1TNQA

Structures of the apo and calcium troponin-c regulatory domains: the muscle contraction switch
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
90
structure length
90
Chain Sequence
ASMTDQQAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TROPONIN-C
publication title Structures of the troponin C regulatory domains in the apo and calcium-saturated states.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Calcium-binding protein
total genus 12
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 1995-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1tnqA00
3DVEA 1WLZA 4ORBB 3SG5A 2LLUA 4F0ZB 1QV0A 2ZNEA 1QXPA 1S1EA 1IKUA 1SL7A 4FTGA 2KBMA 2OTGB 4FQOA 3PSRA 4XYNA 3OHMB 5D69A 4UPGA 1L2OB 2P6BB 2L50A 3SG7A 2K0JA 2KAYA 2BE6A 2KI4B 2M0RA 2JTTA 1F70A 2BCXA 2KYFA 2KYCA 2PMYA 3SG2A 2Y1NA 2MLFC 2ZFDA 3PLFB 2CBLA 3QRXA 1YVLA 1G4YR 3LCPC 2KDHA 1WRKA 1SCMB 4NDDA 3LK0A 1M46A 2I18A 1SYMA 4YGBB 2LHIA 5F6TA 4I5NB 2MHHA 1IRJA 3BUWB 1Y6WA 4C0KA 5JJGA 2F8PA 2M3WA 3C1VA 1A03A 3BOWA 3NXAA 1UURA 3CLNA 2IS9A 3EK4A 3PFVA 1NX3A 1RECA 1QASA 2JRFA 4HSZA 5CSJA 1XFZO 3A8RA 1F8HA 3DVJA 1XFVO 2K7OA 3K21A 2JU0A 3O6BA 1QLSA 2LE9B 3OB2B 4A4CA 4TNCA 2BBMA 4QJ5B 1CNPA 3DF0A 1JF2A 2LAPA 2Y1MA 4QJ4B 3CTNA 1VRKA 1KFUL 1IJ5A 1NSHA 2LVIA 2Q91A 3CR2A 3BUNB 3IQOA 2NLNA 3CS1A 2O60A 1ZMZA 1SY9A 1SNLA 4GAOA 4ORCB 4AQIA 4N1FA 5AEQA 3TZ1A 1M63B 5HKWA 2K2FA 3CGAA 3EVUA 2K7BA 2EGDA 2I7AA 4YI9A 3VRNA 5KU1A 1NWDA 1H8BA 1KK7Z 3H4SE 4WRIA 1EH2A 1MUXA 2F2OA 2F3YA 2OS8B 1A75B 1DJWA 2NZ0A 4C0JA 2JZIA 1B4CA 1UHIA 5DKNA 2R2IA 4YRUA 1HQVA 3FS7A 2BKHB 3PN7B 1EG4A 2HQ8A 2LLTA 1EJ3A 4PDZA 5ER4X 1UHNA 1TN4A 2JQ6A 2Q4UA 4CLNA 2L51A 2LLSA 1S36A 1KSOA 2LV7A 1IGVA 3BQ3A 3WNXB 1B9AA 3JTDC 1QVIZ 1PSRA 1WLMA 5BPJA 1CM4A 1S6CA 4JWQA 1BMOA 1XVJA 4PE1A 2ISDA 2NXQA 2AMIA 1DF0A 2E30A 4PHMA 4XJKB 1G8IA 1JWDA 1QIWA 4U8DA 4YGAA 1CFFA 4DIRA 1GGZA 1SKTA 1BG1A 2COLB 1DMOA 1QTXA 1NCXA 2PALA 1UHKA 5I2LA 1CTRA 2L2EA 1J1DA 4I5JA 1B8LA 2KBIA 4MVFA 1DJIA 1SW8A 3TUYC 3D10A 1A2XA 2A4JA 3I5GB 2WNDA 1S6JA 4NQGA 1DVIA 4NDBA 2MBXA 1PK0D 2BL0B 1G33A 2ZKMX 4GFTA 3LLEA 4GBAA 3OP0A 1ZACA 1GQMA 1SR6B 2ZRTA 1V1FA 2NCPA 3KF9A 2QACA 4R1EA 2KI6D 5J3XA 3FWCA 2BECA 1Y1XA 4ICBA 3I5HC 1JSAA 1AVSA 1DJXA 1YR5A 1PVBA 1S5GZ 1CDLA 1K8UA 2KAVA 4USLA 3AKBA 1Y0VH 1RFJA 4YGDB 1LINA 4PCWA 1J55A 2LMUA 3KEVA 1MWNA 3AAKA 1JFJA 1ALWA 4OVNF 3GOFA 2BBNA 2PVBA 5KSZA 1F4QA 2I2RE 1M45A 1YRUB 2G2BA 3SG6A 1KFXS 2JC2A 3BXKA 1IG5A 1BJFA 3HX4A 5HLVA 1B8RA 1RROA 1SCVA 2NCOA 1TOPA 2Y5IA 1KWOB 1AJ5A 2ZNDA 1QIVA 1SBJA 1S5GY 4I5KA 1OSAA 5CPVA 3JTDB 4MEWA 3TDUA 1FPWA 1YVHA 2GV5A 2Y4QA 4OKHA 1Q80A 2H2KA 1Y1AA 1R6PA 3AKAA 3MSEB 3F45A 2M7LA 1BF5A 1K93D 5K89A 1TNQA 1C7VA 2WCBA 3BUOB 4MLWA 1OMVA 1C07A 1W7IB 1MXLC 1CDNA 2GGZA 2LP3A 3NSKA 5HLOA 4AOMA 3D0YB 1NX0A 3NSIA 1N2DA 3EVVA 3GK4X 3PALA 5JOLA 1RJVA 3SIBA 3CR4X 4E68A 3PM8A 2LVJA 3EK8A 5CSNA 1XFYO 3WHUB 3EKJA 2CT9A 2BCBA 4OV2A 3TUYB 1B7TZ 5HYDA 1XFXO 3CZTX 3KHEA 2LANA 1S3PA 3DVMA 3OB1B 4PHKA 4WQ2A 1YX7A 1CDMA 4NDCA 3CWGA 4BY5A 1NIWA 2JT8A 1B47A 4WQ3A 1WRZA 1NYAA 1CDPA 1OQPA 3I5HB 1NPQA 4AQJA 1CLMA 2KHNA 1YTZC 1KK8C 1CM1A 2K8MB 3EVRA 2F3ZA 1XK4A 1DJYA 3NSLA 3OX6A 4JPZB 3I5FC 1AJ4A 2M8UA 5PALA 1U5IB 1RK9A 2LCPA 1DGVA 3KO0A 4N1GA 3WHTB 2V53A 1JUOA 1XK4C 3LL8B 2KFFA 1NCZA 1KK7Y 1BOCA 3HCMA 1CMFA 5DKQA 2M7NA 3O4YA 3PATA 4GUKA 1PVAA 2WOSA 2LVVA 1YUUA 1L7ZA 2JXLA 1NX2A 5CSIA 2F2PA 1K9PA 2JNXA 2HQWA 1BLQA 1YUTA 2L4HA 2KFHA 3O2PA 4MSPA 1L2OC 2K7CA 5AXIA 1EG3A 2JULA 2LVKA 3GK2A 1OMDA 2SASA 1BU3A 4HRGA 2GGMA 1PSBA 1FW4A 1S26D 2M9GA 3E3RA 2LM5A 2OPOA 5D7FA 1M31A 1QLKA 2M1KB 1MQ1A 5I2OA 2KAXA 1QVIY 3BUMB 2CNPA 4ORAB 1HT9A 1FI6A 1TNXA 1J7PA 1CFDA 1TCFA 3BOWB 2L0PA 1UP5A 2F33A 1DJZA 2JOJA 4YGEB 1NUBA 1ZOTB 2LUCA 2EC6C 3SIAA 3VRRA 1F71A 4HRHA 1M39A 3M0WA 1H4BA 1DJGA 4PALA 2TN4A 2HF5A 1OE9B 1JF0A 4GNKB 2JPTA 5CSFA 1FI5A 1J1EA 1K96A 2JTZA 3DF0B 1QX5B 3VRQA 5ER5A 5I8NA 1XA5A 3CR5X 4M2QA 1SRAA 2QPTA 4PE0A 2M1UA 1X02A 4CPVA 1OZSA 2VRGA 1Y1UA 2WCFA 2K2AA 1LXFC 1UWOA 1GJYA 5AFPA 1WDCC 1A75A 1K90D 1YURA 2DOQA 1QS7A 3TS5C 3KPXA 3SG4A 1TNWA 1NP8A 1KK8B 1NCYA 2KSPA 2LMVA 3I5IC 2LMTA 1CFPA 1GGWA 1V1GA 1KCYA 1UHJA 3JVTC 4PHNA 1IQ5A 2JT3A 2MJWB 1OOJA 2BKIB 3DD4A 3IQQA 1XO5A 3DVKA 2M97A 2MLEC 4DS7A 2FOTA 2EHBA 1EL4A 1BR4B 4ETOA 3BUXB 4CIDA 5I2QA 1XYDA 1UUSA 4MZJA 4PHJA 3VROA 4DCKA 1TTXA 3ICBA 1SL9A 1AUIB 4YBHB 1TNPA 1MXEA 4MZLA 4YI8A 1KSMA 4C0LA 1MHOA 1LA0A 2B1UA 2PASA 4XJKA 3ZWHA 2LUXA 2MRDA 4YGCB 1CFCA 1JFKA 2LHLA 5IBWA 1AP4A 1D1OA 4ZCUA 1AHRA 1LKJA 1DF0B 1OZOA 1PALA 2O5GA 2KGBC 4DRWA 4PE4A 3LK1A 4PE7A 1YRTB 4HREE 4D1EA 1LVCD 2EC6B 1IQ3A 2JNFA 1QATA 3ZNIA 4L9MA 2KOTA 2L4IA 1TRFA 1F4OA 5FYXA 2I94A 1MR8A 1K9UA 4P5OE 5TNCA 2CCMA 1FBVA 3A4UB 3I5GC 2ZN9A 1BT6A 2PSRA 3OX5A 4GGFA 1CB1A 2ZN8A 1KQMC 1BODA 1PULA 1W7JB 1ZFSA 2KQ6A 2BL0C 5GQQC 3NSOA 2KFGA 4ZCVA 3EK7A 5KTYA 5HKYA 1TCOB 1UHHA 4GGFC 1SR6C 1CKKA 1IH0A 1LA3A 1EXRA 2KNEA 3AAJA 3RM1A 1QJTA 5AANA 1SPYA 1B7TY 1WDCB 1CMGA 3TS5B 2WORA 1MF8B 2KI6C 2BE4A 1C7WA 2K7DA 3SG3A 3TDIA 3I5IB 2CTNA 1ALVA 1DT7B 1E8AA 1DGUA 2CXJA 4OCIA 3GK1A 2G9BA 1DJHA 3JVTB 1XFUO 1BR1B 2ZRSA 2OTGC 1RTP1 4A4BA 4CFQA 2HETA 3FWBA 1R2UA 2LNKA 2HPSA 1CLBA 1TIZA 4BY4A 1IJ6A 2FCDA 2LC5A 2KI4C 3FIAA 2PRUA 4M2OA 1KFXL 1FF1A 1QV1A 1RWYA 1S6IA 2M49B 1NX1A 1KWOC 2SCPA 4MN0A 1SCMC 1N65A 1K94A 1PRWA 3RLZA 3VGOA 4MRXA 2JT0A 1YX8A 2MAZA 1KQVA 3BYAA 1ODBA 1AK8A 4P2YB 1XFWO 1OMRA 1A29A 1KFUS 2AAOA 2K61A 2MA2A 1A4PA 2KGRA 2WCEA 4JQ0D 4DUQA 3D0YA 4GPLB 2L5XB 5HKZA 1SK6D 2RGIA 4MRYA 2FCEA 3O78A 1QX2A 5DKRA 1YUSA 4OR9B 3EKHA 3SJSA 3WXAA 1J7RA 2WC8A 2D8NA 4Q04A 3IF7A 2BCAA 1CLLA 1SMGA 1JBAA 4IL1A 1IWQA 1JC2A 4CFRA 2JXCA 2FJUB 2L98A 1QX7A 1ZUZA 4QJ3B 4I5LB 1J7QA 1WY9A 1KQMB 2H61A 1J7OA 1SL8A 2E6WA 2LP2A 4M2PA 1B1GA 2JWWA 1F55A 1WRLA 5AERA 5B8IB 2AUCA 1K95A 2KQYA 1DTLA 3VRPA 4N5XA 1F54A 2OS8C 3I5FB 2H61C 4MZKA 1K2HA 3TDZA 1K9KA 2M29A 1U5IA 1B8CA 3PN7C 5G08A 4MBEA 1N0YA 4GGNA
chains in the Genus database with same CATH superfamily
3DVEA 1WLZA 4ORBB 3SG5A 2LLUA 4F0ZB 1QV0A 3IVTA 2ZNEA 1QXPA 1S1EA 3B6XA 3BFBA 1IKUA 1SL7A 4FTGA 5D3OA 2KBMA 2OTGB 4FQOA 3PSRA 4XYNA 3OHMB 5D69A 4UPGA 1L2OB 2P6BB 2L50A 3SG7A 2K0JA 2KAYA 2BE6A 2KI4B 2M0RA 2JTTA 1F70A 2BCXA 2KYFA 2KYCA 2PMYA 3SG2A 4GGNA 3D76A 2Y1NA 2MLFC 2ZFDA 3PLFB 2CBLA 3QRXA 1YVLA 1G4YR 3LCPC 2KDHA 1WRKA 1SCMB 4NDDA 3LK0A 1M46A 1XFRA 2I18A 1SYMA 4YGBB 2LHIA 5F6TA 4I5NB 2MHHA 1IRJA 3BUWB 1Y6WA 4C0KA 5JJGA 2F8PA 2M3WA 3C1VA 1A03A 3BOWA 3NXAA 1C3YA 1UURA 3CLNA 2IS9A 3EK4A 3PFVA 1NX3A 1RECA 1QASA 2JRFA 4HSZA 3S0GA 5CSJA 1XFZO 3A8RA 3D75A 3DVJA 1F8HA 1XFVO 2K7OA 3K21A 2JU0A 3O6BA 1QLSA 2LE9B 3OB2B 4A4CA 4KYNA 4TNCA 2BBMA 4QJ5B 1CNPA 3DF0A 1JF2A 2LAPA 2Y1MA 4QJ4B 3PJIA 3CTNA 1VRKA 1KFUL 1IJ5A 1NSHA 2LVIA 1OW4A 2Q91A 3CR2A 3BUNB 3IQOA 2NLNA 3CS1A 2O60A 1ZMZA 1SY9A 1SNLA 4GAOA 4ORCB 4AQIA 4N1FA 5AEQA 3TZ1A 1M63B 5HKWA 2K2FA 3CGAA 3EVUA 2K7BA 2EGDA 2I7AA 2BAPA 4YI9A 3VRNA 1NWDA 5KU1A 1H8BA 1KK7Z 3R1OA 4F7FA 3H4SE 2KLEA 4WRIA 1EH2A 1MUXA 1Z4HA 2F2OA 2F3YA 2OS8B 1A75B 1DJWA 2NZ0A 4C0JA 2JZIA 2QEBA 1UHIA 1B4CA 5DKNA 1DC1A 3L4LA 2R2IA 4YRUA 1HQVA 3FS7A 2BKHB 4FQTA 3PN7B 4OZDA 3UO9A 3DYEA 1EG4A 2HQ8A 2LLTA 1EJ3A 4PDZA 5ER4X 1UHNA 1TN4A 2JQ6A 2H8VA 2KLDA 2Q4UA 3FE8A 4CLNA 2L51A 2LLSA 1S36A 1KSOA 2LV7A 1GM0A 1IGVA 3BQ3A 3VB1A 3WNXB 1B9AA 3B86A 3JTDC 1QVIZ 1PSRA 1WLMA 5HL1A 5BPJA 1CM4A 1S6CA 4JWQA 1BMOA 1XVJA 4PE1A 2ISDA 2NXQA 2AMIA 1DF0A 2E30A 4PHMA 3D74A 4XJKB 1G8IA 1JWDA 1QIWA 4U8DA 4YGAA 1CFFA 4DIRA 3OBVA 1GGZA 1SKTA 1BG1A 2COLB 1DMOA 1QTXA 1NCXA 2PALA 1UHKA 5I2LA 4INWA 1CTRA 2L2EA 1J1DA 4I5JA 3CDNA 1B8LA 3V2LA 2KBIA 3R1VA 4MVFA 3QMEA 1DJIA 2QEOA 1SW8A 3TUYC 3D10A 1A2XA 2A4JA 3I5GB 2WNDA 1S6JA 4NQGA 1DVIA 4NDBA 3DXLA 3OGNA 3Q8IA 2MBXA 1PK0D 2BL0B 1G33A 2ZKMX 3CZ0A 4GFTA 3LLEA 4GBAA 3OP0A 1ZACA 1GQMA 1SR6B 2ZRTA 1V1FA 2NCPA 3KF9A 2QACA 4R1EA 2KI6D 5J3XA 3FWCA 2BECA 1Y1XA 4ICBA 2WCHA 2WCJA 3I5HC 1JSAA 1AVSA 1DJXA 2QDIA 1YR5A 1PVBA 1S5GZ 3DZTA 5DICA 1CDLA 1K8UA 2KAVA 4USLA 3AKBA 1Y0VH 1RFJA 4YGDB 1LINA 3NHIA 4PCWA 1J55A 2LMUA 3KEVA 1MWNA 3AAKA 1JFJA 1ALWA 3SS3A 4OVNF 3GOFA 2BBNA 2PVBA 5KSZA 3S0EA 4IJ7A 1F4QA 2I2RE 1M45A 1YRUB 1W9ZA 2G2BA 1KFXS 2JC2A 3SG6A 3BXKA 1IG5A 1BJFA 3HX4A 5HLVA 1B8RA 1RROA 1SCVA 2NCOA 1TOPA 2Y5IA 1KWOB 1AJ5A 2ZNDA 1QIVA 1SBJA 1S5GY 4I5KA 1OSAA 5CPVA 3JTDB 4MEWA 3TDUA 1FPWA 1YVHA 2GV5A 2Y4QA 2QEHA 3R72A 4OKHA 1Q80A 1OOHA 2H2KA 1Y1AA 1R6PA 3AKAA 3MSEB 3F45A 2M7LA 3B87A 1K93D 5K89A 1TNQA 2K60A 1BF5A 1C7VA 1TUZA 2WCBA 3BUOB 4MLWA 1OMVA 1C07A 1W7IB 1MXLC 2WCKA 1CDNA 2GGZA 2LP3A 3D77A 3NSKA 3CYZA 4PT1A 3S0DA 5HLOA 1C3ZA 2KPHA 4AOMA 3D0YB 1NX0A 3NSIA 1N2DA 3EVVA 3GK4X 3PALA 5JOLA 1RJVA 3SIBA 3CR4X 4E68A 3PM8A 2LVJA 3EK8A 5CSNA 1XFYO 3WHUB 3EKJA 2L5YA 2CT9A 2BCBA 3PM2A 4OV2A 3TUYB 1B7TZ 5HYDA 1XFXO 3CZTX 3KHEA 2LANA 1S3PA 3DVMA 3OB1B 4PHKA 4WQ2A 3BJHA 1YX7A 1CDMA 2BNXA 4NDCA 3CWGA 4BY5A 1NIWA 2WC5A 2JT8A 1B47A 4WQ3A 1WRZA 3B88A 1NYAA 1CDPA 1OQPA 3I5HB 1NPQA 4AQJA 1CLMA 2KHNA 1YTZC 1KK8C 1CM1A 2K8MB 3B7AA 3EVRA 2F3ZA 1XK4A 1DJYA 3NSLA 3OX6A 4JPZB 3I5FC 3L4AA 1AJ4A 2M8UA 5I94A 5PALA 1U5IB 1RK9A 2LCPA 1DGVA 3KO0A 4N1GA 3WHTB 2V53A 1TUJA 1JUOA 3CZ2A 1XK4C 3LL8B 2KFFA 1NCZA 1KK7Y 1BOCA 3HCMA 1CMFA 5DKQA 2M7NA 3O4YA 3PATA 4GUKA 1PVAA 1DQEA 2WOSA 2LVVA 1YUUA 1L7ZA 2JXLA 1NX2A 5CSIA 2WCMA 2F2PA 1K9PA 2JNXA 2HQWA 1BLQA 1YUTA 2L4HA 3K1EA 2KFHA 3O2PA 4MSPA 1L2OC 2K7CA 5AXIA 1EG3A 2JULA 2LVKA 3GK2A 1OMDA 2SASA 3O4XA 1BU3A 4HRGA 1QWVA 2GGMA 1PSBA 1FW4A 1S26D 2M9GA 3E3RA 3UNWA 2FJYA 2LM5A 2OPOA 5D7FA 1M31A 1QLKA 2M1KB 1MQ1A 5I2OA 2WCLA 2KAXA 1QVIY 3BUMB 2CNPA 4ORAB 1HT9A 3SS5A 1FI6A 1TNXA 1J7PA 1CFDA 1TCFA 3BOWB 2L0PA 1UP5A 3EG5B 2F33A 1DJZA 2JOJA 1T14A 4YGEB 1NUBA 1ZOTB 2LUCA 2EC6C 3SIAA 3VRRA 1F71A 3D78A 4HRHA 1M39A 3M0WA 1H4BA 1Z2CB 1DJGA 4PALA 2TN4A 2HF5A 4INXA 1OE9B 1JF0A 3CABA 4GNKB 2JPTA 5CSFA 1FI5A 1J1EA 1K96A 2JTZA 3CZ1A 3DF0B 1QX5B 3VRQA 5ER5A 5I8NA 1XA5A 2PQLA 3CR5X 4M2QA 1SRAA 2QPTA 4PE0A 2M1UA 1ORGA 1X02A 1OZSA 2VRGA 1Y1UA 2WCFA 4CPVA 2K2AA 1LXFC 1UWOA 1GJYA 5AFPA 1WDCC 1A75A 1K90D 1YURA 2DOQA 1QS7A 3TS5C 3KPXA 3SG4A 1TNWA 1NP8A 1KK8B 1NCYA 2KSPA 2LMVA 3I5IC 2LMTA 1CFPA 3D73A 3NHTA 1GGWA 1V1GA 1KCYA 1LS8A 1UHJA 3JVTC 4PHNA 1IQ5A 2JT3A 2MJWB 1OOJA 2BKIB 3DD4A 3IQQA 1XO5A 3DVKA 2M97A 2MLEC 4DS7A 2FOTA 2EHBA 1EL4A 1BR4B 4ETOA 3BUXB 4CIDA 5I2QA 2QEVA 1XYDA 1UUSA 4MZJA 4PHJA 3VROA 4DCKA 2L2CA 1TTXA 3ICBA 1SL9A 2ERBA 1AUIB 4YBHB 1TNPA 1MXEA 2P71A 4MZLA 4YI8A 1KSMA 4C0LA 1MHOA 1LA0A 2B1UA 2PASA 4XJKA 3ZWHA 2LUXA 2MRDA 4YGCB 1CFCA 1JFKA 2LHLA 5IBWA 1AP4A 1D1OA 4ZCUA 1AHRA 1LKJA 1DF0B 1OZOA 1PALA 2O5GA 2KGBC 4DRWA 5FI6A 4PE4A 3LK1A 4PE7A 1YRTB 4JKTA 4HREE 3FE9A 4D1EA 1LVCD 2EC6B 1IQ3A 2JNFA 1QATA 3ZNIA 4L9MA 2KOTA 2L4IA 1TRFA 1F4OA 5FYXA 2I94A 1MR8A 1K9UA 4P5OE 5TNCA 2CCMA 1FBVA 3A4UB 3I5GC 2ZN9A 1BT6A 2PSRA 3OX5A 4GGFA 1CB1A 2ZN8A 1KQMC 1BODA 1PULA 1W7JB 1ZFSA 2KQ6A 2BL0C 5GQQC 3NSOA 2KFGA 4ZCVA 3SS4A 3EK7A 2P70A 5KTYA 5HKYA 1TCOB 1UHHA 4GGFC 1SR6C 1CKKA 1IH0A 1LA3A 1EXRA 2KNEA 3AAJA 3RM1A 1QJTA 5AANA 1SPYA 1B7TY 2GTEA 1WDCB 1CMGA 3TS5B 2WORA 1MF8B 2KI6C 2BE4A 1C7WA 2K7DA 3SG3A 3TDIA 3S0BA 3I5IB 1OOFA 1ALVA 2CTNA 1DT7B 1E8AA 1DGUA 2CXJA 4OCIA 3GK1A 2G9BA 1DJHA 3JVTB 1XFUO 1BR1B 2ZRSA 2OTGC 1RTP1 4A4BA 4CFQA 2HETA 3FWBA 1R2UA 2LNKA 2HPSA 1CLBA 1TIZA 4BY4A 1IJ6A 2FCDA 2LC5A 2KI4C 3FIAA 1P28A 2PRUA 4M2OA 1KFXL 1FF1A 1QV1A 1RWYA 1S6IA 2M49B 3BFAA 1NX1A 1KWOC 2SCPA 4MN0A 3S0FA 1SCMC 1N65A 5EL2A 1K94A 1PRWA 2YGUA 3RLZA 4MRXA 1OOGA 2JT0A 3VGOA 3RZSA 1YX8A 2MAZA 1SSEB 1KQVA 3BYAA 1ODBA 1AK8A 4P2YB 1XFWO 1OMRA 1A29A 1KFUS 2AAOA 2K61A 2MA2A 1A4PA 2KGRA 2WCEA 3R1PA 4JQ0D 4DUQA 3D0YA 4GPLB 4JD9A 3S0AA 2L5XB 5HKZA 1SK6D 2RGIA 3FE6A 2FCEA 3O78A 4MRYA 1QX2A 5DKRA 1YUSA 4OR9B 3EKHA 3SJSA 3WXAA 1J7RA 2WC8A 1DELA 2D8NA 4Q04A 3IF7A 5FI7A 2BCAA 1CLLA 2WC6A 1SMGA 1JBAA 4IL1A 1IWQA 1JC2A 3NGVA 4CFRA 2JXCA 2FJUB 2L98A 1QX7A 1ZUZA 4QJ3B 3L47A 4I5LB 1J7QA 1WY9A 1KQMB 2H61A 1J7OA 1SL8A 2E6WA 1TWOA 2LP2A 4M2PA 2JWWA 1B1GA 1F55A 1WRLA 5AERA 5B8IB 1IIOA 5FI2A 2AUCA 1K95A 2KQYA 1DTLA 3VRPA 1DEKA 4N5XA 1OOIX 1F54A 2OS8C 3I5FB 2H61C 4MZKA 2JPOA 3TDZA 1K2HA 1K9KA 3DY9A 3N7HA 2M29A 1U5IA 1B8CA 3PN7C 5G08A 3BFHA 4MBEA 1N0YA 2PYQA
chains in the Genus database with same CATH topology
3DVEA 1WLZA 4ORBB 3SG5A 2LLUA 4F0ZB 1QV0A 2ZNEA 1QXPA 1S1EA 1IKUA 1SL7A 4FTGA 2KBMA 2OTGB 4FQOA 3PSRA 4XYNA 3OHMB 5D69A 4UPGA 1L2OB 2P6BB 2L50A 3SG7A 2K0JA 2KAYA 2BE6A 2KI4B 2M0RA 2JTTA 1F70A 2BCXA 2KYFA 2KYCA 2PMYA 3SG2A 2Y1NA 2MLFC 2ZFDA 3PLFB 2CBLA 3QRXA 1YVLA 1G4YR 3LCPC 2KDHA 1WRKA 1SCMB 4NDDA 3LK0A 1M46A 2I18A 1SYMA 4YGBB 2LHIA 5F6TA 4I5NB 2MHHA 1IRJA 3BUWB 1Y6WA 4C0KA 5JJGA 2F8PA 2M3WA 3C1VA 1A03A 3BOWA 3NXAA 1UURA 3CLNA 2IS9A 3EK4A 3PFVA 1NX3A 1RECA 1QASA 2JRFA 4HSZA 5CSJA 1XFZO 3A8RA 1F8HA 3DVJA 1XFVO 2K7OA 3K21A 2JU0A 3O6BA 1QLSA 2LE9B 3OB2B 4A4CA 4TNCA 2BBMA 4QJ5B 1CNPA 3DF0A 1JF2A 2LAPA 2Y1MA 4QJ4B 3CTNA 1VRKA 1KFUL 1IJ5A 1NSHA 2LVIA 2Q91A 3CR2A 3BUNB 3IQOA 2NLNA 3CS1A 2O60A 1ZMZA 1SY9A 1SNLA 4GAOA 4ORCB 4AQIA 4N1FA 5AEQA 3TZ1A 1M63B 5HKWA 2K2FA 3CGAA 3EVUA 2K7BA 2EGDA 2I7AA 4YI9A 3VRNA 5KU1A 1NWDA 1H8BA 1KK7Z 3H4SE 4WRIA 1EH2A 1MUXA 2F2OA 2F3YA 2OS8B 1A75B 1DJWA 2NZ0A 4C0JA 2JZIA 1B4CA 1UHIA 5DKNA 2R2IA 4YRUA 1HQVA 3FS7A 2BKHB 3PN7B 1EG4A 2HQ8A 2LLTA 1EJ3A 4PDZA 5ER4X 1UHNA 1TN4A 2JQ6A 2Q4UA 4CLNA 2L51A 2LLSA 1S36A 1KSOA 2LV7A 1IGVA 3BQ3A 3WNXB 1B9AA 3JTDC 1QVIZ 1PSRA 1WLMA 5BPJA 1CM4A 1S6CA 4JWQA 1BMOA 1XVJA 4PE1A 2ISDA 2NXQA 2AMIA 1DF0A 2E30A 4PHMA 4XJKB 1G8IA 1JWDA 1QIWA 4U8DA 4YGAA 1CFFA 4DIRA 1GGZA 1SKTA 1BG1A 2COLB 1DMOA 1QTXA 1NCXA 2PALA 1UHKA 5I2LA 1CTRA 2L2EA 1J1DA 4I5JA 1B8LA 2KBIA 4MVFA 1DJIA 1SW8A 3TUYC 3D10A 1A2XA 2A4JA 3I5GB 2WNDA 1S6JA 4NQGA 1DVIA 4NDBA 2MBXA 1PK0D 2BL0B 1G33A 2ZKMX 4GFTA 3LLEA 4GBAA 3OP0A 1ZACA 1GQMA 1SR6B 2ZRTA 1V1FA 2NCPA 3KF9A 2QACA 4R1EA 2KI6D 5J3XA 3FWCA 2BECA 1Y1XA 4ICBA 3I5HC 1JSAA 1AVSA 1DJXA 1YR5A 1PVBA 1S5GZ 1CDLA 1K8UA 2KAVA 4USLA 3AKBA 1Y0VH 1RFJA 4YGDB 1LINA 4PCWA 1J55A 2LMUA 3KEVA 1MWNA 3AAKA 1JFJA 1ALWA 4OVNF 3GOFA 2BBNA 2PVBA 5KSZA 1F4QA 2I2RE 1M45A 1YRUB 2G2BA 3SG6A 1KFXS 2JC2A 3BXKA 1IG5A 1BJFA 3HX4A 5HLVA 1B8RA 1RROA 1SCVA 2NCOA 1TOPA 2Y5IA 1KWOB 1AJ5A 2ZNDA 1QIVA 1SBJA 1S5GY 4I5KA 1OSAA 5CPVA 3JTDB 4MEWA 3TDUA 1FPWA 1YVHA 2GV5A 2Y4QA 4OKHA 1Q80A 2H2KA 1Y1AA 1R6PA 3AKAA 3MSEB 3F45A 2M7LA 1BF5A 1K93D 5K89A 1TNQA 1C7VA 2WCBA 3BUOB 4MLWA 1OMVA 1C07A 1W7IB 1MXLC 1CDNA 2GGZA 2LP3A 3NSKA 5HLOA 4AOMA 3D0YB 1NX0A 3NSIA 1N2DA 3EVVA 3GK4X 3PALA 5JOLA 1RJVA 3SIBA 3CR4X 4E68A 3PM8A 2LVJA 3EK8A 5CSNA 1XFYO 3WHUB 3EKJA 2CT9A 2BCBA 4OV2A 3TUYB 1B7TZ 5HYDA 1XFXO 3CZTX 3KHEA 2LANA 1S3PA 3DVMA 3OB1B 4PHKA 4WQ2A 1YX7A 1CDMA 4NDCA 3CWGA 4BY5A 1NIWA 2JT8A 1B47A 4WQ3A 1WRZA 1NYAA 1CDPA 1OQPA 3I5HB 1NPQA 4AQJA 1CLMA 2KHNA 1YTZC 1KK8C 1CM1A 2K8MB 3EVRA 2F3ZA 1XK4A 1DJYA 3NSLA 3OX6A 4JPZB 3I5FC 1AJ4A 2M8UA 5PALA 1U5IB 1RK9A 2LCPA 1DGVA 3KO0A 4N1GA 3WHTB 2V53A 1JUOA 1XK4C 3LL8B 2KFFA 1NCZA 1KK7Y 1BOCA 3HCMA 1CMFA 5DKQA 2M7NA 3O4YA 3PATA 4GUKA 1PVAA 2WOSA 2LVVA 1YUUA 1L7ZA 2JXLA 1NX2A 5CSIA 2F2PA 1K9PA 2JNXA 2HQWA 1BLQA 1YUTA 2L4HA 2KFHA 3O2PA 4MSPA 1L2OC 2K7CA 5AXIA 1EG3A 2JULA 2LVKA 3GK2A 1OMDA 2SASA 1BU3A 4HRGA 2GGMA 1PSBA 1FW4A 1S26D 2M9GA 3E3RA 2LM5A 2OPOA 5D7FA 1M31A 1QLKA 2M1KB 1MQ1A 5I2OA 2KAXA 1QVIY 3BUMB 2CNPA 4ORAB 1HT9A 1FI6A 1TNXA 1J7PA 1CFDA 1TCFA 3BOWB 2L0PA 1UP5A 2F33A 1DJZA 2JOJA 4YGEB 1NUBA 1ZOTB 2LUCA 2EC6C 3SIAA 3VRRA 1F71A 4HRHA 1M39A 3M0WA 1H4BA 1DJGA 4PALA 2TN4A 2HF5A 1OE9B 1JF0A 4GNKB 2JPTA 5CSFA 1FI5A 1J1EA 1K96A 2JTZA 3DF0B 1QX5B 3VRQA 5ER5A 5I8NA 1XA5A 3CR5X 4M2QA 1SRAA 2QPTA 4PE0A 2M1UA 1X02A 4CPVA 1OZSA 2VRGA 1Y1UA 2WCFA 2K2AA 1LXFC 1UWOA 1GJYA 5AFPA 1WDCC 1A75A 1K90D 1YURA 2DOQA 1QS7A 3TS5C 3KPXA 3SG4A 1TNWA 1NP8A 1KK8B 1NCYA 2KSPA 2LMVA 3I5IC 2LMTA 1CFPA 1GGWA 1V1GA 1KCYA 1UHJA 3JVTC 4PHNA 1IQ5A 2JT3A 2MJWB 1OOJA 2BKIB 3DD4A 3IQQA 1XO5A 3DVKA 2M97A 2MLEC 4DS7A 2FOTA 2EHBA 1EL4A 1BR4B 4ETOA 3BUXB 4CIDA 5I2QA 1XYDA 1UUSA 4MZJA 4PHJA 3VROA 4DCKA 1TTXA 3ICBA 1SL9A 1AUIB 4YBHB 1TNPA 1MXEA 4MZLA 4YI8A 1KSMA 4C0LA 1MHOA 1LA0A 2B1UA 2PASA 4XJKA 3ZWHA 2LUXA 2MRDA 4YGCB 1CFCA 1JFKA 2LHLA 5IBWA 1AP4A 1D1OA 4ZCUA 1AHRA 1LKJA 1DF0B 1OZOA 1PALA 2O5GA 2KGBC 4DRWA 4PE4A 3LK1A 4PE7A 1YRTB 4HREE 4D1EA 1LVCD 2EC6B 1IQ3A 2JNFA 1QATA 3ZNIA 4L9MA 2KOTA 2L4IA 1TRFA 1F4OA 5FYXA 2I94A 1MR8A 1K9UA 4P5OE 5TNCA 2CCMA 1FBVA 3A4UB 3I5GC 2ZN9A 1BT6A 2PSRA 3OX5A 4GGFA 1CB1A 2ZN8A 1KQMC 1BODA 1PULA 1W7JB 1ZFSA 2KQ6A 2BL0C 5GQQC 3NSOA 2KFGA 4ZCVA 3EK7A 5KTYA 5HKYA 1TCOB 1UHHA 4GGFC 1SR6C 1CKKA 1IH0A 1LA3A 1EXRA 2KNEA 3AAJA 3RM1A 1QJTA 5AANA 1SPYA 1B7TY 1WDCB 1CMGA 3TS5B 2WORA 1MF8B 2KI6C 2BE4A 1C7WA 2K7DA 3SG3A 3TDIA 3I5IB 2CTNA 1ALVA 1DT7B 1E8AA 1DGUA 2CXJA 4OCIA 3GK1A 2G9BA 1DJHA 3JVTB 1XFUO 1BR1B 2ZRSA 2OTGC 1RTP1 4A4BA 4CFQA 2HETA 3FWBA 1R2UA 2LNKA 2HPSA 1CLBA 1TIZA 4BY4A 1IJ6A 2FCDA 2LC5A 2KI4C 3FIAA 2PRUA 4M2OA 1KFXL 1FF1A 1QV1A 1RWYA 1S6IA 2M49B 1NX1A 1KWOC 2SCPA 4MN0A 1SCMC 1N65A 1K94A 1PRWA 3RLZA 3VGOA 4MRXA 2JT0A 1YX8A 2MAZA 1KQVA 3BYAA 1ODBA 1AK8A 4P2YB 1XFWO 1OMRA 1A29A 1KFUS 2AAOA 2K61A 2MA2A 1A4PA 2KGRA 2WCEA 4JQ0D 4DUQA 3D0YA 4GPLB 2L5XB 5HKZA 1SK6D 2RGIA 4MRYA 2FCEA 3O78A 1QX2A 5DKRA 1YUSA 4OR9B 3EKHA 3SJSA 3WXAA 1J7RA 2WC8A 2D8NA 4Q04A 3IF7A 2BCAA 1CLLA 1SMGA 1JBAA 4IL1A 1IWQA 1JC2A 4CFRA 2JXCA 2FJUB 2L98A 1QX7A 1ZUZA 4QJ3B 4I5LB 1J7QA 1WY9A 1KQMB 2H61A 1J7OA 1SL8A 2E6WA 2LP2A 4M2PA 1B1GA 2JWWA 1F55A 1WRLA 5AERA 5B8IB 2AUCA 1K95A 2KQYA 1DTLA 3VRPA 4N5XA 1F54A 2OS8C 3I5FB 2H61C 4MZKA 1K2HA 3TDZA 1K9KA 2M29A 1U5IA 1B8CA 3PN7C 5G08A 4MBEA 1N0YA 4GGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DVE A;  1WLZ A;  4ORB B;  3SG5 A;  2LLU A;  4F0Z B;  1QV0 A;  2ZNE A;  1QXP A;  1S1E A;  1IKU A;  1SL7 A;  4FTG A;  2KBM A;  2OTG B;  4FQO A;  3PSR A;  4XYN A;  3OHM B;  5D69 A;  4UPG A;  1L2O B;  2P6B B;  2L50 A;  3SG7 A;  2K0J A;  2KAY A;  2BE6 A;  2KI4 B;  2M0R A;  2JTT A;  1F70 A;  2BCX A;  2KYF A;  2KYC A;  2PMY A;  3SG2 A;  2Y1N A;  2MLF C;  2ZFD A;  3PLF B;  2CBL A;  3QRX A;  1YVL A;  1G4Y R;  3LCP C;  2KDH A;  1WRK A;  1SCM B;  4NDD A;  3LK0 A;  1M46 A;  2I18 A;  1SYM A;  4YGB B;  2LHI A;  5F6T A;  4I5N B;  2MHH A;  1IRJ A;  3BUW B;  1Y6W A;  4C0K A;  5JJG A;  2F8P A;  2M3W A;  3C1V A;  1A03 A;  3BOW A;  3NXA A;  1UUR A;  3CLN A;  2IS9 A;  3EK4 A;  3PFV A;  1NX3 A;  1REC A;  1QAS A;  2JRF A;  4HSZ A;  5CSJ A;  1XFZ O;  3A8R A;  1F8H A;  3DVJ A;  1XFV O;  2K7O A;  3K21 A;  2JU0 A;  3O6B A;  1QLS A;  2LE9 B;  3OB2 B;  4A4C A;  4TNC A;  2BBM A;  4QJ5 B;  1CNP A;  3DF0 A;  1JF2 A;  2LAP A;  2Y1M A;  4QJ4 B;  3CTN A;  1VRK A;  1KFU L;  1IJ5 A;  1NSH A;  2LVI A;  2Q91 A;  3CR2 A;  3BUN B;  3IQO A;  2NLN A;  3CS1 A;  2O60 A;  1ZMZ A;  1SY9 A;  1SNL A;  4GAO A;  4ORC B;  4AQI A;  4N1F A;  5AEQ A;  3TZ1 A;  1M63 B;  5HKW A;  2K2F A;  3CGA A;  3EVU A;  2K7B A;  2EGD A;  2I7A A;  4YI9 A;  3VRN A;  5KU1 A;  1NWD A;  1H8B A;  1KK7 Z;  3H4S E;  4WRI A;  1EH2 A;  1MUX A;  2F2O A;  2F3Y A;  2OS8 B;  1A75 B;  1DJW A;  2NZ0 A;  4C0J A;  2JZI A;  1B4C A;  1UHI A;  5DKN A;  2R2I A;  4YRU A;  1HQV A;  3FS7 A;  2BKH B;  3PN7 B;  1EG4 A;  2HQ8 A;  2LLT A;  1EJ3 A;  4PDZ A;  5ER4 X;  1UHN A;  1TN4 A;  2JQ6 A;  2Q4U A;  4CLN A;  2L51 A;  2LLS A;  1S36 A;  1KSO A;  2LV7 A;  1IGV A;  3BQ3 A;  3WNX B;  1B9A A;  3JTD C;  1QVI Z;  1PSR A;  1WLM A;  5BPJ A;  1CM4 A;  1S6C A;  4JWQ A;  1BMO A;  1XVJ A;  4PE1 A;  2ISD A;  2NXQ A;  2AMI A;  1DF0 A;  2E30 A;  4PHM A;  4XJK B;  1G8I A;  1JWD A;  1QIW A;  4U8D A;  4YGA A;  1CFF A;  4DIR A;  1GGZ A;  1SKT A;  1BG1 A;  2COL B;  1DMO A;  1QTX A;  1NCX A;  2PAL A;  1UHK A;  5I2L A;  1CTR A;  2L2E A;  1J1D A;  4I5J A;  1B8L A;  2KBI A;  4MVF A;  1DJI A;  1SW8 A;  3TUY C;  3D10 A;  1A2X A;  2A4J A;  3I5G B;  2WND A;  1S6J A;  4NQG A;  1DVI A;  4NDB A;  2MBX A;  1PK0 D;  2BL0 B;  1G33 A;  2ZKM X;  4GFT A;  3LLE A;  4GBA A;  3OP0 A;  1ZAC A;  1GQM A;  1SR6 B;  2ZRT A;  1V1F A;  2NCP A;  3KF9 A;  2QAC A;  4R1E A;  2KI6 D;  5J3X A;  3FWC A;  2BEC A;  1Y1X A;  4ICB A;  3I5H C;  1JSA A;  1AVS A;  1DJX A;  1YR5 A;  1PVB A;  1S5G Z;  1CDL A;  1K8U A;  2KAV A;  4USL A;  3AKB A;  1Y0V H;  1RFJ A;  4YGD B;  1LIN A;  4PCW A;  1J55 A;  2LMU A;  3KEV A;  1MWN A;  3AAK A;  1JFJ A;  1ALW A;  4OVN F;  3GOF A;  2BBN A;  2PVB A;  5KSZ A;  1F4Q A;  2I2R E;  1M45 A;  1YRU B;  2G2B A;  3SG6 A;  1KFX S;  2JC2 A;  3BXK A;  1IG5 A;  1BJF A;  3HX4 A;  5HLV A;  1B8R A;  1RRO A;  1SCV A;  2NCO A;  1TOP A;  2Y5I A;  1KWO B;  1AJ5 A;  2ZND A;  1QIV A;  1SBJ A;  1S5G Y;  4I5K A;  1OSA A;  5CPV A;  3JTD B;  4MEW A;  3TDU A;  1FPW A;  1YVH A;  2GV5 A;  2Y4Q A;  4OKH A;  1Q80 A;  2H2K A;  1Y1A A;  1R6P A;  3AKA A;  3MSE B;  3F45 A;  2M7L A;  1BF5 A;  1K93 D;  5K89 A;  1TNQ A;  1C7V A;  2WCB A;  3BUO B;  4MLW A;  1OMV A;  1C07 A;  1W7I B;  1MXL C;  1CDN A;  2GGZ A;  2LP3 A;  3NSK A;  5HLO A;  4AOM A;  3D0Y B;  1NX0 A;  3NSI A;  1N2D A;  3EVV A;  3GK4 X;  3PAL A;  5JOL A;  1RJV A;  3SIB A;  3CR4 X;  4E68 A;  3PM8 A;  2LVJ A;  3EK8 A;  5CSN A;  1XFY O;  3WHU B;  3EKJ A;  2CT9 A;  2BCB A;  4OV2 A;  3TUY B;  1B7T Z;  5HYD A;  1XFX O;  3CZT X;  3KHE A;  2LAN A;  1S3P A;  3DVM A;  3OB1 B;  4PHK A;  4WQ2 A;  1YX7 A;  1CDM A;  4NDC A;  3CWG A;  4BY5 A;  1NIW A;  2JT8 A;  1B47 A;  4WQ3 A;  1WRZ A;  1NYA A;  1CDP A;  1OQP A;  3I5H B;  1NPQ A;  4AQJ A;  1CLM A;  2KHN A;  1YTZ C;  1KK8 C;  1CM1 A;  2K8M B;  3EVR A;  2F3Z A;  1XK4 A;  1DJY A;  3NSL A;  3OX6 A;  4JPZ B;  3I5F C;  1AJ4 A;  2M8U A;  5PAL A;  1U5I B;  1RK9 A;  2LCP A;  1DGV A;  3KO0 A;  4N1G A;  3WHT B;  2V53 A;  1JUO A;  1XK4 C;  3LL8 B;  2KFF A;  1NCZ A;  1KK7 Y;  1BOC A;  3HCM A;  1CMF A;  5DKQ A;  2M7N A;  3O4Y A;  3PAT A;  4GUK A;  1PVA A;  2WOS A;  2LVV A;  1YUU A;  1L7Z A;  2JXL A;  1NX2 A;  5CSI A;  2F2P A;  1K9P A;  2JNX A;  2HQW A;  1BLQ A;  1YUT A;  2L4H A;  2KFH A;  3O2P A;  4MSP A;  1L2O C;  2K7C A;  5AXI A;  1EG3 A;  2JUL A;  2LVK A;  3GK2 A;  1OMD A;  2SAS A;  1BU3 A;  4HRG A;  2GGM A;  1PSB A;  1FW4 A;  1S26 D;  2M9G A;  3E3R A;  2LM5 A;  2OPO A;  5D7F A;  1M31 A;  1QLK A;  2M1K B;  1MQ1 A;  5I2O A;  2KAX A;  1QVI Y;  3BUM B;  2CNP A;  4ORA B;  1HT9 A;  1FI6 A;  1TNX A;  1J7P A;  1CFD A;  1TCF A;  3BOW B;  2L0P A;  1UP5 A;  2F33 A;  1DJZ A;  2JOJ A;  4YGE B;  1NUB A;  1ZOT B;  2LUC A;  2EC6 C;  3SIA A;  3VRR A;  1F71 A;  4HRH A;  1M39 A;  3M0W A;  1H4B A;  1DJG A;  4PAL A;  2TN4 A;  2HF5 A;  1OE9 B;  1JF0 A;  4GNK B;  2JPT A;  5CSF A;  1FI5 A;  1J1E A;  1K96 A;  2JTZ A;  3DF0 B;  1QX5 B;  3VRQ A;  5ER5 A;  5I8N A;  1XA5 A;  3CR5 X;  4M2Q A;  1SRA A;  2QPT A;  4PE0 A;  2M1U A;  1X02 A;  4CPV A;  1OZS A;  2VRG A;  1Y1U A;  2WCF A;  2K2A A;  1LXF C;  1UWO A;  1GJY A;  5AFP A;  1WDC C;  1A75 A;  1K90 D;  1YUR A;  2DOQ A;  1QS7 A;  3TS5 C;  3KPX A;  3SG4 A;  1TNW A;  1NP8 A;  1KK8 B;  1NCY A;  2KSP A;  2LMV A;  3I5I C;  2LMT A;  1CFP A;  1GGW A;  1V1G A;  1KCY A;  1UHJ A;  3JVT C;  4PHN A;  1IQ5 A;  2JT3 A;  2MJW B;  1OOJ A;  2BKI B;  3DD4 A;  3IQQ A;  1XO5 A;  3DVK A;  2M97 A;  2MLE C;  4DS7 A;  2FOT A;  2EHB A;  1EL4 A;  1BR4 B;  4ETO A;  3BUX B;  4CID A;  5I2Q A;  1XYD A;  1UUS A;  4MZJ A;  4PHJ A;  3VRO A;  4DCK A;  1TTX A;  3ICB A;  1SL9 A;  1AUI B;  4YBH B;  1TNP A;  1MXE A;  4MZL A;  4YI8 A;  1KSM A;  4C0L A;  1MHO A;  1LA0 A;  2B1U A;  2PAS A;  4XJK A;  3ZWH A;  2LUX A;  2MRD A;  4YGC B;  1CFC A;  1JFK A;  2LHL A;  5IBW A;  1AP4 A;  1D1O A;  4ZCU A;  1AHR A;  1LKJ A;  1DF0 B;  1OZO A;  1PAL A;  2O5G A;  2KGB C;  4DRW A;  4PE4 A;  3LK1 A;  4PE7 A;  1YRT B;  4HRE E;  4D1E A;  1LVC D;  2EC6 B;  1IQ3 A;  2JNF A;  1QAT A;  3ZNI A;  4L9M A;  2KOT A;  2L4I A;  1TRF A;  1F4O A;  5FYX A;  2I94 A;  1MR8 A;  1K9U A;  4P5O E;  5TNC A;  2CCM A;  1FBV A;  3A4U B;  3I5G C;  2ZN9 A;  1BT6 A;  2PSR A;  3OX5 A;  4GGF A;  1CB1 A;  2ZN8 A;  1KQM C;  1BOD A;  1PUL A;  1W7J B;  1ZFS A;  2KQ6 A;  2BL0 C;  5GQQ C;  3NSO A;  2KFG A;  4ZCV A;  3EK7 A;  5KTY A;  5HKY A;  1TCO B;  1UHH A;  4GGF C;  1SR6 C;  1CKK A;  1IH0 A;  1LA3 A;  1EXR A;  2KNE A;  3AAJ A;  3RM1 A;  1QJT A;  5AAN A;  1SPY A;  1B7T Y;  1WDC B;  1CMG A;  3TS5 B;  2WOR A;  1MF8 B;  2KI6 C;  2BE4 A;  1C7W A;  2K7D A;  3SG3 A;  3TDI A;  3I5I B;  2CTN A;  1ALV A;  1DT7 B;  1E8A A;  1DGU A;  2CXJ A;  4OCI A;  3GK1 A;  2G9B A;  1DJH A;  3JVT B;  1XFU O;  1BR1 B;  2ZRS A;  2OTG C;  1RTP 1;  4A4B A;  4CFQ A;  2HET A;  3FWB A;  1R2U A;  2LNK A;  2HPS A;  1CLB A;  1TIZ A;  4BY4 A;  1IJ6 A;  2FCD A;  2LC5 A;  2KI4 C;  3FIA A;  2PRU A;  4M2O A;  1KFX L;  1FF1 A;  1QV1 A;  1RWY A;  1S6I A;  2M49 B;  1NX1 A;  1KWO C;  2SCP A;  4MN0 A;  1SCM C;  1N65 A;  1K94 A;  1PRW A;  3RLZ A;  3VGO A;  4MRX A;  2JT0 A;  1YX8 A;  2MAZ A;  1KQV A;  3BYA A;  1ODB A;  1AK8 A;  4P2Y B;  1XFW O;  1OMR A;  1A29 A;  1KFU S;  2AAO A;  2K61 A;  2MA2 A;  1A4P A;  2KGR A;  2WCE A;  4JQ0 D;  4DUQ A;  3D0Y A;  4GPL B;  2L5X B;  5HKZ A;  1SK6 D;  2RGI A;  4MRY A;  2FCE A;  3O78 A;  1QX2 A;  5DKR A;  1YUS A;  4OR9 B;  3EKH A;  3SJS A;  3WXA A;  1J7R A;  2WC8 A;  2D8N A;  4Q04 A;  3IF7 A;  2BCA A;  1CLL A;  1SMG A;  1JBA A;  4IL1 A;  1IWQ A;  1JC2 A;  4CFR A;  2JXC A;  2FJU B;  2L98 A;  1QX7 A;  1ZUZ A;  4QJ3 B;  4I5L B;  1J7Q A;  1WY9 A;  1KQM B;  2H61 A;  1J7O A;  1SL8 A;  2E6W A;  2LP2 A;  4M2P A;  1B1G A;  2JWW A;  1F55 A;  1WRL A;  5AER A;  5B8I B;  2AUC A;  1K95 A;  2KQY A;  1DTL A;  3VRP A;  4N5X A;  1F54 A;  2OS8 C;  3I5F B;  2H61 C;  4MZK A;  1K2H A;  3TDZ A;  1K9K A;  2M29 A;  1U5I A;  1B8C A;  3PN7 C;  5G08 A;  4MBE A;  1N0Y A;  4GGN A; 
#chains in the Genus database with same CATH topology
 3DVE A;  1WLZ A;  4ORB B;  3SG5 A;  2LLU A;  4F0Z B;  1QV0 A;  3IVT A;  2ZNE A;  1QXP A;  1S1E A;  3B6X A;  3BFB A;  1IKU A;  1SL7 A;  4FTG A;  5D3O A;  2KBM A;  2OTG B;  4FQO A;  3PSR A;  4XYN A;  3OHM B;  5D69 A;  4UPG A;  1L2O B;  2P6B B;  2L50 A;  3SG7 A;  2K0J A;  2KAY A;  2BE6 A;  2KI4 B;  2M0R A;  2JTT A;  1F70 A;  2BCX A;  2KYF A;  2KYC A;  2PMY A;  3SG2 A;  4GGN A;  3D76 A;  2Y1N A;  2MLF C;  2ZFD A;  3PLF B;  2CBL A;  3QRX A;  1YVL A;  1G4Y R;  3LCP C;  2KDH A;  1WRK A;  1SCM B;  4NDD A;  3LK0 A;  1M46 A;  1XFR A;  2I18 A;  1SYM A;  4YGB B;  2LHI A;  5F6T A;  4I5N B;  2MHH A;  1IRJ A;  3BUW B;  1Y6W A;  4C0K A;  5JJG A;  2F8P A;  2M3W A;  3C1V A;  1A03 A;  3BOW A;  3NXA A;  1C3Y A;  1UUR A;  3CLN A;  2IS9 A;  3EK4 A;  3PFV A;  1NX3 A;  1REC A;  1QAS A;  2JRF A;  4HSZ A;  3S0G A;  5CSJ A;  1XFZ O;  3A8R A;  3D75 A;  3DVJ A;  1F8H A;  1XFV O;  2K7O A;  3K21 A;  2JU0 A;  3O6B A;  1QLS A;  2LE9 B;  3OB2 B;  4A4C A;  4KYN A;  4TNC A;  2BBM A;  4QJ5 B;  1CNP A;  3DF0 A;  1JF2 A;  2LAP A;  2Y1M A;  4QJ4 B;  3PJI A;  3CTN A;  1VRK A;  1KFU L;  1IJ5 A;  1NSH A;  2LVI A;  1OW4 A;  2Q91 A;  3CR2 A;  3BUN B;  3IQO A;  2NLN A;  3CS1 A;  2O60 A;  1ZMZ A;  1SY9 A;  1SNL A;  4GAO A;  4ORC B;  4AQI A;  4N1F A;  5AEQ A;  3TZ1 A;  1M63 B;  5HKW A;  2K2F A;  3CGA A;  3EVU A;  2K7B A;  2EGD A;  2I7A A;  2BAP A;  4YI9 A;  3VRN A;  1NWD A;  5KU1 A;  1H8B A;  1KK7 Z;  3R1O A;  4F7F A;  3H4S E;  2KLE A;  4WRI A;  1EH2 A;  1MUX A;  1Z4H A;  2F2O A;  2F3Y A;  2OS8 B;  1A75 B;  1DJW A;  2NZ0 A;  4C0J A;  2JZI A;  2QEB A;  1UHI A;  1B4C A;  5DKN A;  1DC1 A;  3L4L A;  2R2I A;  4YRU A;  1HQV A;  3FS7 A;  2BKH B;  4FQT A;  3PN7 B;  4OZD A;  3UO9 A;  3DYE A;  1EG4 A;  2HQ8 A;  2LLT A;  1EJ3 A;  4PDZ A;  5ER4 X;  1UHN A;  1TN4 A;  2JQ6 A;  2H8V A;  2KLD A;  2Q4U A;  3FE8 A;  4CLN A;  2L51 A;  2LLS A;  1S36 A;  1KSO A;  2LV7 A;  1GM0 A;  1IGV A;  3BQ3 A;  3VB1 A;  3WNX B;  1B9A A;  3B86 A;  3JTD C;  1QVI Z;  1PSR A;  1WLM A;  5HL1 A;  5BPJ A;  1CM4 A;  1S6C A;  4JWQ A;  1BMO A;  1XVJ A;  4PE1 A;  2ISD A;  2NXQ A;  2AMI A;  1DF0 A;  2E30 A;  4PHM A;  3D74 A;  4XJK B;  1G8I A;  1JWD A;  1QIW A;  4U8D A;  4YGA A;  1CFF A;  4DIR A;  3OBV A;  1GGZ A;  1SKT A;  1BG1 A;  2COL B;  1DMO A;  1QTX A;  1NCX A;  2PAL A;  1UHK A;  5I2L A;  4INW A;  1CTR A;  2L2E A;  1J1D A;  4I5J A;  3CDN A;  1B8L A;  3V2L A;  2KBI A;  3R1V A;  4MVF A;  3QME A;  1DJI A;  2QEO A;  1SW8 A;  3TUY C;  3D10 A;  1A2X A;  2A4J A;  3I5G B;  2WND A;  1S6J A;  4NQG A;  1DVI A;  4NDB A;  3DXL A;  3OGN A;  3Q8I A;  2MBX A;  1PK0 D;  2BL0 B;  1G33 A;  2ZKM X;  3CZ0 A;  4GFT A;  3LLE A;  4GBA A;  3OP0 A;  1ZAC A;  1GQM A;  1SR6 B;  2ZRT A;  1V1F A;  2NCP A;  3KF9 A;  2QAC A;  4R1E A;  2KI6 D;  5J3X A;  3FWC A;  2BEC A;  1Y1X A;  4ICB A;  2WCH A;  2WCJ A;  3I5H C;  1JSA A;  1AVS A;  1DJX A;  2QDI A;  1YR5 A;  1PVB A;  1S5G Z;  3DZT A;  5DIC A;  1CDL A;  1K8U A;  2KAV A;  4USL A;  3AKB A;  1Y0V H;  1RFJ A;  4YGD B;  1LIN A;  3NHI A;  4PCW A;  1J55 A;  2LMU A;  3KEV A;  1MWN A;  3AAK A;  1JFJ A;  1ALW A;  3SS3 A;  4OVN F;  3GOF A;  2BBN A;  2PVB A;  5KSZ A;  3S0E A;  4IJ7 A;  1F4Q A;  2I2R E;  1M45 A;  1YRU B;  1W9Z A;  2G2B A;  1KFX S;  2JC2 A;  3SG6 A;  3BXK A;  1IG5 A;  1BJF A;  3HX4 A;  5HLV A;  1B8R A;  1RRO A;  1SCV A;  2NCO A;  1TOP A;  2Y5I A;  1KWO B;  1AJ5 A;  2ZND A;  1QIV A;  1SBJ A;  1S5G Y;  4I5K A;  1OSA A;  5CPV A;  3JTD B;  4MEW A;  3TDU A;  1FPW A;  1YVH A;  2GV5 A;  2Y4Q A;  2QEH A;  3R72 A;  4OKH A;  1Q80 A;  1OOH A;  2H2K A;  1Y1A A;  1R6P A;  3AKA A;  3MSE B;  3F45 A;  2M7L A;  3B87 A;  1K93 D;  5K89 A;  1TNQ A;  2K60 A;  1BF5 A;  1C7V A;  1TUZ A;  2WCB A;  3BUO B;  4MLW A;  1OMV A;  1C07 A;  1W7I B;  1MXL C;  2WCK A;  1CDN A;  2GGZ A;  2LP3 A;  3D77 A;  3NSK A;  3CYZ A;  4PT1 A;  3S0D A;  5HLO A;  1C3Z A;  2KPH A;  4AOM A;  3D0Y B;  1NX0 A;  3NSI A;  1N2D A;  3EVV A;  3GK4 X;  3PAL A;  5JOL A;  1RJV A;  3SIB A;  3CR4 X;  4E68 A;  3PM8 A;  2LVJ A;  3EK8 A;  5CSN A;  1XFY O;  3WHU B;  3EKJ A;  2L5Y A;  2CT9 A;  2BCB A;  3PM2 A;  4OV2 A;  3TUY B;  1B7T Z;  5HYD A;  1XFX O;  3CZT X;  3KHE A;  2LAN A;  1S3P A;  3DVM A;  3OB1 B;  4PHK A;  4WQ2 A;  3BJH A;  1YX7 A;  1CDM A;  2BNX A;  4NDC A;  3CWG A;  4BY5 A;  1NIW A;  2WC5 A;  2JT8 A;  1B47 A;  4WQ3 A;  1WRZ A;  3B88 A;  1NYA A;  1CDP A;  1OQP A;  3I5H B;  1NPQ A;  4AQJ A;  1CLM A;  2KHN A;  1YTZ C;  1KK8 C;  1CM1 A;  2K8M B;  3B7A A;  3EVR A;  2F3Z A;  1XK4 A;  1DJY A;  3NSL A;  3OX6 A;  4JPZ B;  3I5F C;  3L4A A;  1AJ4 A;  2M8U A;  5I94 A;  5PAL A;  1U5I B;  1RK9 A;  2LCP A;  1DGV A;  3KO0 A;  4N1G A;  3WHT B;  2V53 A;  1TUJ A;  1JUO A;  3CZ2 A;  1XK4 C;  3LL8 B;  2KFF A;  1NCZ A;  1KK7 Y;  1BOC A;  3HCM A;  1CMF A;  5DKQ A;  2M7N A;  3O4Y A;  3PAT A;  4GUK A;  1PVA A;  1DQE A;  2WOS A;  2LVV A;  1YUU A;  1L7Z A;  2JXL A;  1NX2 A;  5CSI A;  2WCM A;  2F2P A;  1K9P A;  2JNX A;  2HQW A;  1BLQ A;  1YUT A;  2L4H A;  3K1E A;  2KFH A;  3O2P A;  4MSP A;  1L2O C;  2K7C A;  5AXI A;  1EG3 A;  2JUL A;  2LVK A;  3GK2 A;  1OMD A;  2SAS A;  3O4X A;  1BU3 A;  4HRG A;  1QWV A;  2GGM A;  1PSB A;  1FW4 A;  1S26 D;  2M9G A;  3E3R A;  3UNW A;  2FJY A;  2LM5 A;  2OPO A;  5D7F A;  1M31 A;  1QLK A;  2M1K B;  1MQ1 A;  5I2O A;  2WCL A;  2KAX A;  1QVI Y;  3BUM B;  2CNP A;  4ORA B;  1HT9 A;  3SS5 A;  1FI6 A;  1TNX A;  1J7P A;  1CFD A;  1TCF A;  3BOW B;  2L0P A;  1UP5 A;  3EG5 B;  2F33 A;  1DJZ A;  2JOJ A;  1T14 A;  4YGE B;  1NUB A;  1ZOT B;  2LUC A;  2EC6 C;  3SIA A;  3VRR A;  1F71 A;  3D78 A;  4HRH A;  1M39 A;  3M0W A;  1H4B A;  1Z2C B;  1DJG A;  4PAL A;  2TN4 A;  2HF5 A;  4INX A;  1OE9 B;  1JF0 A;  3CAB A;  4GNK B;  2JPT A;  5CSF A;  1FI5 A;  1J1E A;  1K96 A;  2JTZ A;  3CZ1 A;  3DF0 B;  1QX5 B;  3VRQ A;  5ER5 A;  5I8N A;  1XA5 A;  2PQL A;  3CR5 X;  4M2Q A;  1SRA A;  2QPT A;  4PE0 A;  2M1U A;  1ORG A;  1X02 A;  1OZS A;  2VRG A;  1Y1U A;  2WCF A;  4CPV A;  2K2A A;  1LXF C;  1UWO A;  1GJY A;  5AFP A;  1WDC C;  1A75 A;  1K90 D;  1YUR A;  2DOQ A;  1QS7 A;  3TS5 C;  3KPX A;  3SG4 A;  1TNW A;  1NP8 A;  1KK8 B;  1NCY A;  2KSP A;  2LMV A;  3I5I C;  2LMT A;  1CFP A;  3D73 A;  3NHT A;  1GGW A;  1V1G A;  1KCY A;  1LS8 A;  1UHJ A;  3JVT C;  4PHN A;  1IQ5 A;  2JT3 A;  2MJW B;  1OOJ A;  2BKI B;  3DD4 A;  3IQQ A;  1XO5 A;  3DVK A;  2M97 A;  2MLE C;  4DS7 A;  2FOT A;  2EHB A;  1EL4 A;  1BR4 B;  4ETO A;  3BUX B;  4CID A;  5I2Q A;  2QEV A;  1XYD A;  1UUS A;  4MZJ A;  4PHJ A;  3VRO A;  4DCK A;  2L2C A;  1TTX A;  3ICB A;  1SL9 A;  2ERB A;  1AUI B;  4YBH B;  1TNP A;  1MXE A;  2P71 A;  4MZL A;  4YI8 A;  1KSM A;  4C0L A;  1MHO A;  1LA0 A;  2B1U A;  2PAS A;  4XJK A;  3ZWH A;  2LUX A;  2MRD A;  4YGC B;  1CFC A;  1JFK A;  2LHL A;  5IBW A;  1AP4 A;  1D1O A;  4ZCU A;  1AHR A;  1LKJ A;  1DF0 B;  1OZO A;  1PAL A;  2O5G A;  2KGB C;  4DRW A;  5FI6 A;  4PE4 A;  3LK1 A;  4PE7 A;  1YRT B;  4JKT A;  4HRE E;  3FE9 A;  4D1E A;  1LVC D;  2EC6 B;  1IQ3 A;  2JNF A;  1QAT A;  3ZNI A;  4L9M A;  2KOT A;  2L4I A;  1TRF A;  1F4O A;  5FYX A;  2I94 A;  1MR8 A;  1K9U A;  4P5O E;  5TNC A;  2CCM A;  1FBV A;  3A4U B;  3I5G C;  2ZN9 A;  1BT6 A;  2PSR A;  3OX5 A;  4GGF A;  1CB1 A;  2ZN8 A;  1KQM C;  1BOD A;  1PUL A;  1W7J B;  1ZFS A;  2KQ6 A;  2BL0 C;  5GQQ C;  3NSO A;  2KFG A;  4ZCV A;  3SS4 A;  3EK7 A;  2P70 A;  5KTY A;  5HKY A;  1TCO B;  1UHH A;  4GGF C;  1SR6 C;  1CKK A;  1IH0 A;  1LA3 A;  1EXR A;  2KNE A;  3AAJ A;  3RM1 A;  1QJT A;  5AAN A;  1SPY A;  1B7T Y;  2GTE A;  1WDC B;  1CMG A;  3TS5 B;  2WOR A;  1MF8 B;  2KI6 C;  2BE4 A;  1C7W A;  2K7D A;  3SG3 A;  3TDI A;  3S0B A;  3I5I B;  1OOF A;  1ALV A;  2CTN A;  1DT7 B;  1E8A A;  1DGU A;  2CXJ A;  4OCI A;  3GK1 A;  2G9B A;  1DJH A;  3JVT B;  1XFU O;  1BR1 B;  2ZRS A;  2OTG C;  1RTP 1;  4A4B A;  4CFQ A;  2HET A;  3FWB A;  1R2U A;  2LNK A;  2HPS A;  1CLB A;  1TIZ A;  4BY4 A;  1IJ6 A;  2FCD A;  2LC5 A;  2KI4 C;  3FIA A;  1P28 A;  2PRU A;  4M2O A;  1KFX L;  1FF1 A;  1QV1 A;  1RWY A;  1S6I A;  2M49 B;  3BFA A;  1NX1 A;  1KWO C;  2SCP A;  4MN0 A;  3S0F A;  1SCM C;  1N65 A;  5EL2 A;  1K94 A;  1PRW A;  2YGU A;  3RLZ A;  4MRX A;  1OOG A;  2JT0 A;  3VGO A;  3RZS A;  1YX8 A;  2MAZ A;  1SSE B;  1KQV A;  3BYA A;  1ODB A;  1AK8 A;  4P2Y B;  1XFW O;  1OMR A;  1A29 A;  1KFU S;  2AAO A;  2K61 A;  2MA2 A;  1A4P A;  2KGR A;  2WCE A;  3R1P A;  4JQ0 D;  4DUQ A;  3D0Y A;  4GPL B;  4JD9 A;  3S0A A;  2L5X B;  5HKZ A;  1SK6 D;  2RGI A;  3FE6 A;  2FCE A;  3O78 A;  4MRY A;  1QX2 A;  5DKR A;  1YUS A;  4OR9 B;  3EKH A;  3SJS A;  3WXA A;  1J7R A;  2WC8 A;  1DEL A;  2D8N A;  4Q04 A;  3IF7 A;  5FI7 A;  2BCA A;  1CLL A;  2WC6 A;  1SMG A;  1JBA A;  4IL1 A;  1IWQ A;  1JC2 A;  3NGV A;  4CFR A;  2JXC A;  2FJU B;  2L98 A;  1QX7 A;  1ZUZ A;  4QJ3 B;  3L47 A;  4I5L B;  1J7Q A;  1WY9 A;  1KQM B;  2H61 A;  1J7O A;  1SL8 A;  2E6W A;  1TWO A;  2LP2 A;  4M2P A;  2JWW A;  1B1G A;  1F55 A;  1WRL A;  5AER A;  5B8I B;  1IIO A;  5FI2 A;  2AUC A;  1K95 A;  2KQY A;  1DTL A;  3VRP A;  1DEK A;  4N5X A;  1OOI X;  1F54 A;  2OS8 C;  3I5F B;  2H61 C;  4MZK A;  2JPO A;  3TDZ A;  1K2H A;  1K9K A;  3DY9 A;  3N7H A;  2M29 A;  1U5I A;  1B8C A;  3PN7 C;  5G08 A;  3BFH A;  4MBE A;  1N0Y A;  2PYQ A; 
#chains in the Genus database with same CATH homology
 3DVE A;  1WLZ A;  4ORB B;  3SG5 A;  2LLU A;  4F0Z B;  1QV0 A;  2ZNE A;  1QXP A;  1S1E A;  1IKU A;  1SL7 A;  4FTG A;  2KBM A;  2OTG B;  4FQO A;  3PSR A;  4XYN A;  3OHM B;  5D69 A;  4UPG A;  1L2O B;  2P6B B;  2L50 A;  3SG7 A;  2K0J A;  2KAY A;  2BE6 A;  2KI4 B;  2M0R A;  2JTT A;  1F70 A;  2BCX A;  2KYF A;  2KYC A;  2PMY A;  3SG2 A;  2Y1N A;  2MLF C;  2ZFD A;  3PLF B;  2CBL A;  3QRX A;  1YVL A;  1G4Y R;  3LCP C;  2KDH A;  1WRK A;  1SCM B;  4NDD A;  3LK0 A;  1M46 A;  2I18 A;  1SYM A;  4YGB B;  2LHI A;  5F6T A;  4I5N B;  2MHH A;  1IRJ A;  3BUW B;  1Y6W A;  4C0K A;  5JJG A;  2F8P A;  2M3W A;  3C1V A;  1A03 A;  3BOW A;  3NXA A;  1UUR A;  3CLN A;  2IS9 A;  3EK4 A;  3PFV A;  1NX3 A;  1REC A;  1QAS A;  2JRF A;  4HSZ A;  5CSJ A;  1XFZ O;  3A8R A;  1F8H A;  3DVJ A;  1XFV O;  2K7O A;  3K21 A;  2JU0 A;  3O6B A;  1QLS A;  2LE9 B;  3OB2 B;  4A4C A;  4TNC A;  2BBM A;  4QJ5 B;  1CNP A;  3DF0 A;  1JF2 A;  2LAP A;  2Y1M A;  4QJ4 B;  3CTN A;  1VRK A;  1KFU L;  1IJ5 A;  1NSH A;  2LVI A;  2Q91 A;  3CR2 A;  3BUN B;  3IQO A;  2NLN A;  3CS1 A;  2O60 A;  1ZMZ A;  1SY9 A;  1SNL A;  4GAO A;  4ORC B;  4AQI A;  4N1F A;  5AEQ A;  3TZ1 A;  1M63 B;  5HKW A;  2K2F A;  3CGA A;  3EVU A;  2K7B A;  2EGD A;  2I7A A;  4YI9 A;  3VRN A;  5KU1 A;  1NWD A;  1H8B A;  1KK7 Z;  3H4S E;  4WRI A;  1EH2 A;  1MUX A;  2F2O A;  2F3Y A;  2OS8 B;  1A75 B;  1DJW A;  2NZ0 A;  4C0J A;  2JZI A;  1B4C A;  1UHI A;  5DKN A;  2R2I A;  4YRU A;  1HQV A;  3FS7 A;  2BKH B;  3PN7 B;  1EG4 A;  2HQ8 A;  2LLT A;  1EJ3 A;  4PDZ A;  5ER4 X;  1UHN A;  1TN4 A;  2JQ6 A;  2Q4U A;  4CLN A;  2L51 A;  2LLS A;  1S36 A;  1KSO A;  2LV7 A;  1IGV A;  3BQ3 A;  3WNX B;  1B9A A;  3JTD C;  1QVI Z;  1PSR A;  1WLM A;  5BPJ A;  1CM4 A;  1S6C A;  4JWQ A;  1BMO A;  1XVJ A;  4PE1 A;  2ISD A;  2NXQ A;  2AMI A;  1DF0 A;  2E30 A;  4PHM A;  4XJK B;  1G8I A;  1JWD A;  1QIW A;  4U8D A;  4YGA A;  1CFF A;  4DIR A;  1GGZ A;  1SKT A;  1BG1 A;  2COL B;  1DMO A;  1QTX A;  1NCX A;  2PAL A;  1UHK A;  5I2L A;  1CTR A;  2L2E A;  1J1D A;  4I5J A;  1B8L A;  2KBI A;  4MVF A;  1DJI A;  1SW8 A;  3TUY C;  3D10 A;  1A2X A;  2A4J A;  3I5G B;  2WND A;  1S6J A;  4NQG A;  1DVI A;  4NDB A;  2MBX A;  1PK0 D;  2BL0 B;  1G33 A;  2ZKM X;  4GFT A;  3LLE A;  4GBA A;  3OP0 A;  1ZAC A;  1GQM A;  1SR6 B;  2ZRT A;  1V1F A;  2NCP A;  3KF9 A;  2QAC A;  4R1E A;  2KI6 D;  5J3X A;  3FWC A;  2BEC A;  1Y1X A;  4ICB A;  3I5H C;  1JSA A;  1AVS A;  1DJX A;  1YR5 A;  1PVB A;  1S5G Z;  1CDL A;  1K8U A;  2KAV A;  4USL A;  3AKB A;  1Y0V H;  1RFJ A;  4YGD B;  1LIN A;  4PCW A;  1J55 A;  2LMU A;  3KEV A;  1MWN A;  3AAK A;  1JFJ A;  1ALW A;  4OVN F;  3GOF A;  2BBN A;  2PVB A;  5KSZ A;  1F4Q A;  2I2R E;  1M45 A;  1YRU B;  2G2B A;  3SG6 A;  1KFX S;  2JC2 A;  3BXK A;  1IG5 A;  1BJF A;  3HX4 A;  5HLV A;  1B8R A;  1RRO A;  1SCV A;  2NCO A;  1TOP A;  2Y5I A;  1KWO B;  1AJ5 A;  2ZND A;  1QIV A;  1SBJ A;  1S5G Y;  4I5K A;  1OSA A;  5CPV A;  3JTD B;  4MEW A;  3TDU A;  1FPW A;  1YVH A;  2GV5 A;  2Y4Q A;  4OKH A;  1Q80 A;  2H2K A;  1Y1A A;  1R6P A;  3AKA A;  3MSE B;  3F45 A;  2M7L A;  1BF5 A;  1K93 D;  5K89 A;  1TNQ A;  1C7V A;  2WCB A;  3BUO B;  4MLW A;  1OMV A;  1C07 A;  1W7I B;  1MXL C;  1CDN A;  2GGZ A;  2LP3 A;  3NSK A;  5HLO A;  4AOM A;  3D0Y B;  1NX0 A;  3NSI A;  1N2D A;  3EVV A;  3GK4 X;  3PAL A;  5JOL A;  1RJV A;  3SIB A;  3CR4 X;  4E68 A;  3PM8 A;  2LVJ A;  3EK8 A;  5CSN A;  1XFY O;  3WHU B;  3EKJ A;  2CT9 A;  2BCB A;  4OV2 A;  3TUY B;  1B7T Z;  5HYD A;  1XFX O;  3CZT X;  3KHE A;  2LAN A;  1S3P A;  3DVM A;  3OB1 B;  4PHK A;  4WQ2 A;  1YX7 A;  1CDM A;  4NDC A;  3CWG A;  4BY5 A;  1NIW A;  2JT8 A;  1B47 A;  4WQ3 A;  1WRZ A;  1NYA A;  1CDP A;  1OQP A;  3I5H B;  1NPQ A;  4AQJ A;  1CLM A;  2KHN A;  1YTZ C;  1KK8 C;  1CM1 A;  2K8M B;  3EVR A;  2F3Z A;  1XK4 A;  1DJY A;  3NSL A;  3OX6 A;  4JPZ B;  3I5F C;  1AJ4 A;  2M8U A;  5PAL A;  1U5I B;  1RK9 A;  2LCP A;  1DGV A;  3KO0 A;  4N1G A;  3WHT B;  2V53 A;  1JUO A;  1XK4 C;  3LL8 B;  2KFF A;  1NCZ A;  1KK7 Y;  1BOC A;  3HCM A;  1CMF A;  5DKQ A;  2M7N A;  3O4Y A;  3PAT A;  4GUK A;  1PVA A;  2WOS A;  2LVV A;  1YUU A;  1L7Z A;  2JXL A;  1NX2 A;  5CSI A;  2F2P A;  1K9P A;  2JNX A;  2HQW A;  1BLQ A;  1YUT A;  2L4H A;  2KFH A;  3O2P A;  4MSP A;  1L2O C;  2K7C A;  5AXI A;  1EG3 A;  2JUL A;  2LVK A;  3GK2 A;  1OMD A;  2SAS A;  1BU3 A;  4HRG A;  2GGM A;  1PSB A;  1FW4 A;  1S26 D;  2M9G A;  3E3R A;  2LM5 A;  2OPO A;  5D7F A;  1M31 A;  1QLK A;  2M1K B;  1MQ1 A;  5I2O A;  2KAX A;  1QVI Y;  3BUM B;  2CNP A;  4ORA B;  1HT9 A;  1FI6 A;  1TNX A;  1J7P A;  1CFD A;  1TCF A;  3BOW B;  2L0P A;  1UP5 A;  2F33 A;  1DJZ A;  2JOJ A;  4YGE B;  1NUB A;  1ZOT B;  2LUC A;  2EC6 C;  3SIA A;  3VRR A;  1F71 A;  4HRH A;  1M39 A;  3M0W A;  1H4B A;  1DJG A;  4PAL A;  2TN4 A;  2HF5 A;  1OE9 B;  1JF0 A;  4GNK B;  2JPT A;  5CSF A;  1FI5 A;  1J1E A;  1K96 A;  2JTZ A;  3DF0 B;  1QX5 B;  3VRQ A;  5ER5 A;  5I8N A;  1XA5 A;  3CR5 X;  4M2Q A;  1SRA A;  2QPT A;  4PE0 A;  2M1U A;  1X02 A;  4CPV A;  1OZS A;  2VRG A;  1Y1U A;  2WCF A;  2K2A A;  1LXF C;  1UWO A;  1GJY A;  5AFP A;  1WDC C;  1A75 A;  1K90 D;  1YUR A;  2DOQ A;  1QS7 A;  3TS5 C;  3KPX A;  3SG4 A;  1TNW A;  1NP8 A;  1KK8 B;  1NCY A;  2KSP A;  2LMV A;  3I5I C;  2LMT A;  1CFP A;  1GGW A;  1V1G A;  1KCY A;  1UHJ A;  3JVT C;  4PHN A;  1IQ5 A;  2JT3 A;  2MJW B;  1OOJ A;  2BKI B;  3DD4 A;  3IQQ A;  1XO5 A;  3DVK A;  2M97 A;  2MLE C;  4DS7 A;  2FOT A;  2EHB A;  1EL4 A;  1BR4 B;  4ETO A;  3BUX B;  4CID A;  5I2Q A;  1XYD A;  1UUS A;  4MZJ A;  4PHJ A;  3VRO A;  4DCK A;  1TTX A;  3ICB A;  1SL9 A;  1AUI B;  4YBH B;  1TNP A;  1MXE A;  4MZL A;  4YI8 A;  1KSM A;  4C0L A;  1MHO A;  1LA0 A;  2B1U A;  2PAS A;  4XJK A;  3ZWH A;  2LUX A;  2MRD A;  4YGC B;  1CFC A;  1JFK A;  2LHL A;  5IBW A;  1AP4 A;  1D1O A;  4ZCU A;  1AHR A;  1LKJ A;  1DF0 B;  1OZO A;  1PAL A;  2O5G A;  2KGB C;  4DRW A;  4PE4 A;  3LK1 A;  4PE7 A;  1YRT B;  4HRE E;  4D1E A;  1LVC D;  2EC6 B;  1IQ3 A;  2JNF A;  1QAT A;  3ZNI A;  4L9M A;  2KOT A;  2L4I A;  1TRF A;  1F4O A;  5FYX A;  2I94 A;  1MR8 A;  1K9U A;  4P5O E;  5TNC A;  2CCM A;  1FBV A;  3A4U B;  3I5G C;  2ZN9 A;  1BT6 A;  2PSR A;  3OX5 A;  4GGF A;  1CB1 A;  2ZN8 A;  1KQM C;  1BOD A;  1PUL A;  1W7J B;  1ZFS A;  2KQ6 A;  2BL0 C;  5GQQ C;  3NSO A;  2KFG A;  4ZCV A;  3EK7 A;  5KTY A;  5HKY A;  1TCO B;  1UHH A;  4GGF C;  1SR6 C;  1CKK A;  1IH0 A;  1LA3 A;  1EXR A;  2KNE A;  3AAJ A;  3RM1 A;  1QJT A;  5AAN A;  1SPY A;  1B7T Y;  1WDC B;  1CMG A;  3TS5 B;  2WOR A;  1MF8 B;  2KI6 C;  2BE4 A;  1C7W A;  2K7D A;  3SG3 A;  3TDI A;  3I5I B;  2CTN A;  1ALV A;  1DT7 B;  1E8A A;  1DGU A;  2CXJ A;  4OCI A;  3GK1 A;  2G9B A;  1DJH A;  3JVT B;  1XFU O;  1BR1 B;  2ZRS A;  2OTG C;  1RTP 1;  4A4B A;  4CFQ A;  2HET A;  3FWB A;  1R2U A;  2LNK A;  2HPS A;  1CLB A;  1TIZ A;  4BY4 A;  1IJ6 A;  2FCD A;  2LC5 A;  2KI4 C;  3FIA A;  2PRU A;  4M2O A;  1KFX L;  1FF1 A;  1QV1 A;  1RWY A;  1S6I A;  2M49 B;  1NX1 A;  1KWO C;  2SCP A;  4MN0 A;  1SCM C;  1N65 A;  1K94 A;  1PRW A;  3RLZ A;  3VGO A;  4MRX A;  2JT0 A;  1YX8 A;  2MAZ A;  1KQV A;  3BYA A;  1ODB A;  1AK8 A;  4P2Y B;  1XFW O;  1OMR A;  1A29 A;  1KFU S;  2AAO A;  2K61 A;  2MA2 A;  1A4P A;  2KGR A;  2WCE A;  4JQ0 D;  4DUQ A;  3D0Y A;  4GPL B;  2L5X B;  5HKZ A;  1SK6 D;  2RGI A;  4MRY A;  2FCE A;  3O78 A;  1QX2 A;  5DKR A;  1YUS A;  4OR9 B;  3EKH A;  3SJS A;  3WXA A;  1J7R A;  2WC8 A;  2D8N A;  4Q04 A;  3IF7 A;  2BCA A;  1CLL A;  1SMG A;  1JBA A;  4IL1 A;  1IWQ A;  1JC2 A;  4CFR A;  2JXC A;  2FJU B;  2L98 A;  1QX7 A;  1ZUZ A;  4QJ3 B;  4I5L B;  1J7Q A;  1WY9 A;  1KQM B;  2H61 A;  1J7O A;  1SL8 A;  2E6W A;  2LP2 A;  4M2P A;  1B1G A;  2JWW A;  1F55 A;  1WRL A;  5AER A;  5B8I B;  2AUC A;  1K95 A;  2KQY A;  1DTL A;  3VRP A;  4N5X A;  1F54 A;  2OS8 C;  3I5F B;  2H61 C;  4MZK A;  1K2H A;  3TDZ A;  1K9K A;  2M29 A;  1U5I A;  1B8C A;  3PN7 C;  5G08 A;  4MBE A;  1N0Y A;  4GGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...