2BE4A

X-ray structure an ef-hand protein from danio rerio dr.36843
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
270
structure length
270
Chain Sequence
SAFANLDAAGFLQIWQHFDADDNGYIEGKELDDFFRHMLKKLQPKDKITDERVQQIKKSFMSAYDATFDGRLQIEELANMILPQEENFLLIFRREAPLDNSVEFMKIWRKYDADSSGYISAAELKNFLKDLFLQHKKKIPPNKLDEYTDAMMKIFDKNKDGRLDLNDLARILALQENFLLQFKMDASSQVERKRDFEKIFAHYDVSRTGALEGPEVDGFVKDMMELVRPSISGGDLDKFRECLLTHCDMNKDGKIQKSELALCLGLKHKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein LOC449832
publication title X-ray structure of Danio rerio secretagogin: A hexa-EF-hand calcium sensor.
pubmed doi rcsb
source organism Danio rerio
molecule tags Structural genomics, unknown function
total genus 82
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2005-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2be4A02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2be4A03
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2be4A01
3TDIA 2JC2A 1OZOA 2HF5A 2CT9A 1AK8A 5AXIA 1NCYA 1CTRA 4HRGA 1XK4C 4YGDB 1GJYA 3IF7A 2FOTA 2K2FA 4YI9A 5HYDA 4P5OE 3SG7A 1D1OA 1F55A 3CZTX 4C0KA 1AHRA 2KQYA 1J1EA 3KHEA 2VRGA 3MSEB 1J55A 3I5HB 1AVSA 1DGVA 1DJIA 4YBHB 5AFPA 1XFUO 2MAZA 3WXAA 3BOWB 3KEVA 1IJ6A 3C1VA 1XO5A 2Q4UA 3DVKA 2ZRTA 3DVMA 1UHJA 2JU0A 2LVVA 3PALA 4PALA 4WQ3A 1NX0A 5BPJA 1IQ5A 2AUCA 2KAYA 1L2OB 4NDBA 3PN7B 4ORCB 1Y1UA 1QV1A 1DVIA 1QVIZ 2F2PA 1BJFA 1QJTA 2ZNDA 1JF2A 1HQVA 1MR8A 2I18A 5G08A 3D0YB 4OV2A 2LVIA 2NXQA 3FS7A 2QACA 1B7TZ 3BUOB 4I5LB 2H2KA 3OB1B 1YX8A 1CLLA 1MUXA 3EVUA 2NZ0A 1SL7A 4GAOA 2K7DA 1KK8C 4YGBB 3VGOA 2ZN8A 1QXPA 1DGUA 1RFJA 1CKKA 5B8IB 1EXRA 1R2UA 1NUBA 5I2QA 4DRWA 4WQ2A 4XJKB 5CSFA 1MXLC 2TN4A 2QPTA 2Y1MA 1B8RA 1BR4B 3AAJA 2RGIA 2BCXA 1SCMB 4AOMA 1UHIA 2SCPA 3FWCA 4YGAA 1EG3A 1NP8A 1RK9A 3I5FC 3NSKA 3OB2B 3PLFB 4PE0A 1NIWA 1DT7B 1TIZA 4I5KA 1OOJA 1M46A 1KCYA 1JWDA 2GGZA 1IKUA 1FW4A 2BCBA 3O4YA 1JFJA 2JXLA 1CB1A 5PALA 1IJ5A 3IQQA 5AEQA 1B1GA 4HREE 2MLEC 3KO0A 5KU1A 1SRAA 3DD4A 1QLKA 3GOFA 1GGZA 1S5GY 2PALA 2I94A 3BOWA 2AMIA 1H8BA 1XFYO 2KFFA 1IRJA 2LVJA 2PSRA 1FF1A 1UP5A 1ZUZA 1G4YR 4GUKA 1BODA 2EC6C 1TOPA 1FI5A 1WDCB 5JJGA 1DMOA 3OX5A 3ZNIA 2K61A 1CM1A 3LCPC 1ALWA 1CLMA 3OHMB 2M1UA 1GQMA 3QRXA 3D0YA 5HLVA 1QVIY 2OTGC 2WORA 3NXAA 1N65A 1LXFC 1BG1A 1TNXA 1OSAA 2LMVA 4ICBA 3VROA 2JQ6A 2M49B 5D69A 2MBXA 1W7IB 2SASA 2M0RA 4OVNF 1C7WA 1UHKA 3HX4A 1IGVA 3IQOA 1EL4A 3I5GC 3WHTB 1CFDA 2LV7A 4MVFA 4OKHA 4QJ3B 2JT3A 4XJKA 2WCFA 4CPVA 2B1UA 3TDZA 1QASA 1K8UA 4C0JA 2H61A 1QATA 2P6BB 4D1EA 1WLZA 1SYMA 5HKWA 3BUNB 1DF0B 3SIAA 3SG4A 4BY4A 5HKZA 2ZN9A 4PE1A 3AKBA 1J7QA 1NCXA 1LKJA 1XFWO 2KYFA 1RTP1 2NLNA 4N1GA 1C7VA 2LUCA 2I7AA 2Y1NA 2GV5A 4BY5A 2LNKA 3SG3A 1SKTA 2WC8A 3AAKA 4YRUA 1U5IB 5D7FA 2LC5A 2EGDA 2JNFA 1MXEA 1A75B 1DJYA 1SMGA 1CFPA 2IS9A 1CDPA 4ORAB 3FIAA 1ALVA 4MZLA 3GK2A 1RECA 4MRYA 1PSRA 3TS5C 4AQJA 1LA3A 1NX1A 1S5GZ 4NQGA 1FPWA 1GGWA 4PE7A 1CMGA 3CWGA 1B9AA 2M1KB 3K21A 1SNLA 4R1EA 1MWNA 2PRUA 2KHNA 4IL1A 4PCWA 1JC2A 5ER4X 1TN4A 2JRFA 1JSAA 4P2YB 3FWBA 1UURA 2LHIA 2GGMA 2L51A 2LVKA 2O5GA 1KK8B 1FBVA 3EKHA 2KQ6A 2WCEA 4L9MA 1YTZC 2M97A 1M45A 1BMOA 2M3WA 3O2PA 2KGBC 2JT8A 4DCKA 1TNQA 1ZMZA 1NCZA 1IWQA 2M7LA 1QX2A 2E30A 4GGNA 4U8DA 1JUOA 1OZSA 1K9PA 1QS7A 2BKHB 4MSPA 2HPSA 1AJ4A 3I5FB 1DF0A 1BR1B 2G9BA 3CR2A 1G8IA 1XK4A 1C07A 2FCDA 2LMUA 1IQ3A 2L0PA 4CLNA 2LE9B 2KGRA 2NCOA 3BUMB 1K9UA 1PVBA 4MLWA 2KBMA 1SL9A 2K8MB 4OCIA 3EK8A 1RWYA 1U5IA 1B4CA 2OPOA 1SCVA 2HETA 1QTXA 4PHMA 1YUSA 2BCAA 3JTDC 1A75A 4JWQA 1YUTA 2AAOA 4Q04A 5I2OA 4WRIA 2KOTA 4N5XA 1S6IA 1DJXA 3M0WA 2BE4A 2LCPA 1LA0A 3A8RA 5DKNA 2LLSA 5JOLA 3EVRA 2EC6B 2K7OA 2LUXA 4JPZB 4GGFC 1S1EA 1E8AA 2L4HA 4MZKA 2K0JA 4DS7A 3DVEA 3E3RA 1F4OA 3PSRA 2FCEA 2BL0C 4QJ4B 3ZWHA 2OTGB 1ZOTB 1YRTB 2JTZA 1DJZA 2LANA 1PRWA 1YX7A 1UUSA 3BUXB 3GK4X 2WNDA 1K93D 1BOCA 4JQ0D 4PHNA 1SK6D 2F3YA 3EVVA 2K7BA 1QIWA 4YGCB 3CS1A 1XFZO 1CLBA 5F6TA 1UWOA 3TZ1A 2JPTA 3I5GB 2R2IA 4PE4A 2OS8C 1SW8A 5I8NA 2F2OA 4ZCVA 3H4SE 1PSBA 1Y1AA 1KQMC 1A4PA 2MA2A 2ZFDA 1SY9A 1V1GA 1WRLA 1B47A 2BKIB 3RLZA 1JF0A 2KI6D 1S6JA 2HQ8A 2ZRSA 2F8PA 3BXKA 4HRHA 1AJ5A 1OE9B 3JVTC 4MZJA 1WLMA 3PATA 5HLOA 2PMYA 2L5XB 1OMDA 1CFFA 4CFRA 3LK0A 1VRKA 2WCBA 1LINA 1M31A 3AKAA 5AERA 1K2HA 1M39A 1J7OA 4MBEA 5ER5A 3CGAA 3OX6A 2Y4QA 3EK7A 1M63B 3LL8B 1SL8A 3LK1A 4CIDA 1F4QA 3KPXA 4GFTA 5CSNA 1YVHA 4M2OA 3TS5B 1L7ZA 1Y6WA 2E6WA 2JXCA 1BT6A 5IBWA 2LM5A 2JZIA 1YR5A 2KI6C 2LMTA 1EH2A 1AUIB 1OMVA 3BQ3A 2CCMA 1BF5A 4PHJA 4CFQA 2F3ZA 4I5JA 1JBAA 1NSHA 2KNEA 1S6CA 1ZFSA 2LLTA 1MQ1A 2D8NA 2MRDA 4MRXA 3A4UB 2G2BA 3I5IC 4PHKA 1QX7A 1K90D 1J7RA 2JWWA 3VRQA 3DF0B 5DKQA 1EJ3A 2WOSA 4MEWA 4ORBB 3CR5X 1TCFA 2V53A 2MJWB 3PM8A 1CM4A 1LVCD 4NDDA 2KAXA 3SJSA 2HQWA 2ISDA 2LP3A 1YVLA 2K7CA 3LLEA 4AQIA 4ZCUA 2JOJA 1F70A 1EG4A 2JT0A 1NPQA 3BYAA 2F33A 3ICBA 3SG6A 1K96A 2ZKMX 5CPVA 1A29A 2A4JA 1SR6B 2Q91A 4A4BA 1TCOB 1IG5A 2M7NA 1RJVA 5I2LA 4E68A 1CDMA 2JTTA 2I2RE 1NWDA 1DJGA 1TTXA 3I5HC 2L2EA 3SG2A 2LP2A 3WNXB 4YI8A 1SR6C 3OP0A 4QJ5B 2KBIA 5K89A 2L98A 1A03A 4FTGA 3JTDB 3NSIA 1BLQA 4HSZA 1YRUB 1F54A 1KSMA 2BE6A 1L2OC 3PN7C 1N2DA 5KTYA 3PFVA 3EKJA 4FQOA 2FJUB 3BUWB 3WHUB 1HT9A 5GQQC 1QX5B 1TRFA 1IH0A 1OMRA 4M2PA 4DIRA 1PULA 1X02A 4GPLB 1S3PA 2L4IA 1RROA 2BL0B 1WY9A 1QV0A 1N0YA 1CDLA 1S26D 4I5NB 1KFUS 1Y0VH 3F45A 2L50A 1CFCA 1S36A 1UHNA 1QIVA 1KK7Y 4MN0A 1XVJA 1MHOA 1A2XA 1Y1XA 2M9GA 3DF0A 2LAPA 2M29A 3GK1A 1JFKA 2OS8B 1SBJA 3CLNA 4USLA 2KFHA 1KFXS 1SCMC 2H61C 2PASA 4GBAA 3CR4X 1V1FA 2JULA 1J7PA 1KFUL 1WRZA 1R6PA 2BBMA 1KQMB 2KFGA 3CTNA 5FYXA 4YGEB 4C0LA 1F71A 2Y5IA 2JNXA 1WRKA 2CBLA 3EK4A 5CSIA 2KDHA 5TNCA 1KSOA 4N1FA 2PVBA 1DTLA 3SG5A 1DJHA 1YUUA 1K9KA 2KI4B 3JVTB 1SPYA 1KFXL 2BECA 4DUQA 1NYAA 2LLUA 3DVJA 3RM1A 1KWOB 1Q80A 2LHLA 1K95A 4A4CA 3SIBA 3NSLA 1H4BA 5AANA 2KI4C 4NDCA 1F8HA 2BBNA 2NCPA 1FI6A 1CMFA 3VRPA 4UPGA 3TDUA 1MF8B 1TNWA 4PDZA 1UHHA 2DOQA 4TNCA 1WDCC 1XYDA 2KAVA 1YURA 1KWOC 2KYCA 3O6BA 3VRNA 2CXJA 3TUYB 1B7TY 1W7JB 5KSZA 3D10A 4GGFA 1BU3A 2COLB 3KF9A 1XFVO 1G33A 4M2QA 5CSJA 1DJWA 5J3XA 2KSPA 2M8UA 3VRRA 1PK0D 2K2AA 1ZACA 1K94A 1PALA 5DKRA 5HKYA 1ODBA 1QLSA 1XFXO 2CNPA 1KQVA 3TUYC 1PVAA 3NSOA 1B8LA 1XA5A 3I5IB 3HCMA 1B8CA 4F0ZB 4GNKB 1NX2A 3O78A 1CDNA 1NX3A 2MHHA 2O60A 2ZNEA 1OQPA 4OR9B 1KK7Z 2CTNA 2MLFC 4XYNA 1AP4A 1CNPA 1J1DA 4ETOA 1TNPA 2EHBA
chains in the Genus database with same CATH superfamily
3TDIA 2JC2A 1OZOA 2HF5A 2CT9A 1AK8A 5AXIA 1NCYA 1CTRA 1TWOA 4HRGA 1XK4C 2WC5A 4YGDB 1GJYA 3IF7A 2FOTA 2K2FA 4YI9A 3S0EA 4P5OE 5HYDA 3SG7A 1D1OA 1F55A 3CZTX 2QEOA 2WCMA 4C0KA 1AHRA 2KQYA 1J1EA 3KHEA 2VRGA 3MSEB 1J55A 3I5HB 1AVSA 1DGVA 1DJIA 4JD9A 4YBHB 5AFPA 1XFUO 2MAZA 3WXAA 2QDIA 3BOWB 3KEVA 1IJ6A 3C1VA 1XO5A 2Q4UA 3DVKA 2ZRTA 3DVMA 1UHJA 2JU0A 2LVVA 3PALA 4PALA 4WQ3A 1NX0A 3R1VA 5BPJA 1IQ5A 2AUCA 2KAYA 1L2OB 4NDBA 3PN7B 4ORCB 1Y1UA 3D77A 1QV1A 1DVIA 1QVIZ 2F2PA 1Z2CB 1BJFA 1QJTA 1JF2A 1HQVA 1MR8A 2I18A 2ZNDA 3D0YB 5G08A 4OV2A 2LVIA 2NXQA 3FS7A 2QACA 1B7TZ 3BUOB 1OOIX 4I5LB 2H2KA 3OB1B 1YX8A 1CLLA 1MUXA 3EVUA 2NZ0A 1SL7A 4GAOA 2K7DA 1KK8C 4YGBB 3VGOA 2ZN8A 1QXPA 1DGUA 1RFJA 1CKKA 5B8IB 1EXRA 1R2UA 1NUBA 2KLDA 3SS5A 5I2QA 4DRWA 4WQ2A 4XJKB 5CSFA 1MXLC 2TN4A 2QPTA 2Y1MA 1B8RA 1BR4B 3AAJA 5HL1A 2RGIA 2BCXA 1SCMB 4AOMA 1UHIA 2SCPA 3FWCA 4YGAA 5D3OA 1EG3A 1NP8A 1RK9A 3I5FC 3NSKA 3OB2B 3PLFB 4PE0A 1NIWA 1DT7B 1TIZA 4I5KA 1OOJA 1M46A 1KCYA 1W9ZA 1JWDA 2GGZA 1IKUA 1FW4A 4INXA 2BCBA 3O4YA 1JFJA 2JXLA 1CB1A 5PALA 1IJ5A 3IQQA 3B6XA 1P28A 5AEQA 3S0BA 1B1GA 1OOHA 4HREE 2L5YA 2MLEC 3KO0A 5DICA 1SRAA 3DD4A 1QLKA 3GOFA 5KU1A 1T14A 1GGZA 1S5GY 2PALA 2I94A 3BOWA 2AMIA 1H8BA 1XFYO 2KFFA 3OGNA 1IRJA 2LVJA 2PSRA 1FF1A 1UP5A 1DEKA 1ZUZA 1G4YR 4GUKA 1BODA 2EC6C 1TOPA 1FI5A 3DYEA 1WDCB 5JJGA 3PM2A 1DMOA 1XFRA 3OX5A 3ZNIA 2K61A 1CM1A 3LCPC 1ALWA 1CLMA 3OHMB 2M1UA 1GQMA 3QRXA 3D0YA 3O4XA 5HLVA 3D78A 4DCKA 1QVIY 1LS8A 2OTGC 2WORA 3NXAA 1N65A 1LXFC 1BG1A 1TNXA 1OSAA 2LMVA 4ICBA 3VROA 2JQ6A 2M49B 3D76A 5D69A 2MBXA 1W7IB 2SASA 2WCJA 2M0RA 4OVNF 1C7WA 1UHKA 3HX4A 1IGVA 3IQOA 1EL4A 2KLEA 3I5GC 3WHTB 1CFDA 2LV7A 3RZSA 4MVFA 4OKHA 4QJ3B 2JT3A 4XJKA 2WCFA 4CPVA 2B1UA 2QEHA 3TDZA 1QASA 1K8UA 3B7AA 4C0JA 2H61A 1QATA 2P6BB 4D1EA 1TUZA 3Q8IA 1WLZA 1SYMA 3NHTA 3BUNB 1DF0B 5HKWA 3SIAA 3CZ0A 4KYNA 3SG4A 4BY4A 5HKZA 2ZN9A 3B86A 4PE1A 3AKBA 1J7QA 1NCXA 1LKJA 1XFWO 2FJYA 1RTP1 2KYFA 2NLNA 4N1GA 1C7VA 2LUCA 2I7AA 2Y1NA 2GV5A 4BY5A 2LNKA 3SG3A 3QMEA 1SKTA 2WC8A 3AAKA 4YRUA 1U5IB 5D7FA 4INWA 2LC5A 2EGDA 2JNFA 1MXEA 1A75B 2WCHA 1DJYA 1SMGA 1CFPA 2IS9A 1CDPA 4ORAB 3FIAA 1ALVA 4MZLA 3GK2A 1RECA 4MRYA 1PSRA 3TS5C 4AQJA 1LA3A 1NX1A 1S5GZ 4NQGA 5FI7A 1FPWA 1GGWA 4PE7A 1CMGA 3CWGA 1B9AA 2M1KB 3K21A 4OZDA 1SNLA 4R1EA 1MWNA 2PRUA 2KHNA 3R1OA 4IL1A 4PCWA 1JC2A 5ER4X 1TN4A 2JRFA 1JSAA 1ORGA 4P2YB 3FWBA 5EL2A 1UURA 2GTEA 2LHIA 2GGMA 2L51A 2LVKA 2O5GA 1KK8B 1FBVA 3EKHA 3PJIA 2KQ6A 2WCEA 4L9MA 1YTZC 2M97A 1M45A 1BMOA 2M3WA 3O2PA 2KGBC 2JT8A 3NHIA 5FI2A 1TNQA 1ZMZA 1NCZA 1IWQA 2M7LA 1QX2A 2E30A 4GGNA 4U8DA 1JUOA 1OZSA 1K9PA 1QS7A 2BKHB 4MSPA 2QEBA 2HPSA 1AJ4A 3I5FB 1DF0A 1BR1B 2G9BA 3CR2A 1G8IA 1XK4A 1C07A 2FCDA 2LMUA 1IQ3A 2L0PA 4CLNA 2LE9B 2KGRA 2NCOA 3BUMB 1K9UA 1PVBA 4MLWA 2KBMA 1SL9A 2K8MB 4OCIA 3EK8A 1RWYA 1U5IA 1B4CA 2OPOA 1SCVA 2HETA 1QTXA 3CZ2A 4PHMA 1YUSA 2BCAA 3JTDC 1A75A 4JWQA 1YUTA 2AAOA 2K60A 4Q04A 4WRIA 3S0DA 2KOTA 5I2OA 4N5XA 1S6IA 3V2LA 1DJXA 3M0WA 2BE4A 2H8VA 2LCPA 1LA0A 3A8RA 5DKNA 2LLSA 5JOLA 3EVRA 2EC6B 2K7OA 2LUXA 3D75A 4GGFC 4JPZB 1S1EA 1E8AA 2L4HA 4MZKA 2K0JA 4DS7A 2WCLA 1QWVA 3DVEA 3E3RA 2P71A 3IVTA 1F4OA 3PSRA 2FCEA 2BL0C 4QJ4B 3ZWHA 2OTGB 2YGUA 1ZOTB 1YRTB 2JTZA 1DJZA 2LANA 1PRWA 1YX7A 1UUSA 3BUXB 3GK4X 2WNDA 1K93D 4FQTA 2PYQA 4JQ0D 4PHNA 1BOCA 1SK6D 2F3YA 3EVVA 2K7BA 2WC6A 1QIWA 3NGVA 4YGCB 3CS1A 1TUJA 1XFZO 1CLBA 5F6TA 3BFHA 1UWOA 3TZ1A 2JPTA 3I5GB 2R2IA 4PE4A 2OS8C 1SW8A 2WCKA 5I8NA 2F2OA 4ZCVA 3S0FA 4PT1A 3BFAA 3H4SE 1PSBA 1Y1AA 1KQMC 1A4PA 2MA2A 2ZFDA 1SY9A 1V1GA 1WRLA 1B47A 2BKIB 3RLZA 1JF0A 2KI6D 1S6JA 2HQ8A 2ZRSA 2F8PA 3BXKA 4HRHA 1AJ5A 1OE9B 3JVTC 4MZJA 1WLMA 3PATA 5HLOA 2PMYA 2L5XB 1OMDA 1CFFA 4CFRA 3SS4A 3LK0A 1VRKA 2WCBA 3UO9A 1LINA 1M31A 3AKAA 5AERA 1K2HA 1M39A 1J7OA 4MBEA 5ER5A 3CGAA 3OX6A 4F7FA 3FE9A 2Y4QA 3EK7A 1M63B 3LL8B 1SL8A 3LK1A 3UNWA 4CIDA 1F4QA 3KPXA 4GFTA 5CSNA 1YVHA 3R1PA 4M2OA 3TS5B 1L7ZA 1Y6WA 2E6WA 2JXCA 1BT6A 5IBWA 3BFBA 4JKTA 2LM5A 2JZIA 1YR5A 2KI6C 2LMTA 1EH2A 1AUIB 1OMVA 3BQ3A 2CCMA 3L47A 1DQEA 4PHJA 1BF5A 4CFQA 2F3ZA 2KPHA 4I5JA 1NSHA 1JBAA 2KNEA 3CABA 3EG5B 1S6CA 1ZFSA 2LLTA 3FE6A 3K1EA 1MQ1A 2D8NA 3D73A 2MRDA 4MRXA 3A4UB 2BAPA 2G2BA 3I5IC 4PHKA 1QX7A 1K90D 1J7RA 2JWWA 3VRQA 2P70A 3DF0B 5DKQA 1EJ3A 2WOSA 4MEWA 4ORBB 3CR5X 1TCFA 2V53A 2MJWB 3PM8A 1CM4A 1LVCD 4NDDA 2KAXA 1OOGA 2HQWA 2ISDA 2LP3A 1YVLA 2K7CA 3LLEA 3SJSA 4AQIA 4ZCUA 2JOJA 2JPOA 1F70A 1EG4A 2JT0A 1NPQA 3BYAA 2F33A 3ICBA 3SG6A 1K96A 2ZKMX 3N7HA 5CPVA 1A29A 2A4JA 1SR6B 2Q91A 1C3ZA 3VB1A 1TCOB 4A4BA 1IG5A 2M7NA 1RJVA 3CDNA 5I2LA 4E68A 1CDMA 2JTTA 2I2RE 1NWDA 1DJGA 1TTXA 3I5HC 2L2EA 3SG2A 2LP2A 3WNXB 4YI8A 1SR6C 3OP0A 4QJ5B 3CYZA 2KBIA 5K89A 3DY9A 5I94A 2L98A 1A03A 4FTGA 3JTDB 3NSIA 1BLQA 4HSZA 1YRUB 1F54A 1KSMA 1GM0A 3OBVA 2BE6A 1L2OC 3PN7C 1N2DA 5KTYA 3PFVA 3EKJA 4FQOA 2FJUB 3BUWB 3WHUB 1HT9A 5GQQC 1QX5B 2BNXA 1TRFA 1IH0A 1OMRA 4M2PA 4DIRA 1PULA 1X02A 4GPLB 1S3PA 2L4IA 1RROA 2BL0B 1WY9A 1QV0A 1N0YA 1CDLA 1S26D 4I5NB 1KFUS 1Y0VH 3F45A 2L50A 3L4LA 1CFCA 1S36A 1UHNA 1QIVA 3DXLA 1KK7Y 4MN0A 1DELA 1XVJA 1MHOA 1C3YA 2ERBA 1A2XA 5FI6A 1Y1XA 2M9GA 3DF0A 2LAPA 2M29A 3GK1A 1JFKA 2OS8B 1SBJA 3CLNA 4USLA 2KFHA 1KFXS 1SCMC 2H61C 2PASA 4GBAA 3CR4X 1V1FA 2JULA 1J7PA 1KFUL 1WRZA 1R6PA 2BBMA 1KQMB 2KFGA 3CTNA 3CZ1A 4YGEB 5FYXA 4C0LA 1F71A 2Y5IA 2JNXA 1WRKA 2CBLA 1Z4HA 3EK4A 5CSIA 2KDHA 5TNCA 1SSEB 1KSOA 4N1FA 2PVBA 1DTLA 3BJHA 3SG5A 1DJHA 1YUUA 1K9KA 2KI4B 3JVTB 1SPYA 1KFXL 2BECA 4DUQA 3SS3A 1NYAA 3FE8A 2LLUA 3DVJA 2QEVA 3RM1A 1KWOB 3R72A 1Q80A 2LHLA 1K95A 4A4CA 3SIBA 3NSLA 1H4BA 5AANA 2KI4C 4NDCA 1F8HA 2BBNA 2NCPA 1FI6A 1CMFA 3VRPA 4UPGA 3TDUA 1MF8B 1TNWA 1DC1A 4PDZA 1UHHA 2DOQA 4TNCA 1WDCC 1XYDA 2KAVA 1YURA 1KWOC 2KYCA 3O6BA 3VRNA 2CXJA 3TUYB 1B7TY 1W7JB 5KSZA 3D10A 4GGFA 3B87A 1BU3A 2COLB 3KF9A 1XFVO 1G33A 4M2QA 2PQLA 5CSJA 1DJWA 5J3XA 2KSPA 1OOFA 2M8UA 3VRRA 1PK0D 2K2AA 1ZACA 1K94A 1OW4A 1PALA 3DZTA 5DKRA 5HKYA 1ODBA 1QLSA 1XFXO 2CNPA 1KQVA 3TUYC 1PVAA 3NSOA 1B8LA 3L4AA 1XA5A 4IJ7A 3S0AA 3I5IB 3HCMA 1B8CA 4F0ZB 4GNKB 1NX2A 3O78A 3S0GA 3D74A 1CDNA 1NX3A 2MHHA 2O60A 2ZNEA 1OQPA 4OR9B 1KK7Z 2CTNA 2MLFC 3B88A 4XYNA 1AP4A 1J1DA 4ETOA 1CNPA 1IIOA 1TNPA 2EHBA 2L2CA
chains in the Genus database with same CATH topology
3TDIA 2JC2A 1OZOA 2HF5A 2CT9A 1AK8A 5AXIA 1NCYA 1CTRA 4HRGA 1XK4C 4YGDB 1GJYA 3IF7A 2FOTA 2K2FA 4YI9A 5HYDA 4P5OE 3SG7A 1D1OA 1F55A 3CZTX 4C0KA 1AHRA 2KQYA 1J1EA 3KHEA 2VRGA 3MSEB 1J55A 3I5HB 1AVSA 1DGVA 1DJIA 4YBHB 5AFPA 1XFUO 2MAZA 3WXAA 3BOWB 3KEVA 1IJ6A 3C1VA 1XO5A 2Q4UA 3DVKA 2ZRTA 3DVMA 1UHJA 2JU0A 2LVVA 3PALA 4PALA 4WQ3A 1NX0A 5BPJA 1IQ5A 2AUCA 2KAYA 1L2OB 4NDBA 3PN7B 4ORCB 1Y1UA 1QV1A 1DVIA 1QVIZ 2F2PA 1BJFA 1QJTA 2ZNDA 1JF2A 1HQVA 1MR8A 2I18A 5G08A 3D0YB 4OV2A 2LVIA 2NXQA 3FS7A 2QACA 1B7TZ 3BUOB 4I5LB 2H2KA 3OB1B 1YX8A 1CLLA 1MUXA 3EVUA 2NZ0A 1SL7A 4GAOA 2K7DA 1KK8C 4YGBB 3VGOA 2ZN8A 1QXPA 1DGUA 1RFJA 1CKKA 5B8IB 1EXRA 1R2UA 1NUBA 5I2QA 4DRWA 4WQ2A 4XJKB 5CSFA 1MXLC 2TN4A 2QPTA 2Y1MA 1B8RA 1BR4B 3AAJA 2RGIA 2BCXA 1SCMB 4AOMA 1UHIA 2SCPA 3FWCA 4YGAA 1EG3A 1NP8A 1RK9A 3I5FC 3NSKA 3OB2B 3PLFB 4PE0A 1NIWA 1DT7B 1TIZA 4I5KA 1OOJA 1M46A 1KCYA 1JWDA 2GGZA 1IKUA 1FW4A 2BCBA 3O4YA 1JFJA 2JXLA 1CB1A 5PALA 1IJ5A 3IQQA 5AEQA 1B1GA 4HREE 2MLEC 3KO0A 5KU1A 1SRAA 3DD4A 1QLKA 3GOFA 1GGZA 1S5GY 2PALA 2I94A 3BOWA 2AMIA 1H8BA 1XFYO 2KFFA 1IRJA 2LVJA 2PSRA 1FF1A 1UP5A 1ZUZA 1G4YR 4GUKA 1BODA 2EC6C 1TOPA 1FI5A 1WDCB 5JJGA 1DMOA 3OX5A 3ZNIA 2K61A 1CM1A 3LCPC 1ALWA 1CLMA 3OHMB 2M1UA 1GQMA 3QRXA 3D0YA 5HLVA 1QVIY 2OTGC 2WORA 3NXAA 1N65A 1LXFC 1BG1A 1TNXA 1OSAA 2LMVA 4ICBA 3VROA 2JQ6A 2M49B 5D69A 2MBXA 1W7IB 2SASA 2M0RA 4OVNF 1C7WA 1UHKA 3HX4A 1IGVA 3IQOA 1EL4A 3I5GC 3WHTB 1CFDA 2LV7A 4MVFA 4OKHA 4QJ3B 2JT3A 4XJKA 2WCFA 4CPVA 2B1UA 3TDZA 1QASA 1K8UA 4C0JA 2H61A 1QATA 2P6BB 4D1EA 1WLZA 1SYMA 5HKWA 3BUNB 1DF0B 3SIAA 3SG4A 4BY4A 5HKZA 2ZN9A 4PE1A 3AKBA 1J7QA 1NCXA 1LKJA 1XFWO 2KYFA 1RTP1 2NLNA 4N1GA 1C7VA 2LUCA 2I7AA 2Y1NA 2GV5A 4BY5A 2LNKA 3SG3A 1SKTA 2WC8A 3AAKA 4YRUA 1U5IB 5D7FA 2LC5A 2EGDA 2JNFA 1MXEA 1A75B 1DJYA 1SMGA 1CFPA 2IS9A 1CDPA 4ORAB 3FIAA 1ALVA 4MZLA 3GK2A 1RECA 4MRYA 1PSRA 3TS5C 4AQJA 1LA3A 1NX1A 1S5GZ 4NQGA 1FPWA 1GGWA 4PE7A 1CMGA 3CWGA 1B9AA 2M1KB 3K21A 1SNLA 4R1EA 1MWNA 2PRUA 2KHNA 4IL1A 4PCWA 1JC2A 5ER4X 1TN4A 2JRFA 1JSAA 4P2YB 3FWBA 1UURA 2LHIA 2GGMA 2L51A 2LVKA 2O5GA 1KK8B 1FBVA 3EKHA 2KQ6A 2WCEA 4L9MA 1YTZC 2M97A 1M45A 1BMOA 2M3WA 3O2PA 2KGBC 2JT8A 4DCKA 1TNQA 1ZMZA 1NCZA 1IWQA 2M7LA 1QX2A 2E30A 4GGNA 4U8DA 1JUOA 1OZSA 1K9PA 1QS7A 2BKHB 4MSPA 2HPSA 1AJ4A 3I5FB 1DF0A 1BR1B 2G9BA 3CR2A 1G8IA 1XK4A 1C07A 2FCDA 2LMUA 1IQ3A 2L0PA 4CLNA 2LE9B 2KGRA 2NCOA 3BUMB 1K9UA 1PVBA 4MLWA 2KBMA 1SL9A 2K8MB 4OCIA 3EK8A 1RWYA 1U5IA 1B4CA 2OPOA 1SCVA 2HETA 1QTXA 4PHMA 1YUSA 2BCAA 3JTDC 1A75A 4JWQA 1YUTA 2AAOA 4Q04A 5I2OA 4WRIA 2KOTA 4N5XA 1S6IA 1DJXA 3M0WA 2BE4A 2LCPA 1LA0A 3A8RA 5DKNA 2LLSA 5JOLA 3EVRA 2EC6B 2K7OA 2LUXA 4JPZB 4GGFC 1S1EA 1E8AA 2L4HA 4MZKA 2K0JA 4DS7A 3DVEA 3E3RA 1F4OA 3PSRA 2FCEA 2BL0C 4QJ4B 3ZWHA 2OTGB 1ZOTB 1YRTB 2JTZA 1DJZA 2LANA 1PRWA 1YX7A 1UUSA 3BUXB 3GK4X 2WNDA 1K93D 1BOCA 4JQ0D 4PHNA 1SK6D 2F3YA 3EVVA 2K7BA 1QIWA 4YGCB 3CS1A 1XFZO 1CLBA 5F6TA 1UWOA 3TZ1A 2JPTA 3I5GB 2R2IA 4PE4A 2OS8C 1SW8A 5I8NA 2F2OA 4ZCVA 3H4SE 1PSBA 1Y1AA 1KQMC 1A4PA 2MA2A 2ZFDA 1SY9A 1V1GA 1WRLA 1B47A 2BKIB 3RLZA 1JF0A 2KI6D 1S6JA 2HQ8A 2ZRSA 2F8PA 3BXKA 4HRHA 1AJ5A 1OE9B 3JVTC 4MZJA 1WLMA 3PATA 5HLOA 2PMYA 2L5XB 1OMDA 1CFFA 4CFRA 3LK0A 1VRKA 2WCBA 1LINA 1M31A 3AKAA 5AERA 1K2HA 1M39A 1J7OA 4MBEA 5ER5A 3CGAA 3OX6A 2Y4QA 3EK7A 1M63B 3LL8B 1SL8A 3LK1A 4CIDA 1F4QA 3KPXA 4GFTA 5CSNA 1YVHA 4M2OA 3TS5B 1L7ZA 1Y6WA 2E6WA 2JXCA 1BT6A 5IBWA 2LM5A 2JZIA 1YR5A 2KI6C 2LMTA 1EH2A 1AUIB 1OMVA 3BQ3A 2CCMA 1BF5A 4PHJA 4CFQA 2F3ZA 4I5JA 1JBAA 1NSHA 2KNEA 1S6CA 1ZFSA 2LLTA 1MQ1A 2D8NA 2MRDA 4MRXA 3A4UB 2G2BA 3I5IC 4PHKA 1QX7A 1K90D 1J7RA 2JWWA 3VRQA 3DF0B 5DKQA 1EJ3A 2WOSA 4MEWA 4ORBB 3CR5X 1TCFA 2V53A 2MJWB 3PM8A 1CM4A 1LVCD 4NDDA 2KAXA 3SJSA 2HQWA 2ISDA 2LP3A 1YVLA 2K7CA 3LLEA 4AQIA 4ZCUA 2JOJA 1F70A 1EG4A 2JT0A 1NPQA 3BYAA 2F33A 3ICBA 3SG6A 1K96A 2ZKMX 5CPVA 1A29A 2A4JA 1SR6B 2Q91A 4A4BA 1TCOB 1IG5A 2M7NA 1RJVA 5I2LA 4E68A 1CDMA 2JTTA 2I2RE 1NWDA 1DJGA 1TTXA 3I5HC 2L2EA 3SG2A 2LP2A 3WNXB 4YI8A 1SR6C 3OP0A 4QJ5B 2KBIA 5K89A 2L98A 1A03A 4FTGA 3JTDB 3NSIA 1BLQA 4HSZA 1YRUB 1F54A 1KSMA 2BE6A 1L2OC 3PN7C 1N2DA 5KTYA 3PFVA 3EKJA 4FQOA 2FJUB 3BUWB 3WHUB 1HT9A 5GQQC 1QX5B 1TRFA 1IH0A 1OMRA 4M2PA 4DIRA 1PULA 1X02A 4GPLB 1S3PA 2L4IA 1RROA 2BL0B 1WY9A 1QV0A 1N0YA 1CDLA 1S26D 4I5NB 1KFUS 1Y0VH 3F45A 2L50A 1CFCA 1S36A 1UHNA 1QIVA 1KK7Y 4MN0A 1XVJA 1MHOA 1A2XA 1Y1XA 2M9GA 3DF0A 2LAPA 2M29A 3GK1A 1JFKA 2OS8B 1SBJA 3CLNA 4USLA 2KFHA 1KFXS 1SCMC 2H61C 2PASA 4GBAA 3CR4X 1V1FA 2JULA 1J7PA 1KFUL 1WRZA 1R6PA 2BBMA 1KQMB 2KFGA 3CTNA 5FYXA 4YGEB 4C0LA 1F71A 2Y5IA 2JNXA 1WRKA 2CBLA 3EK4A 5CSIA 2KDHA 5TNCA 1KSOA 4N1FA 2PVBA 1DTLA 3SG5A 1DJHA 1YUUA 1K9KA 2KI4B 3JVTB 1SPYA 1KFXL 2BECA 4DUQA 1NYAA 2LLUA 3DVJA 3RM1A 1KWOB 1Q80A 2LHLA 1K95A 4A4CA 3SIBA 3NSLA 1H4BA 5AANA 2KI4C 4NDCA 1F8HA 2BBNA 2NCPA 1FI6A 1CMFA 3VRPA 4UPGA 3TDUA 1MF8B 1TNWA 4PDZA 1UHHA 2DOQA 4TNCA 1WDCC 1XYDA 2KAVA 1YURA 1KWOC 2KYCA 3O6BA 3VRNA 2CXJA 3TUYB 1B7TY 1W7JB 5KSZA 3D10A 4GGFA 1BU3A 2COLB 3KF9A 1XFVO 1G33A 4M2QA 5CSJA 1DJWA 5J3XA 2KSPA 2M8UA 3VRRA 1PK0D 2K2AA 1ZACA 1K94A 1PALA 5DKRA 5HKYA 1ODBA 1QLSA 1XFXO 2CNPA 1KQVA 3TUYC 1PVAA 3NSOA 1B8LA 1XA5A 3I5IB 3HCMA 1B8CA 4F0ZB 4GNKB 1NX2A 3O78A 1CDNA 1NX3A 2MHHA 2O60A 2ZNEA 1OQPA 4OR9B 1KK7Z 2CTNA 2MLFC 4XYNA 1AP4A 1CNPA 1J1DA 4ETOA 1TNPA 2EHBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TDI A;  2JC2 A;  1OZO A;  2HF5 A;  2CT9 A;  1AK8 A;  5AXI A;  1NCY A;  1CTR A;  4HRG A;  1XK4 C;  4YGD B;  1GJY A;  3IF7 A;  2FOT A;  2K2F A;  4YI9 A;  5HYD A;  4P5O E;  3SG7 A;  1D1O A;  1F55 A;  3CZT X;  4C0K A;  1AHR A;  2KQY A;  1J1E A;  3KHE A;  2VRG A;  3MSE B;  1J55 A;  3I5H B;  1AVS A;  1DGV A;  1DJI A;  4YBH B;  5AFP A;  1XFU O;  2MAZ A;  3WXA A;  3BOW B;  3KEV A;  1IJ6 A;  3C1V A;  1XO5 A;  2Q4U A;  3DVK A;  2ZRT A;  3DVM A;  1UHJ A;  2JU0 A;  2LVV A;  3PAL A;  4PAL A;  4WQ3 A;  1NX0 A;  5BPJ A;  1IQ5 A;  2AUC A;  2KAY A;  1L2O B;  4NDB A;  3PN7 B;  4ORC B;  1Y1U A;  1QV1 A;  1DVI A;  1QVI Z;  2F2P A;  1BJF A;  1QJT A;  2ZND A;  1JF2 A;  1HQV A;  1MR8 A;  2I18 A;  5G08 A;  3D0Y B;  4OV2 A;  2LVI A;  2NXQ A;  3FS7 A;  2QAC A;  1B7T Z;  3BUO B;  4I5L B;  2H2K A;  3OB1 B;  1YX8 A;  1CLL A;  1MUX A;  3EVU A;  2NZ0 A;  1SL7 A;  4GAO A;  2K7D A;  1KK8 C;  4YGB B;  3VGO A;  2ZN8 A;  1QXP A;  1DGU A;  1RFJ A;  1CKK A;  5B8I B;  1EXR A;  1R2U A;  1NUB A;  5I2Q A;  4DRW A;  4WQ2 A;  4XJK B;  5CSF A;  1MXL C;  2TN4 A;  2QPT A;  2Y1M A;  1B8R A;  1BR4 B;  3AAJ A;  2RGI A;  2BCX A;  1SCM B;  4AOM A;  1UHI A;  2SCP A;  3FWC A;  4YGA A;  1EG3 A;  1NP8 A;  1RK9 A;  3I5F C;  3NSK A;  3OB2 B;  3PLF B;  4PE0 A;  1NIW A;  1DT7 B;  1TIZ A;  4I5K A;  1OOJ A;  1M46 A;  1KCY A;  1JWD A;  2GGZ A;  1IKU A;  1FW4 A;  2BCB A;  3O4Y A;  1JFJ A;  2JXL A;  1CB1 A;  5PAL A;  1IJ5 A;  3IQQ A;  5AEQ A;  1B1G A;  4HRE E;  2MLE C;  3KO0 A;  5KU1 A;  1SRA A;  3DD4 A;  1QLK A;  3GOF A;  1GGZ A;  1S5G Y;  2PAL A;  2I94 A;  3BOW A;  2AMI A;  1H8B A;  1XFY O;  2KFF A;  1IRJ A;  2LVJ A;  2PSR A;  1FF1 A;  1UP5 A;  1ZUZ A;  1G4Y R;  4GUK A;  1BOD A;  2EC6 C;  1TOP A;  1FI5 A;  1WDC B;  5JJG A;  1DMO A;  3OX5 A;  3ZNI A;  2K61 A;  1CM1 A;  3LCP C;  1ALW A;  1CLM A;  3OHM B;  2M1U A;  1GQM A;  3QRX A;  3D0Y A;  5HLV A;  1QVI Y;  2OTG C;  2WOR A;  3NXA A;  1N65 A;  1LXF C;  1BG1 A;  1TNX A;  1OSA A;  2LMV A;  4ICB A;  3VRO A;  2JQ6 A;  2M49 B;  5D69 A;  2MBX A;  1W7I B;  2SAS A;  2M0R A;  4OVN F;  1C7W A;  1UHK A;  3HX4 A;  1IGV A;  3IQO A;  1EL4 A;  3I5G C;  3WHT B;  1CFD A;  2LV7 A;  4MVF A;  4OKH A;  4QJ3 B;  2JT3 A;  4XJK A;  2WCF A;  4CPV A;  2B1U A;  3TDZ A;  1QAS A;  1K8U A;  4C0J A;  2H61 A;  1QAT A;  2P6B B;  4D1E A;  1WLZ A;  1SYM A;  5HKW A;  3BUN B;  1DF0 B;  3SIA A;  3SG4 A;  4BY4 A;  5HKZ A;  2ZN9 A;  4PE1 A;  3AKB A;  1J7Q A;  1NCX A;  1LKJ A;  1XFW O;  2KYF A;  1RTP 1;  2NLN A;  4N1G A;  1C7V A;  2LUC A;  2I7A A;  2Y1N A;  2GV5 A;  4BY5 A;  2LNK A;  3SG3 A;  1SKT A;  2WC8 A;  3AAK A;  4YRU A;  1U5I B;  5D7F A;  2LC5 A;  2EGD A;  2JNF A;  1MXE A;  1A75 B;  1DJY A;  1SMG A;  1CFP A;  2IS9 A;  1CDP A;  4ORA B;  3FIA A;  1ALV A;  4MZL A;  3GK2 A;  1REC A;  4MRY A;  1PSR A;  3TS5 C;  4AQJ A;  1LA3 A;  1NX1 A;  1S5G Z;  4NQG A;  1FPW A;  1GGW A;  4PE7 A;  1CMG A;  3CWG A;  1B9A A;  2M1K B;  3K21 A;  1SNL A;  4R1E A;  1MWN A;  2PRU A;  2KHN A;  4IL1 A;  4PCW A;  1JC2 A;  5ER4 X;  1TN4 A;  2JRF A;  1JSA A;  4P2Y B;  3FWB A;  1UUR A;  2LHI A;  2GGM A;  2L51 A;  2LVK A;  2O5G A;  1KK8 B;  1FBV A;  3EKH A;  2KQ6 A;  2WCE A;  4L9M A;  1YTZ C;  2M97 A;  1M45 A;  1BMO A;  2M3W A;  3O2P A;  2KGB C;  2JT8 A;  4DCK A;  1TNQ A;  1ZMZ A;  1NCZ A;  1IWQ A;  2M7L A;  1QX2 A;  2E30 A;  4GGN A;  4U8D A;  1JUO A;  1OZS A;  1K9P A;  1QS7 A;  2BKH B;  4MSP A;  2HPS A;  1AJ4 A;  3I5F B;  1DF0 A;  1BR1 B;  2G9B A;  3CR2 A;  1G8I A;  1XK4 A;  1C07 A;  2FCD A;  2LMU A;  1IQ3 A;  2L0P A;  4CLN A;  2LE9 B;  2KGR A;  2NCO A;  3BUM B;  1K9U A;  1PVB A;  4MLW A;  2KBM A;  1SL9 A;  2K8M B;  4OCI A;  3EK8 A;  1RWY A;  1U5I A;  1B4C A;  2OPO A;  1SCV A;  2HET A;  1QTX A;  4PHM A;  1YUS A;  2BCA A;  3JTD C;  1A75 A;  4JWQ A;  1YUT A;  2AAO A;  4Q04 A;  5I2O A;  4WRI A;  2KOT A;  4N5X A;  1S6I A;  1DJX A;  3M0W A;  2BE4 A;  2LCP A;  1LA0 A;  3A8R A;  5DKN A;  2LLS A;  5JOL A;  3EVR A;  2EC6 B;  2K7O A;  2LUX A;  4JPZ B;  4GGF C;  1S1E A;  1E8A A;  2L4H A;  4MZK A;  2K0J A;  4DS7 A;  3DVE A;  3E3R A;  1F4O A;  3PSR A;  2FCE A;  2BL0 C;  4QJ4 B;  3ZWH A;  2OTG B;  1ZOT B;  1YRT B;  2JTZ A;  1DJZ A;  2LAN A;  1PRW A;  1YX7 A;  1UUS A;  3BUX B;  3GK4 X;  2WND A;  1K93 D;  1BOC A;  4JQ0 D;  4PHN A;  1SK6 D;  2F3Y A;  3EVV A;  2K7B A;  1QIW A;  4YGC B;  3CS1 A;  1XFZ O;  1CLB A;  5F6T A;  1UWO A;  3TZ1 A;  2JPT A;  3I5G B;  2R2I A;  4PE4 A;  2OS8 C;  1SW8 A;  5I8N A;  2F2O A;  4ZCV A;  3H4S E;  1PSB A;  1Y1A A;  1KQM C;  1A4P A;  2MA2 A;  2ZFD A;  1SY9 A;  1V1G A;  1WRL A;  1B47 A;  2BKI B;  3RLZ A;  1JF0 A;  2KI6 D;  1S6J A;  2HQ8 A;  2ZRS A;  2F8P A;  3BXK A;  4HRH A;  1AJ5 A;  1OE9 B;  3JVT C;  4MZJ A;  1WLM A;  3PAT A;  5HLO A;  2PMY A;  2L5X B;  1OMD A;  1CFF A;  4CFR A;  3LK0 A;  1VRK A;  2WCB A;  1LIN A;  1M31 A;  3AKA A;  5AER A;  1K2H A;  1M39 A;  1J7O A;  4MBE A;  5ER5 A;  3CGA A;  3OX6 A;  2Y4Q A;  3EK7 A;  1M63 B;  3LL8 B;  1SL8 A;  3LK1 A;  4CID A;  1F4Q A;  3KPX A;  4GFT A;  5CSN A;  1YVH A;  4M2O A;  3TS5 B;  1L7Z A;  1Y6W A;  2E6W A;  2JXC A;  1BT6 A;  5IBW A;  2LM5 A;  2JZI A;  1YR5 A;  2KI6 C;  2LMT A;  1EH2 A;  1AUI B;  1OMV A;  3BQ3 A;  2CCM A;  1BF5 A;  4PHJ A;  4CFQ A;  2F3Z A;  4I5J A;  1JBA A;  1NSH A;  2KNE A;  1S6C A;  1ZFS A;  2LLT A;  1MQ1 A;  2D8N A;  2MRD A;  4MRX A;  3A4U B;  2G2B A;  3I5I C;  4PHK A;  1QX7 A;  1K90 D;  1J7R A;  2JWW A;  3VRQ A;  3DF0 B;  5DKQ A;  1EJ3 A;  2WOS A;  4MEW A;  4ORB B;  3CR5 X;  1TCF A;  2V53 A;  2MJW B;  3PM8 A;  1CM4 A;  1LVC D;  4NDD A;  2KAX A;  3SJS A;  2HQW A;  2ISD A;  2LP3 A;  1YVL A;  2K7C A;  3LLE A;  4AQI A;  4ZCU A;  2JOJ A;  1F70 A;  1EG4 A;  2JT0 A;  1NPQ A;  3BYA A;  2F33 A;  3ICB A;  3SG6 A;  1K96 A;  2ZKM X;  5CPV A;  1A29 A;  2A4J A;  1SR6 B;  2Q91 A;  4A4B A;  1TCO B;  1IG5 A;  2M7N A;  1RJV A;  5I2L A;  4E68 A;  1CDM A;  2JTT A;  2I2R E;  1NWD A;  1DJG A;  1TTX A;  3I5H C;  2L2E A;  3SG2 A;  2LP2 A;  3WNX B;  4YI8 A;  1SR6 C;  3OP0 A;  4QJ5 B;  2KBI A;  5K89 A;  2L98 A;  1A03 A;  4FTG A;  3JTD B;  3NSI A;  1BLQ A;  4HSZ A;  1YRU B;  1F54 A;  1KSM A;  2BE6 A;  1L2O C;  3PN7 C;  1N2D A;  5KTY A;  3PFV A;  3EKJ A;  4FQO A;  2FJU B;  3BUW B;  3WHU B;  1HT9 A;  5GQQ C;  1QX5 B;  1TRF A;  1IH0 A;  1OMR A;  4M2P A;  4DIR A;  1PUL A;  1X02 A;  4GPL B;  1S3P A;  2L4I A;  1RRO A;  2BL0 B;  1WY9 A;  1QV0 A;  1N0Y A;  1CDL A;  1S26 D;  4I5N B;  1KFU S;  1Y0V H;  3F45 A;  2L50 A;  1CFC A;  1S36 A;  1UHN A;  1QIV A;  1KK7 Y;  4MN0 A;  1XVJ A;  1MHO A;  1A2X A;  1Y1X A;  2M9G A;  3DF0 A;  2LAP A;  2M29 A;  3GK1 A;  1JFK A;  2OS8 B;  1SBJ A;  3CLN A;  4USL A;  2KFH A;  1KFX S;  1SCM C;  2H61 C;  2PAS A;  4GBA A;  3CR4 X;  1V1F A;  2JUL A;  1J7P A;  1KFU L;  1WRZ A;  1R6P A;  2BBM A;  1KQM B;  2KFG A;  3CTN A;  5FYX A;  4YGE B;  4C0L A;  1F71 A;  2Y5I A;  2JNX A;  1WRK A;  2CBL A;  3EK4 A;  5CSI A;  2KDH A;  5TNC A;  1KSO A;  4N1F A;  2PVB A;  1DTL A;  3SG5 A;  1DJH A;  1YUU A;  1K9K A;  2KI4 B;  3JVT B;  1SPY A;  1KFX L;  2BEC A;  4DUQ A;  1NYA A;  2LLU A;  3DVJ A;  3RM1 A;  1KWO B;  1Q80 A;  2LHL A;  1K95 A;  4A4C A;  3SIB A;  3NSL A;  1H4B A;  5AAN A;  2KI4 C;  4NDC A;  1F8H A;  2BBN A;  2NCP A;  1FI6 A;  1CMF A;  3VRP A;  4UPG A;  3TDU A;  1MF8 B;  1TNW A;  4PDZ A;  1UHH A;  2DOQ A;  4TNC A;  1WDC C;  1XYD A;  2KAV A;  1YUR A;  1KWO C;  2KYC A;  3O6B A;  3VRN A;  2CXJ A;  3TUY B;  1B7T Y;  1W7J B;  5KSZ A;  3D10 A;  4GGF A;  1BU3 A;  2COL B;  3KF9 A;  1XFV O;  1G33 A;  4M2Q A;  5CSJ A;  1DJW A;  5J3X A;  2KSP A;  2M8U A;  3VRR A;  1PK0 D;  2K2A A;  1ZAC A;  1K94 A;  1PAL A;  5DKR A;  5HKY A;  1ODB A;  1QLS A;  1XFX O;  2CNP A;  1KQV A;  3TUY C;  1PVA A;  3NSO A;  1B8L A;  1XA5 A;  3I5I B;  3HCM A;  1B8C A;  4F0Z B;  4GNK B;  1NX2 A;  3O78 A;  1CDN A;  1NX3 A;  2MHH A;  2O60 A;  2ZNE A;  1OQP A;  4OR9 B;  1KK7 Z;  2CTN A;  2MLF C;  4XYN A;  1AP4 A;  1CNP A;  1J1D A;  4ETO A;  1TNP A;  2EHB A; 
#chains in the Genus database with same CATH topology
 3TDI A;  2JC2 A;  1OZO A;  2HF5 A;  2CT9 A;  1AK8 A;  5AXI A;  1NCY A;  1CTR A;  1TWO A;  4HRG A;  1XK4 C;  2WC5 A;  4YGD B;  1GJY A;  3IF7 A;  2FOT A;  2K2F A;  4YI9 A;  3S0E A;  4P5O E;  5HYD A;  3SG7 A;  1D1O A;  1F55 A;  3CZT X;  2QEO A;  2WCM A;  4C0K A;  1AHR A;  2KQY A;  1J1E A;  3KHE A;  2VRG A;  3MSE B;  1J55 A;  3I5H B;  1AVS A;  1DGV A;  1DJI A;  4JD9 A;  4YBH B;  5AFP A;  1XFU O;  2MAZ A;  3WXA A;  2QDI A;  3BOW B;  3KEV A;  1IJ6 A;  3C1V A;  1XO5 A;  2Q4U A;  3DVK A;  2ZRT A;  3DVM A;  1UHJ A;  2JU0 A;  2LVV A;  3PAL A;  4PAL A;  4WQ3 A;  1NX0 A;  3R1V A;  5BPJ A;  1IQ5 A;  2AUC A;  2KAY A;  1L2O B;  4NDB A;  3PN7 B;  4ORC B;  1Y1U A;  3D77 A;  1QV1 A;  1DVI A;  1QVI Z;  2F2P A;  1Z2C B;  1BJF A;  1QJT A;  1JF2 A;  1HQV A;  1MR8 A;  2I18 A;  2ZND A;  3D0Y B;  5G08 A;  4OV2 A;  2LVI A;  2NXQ A;  3FS7 A;  2QAC A;  1B7T Z;  3BUO B;  1OOI X;  4I5L B;  2H2K A;  3OB1 B;  1YX8 A;  1CLL A;  1MUX A;  3EVU A;  2NZ0 A;  1SL7 A;  4GAO A;  2K7D A;  1KK8 C;  4YGB B;  3VGO A;  2ZN8 A;  1QXP A;  1DGU A;  1RFJ A;  1CKK A;  5B8I B;  1EXR A;  1R2U A;  1NUB A;  2KLD A;  3SS5 A;  5I2Q A;  4DRW A;  4WQ2 A;  4XJK B;  5CSF A;  1MXL C;  2TN4 A;  2QPT A;  2Y1M A;  1B8R A;  1BR4 B;  3AAJ A;  5HL1 A;  2RGI A;  2BCX A;  1SCM B;  4AOM A;  1UHI A;  2SCP A;  3FWC A;  4YGA A;  5D3O A;  1EG3 A;  1NP8 A;  1RK9 A;  3I5F C;  3NSK A;  3OB2 B;  3PLF B;  4PE0 A;  1NIW A;  1DT7 B;  1TIZ A;  4I5K A;  1OOJ A;  1M46 A;  1KCY A;  1W9Z A;  1JWD A;  2GGZ A;  1IKU A;  1FW4 A;  4INX A;  2BCB A;  3O4Y A;  1JFJ A;  2JXL A;  1CB1 A;  5PAL A;  1IJ5 A;  3IQQ A;  3B6X A;  1P28 A;  5AEQ A;  3S0B A;  1B1G A;  1OOH A;  4HRE E;  2L5Y A;  2MLE C;  3KO0 A;  5DIC A;  1SRA A;  3DD4 A;  1QLK A;  3GOF A;  5KU1 A;  1T14 A;  1GGZ A;  1S5G Y;  2PAL A;  2I94 A;  3BOW A;  2AMI A;  1H8B A;  1XFY O;  2KFF A;  3OGN A;  1IRJ A;  2LVJ A;  2PSR A;  1FF1 A;  1UP5 A;  1DEK A;  1ZUZ A;  1G4Y R;  4GUK A;  1BOD A;  2EC6 C;  1TOP A;  1FI5 A;  3DYE A;  1WDC B;  5JJG A;  3PM2 A;  1DMO A;  1XFR A;  3OX5 A;  3ZNI A;  2K61 A;  1CM1 A;  3LCP C;  1ALW A;  1CLM A;  3OHM B;  2M1U A;  1GQM A;  3QRX A;  3D0Y A;  3O4X A;  5HLV A;  3D78 A;  4DCK A;  1QVI Y;  1LS8 A;  2OTG C;  2WOR A;  3NXA A;  1N65 A;  1LXF C;  1BG1 A;  1TNX A;  1OSA A;  2LMV A;  4ICB A;  3VRO A;  2JQ6 A;  2M49 B;  3D76 A;  5D69 A;  2MBX A;  1W7I B;  2SAS A;  2WCJ A;  2M0R A;  4OVN F;  1C7W A;  1UHK A;  3HX4 A;  1IGV A;  3IQO A;  1EL4 A;  2KLE A;  3I5G C;  3WHT B;  1CFD A;  2LV7 A;  3RZS A;  4MVF A;  4OKH A;  4QJ3 B;  2JT3 A;  4XJK A;  2WCF A;  4CPV A;  2B1U A;  2QEH A;  3TDZ A;  1QAS A;  1K8U A;  3B7A A;  4C0J A;  2H61 A;  1QAT A;  2P6B B;  4D1E A;  1TUZ A;  3Q8I A;  1WLZ A;  1SYM A;  3NHT A;  3BUN B;  1DF0 B;  5HKW A;  3SIA A;  3CZ0 A;  4KYN A;  3SG4 A;  4BY4 A;  5HKZ A;  2ZN9 A;  3B86 A;  4PE1 A;  3AKB A;  1J7Q A;  1NCX A;  1LKJ A;  1XFW O;  2FJY A;  1RTP 1;  2KYF A;  2NLN A;  4N1G A;  1C7V A;  2LUC A;  2I7A A;  2Y1N A;  2GV5 A;  4BY5 A;  2LNK A;  3SG3 A;  3QME A;  1SKT A;  2WC8 A;  3AAK A;  4YRU A;  1U5I B;  5D7F A;  4INW A;  2LC5 A;  2EGD A;  2JNF A;  1MXE A;  1A75 B;  2WCH A;  1DJY A;  1SMG A;  1CFP A;  2IS9 A;  1CDP A;  4ORA B;  3FIA A;  1ALV A;  4MZL A;  3GK2 A;  1REC A;  4MRY A;  1PSR A;  3TS5 C;  4AQJ A;  1LA3 A;  1NX1 A;  1S5G Z;  4NQG A;  5FI7 A;  1FPW A;  1GGW A;  4PE7 A;  1CMG A;  3CWG A;  1B9A A;  2M1K B;  3K21 A;  4OZD A;  1SNL A;  4R1E A;  1MWN A;  2PRU A;  2KHN A;  3R1O A;  4IL1 A;  4PCW A;  1JC2 A;  5ER4 X;  1TN4 A;  2JRF A;  1JSA A;  1ORG A;  4P2Y B;  3FWB A;  5EL2 A;  1UUR A;  2GTE A;  2LHI A;  2GGM A;  2L51 A;  2LVK A;  2O5G A;  1KK8 B;  1FBV A;  3EKH A;  3PJI A;  2KQ6 A;  2WCE A;  4L9M A;  1YTZ C;  2M97 A;  1M45 A;  1BMO A;  2M3W A;  3O2P A;  2KGB C;  2JT8 A;  3NHI A;  5FI2 A;  1TNQ A;  1ZMZ A;  1NCZ A;  1IWQ A;  2M7L A;  1QX2 A;  2E30 A;  4GGN A;  4U8D A;  1JUO A;  1OZS A;  1K9P A;  1QS7 A;  2BKH B;  4MSP A;  2QEB A;  2HPS A;  1AJ4 A;  3I5F B;  1DF0 A;  1BR1 B;  2G9B A;  3CR2 A;  1G8I A;  1XK4 A;  1C07 A;  2FCD A;  2LMU A;  1IQ3 A;  2L0P A;  4CLN A;  2LE9 B;  2KGR A;  2NCO A;  3BUM B;  1K9U A;  1PVB A;  4MLW A;  2KBM A;  1SL9 A;  2K8M B;  4OCI A;  3EK8 A;  1RWY A;  1U5I A;  1B4C A;  2OPO A;  1SCV A;  2HET A;  1QTX A;  3CZ2 A;  4PHM A;  1YUS A;  2BCA A;  3JTD C;  1A75 A;  4JWQ A;  1YUT A;  2AAO A;  2K60 A;  4Q04 A;  4WRI A;  3S0D A;  2KOT A;  5I2O A;  4N5X A;  1S6I A;  3V2L A;  1DJX A;  3M0W A;  2BE4 A;  2H8V A;  2LCP A;  1LA0 A;  3A8R A;  5DKN A;  2LLS A;  5JOL A;  3EVR A;  2EC6 B;  2K7O A;  2LUX A;  3D75 A;  4GGF C;  4JPZ B;  1S1E A;  1E8A A;  2L4H A;  4MZK A;  2K0J A;  4DS7 A;  2WCL A;  1QWV A;  3DVE A;  3E3R A;  2P71 A;  3IVT A;  1F4O A;  3PSR A;  2FCE A;  2BL0 C;  4QJ4 B;  3ZWH A;  2OTG B;  2YGU A;  1ZOT B;  1YRT B;  2JTZ A;  1DJZ A;  2LAN A;  1PRW A;  1YX7 A;  1UUS A;  3BUX B;  3GK4 X;  2WND A;  1K93 D;  4FQT A;  2PYQ A;  4JQ0 D;  4PHN A;  1BOC A;  1SK6 D;  2F3Y A;  3EVV A;  2K7B A;  2WC6 A;  1QIW A;  3NGV A;  4YGC B;  3CS1 A;  1TUJ A;  1XFZ O;  1CLB A;  5F6T A;  3BFH A;  1UWO A;  3TZ1 A;  2JPT A;  3I5G B;  2R2I A;  4PE4 A;  2OS8 C;  1SW8 A;  2WCK A;  5I8N A;  2F2O A;  4ZCV A;  3S0F A;  4PT1 A;  3BFA A;  3H4S E;  1PSB A;  1Y1A A;  1KQM C;  1A4P A;  2MA2 A;  2ZFD A;  1SY9 A;  1V1G A;  1WRL A;  1B47 A;  2BKI B;  3RLZ A;  1JF0 A;  2KI6 D;  1S6J A;  2HQ8 A;  2ZRS A;  2F8P A;  3BXK A;  4HRH A;  1AJ5 A;  1OE9 B;  3JVT C;  4MZJ A;  1WLM A;  3PAT A;  5HLO A;  2PMY A;  2L5X B;  1OMD A;  1CFF A;  4CFR A;  3SS4 A;  3LK0 A;  1VRK A;  2WCB A;  3UO9 A;  1LIN A;  1M31 A;  3AKA A;  5AER A;  1K2H A;  1M39 A;  1J7O A;  4MBE A;  5ER5 A;  3CGA A;  3OX6 A;  4F7F A;  3FE9 A;  2Y4Q A;  3EK7 A;  1M63 B;  3LL8 B;  1SL8 A;  3LK1 A;  3UNW A;  4CID A;  1F4Q A;  3KPX A;  4GFT A;  5CSN A;  1YVH A;  3R1P A;  4M2O A;  3TS5 B;  1L7Z A;  1Y6W A;  2E6W A;  2JXC A;  1BT6 A;  5IBW A;  3BFB A;  4JKT A;  2LM5 A;  2JZI A;  1YR5 A;  2KI6 C;  2LMT A;  1EH2 A;  1AUI B;  1OMV A;  3BQ3 A;  2CCM A;  3L47 A;  1DQE A;  4PHJ A;  1BF5 A;  4CFQ A;  2F3Z A;  2KPH A;  4I5J A;  1NSH A;  1JBA A;  2KNE A;  3CAB A;  3EG5 B;  1S6C A;  1ZFS A;  2LLT A;  3FE6 A;  3K1E A;  1MQ1 A;  2D8N A;  3D73 A;  2MRD A;  4MRX A;  3A4U B;  2BAP A;  2G2B A;  3I5I C;  4PHK A;  1QX7 A;  1K90 D;  1J7R A;  2JWW A;  3VRQ A;  2P70 A;  3DF0 B;  5DKQ A;  1EJ3 A;  2WOS A;  4MEW A;  4ORB B;  3CR5 X;  1TCF A;  2V53 A;  2MJW B;  3PM8 A;  1CM4 A;  1LVC D;  4NDD A;  2KAX A;  1OOG A;  2HQW A;  2ISD A;  2LP3 A;  1YVL A;  2K7C A;  3LLE A;  3SJS A;  4AQI A;  4ZCU A;  2JOJ A;  2JPO A;  1F70 A;  1EG4 A;  2JT0 A;  1NPQ A;  3BYA A;  2F33 A;  3ICB A;  3SG6 A;  1K96 A;  2ZKM X;  3N7H A;  5CPV A;  1A29 A;  2A4J A;  1SR6 B;  2Q91 A;  1C3Z A;  3VB1 A;  1TCO B;  4A4B A;  1IG5 A;  2M7N A;  1RJV A;  3CDN A;  5I2L A;  4E68 A;  1CDM A;  2JTT A;  2I2R E;  1NWD A;  1DJG A;  1TTX A;  3I5H C;  2L2E A;  3SG2 A;  2LP2 A;  3WNX B;  4YI8 A;  1SR6 C;  3OP0 A;  4QJ5 B;  3CYZ A;  2KBI A;  5K89 A;  3DY9 A;  5I94 A;  2L98 A;  1A03 A;  4FTG A;  3JTD B;  3NSI A;  1BLQ A;  4HSZ A;  1YRU B;  1F54 A;  1KSM A;  1GM0 A;  3OBV A;  2BE6 A;  1L2O C;  3PN7 C;  1N2D A;  5KTY A;  3PFV A;  3EKJ A;  4FQO A;  2FJU B;  3BUW B;  3WHU B;  1HT9 A;  5GQQ C;  1QX5 B;  2BNX A;  1TRF A;  1IH0 A;  1OMR A;  4M2P A;  4DIR A;  1PUL A;  1X02 A;  4GPL B;  1S3P A;  2L4I A;  1RRO A;  2BL0 B;  1WY9 A;  1QV0 A;  1N0Y A;  1CDL A;  1S26 D;  4I5N B;  1KFU S;  1Y0V H;  3F45 A;  2L50 A;  3L4L A;  1CFC A;  1S36 A;  1UHN A;  1QIV A;  3DXL A;  1KK7 Y;  4MN0 A;  1DEL A;  1XVJ A;  1MHO A;  1C3Y A;  2ERB A;  1A2X A;  5FI6 A;  1Y1X A;  2M9G A;  3DF0 A;  2LAP A;  2M29 A;  3GK1 A;  1JFK A;  2OS8 B;  1SBJ A;  3CLN A;  4USL A;  2KFH A;  1KFX S;  1SCM C;  2H61 C;  2PAS A;  4GBA A;  3CR4 X;  1V1F A;  2JUL A;  1J7P A;  1KFU L;  1WRZ A;  1R6P A;  2BBM A;  1KQM B;  2KFG A;  3CTN A;  3CZ1 A;  4YGE B;  5FYX A;  4C0L A;  1F71 A;  2Y5I A;  2JNX A;  1WRK A;  2CBL A;  1Z4H A;  3EK4 A;  5CSI A;  2KDH A;  5TNC A;  1SSE B;  1KSO A;  4N1F A;  2PVB A;  1DTL A;  3BJH A;  3SG5 A;  1DJH A;  1YUU A;  1K9K A;  2KI4 B;  3JVT B;  1SPY A;  1KFX L;  2BEC A;  4DUQ A;  3SS3 A;  1NYA A;  3FE8 A;  2LLU A;  3DVJ A;  2QEV A;  3RM1 A;  1KWO B;  3R72 A;  1Q80 A;  2LHL A;  1K95 A;  4A4C A;  3SIB A;  3NSL A;  1H4B A;  5AAN A;  2KI4 C;  4NDC A;  1F8H A;  2BBN A;  2NCP A;  1FI6 A;  1CMF A;  3VRP A;  4UPG A;  3TDU A;  1MF8 B;  1TNW A;  1DC1 A;  4PDZ A;  1UHH A;  2DOQ A;  4TNC A;  1WDC C;  1XYD A;  2KAV A;  1YUR A;  1KWO C;  2KYC A;  3O6B A;  3VRN A;  2CXJ A;  3TUY B;  1B7T Y;  1W7J B;  5KSZ A;  3D10 A;  4GGF A;  3B87 A;  1BU3 A;  2COL B;  3KF9 A;  1XFV O;  1G33 A;  4M2Q A;  2PQL A;  5CSJ A;  1DJW A;  5J3X A;  2KSP A;  1OOF A;  2M8U A;  3VRR A;  1PK0 D;  2K2A A;  1ZAC A;  1K94 A;  1OW4 A;  1PAL A;  3DZT A;  5DKR A;  5HKY A;  1ODB A;  1QLS A;  1XFX O;  2CNP A;  1KQV A;  3TUY C;  1PVA A;  3NSO A;  1B8L A;  3L4A A;  1XA5 A;  4IJ7 A;  3S0A A;  3I5I B;  3HCM A;  1B8C A;  4F0Z B;  4GNK B;  1NX2 A;  3O78 A;  3S0G A;  3D74 A;  1CDN A;  1NX3 A;  2MHH A;  2O60 A;  2ZNE A;  1OQP A;  4OR9 B;  1KK7 Z;  2CTN A;  2MLF C;  3B88 A;  4XYN A;  1AP4 A;  1J1D A;  4ETO A;  1CNP A;  1IIO A;  1TNP A;  2EHB A;  2L2C A; 
#chains in the Genus database with same CATH homology
 3TDI A;  2JC2 A;  1OZO A;  2HF5 A;  2CT9 A;  1AK8 A;  5AXI A;  1NCY A;  1CTR A;  4HRG A;  1XK4 C;  4YGD B;  1GJY A;  3IF7 A;  2FOT A;  2K2F A;  4YI9 A;  5HYD A;  4P5O E;  3SG7 A;  1D1O A;  1F55 A;  3CZT X;  4C0K A;  1AHR A;  2KQY A;  1J1E A;  3KHE A;  2VRG A;  3MSE B;  1J55 A;  3I5H B;  1AVS A;  1DGV A;  1DJI A;  4YBH B;  5AFP A;  1XFU O;  2MAZ A;  3WXA A;  3BOW B;  3KEV A;  1IJ6 A;  3C1V A;  1XO5 A;  2Q4U A;  3DVK A;  2ZRT A;  3DVM A;  1UHJ A;  2JU0 A;  2LVV A;  3PAL A;  4PAL A;  4WQ3 A;  1NX0 A;  5BPJ A;  1IQ5 A;  2AUC A;  2KAY A;  1L2O B;  4NDB A;  3PN7 B;  4ORC B;  1Y1U A;  1QV1 A;  1DVI A;  1QVI Z;  2F2P A;  1BJF A;  1QJT A;  2ZND A;  1JF2 A;  1HQV A;  1MR8 A;  2I18 A;  5G08 A;  3D0Y B;  4OV2 A;  2LVI A;  2NXQ A;  3FS7 A;  2QAC A;  1B7T Z;  3BUO B;  4I5L B;  2H2K A;  3OB1 B;  1YX8 A;  1CLL A;  1MUX A;  3EVU A;  2NZ0 A;  1SL7 A;  4GAO A;  2K7D A;  1KK8 C;  4YGB B;  3VGO A;  2ZN8 A;  1QXP A;  1DGU A;  1RFJ A;  1CKK A;  5B8I B;  1EXR A;  1R2U A;  1NUB A;  5I2Q A;  4DRW A;  4WQ2 A;  4XJK B;  5CSF A;  1MXL C;  2TN4 A;  2QPT A;  2Y1M A;  1B8R A;  1BR4 B;  3AAJ A;  2RGI A;  2BCX A;  1SCM B;  4AOM A;  1UHI A;  2SCP A;  3FWC A;  4YGA A;  1EG3 A;  1NP8 A;  1RK9 A;  3I5F C;  3NSK A;  3OB2 B;  3PLF B;  4PE0 A;  1NIW A;  1DT7 B;  1TIZ A;  4I5K A;  1OOJ A;  1M46 A;  1KCY A;  1JWD A;  2GGZ A;  1IKU A;  1FW4 A;  2BCB A;  3O4Y A;  1JFJ A;  2JXL A;  1CB1 A;  5PAL A;  1IJ5 A;  3IQQ A;  5AEQ A;  1B1G A;  4HRE E;  2MLE C;  3KO0 A;  5KU1 A;  1SRA A;  3DD4 A;  1QLK A;  3GOF A;  1GGZ A;  1S5G Y;  2PAL A;  2I94 A;  3BOW A;  2AMI A;  1H8B A;  1XFY O;  2KFF A;  1IRJ A;  2LVJ A;  2PSR A;  1FF1 A;  1UP5 A;  1ZUZ A;  1G4Y R;  4GUK A;  1BOD A;  2EC6 C;  1TOP A;  1FI5 A;  1WDC B;  5JJG A;  1DMO A;  3OX5 A;  3ZNI A;  2K61 A;  1CM1 A;  3LCP C;  1ALW A;  1CLM A;  3OHM B;  2M1U A;  1GQM A;  3QRX A;  3D0Y A;  5HLV A;  1QVI Y;  2OTG C;  2WOR A;  3NXA A;  1N65 A;  1LXF C;  1BG1 A;  1TNX A;  1OSA A;  2LMV A;  4ICB A;  3VRO A;  2JQ6 A;  2M49 B;  5D69 A;  2MBX A;  1W7I B;  2SAS A;  2M0R A;  4OVN F;  1C7W A;  1UHK A;  3HX4 A;  1IGV A;  3IQO A;  1EL4 A;  3I5G C;  3WHT B;  1CFD A;  2LV7 A;  4MVF A;  4OKH A;  4QJ3 B;  2JT3 A;  4XJK A;  2WCF A;  4CPV A;  2B1U A;  3TDZ A;  1QAS A;  1K8U A;  4C0J A;  2H61 A;  1QAT A;  2P6B B;  4D1E A;  1WLZ A;  1SYM A;  5HKW A;  3BUN B;  1DF0 B;  3SIA A;  3SG4 A;  4BY4 A;  5HKZ A;  2ZN9 A;  4PE1 A;  3AKB A;  1J7Q A;  1NCX A;  1LKJ A;  1XFW O;  2KYF A;  1RTP 1;  2NLN A;  4N1G A;  1C7V A;  2LUC A;  2I7A A;  2Y1N A;  2GV5 A;  4BY5 A;  2LNK A;  3SG3 A;  1SKT A;  2WC8 A;  3AAK A;  4YRU A;  1U5I B;  5D7F A;  2LC5 A;  2EGD A;  2JNF A;  1MXE A;  1A75 B;  1DJY A;  1SMG A;  1CFP A;  2IS9 A;  1CDP A;  4ORA B;  3FIA A;  1ALV A;  4MZL A;  3GK2 A;  1REC A;  4MRY A;  1PSR A;  3TS5 C;  4AQJ A;  1LA3 A;  1NX1 A;  1S5G Z;  4NQG A;  1FPW A;  1GGW A;  4PE7 A;  1CMG A;  3CWG A;  1B9A A;  2M1K B;  3K21 A;  1SNL A;  4R1E A;  1MWN A;  2PRU A;  2KHN A;  4IL1 A;  4PCW A;  1JC2 A;  5ER4 X;  1TN4 A;  2JRF A;  1JSA A;  4P2Y B;  3FWB A;  1UUR A;  2LHI A;  2GGM A;  2L51 A;  2LVK A;  2O5G A;  1KK8 B;  1FBV A;  3EKH A;  2KQ6 A;  2WCE A;  4L9M A;  1YTZ C;  2M97 A;  1M45 A;  1BMO A;  2M3W A;  3O2P A;  2KGB C;  2JT8 A;  4DCK A;  1TNQ A;  1ZMZ A;  1NCZ A;  1IWQ A;  2M7L A;  1QX2 A;  2E30 A;  4GGN A;  4U8D A;  1JUO A;  1OZS A;  1K9P A;  1QS7 A;  2BKH B;  4MSP A;  2HPS A;  1AJ4 A;  3I5F B;  1DF0 A;  1BR1 B;  2G9B A;  3CR2 A;  1G8I A;  1XK4 A;  1C07 A;  2FCD A;  2LMU A;  1IQ3 A;  2L0P A;  4CLN A;  2LE9 B;  2KGR A;  2NCO A;  3BUM B;  1K9U A;  1PVB A;  4MLW A;  2KBM A;  1SL9 A;  2K8M B;  4OCI A;  3EK8 A;  1RWY A;  1U5I A;  1B4C A;  2OPO A;  1SCV A;  2HET A;  1QTX A;  4PHM A;  1YUS A;  2BCA A;  3JTD C;  1A75 A;  4JWQ A;  1YUT A;  2AAO A;  4Q04 A;  5I2O A;  4WRI A;  2KOT A;  4N5X A;  1S6I A;  1DJX A;  3M0W A;  2BE4 A;  2LCP A;  1LA0 A;  3A8R A;  5DKN A;  2LLS A;  5JOL A;  3EVR A;  2EC6 B;  2K7O A;  2LUX A;  4JPZ B;  4GGF C;  1S1E A;  1E8A A;  2L4H A;  4MZK A;  2K0J A;  4DS7 A;  3DVE A;  3E3R A;  1F4O A;  3PSR A;  2FCE A;  2BL0 C;  4QJ4 B;  3ZWH A;  2OTG B;  1ZOT B;  1YRT B;  2JTZ A;  1DJZ A;  2LAN A;  1PRW A;  1YX7 A;  1UUS A;  3BUX B;  3GK4 X;  2WND A;  1K93 D;  1BOC A;  4JQ0 D;  4PHN A;  1SK6 D;  2F3Y A;  3EVV A;  2K7B A;  1QIW A;  4YGC B;  3CS1 A;  1XFZ O;  1CLB A;  5F6T A;  1UWO A;  3TZ1 A;  2JPT A;  3I5G B;  2R2I A;  4PE4 A;  2OS8 C;  1SW8 A;  5I8N A;  2F2O A;  4ZCV A;  3H4S E;  1PSB A;  1Y1A A;  1KQM C;  1A4P A;  2MA2 A;  2ZFD A;  1SY9 A;  1V1G A;  1WRL A;  1B47 A;  2BKI B;  3RLZ A;  1JF0 A;  2KI6 D;  1S6J A;  2HQ8 A;  2ZRS A;  2F8P A;  3BXK A;  4HRH A;  1AJ5 A;  1OE9 B;  3JVT C;  4MZJ A;  1WLM A;  3PAT A;  5HLO A;  2PMY A;  2L5X B;  1OMD A;  1CFF A;  4CFR A;  3LK0 A;  1VRK A;  2WCB A;  1LIN A;  1M31 A;  3AKA A;  5AER A;  1K2H A;  1M39 A;  1J7O A;  4MBE A;  5ER5 A;  3CGA A;  3OX6 A;  2Y4Q A;  3EK7 A;  1M63 B;  3LL8 B;  1SL8 A;  3LK1 A;  4CID A;  1F4Q A;  3KPX A;  4GFT A;  5CSN A;  1YVH A;  4M2O A;  3TS5 B;  1L7Z A;  1Y6W A;  2E6W A;  2JXC A;  1BT6 A;  5IBW A;  2LM5 A;  2JZI A;  1YR5 A;  2KI6 C;  2LMT A;  1EH2 A;  1AUI B;  1OMV A;  3BQ3 A;  2CCM A;  1BF5 A;  4PHJ A;  4CFQ A;  2F3Z A;  4I5J A;  1JBA A;  1NSH A;  2KNE A;  1S6C A;  1ZFS A;  2LLT A;  1MQ1 A;  2D8N A;  2MRD A;  4MRX A;  3A4U B;  2G2B A;  3I5I C;  4PHK A;  1QX7 A;  1K90 D;  1J7R A;  2JWW A;  3VRQ A;  3DF0 B;  5DKQ A;  1EJ3 A;  2WOS A;  4MEW A;  4ORB B;  3CR5 X;  1TCF A;  2V53 A;  2MJW B;  3PM8 A;  1CM4 A;  1LVC D;  4NDD A;  2KAX A;  3SJS A;  2HQW A;  2ISD A;  2LP3 A;  1YVL A;  2K7C A;  3LLE A;  4AQI A;  4ZCU A;  2JOJ A;  1F70 A;  1EG4 A;  2JT0 A;  1NPQ A;  3BYA A;  2F33 A;  3ICB A;  3SG6 A;  1K96 A;  2ZKM X;  5CPV A;  1A29 A;  2A4J A;  1SR6 B;  2Q91 A;  4A4B A;  1TCO B;  1IG5 A;  2M7N A;  1RJV A;  5I2L A;  4E68 A;  1CDM A;  2JTT A;  2I2R E;  1NWD A;  1DJG A;  1TTX A;  3I5H C;  2L2E A;  3SG2 A;  2LP2 A;  3WNX B;  4YI8 A;  1SR6 C;  3OP0 A;  4QJ5 B;  2KBI A;  5K89 A;  2L98 A;  1A03 A;  4FTG A;  3JTD B;  3NSI A;  1BLQ A;  4HSZ A;  1YRU B;  1F54 A;  1KSM A;  2BE6 A;  1L2O C;  3PN7 C;  1N2D A;  5KTY A;  3PFV A;  3EKJ A;  4FQO A;  2FJU B;  3BUW B;  3WHU B;  1HT9 A;  5GQQ C;  1QX5 B;  1TRF A;  1IH0 A;  1OMR A;  4M2P A;  4DIR A;  1PUL A;  1X02 A;  4GPL B;  1S3P A;  2L4I A;  1RRO A;  2BL0 B;  1WY9 A;  1QV0 A;  1N0Y A;  1CDL A;  1S26 D;  4I5N B;  1KFU S;  1Y0V H;  3F45 A;  2L50 A;  1CFC A;  1S36 A;  1UHN A;  1QIV A;  1KK7 Y;  4MN0 A;  1XVJ A;  1MHO A;  1A2X A;  1Y1X A;  2M9G A;  3DF0 A;  2LAP A;  2M29 A;  3GK1 A;  1JFK A;  2OS8 B;  1SBJ A;  3CLN A;  4USL A;  2KFH A;  1KFX S;  1SCM C;  2H61 C;  2PAS A;  4GBA A;  3CR4 X;  1V1F A;  2JUL A;  1J7P A;  1KFU L;  1WRZ A;  1R6P A;  2BBM A;  1KQM B;  2KFG A;  3CTN A;  5FYX A;  4YGE B;  4C0L A;  1F71 A;  2Y5I A;  2JNX A;  1WRK A;  2CBL A;  3EK4 A;  5CSI A;  2KDH A;  5TNC A;  1KSO A;  4N1F A;  2PVB A;  1DTL A;  3SG5 A;  1DJH A;  1YUU A;  1K9K A;  2KI4 B;  3JVT B;  1SPY A;  1KFX L;  2BEC A;  4DUQ A;  1NYA A;  2LLU A;  3DVJ A;  3RM1 A;  1KWO B;  1Q80 A;  2LHL A;  1K95 A;  4A4C A;  3SIB A;  3NSL A;  1H4B A;  5AAN A;  2KI4 C;  4NDC A;  1F8H A;  2BBN A;  2NCP A;  1FI6 A;  1CMF A;  3VRP A;  4UPG A;  3TDU A;  1MF8 B;  1TNW A;  4PDZ A;  1UHH A;  2DOQ A;  4TNC A;  1WDC C;  1XYD A;  2KAV A;  1YUR A;  1KWO C;  2KYC A;  3O6B A;  3VRN A;  2CXJ A;  3TUY B;  1B7T Y;  1W7J B;  5KSZ A;  3D10 A;  4GGF A;  1BU3 A;  2COL B;  3KF9 A;  1XFV O;  1G33 A;  4M2Q A;  5CSJ A;  1DJW A;  5J3X A;  2KSP A;  2M8U A;  3VRR A;  1PK0 D;  2K2A A;  1ZAC A;  1K94 A;  1PAL A;  5DKR A;  5HKY A;  1ODB A;  1QLS A;  1XFX O;  2CNP A;  1KQV A;  3TUY C;  1PVA A;  3NSO A;  1B8L A;  1XA5 A;  3I5I B;  3HCM A;  1B8C A;  4F0Z B;  4GNK B;  1NX2 A;  3O78 A;  1CDN A;  1NX3 A;  2MHH A;  2O60 A;  2ZNE A;  1OQP A;  4OR9 B;  1KK7 Z;  2CTN A;  2MLF C;  4XYN A;  1AP4 A;  1CNP A;  1J1D A;  4ETO A;  1TNP A;  2EHB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...