 1AVYA 2KOGA 3AAJA 2FBWC 1VQLP 4RJTA 1LTBC 2ZT9D 3OAKA 1SQQE 3O4XA 2LHLA 3H32A 2J59M 2L5YA 1B7TY 1A03A 2O01N 1WT6A 1TCFA 3MIWA 1F70A 1F54A 2P6BB 5BVZA 4WY4A 1CFCA 3MP7B 1QATA 3AKAA 1CDNA 2ITAA 1Y1XA 2QRXA 5AVQB 4KHXA 3L4LA 3BOWA 1L0LJ 1CKKA 1A4PA 2I2RE 2P2UA 1OQPA 1N73C 5EFWB 5AXIA 5KKZC 1TU3F 1L0LE 1F55A 4Y99C 5DKRA 2OYIC 1KQFB 1DELA 5CPVA 3I5HC 2ZYGA 1KN7A 2H61A 1OOIX 1SKTA 3H1LD 4MRYA 1M45A 1M8OB 1GL2D 2E30A 1T8ZA 4PD4D 1NTMK 3O6QB 4N6JA 1DJYA 1ZMZA 1P84D 4NPFX 3PFVA 2KQYA 3CL3D 4I5JA 4YGAA 2M7NA 5CHXA 2WSCJ 3PRJA 3FWCA 3I55P 3JTDB 1DJXA 2CXJA 5KLVK 3FE6A 2ZN9A 4IJ7A 3F45A 2W83C 1DD3A 2IBZD 2ZT9C 1QIVA 2OS8C 1KILB 1TOPA 1YIJP 1UHJA 3WU2H 3H1LJ 1JCCA 3QWOC 2OTKE 3A3YB 2G2BA 3H1LE 4PD4E 2QEXP 1VQ4P 3DYEA 2KNCA 1P84E 3NHTA 1PPJG 1EZVG 2QM8A 3CCVP 1K8UA 4UPGA 3GHGA 2V53A 1Y1UA 3ICBA 1S3JA 2A45H 2E76D 1CI6A 1PK0D 3USSA 4OCIA 4PE1A 2IBZE 5AW1B 4HREE 3AE1C 4YXWH 1OZHA 3H1JG 1GL2C 3VN0A 4MN0A 3TF5A 1BCCG 4GPLB 2P67A 4JBZA 3QRXA 3S4RA 4RESB 1F8HA 4D6TJ 3RK2D 3II6A 4HKZH 1FZCA 1JY3O 5KAIE 2I1JA 3KXDA 4IL6X 4GBAA 3R4YA 5AW9B 1MHOA 1JY3P 1SQVE 4HJGH 4I2LC 4W7YA 1H89A 3KDPB 2FYUK 2XNDH 1BF5A 5B8IB 3I5GB 4FQOA 3SS5A 1U7JA 2KOTA 3HE4A 1SQPD 2FOTA 4MRXA 1S5LH 2Q4UA 2AAOA 4PCWA 1NTZK 1SQBJ 1FDIA 2FCEA 1GZLA 3D6YA 2IFMA 1FAVA 1LP1A 1QVFO 4MZJA 4I5LB 2B87B 1QVIY 4UB6E 1SSEB 1XA5A 1N86A 2PRRA 2MHHA 1DGUA 3LK1A 1NX2A 4FTGA 1FBVA 1IIOA 5GTHE 2E76C 2I94A 3I5CA 5AW0B 1SMGA 1FZEA 3Q1MA 3EKJA 1BDCA 1QTXA 1ODBA 2BL0C 1SQPE 2OGUA 1PALA 1DVIA 1CDPA 1NYHA 2HQ8A 2O01J 4M3LA 1FZFA 1KFXL 3RK2C 2LUCA 4A4BA 1X02A 2BASA 3BATA 4OH8B 3CXHI 1GGZA 1OOFA 3EFGA 1SQXD 2M8RA 1KQSO 4EOTA 5CSIA 4AQRD 3SWKA 3B87A 1FDOA 3V5BA 1B8LA 3M9HA 3PM2A 3AE8C 3O6QA 4I7ZC 4XE5B 2YKQA 2M97A 3NSLA 4DRWA 1MFZA 1SPYA 4B86A 2IBZG 4IFFA 2OYHC 1NX0A 1QWVA 3MSEB 3M0AA 1CW5A 3IN6A 4L75A 1BDDA 1EH2A 3JVTC 4WVZA 1NTMJ 3TNUA 4BWNA 2QA4P 4XFJA 3H4SE 3I5FC 1JOCA 1SQXE 1W5CE 3EK4A 3R72A 3CMAP 1OVRA 1KC8Q 2AEFA 1XFUO 4AOMA 2MRDA 3BRTB 3B5NC 1N2DC 1SQVG 5KLVJ 4AYCA 3UNWA 1BR1B 3B71A 3P32A 3OB1B 5DKNA 5H2FH 2PGDA 2BE4A 1QX5B 1RF0C 3HE5B 1ZOYC 2E5YA 5CBNA 1UWOA 1RE4A 3MZWB 3I5IB 3VRPA 1LXFC 1SL8A 3KHEA 3A5TA 1Q90D 2FXMA 3D76A 3SIBA 4XYNA 3CWBJ 2XV5A 2BKIB 1RE3C 1VQ5P 1MFTA 4CPVA 3GMAA 2ZN8A 1B47A 2N1TB 2YO2A 1GDTA 3L47A 1ZP0C 3E1IA 2R5BA 3OX6A 1RECA 1SQPG 3CXHD 3BQ3A 2KI4C 2E74B 1DEBA 1KYOH 4CFQA 1BLQA 1IFMA 3BUOB 2BCAA 3TDZA 1Y47A 1VQ6P 1B8RA 3O8ZA 3OJAB 1SL7A 2WMMA 1FS0E 4OGQB 2W8ZA 1MKMA 2M1UA 2PYQA 2H8PD 5AFPA 1QIWA 3BUNB 2CNPA 3MUDC 2FYUJ 1WDCB 1WLZA 2KS1B 4OKHA 1LWUC 2K9JA 2K3RA 4ZKUA 3VMZA 1LTJC 1IO4A 1SR6C 1NTZJ 1IJ5A 1NX3A 5KAFE 1S5GZ 3BFAA 5B66H 2GM4A 3AE3C 3CXHE 3PSRA 1OXZA 2E75D 3L36A 2KBMA 5HKZA 2MBXA 2WSEH 4M2PA 2LMTA 4L9MA 1PP9J 3BYAA 3EKHA 4U3FD 3TZ1A 1IZNB 4GUKA 1SFCA 1SQXG 1R5LA 3VB1A 1AJ4A 1OW6A 1UHIA 1MQ1A 2JXLA 4IL6H 5AW4B 4C7NB 1EJ3A 1U5IB 4PHKA 2LVJA 1EDLA 1AJYA 2JJLA 1HQVA 1J7RA 1QX7A 1YTZI 2HODB 3LIDA 3QMEA 2YXRB 2D8NA 2B9BA 2QJPB 1URQD 4L74A 2ZYDA 2JEEA 1VL2A 1J1EC 3LW5H 2WPSA 1JM0A 1YUUA 2GA1A 3F89A 1QASA 1KQLA 2C0XA 4QJ3B 4U3FE 3Q5PA 1OMIA 5AW2B 1T2KD 2LV7A 4LLHA 3TYYA 3V2LA 1K2HA 2MA2A 5AEQA 3FXDA 4PE0A 5DJUB 5APXA 4ORAB 1YURA 5CSFA 1OE9B 1KFXS 2VRGA 3RM1A 1CFPA 1MUUA 1AVSA 2E75C 3DF0B 1GJYA 4C0JA 1EZVI 3CCEP 1SLQA 2F8PA 2KAVA 1YI2P 3BJHA 2LMVA 3H32B 2K8MB 4IFMA 1NVOA 3WUTA 1ZACA 4K35A 1JUNA 1T3UA 2LAPA 2LVVA 4WY4B 3WUVA 3AAKA 4QJ4B 3M9QA 2KZIA 1PVAA 2OTJP 1DJHA 3A0BE 2PAJA 3BOWB 3CTNA 3V2PA 1KILD 3HD7A 1QLED 1URQC 1XFVO 3OA7A 2O01H 4ICBA 1OMDA 3T97A 1R2UA 1QEXA 5APUA 1NUBA 4XJKA 1ZUZA 4BY4A 3VMYA 1S6JA 2N1TA 5D69A 1T2KC 1QVGO 1OFCX 5JOLA 2L50A 1KFMA 1SRAA 4L76A 1RROA 2M5AB 3FWBA 1AA0A 2YNYA 3LL8B 2OYOA 1IK9A 1JF0A 1LTSC 5CSJA 3SS3A 1WRGA 1M1JA 3GK1A 1B4CA 5KTBA 1JTHA 4GGNA 4JYBA 1J7QA 1KILE 1RK9A 2QEHA 4Z1MH 4GGFC 2JDIH 1IQ3A 3AE6C 4KJMA 1LINA 2FFDA 1LNQA 1KZUB 4DS7A 2IYOA 4AQJA 3G6EP 3S0AA 2Z5HA 4DUQA 3JTDC 1TUZA 3O6BA 5CJ4A 3M0DC 1XTCC 2KNCB 4CFRA 1G1JA 1S72P 2JT8A 2PQLA 3D0YA 1PFIA 4PT1A 2KLDA 3BCCG 3LIEA 1KILC 1XK4C 3L72D 1L4AA 2I7AA 2V7QJ 1YQ4C 4U3FG 3WNXB 3GHGB 1N7SB 2HR3A 2JU0A 2ZAEB 4D1EA 1NTKE 2HG5D 1J1DC 1CI6B 1SQVK 2Q3EA 3A2AA 3L73E 1PL5A 1X8YA 2ZRSA 4NPEA 1P84I 2L5GB 1GU5A 1U5IA 1VQ8P 1IWQA 1OVUA 1YVHA 4LGDE 2NXQA 2M0BA 3VMXA 3H1JD 1YUTA 2HODA 1XFXO 2LVIA 1BCCD 2LP2A 1V1GA 2JTTA 2IBZI 4C46A 1M7LA 3EQ2A 3CCQP 4WQ2A 5CCHD 3L72E 1YX8A 2COLB 2PFXA 1FJPA 3BUWB 2POHA 2YIUB 2LCPA 2LLSA 1QL2A 4WWIA 2XNXA 3HE4B 1FJKA 2JO1A 2JOJA 3GW6A 2DW3A 3C9IA 3QH9A 2QDIA 1GMJA 2A45G 3H1JJ 1CLBA 1EXJA 1SQPK 1NCZA 4IFDK 1KCYA 1SNLA 4H13B 1T14A 3PALA 4F0ZB 2L51A 2ZXXA 1BCCJ 3H1JE 1IK7A 2IFNA 1K94A 3I5GC 3TS5B 4N3YB 1LA3A 2Q91A 1BCCE 2L5XB 1EG4A 3IVTA 3TGUD 1R6PA 3SG6A 2QG4A 4OV2A 2I18A 1KQMB 5APQA 1HH0A 3V4QA 2WPQA 4QJ5B 1TNXA 3TDKA 1M1KQ 2WSSH 3AE9C 4N1GA 3CX5D 5AVWB 2C9LY 1G2CB 3M0WA 1YBKA 3A0HE 2K7BA 1BR4B 1H88A 3R1VA 3BXKA 3BFBA 1LT9B 5CCHC 4PV1C 2P1JA 2WCFA 1JWDA 1B8CA 1JSAA 4CLNA 2NPSA 1NX1A 3TGUE 5AANA 4Y28J 1ZMEC 2Y1MA 1S9KE 2M3BA 2KIKA 1SQXK 2LXCB 2YGUA 2IZ1A 3HX4A 3H1ID 4GFTA 2M5AA 1OMRA 1VQPP 1HTLC 3AKBA 1NTKG 2RH0A 3CX5E 1LA0A 3L73G 2KFGA 4TNCA 2LLUA 1QX8A 1GTWA 3EVVA 1L7ZA 1IQ5A 1S26D 4WQ3A 4WRIA 3RBXA 3TNUB 1S6CA 2B1UA 3VP9A 3KF9A 1H0TA 1CZQA 4K3AA 3BFHA 3HUSA 4N78D 4YBHB 1C7VA 2Q1KA 3NXSA 3R1PA 3SFEC 1CLLA 3Q5SA 2F2PA 1CMFA 2N1TD 3L72G 3NHIA 1UP5A 3JCUE 4BXLA 1N7LA 2KI6D 4H0LB 3H1IE 1ZRTD 1NCXA 1MF8B 1KFUL 1SQVD 2B89A 2E74D 2Y9ZA 1Z56A 2NCPA 3WMM0 5APYA 1G4YR 1IRJA 1JCDA 1N7SA 3D70A 1XFRA 1Y1AA 4XA4A 1TNPA 1UHKA 3S0GA 2WORA 3NSOA 4OGQD 2KLVA 3CCRP 2IZ0A 2M1KB 1FZBA 1K04A 2IX7C 2Q6QA 4O9BA 1YQ3C 3CCJP 1QV0A 4N78E 1NWDA 2O1KA 1B9AA 2JXCA 2FCDA 1KB9D 1DJZA 3E7KA 1IJ6A 4GODA 2AMIA 1SQVJ 2WCJA 3I5IC 1IFDA 2BBNA 1XYDA 1ZRTE 2W6AA 3MD0A 1ZR2A 3PLFB 3RZSA 1KFNA 2KSPA 1BJFA 4EDFA 1Q81Q 1XO5A 2N9YB 2KB7P 3SG2A 1AP4A 1PIXA 2SPZA 1LTTC 3AECC 3NMDA 1MXLC 1VF5B 2JRFA 2KI6C 4M2QA 3SSUA 5B5EE 3SWFA 3A8RA 3TGUG 2LM5A 2E74C 1KB9E 2KAYA 4DZOA 1YRTB 2K9JB 1YRUB 5KLIB 4YXDC 2WCKA 3DVKA 2E6WA 2W6BA 4DCKA 2WQYC 4OGQC 1VQ7P 4GIFA 1NIWA 3HRNA 1NU1E 1S6IA 1XFZO 2WOSA 4E68A 1SQPJ 2R44A 1WDCC 4PE7A 1XFYO 2QEBA 3O78A 4YRUA 1NWQA 1ZR4A 3CZ0A 1WMKA 2JPOA 1G2CA 3TDUA 1NPQA 4HH2A 4UB8E 2GV5A 1ORGA 1PGPA 3RK3B 1SFCB 3AEAC 5FI2A 5FYXA 1N73B 1ZFSA 1LT9A 3VRRA 1YJNP 1JEKA 3H25A 1JMMA 3SG3A 4HYTB 1FZAA 2H43A 4RKUJ 1NHLA 3H1IG 4AUWA 1A75B 3VGOA 3CZ1A 3Q2YA 1HBWA 2ZYAA 1RF1A 1TNQA 5APSA 4WY4D 2FXOA 2KQ6A 1YVLA 3CC2P 3DVEA 4PJ0H 2NZ2A 2QEVA 4EI2A 5TNCA 1CFDA 3D77A 1HGZA 4LC1A 3KZIE 2JZIA 1SQXJ 2WCEA 2QJPC 1T3JA 4C7RA 2AXTH 1RWYA 5M1BA 2CBLA 4OVNF 2HFED 3DVMA 1BSNA 1OW8A 2ZXEB 2WSFH 2AUCA 2J58A 1WRZA 3AEDC 2XZRA 3R2PA 1RQUA 2HPCB 1LKJA 3TK1A 3L37A 2YO3A 2NRGA 4JF7A 1KK8C 2HETA 4JQ0D 2QVAA 4HSZA 5BU8B 3HCMA 2HLOA 2PVBA 5J3XA 2HPSA 3FE8A 5HLVA 4ZKPA 1W9ZA 2JNXA 5KJ7A 3EVRA 1QGKB 1GQMA 3U59A 1Y8AA 3HD7B 3P7KA 5TISE 5L8RJ 1UIIA 1UHNA 1GK4A 3AEBC 4WY4C 5GTIH 2K1AA 3T97B 1U57A 1FF1A 1BE3D 3CGAA 2R3SA 4XJKB 1HGVA 1NU1G 5CCGA 4QMAA 3SG5A 5BPJA 2Q9IA 5AVVB 2GTEA 1XTGB 3NXAA 4ZNCA 4A4CA 3H6PA 1HUCA 1N7SD 1M90Q 3C8VA 2M49B 2NLNA 2A45I 1KFUS 5E79E 1VPCA 2PSRA 1M1JB 2H61C 1S5GY 1FDMA 1JTHB 1USEA 1QLKA 3V6IA 4EIJA 4WB4A 3UIAA 2WSCH 2FFDB 1NTKK 1P28A 2BAPA 4JD9A 1BE3E 1DH3A 3RBZA 1K73Q 2QPTA 4NQGA 1IG5A 1BGYG 1JF2A 1GM0A 3WHUB 3GG2A 5ER4X 2QEOA 1EDKA 1DEEG 3PJSK 3V2NA 1PGOA 3FWLA 1ZXGA 3D0YB 2M29A 4OR9B 4PD4H 1AQTA 1L4AB 1TIZA 1P84H 2BCCD 3ITKA 1DJWA 1F4OA 2JC2A 2WNDA 1RQVA 3BCCD 3CI9A 1DJIA 3N7HA 3H1HE 2WZ7A 3CABA 3B88A 3PN7B 5DKQA 4H13D 1N73A 1EXRA 1FW4A 2P70A 1KQVA 1JMBA 3IF7A 5PALA 2OYIA 4JKTA 2QJYB 5I8NA 1YTZT 3GHGC 1J7OA 3K21A 1HT9A 3L4AA 1ALVA 1AVOA 2VRSA 1BU3A 4DIRA 1BMOA 1A75A 4ASVA 1YITP 2BCCJ 1Y6WA 2K61A 3VTPC 1L2OC 3BCCJ 2H7HA 1X9VA 3AEFC 1KORA 1QV1A 1PZQA 5KAIH 1FPWA 1WY9A 1NGMB 2BCCE 3W68A 4JWQA 3G9RA 1ZLLA 3CLNA 4U3FJ 3OB2B 2AEJA 2W6JH 3AE2C 1K95A 3VP8A 3CR4X 3BCCE 3L71D 4EYYQ 1HF9A 3DXLA 3Q3DA 1Q2NA 1ZOTB 2R3CA 1LTIC 1K8AQ 1FZCC 2KYCA 2F33A 3L74D 5AW6B 1C3ZA 2YIUC 3ZDMA 2KNEA 2M9GA 1JY3N 1VDFA 3AEGC 2MJZA 3B5NB 4UB6H 1XFWO 2Y1NA 1CB1A 1QL1A 2HPCA 3WU2E 1UHHA 5GTHH 3TSIA 4H13C 1FE6A 3L71E 5F6TA 2M8UA 4ASWA 1FU1A 1F71A 1JNMA 3H1KD 3TS5C 4PHJA 1VRKA 4OWFA 1DF0A 1KQMC 3L74E 4PALA 1GL2A 2F3YA 1BE3G 2LR2A 4INXA 1KQGB 3C1VA 3K1EA 3CLQA 1Y0VH 3S0DA 1GU4A 1KK7Z 1JO5A 2NPSB 3SG7A 1J7PA 2H8VA 1L0ND 1VQKP 1PGJA 3L70G 4H0LD 3PJIA 3GLMA 3MGNA 3LCPC 1OVVA 2CK3H 2ZFCA 5I2LA 3L35A 2BBMA 1LT9C 5HYDA 5CJ0A 1DTLA 1BSHA 4JPZB 3H1KE 1S36A 1KV4A 1KTMA 3H1HG 1SS1A 4CIDA 3CCLP 2PMYA 1GD2E 2QJKB 1NTKD 2KBIA 3L73D 2JNFA 2JP3A 1PSRA 2K88A 1VQNP 1H0TB 4HRHA 3OW2O 4BRYB 3GK4X 3HUSB 3IR9A 2JTZA 1S5LE 3CX5I 4W80A 1YJ9P 3EFFK 1L0NE 2O1JA 1GGWA 2EC6B 2BCCG 2N9BA 3LLEA 3ABVC 2L98A 2WT7B 3WXAA 1DQEA 4W7ZA 1KYOI 1NTKJ 4MBEA 3L73J 5FI7A 2ZRTA 1OOGA 1S5LX 1EDJA 2WCLA 2WVRA 4C0LA 1K9KA 1HJ0A 1K9PA 2H88C 1VF5D 2SASA 2RN0A 1UURA 3KO0A 3TUYB 2I1KA 4YGCB 2HYNA 2M3WA 2WTYA 5AERA 3M06A 5HLOA 1SP4A 2KLEA 3MTUE 4NDCA 3EK7A 2JPTA 1NOHA 2W90A 5C39A 2WCBA 5CBOA 5APTA 3IQQA 4USLA 3L72J 3L75D 1RE4C 1X0TA 1R8EA 1NKZB 2F3ZA 4OZDA 3B4SA 3L71G 3AE4C 4I5KA 2P10A 5TJHA 2LVKA 1DIPA 1E5WA 2CPBA 3CYZA 2BKHB 4PE4A 2Q5UA 2LANA 1K90D 3NTNA 3RGUA 3KPXA 4YI8A 2EGDA 3RK3D 2OYHA 1NU1K 3L74G 1SFCD 2CTNA 2YXQB 2LE9B 4H44B 1FZGA 2K37A 2GGMA 1VQMP 4GOEA 1CTRA 3OHMB 3K5BA 3V2RA 1DC1A 3B86A 3L75E 3B5NA 1IJDB 1N2DA 1X79B 4YGEB 2AXTE 4Q04A 1HJBA 1FOSF 1S9KD 2CPSA 3CS1A 2JWWA 1VF5C 1A2XA 3NSIA 3OX5A 1T6AA 2ZNDA 3RLZA 3H1KG 5KAFH 1LT1A 4INWA 2AXCA 1NKNA 1FC2C 5APVA 5BU5A 3CXHH 1KB9I 1RF0A 4ZMDA 3RK3E 4P5OE 1OZSA 3CWGA 3BRVB 1EXIA 1Q82Q 2L2CA 4DOJA 1TRFA 1TTXA 3A7OA 2KLUA 1J55A 3KYQA 1J2JB 5H2FE 1CM1A 3RL0B 1C07A 3TDIA 1BG1A 1URQB 1MWNA 1QJTA 3D10A 5KTYA 1F4QA 1KYOD 2MJWB 1MR8A 2LP3A 1L0NG 2FY8A 2QIWA 3TGUJ 2D2CB 3C1LA 2KI7B 3IAOA 3L4FA 1RE3A 1SCMB 2IDBA 1RFJA 1SYMA 5AVSB 3RK3C 1WLMA 2KK7A 1Z4HA 1MV8A 4ZCVA 1SFCC 1JBAA 4GAOA 2K2FA 5GTIE 1RF1B 2JT0A 1B7TZ 1QS7A 3D74A 2FYNB 3S0EA 1AV1A 4ORBB 2R2IA 4I1LA 2OTGB 1C7WA 1YHQP 3HD7D 3G71P 3EG5B 1KYOE 4BRYA 3VMAA 3CC7P 2YKPA 2FXPA 3MUDA 1EQ7A 1KWOB 1LWUA 2K7DA 4MEWA 2KDHA 1LTJA 1SY9A 1VQOP 1YX7A 3H1IJ 1HVVA 3EK8A 2YKOA 2O5GA 1E79H 2JT3A 4I5NB 2WT7A 2Y4QA 2K9YA 2WCHA 1LGHB 1WRLA 4YI9A 2O60A 5HKWA 3S0FA 1TWOA 5FI6A 1PV3A 3FX0A 3ZNIA 4R4LA 4A7PA
chains in the Genus database with same CATH topology
2CBLA 3DD4A 4OVNF 1BOCA 2G9BA 2Y9YA 1DGVA 1M63B 1PULA 1DT7B 3DVMA 5KU1A 1L2OB 2PRUA 2KHNA 1YUUA 1QASA 2AUCA 4QJ3B 1SL9A 1WRZA 4M2OA 2LV7A 1S3PA 1LKJA 1OSAA 1K2HA 2MA2A 2TN4A 5AEQA 1QXPA 1KK8C 4PE0A 1M46A 2HETA 1YURA 4HSZA 1YTZC 4JQ0D 4ORAB 5CSFA 1OE9B 1JFKA 1KFXS 2VRGA 3RM1A 3HCMA 2PVBA 5J3XA 1AVSA 2HPSA 1TCOB 1CFPA 5HLVA 3FS7A 2JNXA 3DF0B 1GJYA 2BECA 3GK2A 4C0JA 1J1EA 5I2OA 3EVRA 1H4BA 1GQMA 2F8PA 2KAVA 2KGRA 2LMVA 2LC5A 3EVUA 2WC8A 2MLFC 2PASA 3PM8A 2K8MB 1UHNA 1ZACA 2ZFDA 4MVFA 5JJGA 2LMUA 1EG3A 3VRQA 1EL4A 2LAPA 1FF1A 2LVVA 2K7OA 3CGAA 3AAKA 1K9UA 3BUMB 4PDZA 4XJKB 1LVCD 4QJ4B 1PVAA 1AHRA 2MLEC 3SG5A 5BPJA 4MZLA 1WRKA 3PATA 1KSMA 1W7JB 3DF0A 1DJHA 5HKYA 3O2PA 1CDMA 3NXAA 3BOWB 3AAJA 4NDBA 3CTNA 2L2EA 2LLTA 4PHNA 4A4CA 2L4HA 2LHLA 5D7FA 1XFVO 2M49B 2NLNA 3VRNA 1KFUS 1JUOA 2LHIA 2PSRA 1B7TY 2MAZA 3WHTB 1A03A 1TCFA 4ZCUA 4ICBA 1OMDA 2H61C 1K96A 1S5GY 1F70A 1F54A 2P6BB 1R2UA 4BY5A 1NUBA 1CFCA 1QATA 1ZUZA 3AKAA 4XJKA 4BY4A 1QLKA 1CDNA 1S6JA 1W7IB 1Y1XA 5D69A 1YR5A 2L4IA 2IS9A 1OFCX 5JOLA 2L50A 1SRAA 3FIAA 5CSNA 3BOWA 4U8DA 1ALWA 1RROA 3DVJA 3FWBA 1CKKA 1A4PA 2I2RE 1OQPA 3LL8B 2QPTA 4NQGA 5AXIA 1JF0A 1IG5A 1SBJA 1JF2A 5CSJA 1F55A 1PSBA 5DKRA 3WHUB 5ER4X 4HRGA 3GK1A 5CPVA 1B4CA 1AUIB 4YGBB 3I5HC 3D0YB 1BODA 2M29A 4OR9B 4GGNA 1UUSA 1J7QA 1QVIZ 2H61A 1RK9A 1SKTA 3I5HB 4GGFC 1TIZA 1PVBA 1IQ3A 4MRYA 1M45A 1DJWA 1F4OA 1LINA 2JC2A 2WNDA 2E30A 3OP0A 3O4YA 4DS7A 4AQJA 1DJYA 1ZMZA 5IBWA 1DJIA 3PFVA 2KQYA 3PN7C 4I5JA 4DUQA 4YGAA 3JTDC 2M7NA 2NCOA 3O6BA 3PN7B 1NSHA 5DKQA 3FWCA 1RTP1 1EXRA 1FW4A 1DMOA 3JTDB 1KQVA 1DJXA 3IF7A 2CXJA 5PALA 4CFRA 2JT8A 3D0YA 1IH0A 2ZN9A 2BCXA 3F45A 1XK4C 2CCMA 5I8NA 2I7AA 1QIVA 4MSPA 1J7OA 3K21A 2SCPA 1HT9A 2OS8C 3WNXB 1ALVA 1TOPA 3ZWHA 1BU3A 4DIRA 1BMOA 4GGFA 1A75A 1UHJA 2JU0A 4D1EA 2OS8B 5GQQC 1Y6WA 2K61A 3E3RA 1L2OC 1QV1A 1OMVA 1WY9A 2ZRSA 1FPWA 2G2BA 4JWQA 1SW8A 3CLNA 3OB2B 1NCYA 1K95A 3CR4X 1U5IA 5I2QA 1FI5A 1IWQA 3A4UB 3SG4A 1YVHA 2NXQA 1ZOTB 1YUTA 1K8UA 2KYCA 2RGIA 4UPGA 1XK4A 2F33A 1XFXO 2LVIA 1IGVA 2V53A 3CR5X 1Y1UA 3ICBA 2LP2A 1V1GA 2JTTA 1PK0D 4WQ2A 4OCIA 4PE1A 1YX8A 2COLB 1PRWA 4ETOA 3BUWB 1J1DA 4HREE 2KNEA 2LCPA 2LLSA 2M9GA 1H8BA 1DF0B 4MN0A 3LK0A 1OZOA 1XFWO 2Y1NA 4GPLB 1CB1A 3QRXA 2JOJA 1UHHA 1F8HA 1JFJA 2LNKA 4MLWA 1CLBA 5F6TA 2JULA 1NCZA 2M8UA 1KCYA 1QLSA 1SNLA 1SK6D 1G33A 4GBAA 1MHOA 3PALA 4F0ZB 2L51A 3TS5C 1F71A 4PHJA 1K94A 1VRKA 3I5GC 3TS5B 1AJ5A 1LA3A 1QX2A 2Q91A 1BF5A 5B8IB 2L5XB 1EG4A 3NSKA 1DF0A 1KQMC 3I5GB 1NYAA 1R6PA 4FQOA 3SG6A 2KOTA 4PALA 2F3YA 4OV2A 2FOTA 4MRXA 2I18A 1KQMB 2AAOA 2Q4UA 4PCWA 2FCEA 1N65A 3C1VA 2H2KA 2KFFA 1Y0VH 1KK7Z 4YGDB 1TNXA 1RJVA 3SG7A 4QJ5B 1J7PA 1Q80A 3KEVA 4N1GA 4MZJA 4I5LB 1M31A 1QVIY 1DJGA 3LCPC 1XA5A 1KSOA 3M0WA 5I2LA 2BBMA 2BCBA 2K7BA 2MHHA 2L0PA 1DGUA 5HYDA 3LK1A 1NX2A 1BR4B 1DTLA 4FTGA 1FBVA 3BXKA 2I94A 4JPZB 1S36A 1CMGA 1SMGA 4CIDA 2WCFA 5G08A 1AK8A 2PMYA 3EKJA 1JWDA 1B8CA 4PHMA 2M7LA 1JSAA 2KBIA 1QTXA 4CLNA 1MUXA 1ODBA 4C0KA 1NX1A 5AANA 2BL0C 4N5XA 2Y1MA 1NP8A 2JNFA 1PALA 1DVIA 1PSRA 1CDPA 4HRHA 2BL0B 2HQ8A 2K7CA 3GK4X 1KFXL 2JTZA 3HX4A 4GFTA 2LUCA 1OMRA 2EC6C 1JC2A 4A4BA 1BT6A 3BUXB 1X02A 3AKBA 1GGWA 1LA0A 2EC6B 2KFGA 1GGZA 4TNCA 2LLUA 3EVVA 1N0YA 3LLEA 2L98A 1CNPA 2ISDA 1L7ZA 1CM4A 3WXAA 1IQ5A 1S26D 4WQ3A 4WRIA 5CSIA 2QACA 1S6CA 2B1UA 1B8LA 3KF9A 2ZNEA 4MBEA 2ZRTA 2KFHA 4YBHB 1C7VA 4C0LA 1K9KA 2M97A 3NSLA 1K9PA 4DRWA 3TUYC 1SPYA 5K89A 2SASA 1CDLA 1CLLA 3SIAA 1UURA 3KO0A 2F2PA 4P2YB 4YGCB 3TUYB 2LUXA 2M3WA 1CMFA 1UP5A 4MZKA 5AERA 2KGBC 5HLOA 1NX0A 2KI6D 3MSEB 4NDCA 4ORCB 3EK7A 2JPTA 1NCXA 1MF8B 1KFUL 2WCBA 3JVTC 1EH2A 2Y9ZA 3IQQA 2NCPA 2OPOA 1G4YR 4USLA 3H4SE 3I5FC 1IRJA 3JVTB 3EK4A 4IL1A 1Y1AA 1TNPA 1UHKA 3I5FB 2WORA 3NSOA 2F3ZA 4N1FA 4R1EA 2M1KB 4I5KA 1XFUO 4AOMA 2MRDA 2LVKA 1OOJA 2BKHB 2ZKMX 4PE4A 2LANA 2K0JA 1K90D 1QV0A 1NWDA 3KPXA 4YI8A 1B9AA 1BR1B 2EGDA 2JXCA 3CZTX 3OB1B 5DKNA 2FCDA 1DJZA 2CTNA 2LE9B 2BE4A 1QX5B 1IJ6A 2AMIA 2GGMA 1KK8B 3I5IC 4NDDA 2BBNA 1XYDA 1UWOA 1KK7Y 1SCVA 1CTRA 3I5IB 3PLFB 3VRPA 2NZ0A 3OHMB 1LXFC 2KSPA 1BJFA 1SL8A 1MXEA 1XO5A 3KHEA 3SG2A 1N2DA 4YGEB 4Q04A 3SIBA 1AP4A 3CS1A 4XYNA 1TN4A 2BKIB 2JWWA 1A2XA 2HF5A 3NSIA 3OX5A 2ZNDA 3RLZA 1MXLC 4CPVA 2ZN8A 2JRFA 1V1FA 1CFFA 2KI6C 1B47A 4M2QA 1D1OA 4P5OE 1B1GA 3A8RA 1XVJA 2LM5A 1OZSA 1CLMA 1YUSA 3CWGA 2DOQA 2KAYA 3OX6A 1K93D 1RECA 1YRTB 3BQ3A 1YRUB 1TRFA 1TTXA 2KI4C 5ER5A 1J55A 4CFQA 1BLQA 3BUOB 2BCAA 3TDZA 2KI4B 1CM1A 1B8RA 1C07A 3DVKA 2E6WA 3TDIA 1BG1A 1MWNA 1QJTA 2M0RA 3D10A 1F4QA 4DCKA 5KTYA 2MJWB 1MR8A 1NIWA 2LP3A 1SL7A 2KYFA 1S6IA 2KAXA 1IKUA 1G8IA 1FI6A 1SCMC 1XFZO 2WOSA 4E68A 3IQOA 2M1UA 1WDCC 4PE7A 3CR2A 5AFPA 1XFYO 1QIWA 1SCMB 3O78A 3BUNB 2CNPA 1RFJA 4YRUA 1SYMA 1WDCB 1WLZA 1WLMA 4OKHA 3TDUA 1NPQA 4ZCVA 1JBAA 2GV5A 4GAOA 2K2FA 2JQ6A 2JT0A 1B7TZ 1SR6C 1QS7A 2K2AA 1IJ5A 1NX3A 4GNKB 2HQWA 1S5GZ 5FYXA 2PALA 1ZFSA 3SJSA 4AQIA 1SR6B 3VRRA 2OTGC 2A4JA 4ORBB 5KSZA 1TNWA 2R2IA 3PSRA 3SG3A 2OTGB 1C7WA 2KBMA 3GOFA 5HKZA 2MBXA 4M2PA 2F2OA 2LMTA 4L9MA 2FJUB 1A75B 1E8AA 1KWOC 3BYAA 3VGOA 2CT9A 3EKHA 3TZ1A 1TNQA 1KWOB 2K7DA 1S1EA 4GUKA 4MEWA 2KQ6A 1AJ4A 1YVLA 2KDHA 1UHIA 1SY9A 1MQ1A 2JXLA 1YX7A 3DVEA 1EJ3A 2BE6A 1M39A 3EK8A 5TNCA 1U5IB 4PHKA 2O5GA 1CFDA 2LVJA 2Y5IA 2JT3A 4I5NB 1A29A 2Y4QA 1HQVA 2GGZA 1J7RA 1QX7A 2JZIA 1WRLA 4YI9A 2O60A 2WCEA 5HKWA 3VROA 3ZNIA 2D8NA 2EHBA 1RWYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CBL A;  3DD4 A;  4OVN F;  1BOC A;  2G9B A;  2Y9Y A;  1DGV A;  1M63 B;  1PUL A;  1DT7 B;  3DVM A;  5KU1 A;  1L2O B;  2PRU A;  2KHN A;  1YUU A;  1QAS A;  2AUC A;  4QJ3 B;  1SL9 A;  1WRZ A;  4M2O A;  2LV7 A;  1S3P A;  1LKJ A;  1OSA A;  1K2H A;  2MA2 A;  2TN4 A;  5AEQ A;  1QXP A;  1KK8 C;  4PE0 A;  1M46 A;  2HET A;  1YUR A;  4HSZ A;  1YTZ C;  4JQ0 D;  4ORA B;  5CSF A;  1OE9 B;  1JFK A;  1KFX S;  2VRG A;  3RM1 A;  3HCM A;  2PVB A;  5J3X A;  1AVS A;  2HPS A;  1TCO B;  1CFP A;  5HLV A;  3FS7 A;  2JNX A;  3DF0 B;  1GJY A;  2BEC A;  3GK2 A;  4C0J A;  1J1E A;  5I2O A;  3EVR A;  1H4B A;  1GQM A;  2F8P A;  2KAV A;  2KGR A;  2LMV A;  2LC5 A;  3EVU A;  2WC8 A;  2MLF C;  2PAS A;  3PM8 A;  2K8M B;  1UHN A;  1ZAC A;  2ZFD A;  4MVF A;  5JJG A;  2LMU A;  1EG3 A;  3VRQ A;  1EL4 A;  2LAP A;  1FF1 A;  2LVV A;  2K7O A;  3CGA A;  3AAK A;  1K9U A;  3BUM B;  4PDZ A;  4XJK B;  1LVC D;  4QJ4 B;  1PVA A;  1AHR A;  2MLE C;  3SG5 A;  5BPJ A;  4MZL A;  1WRK A;  3PAT A;  1KSM A;  1W7J B;  3DF0 A;  1DJH A;  5HKY A;  3O2P A;  1CDM A;  3NXA A;  3BOW B;  3AAJ A;  4NDB A;  3CTN A;  2L2E A;  2LLT A;  4PHN A;  4A4C A;  2L4H A;  2LHL A;  5D7F A;  1XFV O;  2M49 B;  2NLN A;  3VRN A;  1KFU S;  1JUO A;  2LHI A;  2PSR A;  1B7T Y;  2MAZ A;  3WHT B;  1A03 A;  1TCF A;  4ZCU A;  4ICB A;  1OMD A;  2H61 C;  1K96 A;  1S5G Y;  1F70 A;  1F54 A;  2P6B B;  1R2U A;  4BY5 A;  1NUB A;  1CFC A;  1QAT A;  1ZUZ A;  3AKA A;  4XJK A;  4BY4 A;  1QLK A;  1CDN A;  1S6J A;  1W7I B;  1Y1X A;  5D69 A;  1YR5 A;  2L4I A;  2IS9 A;  1OFC X;  5JOL A;  2L50 A;  1SRA A;  3FIA A;  5CSN A;  3BOW A;  4U8D A;  1ALW A;  1RRO A;  3DVJ A;  3FWB A;  1CKK A;  1A4P A;  2I2R E;  1OQP A;  3LL8 B;  2QPT A;  4NQG A;  5AXI A;  1JF0 A;  1IG5 A;  1SBJ A;  1JF2 A;  5CSJ A;  1F55 A;  1PSB A;  5DKR A;  3WHU B;  5ER4 X;  4HRG A;  3GK1 A;  5CPV A;  1B4C A;  1AUI B;  4YGB B;  3I5H C;  3D0Y B;  1BOD A;  2M29 A;  4OR9 B;  4GGN A;  1UUS A;  1J7Q A;  1QVI Z;  2H61 A;  1RK9 A;  1SKT A;  3I5H B;  4GGF C;  1TIZ A;  1PVB A;  1IQ3 A;  4MRY A;  1M45 A;  1DJW A;  1F4O A;  1LIN A;  2JC2 A;  2WND A;  2E30 A;  3OP0 A;  3O4Y A;  4DS7 A;  4AQJ A;  1DJY A;  1ZMZ A;  5IBW A;  1DJI A;  3PFV A;  2KQY A;  3PN7 C;  4I5J A;  4DUQ A;  4YGA A;  3JTD C;  2M7N A;  2NCO A;  3O6B A;  3PN7 B;  1NSH A;  5DKQ A;  3FWC A;  1RTP 1;  1EXR A;  1FW4 A;  1DMO A;  3JTD B;  1KQV A;  1DJX A;  3IF7 A;  2CXJ A;  5PAL A;  4CFR A;  2JT8 A;  3D0Y A;  1IH0 A;  2ZN9 A;  2BCX A;  3F45 A;  1XK4 C;  2CCM A;  5I8N A;  2I7A A;  1QIV A;  4MSP A;  1J7O A;  3K21 A;  2SCP A;  1HT9 A;  2OS8 C;  3WNX B;  1ALV A;  1TOP A;  3ZWH A;  1BU3 A;  4DIR A;  1BMO A;  4GGF A;  1A75 A;  1UHJ A;  2JU0 A;  4D1E A;  2OS8 B;  5GQQ C;  1Y6W A;  2K61 A;  3E3R A;  1L2O C;  1QV1 A;  1OMV A;  1WY9 A;  2ZRS A;  1FPW A;  2G2B A;  4JWQ A;  1SW8 A;  3CLN A;  3OB2 B;  1NCY A;  1K95 A;  3CR4 X;  1U5I A;  5I2Q A;  1FI5 A;  1IWQ A;  3A4U B;  3SG4 A;  1YVH A;  2NXQ A;  1ZOT B;  1YUT A;  1K8U A;  2KYC A;  2RGI A;  4UPG A;  1XK4 A;  2F33 A;  1XFX O;  2LVI A;  1IGV A;  2V53 A;  3CR5 X;  1Y1U A;  3ICB A;  2LP2 A;  1V1G A;  2JTT A;  1PK0 D;  4WQ2 A;  4OCI A;  4PE1 A;  1YX8 A;  2COL B;  1PRW A;  4ETO A;  3BUW B;  1J1D A;  4HRE E;  2KNE A;  2LCP A;  2LLS A;  2M9G A;  1H8B A;  1DF0 B;  4MN0 A;  3LK0 A;  1OZO A;  1XFW O;  2Y1N A;  4GPL B;  1CB1 A;  3QRX A;  2JOJ A;  1UHH A;  1F8H A;  1JFJ A;  2LNK A;  4MLW A;  1CLB A;  5F6T A;  2JUL A;  1NCZ A;  2M8U A;  1KCY A;  1QLS A;  1SNL A;  1SK6 D;  1G33 A;  4GBA A;  1MHO A;  3PAL A;  4F0Z B;  2L51 A;  3TS5 C;  1F71 A;  4PHJ A;  1K94 A;  1VRK A;  3I5G C;  3TS5 B;  1AJ5 A;  1LA3 A;  1QX2 A;  2Q91 A;  1BF5 A;  5B8I B;  2L5X B;  1EG4 A;  3NSK A;  1DF0 A;  1KQM C;  3I5G B;  1NYA A;  1R6P A;  4FQO A;  3SG6 A;  2KOT A;  4PAL A;  2F3Y A;  4OV2 A;  2FOT A;  4MRX A;  2I18 A;  1KQM B;  2AAO A;  2Q4U A;  4PCW A;  2FCE A;  1N65 A;  3C1V A;  2H2K A;  2KFF A;  1Y0V H;  1KK7 Z;  4YGD B;  1TNX A;  1RJV A;  3SG7 A;  4QJ5 B;  1J7P A;  1Q80 A;  3KEV A;  4N1G A;  4MZJ A;  4I5L B;  1M31 A;  1QVI Y;  1DJG A;  3LCP C;  1XA5 A;  1KSO A;  3M0W A;  5I2L A;  2BBM A;  2BCB A;  2K7B A;  2MHH A;  2L0P A;  1DGU A;  5HYD A;  3LK1 A;  1NX2 A;  1BR4 B;  1DTL A;  4FTG A;  1FBV A;  3BXK A;  2I94 A;  4JPZ B;  1S36 A;  1CMG A;  1SMG A;  4CID A;  2WCF A;  5G08 A;  1AK8 A;  2PMY A;  3EKJ A;  1JWD A;  1B8C A;  4PHM A;  2M7L A;  1JSA A;  2KBI A;  1QTX A;  4CLN A;  1MUX A;  1ODB A;  4C0K A;  1NX1 A;  5AAN A;  2BL0 C;  4N5X A;  2Y1M A;  1NP8 A;  2JNF A;  1PAL A;  1DVI A;  1PSR A;  1CDP A;  4HRH A;  2BL0 B;  2HQ8 A;  2K7C A;  3GK4 X;  1KFX L;  2JTZ A;  3HX4 A;  4GFT A;  2LUC A;  1OMR A;  2EC6 C;  1JC2 A;  4A4B A;  1BT6 A;  3BUX B;  1X02 A;  3AKB A;  1GGW A;  1LA0 A;  2EC6 B;  2KFG A;  1GGZ A;  4TNC A;  2LLU A;  3EVV A;  1N0Y A;  3LLE A;  2L98 A;  1CNP A;  2ISD A;  1L7Z A;  1CM4 A;  3WXA A;  1IQ5 A;  1S26 D;  4WQ3 A;  4WRI A;  5CSI A;  2QAC A;  1S6C A;  2B1U A;  1B8L A;  3KF9 A;  2ZNE A;  4MBE A;  2ZRT A;  2KFH A;  4YBH B;  1C7V A;  4C0L A;  1K9K A;  2M97 A;  3NSL A;  1K9P A;  4DRW A;  3TUY C;  1SPY A;  5K89 A;  2SAS A;  1CDL A;  1CLL A;  3SIA A;  1UUR A;  3KO0 A;  2F2P A;  4P2Y B;  4YGC B;  3TUY B;  2LUX A;  2M3W A;  1CMF A;  1UP5 A;  4MZK A;  5AER A;  2KGB C;  5HLO A;  1NX0 A;  2KI6 D;  3MSE B;  4NDC A;  4ORC B;  3EK7 A;  2JPT A;  1NCX A;  1MF8 B;  1KFU L;  2WCB A;  3JVT C;  1EH2 A;  2Y9Z A;  3IQQ A;  2NCP A;  2OPO A;  1G4Y R;  4USL A;  3H4S E;  3I5F C;  1IRJ A;  3JVT B;  3EK4 A;  4IL1 A;  1Y1A A;  1TNP A;  1UHK A;  3I5F B;  2WOR A;  3NSO A;  2F3Z A;  4N1F A;  4R1E A;  2M1K B;  4I5K A;  1XFU O;  4AOM A;  2MRD A;  2LVK A;  1OOJ A;  2BKH B;  2ZKM X;  4PE4 A;  2LAN A;  2K0J A;  1K90 D;  1QV0 A;  1NWD A;  3KPX A;  4YI8 A;  1B9A A;  1BR1 B;  2EGD A;  2JXC A;  3CZT X;  3OB1 B;  5DKN A;  2FCD A;  1DJZ A;  2CTN A;  2LE9 B;  2BE4 A;  1QX5 B;  1IJ6 A;  2AMI A;  2GGM A;  1KK8 B;  3I5I C;  4NDD A;  2BBN A;  1XYD A;  1UWO A;  1KK7 Y;  1SCV A;  1CTR A;  3I5I B;  3PLF B;  3VRP A;  2NZ0 A;  3OHM B;  1LXF C;  2KSP A;  1BJF A;  1SL8 A;  1MXE A;  1XO5 A;  3KHE A;  3SG2 A;  1N2D A;  4YGE B;  4Q04 A;  3SIB A;  1AP4 A;  3CS1 A;  4XYN A;  1TN4 A;  2BKI B;  2JWW A;  1A2X A;  2HF5 A;  3NSI A;  3OX5 A;  2ZND A;  3RLZ A;  1MXL C;  4CPV A;  2ZN8 A;  2JRF A;  1V1F A;  1CFF A;  2KI6 C;  1B47 A;  4M2Q A;  1D1O A;  4P5O E;  1B1G A;  3A8R A;  1XVJ A;  2LM5 A;  1OZS A;  1CLM A;  1YUS A;  3CWG A;  2DOQ A;  2KAY A;  3OX6 A;  1K93 D;  1REC A;  1YRT B;  3BQ3 A;  1YRU B;  1TRF A;  1TTX A;  2KI4 C;  5ER5 A;  1J55 A;  4CFQ A;  1BLQ A;  3BUO B;  2BCA A;  3TDZ A;  2KI4 B;  1CM1 A;  1B8R A;  1C07 A;  3DVK A;  2E6W A;  3TDI A;  1BG1 A;  1MWN A;  1QJT A;  2M0R A;  3D10 A;  1F4Q A;  4DCK A;  5KTY A;  2MJW B;  1MR8 A;  1NIW A;  2LP3 A;  1SL7 A;  2KYF A;  1S6I A;  2KAX A;  1IKU A;  1G8I A;  1FI6 A;  1SCM C;  1XFZ O;  2WOS A;  4E68 A;  3IQO A;  2M1U A;  1WDC C;  4PE7 A;  3CR2 A;  5AFP A;  1XFY O;  1QIW A;  1SCM B;  3O78 A;  3BUN B;  2CNP A;  1RFJ A;  4YRU A;  1SYM A;  1WDC B;  1WLZ A;  1WLM A;  4OKH A;  3TDU A;  1NPQ A;  4ZCV A;  1JBA A;  2GV5 A;  4GAO A;  2K2F A;  2JQ6 A;  2JT0 A;  1B7T Z;  1SR6 C;  1QS7 A;  2K2A A;  1IJ5 A;  1NX3 A;  4GNK B;  2HQW A;  1S5G Z;  5FYX A;  2PAL A;  1ZFS A;  3SJS A;  4AQI A;  1SR6 B;  3VRR A;  2OTG C;  2A4J A;  4ORB B;  5KSZ A;  1TNW A;  2R2I A;  3PSR A;  3SG3 A;  2OTG B;  1C7W A;  2KBM A;  3GOF A;  5HKZ A;  2MBX A;  4M2P A;  2F2O A;  2LMT A;  4L9M A;  2FJU B;  1A75 B;  1E8A A;  1KWO C;  3BYA A;  3VGO A;  2CT9 A;  3EKH A;  3TZ1 A;  1TNQ A;  1KWO B;  2K7D A;  1S1E A;  4GUK A;  4MEW A;  2KQ6 A;  1AJ4 A;  1YVL A;  2KDH A;  1UHI A;  1SY9 A;  1MQ1 A;  2JXL A;  1YX7 A;  3DVE A;  1EJ3 A;  2BE6 A;  1M39 A;  3EK8 A;  5TNC A;  1U5I B;  4PHK A;  2O5G A;  1CFD A;  2LVJ A;  2Y5I A;  2JT3 A;  4I5N B;  1A29 A;  2Y4Q A;  1HQV A;  2GGZ A;  1J7R A;  1QX7 A;  2JZI A;  1WRL A;  4YI9 A;  2O60 A;  2WCE A;  5HKW A;  3VRO A;  3ZNI A;  2D8N A;  2EHB A;  1RWY A; 
#chains in the Genus database with same CATH topology
 4GKG A;  2LKM A;  1OOH A;  1BOC A;  2Y9Y A;  3V2Q A;  2ZVN B;  1DGV A;  1Q86 Q;  5B66 E;  4CPG A;  1M63 B;  1PUL A;  2WSE J;  1DT7 B;  1K9M Q;  1J1D B;  4GOF A;  2PRU A;  2KHN A;  2BEQ D;  5CMZ A;  3A0B H;  3W67 A;  4D6T D;  1SL9 A;  3SFD C;  3L75 G;  1S3P A;  3PHL A;  2TN4 A;  2RMZ A;  1L2P A;  3SS4 A;  1JFK A;  3P8M C;  4IL6 E;  3M9B A;  4TLF A;  3HD7 C;  2BEC A;  1L4A D;  1NU1 D;  3HTK A;  1J1E A;  4DT0 A;  5I2O A;  1H4B A;  1RH5 B;  5AVT B;  2KGR A;  1SQB D;  3EVU A;  1KD1 Q;  2MLF C;  1JB0 J;  1SQQ G;  3KQG A;  3LW5 J;  1GK6 A;  4KYN A;  1GW3 A;  2ZFD A;  4YTP C;  4MVF A;  5JJG A;  1ZV8 A;  1EG3 A;  3VRQ A;  1EL4 A;  2M3E A;  2N1T C;  1LJ2 A;  2K7O A;  4TT3 H;  3BUM B;  4YPC A;  1LVC D;  1USD A;  4D6T E;  1GW4 A;  1WRK A;  5HKY A;  1KSM A;  3O2P A;  1CDM A;  2FYZ A;  3D71 A;  3KHU A;  3D75 A;  2FKW B;  4NDB A;  2L2E A;  2LLT A;  4PHN A;  2L4H A;  5D7F A;  1NU1 J;  1X22 A;  3VRN A;  1M1J C;  1JUO A;  2LHI A;  2MAZ A;  3WHT B;  2GUS A;  5AVX B;  4ZCU A;  1L0L G;  1K96 A;  4BY5 A;  2Y0C A;  2C9N Y;  1SQB E;  2FFD C;  1BGY D;  2ZVO B;  2R5D A;  1W7I B;  1YR5 A;  2L4I A;  2IS9 A;  3FIA A;  5CSN A;  4U8D A;  2O3J A;  1ALW A;  3DVJ A;  3EWK A;  1AQ5 A;  5D3O A;  2V7Q H;  3U1C A;  2OTL P;  2FJY A;  1SBJ A;  1URQ A;  1PSB A;  1IFN A;  4HRG A;  5KKZ B;  4NPD A;  1AUI B;  4YGB B;  1L4A C;  1SVF A;  4PV1 B;  4Y99 B;  1BOD A;  3P8C D;  3PLN A;  5AVY B;  2KYV A;  1UUS A;  3CPW O;  1IFJ A;  1QVI Z;  2OYI B;  1NH4 A;  3I5H B;  3B5N D;  1PVB A;  1BGY J;  3OP0 A;  3O4Y A;  2W27 A;  3DZT A;  5IBW A;  1U7M A;  2Z5I A;  5DIC A;  2WC5 A;  2QE7 H;  1RY3 A;  3PN7 C;  2JWD A;  1BGY E;  2KSJ A;  2NCO A;  1NSH A;  1RTP 1;  1DMO A;  1OW7 A;  2QJY C;  3H1L G;  1NTM D;  1IH0 A;  3BVH A;  2BCX A;  1ZN5 A;  2CCM A;  1NAF A;  4MSP A;  3CCU P;  2SCP A;  2QSI A;  3ZWH A;  2ZT9 B;  4GGF A;  1YYC A;  2JR8 A;  2OS8 B;  5GQQ C;  5KLV D;  3P8C E;  3E3R A;  1PGQ A;  1LTA C;  4R4M A;  1A02 F;  2NPS D;  1OMV A;  1SW8 A;  1NCY A;  5AW5 B;  3AE7 C;  1HWT C;  5I2Q A;  1FI5 A;  3A4U B;  3SG4 A;  4MN4 C;  5DJT B;  3M0D A;  1JY2 O;  3B6X A;  2RGI A;  1JY2 P;  2BEZ F;  1KIL A;  1XK4 A;  1H8A A;  1IGV A;  3CR5 X;  1NTM E;  4KT0 J;  1KMI Z;  1PRW A;  4ETO A;  2H89 C;  1FOS E;  1J1D A;  3B7A A;  4D6T G;  1EC5 A;  1Q7Y Q;  1H8B A;  2RKL A;  3CWB D;  2KXP B;  3S0B A;  1DF0 B;  5AW8 B;  3LK0 A;  1S4X A;  1OZO A;  1DEK A;  4U7J A;  1GL2 B;  5KLV E;  3A0H H;  2Z4E A;  4FQT A;  4GT1 A;  1JFJ A;  2LNK A;  1K05 A;  4MLW A;  1Z2C B;  2JWA A;  2OAR A;  2JUL A;  1QLS A;  1SK6 D;  1G33 A;  5APW A;  1SQB G;  3Q5R A;  4L73 A;  2ZJS E;  1IFP A;  2KSE A;  1AJ5 A;  1QX2 A;  3NSK A;  3L70 D;  1L0N K;  3N4X A;  1NYA A;  4RO0 A;  2R32 A;  4DJG A;  3M91 A;  1CSB A;  5I94 A;  2NPS C;  1N65 A;  2H2K A;  2KFF A;  3CX5 H;  3PH0 A;  1VQ9 P;  2J5U A;  2KP8 A;  2FYU D;  4YGD B;  1RJV A;  3CWB E;  3CC4 P;  1Q80 A;  3KEV A;  5AW3 B;  1G1I A;  1RHZ B;  1UIX A;  3OGN A;  3H1H D;  3I56 P;  1M31 A;  1BE3 J;  2XKM A;  1DJG A;  3N7N A;  1NTZ D;  4JYC A;  1KSO A;  2BCB A;  2L0P A;  3VYI A;  1M57 D;  2QJK C;  1CMG A;  3L70 J;  5G08 A;  1AK8 A;  2E76 B;  1PP9 D;  4PHM A;  2M7L A;  1ZW0 A;  3KPE A;  1MUX A;  4C0K A;  3L70 E;  1S2E A;  4N5X A;  3JCU H;  1NP8 A;  2B87 A;  2OQQ A;  3HUS C;  2BL0 B;  1R5S A;  3H1H J;  2K7C A;  4IOI H;  3V4W A;  1D7M A;  2E42 A;  2FYU E;  2EC6 C;  1JC2 A;  1BT6 A;  3BUX B;  2L91 A;  4H44 D;  3WUU A;  3RK2 B;  3SWY A;  1DX7 A;  1NTZ E;  1N0Y A;  3DY9 A;  1CNP A;  5CCH A;  2ISD A;  1CM4 A;  3D6Z A;  3UO9 A;  2Q3I A;  2QAC A;  5AVU B;  1N7S C;  2K60 A;  2ZNE A;  1PP9 E;  2KFH A;  2B88 A;  3CDN A;  3TUY C;  2C0W A;  4I7Z B;  1NTM G;  3B8E B;  5K89 A;  1CDL A;  5K5G B;  3SIA A;  1DD4 A;  4P2Y B;  3CCS P;  2LUX A;  2P71 A;  4MZK A;  3JC2 2;  2KGB C;  1NO4 A;  4ORC B;  2G3A A;  2Y0E A;  3CCM P;  2V4H A;  2OYH B;  2A06 D;  5KLV G;  2OPO A;  3RL0 D;  2Y0D A;  3JVT B;  4IL1 A;  3PP5 A;  3I5F B;  2D2C D;  1AFO A;  1YJW P;  4N1F A;  4R1E A;  5AVR B;  2G8Y A;  2I8D A;  2P58 A;  5B5E H;  1SQQ K;  1OOJ A;  2WCM A;  3GF7 A;  2ZKM X;  3D73 A;  1KB9 H;  2K0J A;  1EDI A;  5AVZ B;  5AW7 B;  3CZT X;  4H44 C;  3L71 J;  5HL1 A;  3FGA D;  2JKV A;  2GUV A;  4HB1 A;  3R1O A;  1KK8 B;  4NDD A;  1KK7 Y;  1SCV A;  3CWB G;  2XU6 A;  2A06 E;  2NZ0 A;  3L74 J;  3VOP A;  1MXE A;  2WIT A;  3BAS A;  3F5H A;  1OWA A;  1L0L K;  1OW4 A;  2QM7 A;  4UB8 H;  4WBA A;  2WC6 A;  3CZ2 A;  1LS8 A;  1TN4 A;  1MZ9 A;  2LXB A;  2HF5 A;  2WWW A;  1W2E A;  3HE5 A;  3MHV A;  3FE9 A;  1CFF A;  1V1F A;  3NFQ A;  2KUB A;  1D1O A;  1B1G A;  1XVJ A;  1CLM A;  1YUS A;  2DOQ A;  1K93 D;  3H1K J;  5ER5 A;  3RL0 C;  3NGV A;  3FWN A;  2KI4 B;  2FYU G;  2D2C C;  3AEE C;  2M0R A;  2KYF A;  2KAX A;  1IKU A;  1G8I A;  1FI6 A;  1SCM C;  1IC2 A;  5KJ7 D;  1OX3 A;  3IQO A;  4F7F A;  1NTZ G;  3CR2 A;  3GF3 A;  3KZI H;  1RF1 C;  3PTZ A;  1OIP A;  1L0N J;  2FYN C;  2Q7C A;  1LWU B;  2JQ6 A;  1LTG C;  1PP9 G;  2K2A A;  4GNK B;  1LTJ B;  2HQW A;  5CCG D;  2E43 A;  2PAL A;  3SJS A;  4AQI A;  1SR6 B;  2OTG C;  2A4J A;  5KSZ A;  1TNW A;  3Q8I A;  1S1C X;  3GOF A;  1A02 J;  2IPP A;  2F2O A;  2E5T A;  3U1A A;  1N8R Q;  1FBM A;  2FJU B;  2KS1 A;  1KWO C;  1E8A A;  3E1R A;  2YMY A;  1W2B O;  2WPR A;  2CT9 A;  1IFI A;  1S1E A;  5EL2 A;  2BE6 A;  1M39 A;  4H0L C;  2XDJ A;  2Y5I A;  3S9O A;  1A29 A;  2GGZ A;  3S1K A;  3VRO A;  1C3Y A;  5TIS H;  2KPH A;  2AEM A;  2EHB A;  1PPJ D;  2PP6 A;  2BNX A;  3DD4 A;  1NAY A;  1EZV D;  1TUJ A;  3AE5 C;  2G9B A;  1JY2 N;  5KJ7 C;  1M56 D;  3G3Z A;  5KU1 A;  4PD4 I;  3FXE A;  1L2O B;  4C7N A;  3CME P;  3HTK B;  1J1E B;  3JSV C;  2A06 G;  2KZJ A;  3G4S P;  1NJI Q;  3IFM A;  4M2O A;  2P7J A;  4I6M C;  1OSA A;  5CCG C;  1QXP A;  2YMK A;  1M46 A;  1SQB K;  5E79 H;  1YTZ C;  1FZC B;  3CD6 P;  1SQQ D;  2WPV B;  1TCO B;  4PJ0 E;  3IF4 A;  4PV1 D;  3OBV A;  3FS7 A;  3L75 J;  3GK2 A;  2E75 B;  1PPJ E;  3D78 A;  1EZV E;  2LC5 A;  2WC8 A;  2UWJ E;  2PAS A;  3PM8 A;  4GDO A;  2LMU A;  2WSF J;  3RL0 g;  1Y9B A;  4PDZ A;  1K9U A;  2MKV A;  1LP1 B;  1AHR A;  2ERB A;  1L0L D;  2MLE C;  2IYP A;  1SQQ J;  5KLI C;  4MZL A;  3PAT A;  1W7J B;  3DF0 A;  1AVY A;  2KOG A;  3AAJ A;  2FBW C;  1VQL P;  4RJT A;  1LTB C;  2ZT9 D;  3OAK A;  1SQQ E;  3O4X A;  2LHL A;  3H32 A;  2J59 M;  2L5Y A;  1B7T Y;  1A03 A;  2O01 N;  1WT6 A;  1TCF A;  3MIW A;  1F70 A;  1F54 A;  2P6B B;  5BVZ A;  4WY4 A;  1CFC A;  3MP7 B;  1QAT A;  3AKA A;  1CDN A;  2ITA A;  1Y1X A;  2QRX A;  5AVQ B;  4KHX A;  3L4L A;  3BOW A;  1L0L J;  1CKK A;  1A4P A;  2I2R E;  2P2U A;  1OQP A;  1N73 C;  5EFW B;  5AXI A;  5KKZ C;  1TU3 F;  1L0L E;  1F55 A;  4Y99 C;  5DKR A;  2OYI C;  1KQF B;  1DEL A;  5CPV A;  3I5H C;  2ZYG A;  1KN7 A;  2H61 A;  1OOI X;  1SKT A;  3H1L D;  4MRY A;  1M45 A;  1M8O B;  1GL2 D;  2E30 A;  1T8Z A;  4PD4 D;  1NTM K;  3O6Q B;  4N6J A;  1DJY A;  1ZMZ A;  1P84 D;  4NPF X;  3PFV A;  2KQY A;  3CL3 D;  4I5J A;  4YGA A;  2M7N A;  5CHX A;  2WSC J;  3PRJ A;  3FWC A;  3I55 P;  3JTD B;  1DJX A;  2CXJ A;  5KLV K;  3FE6 A;  2ZN9 A;  4IJ7 A;  3F45 A;  2W83 C;  1DD3 A;  2IBZ D;  2ZT9 C;  1QIV A;  2OS8 C;  1KIL B;  1TOP A;  1YIJ P;  1UHJ A;  3WU2 H;  3H1L J;  1JCC A;  3QWO C;  2OTK E;  3A3Y B;  2G2B A;  3H1L E;  4PD4 E;  2QEX P;  1VQ4 P;  3DYE A;  2KNC A;  1P84 E;  3NHT A;  1PPJ G;  1EZV G;  2QM8 A;  3CCV P;  1K8U A;  4UPG A;  3GHG A;  2V53 A;  1Y1U A;  3ICB A;  1S3J A;  2A45 H;  2E76 D;  1CI6 A;  1PK0 D;  3USS A;  4OCI A;  4PE1 A;  2IBZ E;  5AW1 B;  4HRE E;  3AE1 C;  4YXW H;  1OZH A;  3H1J G;  1GL2 C;  3VN0 A;  4MN0 A;  3TF5 A;  1BCC G;  4GPL B;  2P67 A;  4JBZ A;  3QRX A;  3S4R A;  4RES B;  1F8H A;  4D6T J;  3RK2 D;  3II6 A;  4HKZ H;  1FZC A;  1JY3 O;  5KAI E;  2I1J A;  3KXD A;  4IL6 X;  4GBA A;  3R4Y A;  5AW9 B;  1MHO A;  1JY3 P;  1SQV E;  4HJG H;  4I2L C;  4W7Y A;  1H89 A;  3KDP B;  2FYU K;  2XND H;  1BF5 A;  5B8I B;  3I5G B;  4FQO A;  3SS5 A;  1U7J A;  2KOT A;  3HE4 A;  1SQP D;  2FOT A;  4MRX A;  1S5L H;  2Q4U A;  2AAO A;  4PCW A;  1NTZ K;  1SQB J;  1FDI A;  2FCE A;  1GZL A;  3D6Y A;  2IFM A;  1FAV A;  1LP1 A;  1QVF O;  4MZJ A;  4I5L B;  2B87 B;  1QVI Y;  4UB6 E;  1SSE B;  1XA5 A;  1N86 A;  2PRR A;  2MHH A;  1DGU A;  3LK1 A;  1NX2 A;  4FTG A;  1FBV A;  1IIO A;  5GTH E;  2E76 C;  2I94 A;  3I5C A;  5AW0 B;  1SMG A;  1FZE A;  3Q1M A;  3EKJ A;  1BDC A;  1QTX A;  1ODB A;  2BL0 C;  1SQP E;  2OGU A;  1PAL A;  1DVI A;  1CDP A;  1NYH A;  2HQ8 A;  2O01 J;  4M3L A;  1FZF A;  1KFX L;  3RK2 C;  2LUC A;  4A4B A;  1X02 A;  2BAS A;  3BAT A;  4OH8 B;  3CXH I;  1GGZ A;  1OOF A;  3EFG A;  1SQX D;  2M8R A;  1KQS O;  4EOT A;  5CSI A;  4AQR D;  3SWK A;  3B87 A;  1FDO A;  3V5B A;  1B8L A;  3M9H A;  3PM2 A;  3AE8 C;  3O6Q A;  4I7Z C;  4XE5 B;  2YKQ A;  2M97 A;  3NSL A;  4DRW A;  1MFZ A;  1SPY A;  4B86 A;  2IBZ G;  4IFF A;  2OYH C;  1NX0 A;  1QWV A;  3MSE B;  3M0A A;  1CW5 A;  3IN6 A;  4L75 A;  1BDD A;  1EH2 A;  3JVT C;  4WVZ A;  1NTM J;  3TNU A;  4BWN A;  2QA4 P;  4XFJ A;  3H4S E;  3I5F C;  1JOC A;  1SQX E;  1W5C E;  3EK4 A;  3R72 A;  3CMA P;  1OVR A;  1KC8 Q;  2AEF A;  1XFU O;  4AOM A;  2MRD A;  3BRT B;  3B5N C;  1N2D C;  1SQV G;  5KLV J;  4AYC A;  3UNW A;  1BR1 B;  3B71 A;  3P32 A;  3OB1 B;  5DKN A;  5H2F H;  2PGD A;  2BE4 A;  1QX5 B;  1RF0 C;  3HE5 B;  1ZOY C;  2E5Y A;  5CBN A;  1UWO A;  1RE4 A;  3MZW B;  3I5I B;  3VRP A;  1LXF C;  1SL8 A;  3KHE A;  3A5T A;  1Q90 D;  2FXM A;  3D76 A;  3SIB A;  4XYN A;  3CWB J;  2XV5 A;  2BKI B;  1RE3 C;  1VQ5 P;  1MFT A;  4CPV A;  3GMA A;  2ZN8 A;  1B47 A;  2N1T B;  2YO2 A;  1GDT A;  3L47 A;  1ZP0 C;  3E1I A;  2R5B A;  3OX6 A;  1REC A;  1SQP G;  3CXH D;  3BQ3 A;  2KI4 C;  2E74 B;  1DEB A;  1KYO H;  4CFQ A;  1BLQ A;  1IFM A;  3BUO B;  2BCA A;  3TDZ A;  1Y47 A;  1VQ6 P;  1B8R A;  3O8Z A;  3OJA B;  1SL7 A;  2WMM A;  1FS0 E;  4OGQ B;  2W8Z A;  1MKM A;  2M1U A;  2PYQ A;  2H8P D;  5AFP A;  1QIW A;  3BUN B;  2CNP A;  3MUD C;  2FYU J;  1WDC B;  1WLZ A;  2KS1 B;  4OKH A;  1LWU C;  2K9J A;  2K3R A;  4ZKU A;  3VMZ A;  1LTJ C;  1IO4 A;  1SR6 C;  1NTZ J;  1IJ5 A;  1NX3 A;  5KAF E;  1S5G Z;  3BFA A;  5B66 H;  2GM4 A;  3AE3 C;  3CXH E;  3PSR A;  1OXZ A;  2E75 D;  3L36 A;  2KBM A;  5HKZ A;  2MBX A;  2WSE H;  4M2P A;  2LMT A;  4L9M A;  1PP9 J;  3BYA A;  3EKH A;  4U3F D;  3TZ1 A;  1IZN B;  4GUK A;  1SFC A;  1SQX G;  1R5L A;  3VB1 A;  1AJ4 A;  1OW6 A;  1UHI A;  1MQ1 A;  2JXL A;  4IL6 H;  5AW4 B;  4C7N B;  1EJ3 A;  1U5I B;  4PHK A;  2LVJ A;  1EDL A;  1AJY A;  2JJL A;  1HQV A;  1J7R A;  1QX7 A;  1YTZ I;  2HOD B;  3LID A;  3QME A;  2YXR B;  2D8N A;  2B9B A;  2QJP B;  1URQ D;  4L74 A;  2ZYD A;  2JEE A;  1VL2 A;  1J1E C;  3LW5 H;  2WPS A;  1JM0 A;  1YUU A;  2GA1 A;  3F89 A;  1QAS A;  1KQL A;  2C0X A;  4QJ3 B;  4U3F E;  3Q5P A;  1OMI A;  5AW2 B;  1T2K D;  2LV7 A;  4LLH A;  3TYY A;  3V2L A;  1K2H A;  2MA2 A;  5AEQ A;  3FXD A;  4PE0 A;  5DJU B;  5APX A;  4ORA B;  1YUR A;  5CSF A;  1OE9 B;  1KFX S;  2VRG A;  3RM1 A;  1CFP A;  1MUU A;  1AVS A;  2E75 C;  3DF0 B;  1GJY A;  4C0J A;  1EZV I;  3CCE P;  1SLQ A;  2F8P A;  2KAV A;  1YI2 P;  3BJH A;  2LMV A;  3H32 B;  2K8M B;  4IFM A;  1NVO A;  3WUT A;  1ZAC A;  4K35 A;  1JUN A;  1T3U A;  2LAP A;  2LVV A;  4WY4 B;  3WUV A;  3AAK A;  4QJ4 B;  3M9Q A;  2KZI A;  1PVA A;  2OTJ P;  1DJH A;  3A0B E;  2PAJ A;  3BOW B;  3CTN A;  3V2P A;  1KIL D;  3HD7 A;  1QLE D;  1URQ C;  1XFV O;  3OA7 A;  2O01 H;  4ICB A;  1OMD A;  3T97 A;  1R2U A;  1QEX A;  5APU A;  1NUB A;  4XJK A;  1ZUZ A;  4BY4 A;  3VMY A;  1S6J A;  2N1T A;  5D69 A;  1T2K C;  1QVG O;  1OFC X;  5JOL A;  2L50 A;  1KFM A;  1SRA A;  4L76 A;  1RRO A;  2M5A B;  3FWB A;  1AA0 A;  2YNY A;  3LL8 B;  2OYO A;  1IK9 A;  1JF0 A;  1LTS C;  5CSJ A;  3SS3 A;  1WRG A;  1M1J A;  3GK1 A;  1B4C A;  5KTB A;  1JTH A;  4GGN A;  4JYB A;  1J7Q A;  1KIL E;  1RK9 A;  2QEH A;  4Z1M H;  4GGF C;  2JDI H;  1IQ3 A;  3AE6 C;  4KJM A;  1LIN A;  2FFD A;  1LNQ A;  1KZU B;  4DS7 A;  2IYO A;  4AQJ A;  3G6E P;  3S0A A;  2Z5H A;  4DUQ A;  3JTD C;  1TUZ A;  3O6B A;  5CJ4 A;  3M0D C;  1XTC C;  2KNC B;  4CFR A;  1G1J A;  1S72 P;  2JT8 A;  2PQL A;  3D0Y A;  1PFI A;  4PT1 A;  2KLD A;  3BCC G;  3LIE A;  1KIL C;  1XK4 C;  3L72 D;  1L4A A;  2I7A A;  2V7Q J;  1YQ4 C;  4U3F G;  3WNX B;  3GHG B;  1N7S B;  2HR3 A;  2JU0 A;  2ZAE B;  4D1E A;  1NTK E;  2HG5 D;  1J1D C;  1CI6 B;  1SQV K;  2Q3E A;  3A2A A;  3L73 E;  1PL5 A;  1X8Y A;  2ZRS A;  4NPE A;  1P84 I;  2L5G B;  1GU5 A;  1U5I A;  1VQ8 P;  1IWQ A;  1OVU A;  1YVH A;  4LGD E;  2NXQ A;  2M0B A;  3VMX A;  3H1J D;  1YUT A;  2HOD A;  1XFX O;  2LVI A;  1BCC D;  2LP2 A;  1V1G A;  2JTT A;  2IBZ I;  4C46 A;  1M7L A;  3EQ2 A;  3CCQ P;  4WQ2 A;  5CCH D;  3L72 E;  1YX8 A;  2COL B;  2PFX A;  1FJP A;  3BUW B;  2POH A;  2YIU B;  2LCP A;  2LLS A;  1QL2 A;  4WWI A;  2XNX A;  3HE4 B;  1FJK A;  2JO1 A;  2JOJ A;  3GW6 A;  2DW3 A;  3C9I A;  3QH9 A;  2QDI A;  1GMJ A;  2A45 G;  3H1J J;  1CLB A;  1EXJ A;  1SQP K;  1NCZ A;  4IFD K;  1KCY A;  1SNL A;  4H13 B;  1T14 A;  3PAL A;  4F0Z B;  2L51 A;  2ZXX A;  1BCC J;  3H1J E;  1IK7 A;  2IFN A;  1K94 A;  3I5G C;  3TS5 B;  4N3Y B;  1LA3 A;  2Q91 A;  1BCC E;  2L5X B;  1EG4 A;  3IVT A;  3TGU D;  1R6P A;  3SG6 A;  2QG4 A;  4OV2 A;  2I18 A;  1KQM B;  5APQ A;  1HH0 A;  3V4Q A;  2WPQ A;  4QJ5 B;  1TNX A;  3TDK A;  1M1K Q;  2WSS H;  3AE9 C;  4N1G A;  3CX5 D;  5AVW B;  2C9L Y;  1G2C B;  3M0W A;  1YBK A;  3A0H E;  2K7B A;  1BR4 B;  1H88 A;  3R1V A;  3BXK A;  3BFB A;  1LT9 B;  5CCH C;  4PV1 C;  2P1J A;  2WCF A;  1JWD A;  1B8C A;  1JSA A;  4CLN A;  2NPS A;  1NX1 A;  3TGU E;  5AAN A;  4Y28 J;  1ZME C;  2Y1M A;  1S9K E;  2M3B A;  2KIK A;  1SQX K;  2LXC B;  2YGU A;  2IZ1 A;  3HX4 A;  3H1I D;  4GFT A;  2M5A A;  1OMR A;  1VQP P;  1HTL C;  3AKB A;  1NTK G;  2RH0 A;  3CX5 E;  1LA0 A;  3L73 G;  2KFG A;  4TNC A;  2LLU A;  1QX8 A;  1GTW A;  3EVV A;  1L7Z A;  1IQ5 A;  1S26 D;  4WQ3 A;  4WRI A;  3RBX A;  3TNU B;  1S6C A;  2B1U A;  3VP9 A;  3KF9 A;  1H0T A;  1CZQ A;  4K3A A;  3BFH A;  3HUS A;  4N78 D;  4YBH B;  1C7V A;  2Q1K A;  3NXS A;  3R1P A;  3SFE C;  1CLL A;  3Q5S A;  2F2P A;  1CMF A;  2N1T D;  3L72 G;  3NHI A;  1UP5 A;  3JCU E;  4BXL A;  1N7L A;  2KI6 D;  4H0L B;  3H1I E;  1ZRT D;  1NCX A;  1MF8 B;  1KFU L;  1SQV D;  2B89 A;  2E74 D;  2Y9Z A;  1Z56 A;  2NCP A;  3WMM 0;  5APY A;  1G4Y R;  1IRJ A;  1JCD A;  1N7S A;  3D70 A;  1XFR A;  1Y1A A;  4XA4 A;  1TNP A;  1UHK A;  3S0G A;  2WOR A;  3NSO A;  4OGQ D;  2KLV A;  3CCR P;  2IZ0 A;  2M1K B;  1FZB A;  1K04 A;  2IX7 C;  2Q6Q A;  4O9B A;  1YQ3 C;  3CCJ P;  1QV0 A;  4N78 E;  1NWD A;  2O1K A;  1B9A A;  2JXC A;  2FCD A;  1KB9 D;  1DJZ A;  3E7K A;  1IJ6 A;  4GOD A;  2AMI A;  1SQV J;  2WCJ A;  3I5I C;  1IFD A;  2BBN A;  1XYD A;  1ZRT E;  2W6A A;  3MD0 A;  1ZR2 A;  3PLF B;  3RZS A;  1KFN A;  2KSP A;  1BJF A;  4EDF A;  1Q81 Q;  1XO5 A;  2N9Y B;  2KB7 P;  3SG2 A;  1AP4 A;  1PIX A;  2SPZ A;  1LTT C;  3AEC C;  3NMD A;  1MXL C;  1VF5 B;  2JRF A;  2KI6 C;  4M2Q A;  3SSU A;  5B5E E;  3SWF A;  3A8R A;  3TGU G;  2LM5 A;  2E74 C;  1KB9 E;  2KAY A;  4DZO A;  1YRT B;  2K9J B;  1YRU B;  5KLI B;  4YXD C;  2WCK A;  3DVK A;  2E6W A;  2W6B A;  4DCK A;  2WQY C;  4OGQ C;  1VQ7 P;  4GIF A;  1NIW A;  3HRN A;  1NU1 E;  1S6I A;  1XFZ O;  2WOS A;  4E68 A;  1SQP J;  2R44 A;  1WDC C;  4PE7 A;  1XFY O;  2QEB A;  3O78 A;  4YRU A;  1NWQ A;  1ZR4 A;  3CZ0 A;  1WMK A;  2JPO A;  1G2C A;  3TDU A;  1NPQ A;  4HH2 A;  4UB8 E;  2GV5 A;  1ORG A;  1PGP A;  3RK3 B;  1SFC B;  3AEA C;  5FI2 A;  5FYX A;  1N73 B;  1ZFS A;  1LT9 A;  3VRR A;  1YJN P;  1JEK A;  3H25 A;  1JMM A;  3SG3 A;  4HYT B;  1FZA A;  2H43 A;  4RKU J;  1NHL A;  3H1I G;  4AUW A;  1A75 B;  3VGO A;  3CZ1 A;  3Q2Y A;  1HBW A;  2ZYA A;  1RF1 A;  1TNQ A;  5APS A;  4WY4 D;  2FXO A;  2KQ6 A;  1YVL A;  3CC2 P;  3DVE A;  4PJ0 H;  2NZ2 A;  2QEV A;  4EI2 A;  5TNC A;  1CFD A;  3D77 A;  1HGZ A;  4LC1 A;  3KZI E;  2JZI A;  1SQX J;  2WCE A;  2QJP C;  1T3J A;  4C7R A;  2AXT H;  1RWY A;  5M1B A;  2CBL A;  4OVN F;  2HFE D;  3DVM A;  1BSN A;  1OW8 A;  2ZXE B;  2WSF H;  2AUC A;  2J58 A;  1WRZ A;  3AED C;  2XZR A;  3R2P A;  1RQU A;  2HPC B;  1LKJ A;  3TK1 A;  3L37 A;  2YO3 A;  2NRG A;  4JF7 A;  1KK8 C;  2HET A;  4JQ0 D;  2QVA A;  4HSZ A;  5BU8 B;  3HCM A;  2HLO A;  2PVB A;  5J3X A;  2HPS A;  3FE8 A;  5HLV A;  4ZKP A;  1W9Z A;  2JNX A;  5KJ7 A;  3EVR A;  1QGK B;  1GQM A;  3U59 A;  1Y8A A;  3HD7 B;  3P7K A;  5TIS E;  5L8R J;  1UII A;  1UHN A;  1GK4 A;  3AEB C;  4WY4 C;  5GTI H;  2K1A A;  3T97 B;  1U57 A;  1FF1 A;  1BE3 D;  3CGA A;  2R3S A;  4XJK B;  1HGV A;  1NU1 G;  5CCG A;  4QMA A;  3SG5 A;  5BPJ A;  2Q9I A;  5AVV B;  2GTE A;  1XTG B;  3NXA A;  4ZNC A;  4A4C A;  3H6P A;  1HUC A;  1N7S D;  1M90 Q;  3C8V A;  2M49 B;  2NLN A;  2A45 I;  1KFU S;  5E79 E;  1VPC A;  2PSR A;  1M1J B;  2H61 C;  1S5G Y;  1FDM A;  1JTH B;  1USE A;  1QLK A;  3V6I A;  4EIJ A;  4WB4 A;  3UIA A;  2WSC H;  2FFD B;  1NTK K;  1P28 A;  2BAP A;  4JD9 A;  1BE3 E;  1DH3 A;  3RBZ A;  1K73 Q;  2QPT A;  4NQG A;  1IG5 A;  1BGY G;  1JF2 A;  1GM0 A;  3WHU B;  3GG2 A;  5ER4 X;  2QEO A;  1EDK A;  1DEE G;  3PJS K;  3V2N A;  1PGO A;  3FWL A;  1ZXG A;  3D0Y B;  2M29 A;  4OR9 B;  4PD4 H;  1AQT A;  1L4A B;  1TIZ A;  1P84 H;  2BCC D;  3ITK A;  1DJW A;  1F4O A;  2JC2 A;  2WND A;  1RQV A;  3BCC D;  3CI9 A;  1DJI A;  3N7H A;  3H1H E;  2WZ7 A;  3CAB A;  3B88 A;  3PN7 B;  5DKQ A;  4H13 D;  1N73 A;  1EXR A;  1FW4 A;  2P70 A;  1KQV A;  1JMB A;  3IF7 A;  5PAL A;  2OYI A;  4JKT A;  2QJY B;  5I8N A;  1YTZ T;  3GHG C;  1J7O A;  3K21 A;  1HT9 A;  3L4A A;  1ALV A;  1AVO A;  2VRS A;  1BU3 A;  4DIR A;  1BMO A;  1A75 A;  4ASV A;  1YIT P;  2BCC J;  1Y6W A;  2K61 A;  3VTP C;  1L2O C;  3BCC J;  2H7H A;  1X9V A;  3AEF C;  1KOR A;  1QV1 A;  1PZQ A;  5KAI H;  1FPW A;  1WY9 A;  1NGM B;  2BCC E;  3W68 A;  4JWQ A;  3G9R A;  1ZLL A;  3CLN A;  4U3F J;  3OB2 B;  2AEJ A;  2W6J H;  3AE2 C;  1K95 A;  3VP8 A;  3CR4 X;  3BCC E;  3L71 D;  4EYY Q;  1HF9 A;  3DXL A;  3Q3D A;  1Q2N A;  1ZOT B;  2R3C A;  1LTI C;  1K8A Q;  1FZC C;  2KYC A;  2F33 A;  3L74 D;  5AW6 B;  1C3Z A;  2YIU C;  3ZDM A;  2KNE A;  2M9G A;  1JY3 N;  1VDF A;  3AEG C;  2MJZ A;  3B5N B;  4UB6 H;  1XFW O;  2Y1N A;  1CB1 A;  1QL1 A;  2HPC A;  3WU2 E;  1UHH A;  5GTH H;  3TSI A;  4H13 C;  1FE6 A;  3L71 E;  5F6T A;  2M8U A;  4ASW A;  1FU1 A;  1F71 A;  1JNM A;  3H1K D;  3TS5 C;  4PHJ A;  1VRK A;  4OWF A;  1DF0 A;  1KQM C;  3L74 E;  4PAL A;  1GL2 A;  2F3Y A;  1BE3 G;  2LR2 A;  4INX A;  1KQG B;  3C1V A;  3K1E A;  3CLQ A;  1Y0V H;  3S0D A;  1GU4 A;  1KK7 Z;  1JO5 A;  2NPS B;  3SG7 A;  1J7P A;  2H8V A;  1L0N D;  1VQK P;  1PGJ A;  3L70 G;  4H0L D;  3PJI A;  3GLM A;  3MGN A;  3LCP C;  1OVV A;  2CK3 H;  2ZFC A;  5I2L A;  3L35 A;  2BBM A;  1LT9 C;  5HYD A;  5CJ0 A;  1DTL A;  1BSH A;  4JPZ B;  3H1K E;  1S36 A;  1KV4 A;  1KTM A;  3H1H G;  1SS1 A;  4CID A;  3CCL P;  2PMY A;  1GD2 E;  2QJK B;  1NTK D;  2KBI A;  3L73 D;  2JNF A;  2JP3 A;  1PSR A;  2K88 A;  1VQN P;  1H0T B;  4HRH A;  3OW2 O;  4BRY B;  3GK4 X;  3HUS B;  3IR9 A;  2JTZ A;  1S5L E;  3CX5 I;  4W80 A;  1YJ9 P;  3EFF K;  1L0N E;  2O1J A;  1GGW A;  2EC6 B;  2BCC G;  2N9B A;  3LLE A;  3ABV C;  2L98 A;  2WT7 B;  3WXA A;  1DQE A;  4W7Z A;  1KYO I;  1NTK J;  4MBE A;  3L73 J;  5FI7 A;  2ZRT A;  1OOG A;  1S5L X;  1EDJ A;  2WCL A;  2WVR A;  4C0L A;  1K9K A;  1HJ0 A;  1K9P A;  2H88 C;  1VF5 D;  2SAS A;  2RN0 A;  1UUR A;  3KO0 A;  3TUY B;  2I1K A;  4YGC B;  2HYN A;  2M3W A;  2WTY A;  5AER A;  3M06 A;  5HLO A;  1SP4 A;  2KLE A;  3MTU E;  4NDC A;  3EK7 A;  2JPT A;  1NOH A;  2W90 A;  5C39 A;  2WCB A;  5CBO A;  5APT A;  3IQQ A;  4USL A;  3L72 J;  3L75 D;  1RE4 C;  1X0T A;  1R8E A;  1NKZ B;  2F3Z A;  4OZD A;  3B4S A;  3L71 G;  3AE4 C;  4I5K A;  2P10 A;  5TJH A;  2LVK A;  1DIP A;  1E5W A;  2CPB A;  3CYZ A;  2BKH B;  4PE4 A;  2Q5U A;  2LAN A;  1K90 D;  3NTN A;  3RGU A;  3KPX A;  4YI8 A;  2EGD A;  3RK3 D;  2OYH A;  1NU1 K;  3L74 G;  1SFC D;  2CTN A;  2YXQ B;  2LE9 B;  4H44 B;  1FZG A;  2K37 A;  2GGM A;  1VQM P;  4GOE A;  1CTR A;  3OHM B;  3K5B A;  3V2R A;  1DC1 A;  3B86 A;  3L75 E;  3B5N A;  1IJD B;  1N2D A;  1X79 B;  4YGE B;  2AXT E;  4Q04 A;  1HJB A;  1FOS F;  1S9K D;  2CPS A;  3CS1 A;  2JWW A;  1VF5 C;  1A2X A;  3NSI A;  3OX5 A;  1T6A A;  2ZND A;  3RLZ A;  3H1K G;  5KAF H;  1LT1 A;  4INW A;  2AXC A;  1NKN A;  1FC2 C;  5APV A;  5BU5 A;  3CXH H;  1KB9 I;  1RF0 A;  4ZMD A;  3RK3 E;  4P5O E;  1OZS A;  3CWG A;  3BRV B;  1EXI A;  1Q82 Q;  2L2C A;  4DOJ A;  1TRF A;  1TTX A;  3A7O A;  2KLU A;  1J55 A;  3KYQ A;  1J2J B;  5H2F E;  1CM1 A;  3RL0 B;  1C07 A;  3TDI A;  1BG1 A;  1URQ B;  1MWN A;  1QJT A;  3D10 A;  5KTY A;  1F4Q A;  1KYO D;  2MJW B;  1MR8 A;  2LP3 A;  1L0N G;  2FY8 A;  2QIW A;  3TGU J;  2D2C B;  3C1L A;  2KI7 B;  3IAO A;  3L4F A;  1RE3 A;  1SCM B;  2IDB A;  1RFJ A;  1SYM A;  5AVS B;  3RK3 C;  1WLM A;  2KK7 A;  1Z4H A;  1MV8 A;  4ZCV A;  1SFC C;  1JBA A;  4GAO A;  2K2F A;  5GTI E;  1RF1 B;  2JT0 A;  1B7T Z;  1QS7 A;  3D74 A;  2FYN B;  3S0E A;  1AV1 A;  4ORB B;  2R2I A;  4I1L A;  2OTG B;  1C7W A;  1YHQ P;  3HD7 D;  3G71 P;  3EG5 B;  1KYO E;  4BRY A;  3VMA A;  3CC7 P;  2YKP A;  2FXP A;  3MUD A;  1EQ7 A;  1KWO B;  1LWU A;  2K7D A;  4MEW A;  2KDH A;  1LTJ A;  1SY9 A;  1VQO P;  1YX7 A;  3H1I J;  1HVV A;  3EK8 A;  2YKO A;  2O5G A;  1E79 H;  2JT3 A;  4I5N B;  2WT7 A;  2Y4Q A;  2K9Y A;  2WCH A;  1LGH B;  1WRL A;  4YI9 A;  2O60 A;  5HKW A;  3S0F A;  1TWO A;  5FI6 A;  1PV3 A;  3FX0 A;  3ZNI A;  4R4L A;  4A7P A; 
#chains in the Genus database with same CATH homology
 2CBL A;  3DD4 A;  4OVN F;  1BOC A;  2G9B A;  2Y9Y A;  1DGV A;  1M63 B;  1PUL A;  1DT7 B;  3DVM A;  5KU1 A;  1L2O B;  2PRU A;  2KHN A;  1YUU A;  1QAS A;  2AUC A;  4QJ3 B;  1SL9 A;  1WRZ A;  4M2O A;  2LV7 A;  1S3P A;  1LKJ A;  1OSA A;  1K2H A;  2MA2 A;  2TN4 A;  5AEQ A;  1QXP A;  1KK8 C;  4PE0 A;  1M46 A;  2HET A;  1YUR A;  4HSZ A;  1YTZ C;  4JQ0 D;  4ORA B;  5CSF A;  1OE9 B;  1JFK A;  1KFX S;  2VRG A;  3RM1 A;  3HCM A;  2PVB A;  5J3X A;  1AVS A;  2HPS A;  1TCO B;  1CFP A;  5HLV A;  3FS7 A;  2JNX A;  3DF0 B;  1GJY A;  2BEC A;  3GK2 A;  4C0J A;  1J1E A;  5I2O A;  3EVR A;  1H4B A;  1GQM A;  2F8P A;  2KAV A;  2KGR A;  2LMV A;  2LC5 A;  3EVU A;  2WC8 A;  2MLF C;  2PAS A;  3PM8 A;  2K8M B;  1UHN A;  1ZAC A;  2ZFD A;  4MVF A;  5JJG A;  2LMU A;  1EG3 A;  3VRQ A;  1EL4 A;  2LAP A;  1FF1 A;  2LVV A;  2K7O A;  3CGA A;  3AAK A;  1K9U A;  3BUM B;  4PDZ A;  4XJK B;  1LVC D;  4QJ4 B;  1PVA A;  1AHR A;  2MLE C;  3SG5 A;  5BPJ A;  4MZL A;  1WRK A;  3PAT A;  1KSM A;  1W7J B;  3DF0 A;  1DJH A;  5HKY A;  3O2P A;  1CDM A;  3NXA A;  3BOW B;  3AAJ A;  4NDB A;  3CTN A;  2L2E A;  2LLT A;  4PHN A;  4A4C A;  2L4H A;  2LHL A;  5D7F A;  1XFV O;  2M49 B;  2NLN A;  3VRN A;  1KFU S;  1JUO A;  2LHI A;  2PSR A;  1B7T Y;  2MAZ A;  3WHT B;  1A03 A;  1TCF A;  4ZCU A;  4ICB A;  1OMD A;  2H61 C;  1K96 A;  1S5G Y;  1F70 A;  1F54 A;  2P6B B;  1R2U A;  4BY5 A;  1NUB A;  1CFC A;  1QAT A;  1ZUZ A;  3AKA A;  4XJK A;  4BY4 A;  1QLK A;  1CDN A;  1S6J A;  1W7I B;  1Y1X A;  5D69 A;  1YR5 A;  2L4I A;  2IS9 A;  1OFC X;  5JOL A;  2L50 A;  1SRA A;  3FIA A;  5CSN A;  3BOW A;  4U8D A;  1ALW A;  1RRO A;  3DVJ A;  3FWB A;  1CKK A;  1A4P A;  2I2R E;  1OQP A;  3LL8 B;  2QPT A;  4NQG A;  5AXI A;  1JF0 A;  1IG5 A;  1SBJ A;  1JF2 A;  5CSJ A;  1F55 A;  1PSB A;  5DKR A;  3WHU B;  5ER4 X;  4HRG A;  3GK1 A;  5CPV A;  1B4C A;  1AUI B;  4YGB B;  3I5H C;  3D0Y B;  1BOD A;  2M29 A;  4OR9 B;  4GGN A;  1UUS A;  1J7Q A;  1QVI Z;  2H61 A;  1RK9 A;  1SKT A;  3I5H B;  4GGF C;  1TIZ A;  1PVB A;  1IQ3 A;  4MRY A;  1M45 A;  1DJW A;  1F4O A;  1LIN A;  2JC2 A;  2WND A;  2E30 A;  3OP0 A;  3O4Y A;  4DS7 A;  4AQJ A;  1DJY A;  1ZMZ A;  5IBW A;  1DJI A;  3PFV A;  2KQY A;  3PN7 C;  4I5J A;  4DUQ A;  4YGA A;  3JTD C;  2M7N A;  2NCO A;  3O6B A;  3PN7 B;  1NSH A;  5DKQ A;  3FWC A;  1RTP 1;  1EXR A;  1FW4 A;  1DMO A;  3JTD B;  1KQV A;  1DJX A;  3IF7 A;  2CXJ A;  5PAL A;  4CFR A;  2JT8 A;  3D0Y A;  1IH0 A;  2ZN9 A;  2BCX A;  3F45 A;  1XK4 C;  2CCM A;  5I8N A;  2I7A A;  1QIV A;  4MSP A;  1J7O A;  3K21 A;  2SCP A;  1HT9 A;  2OS8 C;  3WNX B;  1ALV A;  1TOP A;  3ZWH A;  1BU3 A;  4DIR A;  1BMO A;  4GGF A;  1A75 A;  1UHJ A;  2JU0 A;  4D1E A;  2OS8 B;  5GQQ C;  1Y6W A;  2K61 A;  3E3R A;  1L2O C;  1QV1 A;  1OMV A;  1WY9 A;  2ZRS A;  1FPW A;  2G2B A;  4JWQ A;  1SW8 A;  3CLN A;  3OB2 B;  1NCY A;  1K95 A;  3CR4 X;  1U5I A;  5I2Q A;  1FI5 A;  1IWQ A;  3A4U B;  3SG4 A;  1YVH A;  2NXQ A;  1ZOT B;  1YUT A;  1K8U A;  2KYC A;  2RGI A;  4UPG A;  1XK4 A;  2F33 A;  1XFX O;  2LVI A;  1IGV A;  2V53 A;  3CR5 X;  1Y1U A;  3ICB A;  2LP2 A;  1V1G A;  2JTT A;  1PK0 D;  4WQ2 A;  4OCI A;  4PE1 A;  1YX8 A;  2COL B;  1PRW A;  4ETO A;  3BUW B;  1J1D A;  4HRE E;  2KNE A;  2LCP A;  2LLS A;  2M9G A;  1H8B A;  1DF0 B;  4MN0 A;  3LK0 A;  1OZO A;  1XFW O;  2Y1N A;  4GPL B;  1CB1 A;  3QRX A;  2JOJ A;  1UHH A;  1F8H A;  1JFJ A;  2LNK A;  4MLW A;  1CLB A;  5F6T A;  2JUL A;  1NCZ A;  2M8U A;  1KCY A;  1QLS A;  1SNL A;  1SK6 D;  1G33 A;  4GBA A;  1MHO A;  3PAL A;  4F0Z B;  2L51 A;  3TS5 C;  1F71 A;  4PHJ A;  1K94 A;  1VRK A;  3I5G C;  3TS5 B;  1AJ5 A;  1LA3 A;  1QX2 A;  2Q91 A;  1BF5 A;  5B8I B;  2L5X B;  1EG4 A;  3NSK A;  1DF0 A;  1KQM C;  3I5G B;  1NYA A;  1R6P A;  4FQO A;  3SG6 A;  2KOT A;  4PAL A;  2F3Y A;  4OV2 A;  2FOT A;  4MRX A;  2I18 A;  1KQM B;  2AAO A;  2Q4U A;  4PCW A;  2FCE A;  1N65 A;  3C1V A;  2H2K A;  2KFF A;  1Y0V H;  1KK7 Z;  4YGD B;  1TNX A;  1RJV A;  3SG7 A;  4QJ5 B;  1J7P A;  1Q80 A;  3KEV A;  4N1G A;  4MZJ A;  4I5L B;  1M31 A;  1QVI Y;  1DJG A;  3LCP C;  1XA5 A;  1KSO A;  3M0W A;  5I2L A;  2BBM A;  2BCB A;  2K7B A;  2MHH A;  2L0P A;  1DGU A;  5HYD A;  3LK1 A;  1NX2 A;  1BR4 B;  1DTL A;  4FTG A;  1FBV A;  3BXK A;  2I94 A;  4JPZ B;  1S36 A;  1CMG A;  1SMG A;  4CID A;  2WCF A;  5G08 A;  1AK8 A;  2PMY A;  3EKJ A;  1JWD A;  1B8C A;  4PHM A;  2M7L A;  1JSA A;  2KBI A;  1QTX A;  4CLN A;  1MUX A;  1ODB A;  4C0K A;  1NX1 A;  5AAN A;  2BL0 C;  4N5X A;  2Y1M A;  1NP8 A;  2JNF A;  1PAL A;  1DVI A;  1PSR A;  1CDP A;  4HRH A;  2BL0 B;  2HQ8 A;  2K7C A;  3GK4 X;  1KFX L;  2JTZ A;  3HX4 A;  4GFT A;  2LUC A;  1OMR A;  2EC6 C;  1JC2 A;  4A4B A;  1BT6 A;  3BUX B;  1X02 A;  3AKB A;  1GGW A;  1LA0 A;  2EC6 B;  2KFG A;  1GGZ A;  4TNC A;  2LLU A;  3EVV A;  1N0Y A;  3LLE A;  2L98 A;  1CNP A;  2ISD A;  1L7Z A;  1CM4 A;  3WXA A;  1IQ5 A;  1S26 D;  4WQ3 A;  4WRI A;  5CSI A;  2QAC A;  1S6C A;  2B1U A;  1B8L A;  3KF9 A;  2ZNE A;  4MBE A;  2ZRT A;  2KFH A;  4YBH B;  1C7V A;  4C0L A;  1K9K A;  2M97 A;  3NSL A;  1K9P A;  4DRW A;  3TUY C;  1SPY A;  5K89 A;  2SAS A;  1CDL A;  1CLL A;  3SIA A;  1UUR A;  3KO0 A;  2F2P A;  4P2Y B;  4YGC B;  3TUY B;  2LUX A;  2M3W A;  1CMF A;  1UP5 A;  4MZK A;  5AER A;  2KGB C;  5HLO A;  1NX0 A;  2KI6 D;  3MSE B;  4NDC A;  4ORC B;  3EK7 A;  2JPT A;  1NCX A;  1MF8 B;  1KFU L;  2WCB A;  3JVT C;  1EH2 A;  2Y9Z A;  3IQQ A;  2NCP A;  2OPO A;  1G4Y R;  4USL A;  3H4S E;  3I5F C;  1IRJ A;  3JVT B;  3EK4 A;  4IL1 A;  1Y1A A;  1TNP A;  1UHK A;  3I5F B;  2WOR A;  3NSO A;  2F3Z A;  4N1F A;  4R1E A;  2M1K B;  4I5K A;  1XFU O;  4AOM A;  2MRD A;  2LVK A;  1OOJ A;  2BKH B;  2ZKM X;  4PE4 A;  2LAN A;  2K0J A;  1K90 D;  1QV0 A;  1NWD A;  3KPX A;  4YI8 A;  1B9A A;  1BR1 B;  2EGD A;  2JXC A;  3CZT X;  3OB1 B;  5DKN A;  2FCD A;  1DJZ A;  2CTN A;  2LE9 B;  2BE4 A;  1QX5 B;  1IJ6 A;  2AMI A;  2GGM A;  1KK8 B;  3I5I C;  4NDD A;  2BBN A;  1XYD A;  1UWO A;  1KK7 Y;  1SCV A;  1CTR A;  3I5I B;  3PLF B;  3VRP A;  2NZ0 A;  3OHM B;  1LXF C;  2KSP A;  1BJF A;  1SL8 A;  1MXE A;  1XO5 A;  3KHE A;  3SG2 A;  1N2D A;  4YGE B;  4Q04 A;  3SIB A;  1AP4 A;  3CS1 A;  4XYN A;  1TN4 A;  2BKI B;  2JWW A;  1A2X A;  2HF5 A;  3NSI A;  3OX5 A;  2ZND A;  3RLZ A;  1MXL C;  4CPV A;  2ZN8 A;  2JRF A;  1V1F A;  1CFF A;  2KI6 C;  1B47 A;  4M2Q A;  1D1O A;  4P5O E;  1B1G A;  3A8R A;  1XVJ A;  2LM5 A;  1OZS A;  1CLM A;  1YUS A;  3CWG A;  2DOQ A;  2KAY A;  3OX6 A;  1K93 D;  1REC A;  1YRT B;  3BQ3 A;  1YRU B;  1TRF A;  1TTX A;  2KI4 C;  5ER5 A;  1J55 A;  4CFQ A;  1BLQ A;  3BUO B;  2BCA A;  3TDZ A;  2KI4 B;  1CM1 A;  1B8R A;  1C07 A;  3DVK A;  2E6W A;  3TDI A;  1BG1 A;  1MWN A;  1QJT A;  2M0R A;  3D10 A;  1F4Q A;  4DCK A;  5KTY A;  2MJW B;  1MR8 A;  1NIW A;  2LP3 A;  1SL7 A;  2KYF A;  1S6I A;  2KAX A;  1IKU A;  1G8I A;  1FI6 A;  1SCM C;  1XFZ O;  2WOS A;  4E68 A;  3IQO A;  2M1U A;  1WDC C;  4PE7 A;  3CR2 A;  5AFP A;  1XFY O;  1QIW A;  1SCM B;  3O78 A;  3BUN B;  2CNP A;  1RFJ A;  4YRU A;  1SYM A;  1WDC B;  1WLZ A;  1WLM A;  4OKH A;  3TDU A;  1NPQ A;  4ZCV A;  1JBA A;  2GV5 A;  4GAO A;  2K2F A;  2JQ6 A;  2JT0 A;  1B7T Z;  1SR6 C;  1QS7 A;  2K2A A;  1IJ5 A;  1NX3 A;  4GNK B;  2HQW A;  1S5G Z;  5FYX A;  2PAL A;  1ZFS A;  3SJS A;  4AQI A;  1SR6 B;  3VRR A;  2OTG C;  2A4J A;  4ORB B;  5KSZ A;  1TNW A;  2R2I A;  3PSR A;  3SG3 A;  2OTG B;  1C7W A;  2KBM A;  3GOF A;  5HKZ A;  2MBX A;  4M2P A;  2F2O A;  2LMT A;  4L9M A;  2FJU B;  1A75 B;  1E8A A;  1KWO C;  3BYA A;  3VGO A;  2CT9 A;  3EKH A;  3TZ1 A;  1TNQ A;  1KWO B;  2K7D A;  1S1E A;  4GUK A;  4MEW A;  2KQ6 A;  1AJ4 A;  1YVL A;  2KDH A;  1UHI A;  1SY9 A;  1MQ1 A;  2JXL A;  1YX7 A;  3DVE A;  1EJ3 A;  2BE6 A;  1M39 A;  3EK8 A;  5TNC A;  1U5I B;  4PHK A;  2O5G A;  1CFD A;  2LVJ A;  2Y5I A;  2JT3 A;  4I5N B;  1A29 A;  2Y4Q A;  1HQV A;  2GGZ A;  1J7R A;  1QX7 A;  2JZI A;  1WRL A;  4YI9 A;  2O60 A;  2WCE A;  5HKW A;  3VRO A;  3ZNI A;  2D8N A;  2EHB A;  1RWY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...