3TDIA

Yeast cul1whb-dcn1p acetylated ubc12n complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
202
structure length
202
Chain Sequence
GSVYPKELTQVFEHYINNNLFDIDSLVKFIEELGYNLEDLATLCLAHLLGYKKLEEPLKREDFLSTWFMQGCSTISDMQECIKTLDVKLHEDLQYFTQIYNYAFNLILDPNRKDIDTDEGIQYWKLFFQPEYPVRMEPDLLEAWFRFLRDEGKTTISKDTWRMLLLFFKRYPTIQKIISDYDETAAWPFIIDEFYECLQDQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/protein binding
molecule keywords Defective in cullin neddylation protein 1
publication title N-terminal acetylation acts as an avidity enhancer within an interconnected multiprotein complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 70
structure length 202
sequence length 202
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03556 Cullin_binding Cullin binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3tdiA01
4UPGA 5AXIA 3LLEA 5G08A 4YI8A 4HRGA 1AJ4A 1TNXA 2JQ6A 2LE9B 2ZRTA 1NYAA 2WCEA 1A03A 1M45A 1SNLA 1QASA 3NSKA 2L98A 2LVIA 2HQWA 2HETA 4YGCB 4CIDA 3GK2A 1WRLA 1XFWO 1LA3A 1F4OA 3BUXB 2L51A 1YUUA 2MJWB 3I5FB 3A4UB 4MEWA 3AAKA 4HSZA 4I5JA 1IJ5A 1LKJA 1BOCA 2M7LA 1S26D 5HLVA 4MN0A 2BKHB 4OKHA 1K93D 1DJIA 2JU0A 3I5IB 5FYXA 4MZJA 4WQ3A 2ZN8A 3OX6A 3BUNB 2F3YA 1J55A 2ZKMX 1G33A 4MBEA 4GFTA 2KFFA 4OR9B 2M3WA 1MR8A 4GPLB 4JPZB 2DOQA 2O60A 3PLFB 5IBWA 2JTZA 3HX4A 1TNPA 2TN4A 1F4QA 4NDCA 1TTXA 2Y5IA 4PDZA 2AMIA 1J7RA 3KF9A 2KGRA 4GBAA 1CM1A 1YVLA 2JNXA 2LLTA 2NXQA 1LVCD 1M46A 4XJKA 3F45A 3PFVA 5HLOA 3BOWB 1XFXO 1CMGA 1OZOA 2K7BA 3O2PA 4OV2A 3BXKA 1EXRA 1UP5A 1S6JA 1QX5B 3SG6A 1ZACA 5I2LA 2QPTA 1UHKA 2BCAA 1NX1A 2AUCA 1N0YA 2KAYA 2ZNDA 1J7OA 2F3ZA 1EL4A 2JXLA 2F33A 2LMTA 4PALA 1PSBA 2F2OA 2E30A 1U5IB 4MSPA 1R6PA 3WXAA 1S6IA 3ZWHA 1DJGA 2FCEA 3VRPA 3CS1A 1F71A 1PRWA 1AK8A 3TUYB 2NCOA 4F0ZB 1BLQA 1LXFC 3CR2A 3SG7A 1BU3A 1FI5A 1TNQA 2WORA 4JWQA 2L2EA 2CCMA 1GJYA 1DJXA 4HREE 1FBVA 1SR6C 4WQ2A 3O4YA 1EG4A 3EK8A 1KFXL 3BUOB 2LANA 1FPWA 1SY9A 1J1DA 1KWOB 3PN7B 2ZNEA 1DJHA 4YGDB 1CFDA 2LP3A 3VRRA 4ETOA 1JC2A 3SG3A 3CWGA 2LAPA 2WNDA 1FI6A 1IH0A 1CFFA 1K90D 1YUTA 5CSJA 1FF1A 1ZFSA 2PSRA 1CDPA 2WCBA 1SL8A 1UUSA 4PCWA 1G4YR 2B1UA 1F70A 1K2HA 4GGFC 2NLNA 3TS5B 1F54A 1TN4A 5KTYA 1NWDA 1XK4C 1CLBA 1LA0A 2MA2A 1UHIA 1M31A 2KYCA 1QIWA 2JNFA 2VRGA 4N1FA 5B8IB 3FWCA 3DVJA 4DUQA 1PALA 3ZNIA 1OQPA 1NCXA 2JULA 1JF0A 3NSOA 3OP0A 3RLZA 4CPVA 1CDNA 1B47A 4R1EA 1H8BA 2KI6D 1SRAA 4ORBB 1CLLA 2KFHA 1MXEA 3CGAA 4PHJA 1RECA 1CTRA 3TDIA 1KSMA 1XA5A 1R2UA 2GGZA 1CKKA 3BUWB 2ISDA 3EVRA 1N65A 2LHLA 1NIWA 1YR5A 1KSOA 2SASA 1AP4A 2EC6B 2LLUA 4C0JA 1IKUA 4DCKA 4AOMA 4MZKA 1BF5A 1CB1A 4MZLA 4YGAA 1S36A 4ZCVA 1M63B 1KFUS 2F8PA 1XFVO 4GAOA 4N5XA 2L4HA 5AFPA 2OS8B 3JVTB 1ALVA 1L2OB 1WLZA 2KDHA 3DF0A 4PHNA 1JWDA 2LVJA 3BQ3A 3C1VA 2K0JA 2L4IA 1QLKA 1BR4B 1ALWA 1MF8B 2JPTA 2KBMA 3OB1B 2KAVA 1MWNA 2BCBA 2PRUA 1SL7A 3VROA 2JXCA 1NX2A 1A4PA 2JT3A 1UWOA 1NSHA 3RM1A 3OB2B 3IQQA 2LCPA 3O78A 4XJKB 2BECA 3VRNA 4PE1A 2FOTA 2OPOA 4E68A 1BJFA 1PVAA 4YI9A 3TZ1A 2H2KA 1WDCB 2NCPA 3CR4X 3I5HC 5TNCA 4DRWA 5I2QA 5KSZA 3IF7A 1EH2A 1MHOA 2M8UA 5GQQC 1BG1A 1CFCA 3D10A 2KAXA 4USLA 4C0KA 1OE9B 4M2PA 1B8RA 2COLB 3K21A 1FW4A 1IJ6A 2KI6C 3JTDB 2LMVA 1S1EA 1NCYA 2KI4B 3EKHA 3LL8B 1TCFA 2JT8A 4MRYA 5AANA 3QRXA 3EK7A 1B9AA 4IL1A 4XYNA 2BL0C 1QX2A 4MLWA 4JQ0D 5I8NA 1C07A 1CFPA 2MHHA 3NSIA 1KK7Z 1K96A 2JT0A 2MLFC 3WHUB 1QLSA 2M7NA 5KU1A 2CNPA 1UHNA 4ZCUA 1QS7A 1JFJA 5CSIA 4QJ5B 4YBHB 2SCPA 2BBMA 4GGFA 1HT9A 5JOLA 1DF0A 4PHKA 4CFQA 5HKZA 3OHMB 3I5GC 4GNKB 2LHIA 1A2XA 1SCMB 4M2QA 1XK4A 2K8MB 2P6BB 4QJ3B 5PALA 1K94A 1SPYA 2K2FA 1DGVA 5DKNA 1KK8B 1DTLA 4NQGA 2KGBC 3SIAA 2GV5A 1DMOA 2KBIA 2BKIB 1CDMA 2K7DA 1OMVA 3TDZA 1XFZO 2JZIA 2KQ6A 2Y4QA 1F55A 3JVTC 1H4BA 1TRFA 2JRFA 4MVFA 2R2IA 3SIBA 4GUKA 3PALA 4DIRA 3WHTB 1OMDA 2A4JA 4WRIA 3I5FC 1A75A 1J1EA 1NPQA 1QVIZ 3BYAA 1NX3A 2E6WA 3EVUA 2CT9A 2KQYA 4ICBA 1MXLC 1YURA 1QV0A 2O5GA 2WCFA 3I5IC 4C0LA 1B8LA 2ZFDA 1DVIA 4BY4A 2AAOA 2K61A 1WDCC 2GGMA 3AAJA 2CTNA 1PVBA 1SW8A 1RK9A 2JC2A 4PHMA 1TNWA 1WLMA 2LC5A 1DT7B 3SG5A 2KOTA 4OCIA 4QJ4B 2BCXA 2ZN9A 3E3RA 2HPSA 3KHEA 2M1KB 3NXAA 4ORAB 4PE0A 4ORCB 1UURA 3JTDC 2M9GA 1UHHA 3DF0B 3VRQA 2LMUA 1XO5A 3FIAA 2D8NA 2LVKA 2OTGB 1OMRA 1QX7A 3SG4A 1S6CA 1Y1XA 3KEVA 3CR5X 2H61C 1JUOA 3HCMA 1K9PA 3CLNA 1MUXA 1PULA 2G2BA 2V53A 2EHBA 5HYDA 1AHRA 3D0YA 2MAZA 1YUSA 1C7WA 1CMFA 4AQJA 5BPJA 2MLEC 4MRXA 2KSPA 3KO0A 3CZTX 1N2DA 1SCVA 2Q91A 3GK4X 4CLNA 1SBJA 3TUYC 1K8UA 1YX8A 4GGNA 4NDDA 3EVVA 3CTNA 1ZUZA 1CNPA 2I7AA 5DKRA 4FTGA 2F2PA 1M39A 1WY9A 1SR6B 3H4SE 5D7FA 1EG3A 1DGUA 1KWOC 2JWWA 3AKAA 3PN7C 3TDUA 1TIZA 3GK1A 4YGEB 2MBXA 2BE6A 5JJGA 1DJWA 2FJUB 1ZOTB 3GOFA 1KFXS 1QATA 1ZMZA 1IQ3A 2Y1MA 3DVMA 2ZRSA 3MSEB 1EJ3A 1RFJA 4OVNF 1IRJA 1NX0A 4Q04A 4PE7A 2PVBA 2K2AA 2M1UA 1RWYA 2BBNA 1YRUB 2M97A 1CM4A 2KHNA 1L7ZA 2MRDA 3TS5C 1DF0B 1LINA 1Y0VH 3O6BA 3EK4A 5DKQA 4P2YB 1RJVA 3KPXA 1WRZA 1Q80A 1SK6D 4DS7A 2IS9A 2I2RE 1AVSA 4YRUA 3M0WA 2L50A 2WC8A 5F6TA 5CSNA 2LP2A 1QIVA 3WNXB 2K7CA 1MQ1A 2KYFA 2I18A 1D1OA 2LUXA 1RROA 1Y1AA 3PATA 2OTGC 3LK1A 3AKBA 1GGZA 3LK0A 1KQMB 1IQ5A 1KK7Y 1XYDA 1F8HA 1A29A 3BUMB 5CSFA 1J7PA 5AEQA 1NUBA 1A75B 1B8CA 1AJ5A 1JBAA 4BY5A 1SL9A 1W7JB 2QACA 3ICBA 1CDLA 1YX7A 2EC6C 4I5NB 4U8DA 4A4CA 3FS7A 5D69A 1KFUL 4HRHA 4A4BA 2CXJA 3FWBA 5I2OA 2JTTA 1B4CA 5ER5A 2KFGA 1S3PA 4TNCA 4P5OE 3DVKA 4N1GA 2OS8C 1ODBA 1L2OC 2LM5A 2LVVA 1JFKA 1BMOA 1VRKA 2I94A 3PSRA 2Y1NA 1X02A 3A8RA 2EGDA 5HKYA 1QXPA 4I5KA 5HKWA 1IG5A 2KNEA 5K89A 1SKTA 2H61A 3BOWA 2HQ8A 1GQMA 1B7TZ 1E8AA 1TCOB 1XFYO 2M29A 4I5LB 1YRTB 4NDBA 2K7OA 3LCPC 3EKJA 1S5GZ 2FCDA 2LNKA 1KQVA 1K9UA 1WRKA 1IGVA 2WOSA 1SMGA 3I5HB 1DJZA 3OX5A 1OZSA 1OSAA 1TOPA 1BR1B 1DJYA 2LLSA 2PALA 3IQOA 4FQOA 1K9KA 1QVIY 2M49B 1U5IA 2PASA 1B7TY 3D0YB 3SJSA 2M0RA 4D1EA 1BODA 2CBLA 2HF5A 1XFUO 1BT6A 3SG2A 1S5GY 1Y6WA 5CPVA 2G9BA 2KI4C 1K95A 1CLMA 1OOJA 4CFRA 4AQIA 1J7QA 1JF2A 3DVEA 2BE4A 4PE4A 1UHJA 3VGOA 3NSLA 1GGWA 2BL0B 1HQVA 2LV7A 2RGIA 3PM8A 1YTZC 2NZ0A 1PK0D 1KCYA 1YVHA 1RTP1 1W7IB 1QV1A 4YGBB 1Y1UA 1QJTA 2L5XB 1NCZA 1NP8A 4M2OA 1V1GA 2PMYA 1JSAA 4L9MA 2LUCA 2Q4UA 1KQMC 5J3XA 1B1GA 1C7VA 1SYMA 1PSRA 1AUIB 1QTXA 1XVJA 3I5GB 1SCMC 5ER4X 3DD4A 5AERA 1G8IA 1IWQA 2JOJA 1V1FA 1KK8C 2L0PA
chains in the Genus database with same CATH superfamily
4UPGA 5AXIA 3LLEA 5G08A 4YI8A 4HRGA 1AJ4A 1TNXA 2JQ6A 2LE9B 2ZRTA 4INXA 1NYAA 2WCEA 1A03A 1M45A 1SNLA 1QASA 3NSKA 2L98A 2LVIA 3PM2A 2HQWA 3CZ2A 2HETA 4YGCB 4CIDA 3GK2A 1WRLA 1XFWO 1LA3A 1F4OA 3BUXB 2L51A 1YUUA 2MJWB 3I5FB 3A4UB 4MEWA 3AAKA 4HSZA 4I5JA 1IJ5A 1LKJA 1BOCA 2M7LA 1S26D 5HLVA 2PQLA 2BKHB 4MN0A 4OKHA 1K93D 1DJIA 2JU0A 3I5IB 5FYXA 4MZJA 4WQ3A 3DYEA 2ZN8A 3OX6A 3BUNB 2F3YA 1J55A 2ZKMX 4JKTA 1G33A 4MBEA 4GFTA 2KFFA 3D78A 3OBVA 4OR9B 2M3WA 3L4AA 1MR8A 3CZ0A 4GPLB 4JPZB 2DOQA 2O60A 3PLFB 5IBWA 2JTZA 3HX4A 1TNPA 2TN4A 1OW4A 1F4QA 4NDCA 1TTXA 2Y5IA 4PDZA 2AMIA 1J7RA 3KF9A 2KGRA 4GBAA 1CM1A 1YVLA 2JNXA 2LLTA 2NXQA 1LVCD 1M46A 4XJKA 3F45A 3PFVA 1Z2CB 5HLOA 3BOWB 1XFXO 1CMGA 1OZOA 2K7BA 3O2PA 4OV2A 3BXKA 1EXRA 1UP5A 1S6JA 1QX5B 3SG6A 1ZACA 1OOGA 5I2LA 2QPTA 1UHKA 2BCAA 1NX1A 2AUCA 1N0YA 4FQTA 2KAYA 2ZNDA 3D76A 2F3ZA 1EL4A 2JXLA 2F33A 1J7OA 3BJHA 2LMTA 2WCKA 4PALA 1PSBA 2F2OA 2E30A 1U5IB 4MSPA 1R6PA 3WXAA 1S6IA 3ZWHA 1DJGA 2FCEA 3VRPA 3CS1A 1F71A 1PRWA 1AK8A 5HL1A 3QMEA 2NCOA 3CDNA 3TUYB 1LXFC 3CR2A 3SG7A 1BU3A 4F0ZB 1BLQA 2QEHA 3B87A 1OOHA 1TNQA 2WORA 4JWQA 1FI5A 1TUJA 2L2EA 2CCMA 1GJYA 1DJXA 4HREE 1FBVA 1SR6C 4WQ2A 3O4YA 1EG4A 3EK8A 1KFXL 3BUOB 2LANA 1FPWA 1SY9A 1J1DA 1KWOB 3PN7B 2ZNEA 1DJHA 4YGDB 1CFDA 2LP3A 3K1EA 3VRRA 4ETOA 1JC2A 3SG3A 3CWGA 1OOIX 2LAPA 2WNDA 3UNWA 1FI6A 3D75A 1CFFA 1IH0A 1K90D 1QWVA 1YUTA 5CSJA 1FF1A 1ZFSA 3EG5B 3BFBA 2PSRA 1CDPA 2WCBA 4IJ7A 1SL8A 1UUSA 3BFAA 4PCWA 3SS4A 1G4YR 2B1UA 1F70A 1K2HA 4GGFC 2NLNA 3TS5B 1F54A 3CABA 3R72A 1TN4A 2L5YA 5KTYA 1NWDA 1XK4C 3Q8IA 1LA0A 1CLBA 1W9ZA 2L2CA 2MA2A 5FI2A 3IVTA 1UHIA 1M31A 2KYCA 3FE6A 1QIWA 3S0EA 2JNFA 3SS5A 2VRGA 4N1FA 5B8IB 1DQEA 3FWCA 3DVJA 4DUQA 1T14A 1PALA 3ZNIA 1OQPA 1NCXA 2JULA 1JF0A 3NSOA 3OP0A 3RLZA 4CPVA 1CDNA 1B47A 4R1EA 1H8BA 2KI6D 1SRAA 4ORBB 1CLLA 2KFHA 1MXEA 1Z4HA 3CGAA 4PHJA 1RECA 3S0GA 1CTRA 3TDIA 1KSMA 1XA5A 1R2UA 2GGZA 1CKKA 3BUWB 2ISDA 3EVRA 1N65A 2LHLA 1NIWA 1YR5A 1KSOA 2SASA 2KLEA 2EC6B 3D73A 3L4LA 4PT1A 2WC6A 2LLUA 4C0JA 1IKUA 4DCKA 4AOMA 4MZKA 1BF5A 1CB1A 4MZLA 4YGAA 1S36A 4ZCVA 1M63B 1KFUS 2F8PA 1XFVO 4GAOA 4N5XA 2L4HA 5AFPA 2OS8B 3JVTB 1ALVA 1L2OB 1WLZA 2KDHA 3DF0A 4PHNA 1JWDA 2LVJA 3BQ3A 3C1VA 2K0JA 2L4IA 1DC1A 1QLKA 1BR4B 1ALWA 1MF8B 2JPTA 2KBMA 3OB1B 3V2LA 2KAVA 1MWNA 2BCBA 2PRUA 1SL7A 1TUZA 3VROA 2JXCA 1NX2A 1A4PA 2JT3A 1UWOA 1NSHA 3RM1A 3DXLA 3IQQA 2LCPA 3O78A 3OB2B 2BECA 4XJKB 3S0DA 4PE1A 2FOTA 2OPOA 4E68A 1BJFA 1PVAA 2FJYA 4YI9A 3TZ1A 1DELA 2H2KA 1WDCB 2NCPA 3CR4X 3I5HC 5TNCA 4DRWA 5I2QA 3FE9A 1SSEB 3IF7A 5KSZA 1EH2A 1MHOA 2M8UA 5GQQC 1BG1A 1CFCA 3D10A 2KAXA 4USLA 4C0KA 1OE9B 4M2PA 1B8RA 2COLB 3K21A 1FW4A 1IJ6A 2KI6C 3JTDB 2LMVA 1S1EA 1NCYA 3UO9A 2KI4B 3EKHA 3LL8B 1TCFA 2JT8A 4MRYA 5AANA 3QRXA 3EK7A 1B9AA 4IL1A 4XYNA 2BL0C 1QX2A 4MLWA 4JQ0D 5I8NA 1C07A 1CFPA 2MHHA 3NSIA 1KK7Z 3DZTA 1K96A 2JT0A 2MLFC 3WHUB 1QLSA 2M7NA 5KU1A 2KPHA 2CNPA 1UHNA 4ZCUA 1QS7A 1JFJA 5CSIA 3FE8A 2PYQA 4YBHB 4QJ5B 2SCPA 2BBMA 4GGFA 1HT9A 5JOLA 1DF0A 4PHKA 4CFQA 2BNXA 5HKZA 3OHMB 3I5GC 4GNKB 2LHIA 1A2XA 5D3OA 1SCMB 4M2QA 1XK4A 2K8MB 2P6BB 4KYNA 4QJ3B 5PALA 5FI7A 1K94A 1SPYA 2K2FA 1DGVA 2WCLA 5DKNA 1KK8B 1DTLA 4NQGA 2KGBC 3SIAA 2GV5A 1DMOA 2KBIA 2BKIB 3S0AA 1CDMA 4OZDA 2K7DA 1OMVA 3TDZA 1XFZO 2JZIA 2KQ6A 2Y4QA 1F55A 3JVTC 1H4BA 1TRFA 2QEBA 1OOFA 2JRFA 4MVFA 2R2IA 3SIBA 4GUKA 3PALA 4DIRA 3WHTB 1OMDA 2A4JA 4WRIA 3I5FC 1A75A 1J1EA 1NPQA 1QVIZ 3BYAA 1NX3A 2E6WA 3EVUA 2CT9A 3SS3A 2KQYA 4ICBA 2YGUA 1MXLC 1YURA 1QV0A 2BAPA 2O5GA 2WCFA 3I5IC 4C0LA 1B8LA 2ZFDA 1DVIA 4BY4A 2AAOA 2K61A 1WDCC 2GGMA 3AAJA 2CTNA 1PVBA 1SW8A 1RK9A 2JC2A 4PHMA 1TNWA 1WLMA 2LC5A 1DT7B 3SG5A 2KOTA 3NHTA 4OCIA 4QJ4B 2BCXA 2ZN9A 4INWA 3E3RA 2HPSA 3KHEA 2M1KB 3NXAA 4ORAB 4PE0A 4ORCB 1UURA 3JTDC 2P70A 2M9GA 1UHHA 3DF0B 3VRQA 2LMUA 1XO5A 3FIAA 2D8NA 2LVKA 2OTGB 2WCJA 1OMRA 1QX7A 3SG4A 1S6CA 3NHIA 1Y1XA 3KEVA 3CR5X 2H61C 1JUOA 3HCMA 1K9PA 3CLNA 3DY9A 1MUXA 2QEVA 1PULA 2G2BA 2V53A 2EHBA 5HYDA 1AHRA 1GM0A 3D0YA 2MAZA 1YUSA 2H8VA 1C3ZA 1C7WA 1CMFA 4AQJA 5BPJA 2MLEC 4JD9A 4MRXA 2KSPA 3KO0A 3NGVA 3CZTX 1N2DA 1SCVA 2Q91A 3GK4X 4CLNA 1SBJA 3TUYC 1K8UA 1YX8A 4GGNA 4NDDA 3EVVA 3CTNA 1ZUZA 1CNPA 2I7AA 5DKRA 4FTGA 2F2PA 1M39A 1WY9A 2GTEA 1SR6B 2WCMA 3H4SE 5D7FA 1EG3A 1DGUA 1KWOC 2JWWA 3AKAA 3PN7C 3TDUA 1AP4A 1TIZA 3GK1A 4YGEB 2MBXA 2BE6A 5JJGA 1DJWA 2FJUB 1ZOTB 3B88A 3GOFA 1KFXS 1QATA 1ZMZA 2P71A 1IQ3A 2Y1MA 3DVMA 2ZRSA 3MSEB 1EJ3A 3O4XA 1RFJA 4OVNF 1IRJA 1NX0A 4F7FA 4Q04A 3BFHA 2PVBA 2K2AA 2M1UA 4PE7A 1RWYA 2BBNA 1YRUB 2M97A 1CM4A 2KHNA 1L7ZA 2MRDA 1ORGA 2WCHA 3TS5C 1DF0B 1LINA 1Y0VH 3O6BA 3EK4A 5DKQA 3CZ1A 4P2YB 1RJVA 3KPXA 1WRZA 1Q80A 1SK6D 3VRNA 4DS7A 3RZSA 2IS9A 2I2RE 1AVSA 3VB1A 4YRUA 3M0WA 2L50A 1TWOA 2WC8A 5F6TA 5CSNA 2LP2A 1QIVA 3WNXB 2K7CA 1MQ1A 3D77A 2KYFA 2I18A 5EL2A 2LUXA 1D1OA 1RROA 1Y1AA 3PATA 2OTGC 3LK1A 2ERBA 3AKBA 1GGZA 3LK0A 2K60A 1KQMB 1IQ5A 1KK7Y 1XYDA 1F8HA 1A29A 3BUMB 5CSFA 1J7PA 5FI6A 5AEQA 1NUBA 3OGNA 1A75B 1B8CA 1AJ5A 1JBAA 4BY5A 3R1OA 1SL9A 1W7JB 2QACA 3ICBA 1CDLA 1YX7A 2EC6C 4I5NB 4U8DA 4A4CA 3FS7A 1LS8A 5D69A 1KFUL 4HRHA 4A4BA 2CXJA 3FWBA 5I2OA 2JTTA 5I94A 1B4CA 5ER5A 2KFGA 1S3PA 3B7AA 4TNCA 4P5OE 3DVKA 4N1GA 2OS8C 1ODBA 1L2OC 2LM5A 2LVVA 1JFKA 1BMOA 1VRKA 2I94A 3PSRA 2Y1NA 1X02A 3A8RA 2EGDA 5HKYA 1QXPA 4I5KA 5HKWA 1IG5A 2KNEA 5K89A 1SKTA 2H61A 3BOWA 2HQ8A 1GQMA 3N7HA 1B7TZ 1E8AA 3CYZA 1TCOB 1XFYO 5DICA 3B6XA 1IIOA 2M29A 4I5LB 1YRTB 4NDBA 2K7OA 3LCPC 3EKJA 1S5GZ 2FCDA 2LNKA 1KQVA 1K9UA 1WRKA 1IGVA 2WOSA 1SMGA 3I5HB 1DJZA 3OX5A 1OZSA 1OSAA 1TOPA 1BR1B 1DJYA 2LLSA 2PALA 3IQOA 4FQOA 1K9KA 1QVIY 2KLDA 1U5IA 2M49B 2PASA 1B7TY 3D0YB 3SJSA 2M0RA 4D1EA 1BODA 2CBLA 1XFRA 1P28A 2HF5A 1XFUO 1BT6A 3SG2A 1S5GY 1Y6WA 5CPVA 2WC5A 3PJIA 2G9BA 3D74A 2KI4C 3R1VA 1K95A 1CLMA 3S0FA 1OOJA 4CFRA 4AQIA 1J7QA 1JF2A 3DVEA 2BE4A 2JPOA 1UHJA 4PE4A 3NSLA 3VGOA 2BL0B 1DEKA 1HQVA 2LV7A 2QDIA 2RGIA 3L47A 1GGWA 3PM8A 1YTZC 2NZ0A 1PK0D 1KCYA 2QEOA 3S0BA 1YVHA 1RTP1 1W7IB 1QV1A 1C3YA 4YGBB 1Y1UA 1QJTA 2L5XB 1NCZA 1NP8A 4M2OA 1V1GA 2PMYA 1JSAA 4L9MA 2LUCA 2Q4UA 1KQMC 3R1PA 5J3XA 1B1GA 1C7VA 1SYMA 1PSRA 1AUIB 1QTXA 1XVJA 3I5GB 1SCMC 5ER4X 3B86A 3DD4A 5AERA 1G8IA 1IWQA 2JOJA 1V1FA 1KK8C 2L0PA
chains in the Genus database with same CATH topology
4UPGA 5AXIA 3LLEA 5G08A 4YI8A 4HRGA 1AJ4A 1TNXA 2JQ6A 2LE9B 2ZRTA 1NYAA 2WCEA 1A03A 1M45A 1SNLA 1QASA 3NSKA 2L98A 2LVIA 2HQWA 2HETA 4YGCB 4CIDA 3GK2A 1WRLA 1XFWO 1LA3A 1F4OA 3BUXB 2L51A 1YUUA 2MJWB 3I5FB 3A4UB 4MEWA 3AAKA 4HSZA 4I5JA 1IJ5A 1LKJA 1BOCA 2M7LA 1S26D 5HLVA 4MN0A 2BKHB 4OKHA 1K93D 1DJIA 2JU0A 3I5IB 5FYXA 4MZJA 4WQ3A 2ZN8A 3OX6A 3BUNB 2F3YA 1J55A 2ZKMX 1G33A 4MBEA 4GFTA 2KFFA 4OR9B 2M3WA 1MR8A 4GPLB 4JPZB 2DOQA 2O60A 3PLFB 5IBWA 2JTZA 3HX4A 1TNPA 2TN4A 1F4QA 4NDCA 1TTXA 2Y5IA 4PDZA 2AMIA 1J7RA 3KF9A 2KGRA 4GBAA 1CM1A 1YVLA 2JNXA 2LLTA 2NXQA 1LVCD 1M46A 4XJKA 3F45A 3PFVA 5HLOA 3BOWB 1XFXO 1CMGA 1OZOA 2K7BA 3O2PA 4OV2A 3BXKA 1EXRA 1UP5A 1S6JA 1QX5B 3SG6A 1ZACA 5I2LA 2QPTA 1UHKA 2BCAA 1NX1A 2AUCA 1N0YA 2KAYA 2ZNDA 1J7OA 2F3ZA 1EL4A 2JXLA 2F33A 2LMTA 4PALA 1PSBA 2F2OA 2E30A 1U5IB 4MSPA 1R6PA 3WXAA 1S6IA 3ZWHA 1DJGA 2FCEA 3VRPA 3CS1A 1F71A 1PRWA 1AK8A 3TUYB 2NCOA 4F0ZB 1BLQA 1LXFC 3CR2A 3SG7A 1BU3A 1FI5A 1TNQA 2WORA 4JWQA 2L2EA 2CCMA 1GJYA 1DJXA 4HREE 1FBVA 1SR6C 4WQ2A 3O4YA 1EG4A 3EK8A 1KFXL 3BUOB 2LANA 1FPWA 1SY9A 1J1DA 1KWOB 3PN7B 2ZNEA 1DJHA 4YGDB 1CFDA 2LP3A 3VRRA 4ETOA 1JC2A 3SG3A 3CWGA 2LAPA 2WNDA 1FI6A 1IH0A 1CFFA 1K90D 1YUTA 5CSJA 1FF1A 1ZFSA 2PSRA 1CDPA 2WCBA 1SL8A 1UUSA 4PCWA 1G4YR 2B1UA 1F70A 1K2HA 4GGFC 2NLNA 3TS5B 1F54A 1TN4A 5KTYA 1NWDA 1XK4C 1CLBA 1LA0A 2MA2A 1UHIA 1M31A 2KYCA 1QIWA 2JNFA 2VRGA 4N1FA 5B8IB 3FWCA 3DVJA 4DUQA 1PALA 3ZNIA 1OQPA 1NCXA 2JULA 1JF0A 3NSOA 3OP0A 3RLZA 4CPVA 1CDNA 1B47A 4R1EA 1H8BA 2KI6D 1SRAA 4ORBB 1CLLA 2KFHA 1MXEA 3CGAA 4PHJA 1RECA 1CTRA 3TDIA 1KSMA 1XA5A 1R2UA 2GGZA 1CKKA 3BUWB 2ISDA 3EVRA 1N65A 2LHLA 1NIWA 1YR5A 1KSOA 2SASA 1AP4A 2EC6B 2LLUA 4C0JA 1IKUA 4DCKA 4AOMA 4MZKA 1BF5A 1CB1A 4MZLA 4YGAA 1S36A 4ZCVA 1M63B 1KFUS 2F8PA 1XFVO 4GAOA 4N5XA 2L4HA 5AFPA 2OS8B 3JVTB 1ALVA 1L2OB 1WLZA 2KDHA 3DF0A 4PHNA 1JWDA 2LVJA 3BQ3A 3C1VA 2K0JA 2L4IA 1QLKA 1BR4B 1ALWA 1MF8B 2JPTA 2KBMA 3OB1B 2KAVA 1MWNA 2BCBA 2PRUA 1SL7A 3VROA 2JXCA 1NX2A 1A4PA 2JT3A 1UWOA 1NSHA 3RM1A 3OB2B 3IQQA 2LCPA 3O78A 4XJKB 2BECA 3VRNA 4PE1A 2FOTA 2OPOA 4E68A 1BJFA 1PVAA 4YI9A 3TZ1A 2H2KA 1WDCB 2NCPA 3CR4X 3I5HC 5TNCA 4DRWA 5I2QA 5KSZA 3IF7A 1EH2A 1MHOA 2M8UA 5GQQC 1BG1A 1CFCA 3D10A 2KAXA 4USLA 4C0KA 1OE9B 4M2PA 1B8RA 2COLB 3K21A 1FW4A 1IJ6A 2KI6C 3JTDB 2LMVA 1S1EA 1NCYA 2KI4B 3EKHA 3LL8B 1TCFA 2JT8A 4MRYA 5AANA 3QRXA 3EK7A 1B9AA 4IL1A 4XYNA 2BL0C 1QX2A 4MLWA 4JQ0D 5I8NA 1C07A 1CFPA 2MHHA 3NSIA 1KK7Z 1K96A 2JT0A 2MLFC 3WHUB 1QLSA 2M7NA 5KU1A 2CNPA 1UHNA 4ZCUA 1QS7A 1JFJA 5CSIA 4QJ5B 4YBHB 2SCPA 2BBMA 4GGFA 1HT9A 5JOLA 1DF0A 4PHKA 4CFQA 5HKZA 3OHMB 3I5GC 4GNKB 2LHIA 1A2XA 1SCMB 4M2QA 1XK4A 2K8MB 2P6BB 4QJ3B 5PALA 1K94A 1SPYA 2K2FA 1DGVA 5DKNA 1KK8B 1DTLA 4NQGA 2KGBC 3SIAA 2GV5A 1DMOA 2KBIA 2BKIB 1CDMA 2K7DA 1OMVA 3TDZA 1XFZO 2JZIA 2KQ6A 2Y4QA 1F55A 3JVTC 1H4BA 1TRFA 2JRFA 4MVFA 2R2IA 3SIBA 4GUKA 3PALA 4DIRA 3WHTB 1OMDA 2A4JA 4WRIA 3I5FC 1A75A 1J1EA 1NPQA 1QVIZ 3BYAA 1NX3A 2E6WA 3EVUA 2CT9A 2KQYA 4ICBA 1MXLC 1YURA 1QV0A 2O5GA 2WCFA 3I5IC 4C0LA 1B8LA 2ZFDA 1DVIA 4BY4A 2AAOA 2K61A 1WDCC 2GGMA 3AAJA 2CTNA 1PVBA 1SW8A 1RK9A 2JC2A 4PHMA 1TNWA 1WLMA 2LC5A 1DT7B 3SG5A 2KOTA 4OCIA 4QJ4B 2BCXA 2ZN9A 3E3RA 2HPSA 3KHEA 2M1KB 3NXAA 4ORAB 4PE0A 4ORCB 1UURA 3JTDC 2M9GA 1UHHA 3DF0B 3VRQA 2LMUA 1XO5A 3FIAA 2D8NA 2LVKA 2OTGB 1OMRA 1QX7A 3SG4A 1S6CA 1Y1XA 3KEVA 3CR5X 2H61C 1JUOA 3HCMA 1K9PA 3CLNA 1MUXA 1PULA 2G2BA 2V53A 2EHBA 5HYDA 1AHRA 3D0YA 2MAZA 1YUSA 1C7WA 1CMFA 4AQJA 5BPJA 2MLEC 4MRXA 2KSPA 3KO0A 3CZTX 1N2DA 1SCVA 2Q91A 3GK4X 4CLNA 1SBJA 3TUYC 1K8UA 1YX8A 4GGNA 4NDDA 3EVVA 3CTNA 1ZUZA 1CNPA 2I7AA 5DKRA 4FTGA 2F2PA 1M39A 1WY9A 1SR6B 3H4SE 5D7FA 1EG3A 1DGUA 1KWOC 2JWWA 3AKAA 3PN7C 3TDUA 1TIZA 3GK1A 4YGEB 2MBXA 2BE6A 5JJGA 1DJWA 2FJUB 1ZOTB 3GOFA 1KFXS 1QATA 1ZMZA 1IQ3A 2Y1MA 3DVMA 2ZRSA 3MSEB 1EJ3A 1RFJA 4OVNF 1IRJA 1NX0A 4Q04A 4PE7A 2PVBA 2K2AA 2M1UA 1RWYA 2BBNA 1YRUB 2M97A 1CM4A 2KHNA 1L7ZA 2MRDA 3TS5C 1DF0B 1LINA 1Y0VH 3O6BA 3EK4A 5DKQA 4P2YB 1RJVA 3KPXA 1WRZA 1Q80A 1SK6D 4DS7A 2IS9A 2I2RE 1AVSA 4YRUA 3M0WA 2L50A 2WC8A 5F6TA 5CSNA 2LP2A 1QIVA 3WNXB 2K7CA 1MQ1A 2KYFA 2I18A 1D1OA 2LUXA 1RROA 1Y1AA 3PATA 2OTGC 3LK1A 3AKBA 1GGZA 3LK0A 1KQMB 1IQ5A 1KK7Y 1XYDA 1F8HA 1A29A 3BUMB 5CSFA 1J7PA 5AEQA 1NUBA 1A75B 1B8CA 1AJ5A 1JBAA 4BY5A 1SL9A 1W7JB 2QACA 3ICBA 1CDLA 1YX7A 2EC6C 4I5NB 4U8DA 4A4CA 3FS7A 5D69A 1KFUL 4HRHA 4A4BA 2CXJA 3FWBA 5I2OA 2JTTA 1B4CA 5ER5A 2KFGA 1S3PA 4TNCA 4P5OE 3DVKA 4N1GA 2OS8C 1ODBA 1L2OC 2LM5A 2LVVA 1JFKA 1BMOA 1VRKA 2I94A 3PSRA 2Y1NA 1X02A 3A8RA 2EGDA 5HKYA 1QXPA 4I5KA 5HKWA 1IG5A 2KNEA 5K89A 1SKTA 2H61A 3BOWA 2HQ8A 1GQMA 1B7TZ 1E8AA 1TCOB 1XFYO 2M29A 4I5LB 1YRTB 4NDBA 2K7OA 3LCPC 3EKJA 1S5GZ 2FCDA 2LNKA 1KQVA 1K9UA 1WRKA 1IGVA 2WOSA 1SMGA 3I5HB 1DJZA 3OX5A 1OZSA 1OSAA 1TOPA 1BR1B 1DJYA 2LLSA 2PALA 3IQOA 4FQOA 1K9KA 1QVIY 2M49B 1U5IA 2PASA 1B7TY 3D0YB 3SJSA 2M0RA 4D1EA 1BODA 2CBLA 2HF5A 1XFUO 1BT6A 3SG2A 1S5GY 1Y6WA 5CPVA 2G9BA 2KI4C 1K95A 1CLMA 1OOJA 4CFRA 4AQIA 1J7QA 1JF2A 3DVEA 2BE4A 4PE4A 1UHJA 3VGOA 3NSLA 1GGWA 2BL0B 1HQVA 2LV7A 2RGIA 3PM8A 1YTZC 2NZ0A 1PK0D 1KCYA 1YVHA 1RTP1 1W7IB 1QV1A 4YGBB 1Y1UA 1QJTA 2L5XB 1NCZA 1NP8A 4M2OA 1V1GA 2PMYA 1JSAA 4L9MA 2LUCA 2Q4UA 1KQMC 5J3XA 1B1GA 1C7VA 1SYMA 1PSRA 1AUIB 1QTXA 1XVJA 3I5GB 1SCMC 5ER4X 3DD4A 5AERA 1G8IA 1IWQA 2JOJA 1V1FA 1KK8C 2L0PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UPG A;  5AXI A;  3LLE A;  5G08 A;  4YI8 A;  4HRG A;  1AJ4 A;  1TNX A;  2JQ6 A;  2LE9 B;  2ZRT A;  1NYA A;  2WCE A;  1A03 A;  1M45 A;  1SNL A;  1QAS A;  3NSK A;  2L98 A;  2LVI A;  2HQW A;  2HET A;  4YGC B;  4CID A;  3GK2 A;  1WRL A;  1XFW O;  1LA3 A;  1F4O A;  3BUX B;  2L51 A;  1YUU A;  2MJW B;  3I5F B;  3A4U B;  4MEW A;  3AAK A;  4HSZ A;  4I5J A;  1IJ5 A;  1LKJ A;  1BOC A;  2M7L A;  1S26 D;  5HLV A;  4MN0 A;  2BKH B;  4OKH A;  1K93 D;  1DJI A;  2JU0 A;  3I5I B;  5FYX A;  4MZJ A;  4WQ3 A;  2ZN8 A;  3OX6 A;  3BUN B;  2F3Y A;  1J55 A;  2ZKM X;  1G33 A;  4MBE A;  4GFT A;  2KFF A;  4OR9 B;  2M3W A;  1MR8 A;  4GPL B;  4JPZ B;  2DOQ A;  2O60 A;  3PLF B;  5IBW A;  2JTZ A;  3HX4 A;  1TNP A;  2TN4 A;  1F4Q A;  4NDC A;  1TTX A;  2Y5I A;  4PDZ A;  2AMI A;  1J7R A;  3KF9 A;  2KGR A;  4GBA A;  1CM1 A;  1YVL A;  2JNX A;  2LLT A;  2NXQ A;  1LVC D;  1M46 A;  4XJK A;  3F45 A;  3PFV A;  5HLO A;  3BOW B;  1XFX O;  1CMG A;  1OZO A;  2K7B A;  3O2P A;  4OV2 A;  3BXK A;  1EXR A;  1UP5 A;  1S6J A;  1QX5 B;  3SG6 A;  1ZAC A;  5I2L A;  2QPT A;  1UHK A;  2BCA A;  1NX1 A;  2AUC A;  1N0Y A;  2KAY A;  2ZND A;  1J7O A;  2F3Z A;  1EL4 A;  2JXL A;  2F33 A;  2LMT A;  4PAL A;  1PSB A;  2F2O A;  2E30 A;  1U5I B;  4MSP A;  1R6P A;  3WXA A;  1S6I A;  3ZWH A;  1DJG A;  2FCE A;  3VRP A;  3CS1 A;  1F71 A;  1PRW A;  1AK8 A;  3TUY B;  2NCO A;  4F0Z B;  1BLQ A;  1LXF C;  3CR2 A;  3SG7 A;  1BU3 A;  1FI5 A;  1TNQ A;  2WOR A;  4JWQ A;  2L2E A;  2CCM A;  1GJY A;  1DJX A;  4HRE E;  1FBV A;  1SR6 C;  4WQ2 A;  3O4Y A;  1EG4 A;  3EK8 A;  1KFX L;  3BUO B;  2LAN A;  1FPW A;  1SY9 A;  1J1D A;  1KWO B;  3PN7 B;  2ZNE A;  1DJH A;  4YGD B;  1CFD A;  2LP3 A;  3VRR A;  4ETO A;  1JC2 A;  3SG3 A;  3CWG A;  2LAP A;  2WND A;  1FI6 A;  1IH0 A;  1CFF A;  1K90 D;  1YUT A;  5CSJ A;  1FF1 A;  1ZFS A;  2PSR A;  1CDP A;  2WCB A;  1SL8 A;  1UUS A;  4PCW A;  1G4Y R;  2B1U A;  1F70 A;  1K2H A;  4GGF C;  2NLN A;  3TS5 B;  1F54 A;  1TN4 A;  5KTY A;  1NWD A;  1XK4 C;  1CLB A;  1LA0 A;  2MA2 A;  1UHI A;  1M31 A;  2KYC A;  1QIW A;  2JNF A;  2VRG A;  4N1F A;  5B8I B;  3FWC A;  3DVJ A;  4DUQ A;  1PAL A;  3ZNI A;  1OQP A;  1NCX A;  2JUL A;  1JF0 A;  3NSO A;  3OP0 A;  3RLZ A;  4CPV A;  1CDN A;  1B47 A;  4R1E A;  1H8B A;  2KI6 D;  1SRA A;  4ORB B;  1CLL A;  2KFH A;  1MXE A;  3CGA A;  4PHJ A;  1REC A;  1CTR A;  3TDI A;  1KSM A;  1XA5 A;  1R2U A;  2GGZ A;  1CKK A;  3BUW B;  2ISD A;  3EVR A;  1N65 A;  2LHL A;  1NIW A;  1YR5 A;  1KSO A;  2SAS A;  1AP4 A;  2EC6 B;  2LLU A;  4C0J A;  1IKU A;  4DCK A;  4AOM A;  4MZK A;  1BF5 A;  1CB1 A;  4MZL A;  4YGA A;  1S36 A;  4ZCV A;  1M63 B;  1KFU S;  2F8P A;  1XFV O;  4GAO A;  4N5X A;  2L4H A;  5AFP A;  2OS8 B;  3JVT B;  1ALV A;  1L2O B;  1WLZ A;  2KDH A;  3DF0 A;  4PHN A;  1JWD A;  2LVJ A;  3BQ3 A;  3C1V A;  2K0J A;  2L4I A;  1QLK A;  1BR4 B;  1ALW A;  1MF8 B;  2JPT A;  2KBM A;  3OB1 B;  2KAV A;  1MWN A;  2BCB A;  2PRU A;  1SL7 A;  3VRO A;  2JXC A;  1NX2 A;  1A4P A;  2JT3 A;  1UWO A;  1NSH A;  3RM1 A;  3OB2 B;  3IQQ A;  2LCP A;  3O78 A;  4XJK B;  2BEC A;  3VRN A;  4PE1 A;  2FOT A;  2OPO A;  4E68 A;  1BJF A;  1PVA A;  4YI9 A;  3TZ1 A;  2H2K A;  1WDC B;  2NCP A;  3CR4 X;  3I5H C;  5TNC A;  4DRW A;  5I2Q A;  5KSZ A;  3IF7 A;  1EH2 A;  1MHO A;  2M8U A;  5GQQ C;  1BG1 A;  1CFC A;  3D10 A;  2KAX A;  4USL A;  4C0K A;  1OE9 B;  4M2P A;  1B8R A;  2COL B;  3K21 A;  1FW4 A;  1IJ6 A;  2KI6 C;  3JTD B;  2LMV A;  1S1E A;  1NCY A;  2KI4 B;  3EKH A;  3LL8 B;  1TCF A;  2JT8 A;  4MRY A;  5AAN A;  3QRX A;  3EK7 A;  1B9A A;  4IL1 A;  4XYN A;  2BL0 C;  1QX2 A;  4MLW A;  4JQ0 D;  5I8N A;  1C07 A;  1CFP A;  2MHH A;  3NSI A;  1KK7 Z;  1K96 A;  2JT0 A;  2MLF C;  3WHU B;  1QLS A;  2M7N A;  5KU1 A;  2CNP A;  1UHN A;  4ZCU A;  1QS7 A;  1JFJ A;  5CSI A;  4QJ5 B;  4YBH B;  2SCP A;  2BBM A;  4GGF A;  1HT9 A;  5JOL A;  1DF0 A;  4PHK A;  4CFQ A;  5HKZ A;  3OHM B;  3I5G C;  4GNK B;  2LHI A;  1A2X A;  1SCM B;  4M2Q A;  1XK4 A;  2K8M B;  2P6B B;  4QJ3 B;  5PAL A;  1K94 A;  1SPY A;  2K2F A;  1DGV A;  5DKN A;  1KK8 B;  1DTL A;  4NQG A;  2KGB C;  3SIA A;  2GV5 A;  1DMO A;  2KBI A;  2BKI B;  1CDM A;  2K7D A;  1OMV A;  3TDZ A;  1XFZ O;  2JZI A;  2KQ6 A;  2Y4Q A;  1F55 A;  3JVT C;  1H4B A;  1TRF A;  2JRF A;  4MVF A;  2R2I A;  3SIB A;  4GUK A;  3PAL A;  4DIR A;  3WHT B;  1OMD A;  2A4J A;  4WRI A;  3I5F C;  1A75 A;  1J1E A;  1NPQ A;  1QVI Z;  3BYA A;  1NX3 A;  2E6W A;  3EVU A;  2CT9 A;  2KQY A;  4ICB A;  1MXL C;  1YUR A;  1QV0 A;  2O5G A;  2WCF A;  3I5I C;  4C0L A;  1B8L A;  2ZFD A;  1DVI A;  4BY4 A;  2AAO A;  2K61 A;  1WDC C;  2GGM A;  3AAJ A;  2CTN A;  1PVB A;  1SW8 A;  1RK9 A;  2JC2 A;  4PHM A;  1TNW A;  1WLM A;  2LC5 A;  1DT7 B;  3SG5 A;  2KOT A;  4OCI A;  4QJ4 B;  2BCX A;  2ZN9 A;  3E3R A;  2HPS A;  3KHE A;  2M1K B;  3NXA A;  4ORA B;  4PE0 A;  4ORC B;  1UUR A;  3JTD C;  2M9G A;  1UHH A;  3DF0 B;  3VRQ A;  2LMU A;  1XO5 A;  3FIA A;  2D8N A;  2LVK A;  2OTG B;  1OMR A;  1QX7 A;  3SG4 A;  1S6C A;  1Y1X A;  3KEV A;  3CR5 X;  2H61 C;  1JUO A;  3HCM A;  1K9P A;  3CLN A;  1MUX A;  1PUL A;  2G2B A;  2V53 A;  2EHB A;  5HYD A;  1AHR A;  3D0Y A;  2MAZ A;  1YUS A;  1C7W A;  1CMF A;  4AQJ A;  5BPJ A;  2MLE C;  4MRX A;  2KSP A;  3KO0 A;  3CZT X;  1N2D A;  1SCV A;  2Q91 A;  3GK4 X;  4CLN A;  1SBJ A;  3TUY C;  1K8U A;  1YX8 A;  4GGN A;  4NDD A;  3EVV A;  3CTN A;  1ZUZ A;  1CNP A;  2I7A A;  5DKR A;  4FTG A;  2F2P A;  1M39 A;  1WY9 A;  1SR6 B;  3H4S E;  5D7F A;  1EG3 A;  1DGU A;  1KWO C;  2JWW A;  3AKA A;  3PN7 C;  3TDU A;  1TIZ A;  3GK1 A;  4YGE B;  2MBX A;  2BE6 A;  5JJG A;  1DJW A;  2FJU B;  1ZOT B;  3GOF A;  1KFX S;  1QAT A;  1ZMZ A;  1IQ3 A;  2Y1M A;  3DVM A;  2ZRS A;  3MSE B;  1EJ3 A;  1RFJ A;  4OVN F;  1IRJ A;  1NX0 A;  4Q04 A;  4PE7 A;  2PVB A;  2K2A A;  2M1U A;  1RWY A;  2BBN A;  1YRU B;  2M97 A;  1CM4 A;  2KHN A;  1L7Z A;  2MRD A;  3TS5 C;  1DF0 B;  1LIN A;  1Y0V H;  3O6B A;  3EK4 A;  5DKQ A;  4P2Y B;  1RJV A;  3KPX A;  1WRZ A;  1Q80 A;  1SK6 D;  4DS7 A;  2IS9 A;  2I2R E;  1AVS A;  4YRU A;  3M0W A;  2L50 A;  2WC8 A;  5F6T A;  5CSN A;  2LP2 A;  1QIV A;  3WNX B;  2K7C A;  1MQ1 A;  2KYF A;  2I18 A;  1D1O A;  2LUX A;  1RRO A;  1Y1A A;  3PAT A;  2OTG C;  3LK1 A;  3AKB A;  1GGZ A;  3LK0 A;  1KQM B;  1IQ5 A;  1KK7 Y;  1XYD A;  1F8H A;  1A29 A;  3BUM B;  5CSF A;  1J7P A;  5AEQ A;  1NUB A;  1A75 B;  1B8C A;  1AJ5 A;  1JBA A;  4BY5 A;  1SL9 A;  1W7J B;  2QAC A;  3ICB A;  1CDL A;  1YX7 A;  2EC6 C;  4I5N B;  4U8D A;  4A4C A;  3FS7 A;  5D69 A;  1KFU L;  4HRH A;  4A4B A;  2CXJ A;  3FWB A;  5I2O A;  2JTT A;  1B4C A;  5ER5 A;  2KFG A;  1S3P A;  4TNC A;  4P5O E;  3DVK A;  4N1G A;  2OS8 C;  1ODB A;  1L2O C;  2LM5 A;  2LVV A;  1JFK A;  1BMO A;  1VRK A;  2I94 A;  3PSR A;  2Y1N A;  1X02 A;  3A8R A;  2EGD A;  5HKY A;  1QXP A;  4I5K A;  5HKW A;  1IG5 A;  2KNE A;  5K89 A;  1SKT A;  2H61 A;  3BOW A;  2HQ8 A;  1GQM A;  1B7T Z;  1E8A A;  1TCO B;  1XFY O;  2M29 A;  4I5L B;  1YRT B;  4NDB A;  2K7O A;  3LCP C;  3EKJ A;  1S5G Z;  2FCD A;  2LNK A;  1KQV A;  1K9U A;  1WRK A;  1IGV A;  2WOS A;  1SMG A;  3I5H B;  1DJZ A;  3OX5 A;  1OZS A;  1OSA A;  1TOP A;  1BR1 B;  1DJY A;  2LLS A;  2PAL A;  3IQO A;  4FQO A;  1K9K A;  1QVI Y;  2M49 B;  1U5I A;  2PAS A;  1B7T Y;  3D0Y B;  3SJS A;  2M0R A;  4D1E A;  1BOD A;  2CBL A;  2HF5 A;  1XFU O;  1BT6 A;  3SG2 A;  1S5G Y;  1Y6W A;  5CPV A;  2G9B A;  2KI4 C;  1K95 A;  1CLM A;  1OOJ A;  4CFR A;  4AQI A;  1J7Q A;  1JF2 A;  3DVE A;  2BE4 A;  4PE4 A;  1UHJ A;  3VGO A;  3NSL A;  1GGW A;  2BL0 B;  1HQV A;  2LV7 A;  2RGI A;  3PM8 A;  1YTZ C;  2NZ0 A;  1PK0 D;  1KCY A;  1YVH A;  1RTP 1;  1W7I B;  1QV1 A;  4YGB B;  1Y1U A;  1QJT A;  2L5X B;  1NCZ A;  1NP8 A;  4M2O A;  1V1G A;  2PMY A;  1JSA A;  4L9M A;  2LUC A;  2Q4U A;  1KQM C;  5J3X A;  1B1G A;  1C7V A;  1SYM A;  1PSR A;  1AUI B;  1QTX A;  1XVJ A;  3I5G B;  1SCM C;  5ER4 X;  3DD4 A;  5AER A;  1G8I A;  1IWQ A;  2JOJ A;  1V1F A;  1KK8 C;  2L0P A; 
#chains in the Genus database with same CATH topology
 4UPG A;  5AXI A;  3LLE A;  5G08 A;  4YI8 A;  4HRG A;  1AJ4 A;  1TNX A;  2JQ6 A;  2LE9 B;  2ZRT A;  4INX A;  1NYA A;  2WCE A;  1A03 A;  1M45 A;  1SNL A;  1QAS A;  3NSK A;  2L98 A;  2LVI A;  3PM2 A;  2HQW A;  3CZ2 A;  2HET A;  4YGC B;  4CID A;  3GK2 A;  1WRL A;  1XFW O;  1LA3 A;  1F4O A;  3BUX B;  2L51 A;  1YUU A;  2MJW B;  3I5F B;  3A4U B;  4MEW A;  3AAK A;  4HSZ A;  4I5J A;  1IJ5 A;  1LKJ A;  1BOC A;  2M7L A;  1S26 D;  5HLV A;  2PQL A;  2BKH B;  4MN0 A;  4OKH A;  1K93 D;  1DJI A;  2JU0 A;  3I5I B;  5FYX A;  4MZJ A;  4WQ3 A;  3DYE A;  2ZN8 A;  3OX6 A;  3BUN B;  2F3Y A;  1J55 A;  2ZKM X;  4JKT A;  1G33 A;  4MBE A;  4GFT A;  2KFF A;  3D78 A;  3OBV A;  4OR9 B;  2M3W A;  3L4A A;  1MR8 A;  3CZ0 A;  4GPL B;  4JPZ B;  2DOQ A;  2O60 A;  3PLF B;  5IBW A;  2JTZ A;  3HX4 A;  1TNP A;  2TN4 A;  1OW4 A;  1F4Q A;  4NDC A;  1TTX A;  2Y5I A;  4PDZ A;  2AMI A;  1J7R A;  3KF9 A;  2KGR A;  4GBA A;  1CM1 A;  1YVL A;  2JNX A;  2LLT A;  2NXQ A;  1LVC D;  1M46 A;  4XJK A;  3F45 A;  3PFV A;  1Z2C B;  5HLO A;  3BOW B;  1XFX O;  1CMG A;  1OZO A;  2K7B A;  3O2P A;  4OV2 A;  3BXK A;  1EXR A;  1UP5 A;  1S6J A;  1QX5 B;  3SG6 A;  1ZAC A;  1OOG A;  5I2L A;  2QPT A;  1UHK A;  2BCA A;  1NX1 A;  2AUC A;  1N0Y A;  4FQT A;  2KAY A;  2ZND A;  3D76 A;  2F3Z A;  1EL4 A;  2JXL A;  2F33 A;  1J7O A;  3BJH A;  2LMT A;  2WCK A;  4PAL A;  1PSB A;  2F2O A;  2E30 A;  1U5I B;  4MSP A;  1R6P A;  3WXA A;  1S6I A;  3ZWH A;  1DJG A;  2FCE A;  3VRP A;  3CS1 A;  1F71 A;  1PRW A;  1AK8 A;  5HL1 A;  3QME A;  2NCO A;  3CDN A;  3TUY B;  1LXF C;  3CR2 A;  3SG7 A;  1BU3 A;  4F0Z B;  1BLQ A;  2QEH A;  3B87 A;  1OOH A;  1TNQ A;  2WOR A;  4JWQ A;  1FI5 A;  1TUJ A;  2L2E A;  2CCM A;  1GJY A;  1DJX A;  4HRE E;  1FBV A;  1SR6 C;  4WQ2 A;  3O4Y A;  1EG4 A;  3EK8 A;  1KFX L;  3BUO B;  2LAN A;  1FPW A;  1SY9 A;  1J1D A;  1KWO B;  3PN7 B;  2ZNE A;  1DJH A;  4YGD B;  1CFD A;  2LP3 A;  3K1E A;  3VRR A;  4ETO A;  1JC2 A;  3SG3 A;  3CWG A;  1OOI X;  2LAP A;  2WND A;  3UNW A;  1FI6 A;  3D75 A;  1CFF A;  1IH0 A;  1K90 D;  1QWV A;  1YUT A;  5CSJ A;  1FF1 A;  1ZFS A;  3EG5 B;  3BFB A;  2PSR A;  1CDP A;  2WCB A;  4IJ7 A;  1SL8 A;  1UUS A;  3BFA A;  4PCW A;  3SS4 A;  1G4Y R;  2B1U A;  1F70 A;  1K2H A;  4GGF C;  2NLN A;  3TS5 B;  1F54 A;  3CAB A;  3R72 A;  1TN4 A;  2L5Y A;  5KTY A;  1NWD A;  1XK4 C;  3Q8I A;  1LA0 A;  1CLB A;  1W9Z A;  2L2C A;  2MA2 A;  5FI2 A;  3IVT A;  1UHI A;  1M31 A;  2KYC A;  3FE6 A;  1QIW A;  3S0E A;  2JNF A;  3SS5 A;  2VRG A;  4N1F A;  5B8I B;  1DQE A;  3FWC A;  3DVJ A;  4DUQ A;  1T14 A;  1PAL A;  3ZNI A;  1OQP A;  1NCX A;  2JUL A;  1JF0 A;  3NSO A;  3OP0 A;  3RLZ A;  4CPV A;  1CDN A;  1B47 A;  4R1E A;  1H8B A;  2KI6 D;  1SRA A;  4ORB B;  1CLL A;  2KFH A;  1MXE A;  1Z4H A;  3CGA A;  4PHJ A;  1REC A;  3S0G A;  1CTR A;  3TDI A;  1KSM A;  1XA5 A;  1R2U A;  2GGZ A;  1CKK A;  3BUW B;  2ISD A;  3EVR A;  1N65 A;  2LHL A;  1NIW A;  1YR5 A;  1KSO A;  2SAS A;  2KLE A;  2EC6 B;  3D73 A;  3L4L A;  4PT1 A;  2WC6 A;  2LLU A;  4C0J A;  1IKU A;  4DCK A;  4AOM A;  4MZK A;  1BF5 A;  1CB1 A;  4MZL A;  4YGA A;  1S36 A;  4ZCV A;  1M63 B;  1KFU S;  2F8P A;  1XFV O;  4GAO A;  4N5X A;  2L4H A;  5AFP A;  2OS8 B;  3JVT B;  1ALV A;  1L2O B;  1WLZ A;  2KDH A;  3DF0 A;  4PHN A;  1JWD A;  2LVJ A;  3BQ3 A;  3C1V A;  2K0J A;  2L4I A;  1DC1 A;  1QLK A;  1BR4 B;  1ALW A;  1MF8 B;  2JPT A;  2KBM A;  3OB1 B;  3V2L A;  2KAV A;  1MWN A;  2BCB A;  2PRU A;  1SL7 A;  1TUZ A;  3VRO A;  2JXC A;  1NX2 A;  1A4P A;  2JT3 A;  1UWO A;  1NSH A;  3RM1 A;  3DXL A;  3IQQ A;  2LCP A;  3O78 A;  3OB2 B;  2BEC A;  4XJK B;  3S0D A;  4PE1 A;  2FOT A;  2OPO A;  4E68 A;  1BJF A;  1PVA A;  2FJY A;  4YI9 A;  3TZ1 A;  1DEL A;  2H2K A;  1WDC B;  2NCP A;  3CR4 X;  3I5H C;  5TNC A;  4DRW A;  5I2Q A;  3FE9 A;  1SSE B;  3IF7 A;  5KSZ A;  1EH2 A;  1MHO A;  2M8U A;  5GQQ C;  1BG1 A;  1CFC A;  3D10 A;  2KAX A;  4USL A;  4C0K A;  1OE9 B;  4M2P A;  1B8R A;  2COL B;  3K21 A;  1FW4 A;  1IJ6 A;  2KI6 C;  3JTD B;  2LMV A;  1S1E A;  1NCY A;  3UO9 A;  2KI4 B;  3EKH A;  3LL8 B;  1TCF A;  2JT8 A;  4MRY A;  5AAN A;  3QRX A;  3EK7 A;  1B9A A;  4IL1 A;  4XYN A;  2BL0 C;  1QX2 A;  4MLW A;  4JQ0 D;  5I8N A;  1C07 A;  1CFP A;  2MHH A;  3NSI A;  1KK7 Z;  3DZT A;  1K96 A;  2JT0 A;  2MLF C;  3WHU B;  1QLS A;  2M7N A;  5KU1 A;  2KPH A;  2CNP A;  1UHN A;  4ZCU A;  1QS7 A;  1JFJ A;  5CSI A;  3FE8 A;  2PYQ A;  4YBH B;  4QJ5 B;  2SCP A;  2BBM A;  4GGF A;  1HT9 A;  5JOL A;  1DF0 A;  4PHK A;  4CFQ A;  2BNX A;  5HKZ A;  3OHM B;  3I5G C;  4GNK B;  2LHI A;  1A2X A;  5D3O A;  1SCM B;  4M2Q A;  1XK4 A;  2K8M B;  2P6B B;  4KYN A;  4QJ3 B;  5PAL A;  5FI7 A;  1K94 A;  1SPY A;  2K2F A;  1DGV A;  2WCL A;  5DKN A;  1KK8 B;  1DTL A;  4NQG A;  2KGB C;  3SIA A;  2GV5 A;  1DMO A;  2KBI A;  2BKI B;  3S0A A;  1CDM A;  4OZD A;  2K7D A;  1OMV A;  3TDZ A;  1XFZ O;  2JZI A;  2KQ6 A;  2Y4Q A;  1F55 A;  3JVT C;  1H4B A;  1TRF A;  2QEB A;  1OOF A;  2JRF A;  4MVF A;  2R2I A;  3SIB A;  4GUK A;  3PAL A;  4DIR A;  3WHT B;  1OMD A;  2A4J A;  4WRI A;  3I5F C;  1A75 A;  1J1E A;  1NPQ A;  1QVI Z;  3BYA A;  1NX3 A;  2E6W A;  3EVU A;  2CT9 A;  3SS3 A;  2KQY A;  4ICB A;  2YGU A;  1MXL C;  1YUR A;  1QV0 A;  2BAP A;  2O5G A;  2WCF A;  3I5I C;  4C0L A;  1B8L A;  2ZFD A;  1DVI A;  4BY4 A;  2AAO A;  2K61 A;  1WDC C;  2GGM A;  3AAJ A;  2CTN A;  1PVB A;  1SW8 A;  1RK9 A;  2JC2 A;  4PHM A;  1TNW A;  1WLM A;  2LC5 A;  1DT7 B;  3SG5 A;  2KOT A;  3NHT A;  4OCI A;  4QJ4 B;  2BCX A;  2ZN9 A;  4INW A;  3E3R A;  2HPS A;  3KHE A;  2M1K B;  3NXA A;  4ORA B;  4PE0 A;  4ORC B;  1UUR A;  3JTD C;  2P70 A;  2M9G A;  1UHH A;  3DF0 B;  3VRQ A;  2LMU A;  1XO5 A;  3FIA A;  2D8N A;  2LVK A;  2OTG B;  2WCJ A;  1OMR A;  1QX7 A;  3SG4 A;  1S6C A;  3NHI A;  1Y1X A;  3KEV A;  3CR5 X;  2H61 C;  1JUO A;  3HCM A;  1K9P A;  3CLN A;  3DY9 A;  1MUX A;  2QEV A;  1PUL A;  2G2B A;  2V53 A;  2EHB A;  5HYD A;  1AHR A;  1GM0 A;  3D0Y A;  2MAZ A;  1YUS A;  2H8V A;  1C3Z A;  1C7W A;  1CMF A;  4AQJ A;  5BPJ A;  2MLE C;  4JD9 A;  4MRX A;  2KSP A;  3KO0 A;  3NGV A;  3CZT X;  1N2D A;  1SCV A;  2Q91 A;  3GK4 X;  4CLN A;  1SBJ A;  3TUY C;  1K8U A;  1YX8 A;  4GGN A;  4NDD A;  3EVV A;  3CTN A;  1ZUZ A;  1CNP A;  2I7A A;  5DKR A;  4FTG A;  2F2P A;  1M39 A;  1WY9 A;  2GTE A;  1SR6 B;  2WCM A;  3H4S E;  5D7F A;  1EG3 A;  1DGU A;  1KWO C;  2JWW A;  3AKA A;  3PN7 C;  3TDU A;  1AP4 A;  1TIZ A;  3GK1 A;  4YGE B;  2MBX A;  2BE6 A;  5JJG A;  1DJW A;  2FJU B;  1ZOT B;  3B88 A;  3GOF A;  1KFX S;  1QAT A;  1ZMZ A;  2P71 A;  1IQ3 A;  2Y1M A;  3DVM A;  2ZRS A;  3MSE B;  1EJ3 A;  3O4X A;  1RFJ A;  4OVN F;  1IRJ A;  1NX0 A;  4F7F A;  4Q04 A;  3BFH A;  2PVB A;  2K2A A;  2M1U A;  4PE7 A;  1RWY A;  2BBN A;  1YRU B;  2M97 A;  1CM4 A;  2KHN A;  1L7Z A;  2MRD A;  1ORG A;  2WCH A;  3TS5 C;  1DF0 B;  1LIN A;  1Y0V H;  3O6B A;  3EK4 A;  5DKQ A;  3CZ1 A;  4P2Y B;  1RJV A;  3KPX A;  1WRZ A;  1Q80 A;  1SK6 D;  3VRN A;  4DS7 A;  3RZS A;  2IS9 A;  2I2R E;  1AVS A;  3VB1 A;  4YRU A;  3M0W A;  2L50 A;  1TWO A;  2WC8 A;  5F6T A;  5CSN A;  2LP2 A;  1QIV A;  3WNX B;  2K7C A;  1MQ1 A;  3D77 A;  2KYF A;  2I18 A;  5EL2 A;  2LUX A;  1D1O A;  1RRO A;  1Y1A A;  3PAT A;  2OTG C;  3LK1 A;  2ERB A;  3AKB A;  1GGZ A;  3LK0 A;  2K60 A;  1KQM B;  1IQ5 A;  1KK7 Y;  1XYD A;  1F8H A;  1A29 A;  3BUM B;  5CSF A;  1J7P A;  5FI6 A;  5AEQ A;  1NUB A;  3OGN A;  1A75 B;  1B8C A;  1AJ5 A;  1JBA A;  4BY5 A;  3R1O A;  1SL9 A;  1W7J B;  2QAC A;  3ICB A;  1CDL A;  1YX7 A;  2EC6 C;  4I5N B;  4U8D A;  4A4C A;  3FS7 A;  1LS8 A;  5D69 A;  1KFU L;  4HRH A;  4A4B A;  2CXJ A;  3FWB A;  5I2O A;  2JTT A;  5I94 A;  1B4C A;  5ER5 A;  2KFG A;  1S3P A;  3B7A A;  4TNC A;  4P5O E;  3DVK A;  4N1G A;  2OS8 C;  1ODB A;  1L2O C;  2LM5 A;  2LVV A;  1JFK A;  1BMO A;  1VRK A;  2I94 A;  3PSR A;  2Y1N A;  1X02 A;  3A8R A;  2EGD A;  5HKY A;  1QXP A;  4I5K A;  5HKW A;  1IG5 A;  2KNE A;  5K89 A;  1SKT A;  2H61 A;  3BOW A;  2HQ8 A;  1GQM A;  3N7H A;  1B7T Z;  1E8A A;  3CYZ A;  1TCO B;  1XFY O;  5DIC A;  3B6X A;  1IIO A;  2M29 A;  4I5L B;  1YRT B;  4NDB A;  2K7O A;  3LCP C;  3EKJ A;  1S5G Z;  2FCD A;  2LNK A;  1KQV A;  1K9U A;  1WRK A;  1IGV A;  2WOS A;  1SMG A;  3I5H B;  1DJZ A;  3OX5 A;  1OZS A;  1OSA A;  1TOP A;  1BR1 B;  1DJY A;  2LLS A;  2PAL A;  3IQO A;  4FQO A;  1K9K A;  1QVI Y;  2KLD A;  1U5I A;  2M49 B;  2PAS A;  1B7T Y;  3D0Y B;  3SJS A;  2M0R A;  4D1E A;  1BOD A;  2CBL A;  1XFR A;  1P28 A;  2HF5 A;  1XFU O;  1BT6 A;  3SG2 A;  1S5G Y;  1Y6W A;  5CPV A;  2WC5 A;  3PJI A;  2G9B A;  3D74 A;  2KI4 C;  3R1V A;  1K95 A;  1CLM A;  3S0F A;  1OOJ A;  4CFR A;  4AQI A;  1J7Q A;  1JF2 A;  3DVE A;  2BE4 A;  2JPO A;  1UHJ A;  4PE4 A;  3NSL A;  3VGO A;  2BL0 B;  1DEK A;  1HQV A;  2LV7 A;  2QDI A;  2RGI A;  3L47 A;  1GGW A;  3PM8 A;  1YTZ C;  2NZ0 A;  1PK0 D;  1KCY A;  2QEO A;  3S0B A;  1YVH A;  1RTP 1;  1W7I B;  1QV1 A;  1C3Y A;  4YGB B;  1Y1U A;  1QJT A;  2L5X B;  1NCZ A;  1NP8 A;  4M2O A;  1V1G A;  2PMY A;  1JSA A;  4L9M A;  2LUC A;  2Q4U A;  1KQM C;  3R1P A;  5J3X A;  1B1G A;  1C7V A;  1SYM A;  1PSR A;  1AUI B;  1QTX A;  1XVJ A;  3I5G B;  1SCM C;  5ER4 X;  3B86 A;  3DD4 A;  5AER A;  1G8I A;  1IWQ A;  2JOJ A;  1V1F A;  1KK8 C;  2L0P A; 
#chains in the Genus database with same CATH homology
 4UPG A;  5AXI A;  3LLE A;  5G08 A;  4YI8 A;  4HRG A;  1AJ4 A;  1TNX A;  2JQ6 A;  2LE9 B;  2ZRT A;  1NYA A;  2WCE A;  1A03 A;  1M45 A;  1SNL A;  1QAS A;  3NSK A;  2L98 A;  2LVI A;  2HQW A;  2HET A;  4YGC B;  4CID A;  3GK2 A;  1WRL A;  1XFW O;  1LA3 A;  1F4O A;  3BUX B;  2L51 A;  1YUU A;  2MJW B;  3I5F B;  3A4U B;  4MEW A;  3AAK A;  4HSZ A;  4I5J A;  1IJ5 A;  1LKJ A;  1BOC A;  2M7L A;  1S26 D;  5HLV A;  4MN0 A;  2BKH B;  4OKH A;  1K93 D;  1DJI A;  2JU0 A;  3I5I B;  5FYX A;  4MZJ A;  4WQ3 A;  2ZN8 A;  3OX6 A;  3BUN B;  2F3Y A;  1J55 A;  2ZKM X;  1G33 A;  4MBE A;  4GFT A;  2KFF A;  4OR9 B;  2M3W A;  1MR8 A;  4GPL B;  4JPZ B;  2DOQ A;  2O60 A;  3PLF B;  5IBW A;  2JTZ A;  3HX4 A;  1TNP A;  2TN4 A;  1F4Q A;  4NDC A;  1TTX A;  2Y5I A;  4PDZ A;  2AMI A;  1J7R A;  3KF9 A;  2KGR A;  4GBA A;  1CM1 A;  1YVL A;  2JNX A;  2LLT A;  2NXQ A;  1LVC D;  1M46 A;  4XJK A;  3F45 A;  3PFV A;  5HLO A;  3BOW B;  1XFX O;  1CMG A;  1OZO A;  2K7B A;  3O2P A;  4OV2 A;  3BXK A;  1EXR A;  1UP5 A;  1S6J A;  1QX5 B;  3SG6 A;  1ZAC A;  5I2L A;  2QPT A;  1UHK A;  2BCA A;  1NX1 A;  2AUC A;  1N0Y A;  2KAY A;  2ZND A;  1J7O A;  2F3Z A;  1EL4 A;  2JXL A;  2F33 A;  2LMT A;  4PAL A;  1PSB A;  2F2O A;  2E30 A;  1U5I B;  4MSP A;  1R6P A;  3WXA A;  1S6I A;  3ZWH A;  1DJG A;  2FCE A;  3VRP A;  3CS1 A;  1F71 A;  1PRW A;  1AK8 A;  3TUY B;  2NCO A;  4F0Z B;  1BLQ A;  1LXF C;  3CR2 A;  3SG7 A;  1BU3 A;  1FI5 A;  1TNQ A;  2WOR A;  4JWQ A;  2L2E A;  2CCM A;  1GJY A;  1DJX A;  4HRE E;  1FBV A;  1SR6 C;  4WQ2 A;  3O4Y A;  1EG4 A;  3EK8 A;  1KFX L;  3BUO B;  2LAN A;  1FPW A;  1SY9 A;  1J1D A;  1KWO B;  3PN7 B;  2ZNE A;  1DJH A;  4YGD B;  1CFD A;  2LP3 A;  3VRR A;  4ETO A;  1JC2 A;  3SG3 A;  3CWG A;  2LAP A;  2WND A;  1FI6 A;  1IH0 A;  1CFF A;  1K90 D;  1YUT A;  5CSJ A;  1FF1 A;  1ZFS A;  2PSR A;  1CDP A;  2WCB A;  1SL8 A;  1UUS A;  4PCW A;  1G4Y R;  2B1U A;  1F70 A;  1K2H A;  4GGF C;  2NLN A;  3TS5 B;  1F54 A;  1TN4 A;  5KTY A;  1NWD A;  1XK4 C;  1CLB A;  1LA0 A;  2MA2 A;  1UHI A;  1M31 A;  2KYC A;  1QIW A;  2JNF A;  2VRG A;  4N1F A;  5B8I B;  3FWC A;  3DVJ A;  4DUQ A;  1PAL A;  3ZNI A;  1OQP A;  1NCX A;  2JUL A;  1JF0 A;  3NSO A;  3OP0 A;  3RLZ A;  4CPV A;  1CDN A;  1B47 A;  4R1E A;  1H8B A;  2KI6 D;  1SRA A;  4ORB B;  1CLL A;  2KFH A;  1MXE A;  3CGA A;  4PHJ A;  1REC A;  1CTR A;  3TDI A;  1KSM A;  1XA5 A;  1R2U A;  2GGZ A;  1CKK A;  3BUW B;  2ISD A;  3EVR A;  1N65 A;  2LHL A;  1NIW A;  1YR5 A;  1KSO A;  2SAS A;  1AP4 A;  2EC6 B;  2LLU A;  4C0J A;  1IKU A;  4DCK A;  4AOM A;  4MZK A;  1BF5 A;  1CB1 A;  4MZL A;  4YGA A;  1S36 A;  4ZCV A;  1M63 B;  1KFU S;  2F8P A;  1XFV O;  4GAO A;  4N5X A;  2L4H A;  5AFP A;  2OS8 B;  3JVT B;  1ALV A;  1L2O B;  1WLZ A;  2KDH A;  3DF0 A;  4PHN A;  1JWD A;  2LVJ A;  3BQ3 A;  3C1V A;  2K0J A;  2L4I A;  1QLK A;  1BR4 B;  1ALW A;  1MF8 B;  2JPT A;  2KBM A;  3OB1 B;  2KAV A;  1MWN A;  2BCB A;  2PRU A;  1SL7 A;  3VRO A;  2JXC A;  1NX2 A;  1A4P A;  2JT3 A;  1UWO A;  1NSH A;  3RM1 A;  3OB2 B;  3IQQ A;  2LCP A;  3O78 A;  4XJK B;  2BEC A;  3VRN A;  4PE1 A;  2FOT A;  2OPO A;  4E68 A;  1BJF A;  1PVA A;  4YI9 A;  3TZ1 A;  2H2K A;  1WDC B;  2NCP A;  3CR4 X;  3I5H C;  5TNC A;  4DRW A;  5I2Q A;  5KSZ A;  3IF7 A;  1EH2 A;  1MHO A;  2M8U A;  5GQQ C;  1BG1 A;  1CFC A;  3D10 A;  2KAX A;  4USL A;  4C0K A;  1OE9 B;  4M2P A;  1B8R A;  2COL B;  3K21 A;  1FW4 A;  1IJ6 A;  2KI6 C;  3JTD B;  2LMV A;  1S1E A;  1NCY A;  2KI4 B;  3EKH A;  3LL8 B;  1TCF A;  2JT8 A;  4MRY A;  5AAN A;  3QRX A;  3EK7 A;  1B9A A;  4IL1 A;  4XYN A;  2BL0 C;  1QX2 A;  4MLW A;  4JQ0 D;  5I8N A;  1C07 A;  1CFP A;  2MHH A;  3NSI A;  1KK7 Z;  1K96 A;  2JT0 A;  2MLF C;  3WHU B;  1QLS A;  2M7N A;  5KU1 A;  2CNP A;  1UHN A;  4ZCU A;  1QS7 A;  1JFJ A;  5CSI A;  4QJ5 B;  4YBH B;  2SCP A;  2BBM A;  4GGF A;  1HT9 A;  5JOL A;  1DF0 A;  4PHK A;  4CFQ A;  5HKZ A;  3OHM B;  3I5G C;  4GNK B;  2LHI A;  1A2X A;  1SCM B;  4M2Q A;  1XK4 A;  2K8M B;  2P6B B;  4QJ3 B;  5PAL A;  1K94 A;  1SPY A;  2K2F A;  1DGV A;  5DKN A;  1KK8 B;  1DTL A;  4NQG A;  2KGB C;  3SIA A;  2GV5 A;  1DMO A;  2KBI A;  2BKI B;  1CDM A;  2K7D A;  1OMV A;  3TDZ A;  1XFZ O;  2JZI A;  2KQ6 A;  2Y4Q A;  1F55 A;  3JVT C;  1H4B A;  1TRF A;  2JRF A;  4MVF A;  2R2I A;  3SIB A;  4GUK A;  3PAL A;  4DIR A;  3WHT B;  1OMD A;  2A4J A;  4WRI A;  3I5F C;  1A75 A;  1J1E A;  1NPQ A;  1QVI Z;  3BYA A;  1NX3 A;  2E6W A;  3EVU A;  2CT9 A;  2KQY A;  4ICB A;  1MXL C;  1YUR A;  1QV0 A;  2O5G A;  2WCF A;  3I5I C;  4C0L A;  1B8L A;  2ZFD A;  1DVI A;  4BY4 A;  2AAO A;  2K61 A;  1WDC C;  2GGM A;  3AAJ A;  2CTN A;  1PVB A;  1SW8 A;  1RK9 A;  2JC2 A;  4PHM A;  1TNW A;  1WLM A;  2LC5 A;  1DT7 B;  3SG5 A;  2KOT A;  4OCI A;  4QJ4 B;  2BCX A;  2ZN9 A;  3E3R A;  2HPS A;  3KHE A;  2M1K B;  3NXA A;  4ORA B;  4PE0 A;  4ORC B;  1UUR A;  3JTD C;  2M9G A;  1UHH A;  3DF0 B;  3VRQ A;  2LMU A;  1XO5 A;  3FIA A;  2D8N A;  2LVK A;  2OTG B;  1OMR A;  1QX7 A;  3SG4 A;  1S6C A;  1Y1X A;  3KEV A;  3CR5 X;  2H61 C;  1JUO A;  3HCM A;  1K9P A;  3CLN A;  1MUX A;  1PUL A;  2G2B A;  2V53 A;  2EHB A;  5HYD A;  1AHR A;  3D0Y A;  2MAZ A;  1YUS A;  1C7W A;  1CMF A;  4AQJ A;  5BPJ A;  2MLE C;  4MRX A;  2KSP A;  3KO0 A;  3CZT X;  1N2D A;  1SCV A;  2Q91 A;  3GK4 X;  4CLN A;  1SBJ A;  3TUY C;  1K8U A;  1YX8 A;  4GGN A;  4NDD A;  3EVV A;  3CTN A;  1ZUZ A;  1CNP A;  2I7A A;  5DKR A;  4FTG A;  2F2P A;  1M39 A;  1WY9 A;  1SR6 B;  3H4S E;  5D7F A;  1EG3 A;  1DGU A;  1KWO C;  2JWW A;  3AKA A;  3PN7 C;  3TDU A;  1TIZ A;  3GK1 A;  4YGE B;  2MBX A;  2BE6 A;  5JJG A;  1DJW A;  2FJU B;  1ZOT B;  3GOF A;  1KFX S;  1QAT A;  1ZMZ A;  1IQ3 A;  2Y1M A;  3DVM A;  2ZRS A;  3MSE B;  1EJ3 A;  1RFJ A;  4OVN F;  1IRJ A;  1NX0 A;  4Q04 A;  4PE7 A;  2PVB A;  2K2A A;  2M1U A;  1RWY A;  2BBN A;  1YRU B;  2M97 A;  1CM4 A;  2KHN A;  1L7Z A;  2MRD A;  3TS5 C;  1DF0 B;  1LIN A;  1Y0V H;  3O6B A;  3EK4 A;  5DKQ A;  4P2Y B;  1RJV A;  3KPX A;  1WRZ A;  1Q80 A;  1SK6 D;  4DS7 A;  2IS9 A;  2I2R E;  1AVS A;  4YRU A;  3M0W A;  2L50 A;  2WC8 A;  5F6T A;  5CSN A;  2LP2 A;  1QIV A;  3WNX B;  2K7C A;  1MQ1 A;  2KYF A;  2I18 A;  1D1O A;  2LUX A;  1RRO A;  1Y1A A;  3PAT A;  2OTG C;  3LK1 A;  3AKB A;  1GGZ A;  3LK0 A;  1KQM B;  1IQ5 A;  1KK7 Y;  1XYD A;  1F8H A;  1A29 A;  3BUM B;  5CSF A;  1J7P A;  5AEQ A;  1NUB A;  1A75 B;  1B8C A;  1AJ5 A;  1JBA A;  4BY5 A;  1SL9 A;  1W7J B;  2QAC A;  3ICB A;  1CDL A;  1YX7 A;  2EC6 C;  4I5N B;  4U8D A;  4A4C A;  3FS7 A;  5D69 A;  1KFU L;  4HRH A;  4A4B A;  2CXJ A;  3FWB A;  5I2O A;  2JTT A;  1B4C A;  5ER5 A;  2KFG A;  1S3P A;  4TNC A;  4P5O E;  3DVK A;  4N1G A;  2OS8 C;  1ODB A;  1L2O C;  2LM5 A;  2LVV A;  1JFK A;  1BMO A;  1VRK A;  2I94 A;  3PSR A;  2Y1N A;  1X02 A;  3A8R A;  2EGD A;  5HKY A;  1QXP A;  4I5K A;  5HKW A;  1IG5 A;  2KNE A;  5K89 A;  1SKT A;  2H61 A;  3BOW A;  2HQ8 A;  1GQM A;  1B7T Z;  1E8A A;  1TCO B;  1XFY O;  2M29 A;  4I5L B;  1YRT B;  4NDB A;  2K7O A;  3LCP C;  3EKJ A;  1S5G Z;  2FCD A;  2LNK A;  1KQV A;  1K9U A;  1WRK A;  1IGV A;  2WOS A;  1SMG A;  3I5H B;  1DJZ A;  3OX5 A;  1OZS A;  1OSA A;  1TOP A;  1BR1 B;  1DJY A;  2LLS A;  2PAL A;  3IQO A;  4FQO A;  1K9K A;  1QVI Y;  2M49 B;  1U5I A;  2PAS A;  1B7T Y;  3D0Y B;  3SJS A;  2M0R A;  4D1E A;  1BOD A;  2CBL A;  2HF5 A;  1XFU O;  1BT6 A;  3SG2 A;  1S5G Y;  1Y6W A;  5CPV A;  2G9B A;  2KI4 C;  1K95 A;  1CLM A;  1OOJ A;  4CFR A;  4AQI A;  1J7Q A;  1JF2 A;  3DVE A;  2BE4 A;  4PE4 A;  1UHJ A;  3VGO A;  3NSL A;  1GGW A;  2BL0 B;  1HQV A;  2LV7 A;  2RGI A;  3PM8 A;  1YTZ C;  2NZ0 A;  1PK0 D;  1KCY A;  1YVH A;  1RTP 1;  1W7I B;  1QV1 A;  4YGB B;  1Y1U A;  1QJT A;  2L5X B;  1NCZ A;  1NP8 A;  4M2O A;  1V1G A;  2PMY A;  1JSA A;  4L9M A;  2LUC A;  2Q4U A;  1KQM C;  5J3X A;  1B1G A;  1C7V A;  1SYM A;  1PSR A;  1AUI B;  1QTX A;  1XVJ A;  3I5G B;  1SCM C;  5ER4 X;  3DD4 A;  5AER A;  1G8I A;  1IWQ A;  2JOJ A;  1V1F A;  1KK8 C;  2L0P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...