2BE4A

X-ray structure an ef-hand protein from danio rerio dr.36843
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
270
structure length
270
Chain Sequence
SAFANLDAAGFLQIWQHFDADDNGYIEGKELDDFFRHMLKKLQPKDKITDERVQQIKKSFMSAYDATFDGRLQIEELANMILPQEENFLLIFRREAPLDNSVEFMKIWRKYDADSSGYISAAELKNFLKDLFLQHKKKIPPNKLDEYTDAMMKIFDKNKDGRLDLNDLARILALQENFLLQFKMDASSQVERKRDFEKIFAHYDVSRTGALEGPEVDGFVKDMMELVRPSISGGDLDKFRECLLTHCDMNKDGKIQKSELALCLGLKHKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein LOC449832
publication title X-ray structure of Danio rerio secretagogin: A hexa-EF-hand calcium sensor.
pubmed doi rcsb
source organism Danio rerio
total genus 82
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2005-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2be4A02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2be4A03
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2be4A01
5AEQA 3OB2B 1IH0A 5GQQC 1QV1A 1CMFA 1CLBA 2EGDA 5D69A 3NXAA 1XFZO 2BBMA 1TTXA 1R2UA 3A8RA 3LK1A 4YI9A 2K8MB 2MRDA 2BCAA 2ISDA 2G9BA 1SL9A 3DVEA 2BCXA 5HLOA 2I94A 4MZLA 1QIVA 1SMGA 3TS5C 1J1DA 3D0YB 3RLZA 5CSFA 2Q91A 5I2QA 2KHNA 1X02A 1B47A 2PALA 2IS9A 2GV5A 1B1GA 3I5GC 4NQGA 4OKHA 4PE7A 4N1GA 1JSAA 1F71A 5AFPA 3WHTB 2HETA 2I18A 2K2AA 3LCPC 4L9MA 1GJYA 2OS8C 4PHMA 1QS7A 5CSNA 3PM8A 1MR8A 2R2IA 2M7LA 3ZWHA 1K95A 2PSRA 4GFTA 1MQ1A 1S1EA 2ZKMX 3FIAA 1D1OA 2FOTA 3BUMB 3KPXA 2FCEA 1Y0VH 2ZFDA 3HX4A 2KI4B 1M31A 4DS7A 1Q80A 2Y5IA 4JPZB 1DJGA 3FWBA 1AHRA 3DF0B 4M2PA 4YGCB 3RM1A 1K9UA 1TNPA 1QVIY 3C1VA 2L4IA 1TCFA 1YUSA 4R1EA 3O78A 3PFVA 2JQ6A 1AJ5A 4A4CA 2F3YA 1UURA 3PN7B 3A4UB 2AUCA 4HREE 1R6PA 3BOWA 2JT0A 3I5IB 4MZKA 1H4BA 1OE9B 3BUXB 1K2HA 1CB1A 2P6BB 2GGMA 1PULA 1J7QA 1KQMC 3LK0A 5DKQA 1A75A 1H8BA 3H4SE 3GK4X 3SIBA 2LAPA 1A2XA 1QX7A 1KSMA 3CR4X 1F8HA 3EVUA 1BR1B 2GGZA 2JT8A 2BKIB 2KAVA 2ZRSA 4YGAA 5JJGA 1S5GZ 5HYDA 1EJ3A 1Y6WA 1CFFA 3VGOA 1XVJA 1NUBA 1BR4B 1JUOA 3DD4A 1B9AA 3EK4A 2I2RE 4N5XA 2M1UA 2M9GA 3BXKA 1WDCB 4NDBA 1TOPA 3E3RA 1CTRA 1J7OA 1B7TZ 2AAOA 2TN4A 1FI6A 1A29A 1IJ6A 1S26D 2KFGA 1TNXA 4GGNA 3WNXB 4N1FA 1SK6D 3VROA 5HKYA 2RGIA 4QJ4B 3SG5A 3CR2A 3CS1A 1SPYA 4HSZA 4I5NB 2LVIA 1DGVA 2KI4C 2WCBA 5CSIA 1BF5A 1M45A 3O2PA 2F2OA 2BL0B 3BUWB 3D0YA 4GGFA 2ZN8A 4OR9B 3VRNA 1IG5A 3O6BA 1JF2A 2LLUA 4OCIA 2KOTA 2L2EA 4XJKB 3PN7C 2CXJA 1ZUZA 3I5IC 1IRJA 4MRYA 2I7AA 3KHEA 2PVBA 1L2OC 1NIWA 3TDIA 3QRXA 2LHLA 2KI6D 4PE1A 2FJUB 4CLNA 1SCMB 1QIWA 2LP2A 2KBMA 3TDZA 1UHJA 1DJXA 1JFKA 3KO0A 3AAKA 1DTLA 1KK7Z 1K9KA 4GNKB 4M2QA 2CTNA 1ZACA 3I5FB 3ZNIA 1KK8C 1CLMA 3EVVA 2WNDA 1RJVA 1XFVO 4ORAB 2Q4UA 1CLLA 1XYDA 3DF0A 3FWCA 1BLQA 2M0RA 2LMVA 1WLZA 1QXPA 1XFWO 2M8UA 3D10A 1CFCA 1TIZA 5FYXA 4YRUA 4C0KA 1N0YA 1C7WA 2BKHB 1CFPA 1SNLA 3JVTC 2LLSA 1WDCC 2JC2A 4ICBA 2KQYA 1SKTA 1UWOA 4WQ3A 1MUXA 4ORBB 1KWOC 1F70A 1SCVA 3BQ3A 4PE4A 2L98A 1DVIA 2NLNA 1DT7B 1QATA 1QX2A 1TCOB 3TZ1A 5JOLA 1BOCA 1DMOA 2K7OA 1XA5A 1S6JA 1DJZA 2K61A 2KI6C 4P5OE 2K7CA 4ORCB 4GAOA 2V53A 4DUQA 1YUUA 3WHUB 3SG6A 2OTGB 4PDZA 2H2KA 3GK2A 2BE6A 1SYMA 2NXQA 1F4OA 3IF7A 1UHIA 2BCBA 2LV7A 3IQQA 1BODA 2LVJA 1NCZA 1MHOA 4MZJA 1IQ3A 1ZFSA 2KGRA 1NWDA 1S3PA 5CPVA 2KSPA 2K0JA 1M46A 1CKKA 4M2OA 4ZCVA 4PALA 1DF0B 2LNKA 4MN0A 2EHBA 2L5XB 1K93D 2JNFA 2G2BA 2KDHA 2L50A 3DVMA 3MSEB 2BBNA 4IL1A 4JQ0D 1CM4A 5AERA 2NCPA 3TDUA 3NSLA 3SG2A 1NX2A 4ZCUA 3JTDB 1EG4A 2JT3A 1QV0A 3I5FC 1K9PA 3OX5A 1EL4A 1F4QA 2O60A 1SL7A 1DJHA 2K7BA 4MEWA 2M97A 5HKWA 4D1EA 1FI5A 1EXRA 1BG1A 1SY9A 4MBEA 1SL8A 1MWNA 3KF9A 3SG3A 2JWWA 4YGEB 3PSRA 2WCFA 1KFUL 3IQOA 4GGFC 4PE0A 4WQ2A 4CFRA 1EH2A 2MA2A 1S36A 2JPTA 4GBAA 3AKBA 2WC8A 1TNQA 1TNWA 2Y1NA 1G8IA 2WCEA 4XJKA 1MF8B 4OVNF 2DOQA 1XK4A 4YGBB 1ALWA 2LVVA 2LE9B 1RROA 2JNXA 1W7IB 2M49B 1NPQA 1B4CA 4YGDB 1S6IA 4I5JA 2MHHA 1KFXL 5KTYA 1XFUO 1NYAA 1CDPA 1G33A 1OMDA 1ALVA 4MSPA 5KSZA 1SR6B 1PALA 2M1KB 1YTZC 3VRRA 1JC2A 1YVLA 2M3WA 2JTTA 2SASA 1B8CA 2LVKA 3CR5X 2CBLA 1QVIZ 3I5HB 1N65A 1HT9A 3DVJA 3SG4A 3TS5B 4DRWA 4PCWA 4ETOA 2JRFA 5I2LA 1V1FA 2KQ6A 3O4YA 1K90D 3PLFB 4PHKA 1UP5A 4P2YB 1TN4A 1UUSA 1N2DA 4QJ3B 2H61C 1K8UA 1SRAA 2OS8B 1J7PA 5ER5A 1LXFC 1NP8A 1PSRA 3VRPA 1BMOA 2K7DA 2NZ0A 2KBIA 1M39A 2BE4A 1NSHA 2LMTA 5D7FA 2AMIA 1IQ5A 5TNCA 2CNPA 2OPOA 3K21A 1QLKA 5ER4X 3CLNA 4AQJA 4I5KA 1RTP1 1HQVA 2WORA 2F33A 3CZTX 3OP0A 2WOSA 4CPVA 2MLFC 1NCXA 1S6CA 1KFUS 3CGAA 4F0ZB 2A4JA 2LC5A 4CFQA 2LMUA 3CWGA 1RWYA 3OX6A 3TUYB 1TRFA 1KSOA 1WY9A 1YURA 2E6WA 1W7JB 3EKJA 4BY4A 2MLEC 1DF0A 1GGWA 1DJWA 1AJ4A 2H61A 4I5LB 2SCPA 4MVFA 2EC6B 1LINA 1KQMB 1SW8A 4OV2A 5CSJA 3LL8B 1JFJA 1M63B 4C0LA 1KFXS 2K2FA 2HQWA 1YUTA 2MJWB 1OQPA 1SR6C 2B1UA 3EVRA 1OZSA 1AUIB 4U8DA 3OHMB 1AK8A 1G4YR 1C7VA 1IWQA 5I8NA 3FS7A 3WXAA 2M29A 2CCMA 3M0WA 1CDLA 1SBJA 2KFFA 3I5HC 4MLWA 5BPJA 1YRUB 5DKRA 3BYAA 1VRKA 3BUOB 1S5GY 2ZNDA 2BL0C 2CT9A 1PVBA 4QJ5B 2L51A 1U5IB 1OMVA 3BUNB 1WLMA 2LUCA 4C0JA 3DVKA 1PRWA 1XK4C 2KYCA 5I2OA 1GGZA 1QASA 3AKAA 1ZMZA 1AP4A 1B7TY 3NSIA 1F54A 2O5GA 1LVCD 4FQOA 2VRGA 1FBVA 3ICBA 5DKNA 1FPWA 1AVSA 1SCMC 2LUXA 4DCKA 1JBAA 2KGBC 1L7ZA 4MRXA 1DJYA 3LLEA 2D8NA 1K96A 2PMYA 1QJTA 4GPLB 1KCYA 2KFHA 3EK7A 1FF1A 1RECA 1ZOTB 4PHNA 1MXEA 3VRQA 1K94A 1PK0D 1UHKA 5IBWA 1BT6A 1CM1A 1DJIA 5G08A 3CTNA 1DGUA 1WRLA 1CDNA 3TUYC 1V1GA 1OZOA 1J1EA 2L4HA 4CIDA 5J3XA 3PALA 2E30A 4PHJA 2LANA 1NX3A 5K89A 1YR5A 5KU1A 1PVAA 1L2OB 3GK1A 5HKZA 2EC6C 1B8LA 1J7RA 1OOJA 2QPTA 4HRGA 2Y1MA 2QACA 4BY5A 1JWDA 2JXLA 2FCDA 3NSKA 1NX1A 3AAJA 2KAYA 1J55A 2KNEA 4E68A 4YBHB 2COLB 1KK8B 1QTXA 1KK7Y 4HRHA 3GOFA 4JWQA 2JTZA 2OTGC 1KQVA 4AOMA 3SG7A 2ZN9A 1EG3A 2KYFA 3EK8A 4GUKA 2BECA 1OMRA 2LCPA 3OB1B 1NCYA 2HF5A 3JVTB 1LA3A 1XFXO 1Y1XA 2JZIA 4WRIA 5F6TA 2PASA 1B8RA 2F3ZA 4UPGA 1LA0A 5HLVA 1C07A 1RFJA 1Y1UA 3I5GB 1IGVA 1KWOB 4NDDA 4NDCA 5AXIA 3HCMA 4AQIA 4DIRA 3BOWB 1A4PA 2M7NA 1MXLC 1QX5B 1E8AA 4XYNA 2ZRTA 1YRTB 2F2PA 4YI8A 3NSOA 2F8PA 2MAZA 5B8IB 1XFYO 1A75B 2ZNEA 1YX8A 1JF0A 1BU3A 1XO5A 2LP3A 1CDMA 4A4BA 3JTDC 5PALA 1WRKA 2LLTA 1BJFA 3EKHA 1IKUA 2KAXA 1LKJA 2HPSA 1CFDA 2JXCA 1IJ5A 1ODBA 3SJSA 1RK9A 1GQMA 1UHHA 2NCOA 3F45A 4USLA 5AANA 1CNPA 1WRZA 4Q04A 1YVHA 1Y1AA 2L0PA 3SIAA 2JU0A 1F55A 1YX7A 2PRUA 1U5IA 3PATA 1FW4A 4FTGA 2Y4QA 2JULA 2HQ8A 1QLSA 2LM5A 4TNCA 2MBXA 2LHIA 1CMGA 1OSAA 3KEVA 1PSBA 1A03A 2JOJA 1UHNA 1NX0A
chains in the Genus database with same CATH superfamily
5AEQA 3OB2B 1IH0A 5GQQC 1QV1A 1CMFA 1CLBA 2EGDA 5D69A 3NXAA 3D76A 1XFZO 3SS3A 2BBMA 1TTXA 1R2UA 3A8RA 3LK1A 4OZDA 4YI9A 2K8MB 2MRDA 3NHTA 1TWOA 2BCAA 2ISDA 2G9BA 1SL9A 3DVEA 2BCXA 5HLOA 2I94A 4MZLA 3VB1A 1OOHA 1QIVA 3S0BA 1SMGA 3TS5C 1J1DA 3D0YB 3RLZA 3D75A 5CSFA 2Q91A 5I2QA 2KHNA 1X02A 1B47A 1OOIX 2PALA 2IS9A 3BFAA 2GV5A 1B1GA 3I5GC 4NQGA 4OKHA 4PE7A 4N1GA 1JSAA 1F71A 5AFPA 3WHTB 2HETA 2I18A 2K2AA 3LCPC 4L9MA 1GJYA 2OS8C 4PHMA 1QS7A 5CSNA 3PM8A 1MR8A 2R2IA 2M7LA 3ZWHA 1K95A 2PSRA 4GFTA 1MQ1A 1TUZA 1S1EA 2ZKMX 3FIAA 1D1OA 2FOTA 3BUMB 3KPXA 1DC1A 2JPOA 2FCEA 1Y0VH 1LS8A 2ZFDA 3HX4A 2KI4B 1M31A 4DS7A 3BJHA 1Q80A 3S0EA 2Y5IA 3R72A 1DJGA 3FWBA 4JPZB 1AHRA 1OOGA 3DF0B 4M2PA 4YGCB 3RM1A 1K9UA 1TNPA 3D74A 3Q8IA 1QVIY 3C1VA 2L4IA 1TCFA 1YUSA 4R1EA 3O78A 3PFVA 2JQ6A 1AJ5A 4A4CA 2F3YA 1UURA 3PN7B 3A4UB 2AUCA 4HREE 1R6PA 3CZ1A 3BOWA 2JT0A 3I5IB 4MZKA 1H4BA 1OE9B 3BUXB 1K2HA 1CB1A 2P6BB 2GGMA 3D77A 1PULA 1J7QA 1KQMC 3LK0A 5DKQA 1A75A 1H8BA 3H4SE 3GK4X 3SIBA 2LAPA 3UO9A 1A2XA 1QX7A 1KSMA 3FE8A 3NGVA 3CR4X 1F8HA 3EVUA 1BR1B 2GGZA 2QEVA 3O4XA 3B87A 2JT8A 2BKIB 2KAVA 2ZRSA 4YGAA 5JJGA 1S5GZ 5HYDA 1EJ3A 1Y6WA 1CFFA 3VGOA 1XVJA 1NUBA 1BR4B 2QDIA 1JUOA 3CYZA 3DD4A 1B9AA 3EK4A 2I2RE 4N5XA 2M1UA 1C3YA 2M9GA 3BXKA 1WDCB 4NDBA 1TOPA 3E3RA 1CTRA 1J7OA 1B7TZ 2AAOA 2TN4A 2YGUA 3L47A 1FI6A 1A29A 1IJ6A 1S26D 2KFGA 1TNXA 2L5YA 4GGNA 4PT1A 3WNXB 1IIOA 4N1FA 1SK6D 3VROA 5HKYA 2RGIA 4QJ4B 3SG5A 3CR2A 3CS1A 1SPYA 4HSZA 4I5NB 2LVIA 3B6XA 1DGVA 2KI4C 2WCBA 5CSIA 2KLDA 4JKTA 1BF5A 1M45A 3O2PA 2F2OA 2BL0B 3BUWB 3D0YA 4GGFA 2ZN8A 4OR9B 3VRNA 1IG5A 3O6BA 4JD9A 1JF2A 2LLUA 5FI2A 1Z4HA 4OCIA 2H8VA 2KOTA 2L2EA 4XJKB 3PN7C 2CXJA 1ZUZA 3OBVA 2BNXA 4IJ7A 3I5IC 1IRJA 4MRYA 2I7AA 3KHEA 2PVBA 1L2OC 1NIWA 3TDIA 3QRXA 2LHLA 2KI6D 4PE1A 2FJUB 4CLNA 1SCMB 1QIWA 2LP2A 3S0DA 2KBMA 2GTEA 3TDZA 1UHJA 1DJXA 1JFKA 2BAPA 3KO0A 3R1OA 3AAKA 1DTLA 1KK7Z 1K9KA 4GNKB 4M2QA 2CTNA 1ZACA 3I5FB 3ZNIA 1KK8C 1CLMA 2P70A 3EVVA 2WNDA 3CDNA 1RJVA 1XFVO 4ORAB 2Q4UA 1CLLA 1XYDA 3DF0A 3FWCA 1BLQA 2M0RA 2LMVA 1WLZA 1QXPA 1XFWO 2M8UA 3D10A 3DY9A 1CFCA 1TIZA 4INXA 5FYXA 4YRUA 4C0KA 1N0YA 1C7WA 1SSEB 2BKHB 1CFPA 1SNLA 3JVTC 2LLSA 1WDCC 2JC2A 4ICBA 2KQYA 1SKTA 1UWOA 4WQ3A 1MUXA 4ORBB 2FJYA 2WC5A 1KWOC 3CZ0A 1F70A 1SCVA 3BQ3A 4PE4A 1W9ZA 2L98A 1DVIA 2NLNA 2WCJA 1QATA 1QX2A 1TCOB 1DT7B 3TZ1A 5JOLA 1BOCA 4JQ0D 1DMOA 1GM0A 5FI7A 2K7OA 1XA5A 1S6JA 1DJZA 2K61A 2KI6C 4P5OE 2K7CA 4ORCB 4GAOA 3L4LA 2V53A 4DUQA 1YUUA 1QWVA 3WHUB 3SG6A 2OTGB 4PDZA 2H2KA 3GK2A 3FE9A 2BE6A 1SYMA 2NXQA 2QEBA 1F4OA 3QMEA 3IF7A 1UHIA 2BCBA 2LV7A 3IQQA 1BODA 2LVJA 1NCZA 1MHOA 4MZJA 1IQ3A 1ZFSA 2KGRA 1NWDA 1S3PA 3NHIA 5CPVA 2KSPA 2K0JA 1M46A 1CKKA 4M2OA 2WCHA 4ZCVA 2WCKA 4PALA 1DF0B 2LNKA 4MN0A 2EHBA 2L5XB 2PQLA 1K93D 2JNFA 2G2BA 2KDHA 2L50A 3DVMA 3DZTA 2BBNA 3MSEB 4INWA 1CM4A 4IL1A 5AERA 2NCPA 3S0AA 3TDUA 3NSLA 3SG2A 1NX2A 4ZCUA 3JTDB 1EG4A 2JT3A 1QV0A 3I5FC 3CZ2A 1K9PA 3SS4A 1XFRA 3OX5A 1EL4A 1F4QA 2O60A 1T14A 1SL7A 1DJHA 2K7BA 4MEWA 2M97A 5HKWA 3UNWA 4D1EA 3PM2A 1EXRA 1BG1A 1SY9A 4MBEA 1SL8A 1MWNA 3KF9A 3SG3A 2JWWA 4YGEB 3PSRA 2WCFA 1KFUL 3IQOA 4GGFC 4PE0A 4WQ2A 4CFRA 1EH2A 2MA2A 1S36A 2JPTA 4GBAA 3AKBA 3D73A 2WC8A 1TNQA 3BFHA 1TNWA 2Y1NA 1G8IA 2WCEA 4XJKA 2ERBA 3R1PA 1MF8B 3N7HA 4OVNF 2DOQA 1XK4A 4YGBB 1ALWA 2LVVA 2LE9B 1Z2CB 1RROA 2JNXA 2PYQA 1W7IB 2M49B 1NPQA 1B4CA 4YGDB 1S6IA 4I5JA 2MHHA 1KFXL 5KTYA 1XFUO 1NYAA 1CDPA 1G33A 1OMDA 1ALVA 1P28A 4MSPA 5KSZA 1SR6B 1PALA 2M1KB 1YTZC 3VRRA 1JC2A 1YVLA 2WC6A 2M3WA 2JTTA 2SASA 1B8CA 2LVKA 3CR5X 2CBLA 1QVIZ 3I5HB 1N65A 1HT9A 2L2CA 3DVJA 3SG4A 3TS5B 4DRWA 4PCWA 4ETOA 2JRFA 3B86A 5I2LA 1V1FA 2KQ6A 3O4YA 1K90D 2WCMA 4F7FA 3PLFB 4PHKA 1UP5A 4P2YB 1TN4A 1UUSA 1N2DA 4QJ3B 2H61C 1K8UA 1SRAA 2WCLA 2OS8B 1J7PA 5ER5A 1LXFC 2QEHA 1NP8A 1PSRA 3SS5A 2KPHA 3VRPA 1BMOA 2K7DA 2NZ0A 2KBIA 1M39A 2BE4A 3B7AA 1NSHA 2LMTA 3R1VA 5D7FA 2AMIA 1IQ5A 5TNCA 2CNPA 2OPOA 3K21A 1QLKA 3CABA 5ER4X 3CLNA 4AQJA 4I5KA 1RTP1 1HQVA 3OGNA 2WORA 2F33A 3CZTX 3OP0A 2WOSA 4CPVA 2MLFC 1NCXA 1S6CA 1KFUS 3B88A 3CGAA 4F0ZB 2A4JA 2LC5A 4CFQA 2LMUA 3IVTA 3CWGA 1RWYA 3OX6A 3TUYB 1TRFA 1KSOA 1WY9A 1YURA 2E6WA 1W7JB 3EKJA 4BY4A 2MLEC 1DF0A 1GGWA 1DJWA 1AJ4A 2H61A 4I5LB 2SCPA 4MVFA 2EC6B 1LINA 1KQMB 1SW8A 3DXLA 4OV2A 3LL8B 5CSJA 1JFJA 1M63B 4C0LA 1KFXS 2K2FA 2HQWA 1YUTA 2MJWB 1OQPA 4KYNA 1SR6C 2B1UA 3EVRA 1FI5A 1OZSA 1AUIB 4U8DA 3OHMB 1AK8A 1G4YR 1C7VA 1IWQA 5I8NA 3FS7A 3WXAA 2M29A 2CCMA 3M0WA 1CDLA 1SBJA 2KFFA 3I5HC 4MLWA 5BPJA 1YRUB 5DKRA 3BYAA 1VRKA 3BUOB 1S5GY 2ZNDA 2BL0C 2CT9A 1PVBA 4QJ5B 2L51A 1U5IB 2K60A 1OMVA 3BUNB 1WLMA 2LUCA 4C0JA 3DVKA 3DYEA 1PRWA 1XK4C 2KYCA 3L4AA 5I2OA 3RZSA 1GGZA 1QASA 3AKAA 1ZMZA 1AP4A 1B7TY 3NSIA 1F54A 2O5GA 1LVCD 4FQOA 2VRGA 1FBVA 1OOFA 3ICBA 3K1EA 5DKNA 1FPWA 1AVSA 1C3ZA 1SCMC 2KLEA 2LUXA 4DCKA 2KGBC 1JBAA 1L7ZA 4MRXA 1DJYA 3LLEA 2D8NA 1K96A 2PMYA 1QJTA 4GPLB 1KCYA 2KFHA 3EK7A 1FF1A 1RECA 1ZOTB 4PHNA 1MXEA 4FQTA 1K94A 1PK0D 1UHKA 3VRQA 5IBWA 1BT6A 1CM1A 1DJIA 3S0FA 5G08A 3CTNA 1DGUA 1WRLA 1CDNA 2QEOA 3TUYC 1V1GA 1OZOA 1J1EA 2L4HA 4CIDA 5J3XA 3PALA 2E30A 4PHJA 2LANA 1NX3A 5K89A 1YR5A 3BFBA 5KU1A 1PVAA 1L2OB 3GK1A 3FE6A 5HKZA 2EC6C 1B8LA 1J7RA 1OOJA 2QPTA 5EL2A 4HRGA 2Y1MA 2QACA 4BY5A 1JWDA 2JXLA 2FCDA 3NSKA 1NX1A 3AAJA 2KAYA 1J55A 2KNEA 4E68A 4YBHB 2COLB 1KK8B 1QTXA 1KK7Y 4HRHA 3GOFA 4JWQA 2JTZA 2OTGC 1KQVA 4AOMA 3SG7A 2ZN9A 1EG3A 1DELA 2KYFA 3EK8A 2BECA 4GUKA 1OMRA 2LCPA 5DICA 5HL1A 3OB1B 5D3OA 1NCYA 2HF5A 3JVTB 1DQEA 1LA3A 1TUJA 1XFXO 1Y1XA 2JZIA 4WRIA 5F6TA 2PASA 1B8RA 2F3ZA 4UPGA 1LA0A 5HLVA 1C07A 1RFJA 1Y1UA 3I5GB 1IGVA 1KWOB 4NDDA 4NDCA 5AXIA 3HCMA 4AQIA 4DIRA 3BOWB 1A4PA 2M7NA 1MXLC 1QX5B 1E8AA 4XYNA 2ZRTA 1YRTB 2F2PA 4YI8A 3NSOA 2F8PA 2MAZA 5B8IB 1XFYO 1A75B 2ZNEA 1YX8A 1JF0A 1BU3A 1XO5A 2LP3A 1CDMA 3PJIA 4A4BA 3JTDC 2P71A 5PALA 1WRKA 2LLTA 1BJFA 3EG5B 3EKHA 1IKUA 2KAXA 1LKJA 2HPSA 3D78A 1CFDA 2JXCA 1IJ5A 1ODBA 3SJSA 3V2LA 1RK9A 1GQMA 1UHHA 2NCOA 3F45A 4USLA 5FI6A 5AANA 5I94A 3S0GA 1CNPA 1WRZA 4Q04A 1YVHA 1Y1AA 2L0PA 3SIAA 1ORGA 2JU0A 1YX7A 1F55A 2PRUA 1U5IA 3PATA 1FW4A 4FTGA 1DEKA 2Y4QA 2JULA 2HQ8A 1QLSA 2LM5A 4TNCA 2MBXA 2LHIA 1CMGA 1OSAA 3KEVA 1PSBA 1A03A 2JOJA 1OW4A 1UHNA 1NX0A
chains in the Genus database with same CATH topology
5AEQA 3OB2B 1IH0A 5GQQC 1QV1A 1CMFA 1CLBA 2EGDA 5D69A 3NXAA 1XFZO 2BBMA 1TTXA 1R2UA 3A8RA 3LK1A 4YI9A 2K8MB 2MRDA 2BCAA 2ISDA 2G9BA 1SL9A 3DVEA 2BCXA 5HLOA 2I94A 4MZLA 1QIVA 1SMGA 3TS5C 1J1DA 3D0YB 3RLZA 5CSFA 2Q91A 5I2QA 2KHNA 1X02A 1B47A 2PALA 2IS9A 2GV5A 1B1GA 3I5GC 4NQGA 4OKHA 4PE7A 4N1GA 1JSAA 1F71A 5AFPA 3WHTB 2HETA 2I18A 2K2AA 3LCPC 4L9MA 1GJYA 2OS8C 4PHMA 1QS7A 5CSNA 3PM8A 1MR8A 2R2IA 2M7LA 3ZWHA 1K95A 2PSRA 4GFTA 1MQ1A 1S1EA 2ZKMX 3FIAA 1D1OA 2FOTA 3BUMB 3KPXA 2FCEA 1Y0VH 2ZFDA 3HX4A 2KI4B 1M31A 4DS7A 1Q80A 2Y5IA 4JPZB 1DJGA 3FWBA 1AHRA 3DF0B 4M2PA 4YGCB 3RM1A 1K9UA 1TNPA 1QVIY 3C1VA 2L4IA 1TCFA 1YUSA 4R1EA 3O78A 3PFVA 2JQ6A 1AJ5A 4A4CA 2F3YA 1UURA 3PN7B 3A4UB 2AUCA 4HREE 1R6PA 3BOWA 2JT0A 3I5IB 4MZKA 1H4BA 1OE9B 3BUXB 1K2HA 1CB1A 2P6BB 2GGMA 1PULA 1J7QA 1KQMC 3LK0A 5DKQA 1A75A 1H8BA 3H4SE 3GK4X 3SIBA 2LAPA 1A2XA 1QX7A 1KSMA 3CR4X 1F8HA 3EVUA 1BR1B 2GGZA 2JT8A 2BKIB 2KAVA 2ZRSA 4YGAA 5JJGA 1S5GZ 5HYDA 1EJ3A 1Y6WA 1CFFA 3VGOA 1XVJA 1NUBA 1BR4B 1JUOA 3DD4A 1B9AA 3EK4A 2I2RE 4N5XA 2M1UA 2M9GA 3BXKA 1WDCB 4NDBA 1TOPA 3E3RA 1CTRA 1J7OA 1B7TZ 2AAOA 2TN4A 1FI6A 1A29A 1IJ6A 1S26D 2KFGA 1TNXA 4GGNA 3WNXB 4N1FA 1SK6D 3VROA 5HKYA 2RGIA 4QJ4B 3SG5A 3CR2A 3CS1A 1SPYA 4HSZA 4I5NB 2LVIA 1DGVA 2KI4C 2WCBA 5CSIA 1BF5A 1M45A 3O2PA 2F2OA 2BL0B 3BUWB 3D0YA 4GGFA 2ZN8A 4OR9B 3VRNA 1IG5A 3O6BA 1JF2A 2LLUA 4OCIA 2KOTA 2L2EA 4XJKB 3PN7C 2CXJA 1ZUZA 3I5IC 1IRJA 4MRYA 2I7AA 3KHEA 2PVBA 1L2OC 1NIWA 3TDIA 3QRXA 2LHLA 2KI6D 4PE1A 2FJUB 4CLNA 1SCMB 1QIWA 2LP2A 2KBMA 3TDZA 1UHJA 1DJXA 1JFKA 3KO0A 3AAKA 1DTLA 1KK7Z 1K9KA 4GNKB 4M2QA 2CTNA 1ZACA 3I5FB 3ZNIA 1KK8C 1CLMA 3EVVA 2WNDA 1RJVA 1XFVO 4ORAB 2Q4UA 1CLLA 1XYDA 3DF0A 3FWCA 1BLQA 2M0RA 2LMVA 1WLZA 1QXPA 1XFWO 2M8UA 3D10A 1CFCA 1TIZA 5FYXA 4YRUA 4C0KA 1N0YA 1C7WA 2BKHB 1CFPA 1SNLA 3JVTC 2LLSA 1WDCC 2JC2A 4ICBA 2KQYA 1SKTA 1UWOA 4WQ3A 1MUXA 4ORBB 1KWOC 1F70A 1SCVA 3BQ3A 4PE4A 2L98A 1DVIA 2NLNA 1DT7B 1QATA 1QX2A 1TCOB 3TZ1A 5JOLA 1BOCA 1DMOA 2K7OA 1XA5A 1S6JA 1DJZA 2K61A 2KI6C 4P5OE 2K7CA 4ORCB 4GAOA 2V53A 4DUQA 1YUUA 3WHUB 3SG6A 2OTGB 4PDZA 2H2KA 3GK2A 2BE6A 1SYMA 2NXQA 1F4OA 3IF7A 1UHIA 2BCBA 2LV7A 3IQQA 1BODA 2LVJA 1NCZA 1MHOA 4MZJA 1IQ3A 1ZFSA 2KGRA 1NWDA 1S3PA 5CPVA 2KSPA 2K0JA 1M46A 1CKKA 4M2OA 4ZCVA 4PALA 1DF0B 2LNKA 4MN0A 2EHBA 2L5XB 1K93D 2JNFA 2G2BA 2KDHA 2L50A 3DVMA 3MSEB 2BBNA 4IL1A 4JQ0D 1CM4A 5AERA 2NCPA 3TDUA 3NSLA 3SG2A 1NX2A 4ZCUA 3JTDB 1EG4A 2JT3A 1QV0A 3I5FC 1K9PA 3OX5A 1EL4A 1F4QA 2O60A 1SL7A 1DJHA 2K7BA 4MEWA 2M97A 5HKWA 4D1EA 1FI5A 1EXRA 1BG1A 1SY9A 4MBEA 1SL8A 1MWNA 3KF9A 3SG3A 2JWWA 4YGEB 3PSRA 2WCFA 1KFUL 3IQOA 4GGFC 4PE0A 4WQ2A 4CFRA 1EH2A 2MA2A 1S36A 2JPTA 4GBAA 3AKBA 2WC8A 1TNQA 1TNWA 2Y1NA 1G8IA 2WCEA 4XJKA 1MF8B 4OVNF 2DOQA 1XK4A 4YGBB 1ALWA 2LVVA 2LE9B 1RROA 2JNXA 1W7IB 2M49B 1NPQA 1B4CA 4YGDB 1S6IA 4I5JA 2MHHA 1KFXL 5KTYA 1XFUO 1NYAA 1CDPA 1G33A 1OMDA 1ALVA 4MSPA 5KSZA 1SR6B 1PALA 2M1KB 1YTZC 3VRRA 1JC2A 1YVLA 2M3WA 2JTTA 2SASA 1B8CA 2LVKA 3CR5X 2CBLA 1QVIZ 3I5HB 1N65A 1HT9A 3DVJA 3SG4A 3TS5B 4DRWA 4PCWA 4ETOA 2JRFA 5I2LA 1V1FA 2KQ6A 3O4YA 1K90D 3PLFB 4PHKA 1UP5A 4P2YB 1TN4A 1UUSA 1N2DA 4QJ3B 2H61C 1K8UA 1SRAA 2OS8B 1J7PA 5ER5A 1LXFC 1NP8A 1PSRA 3VRPA 1BMOA 2K7DA 2NZ0A 2KBIA 1M39A 2BE4A 1NSHA 2LMTA 5D7FA 2AMIA 1IQ5A 5TNCA 2CNPA 2OPOA 3K21A 1QLKA 5ER4X 3CLNA 4AQJA 4I5KA 1RTP1 1HQVA 2WORA 2F33A 3CZTX 3OP0A 2WOSA 4CPVA 2MLFC 1NCXA 1S6CA 1KFUS 3CGAA 4F0ZB 2A4JA 2LC5A 4CFQA 2LMUA 3CWGA 1RWYA 3OX6A 3TUYB 1TRFA 1KSOA 1WY9A 1YURA 2E6WA 1W7JB 3EKJA 4BY4A 2MLEC 1DF0A 1GGWA 1DJWA 1AJ4A 2H61A 4I5LB 2SCPA 4MVFA 2EC6B 1LINA 1KQMB 1SW8A 4OV2A 5CSJA 3LL8B 1JFJA 1M63B 4C0LA 1KFXS 2K2FA 2HQWA 1YUTA 2MJWB 1OQPA 1SR6C 2B1UA 3EVRA 1OZSA 1AUIB 4U8DA 3OHMB 1AK8A 1G4YR 1C7VA 1IWQA 5I8NA 3FS7A 3WXAA 2M29A 2CCMA 3M0WA 1CDLA 1SBJA 2KFFA 3I5HC 4MLWA 5BPJA 1YRUB 5DKRA 3BYAA 1VRKA 3BUOB 1S5GY 2ZNDA 2BL0C 2CT9A 1PVBA 4QJ5B 2L51A 1U5IB 1OMVA 3BUNB 1WLMA 2LUCA 4C0JA 3DVKA 1PRWA 1XK4C 2KYCA 5I2OA 1GGZA 1QASA 3AKAA 1ZMZA 1AP4A 1B7TY 3NSIA 1F54A 2O5GA 1LVCD 4FQOA 2VRGA 1FBVA 3ICBA 5DKNA 1FPWA 1AVSA 1SCMC 2LUXA 4DCKA 1JBAA 2KGBC 1L7ZA 4MRXA 1DJYA 3LLEA 2D8NA 1K96A 2PMYA 1QJTA 4GPLB 1KCYA 2KFHA 3EK7A 1FF1A 1RECA 1ZOTB 4PHNA 1MXEA 3VRQA 1K94A 1PK0D 1UHKA 5IBWA 1BT6A 1CM1A 1DJIA 5G08A 3CTNA 1DGUA 1WRLA 1CDNA 3TUYC 1V1GA 1OZOA 1J1EA 2L4HA 4CIDA 5J3XA 3PALA 2E30A 4PHJA 2LANA 1NX3A 5K89A 1YR5A 5KU1A 1PVAA 1L2OB 3GK1A 5HKZA 2EC6C 1B8LA 1J7RA 1OOJA 2QPTA 4HRGA 2Y1MA 2QACA 4BY5A 1JWDA 2JXLA 2FCDA 3NSKA 1NX1A 3AAJA 2KAYA 1J55A 2KNEA 4E68A 4YBHB 2COLB 1KK8B 1QTXA 1KK7Y 4HRHA 3GOFA 4JWQA 2JTZA 2OTGC 1KQVA 4AOMA 3SG7A 2ZN9A 1EG3A 2KYFA 3EK8A 4GUKA 2BECA 1OMRA 2LCPA 3OB1B 1NCYA 2HF5A 3JVTB 1LA3A 1XFXO 1Y1XA 2JZIA 4WRIA 5F6TA 2PASA 1B8RA 2F3ZA 4UPGA 1LA0A 5HLVA 1C07A 1RFJA 1Y1UA 3I5GB 1IGVA 1KWOB 4NDDA 4NDCA 5AXIA 3HCMA 4AQIA 4DIRA 3BOWB 1A4PA 2M7NA 1MXLC 1QX5B 1E8AA 4XYNA 2ZRTA 1YRTB 2F2PA 4YI8A 3NSOA 2F8PA 2MAZA 5B8IB 1XFYO 1A75B 2ZNEA 1YX8A 1JF0A 1BU3A 1XO5A 2LP3A 1CDMA 4A4BA 3JTDC 5PALA 1WRKA 2LLTA 1BJFA 3EKHA 1IKUA 2KAXA 1LKJA 2HPSA 1CFDA 2JXCA 1IJ5A 1ODBA 3SJSA 1RK9A 1GQMA 1UHHA 2NCOA 3F45A 4USLA 5AANA 1CNPA 1WRZA 4Q04A 1YVHA 1Y1AA 2L0PA 3SIAA 2JU0A 1F55A 1YX7A 2PRUA 1U5IA 3PATA 1FW4A 4FTGA 2Y4QA 2JULA 2HQ8A 1QLSA 2LM5A 4TNCA 2MBXA 2LHIA 1CMGA 1OSAA 3KEVA 1PSBA 1A03A 2JOJA 1UHNA 1NX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AEQ A;  3OB2 B;  1IH0 A;  5GQQ C;  1QV1 A;  1CMF A;  1CLB A;  2EGD A;  5D69 A;  3NXA A;  1XFZ O;  2BBM A;  1TTX A;  1R2U A;  3A8R A;  3LK1 A;  4YI9 A;  2K8M B;  2MRD A;  2BCA A;  2ISD A;  2G9B A;  1SL9 A;  3DVE A;  2BCX A;  5HLO A;  2I94 A;  4MZL A;  1QIV A;  1SMG A;  3TS5 C;  1J1D A;  3D0Y B;  3RLZ A;  5CSF A;  2Q91 A;  5I2Q A;  2KHN A;  1X02 A;  1B47 A;  2PAL A;  2IS9 A;  2GV5 A;  1B1G A;  3I5G C;  4NQG A;  4OKH A;  4PE7 A;  4N1G A;  1JSA A;  1F71 A;  5AFP A;  3WHT B;  2HET A;  2I18 A;  2K2A A;  3LCP C;  4L9M A;  1GJY A;  2OS8 C;  4PHM A;  1QS7 A;  5CSN A;  3PM8 A;  1MR8 A;  2R2I A;  2M7L A;  3ZWH A;  1K95 A;  2PSR A;  4GFT A;  1MQ1 A;  1S1E A;  2ZKM X;  3FIA A;  1D1O A;  2FOT A;  3BUM B;  3KPX A;  2FCE A;  1Y0V H;  2ZFD A;  3HX4 A;  2KI4 B;  1M31 A;  4DS7 A;  1Q80 A;  2Y5I A;  4JPZ B;  1DJG A;  3FWB A;  1AHR A;  3DF0 B;  4M2P A;  4YGC B;  3RM1 A;  1K9U A;  1TNP A;  1QVI Y;  3C1V A;  2L4I A;  1TCF A;  1YUS A;  4R1E A;  3O78 A;  3PFV A;  2JQ6 A;  1AJ5 A;  4A4C A;  2F3Y A;  1UUR A;  3PN7 B;  3A4U B;  2AUC A;  4HRE E;  1R6P A;  3BOW A;  2JT0 A;  3I5I B;  4MZK A;  1H4B A;  1OE9 B;  3BUX B;  1K2H A;  1CB1 A;  2P6B B;  2GGM A;  1PUL A;  1J7Q A;  1KQM C;  3LK0 A;  5DKQ A;  1A75 A;  1H8B A;  3H4S E;  3GK4 X;  3SIB A;  2LAP A;  1A2X A;  1QX7 A;  1KSM A;  3CR4 X;  1F8H A;  3EVU A;  1BR1 B;  2GGZ A;  2JT8 A;  2BKI B;  2KAV A;  2ZRS A;  4YGA A;  5JJG A;  1S5G Z;  5HYD A;  1EJ3 A;  1Y6W A;  1CFF A;  3VGO A;  1XVJ A;  1NUB A;  1BR4 B;  1JUO A;  3DD4 A;  1B9A A;  3EK4 A;  2I2R E;  4N5X A;  2M1U A;  2M9G A;  3BXK A;  1WDC B;  4NDB A;  1TOP A;  3E3R A;  1CTR A;  1J7O A;  1B7T Z;  2AAO A;  2TN4 A;  1FI6 A;  1A29 A;  1IJ6 A;  1S26 D;  2KFG A;  1TNX A;  4GGN A;  3WNX B;  4N1F A;  1SK6 D;  3VRO A;  5HKY A;  2RGI A;  4QJ4 B;  3SG5 A;  3CR2 A;  3CS1 A;  1SPY A;  4HSZ A;  4I5N B;  2LVI A;  1DGV A;  2KI4 C;  2WCB A;  5CSI A;  1BF5 A;  1M45 A;  3O2P A;  2F2O A;  2BL0 B;  3BUW B;  3D0Y A;  4GGF A;  2ZN8 A;  4OR9 B;  3VRN A;  1IG5 A;  3O6B A;  1JF2 A;  2LLU A;  4OCI A;  2KOT A;  2L2E A;  4XJK B;  3PN7 C;  2CXJ A;  1ZUZ A;  3I5I C;  1IRJ A;  4MRY A;  2I7A A;  3KHE A;  2PVB A;  1L2O C;  1NIW A;  3TDI A;  3QRX A;  2LHL A;  2KI6 D;  4PE1 A;  2FJU B;  4CLN A;  1SCM B;  1QIW A;  2LP2 A;  2KBM A;  3TDZ A;  1UHJ A;  1DJX A;  1JFK A;  3KO0 A;  3AAK A;  1DTL A;  1KK7 Z;  1K9K A;  4GNK B;  4M2Q A;  2CTN A;  1ZAC A;  3I5F B;  3ZNI A;  1KK8 C;  1CLM A;  3EVV A;  2WND A;  1RJV A;  1XFV O;  4ORA B;  2Q4U A;  1CLL A;  1XYD A;  3DF0 A;  3FWC A;  1BLQ A;  2M0R A;  2LMV A;  1WLZ A;  1QXP A;  1XFW O;  2M8U A;  3D10 A;  1CFC A;  1TIZ A;  5FYX A;  4YRU A;  4C0K A;  1N0Y A;  1C7W A;  2BKH B;  1CFP A;  1SNL A;  3JVT C;  2LLS A;  1WDC C;  2JC2 A;  4ICB A;  2KQY A;  1SKT A;  1UWO A;  4WQ3 A;  1MUX A;  4ORB B;  1KWO C;  1F70 A;  1SCV A;  3BQ3 A;  4PE4 A;  2L98 A;  1DVI A;  2NLN A;  1DT7 B;  1QAT A;  1QX2 A;  1TCO B;  3TZ1 A;  5JOL A;  1BOC A;  1DMO A;  2K7O A;  1XA5 A;  1S6J A;  1DJZ A;  2K61 A;  2KI6 C;  4P5O E;  2K7C A;  4ORC B;  4GAO A;  2V53 A;  4DUQ A;  1YUU A;  3WHU B;  3SG6 A;  2OTG B;  4PDZ A;  2H2K A;  3GK2 A;  2BE6 A;  1SYM A;  2NXQ A;  1F4O A;  3IF7 A;  1UHI A;  2BCB A;  2LV7 A;  3IQQ A;  1BOD A;  2LVJ A;  1NCZ A;  1MHO A;  4MZJ A;  1IQ3 A;  1ZFS A;  2KGR A;  1NWD A;  1S3P A;  5CPV A;  2KSP A;  2K0J A;  1M46 A;  1CKK A;  4M2O A;  4ZCV A;  4PAL A;  1DF0 B;  2LNK A;  4MN0 A;  2EHB A;  2L5X B;  1K93 D;  2JNF A;  2G2B A;  2KDH A;  2L50 A;  3DVM A;  3MSE B;  2BBN A;  4IL1 A;  4JQ0 D;  1CM4 A;  5AER A;  2NCP A;  3TDU A;  3NSL A;  3SG2 A;  1NX2 A;  4ZCU A;  3JTD B;  1EG4 A;  2JT3 A;  1QV0 A;  3I5F C;  1K9P A;  3OX5 A;  1EL4 A;  1F4Q A;  2O60 A;  1SL7 A;  1DJH A;  2K7B A;  4MEW A;  2M97 A;  5HKW A;  4D1E A;  1FI5 A;  1EXR A;  1BG1 A;  1SY9 A;  4MBE A;  1SL8 A;  1MWN A;  3KF9 A;  3SG3 A;  2JWW A;  4YGE B;  3PSR A;  2WCF A;  1KFU L;  3IQO A;  4GGF C;  4PE0 A;  4WQ2 A;  4CFR A;  1EH2 A;  2MA2 A;  1S36 A;  2JPT A;  4GBA A;  3AKB A;  2WC8 A;  1TNQ A;  1TNW A;  2Y1N A;  1G8I A;  2WCE A;  4XJK A;  1MF8 B;  4OVN F;  2DOQ A;  1XK4 A;  4YGB B;  1ALW A;  2LVV A;  2LE9 B;  1RRO A;  2JNX A;  1W7I B;  2M49 B;  1NPQ A;  1B4C A;  4YGD B;  1S6I A;  4I5J A;  2MHH A;  1KFX L;  5KTY A;  1XFU O;  1NYA A;  1CDP A;  1G33 A;  1OMD A;  1ALV A;  4MSP A;  5KSZ A;  1SR6 B;  1PAL A;  2M1K B;  1YTZ C;  3VRR A;  1JC2 A;  1YVL A;  2M3W A;  2JTT A;  2SAS A;  1B8C A;  2LVK A;  3CR5 X;  2CBL A;  1QVI Z;  3I5H B;  1N65 A;  1HT9 A;  3DVJ A;  3SG4 A;  3TS5 B;  4DRW A;  4PCW A;  4ETO A;  2JRF A;  5I2L A;  1V1F A;  2KQ6 A;  3O4Y A;  1K90 D;  3PLF B;  4PHK A;  1UP5 A;  4P2Y B;  1TN4 A;  1UUS A;  1N2D A;  4QJ3 B;  2H61 C;  1K8U A;  1SRA A;  2OS8 B;  1J7P A;  5ER5 A;  1LXF C;  1NP8 A;  1PSR A;  3VRP A;  1BMO A;  2K7D A;  2NZ0 A;  2KBI A;  1M39 A;  2BE4 A;  1NSH A;  2LMT A;  5D7F A;  2AMI A;  1IQ5 A;  5TNC A;  2CNP A;  2OPO A;  3K21 A;  1QLK A;  5ER4 X;  3CLN A;  4AQJ A;  4I5K A;  1RTP 1;  1HQV A;  2WOR A;  2F33 A;  3CZT X;  3OP0 A;  2WOS A;  4CPV A;  2MLF C;  1NCX A;  1S6C A;  1KFU S;  3CGA A;  4F0Z B;  2A4J A;  2LC5 A;  4CFQ A;  2LMU A;  3CWG A;  1RWY A;  3OX6 A;  3TUY B;  1TRF A;  1KSO A;  1WY9 A;  1YUR A;  2E6W A;  1W7J B;  3EKJ A;  4BY4 A;  2MLE C;  1DF0 A;  1GGW A;  1DJW A;  1AJ4 A;  2H61 A;  4I5L B;  2SCP A;  4MVF A;  2EC6 B;  1LIN A;  1KQM B;  1SW8 A;  4OV2 A;  5CSJ A;  3LL8 B;  1JFJ A;  1M63 B;  4C0L A;  1KFX S;  2K2F A;  2HQW A;  1YUT A;  2MJW B;  1OQP A;  1SR6 C;  2B1U A;  3EVR A;  1OZS A;  1AUI B;  4U8D A;  3OHM B;  1AK8 A;  1G4Y R;  1C7V A;  1IWQ A;  5I8N A;  3FS7 A;  3WXA A;  2M29 A;  2CCM A;  3M0W A;  1CDL A;  1SBJ A;  2KFF A;  3I5H C;  4MLW A;  5BPJ A;  1YRU B;  5DKR A;  3BYA A;  1VRK A;  3BUO B;  1S5G Y;  2ZND A;  2BL0 C;  2CT9 A;  1PVB A;  4QJ5 B;  2L51 A;  1U5I B;  1OMV A;  3BUN B;  1WLM A;  2LUC A;  4C0J A;  3DVK A;  1PRW A;  1XK4 C;  2KYC A;  5I2O A;  1GGZ A;  1QAS A;  3AKA A;  1ZMZ A;  1AP4 A;  1B7T Y;  3NSI A;  1F54 A;  2O5G A;  1LVC D;  4FQO A;  2VRG A;  1FBV A;  3ICB A;  5DKN A;  1FPW A;  1AVS A;  1SCM C;  2LUX A;  4DCK A;  1JBA A;  2KGB C;  1L7Z A;  4MRX A;  1DJY A;  3LLE A;  2D8N A;  1K96 A;  2PMY A;  1QJT A;  4GPL B;  1KCY A;  2KFH A;  3EK7 A;  1FF1 A;  1REC A;  1ZOT B;  4PHN A;  1MXE A;  3VRQ A;  1K94 A;  1PK0 D;  1UHK A;  5IBW A;  1BT6 A;  1CM1 A;  1DJI A;  5G08 A;  3CTN A;  1DGU A;  1WRL A;  1CDN A;  3TUY C;  1V1G A;  1OZO A;  1J1E A;  2L4H A;  4CID A;  5J3X A;  3PAL A;  2E30 A;  4PHJ A;  2LAN A;  1NX3 A;  5K89 A;  1YR5 A;  5KU1 A;  1PVA A;  1L2O B;  3GK1 A;  5HKZ A;  2EC6 C;  1B8L A;  1J7R A;  1OOJ A;  2QPT A;  4HRG A;  2Y1M A;  2QAC A;  4BY5 A;  1JWD A;  2JXL A;  2FCD A;  3NSK A;  1NX1 A;  3AAJ A;  2KAY A;  1J55 A;  2KNE A;  4E68 A;  4YBH B;  2COL B;  1KK8 B;  1QTX A;  1KK7 Y;  4HRH A;  3GOF A;  4JWQ A;  2JTZ A;  2OTG C;  1KQV A;  4AOM A;  3SG7 A;  2ZN9 A;  1EG3 A;  2KYF A;  3EK8 A;  4GUK A;  2BEC A;  1OMR A;  2LCP A;  3OB1 B;  1NCY A;  2HF5 A;  3JVT B;  1LA3 A;  1XFX O;  1Y1X A;  2JZI A;  4WRI A;  5F6T A;  2PAS A;  1B8R A;  2F3Z A;  4UPG A;  1LA0 A;  5HLV A;  1C07 A;  1RFJ A;  1Y1U A;  3I5G B;  1IGV A;  1KWO B;  4NDD A;  4NDC A;  5AXI A;  3HCM A;  4AQI A;  4DIR A;  3BOW B;  1A4P A;  2M7N A;  1MXL C;  1QX5 B;  1E8A A;  4XYN A;  2ZRT A;  1YRT B;  2F2P A;  4YI8 A;  3NSO A;  2F8P A;  2MAZ A;  5B8I B;  1XFY O;  1A75 B;  2ZNE A;  1YX8 A;  1JF0 A;  1BU3 A;  1XO5 A;  2LP3 A;  1CDM A;  4A4B A;  3JTD C;  5PAL A;  1WRK A;  2LLT A;  1BJF A;  3EKH A;  1IKU A;  2KAX A;  1LKJ A;  2HPS A;  1CFD A;  2JXC A;  1IJ5 A;  1ODB A;  3SJS A;  1RK9 A;  1GQM A;  1UHH A;  2NCO A;  3F45 A;  4USL A;  5AAN A;  1CNP A;  1WRZ A;  4Q04 A;  1YVH A;  1Y1A A;  2L0P A;  3SIA A;  2JU0 A;  1F55 A;  1YX7 A;  2PRU A;  1U5I A;  3PAT A;  1FW4 A;  4FTG A;  2Y4Q A;  2JUL A;  2HQ8 A;  1QLS A;  2LM5 A;  4TNC A;  2MBX A;  2LHI A;  1CMG A;  1OSA A;  3KEV A;  1PSB A;  1A03 A;  2JOJ A;  1UHN A;  1NX0 A; 
#chains in the Genus database with same CATH topology
 5AEQ A;  3OB2 B;  1IH0 A;  5GQQ C;  1QV1 A;  1CMF A;  1CLB A;  2EGD A;  5D69 A;  3NXA A;  3D76 A;  1XFZ O;  3SS3 A;  2BBM A;  1TTX A;  1R2U A;  3A8R A;  3LK1 A;  4OZD A;  4YI9 A;  2K8M B;  2MRD A;  3NHT A;  1TWO A;  2BCA A;  2ISD A;  2G9B A;  1SL9 A;  3DVE A;  2BCX A;  5HLO A;  2I94 A;  4MZL A;  3VB1 A;  1OOH A;  1QIV A;  3S0B A;  1SMG A;  3TS5 C;  1J1D A;  3D0Y B;  3RLZ A;  3D75 A;  5CSF A;  2Q91 A;  5I2Q A;  2KHN A;  1X02 A;  1B47 A;  1OOI X;  2PAL A;  2IS9 A;  3BFA A;  2GV5 A;  1B1G A;  3I5G C;  4NQG A;  4OKH A;  4PE7 A;  4N1G A;  1JSA A;  1F71 A;  5AFP A;  3WHT B;  2HET A;  2I18 A;  2K2A A;  3LCP C;  4L9M A;  1GJY A;  2OS8 C;  4PHM A;  1QS7 A;  5CSN A;  3PM8 A;  1MR8 A;  2R2I A;  2M7L A;  3ZWH A;  1K95 A;  2PSR A;  4GFT A;  1MQ1 A;  1TUZ A;  1S1E A;  2ZKM X;  3FIA A;  1D1O A;  2FOT A;  3BUM B;  3KPX A;  1DC1 A;  2JPO A;  2FCE A;  1Y0V H;  1LS8 A;  2ZFD A;  3HX4 A;  2KI4 B;  1M31 A;  4DS7 A;  3BJH A;  1Q80 A;  3S0E A;  2Y5I A;  3R72 A;  1DJG A;  3FWB A;  4JPZ B;  1AHR A;  1OOG A;  3DF0 B;  4M2P A;  4YGC B;  3RM1 A;  1K9U A;  1TNP A;  3D74 A;  3Q8I A;  1QVI Y;  3C1V A;  2L4I A;  1TCF A;  1YUS A;  4R1E A;  3O78 A;  3PFV A;  2JQ6 A;  1AJ5 A;  4A4C A;  2F3Y A;  1UUR A;  3PN7 B;  3A4U B;  2AUC A;  4HRE E;  1R6P A;  3CZ1 A;  3BOW A;  2JT0 A;  3I5I B;  4MZK A;  1H4B A;  1OE9 B;  3BUX B;  1K2H A;  1CB1 A;  2P6B B;  2GGM A;  3D77 A;  1PUL A;  1J7Q A;  1KQM C;  3LK0 A;  5DKQ A;  1A75 A;  1H8B A;  3H4S E;  3GK4 X;  3SIB A;  2LAP A;  3UO9 A;  1A2X A;  1QX7 A;  1KSM A;  3FE8 A;  3NGV A;  3CR4 X;  1F8H A;  3EVU A;  1BR1 B;  2GGZ A;  2QEV A;  3O4X A;  3B87 A;  2JT8 A;  2BKI B;  2KAV A;  2ZRS A;  4YGA A;  5JJG A;  1S5G Z;  5HYD A;  1EJ3 A;  1Y6W A;  1CFF A;  3VGO A;  1XVJ A;  1NUB A;  1BR4 B;  2QDI A;  1JUO A;  3CYZ A;  3DD4 A;  1B9A A;  3EK4 A;  2I2R E;  4N5X A;  2M1U A;  1C3Y A;  2M9G A;  3BXK A;  1WDC B;  4NDB A;  1TOP A;  3E3R A;  1CTR A;  1J7O A;  1B7T Z;  2AAO A;  2TN4 A;  2YGU A;  3L47 A;  1FI6 A;  1A29 A;  1IJ6 A;  1S26 D;  2KFG A;  1TNX A;  2L5Y A;  4GGN A;  4PT1 A;  3WNX B;  1IIO A;  4N1F A;  1SK6 D;  3VRO A;  5HKY A;  2RGI A;  4QJ4 B;  3SG5 A;  3CR2 A;  3CS1 A;  1SPY A;  4HSZ A;  4I5N B;  2LVI A;  3B6X A;  1DGV A;  2KI4 C;  2WCB A;  5CSI A;  2KLD A;  4JKT A;  1BF5 A;  1M45 A;  3O2P A;  2F2O A;  2BL0 B;  3BUW B;  3D0Y A;  4GGF A;  2ZN8 A;  4OR9 B;  3VRN A;  1IG5 A;  3O6B A;  4JD9 A;  1JF2 A;  2LLU A;  5FI2 A;  1Z4H A;  4OCI A;  2H8V A;  2KOT A;  2L2E A;  4XJK B;  3PN7 C;  2CXJ A;  1ZUZ A;  3OBV A;  2BNX A;  4IJ7 A;  3I5I C;  1IRJ A;  4MRY A;  2I7A A;  3KHE A;  2PVB A;  1L2O C;  1NIW A;  3TDI A;  3QRX A;  2LHL A;  2KI6 D;  4PE1 A;  2FJU B;  4CLN A;  1SCM B;  1QIW A;  2LP2 A;  3S0D A;  2KBM A;  2GTE A;  3TDZ A;  1UHJ A;  1DJX A;  1JFK A;  2BAP A;  3KO0 A;  3R1O A;  3AAK A;  1DTL A;  1KK7 Z;  1K9K A;  4GNK B;  4M2Q A;  2CTN A;  1ZAC A;  3I5F B;  3ZNI A;  1KK8 C;  1CLM A;  2P70 A;  3EVV A;  2WND A;  3CDN A;  1RJV A;  1XFV O;  4ORA B;  2Q4U A;  1CLL A;  1XYD A;  3DF0 A;  3FWC A;  1BLQ A;  2M0R A;  2LMV A;  1WLZ A;  1QXP A;  1XFW O;  2M8U A;  3D10 A;  3DY9 A;  1CFC A;  1TIZ A;  4INX A;  5FYX A;  4YRU A;  4C0K A;  1N0Y A;  1C7W A;  1SSE B;  2BKH B;  1CFP A;  1SNL A;  3JVT C;  2LLS A;  1WDC C;  2JC2 A;  4ICB A;  2KQY A;  1SKT A;  1UWO A;  4WQ3 A;  1MUX A;  4ORB B;  2FJY A;  2WC5 A;  1KWO C;  3CZ0 A;  1F70 A;  1SCV A;  3BQ3 A;  4PE4 A;  1W9Z A;  2L98 A;  1DVI A;  2NLN A;  2WCJ A;  1QAT A;  1QX2 A;  1TCO B;  1DT7 B;  3TZ1 A;  5JOL A;  1BOC A;  4JQ0 D;  1DMO A;  1GM0 A;  5FI7 A;  2K7O A;  1XA5 A;  1S6J A;  1DJZ A;  2K61 A;  2KI6 C;  4P5O E;  2K7C A;  4ORC B;  4GAO A;  3L4L A;  2V53 A;  4DUQ A;  1YUU A;  1QWV A;  3WHU B;  3SG6 A;  2OTG B;  4PDZ A;  2H2K A;  3GK2 A;  3FE9 A;  2BE6 A;  1SYM A;  2NXQ A;  2QEB A;  1F4O A;  3QME A;  3IF7 A;  1UHI A;  2BCB A;  2LV7 A;  3IQQ A;  1BOD A;  2LVJ A;  1NCZ A;  1MHO A;  4MZJ A;  1IQ3 A;  1ZFS A;  2KGR A;  1NWD A;  1S3P A;  3NHI A;  5CPV A;  2KSP A;  2K0J A;  1M46 A;  1CKK A;  4M2O A;  2WCH A;  4ZCV A;  2WCK A;  4PAL A;  1DF0 B;  2LNK A;  4MN0 A;  2EHB A;  2L5X B;  2PQL A;  1K93 D;  2JNF A;  2G2B A;  2KDH A;  2L50 A;  3DVM A;  3DZT A;  2BBN A;  3MSE B;  4INW A;  1CM4 A;  4IL1 A;  5AER A;  2NCP A;  3S0A A;  3TDU A;  3NSL A;  3SG2 A;  1NX2 A;  4ZCU A;  3JTD B;  1EG4 A;  2JT3 A;  1QV0 A;  3I5F C;  3CZ2 A;  1K9P A;  3SS4 A;  1XFR A;  3OX5 A;  1EL4 A;  1F4Q A;  2O60 A;  1T14 A;  1SL7 A;  1DJH A;  2K7B A;  4MEW A;  2M97 A;  5HKW A;  3UNW A;  4D1E A;  3PM2 A;  1EXR A;  1BG1 A;  1SY9 A;  4MBE A;  1SL8 A;  1MWN A;  3KF9 A;  3SG3 A;  2JWW A;  4YGE B;  3PSR A;  2WCF A;  1KFU L;  3IQO A;  4GGF C;  4PE0 A;  4WQ2 A;  4CFR A;  1EH2 A;  2MA2 A;  1S36 A;  2JPT A;  4GBA A;  3AKB A;  3D73 A;  2WC8 A;  1TNQ A;  3BFH A;  1TNW A;  2Y1N A;  1G8I A;  2WCE A;  4XJK A;  2ERB A;  3R1P A;  1MF8 B;  3N7H A;  4OVN F;  2DOQ A;  1XK4 A;  4YGB B;  1ALW A;  2LVV A;  2LE9 B;  1Z2C B;  1RRO A;  2JNX A;  2PYQ A;  1W7I B;  2M49 B;  1NPQ A;  1B4C A;  4YGD B;  1S6I A;  4I5J A;  2MHH A;  1KFX L;  5KTY A;  1XFU O;  1NYA A;  1CDP A;  1G33 A;  1OMD A;  1ALV A;  1P28 A;  4MSP A;  5KSZ A;  1SR6 B;  1PAL A;  2M1K B;  1YTZ C;  3VRR A;  1JC2 A;  1YVL A;  2WC6 A;  2M3W A;  2JTT A;  2SAS A;  1B8C A;  2LVK A;  3CR5 X;  2CBL A;  1QVI Z;  3I5H B;  1N65 A;  1HT9 A;  2L2C A;  3DVJ A;  3SG4 A;  3TS5 B;  4DRW A;  4PCW A;  4ETO A;  2JRF A;  3B86 A;  5I2L A;  1V1F A;  2KQ6 A;  3O4Y A;  1K90 D;  2WCM A;  4F7F A;  3PLF B;  4PHK A;  1UP5 A;  4P2Y B;  1TN4 A;  1UUS A;  1N2D A;  4QJ3 B;  2H61 C;  1K8U A;  1SRA A;  2WCL A;  2OS8 B;  1J7P A;  5ER5 A;  1LXF C;  2QEH A;  1NP8 A;  1PSR A;  3SS5 A;  2KPH A;  3VRP A;  1BMO A;  2K7D A;  2NZ0 A;  2KBI A;  1M39 A;  2BE4 A;  3B7A A;  1NSH A;  2LMT A;  3R1V A;  5D7F A;  2AMI A;  1IQ5 A;  5TNC A;  2CNP A;  2OPO A;  3K21 A;  1QLK A;  3CAB A;  5ER4 X;  3CLN A;  4AQJ A;  4I5K A;  1RTP 1;  1HQV A;  3OGN A;  2WOR A;  2F33 A;  3CZT X;  3OP0 A;  2WOS A;  4CPV A;  2MLF C;  1NCX A;  1S6C A;  1KFU S;  3B88 A;  3CGA A;  4F0Z B;  2A4J A;  2LC5 A;  4CFQ A;  2LMU A;  3IVT A;  3CWG A;  1RWY A;  3OX6 A;  3TUY B;  1TRF A;  1KSO A;  1WY9 A;  1YUR A;  2E6W A;  1W7J B;  3EKJ A;  4BY4 A;  2MLE C;  1DF0 A;  1GGW A;  1DJW A;  1AJ4 A;  2H61 A;  4I5L B;  2SCP A;  4MVF A;  2EC6 B;  1LIN A;  1KQM B;  1SW8 A;  3DXL A;  4OV2 A;  3LL8 B;  5CSJ A;  1JFJ A;  1M63 B;  4C0L A;  1KFX S;  2K2F A;  2HQW A;  1YUT A;  2MJW B;  1OQP A;  4KYN A;  1SR6 C;  2B1U A;  3EVR A;  1FI5 A;  1OZS A;  1AUI B;  4U8D A;  3OHM B;  1AK8 A;  1G4Y R;  1C7V A;  1IWQ A;  5I8N A;  3FS7 A;  3WXA A;  2M29 A;  2CCM A;  3M0W A;  1CDL A;  1SBJ A;  2KFF A;  3I5H C;  4MLW A;  5BPJ A;  1YRU B;  5DKR A;  3BYA A;  1VRK A;  3BUO B;  1S5G Y;  2ZND A;  2BL0 C;  2CT9 A;  1PVB A;  4QJ5 B;  2L51 A;  1U5I B;  2K60 A;  1OMV A;  3BUN B;  1WLM A;  2LUC A;  4C0J A;  3DVK A;  3DYE A;  1PRW A;  1XK4 C;  2KYC A;  3L4A A;  5I2O A;  3RZS A;  1GGZ A;  1QAS A;  3AKA A;  1ZMZ A;  1AP4 A;  1B7T Y;  3NSI A;  1F54 A;  2O5G A;  1LVC D;  4FQO A;  2VRG A;  1FBV A;  1OOF A;  3ICB A;  3K1E A;  5DKN A;  1FPW A;  1AVS A;  1C3Z A;  1SCM C;  2KLE A;  2LUX A;  4DCK A;  2KGB C;  1JBA A;  1L7Z A;  4MRX A;  1DJY A;  3LLE A;  2D8N A;  1K96 A;  2PMY A;  1QJT A;  4GPL B;  1KCY A;  2KFH A;  3EK7 A;  1FF1 A;  1REC A;  1ZOT B;  4PHN A;  1MXE A;  4FQT A;  1K94 A;  1PK0 D;  1UHK A;  3VRQ A;  5IBW A;  1BT6 A;  1CM1 A;  1DJI A;  3S0F A;  5G08 A;  3CTN A;  1DGU A;  1WRL A;  1CDN A;  2QEO A;  3TUY C;  1V1G A;  1OZO A;  1J1E A;  2L4H A;  4CID A;  5J3X A;  3PAL A;  2E30 A;  4PHJ A;  2LAN A;  1NX3 A;  5K89 A;  1YR5 A;  3BFB A;  5KU1 A;  1PVA A;  1L2O B;  3GK1 A;  3FE6 A;  5HKZ A;  2EC6 C;  1B8L A;  1J7R A;  1OOJ A;  2QPT A;  5EL2 A;  4HRG A;  2Y1M A;  2QAC A;  4BY5 A;  1JWD A;  2JXL A;  2FCD A;  3NSK A;  1NX1 A;  3AAJ A;  2KAY A;  1J55 A;  2KNE A;  4E68 A;  4YBH B;  2COL B;  1KK8 B;  1QTX A;  1KK7 Y;  4HRH A;  3GOF A;  4JWQ A;  2JTZ A;  2OTG C;  1KQV A;  4AOM A;  3SG7 A;  2ZN9 A;  1EG3 A;  1DEL A;  2KYF A;  3EK8 A;  2BEC A;  4GUK A;  1OMR A;  2LCP A;  5DIC A;  5HL1 A;  3OB1 B;  5D3O A;  1NCY A;  2HF5 A;  3JVT B;  1DQE A;  1LA3 A;  1TUJ A;  1XFX O;  1Y1X A;  2JZI A;  4WRI A;  5F6T A;  2PAS A;  1B8R A;  2F3Z A;  4UPG A;  1LA0 A;  5HLV A;  1C07 A;  1RFJ A;  1Y1U A;  3I5G B;  1IGV A;  1KWO B;  4NDD A;  4NDC A;  5AXI A;  3HCM A;  4AQI A;  4DIR A;  3BOW B;  1A4P A;  2M7N A;  1MXL C;  1QX5 B;  1E8A A;  4XYN A;  2ZRT A;  1YRT B;  2F2P A;  4YI8 A;  3NSO A;  2F8P A;  2MAZ A;  5B8I B;  1XFY O;  1A75 B;  2ZNE A;  1YX8 A;  1JF0 A;  1BU3 A;  1XO5 A;  2LP3 A;  1CDM A;  3PJI A;  4A4B A;  3JTD C;  2P71 A;  5PAL A;  1WRK A;  2LLT A;  1BJF A;  3EG5 B;  3EKH A;  1IKU A;  2KAX A;  1LKJ A;  2HPS A;  3D78 A;  1CFD A;  2JXC A;  1IJ5 A;  1ODB A;  3SJS A;  3V2L A;  1RK9 A;  1GQM A;  1UHH A;  2NCO A;  3F45 A;  4USL A;  5FI6 A;  5AAN A;  5I94 A;  3S0G A;  1CNP A;  1WRZ A;  4Q04 A;  1YVH A;  1Y1A A;  2L0P A;  3SIA A;  1ORG A;  2JU0 A;  1YX7 A;  1F55 A;  2PRU A;  1U5I A;  3PAT A;  1FW4 A;  4FTG A;  1DEK A;  2Y4Q A;  2JUL A;  2HQ8 A;  1QLS A;  2LM5 A;  4TNC A;  2MBX A;  2LHI A;  1CMG A;  1OSA A;  3KEV A;  1PSB A;  1A03 A;  2JOJ A;  1OW4 A;  1UHN A;  1NX0 A; 
#chains in the Genus database with same CATH homology
 5AEQ A;  3OB2 B;  1IH0 A;  5GQQ C;  1QV1 A;  1CMF A;  1CLB A;  2EGD A;  5D69 A;  3NXA A;  1XFZ O;  2BBM A;  1TTX A;  1R2U A;  3A8R A;  3LK1 A;  4YI9 A;  2K8M B;  2MRD A;  2BCA A;  2ISD A;  2G9B A;  1SL9 A;  3DVE A;  2BCX A;  5HLO A;  2I94 A;  4MZL A;  1QIV A;  1SMG A;  3TS5 C;  1J1D A;  3D0Y B;  3RLZ A;  5CSF A;  2Q91 A;  5I2Q A;  2KHN A;  1X02 A;  1B47 A;  2PAL A;  2IS9 A;  2GV5 A;  1B1G A;  3I5G C;  4NQG A;  4OKH A;  4PE7 A;  4N1G A;  1JSA A;  1F71 A;  5AFP A;  3WHT B;  2HET A;  2I18 A;  2K2A A;  3LCP C;  4L9M A;  1GJY A;  2OS8 C;  4PHM A;  1QS7 A;  5CSN A;  3PM8 A;  1MR8 A;  2R2I A;  2M7L A;  3ZWH A;  1K95 A;  2PSR A;  4GFT A;  1MQ1 A;  1S1E A;  2ZKM X;  3FIA A;  1D1O A;  2FOT A;  3BUM B;  3KPX A;  2FCE A;  1Y0V H;  2ZFD A;  3HX4 A;  2KI4 B;  1M31 A;  4DS7 A;  1Q80 A;  2Y5I A;  4JPZ B;  1DJG A;  3FWB A;  1AHR A;  3DF0 B;  4M2P A;  4YGC B;  3RM1 A;  1K9U A;  1TNP A;  1QVI Y;  3C1V A;  2L4I A;  1TCF A;  1YUS A;  4R1E A;  3O78 A;  3PFV A;  2JQ6 A;  1AJ5 A;  4A4C A;  2F3Y A;  1UUR A;  3PN7 B;  3A4U B;  2AUC A;  4HRE E;  1R6P A;  3BOW A;  2JT0 A;  3I5I B;  4MZK A;  1H4B A;  1OE9 B;  3BUX B;  1K2H A;  1CB1 A;  2P6B B;  2GGM A;  1PUL A;  1J7Q A;  1KQM C;  3LK0 A;  5DKQ A;  1A75 A;  1H8B A;  3H4S E;  3GK4 X;  3SIB A;  2LAP A;  1A2X A;  1QX7 A;  1KSM A;  3CR4 X;  1F8H A;  3EVU A;  1BR1 B;  2GGZ A;  2JT8 A;  2BKI B;  2KAV A;  2ZRS A;  4YGA A;  5JJG A;  1S5G Z;  5HYD A;  1EJ3 A;  1Y6W A;  1CFF A;  3VGO A;  1XVJ A;  1NUB A;  1BR4 B;  1JUO A;  3DD4 A;  1B9A A;  3EK4 A;  2I2R E;  4N5X A;  2M1U A;  2M9G A;  3BXK A;  1WDC B;  4NDB A;  1TOP A;  3E3R A;  1CTR A;  1J7O A;  1B7T Z;  2AAO A;  2TN4 A;  1FI6 A;  1A29 A;  1IJ6 A;  1S26 D;  2KFG A;  1TNX A;  4GGN A;  3WNX B;  4N1F A;  1SK6 D;  3VRO A;  5HKY A;  2RGI A;  4QJ4 B;  3SG5 A;  3CR2 A;  3CS1 A;  1SPY A;  4HSZ A;  4I5N B;  2LVI A;  1DGV A;  2KI4 C;  2WCB A;  5CSI A;  1BF5 A;  1M45 A;  3O2P A;  2F2O A;  2BL0 B;  3BUW B;  3D0Y A;  4GGF A;  2ZN8 A;  4OR9 B;  3VRN A;  1IG5 A;  3O6B A;  1JF2 A;  2LLU A;  4OCI A;  2KOT A;  2L2E A;  4XJK B;  3PN7 C;  2CXJ A;  1ZUZ A;  3I5I C;  1IRJ A;  4MRY A;  2I7A A;  3KHE A;  2PVB A;  1L2O C;  1NIW A;  3TDI A;  3QRX A;  2LHL A;  2KI6 D;  4PE1 A;  2FJU B;  4CLN A;  1SCM B;  1QIW A;  2LP2 A;  2KBM A;  3TDZ A;  1UHJ A;  1DJX A;  1JFK A;  3KO0 A;  3AAK A;  1DTL A;  1KK7 Z;  1K9K A;  4GNK B;  4M2Q A;  2CTN A;  1ZAC A;  3I5F B;  3ZNI A;  1KK8 C;  1CLM A;  3EVV A;  2WND A;  1RJV A;  1XFV O;  4ORA B;  2Q4U A;  1CLL A;  1XYD A;  3DF0 A;  3FWC A;  1BLQ A;  2M0R A;  2LMV A;  1WLZ A;  1QXP A;  1XFW O;  2M8U A;  3D10 A;  1CFC A;  1TIZ A;  5FYX A;  4YRU A;  4C0K A;  1N0Y A;  1C7W A;  2BKH B;  1CFP A;  1SNL A;  3JVT C;  2LLS A;  1WDC C;  2JC2 A;  4ICB A;  2KQY A;  1SKT A;  1UWO A;  4WQ3 A;  1MUX A;  4ORB B;  1KWO C;  1F70 A;  1SCV A;  3BQ3 A;  4PE4 A;  2L98 A;  1DVI A;  2NLN A;  1DT7 B;  1QAT A;  1QX2 A;  1TCO B;  3TZ1 A;  5JOL A;  1BOC A;  1DMO A;  2K7O A;  1XA5 A;  1S6J A;  1DJZ A;  2K61 A;  2KI6 C;  4P5O E;  2K7C A;  4ORC B;  4GAO A;  2V53 A;  4DUQ A;  1YUU A;  3WHU B;  3SG6 A;  2OTG B;  4PDZ A;  2H2K A;  3GK2 A;  2BE6 A;  1SYM A;  2NXQ A;  1F4O A;  3IF7 A;  1UHI A;  2BCB A;  2LV7 A;  3IQQ A;  1BOD A;  2LVJ A;  1NCZ A;  1MHO A;  4MZJ A;  1IQ3 A;  1ZFS A;  2KGR A;  1NWD A;  1S3P A;  5CPV A;  2KSP A;  2K0J A;  1M46 A;  1CKK A;  4M2O A;  4ZCV A;  4PAL A;  1DF0 B;  2LNK A;  4MN0 A;  2EHB A;  2L5X B;  1K93 D;  2JNF A;  2G2B A;  2KDH A;  2L50 A;  3DVM A;  3MSE B;  2BBN A;  4IL1 A;  4JQ0 D;  1CM4 A;  5AER A;  2NCP A;  3TDU A;  3NSL A;  3SG2 A;  1NX2 A;  4ZCU A;  3JTD B;  1EG4 A;  2JT3 A;  1QV0 A;  3I5F C;  1K9P A;  3OX5 A;  1EL4 A;  1F4Q A;  2O60 A;  1SL7 A;  1DJH A;  2K7B A;  4MEW A;  2M97 A;  5HKW A;  4D1E A;  1FI5 A;  1EXR A;  1BG1 A;  1SY9 A;  4MBE A;  1SL8 A;  1MWN A;  3KF9 A;  3SG3 A;  2JWW A;  4YGE B;  3PSR A;  2WCF A;  1KFU L;  3IQO A;  4GGF C;  4PE0 A;  4WQ2 A;  4CFR A;  1EH2 A;  2MA2 A;  1S36 A;  2JPT A;  4GBA A;  3AKB A;  2WC8 A;  1TNQ A;  1TNW A;  2Y1N A;  1G8I A;  2WCE A;  4XJK A;  1MF8 B;  4OVN F;  2DOQ A;  1XK4 A;  4YGB B;  1ALW A;  2LVV A;  2LE9 B;  1RRO A;  2JNX A;  1W7I B;  2M49 B;  1NPQ A;  1B4C A;  4YGD B;  1S6I A;  4I5J A;  2MHH A;  1KFX L;  5KTY A;  1XFU O;  1NYA A;  1CDP A;  1G33 A;  1OMD A;  1ALV A;  4MSP A;  5KSZ A;  1SR6 B;  1PAL A;  2M1K B;  1YTZ C;  3VRR A;  1JC2 A;  1YVL A;  2M3W A;  2JTT A;  2SAS A;  1B8C A;  2LVK A;  3CR5 X;  2CBL A;  1QVI Z;  3I5H B;  1N65 A;  1HT9 A;  3DVJ A;  3SG4 A;  3TS5 B;  4DRW A;  4PCW A;  4ETO A;  2JRF A;  5I2L A;  1V1F A;  2KQ6 A;  3O4Y A;  1K90 D;  3PLF B;  4PHK A;  1UP5 A;  4P2Y B;  1TN4 A;  1UUS A;  1N2D A;  4QJ3 B;  2H61 C;  1K8U A;  1SRA A;  2OS8 B;  1J7P A;  5ER5 A;  1LXF C;  1NP8 A;  1PSR A;  3VRP A;  1BMO A;  2K7D A;  2NZ0 A;  2KBI A;  1M39 A;  2BE4 A;  1NSH A;  2LMT A;  5D7F A;  2AMI A;  1IQ5 A;  5TNC A;  2CNP A;  2OPO A;  3K21 A;  1QLK A;  5ER4 X;  3CLN A;  4AQJ A;  4I5K A;  1RTP 1;  1HQV A;  2WOR A;  2F33 A;  3CZT X;  3OP0 A;  2WOS A;  4CPV A;  2MLF C;  1NCX A;  1S6C A;  1KFU S;  3CGA A;  4F0Z B;  2A4J A;  2LC5 A;  4CFQ A;  2LMU A;  3CWG A;  1RWY A;  3OX6 A;  3TUY B;  1TRF A;  1KSO A;  1WY9 A;  1YUR A;  2E6W A;  1W7J B;  3EKJ A;  4BY4 A;  2MLE C;  1DF0 A;  1GGW A;  1DJW A;  1AJ4 A;  2H61 A;  4I5L B;  2SCP A;  4MVF A;  2EC6 B;  1LIN A;  1KQM B;  1SW8 A;  4OV2 A;  5CSJ A;  3LL8 B;  1JFJ A;  1M63 B;  4C0L A;  1KFX S;  2K2F A;  2HQW A;  1YUT A;  2MJW B;  1OQP A;  1SR6 C;  2B1U A;  3EVR A;  1OZS A;  1AUI B;  4U8D A;  3OHM B;  1AK8 A;  1G4Y R;  1C7V A;  1IWQ A;  5I8N A;  3FS7 A;  3WXA A;  2M29 A;  2CCM A;  3M0W A;  1CDL A;  1SBJ A;  2KFF A;  3I5H C;  4MLW A;  5BPJ A;  1YRU B;  5DKR A;  3BYA A;  1VRK A;  3BUO B;  1S5G Y;  2ZND A;  2BL0 C;  2CT9 A;  1PVB A;  4QJ5 B;  2L51 A;  1U5I B;  1OMV A;  3BUN B;  1WLM A;  2LUC A;  4C0J A;  3DVK A;  1PRW A;  1XK4 C;  2KYC A;  5I2O A;  1GGZ A;  1QAS A;  3AKA A;  1ZMZ A;  1AP4 A;  1B7T Y;  3NSI A;  1F54 A;  2O5G A;  1LVC D;  4FQO A;  2VRG A;  1FBV A;  3ICB A;  5DKN A;  1FPW A;  1AVS A;  1SCM C;  2LUX A;  4DCK A;  1JBA A;  2KGB C;  1L7Z A;  4MRX A;  1DJY A;  3LLE A;  2D8N A;  1K96 A;  2PMY A;  1QJT A;  4GPL B;  1KCY A;  2KFH A;  3EK7 A;  1FF1 A;  1REC A;  1ZOT B;  4PHN A;  1MXE A;  3VRQ A;  1K94 A;  1PK0 D;  1UHK A;  5IBW A;  1BT6 A;  1CM1 A;  1DJI A;  5G08 A;  3CTN A;  1DGU A;  1WRL A;  1CDN A;  3TUY C;  1V1G A;  1OZO A;  1J1E A;  2L4H A;  4CID A;  5J3X A;  3PAL A;  2E30 A;  4PHJ A;  2LAN A;  1NX3 A;  5K89 A;  1YR5 A;  5KU1 A;  1PVA A;  1L2O B;  3GK1 A;  5HKZ A;  2EC6 C;  1B8L A;  1J7R A;  1OOJ A;  2QPT A;  4HRG A;  2Y1M A;  2QAC A;  4BY5 A;  1JWD A;  2JXL A;  2FCD A;  3NSK A;  1NX1 A;  3AAJ A;  2KAY A;  1J55 A;  2KNE A;  4E68 A;  4YBH B;  2COL B;  1KK8 B;  1QTX A;  1KK7 Y;  4HRH A;  3GOF A;  4JWQ A;  2JTZ A;  2OTG C;  1KQV A;  4AOM A;  3SG7 A;  2ZN9 A;  1EG3 A;  2KYF A;  3EK8 A;  4GUK A;  2BEC A;  1OMR A;  2LCP A;  3OB1 B;  1NCY A;  2HF5 A;  3JVT B;  1LA3 A;  1XFX O;  1Y1X A;  2JZI A;  4WRI A;  5F6T A;  2PAS A;  1B8R A;  2F3Z A;  4UPG A;  1LA0 A;  5HLV A;  1C07 A;  1RFJ A;  1Y1U A;  3I5G B;  1IGV A;  1KWO B;  4NDD A;  4NDC A;  5AXI A;  3HCM A;  4AQI A;  4DIR A;  3BOW B;  1A4P A;  2M7N A;  1MXL C;  1QX5 B;  1E8A A;  4XYN A;  2ZRT A;  1YRT B;  2F2P A;  4YI8 A;  3NSO A;  2F8P A;  2MAZ A;  5B8I B;  1XFY O;  1A75 B;  2ZNE A;  1YX8 A;  1JF0 A;  1BU3 A;  1XO5 A;  2LP3 A;  1CDM A;  4A4B A;  3JTD C;  5PAL A;  1WRK A;  2LLT A;  1BJF A;  3EKH A;  1IKU A;  2KAX A;  1LKJ A;  2HPS A;  1CFD A;  2JXC A;  1IJ5 A;  1ODB A;  3SJS A;  1RK9 A;  1GQM A;  1UHH A;  2NCO A;  3F45 A;  4USL A;  5AAN A;  1CNP A;  1WRZ A;  4Q04 A;  1YVH A;  1Y1A A;  2L0P A;  3SIA A;  2JU0 A;  1F55 A;  1YX7 A;  2PRU A;  1U5I A;  3PAT A;  1FW4 A;  4FTG A;  2Y4Q A;  2JUL A;  2HQ8 A;  1QLS A;  2LM5 A;  4TNC A;  2MBX A;  2LHI A;  1CMG A;  1OSA A;  3KEV A;  1PSB A;  1A03 A;  2JOJ A;  1UHN A;  1NX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...