1TNQA

Structures of the apo and calcium troponin-c regulatory domains: the muscle contraction switch
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
90
structure length
90
Chain Sequence
ASMTDQQAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium-binding protein
molecule keywords TROPONIN-C
publication title Structures of the troponin C regulatory domains in the apo and calcium-saturated states.
pubmed doi rcsb
source organism Gallus gallus
total genus 12
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 1995-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1tnqA00
2ZNEA 1KK7Z 5D7FA 1QX7A 2EHBA 4L9MA 1SNLA 1TTXA 1IGVA 1NX3A 3BYAA 1NCYA 2JULA 3RM1A 3GK4X 1QIWA 1U5IA 3WHTB 1XFUO 1EH2A 1R2UA 1IRJA 2L51A 1AHRA 3NSIA 4N1GA 1PALA 3KO0A 5KTYA 3BUXB 1KCYA 1LXFC 4CLNA 1FI5A 1K9UA 4YI8A 3AAKA 1U5IB 1YUUA 1QVIY 2LP3A 1M39A 1KK7Y 2I94A 2MBXA 3OB2B 1DJGA 1RROA 2KBMA 4PE7A 1BR1B 1CFPA 2P6BB 2B1UA 1K8UA 1TN4A 1W7JB 4AQJA 3H4SE 1B47A 1BJFA 1LA0A 2WORA 4HSZA 1IH0A 1PRWA 2BECA 3PFVA 1ZACA 2PALA 2F8PA 1NCXA 1SKTA 4MZKA 4OVNF 1G4YR 1DGUA 3SIAA 2WCFA 2ZNDA 1RFJA 4DCKA 4U8DA 4GGNA 4MLWA 1HQVA 1X02A 3BUWB 1CKKA 4Q04A 3TDUA 1BF5A 4ORCB 1DMOA 3LK0A 2CBLA 2COLB 1JUOA 3JVTB 2OS8B 2FCEA 3EKHA 1AJ4A 3IQQA 3A8RA 2KGBC 4P2YB 1BR4B 2Y4QA 1GQMA 2LP2A 5I2LA 1OMVA 1S5GZ 1OQPA 3SIBA 4TNCA 3WHUB 4YGEB 1SMGA 3NSLA 1OE9B 4CFRA 2K61A 1KFXL 2WCBA 1DJXA 1OZSA 4HRHA 1C7VA 1NUBA 3PN7C 3ZNIA 3O78A 2KQ6A 1CLLA 2KNEA 1UHJA 2IS9A 1IJ6A 1UHKA 2LHLA 1NYAA 3DVMA 2MLFC 2LNKA 1S3PA 2BL0B 2JNFA 2JOJA 4JWQA 3VRNA 4GGFA 4ZCUA 2Q91A 1GGZA 1S5GY 1SR6C 1K96A 1NX1A 3LL8B 1BODA 5HKZA 1NX2A 1IKUA 1S6IA 1QATA 4WRIA 2WOSA 1QLSA 1JF0A 2JZIA 2AUCA 2K7OA 3EKJA 1CB1A 3IQOA 3MSEB 3OB1B 3SG6A 2OPOA 1QLKA 1TCOB 4PHJA 5K89A 1M46A 1J55A 1MUXA 2V53A 3DF0B 2D8NA 1A4PA 4QJ3B 1WY9A 2L98A 1WDCC 2BE4A 1HT9A 1KFUL 3AKAA 4FTGA 3TUYB 2JT0A 2R2IA 5CSNA 3ZWHA 1MXEA 4WQ3A 3GK2A 2K8MB 1RWYA 1CNPA 3OX6A 2AAOA 2BCAA 2FCDA 2FJUB 2RGIA 2WCEA 1DGVA 3DVEA 5GQQC 5TNCA 4AOMA 1N2DA 5G08A 4YI9A 2BKHB 3PN7B 2H2KA 1B9AA 1S6JA 3DVKA 2LHIA 4ICBA 4IL1A 5FYXA 3BUOB 1LINA 2LMVA 3GK1A 2MJWB 2MLEC 3CR5X 1KWOB 1RK9A 2JXCA 1AUIB 1ALVA 1K94A 2KAYA 1QV1A 2HPSA 2ZFDA 1WRKA 3I5FC 1OZOA 2LM5A 1PULA 2JTZA 2LLSA 1SR6B 3EVUA 1CLBA 3CS1A 1BG1A 1GJYA 3RLZA 1YX7A 1DJIA 1L2OC 2LVIA 1C07A 1F4OA 1IQ3A 1F8HA 4YGAA 4CIDA 4MVFA 2JC2A 2ZN8A 2L50A 4WQ2A 1Y1XA 2M7LA 2G2BA 1EG3A 2NCPA 2FOTA 2KI4C 4PDZA 1IQ5A 1WRZA 3I5IC 3SG4A 1CFCA 4MBEA 3OP0A 2CT9A 4GBAA 2K7CA 2WNDA 2E6WA 2M1UA 1ZMZA 3K21A 1BMOA 2JNXA 1EJ3A 1K9PA 3OX5A 1NSHA 1FBVA 4MZJA 1BT6A 1XFVO 2LMTA 1XFWO 4JPZB 3ICBA 1G8IA 4PE1A 2KSPA 2BCBA 3D0YB 2KOTA 2HQ8A 1CM4A 3FIAA 2H61A 2M8UA 5B8IB 4NQGA 3KF9A 1QV0A 1A29A 3HCMA 1BLQA 5DKNA 2Y1NA 1F71A 1EL4A 1L7ZA 1QX2A 4MN0A 1RTP1 3SG5A 2NLNA 3I5FB 3PATA 1DTLA 2I2RE 3CGAA 1TNXA 3C1VA 3I5GC 2LE9B 1B1GA 3OHMB 5HLOA 1NP8A 2I7AA 3FWBA 3BUMB 2KFFA 1OMRA 2KGRA 5I2OA 1CDMA 3CR2A 2GGZA 1D1OA 1F54A 1ZOTB 1QASA 1K95A 1S6CA 1YUTA 1QTXA 2HQWA 1KQMC 1NWDA 2KI4B 1KFXS 1KSOA 1XFXO 2MA2A 3TS5C 2SCPA 5I8NA 1JWDA 3I5IB 3EK8A 3KHEA 1RJVA 2A4JA 2DOQA 3M0WA 4P5OE 4PALA 5JJGA 3VRQA 2K7DA 1W7IB 2LLUA 2HETA 2MRDA 5CPVA 1UUSA 2M97A 3FWCA 2NZ0A 2MHHA 3O2PA 5J3XA 2PVBA 1Q80A 4XJKA 5HLVA 2GGMA 1OSAA 1DVIA 4A4BA 2JXLA 1CMGA 3LLEA 4NDDA 5BPJA 2LMUA 4DS7A 3WNXB 5KU1A 1TNQA 1H8BA 1XYDA 4XJKB 3DF0A 4R1EA 4YRUA 1SCMC 3I5HC 1LA3A 1B7TZ 5DKRA 3QRXA 3EVRA 1S26D 1F55A 5CSJA 1R6PA 5PALA 3I5GB 1F4QA 2QACA 2KQYA 1DF0A 4DRWA 1DJWA 2HF5A 2QPTA 1UHNA 3IF7A 3KPXA 3BUNB 1TNPA 1XK4C 2M9GA 4M2OA 2JU0A 1KFUS 3SG3A 2G9BA 2JRFA 2NCOA 4ZCVA 2L5XB 1J1EA 2F2PA 4PHMA 1CDNA 1SY9A 1DF0B 1K9KA 5AANA 1YVLA 2BBMA 5AERA 1B7TY 1V1FA 2LVJA 4CPVA 1YTZC 1YR5A 2SASA 3TS5B 1NIWA 5DKQA 1TCFA 2JPTA 4AQIA 1S1EA 2M7NA 1ODBA 1EXRA 2WC8A 5AFPA 1UURA 1FW4A 1IJ5A 1MWNA 1S36A 4XYNA 1PVBA 2KFHA 3BOWA 4USLA 1K93D 4MSPA 1FPWA 1J7OA 3EK7A 2ZRTA 1YRTB 2PRUA 1SK6D 1Y1UA 3FS7A 4OCIA 2GV5A 2TN4A 1B8RA 1UHHA 1WRLA 1XA5A 1TNWA 2LAPA 4YGBB 3BOWB 1DJZA 3VGOA 1JFJA 4BY5A 4PE0A 2ZN9A 1A03A 4PHNA 1K2HA 5HKYA 2JWWA 1FI6A 1Y6WA 1JF2A 3NSOA 4HRGA 1PVAA 3I5HB 3F45A 3SG7A 3VRRA 2CXJA 1YVHA 1WLMA 4I5NB 1SRAA 1XFZO 4MZLA 2KHNA 4NDBA 3HX4A 4GUKA 2LVKA 4N1FA 2ISDA 1RECA 2L2EA 1WDCB 1J7PA 1XO5A 2K7BA 4GAOA 1MQ1A 4CFQA 1B8CA 1NCZA 2BCXA 4I5LB 1PSRA 2M49B 3CWGA 3SG2A 5I2QA 1XVJA 3D0YA 2BBNA 2K2AA 1CM1A 4F0ZB 1KSMA 1FF1A 5HKWA 1UHIA 1IG5A 1YX8A 2JT3A 2PSRA 1CMFA 3DVJA 1MF8B 2F2OA 1B4CA 3CTNA 4OKHA 1TOPA 3SJSA 1WLZA 2OTGC 3WXAA 1DT7B 4OR9B 1SCVA 1Y1AA 2F33A 1B8LA 3NXAA 5F6TA 2BL0C 2ZKMX 1V1GA 2PASA 1KK8C 1SBJA 5CSFA 4DIRA 1G33A 1SPYA 2KI6D 2BKIB 2K0JA 1OMDA 4JQ0D 5JOLA 2MAZA 1EG4A 2AMIA 1CFDA 4ORAB 4DUQA 1JSAA 4GGFC 4YBHB 1F70A 5HYDA 4I5JA 1L2OB 3PSRA 2LUCA 1QIVA 3EVVA 2CNPA 1J7QA 1QS7A 3PLFB 1CTRA 4UPGA 5D69A 1SW8A 2JQ6A 4C0KA 1JBAA 1IWQA 1YUSA 2CCMA 2PMYA 2M0RA 3E3RA 1TIZA 3CLNA 1AVSA 2KAVA 4I5KA 3LK1A 1C7WA 2KYFA 4MRXA 2ZRSA 3O4YA 1QJTA 3TZ1A 1DJHA 2JT8A 1OOJA 4PE4A 4N5XA 3TUYC 2CTNA 1PK0D 5AXIA 3CZTX 3BXKA 2M3WA 1JFKA 4FQOA 1AJ5A 2M29A 2F3YA 2KYCA 4M2QA 4PHKA 1DJYA 2LUXA 2EC6C 3VROA 3JTDC 4GPLB 3TDIA 4BY4A 2OTGB 4C0JA 3PM8A 1MR8A 1TRFA 2LCPA 4MEWA 3PALA 2I18A 2L4IA 1KWOC 1KK8B 1J1DA 1MHOA 5ER5A 1LKJA 3AAJA 2BE6A 2KI6C 2NXQA 3LCPC 2KDHA 1Y0VH 1H4BA 1NPQA 2LVVA 1ALWA 4HREE 1CLMA 2LV7A 1QXPA 3TDZA 5AEQA 1PSBA 1KQVA 4GFTA 1MXLC 4GNKB 2KBIA 1AK8A 1UP5A 1K90D 4OV2A 1A2XA 1A75A 3GOFA 2L0PA 1KQMB 1N0YA 4E68A 1M31A 1QX5B 3VRPA 5ER4X 1YURA 1A75B 4MRYA 3AKBA 1CDLA 1LVCD 1SL7A 2LANA 1BOCA 2LLTA 1E8AA 4M2PA 4QJ4B 1SL8A 2O5GA 1SL9A 2EGDA 4YGCB 3BQ3A 4A4CA 3EK4A 4ORBB 1YRUB 2Y5IA 4ETOA 3O6BA 4C0LA 2O60A 5CSIA 1ZUZA 1NX0A 2EC6B 4NDCA 1JC2A 2LC5A 3JTDB 1M45A 2K2FA 4D1EA 2Y1MA 1J7RA 3NSKA 5KSZA 1ZFSA 1SCMB 1CDPA 1N65A 2Q4UA 5IBWA 3A4UB 2F3ZA 3DD4A 3KEVA 1UWOA 2M1KB 4QJ5B 2H61C 1XK4A 1M63B 1BU3A 3JVTC 1GGWA 3D10A 1CFFA 2OS8C 3CR4X 1SYMA 4YGDB 1XFYO 2E30A 4PCWA 1AP4A 2KFGA 1VRKA 2VRGA 2KAXA 1QVIZ 2L4HA 2JTTA
chains in the Genus database with same CATH superfamily
2ZNEA 1KK7Z 5D7FA 1QX7A 3R1PA 2EHBA 4L9MA 1SNLA 1TTXA 3DXLA 1IGVA 1NX3A 3UNWA 3BYAA 4INWA 1NCYA 2JULA 3S0GA 3RM1A 1DELA 3GK4X 1QIWA 1U5IA 3WHTB 1XFUO 1EH2A 1R2UA 1IRJA 2L51A 1AHRA 3NSIA 4N1GA 1PALA 3KO0A 5KTYA 2GTEA 3BUXB 1KCYA 1LXFC 4CLNA 1FI5A 1K9UA 4YI8A 3AAKA 1U5IB 1YUUA 1QVIY 1XFRA 2LP3A 1M39A 1KK7Y 2I94A 2MBXA 3OB2B 1DJGA 1RROA 2KBMA 4PE7A 1BR1B 1CFPA 2P6BB 2B1UA 1K8UA 1TN4A 1W7JB 3V2LA 3H4SE 4AQJA 1B47A 1BJFA 1LA0A 2WORA 4HSZA 1IH0A 1PRWA 2BECA 3PFVA 1ZACA 2PALA 5D3OA 2F8PA 1NCXA 1SKTA 4MZKA 4OVNF 1G4YR 1DGUA 3SIAA 2WCFA 2ZNDA 1RFJA 4DCKA 4U8DA 4GGNA 4MLWA 1HQVA 1X02A 3BUWB 1CKKA 4Q04A 3TDUA 3FE8A 1BF5A 4ORCB 3R1OA 1DMOA 3LK0A 2CBLA 2COLB 1JUOA 3JVTB 2OS8B 3VB1A 2FCEA 3EKHA 1AJ4A 3IQQA 3A8RA 2KGBC 4P2YB 1BR4B 2Y4QA 1GQMA 2LP2A 5I2LA 3CABA 1OMVA 1S5GZ 1OQPA 4PT1A 3SIBA 2FJYA 4TNCA 3WHUB 4YGEB 1SMGA 3D74A 3NSLA 1OE9B 3PM2A 2K61A 4CFRA 3OBVA 1KFXL 2WCBA 1DJXA 1OZSA 4HRHA 4AOMA 1C7VA 1NUBA 3PN7C 1Z4HA 3ZNIA 3O78A 2KQ6A 1CLLA 2KNEA 1UHJA 2IS9A 1IJ6A 1UHKA 2LHLA 1NYAA 3DVMA 2MLFC 2LNKA 1S3PA 2BL0B 2ERBA 2JNFA 2JOJA 3D75A 4JWQA 3B88A 3VRNA 4GGFA 3R72A 4ZCUA 2Q91A 1GGZA 1S5GY 5EL2A 2L5YA 1SR6C 2BNXA 1K96A 1NX1A 3LL8B 1BODA 5HKZA 1NX2A 1IKUA 1S6IA 1QATA 4WRIA 2WOSA 1QLSA 2QEVA 1JF0A 2JZIA 2AUCA 2K7OA 3EKJA 1CB1A 3IQOA 3MSEB 3OB1B 3SG6A 2OPOA 4NDBA 1QLKA 1TCOB 4PHJA 5K89A 1M46A 1J55A 1MUXA 2V53A 3DF0B 3S0EA 2D8NA 3SS4A 1A4PA 4QJ3B 1WY9A 2L98A 1WDCC 2BE4A 1HT9A 1KFUL 3AKAA 3CZ0A 4FTGA 3TUYB 2JT0A 2R2IA 5CSNA 3ZWHA 1MXEA 4WQ3A 3GK2A 2K8MB 1RWYA 1CNPA 3OX6A 2AAOA 5FI2A 2BCAA 2FCDA 2FJUB 2RGIA 2WCEA 1DGVA 3DVEA 3D73A 5GQQC 5TNCA 1N2DA 1C3ZA 5G08A 4YI9A 2BKHB 3PN7B 2H2KA 1B9AA 1S6JA 3DVKA 2LHIA 3Q8IA 4ICBA 4IL1A 5FYXA 3BUOB 1C3YA 1LINA 2LMVA 3GK1A 2MJWB 2MLEC 2PYQA 3CR5X 1KWOB 1RK9A 2JXCA 1AUIB 1ALVA 1K94A 2KAYA 1QV1A 2HPSA 2ZFDA 1WRKA 3I5FC 1OZOA 2LM5A 1PULA 2JTZA 2LLSA 1SR6B 3EVUA 1CLBA 3CS1A 1BG1A 1GJYA 3RLZA 1SSEB 1DJIA 1YX7A 3CDNA 1L2OC 2LVIA 1C07A 1F4OA 1IQ3A 1F8HA 4YGAA 4CIDA 4MVFA 2JC2A 2ZN8A 2L50A 4WQ2A 1Y1XA 3EG5B 3FE6A 2M7LA 4JKTA 2G2BA 1EG3A 2NCPA 2FOTA 2KI4C 4PDZA 1IQ5A 1WRZA 3I5IC 3SG4A 3S0BA 1CFCA 4MBEA 3OP0A 2CT9A 4GBAA 2K7CA 2WNDA 2E6WA 1T14A 2M1UA 3K1EA 1ZMZA 3K21A 1BMOA 2JNXA 3BFBA 1EJ3A 1K9PA 3DYEA 3OX5A 1NSHA 4OZDA 1FBVA 4MZJA 1BT6A 1XFVO 2LMTA 3CYZA 1XFWO 4JPZB 3ICBA 1G8IA 4PE1A 2KSPA 2BCBA 3D0YB 2KOTA 2HQ8A 1CM4A 3FIAA 1GM0A 2H61A 2M8UA 5B8IB 4NQGA 3KF9A 1QV0A 1A29A 3HCMA 1BLQA 5DKNA 2Y1NA 1F71A 1EL4A 1L7ZA 1QX2A 4MN0A 1RTP1 3SG5A 2NLNA 3I5FB 3PATA 1DTLA 2I2RE 3O4XA 3CGAA 1TNXA 4F7FA 3C1VA 3I5GC 2LE9B 1B1GA 3DY9A 3OHMB 1NP8A 3B86A 5HLOA 2I7AA 1ORGA 3FWBA 3BUMB 2KFFA 1OMRA 2KGRA 5HL1A 5I2OA 1IIOA 1CDMA 3CR2A 2GGZA 1D1OA 1F54A 1ZOTB 1QASA 1K95A 1S6CA 1YUTA 1QTXA 2HQWA 1KQMC 1NWDA 2KI4B 1DEKA 5FI6A 1KFXS 1KSOA 1XFXO 2BAPA 2MA2A 2SCPA 3TS5C 5I8NA 1JWDA 3I5IB 1TUZA 3EK8A 3KHEA 1RJVA 2A4JA 2DOQA 3M0WA 4P5OE 4PALA 5JJGA 3VRQA 4JD9A 2K7DA 1W7IB 2LLUA 2HETA 2MRDA 2P70A 5CPVA 1UUSA 2M97A 3NHIA 3D78A 1P28A 2NZ0A 2MHHA 3FWCA 3O2PA 5J3XA 2PVBA 1Q80A 4XJKA 5HLVA 2WCJA 3NHTA 2GGMA 1OSAA 1DVIA 4A4BA 2JXLA 1CMGA 3LLEA 4NDDA 3S0DA 2LMUA 4DS7A 5BPJA 3WNXB 5KU1A 1TNQA 1H8BA 1XYDA 4XJKB 3DF0A 4R1EA 2WCHA 4YRUA 1QWVA 1SCMC 1LA3A 3I5HC 2WCLA 1B7TZ 5DKRA 2KLEA 3QRXA 3EVRA 1S26D 1F55A 5CSJA 2KLDA 1R6PA 5PALA 3I5GB 1F4QA 2JPOA 2QACA 2KQYA 1DF0A 4DRWA 1DJWA 2HF5A 2QPTA 3CZ1A 1UHNA 3IF7A 3KPXA 3BUNB 1TNPA 1XK4C 2M9GA 4M2OA 2JU0A 1KFUS 3SG3A 2G9BA 2JRFA 1TWOA 2NCOA 4ZCVA 2L5XB 1J1EA 2F2PA 4PHMA 1CDNA 1SY9A 1DF0B 1K9KA 3L4LA 3S0AA 5AANA 1YVLA 2BBMA 5AERA 1B7TY 1V1FA 2LVJA 3DZTA 2L2CA 1YTZC 1YR5A 4CPVA 2SASA 3TS5B 1NIWA 5DKQA 1TCFA 2JPTA 4AQIA 1S1EA 2M7NA 1ODBA 1EXRA 2KPHA 2WC8A 5AFPA 1UURA 1FW4A 1IJ5A 1MWNA 1LS8A 2PQLA 1S36A 4XYNA 1PVBA 2KFHA 3BOWA 4USLA 1K93D 4MSPA 1FPWA 1J7OA 3EK7A 2ZRTA 1YRTB 2PRUA 1SK6D 1Y1UA 3FS7A 4OCIA 2GV5A 3SS3A 2TN4A 1B8RA 1UHHA 1WRLA 1XA5A 1TNWA 2LAPA 4YGBB 3BOWB 1DJZA 5DICA 3VGOA 1JFJA 4BY5A 4PE0A 2ZN9A 1A03A 4PHNA 1OOIX 1K2HA 5HKYA 2JWWA 2WCKA 1FI6A 2K60A 1Y6WA 1JF2A 3NSOA 3NGVA 4HRGA 1PVAA 3I5HB 3R1VA 3F45A 3SG7A 3VRRA 2CXJA 1YVHA 1WLMA 4I5NB 1SRAA 1XFZO 3BFHA 2KHNA 3B87A 3CZ2A 3HX4A 4GUKA 2LVKA 3D76A 4N1FA 4MZLA 1RECA 2L2EA 2ISDA 1WDCB 1J7PA 1XO5A 2K7BA 4GAOA 1MQ1A 4CFQA 1B8CA 1NCZA 2BCXA 3BJHA 4I5LB 1PSRA 2M49B 3CWGA 3SG2A 3L47A 5I2QA 1XVJA 3D0YA 2BBNA 2K2AA 1CM1A 4F0ZB 1KSMA 4INXA 1FF1A 5HKWA 1UHIA 2P71A 1IG5A 1YX8A 2JT3A 2PSRA 1CMFA 3DVJA 1MF8B 2F2OA 1B4CA 3CTNA 4OKHA 1TOPA 3SJSA 1WLZA 2OTGC 3WXAA 1DT7B 4OR9B 1SCVA 1Y1AA 2F33A 3RZSA 1B8LA 1W9ZA 3NXAA 5F6TA 2BL0C 2ZKMX 1V1GA 1OOHA 2PASA 1KK8C 1OW4A 1SBJA 5CSFA 4DIRA 1G33A 1SPYA 2KI6D 2BKIB 2K0JA 1OMDA 4JQ0D 5JOLA 2MAZA 1EG4A 2AMIA 1CFDA 4ORAB 4DUQA 1JSAA 4GGFC 4YBHB 1F70A 5HYDA 4I5JA 1L2OB 3PSRA 2WC5A 2LUCA 1QIVA 3B7AA 2CNPA 3EVVA 1J7QA 1QS7A 3PLFB 1CTRA 4UPGA 5D69A 1SW8A 2JQ6A 4C0KA 1JBAA 1IWQA 1YUSA 2CCMA 2PMYA 2M0RA 2YGUA 3E3RA 1TIZA 3CLNA 1AVSA 2KAVA 4I5KA 3LK1A 1C7WA 2KYFA 4MRXA 1DQEA 2QDIA 2ZRSA 3O4YA 1QJTA 3TZ1A 1DJHA 2JT8A 1OOJA 4PE4A 5I94A 4N5XA 2WCMA 3TUYC 2CTNA 1PK0D 5AXIA 3N7HA 3CZTX 3BXKA 2M3WA 4KYNA 1JFKA 4FQOA 1AJ5A 2M29A 2F3YA 2KYCA 4M2QA 4PHKA 1DJYA 2LUXA 2EC6C 3VROA 3JTDC 4FQTA 4GPLB 3TDIA 4BY4A 2OTGB 5FI7A 3PM8A 1MR8A 4C0JA 1TRFA 2LCPA 4MEWA 3PALA 2I18A 2L4IA 1KWOC 1KK8B 1J1DA 1MHOA 5ER5A 1LKJA 3PJIA 3AAJA 2BE6A 2KI6C 2NXQA 3LCPC 2KDHA 1OOFA 1Y0VH 1H4BA 1NPQA 2LVVA 1ALWA 4HREE 1CLMA 2LV7A 1QXPA 3TDZA 5AEQA 4IJ7A 1PSBA 1KQVA 4GFTA 1MXLC 4GNKB 2KBIA 1AK8A 1UP5A 2QEOA 1K90D 4OV2A 1A2XA 1A75A 3GOFA 2L0PA 1KQMB 1N0YA 4E68A 1M31A 1QX5B 1TUJA 2H8VA 3VRPA 3OGNA 5ER4X 1YURA 2WC6A 1A75B 4MRYA 3UO9A 3AKBA 3IVTA 1CDLA 1LVCD 1SL7A 2LANA 3FE9A 1BOCA 2LLTA 1E8AA 4M2PA 4QJ4B 1SL8A 2O5GA 1SL9A 2EGDA 4YGCB 3BQ3A 4A4CA 3EK4A 3SS5A 4ORBB 1YRUB 3S0FA 2Y5IA 4ETOA 3O6BA 4C0LA 2O60A 1DC1A 5CSIA 1ZUZA 2QEHA 1NX0A 2EC6B 4NDCA 1JC2A 2LC5A 3JTDB 1M45A 2K2FA 4D1EA 3L4AA 2Y1MA 1J7RA 3NSKA 5KSZA 1ZFSA 1SCMB 1CDPA 3B6XA 1N65A 2Q4UA 5IBWA 3A4UB 2F3ZA 3QMEA 3DD4A 2QEBA 3KEVA 1UWOA 2M1KB 4QJ5B 2H61C 1OOGA 1XK4A 1M63B 1Z2CB 1BU3A 3JVTC 1GGWA 3D10A 1CFFA 2OS8C 3CR4X 1SYMA 3BFAA 1XFYO 2E30A 3D77A 4PCWA 4YGDB 1AP4A 2KFGA 1VRKA 2VRGA 2KAXA 1QVIZ 2L4HA 2JTTA
chains in the Genus database with same CATH topology
2ZNEA 1KK7Z 5D7FA 1QX7A 2EHBA 4L9MA 1SNLA 1TTXA 1IGVA 1NX3A 3BYAA 1NCYA 2JULA 3RM1A 3GK4X 1QIWA 1U5IA 3WHTB 1XFUO 1EH2A 1R2UA 1IRJA 2L51A 1AHRA 3NSIA 4N1GA 1PALA 3KO0A 5KTYA 3BUXB 1KCYA 1LXFC 4CLNA 1FI5A 1K9UA 4YI8A 3AAKA 1U5IB 1YUUA 1QVIY 2LP3A 1M39A 1KK7Y 2I94A 2MBXA 3OB2B 1DJGA 1RROA 2KBMA 4PE7A 1BR1B 1CFPA 2P6BB 2B1UA 1K8UA 1TN4A 1W7JB 4AQJA 3H4SE 1B47A 1BJFA 1LA0A 2WORA 4HSZA 1IH0A 1PRWA 2BECA 3PFVA 1ZACA 2PALA 2F8PA 1NCXA 1SKTA 4MZKA 4OVNF 1G4YR 1DGUA 3SIAA 2WCFA 2ZNDA 1RFJA 4DCKA 4U8DA 4GGNA 4MLWA 1HQVA 1X02A 3BUWB 1CKKA 4Q04A 3TDUA 1BF5A 4ORCB 1DMOA 3LK0A 2CBLA 2COLB 1JUOA 3JVTB 2OS8B 2FCEA 3EKHA 1AJ4A 3IQQA 3A8RA 2KGBC 4P2YB 1BR4B 2Y4QA 1GQMA 2LP2A 5I2LA 1OMVA 1S5GZ 1OQPA 3SIBA 4TNCA 3WHUB 4YGEB 1SMGA 3NSLA 1OE9B 4CFRA 2K61A 1KFXL 2WCBA 1DJXA 1OZSA 4HRHA 1C7VA 1NUBA 3PN7C 3ZNIA 3O78A 2KQ6A 1CLLA 2KNEA 1UHJA 2IS9A 1IJ6A 1UHKA 2LHLA 1NYAA 3DVMA 2MLFC 2LNKA 1S3PA 2BL0B 2JNFA 2JOJA 4JWQA 3VRNA 4GGFA 4ZCUA 2Q91A 1GGZA 1S5GY 1SR6C 1K96A 1NX1A 3LL8B 1BODA 5HKZA 1NX2A 1IKUA 1S6IA 1QATA 4WRIA 2WOSA 1QLSA 1JF0A 2JZIA 2AUCA 2K7OA 3EKJA 1CB1A 3IQOA 3MSEB 3OB1B 3SG6A 2OPOA 1QLKA 1TCOB 4PHJA 5K89A 1M46A 1J55A 1MUXA 2V53A 3DF0B 2D8NA 1A4PA 4QJ3B 1WY9A 2L98A 1WDCC 2BE4A 1HT9A 1KFUL 3AKAA 4FTGA 3TUYB 2JT0A 2R2IA 5CSNA 3ZWHA 1MXEA 4WQ3A 3GK2A 2K8MB 1RWYA 1CNPA 3OX6A 2AAOA 2BCAA 2FCDA 2FJUB 2RGIA 2WCEA 1DGVA 3DVEA 5GQQC 5TNCA 4AOMA 1N2DA 5G08A 4YI9A 2BKHB 3PN7B 2H2KA 1B9AA 1S6JA 3DVKA 2LHIA 4ICBA 4IL1A 5FYXA 3BUOB 1LINA 2LMVA 3GK1A 2MJWB 2MLEC 3CR5X 1KWOB 1RK9A 2JXCA 1AUIB 1ALVA 1K94A 2KAYA 1QV1A 2HPSA 2ZFDA 1WRKA 3I5FC 1OZOA 2LM5A 1PULA 2JTZA 2LLSA 1SR6B 3EVUA 1CLBA 3CS1A 1BG1A 1GJYA 3RLZA 1YX7A 1DJIA 1L2OC 2LVIA 1C07A 1F4OA 1IQ3A 1F8HA 4YGAA 4CIDA 4MVFA 2JC2A 2ZN8A 2L50A 4WQ2A 1Y1XA 2M7LA 2G2BA 1EG3A 2NCPA 2FOTA 2KI4C 4PDZA 1IQ5A 1WRZA 3I5IC 3SG4A 1CFCA 4MBEA 3OP0A 2CT9A 4GBAA 2K7CA 2WNDA 2E6WA 2M1UA 1ZMZA 3K21A 1BMOA 2JNXA 1EJ3A 1K9PA 3OX5A 1NSHA 1FBVA 4MZJA 1BT6A 1XFVO 2LMTA 1XFWO 4JPZB 3ICBA 1G8IA 4PE1A 2KSPA 2BCBA 3D0YB 2KOTA 2HQ8A 1CM4A 3FIAA 2H61A 2M8UA 5B8IB 4NQGA 3KF9A 1QV0A 1A29A 3HCMA 1BLQA 5DKNA 2Y1NA 1F71A 1EL4A 1L7ZA 1QX2A 4MN0A 1RTP1 3SG5A 2NLNA 3I5FB 3PATA 1DTLA 2I2RE 3CGAA 1TNXA 3C1VA 3I5GC 2LE9B 1B1GA 3OHMB 5HLOA 1NP8A 2I7AA 3FWBA 3BUMB 2KFFA 1OMRA 2KGRA 5I2OA 1CDMA 3CR2A 2GGZA 1D1OA 1F54A 1ZOTB 1QASA 1K95A 1S6CA 1YUTA 1QTXA 2HQWA 1KQMC 1NWDA 2KI4B 1KFXS 1KSOA 1XFXO 2MA2A 3TS5C 2SCPA 5I8NA 1JWDA 3I5IB 3EK8A 3KHEA 1RJVA 2A4JA 2DOQA 3M0WA 4P5OE 4PALA 5JJGA 3VRQA 2K7DA 1W7IB 2LLUA 2HETA 2MRDA 5CPVA 1UUSA 2M97A 3FWCA 2NZ0A 2MHHA 3O2PA 5J3XA 2PVBA 1Q80A 4XJKA 5HLVA 2GGMA 1OSAA 1DVIA 4A4BA 2JXLA 1CMGA 3LLEA 4NDDA 5BPJA 2LMUA 4DS7A 3WNXB 5KU1A 1TNQA 1H8BA 1XYDA 4XJKB 3DF0A 4R1EA 4YRUA 1SCMC 3I5HC 1LA3A 1B7TZ 5DKRA 3QRXA 3EVRA 1S26D 1F55A 5CSJA 1R6PA 5PALA 3I5GB 1F4QA 2QACA 2KQYA 1DF0A 4DRWA 1DJWA 2HF5A 2QPTA 1UHNA 3IF7A 3KPXA 3BUNB 1TNPA 1XK4C 2M9GA 4M2OA 2JU0A 1KFUS 3SG3A 2G9BA 2JRFA 2NCOA 4ZCVA 2L5XB 1J1EA 2F2PA 4PHMA 1CDNA 1SY9A 1DF0B 1K9KA 5AANA 1YVLA 2BBMA 5AERA 1B7TY 1V1FA 2LVJA 4CPVA 1YTZC 1YR5A 2SASA 3TS5B 1NIWA 5DKQA 1TCFA 2JPTA 4AQIA 1S1EA 2M7NA 1ODBA 1EXRA 2WC8A 5AFPA 1UURA 1FW4A 1IJ5A 1MWNA 1S36A 4XYNA 1PVBA 2KFHA 3BOWA 4USLA 1K93D 4MSPA 1FPWA 1J7OA 3EK7A 2ZRTA 1YRTB 2PRUA 1SK6D 1Y1UA 3FS7A 4OCIA 2GV5A 2TN4A 1B8RA 1UHHA 1WRLA 1XA5A 1TNWA 2LAPA 4YGBB 3BOWB 1DJZA 3VGOA 1JFJA 4BY5A 4PE0A 2ZN9A 1A03A 4PHNA 1K2HA 5HKYA 2JWWA 1FI6A 1Y6WA 1JF2A 3NSOA 4HRGA 1PVAA 3I5HB 3F45A 3SG7A 3VRRA 2CXJA 1YVHA 1WLMA 4I5NB 1SRAA 1XFZO 4MZLA 2KHNA 4NDBA 3HX4A 4GUKA 2LVKA 4N1FA 2ISDA 1RECA 2L2EA 1WDCB 1J7PA 1XO5A 2K7BA 4GAOA 1MQ1A 4CFQA 1B8CA 1NCZA 2BCXA 4I5LB 1PSRA 2M49B 3CWGA 3SG2A 5I2QA 1XVJA 3D0YA 2BBNA 2K2AA 1CM1A 4F0ZB 1KSMA 1FF1A 5HKWA 1UHIA 1IG5A 1YX8A 2JT3A 2PSRA 1CMFA 3DVJA 1MF8B 2F2OA 1B4CA 3CTNA 4OKHA 1TOPA 3SJSA 1WLZA 2OTGC 3WXAA 1DT7B 4OR9B 1SCVA 1Y1AA 2F33A 1B8LA 3NXAA 5F6TA 2BL0C 2ZKMX 1V1GA 2PASA 1KK8C 1SBJA 5CSFA 4DIRA 1G33A 1SPYA 2KI6D 2BKIB 2K0JA 1OMDA 4JQ0D 5JOLA 2MAZA 1EG4A 2AMIA 1CFDA 4ORAB 4DUQA 1JSAA 4GGFC 4YBHB 1F70A 5HYDA 4I5JA 1L2OB 3PSRA 2LUCA 1QIVA 3EVVA 2CNPA 1J7QA 1QS7A 3PLFB 1CTRA 4UPGA 5D69A 1SW8A 2JQ6A 4C0KA 1JBAA 1IWQA 1YUSA 2CCMA 2PMYA 2M0RA 3E3RA 1TIZA 3CLNA 1AVSA 2KAVA 4I5KA 3LK1A 1C7WA 2KYFA 4MRXA 2ZRSA 3O4YA 1QJTA 3TZ1A 1DJHA 2JT8A 1OOJA 4PE4A 4N5XA 3TUYC 2CTNA 1PK0D 5AXIA 3CZTX 3BXKA 2M3WA 1JFKA 4FQOA 1AJ5A 2M29A 2F3YA 2KYCA 4M2QA 4PHKA 1DJYA 2LUXA 2EC6C 3VROA 3JTDC 4GPLB 3TDIA 4BY4A 2OTGB 4C0JA 3PM8A 1MR8A 1TRFA 2LCPA 4MEWA 3PALA 2I18A 2L4IA 1KWOC 1KK8B 1J1DA 1MHOA 5ER5A 1LKJA 3AAJA 2BE6A 2KI6C 2NXQA 3LCPC 2KDHA 1Y0VH 1H4BA 1NPQA 2LVVA 1ALWA 4HREE 1CLMA 2LV7A 1QXPA 3TDZA 5AEQA 1PSBA 1KQVA 4GFTA 1MXLC 4GNKB 2KBIA 1AK8A 1UP5A 1K90D 4OV2A 1A2XA 1A75A 3GOFA 2L0PA 1KQMB 1N0YA 4E68A 1M31A 1QX5B 3VRPA 5ER4X 1YURA 1A75B 4MRYA 3AKBA 1CDLA 1LVCD 1SL7A 2LANA 1BOCA 2LLTA 1E8AA 4M2PA 4QJ4B 1SL8A 2O5GA 1SL9A 2EGDA 4YGCB 3BQ3A 4A4CA 3EK4A 4ORBB 1YRUB 2Y5IA 4ETOA 3O6BA 4C0LA 2O60A 5CSIA 1ZUZA 1NX0A 2EC6B 4NDCA 1JC2A 2LC5A 3JTDB 1M45A 2K2FA 4D1EA 2Y1MA 1J7RA 3NSKA 5KSZA 1ZFSA 1SCMB 1CDPA 1N65A 2Q4UA 5IBWA 3A4UB 2F3ZA 3DD4A 3KEVA 1UWOA 2M1KB 4QJ5B 2H61C 1XK4A 1M63B 1BU3A 3JVTC 1GGWA 3D10A 1CFFA 2OS8C 3CR4X 1SYMA 4YGDB 1XFYO 2E30A 4PCWA 1AP4A 2KFGA 1VRKA 2VRGA 2KAXA 1QVIZ 2L4HA 2JTTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZNE A;  1KK7 Z;  5D7F A;  1QX7 A;  2EHB A;  4L9M A;  1SNL A;  1TTX A;  1IGV A;  1NX3 A;  3BYA A;  1NCY A;  2JUL A;  3RM1 A;  3GK4 X;  1QIW A;  1U5I A;  3WHT B;  1XFU O;  1EH2 A;  1R2U A;  1IRJ A;  2L51 A;  1AHR A;  3NSI A;  4N1G A;  1PAL A;  3KO0 A;  5KTY A;  3BUX B;  1KCY A;  1LXF C;  4CLN A;  1FI5 A;  1K9U A;  4YI8 A;  3AAK A;  1U5I B;  1YUU A;  1QVI Y;  2LP3 A;  1M39 A;  1KK7 Y;  2I94 A;  2MBX A;  3OB2 B;  1DJG A;  1RRO A;  2KBM A;  4PE7 A;  1BR1 B;  1CFP A;  2P6B B;  2B1U A;  1K8U A;  1TN4 A;  1W7J B;  4AQJ A;  3H4S E;  1B47 A;  1BJF A;  1LA0 A;  2WOR A;  4HSZ A;  1IH0 A;  1PRW A;  2BEC A;  3PFV A;  1ZAC A;  2PAL A;  2F8P A;  1NCX A;  1SKT A;  4MZK A;  4OVN F;  1G4Y R;  1DGU A;  3SIA A;  2WCF A;  2ZND A;  1RFJ A;  4DCK A;  4U8D A;  4GGN A;  4MLW A;  1HQV A;  1X02 A;  3BUW B;  1CKK A;  4Q04 A;  3TDU A;  1BF5 A;  4ORC B;  1DMO A;  3LK0 A;  2CBL A;  2COL B;  1JUO A;  3JVT B;  2OS8 B;  2FCE A;  3EKH A;  1AJ4 A;  3IQQ A;  3A8R A;  2KGB C;  4P2Y B;  1BR4 B;  2Y4Q A;  1GQM A;  2LP2 A;  5I2L A;  1OMV A;  1S5G Z;  1OQP A;  3SIB A;  4TNC A;  3WHU B;  4YGE B;  1SMG A;  3NSL A;  1OE9 B;  4CFR A;  2K61 A;  1KFX L;  2WCB A;  1DJX A;  1OZS A;  4HRH A;  1C7V A;  1NUB A;  3PN7 C;  3ZNI A;  3O78 A;  2KQ6 A;  1CLL A;  2KNE A;  1UHJ A;  2IS9 A;  1IJ6 A;  1UHK A;  2LHL A;  1NYA A;  3DVM A;  2MLF C;  2LNK A;  1S3P A;  2BL0 B;  2JNF A;  2JOJ A;  4JWQ A;  3VRN A;  4GGF A;  4ZCU A;  2Q91 A;  1GGZ A;  1S5G Y;  1SR6 C;  1K96 A;  1NX1 A;  3LL8 B;  1BOD A;  5HKZ A;  1NX2 A;  1IKU A;  1S6I A;  1QAT A;  4WRI A;  2WOS A;  1QLS A;  1JF0 A;  2JZI A;  2AUC A;  2K7O A;  3EKJ A;  1CB1 A;  3IQO A;  3MSE B;  3OB1 B;  3SG6 A;  2OPO A;  1QLK A;  1TCO B;  4PHJ A;  5K89 A;  1M46 A;  1J55 A;  1MUX A;  2V53 A;  3DF0 B;  2D8N A;  1A4P A;  4QJ3 B;  1WY9 A;  2L98 A;  1WDC C;  2BE4 A;  1HT9 A;  1KFU L;  3AKA A;  4FTG A;  3TUY B;  2JT0 A;  2R2I A;  5CSN A;  3ZWH A;  1MXE A;  4WQ3 A;  3GK2 A;  2K8M B;  1RWY A;  1CNP A;  3OX6 A;  2AAO A;  2BCA A;  2FCD A;  2FJU B;  2RGI A;  2WCE A;  1DGV A;  3DVE A;  5GQQ C;  5TNC A;  4AOM A;  1N2D A;  5G08 A;  4YI9 A;  2BKH B;  3PN7 B;  2H2K A;  1B9A A;  1S6J A;  3DVK A;  2LHI A;  4ICB A;  4IL1 A;  5FYX A;  3BUO B;  1LIN A;  2LMV A;  3GK1 A;  2MJW B;  2MLE C;  3CR5 X;  1KWO B;  1RK9 A;  2JXC A;  1AUI B;  1ALV A;  1K94 A;  2KAY A;  1QV1 A;  2HPS A;  2ZFD A;  1WRK A;  3I5F C;  1OZO A;  2LM5 A;  1PUL A;  2JTZ A;  2LLS A;  1SR6 B;  3EVU A;  1CLB A;  3CS1 A;  1BG1 A;  1GJY A;  3RLZ A;  1YX7 A;  1DJI A;  1L2O C;  2LVI A;  1C07 A;  1F4O A;  1IQ3 A;  1F8H A;  4YGA A;  4CID A;  4MVF A;  2JC2 A;  2ZN8 A;  2L50 A;  4WQ2 A;  1Y1X A;  2M7L A;  2G2B A;  1EG3 A;  2NCP A;  2FOT A;  2KI4 C;  4PDZ A;  1IQ5 A;  1WRZ A;  3I5I C;  3SG4 A;  1CFC A;  4MBE A;  3OP0 A;  2CT9 A;  4GBA A;  2K7C A;  2WND A;  2E6W A;  2M1U A;  1ZMZ A;  3K21 A;  1BMO A;  2JNX A;  1EJ3 A;  1K9P A;  3OX5 A;  1NSH A;  1FBV A;  4MZJ A;  1BT6 A;  1XFV O;  2LMT A;  1XFW O;  4JPZ B;  3ICB A;  1G8I A;  4PE1 A;  2KSP A;  2BCB A;  3D0Y B;  2KOT A;  2HQ8 A;  1CM4 A;  3FIA A;  2H61 A;  2M8U A;  5B8I B;  4NQG A;  3KF9 A;  1QV0 A;  1A29 A;  3HCM A;  1BLQ A;  5DKN A;  2Y1N A;  1F71 A;  1EL4 A;  1L7Z A;  1QX2 A;  4MN0 A;  1RTP 1;  3SG5 A;  2NLN A;  3I5F B;  3PAT A;  1DTL A;  2I2R E;  3CGA A;  1TNX A;  3C1V A;  3I5G C;  2LE9 B;  1B1G A;  3OHM B;  5HLO A;  1NP8 A;  2I7A A;  3FWB A;  3BUM B;  2KFF A;  1OMR A;  2KGR A;  5I2O A;  1CDM A;  3CR2 A;  2GGZ A;  1D1O A;  1F54 A;  1ZOT B;  1QAS A;  1K95 A;  1S6C A;  1YUT A;  1QTX A;  2HQW A;  1KQM C;  1NWD A;  2KI4 B;  1KFX S;  1KSO A;  1XFX O;  2MA2 A;  3TS5 C;  2SCP A;  5I8N A;  1JWD A;  3I5I B;  3EK8 A;  3KHE A;  1RJV A;  2A4J A;  2DOQ A;  3M0W A;  4P5O E;  4PAL A;  5JJG A;  3VRQ A;  2K7D A;  1W7I B;  2LLU A;  2HET A;  2MRD A;  5CPV A;  1UUS A;  2M97 A;  3FWC A;  2NZ0 A;  2MHH A;  3O2P A;  5J3X A;  2PVB A;  1Q80 A;  4XJK A;  5HLV A;  2GGM A;  1OSA A;  1DVI A;  4A4B A;  2JXL A;  1CMG A;  3LLE A;  4NDD A;  5BPJ A;  2LMU A;  4DS7 A;  3WNX B;  5KU1 A;  1TNQ A;  1H8B A;  1XYD A;  4XJK B;  3DF0 A;  4R1E A;  4YRU A;  1SCM C;  3I5H C;  1LA3 A;  1B7T Z;  5DKR A;  3QRX A;  3EVR A;  1S26 D;  1F55 A;  5CSJ A;  1R6P A;  5PAL A;  3I5G B;  1F4Q A;  2QAC A;  2KQY A;  1DF0 A;  4DRW A;  1DJW A;  2HF5 A;  2QPT A;  1UHN A;  3IF7 A;  3KPX A;  3BUN B;  1TNP A;  1XK4 C;  2M9G A;  4M2O A;  2JU0 A;  1KFU S;  3SG3 A;  2G9B A;  2JRF A;  2NCO A;  4ZCV A;  2L5X B;  1J1E A;  2F2P A;  4PHM A;  1CDN A;  1SY9 A;  1DF0 B;  1K9K A;  5AAN A;  1YVL A;  2BBM A;  5AER A;  1B7T Y;  1V1F A;  2LVJ A;  4CPV A;  1YTZ C;  1YR5 A;  2SAS A;  3TS5 B;  1NIW A;  5DKQ A;  1TCF A;  2JPT A;  4AQI A;  1S1E A;  2M7N A;  1ODB A;  1EXR A;  2WC8 A;  5AFP A;  1UUR A;  1FW4 A;  1IJ5 A;  1MWN A;  1S36 A;  4XYN A;  1PVB A;  2KFH A;  3BOW A;  4USL A;  1K93 D;  4MSP A;  1FPW A;  1J7O A;  3EK7 A;  2ZRT A;  1YRT B;  2PRU A;  1SK6 D;  1Y1U A;  3FS7 A;  4OCI A;  2GV5 A;  2TN4 A;  1B8R A;  1UHH A;  1WRL A;  1XA5 A;  1TNW A;  2LAP A;  4YGB B;  3BOW B;  1DJZ A;  3VGO A;  1JFJ A;  4BY5 A;  4PE0 A;  2ZN9 A;  1A03 A;  4PHN A;  1K2H A;  5HKY A;  2JWW A;  1FI6 A;  1Y6W A;  1JF2 A;  3NSO A;  4HRG A;  1PVA A;  3I5H B;  3F45 A;  3SG7 A;  3VRR A;  2CXJ A;  1YVH A;  1WLM A;  4I5N B;  1SRA A;  1XFZ O;  4MZL A;  2KHN A;  4NDB A;  3HX4 A;  4GUK A;  2LVK A;  4N1F A;  2ISD A;  1REC A;  2L2E A;  1WDC B;  1J7P A;  1XO5 A;  2K7B A;  4GAO A;  1MQ1 A;  4CFQ A;  1B8C A;  1NCZ A;  2BCX A;  4I5L B;  1PSR A;  2M49 B;  3CWG A;  3SG2 A;  5I2Q A;  1XVJ A;  3D0Y A;  2BBN A;  2K2A A;  1CM1 A;  4F0Z B;  1KSM A;  1FF1 A;  5HKW A;  1UHI A;  1IG5 A;  1YX8 A;  2JT3 A;  2PSR A;  1CMF A;  3DVJ A;  1MF8 B;  2F2O A;  1B4C A;  3CTN A;  4OKH A;  1TOP A;  3SJS A;  1WLZ A;  2OTG C;  3WXA A;  1DT7 B;  4OR9 B;  1SCV A;  1Y1A A;  2F33 A;  1B8L A;  3NXA A;  5F6T A;  2BL0 C;  2ZKM X;  1V1G A;  2PAS A;  1KK8 C;  1SBJ A;  5CSF A;  4DIR A;  1G33 A;  1SPY A;  2KI6 D;  2BKI B;  2K0J A;  1OMD A;  4JQ0 D;  5JOL A;  2MAZ A;  1EG4 A;  2AMI A;  1CFD A;  4ORA B;  4DUQ A;  1JSA A;  4GGF C;  4YBH B;  1F70 A;  5HYD A;  4I5J A;  1L2O B;  3PSR A;  2LUC A;  1QIV A;  3EVV A;  2CNP A;  1J7Q A;  1QS7 A;  3PLF B;  1CTR A;  4UPG A;  5D69 A;  1SW8 A;  2JQ6 A;  4C0K A;  1JBA A;  1IWQ A;  1YUS A;  2CCM A;  2PMY A;  2M0R A;  3E3R A;  1TIZ A;  3CLN A;  1AVS A;  2KAV A;  4I5K A;  3LK1 A;  1C7W A;  2KYF A;  4MRX A;  2ZRS A;  3O4Y A;  1QJT A;  3TZ1 A;  1DJH A;  2JT8 A;  1OOJ A;  4PE4 A;  4N5X A;  3TUY C;  2CTN A;  1PK0 D;  5AXI A;  3CZT X;  3BXK A;  2M3W A;  1JFK A;  4FQO A;  1AJ5 A;  2M29 A;  2F3Y A;  2KYC A;  4M2Q A;  4PHK A;  1DJY A;  2LUX A;  2EC6 C;  3VRO A;  3JTD C;  4GPL B;  3TDI A;  4BY4 A;  2OTG B;  4C0J A;  3PM8 A;  1MR8 A;  1TRF A;  2LCP A;  4MEW A;  3PAL A;  2I18 A;  2L4I A;  1KWO C;  1KK8 B;  1J1D A;  1MHO A;  5ER5 A;  1LKJ A;  3AAJ A;  2BE6 A;  2KI6 C;  2NXQ A;  3LCP C;  2KDH A;  1Y0V H;  1H4B A;  1NPQ A;  2LVV A;  1ALW A;  4HRE E;  1CLM A;  2LV7 A;  1QXP A;  3TDZ A;  5AEQ A;  1PSB A;  1KQV A;  4GFT A;  1MXL C;  4GNK B;  2KBI A;  1AK8 A;  1UP5 A;  1K90 D;  4OV2 A;  1A2X A;  1A75 A;  3GOF A;  2L0P A;  1KQM B;  1N0Y A;  4E68 A;  1M31 A;  1QX5 B;  3VRP A;  5ER4 X;  1YUR A;  1A75 B;  4MRY A;  3AKB A;  1CDL A;  1LVC D;  1SL7 A;  2LAN A;  1BOC A;  2LLT A;  1E8A A;  4M2P A;  4QJ4 B;  1SL8 A;  2O5G A;  1SL9 A;  2EGD A;  4YGC B;  3BQ3 A;  4A4C A;  3EK4 A;  4ORB B;  1YRU B;  2Y5I A;  4ETO A;  3O6B A;  4C0L A;  2O60 A;  5CSI A;  1ZUZ A;  1NX0 A;  2EC6 B;  4NDC A;  1JC2 A;  2LC5 A;  3JTD B;  1M45 A;  2K2F A;  4D1E A;  2Y1M A;  1J7R A;  3NSK A;  5KSZ A;  1ZFS A;  1SCM B;  1CDP A;  1N65 A;  2Q4U A;  5IBW A;  3A4U B;  2F3Z A;  3DD4 A;  3KEV A;  1UWO A;  2M1K B;  4QJ5 B;  2H61 C;  1XK4 A;  1M63 B;  1BU3 A;  3JVT C;  1GGW A;  3D10 A;  1CFF A;  2OS8 C;  3CR4 X;  1SYM A;  4YGD B;  1XFY O;  2E30 A;  4PCW A;  1AP4 A;  2KFG A;  1VRK A;  2VRG A;  2KAX A;  1QVI Z;  2L4H A;  2JTT A; 
#chains in the Genus database with same CATH topology
 2ZNE A;  1KK7 Z;  5D7F A;  1QX7 A;  3R1P A;  2EHB A;  4L9M A;  1SNL A;  1TTX A;  3DXL A;  1IGV A;  1NX3 A;  3UNW A;  3BYA A;  4INW A;  1NCY A;  2JUL A;  3S0G A;  3RM1 A;  1DEL A;  3GK4 X;  1QIW A;  1U5I A;  3WHT B;  1XFU O;  1EH2 A;  1R2U A;  1IRJ A;  2L51 A;  1AHR A;  3NSI A;  4N1G A;  1PAL A;  3KO0 A;  5KTY A;  2GTE A;  3BUX B;  1KCY A;  1LXF C;  4CLN A;  1FI5 A;  1K9U A;  4YI8 A;  3AAK A;  1U5I B;  1YUU A;  1QVI Y;  1XFR A;  2LP3 A;  1M39 A;  1KK7 Y;  2I94 A;  2MBX A;  3OB2 B;  1DJG A;  1RRO A;  2KBM A;  4PE7 A;  1BR1 B;  1CFP A;  2P6B B;  2B1U A;  1K8U A;  1TN4 A;  1W7J B;  3V2L A;  3H4S E;  4AQJ A;  1B47 A;  1BJF A;  1LA0 A;  2WOR A;  4HSZ A;  1IH0 A;  1PRW A;  2BEC A;  3PFV A;  1ZAC A;  2PAL A;  5D3O A;  2F8P A;  1NCX A;  1SKT A;  4MZK A;  4OVN F;  1G4Y R;  1DGU A;  3SIA A;  2WCF A;  2ZND A;  1RFJ A;  4DCK A;  4U8D A;  4GGN A;  4MLW A;  1HQV A;  1X02 A;  3BUW B;  1CKK A;  4Q04 A;  3TDU A;  3FE8 A;  1BF5 A;  4ORC B;  3R1O A;  1DMO A;  3LK0 A;  2CBL A;  2COL B;  1JUO A;  3JVT B;  2OS8 B;  3VB1 A;  2FCE A;  3EKH A;  1AJ4 A;  3IQQ A;  3A8R A;  2KGB C;  4P2Y B;  1BR4 B;  2Y4Q A;  1GQM A;  2LP2 A;  5I2L A;  3CAB A;  1OMV A;  1S5G Z;  1OQP A;  4PT1 A;  3SIB A;  2FJY A;  4TNC A;  3WHU B;  4YGE B;  1SMG A;  3D74 A;  3NSL A;  1OE9 B;  3PM2 A;  2K61 A;  4CFR A;  3OBV A;  1KFX L;  2WCB A;  1DJX A;  1OZS A;  4HRH A;  4AOM A;  1C7V A;  1NUB A;  3PN7 C;  1Z4H A;  3ZNI A;  3O78 A;  2KQ6 A;  1CLL A;  2KNE A;  1UHJ A;  2IS9 A;  1IJ6 A;  1UHK A;  2LHL A;  1NYA A;  3DVM A;  2MLF C;  2LNK A;  1S3P A;  2BL0 B;  2ERB A;  2JNF A;  2JOJ A;  3D75 A;  4JWQ A;  3B88 A;  3VRN A;  4GGF A;  3R72 A;  4ZCU A;  2Q91 A;  1GGZ A;  1S5G Y;  5EL2 A;  2L5Y A;  1SR6 C;  2BNX A;  1K96 A;  1NX1 A;  3LL8 B;  1BOD A;  5HKZ A;  1NX2 A;  1IKU A;  1S6I A;  1QAT A;  4WRI A;  2WOS A;  1QLS A;  2QEV A;  1JF0 A;  2JZI A;  2AUC A;  2K7O A;  3EKJ A;  1CB1 A;  3IQO A;  3MSE B;  3OB1 B;  3SG6 A;  2OPO A;  4NDB A;  1QLK A;  1TCO B;  4PHJ A;  5K89 A;  1M46 A;  1J55 A;  1MUX A;  2V53 A;  3DF0 B;  3S0E A;  2D8N A;  3SS4 A;  1A4P A;  4QJ3 B;  1WY9 A;  2L98 A;  1WDC C;  2BE4 A;  1HT9 A;  1KFU L;  3AKA A;  3CZ0 A;  4FTG A;  3TUY B;  2JT0 A;  2R2I A;  5CSN A;  3ZWH A;  1MXE A;  4WQ3 A;  3GK2 A;  2K8M B;  1RWY A;  1CNP A;  3OX6 A;  2AAO A;  5FI2 A;  2BCA A;  2FCD A;  2FJU B;  2RGI A;  2WCE A;  1DGV A;  3DVE A;  3D73 A;  5GQQ C;  5TNC A;  1N2D A;  1C3Z A;  5G08 A;  4YI9 A;  2BKH B;  3PN7 B;  2H2K A;  1B9A A;  1S6J A;  3DVK A;  2LHI A;  3Q8I A;  4ICB A;  4IL1 A;  5FYX A;  3BUO B;  1C3Y A;  1LIN A;  2LMV A;  3GK1 A;  2MJW B;  2MLE C;  2PYQ A;  3CR5 X;  1KWO B;  1RK9 A;  2JXC A;  1AUI B;  1ALV A;  1K94 A;  2KAY A;  1QV1 A;  2HPS A;  2ZFD A;  1WRK A;  3I5F C;  1OZO A;  2LM5 A;  1PUL A;  2JTZ A;  2LLS A;  1SR6 B;  3EVU A;  1CLB A;  3CS1 A;  1BG1 A;  1GJY A;  3RLZ A;  1SSE B;  1DJI A;  1YX7 A;  3CDN A;  1L2O C;  2LVI A;  1C07 A;  1F4O A;  1IQ3 A;  1F8H A;  4YGA A;  4CID A;  4MVF A;  2JC2 A;  2ZN8 A;  2L50 A;  4WQ2 A;  1Y1X A;  3EG5 B;  3FE6 A;  2M7L A;  4JKT A;  2G2B A;  1EG3 A;  2NCP A;  2FOT A;  2KI4 C;  4PDZ A;  1IQ5 A;  1WRZ A;  3I5I C;  3SG4 A;  3S0B A;  1CFC A;  4MBE A;  3OP0 A;  2CT9 A;  4GBA A;  2K7C A;  2WND A;  2E6W A;  1T14 A;  2M1U A;  3K1E A;  1ZMZ A;  3K21 A;  1BMO A;  2JNX A;  3BFB A;  1EJ3 A;  1K9P A;  3DYE A;  3OX5 A;  1NSH A;  4OZD A;  1FBV A;  4MZJ A;  1BT6 A;  1XFV O;  2LMT A;  3CYZ A;  1XFW O;  4JPZ B;  3ICB A;  1G8I A;  4PE1 A;  2KSP A;  2BCB A;  3D0Y B;  2KOT A;  2HQ8 A;  1CM4 A;  3FIA A;  1GM0 A;  2H61 A;  2M8U A;  5B8I B;  4NQG A;  3KF9 A;  1QV0 A;  1A29 A;  3HCM A;  1BLQ A;  5DKN A;  2Y1N A;  1F71 A;  1EL4 A;  1L7Z A;  1QX2 A;  4MN0 A;  1RTP 1;  3SG5 A;  2NLN A;  3I5F B;  3PAT A;  1DTL A;  2I2R E;  3O4X A;  3CGA A;  1TNX A;  4F7F A;  3C1V A;  3I5G C;  2LE9 B;  1B1G A;  3DY9 A;  3OHM B;  1NP8 A;  3B86 A;  5HLO A;  2I7A A;  1ORG A;  3FWB A;  3BUM B;  2KFF A;  1OMR A;  2KGR A;  5HL1 A;  5I2O A;  1IIO A;  1CDM A;  3CR2 A;  2GGZ A;  1D1O A;  1F54 A;  1ZOT B;  1QAS A;  1K95 A;  1S6C A;  1YUT A;  1QTX A;  2HQW A;  1KQM C;  1NWD A;  2KI4 B;  1DEK A;  5FI6 A;  1KFX S;  1KSO A;  1XFX O;  2BAP A;  2MA2 A;  2SCP A;  3TS5 C;  5I8N A;  1JWD A;  3I5I B;  1TUZ A;  3EK8 A;  3KHE A;  1RJV A;  2A4J A;  2DOQ A;  3M0W A;  4P5O E;  4PAL A;  5JJG A;  3VRQ A;  4JD9 A;  2K7D A;  1W7I B;  2LLU A;  2HET A;  2MRD A;  2P70 A;  5CPV A;  1UUS A;  2M97 A;  3NHI A;  3D78 A;  1P28 A;  2NZ0 A;  2MHH A;  3FWC A;  3O2P A;  5J3X A;  2PVB A;  1Q80 A;  4XJK A;  5HLV A;  2WCJ A;  3NHT A;  2GGM A;  1OSA A;  1DVI A;  4A4B A;  2JXL A;  1CMG A;  3LLE A;  4NDD A;  3S0D A;  2LMU A;  4DS7 A;  5BPJ A;  3WNX B;  5KU1 A;  1TNQ A;  1H8B A;  1XYD A;  4XJK B;  3DF0 A;  4R1E A;  2WCH A;  4YRU A;  1QWV A;  1SCM C;  1LA3 A;  3I5H C;  2WCL A;  1B7T Z;  5DKR A;  2KLE A;  3QRX A;  3EVR A;  1S26 D;  1F55 A;  5CSJ A;  2KLD A;  1R6P A;  5PAL A;  3I5G B;  1F4Q A;  2JPO A;  2QAC A;  2KQY A;  1DF0 A;  4DRW A;  1DJW A;  2HF5 A;  2QPT A;  3CZ1 A;  1UHN A;  3IF7 A;  3KPX A;  3BUN B;  1TNP A;  1XK4 C;  2M9G A;  4M2O A;  2JU0 A;  1KFU S;  3SG3 A;  2G9B A;  2JRF A;  1TWO A;  2NCO A;  4ZCV A;  2L5X B;  1J1E A;  2F2P A;  4PHM A;  1CDN A;  1SY9 A;  1DF0 B;  1K9K A;  3L4L A;  3S0A A;  5AAN A;  1YVL A;  2BBM A;  5AER A;  1B7T Y;  1V1F A;  2LVJ A;  3DZT A;  2L2C A;  1YTZ C;  1YR5 A;  4CPV A;  2SAS A;  3TS5 B;  1NIW A;  5DKQ A;  1TCF A;  2JPT A;  4AQI A;  1S1E A;  2M7N A;  1ODB A;  1EXR A;  2KPH A;  2WC8 A;  5AFP A;  1UUR A;  1FW4 A;  1IJ5 A;  1MWN A;  1LS8 A;  2PQL A;  1S36 A;  4XYN A;  1PVB A;  2KFH A;  3BOW A;  4USL A;  1K93 D;  4MSP A;  1FPW A;  1J7O A;  3EK7 A;  2ZRT A;  1YRT B;  2PRU A;  1SK6 D;  1Y1U A;  3FS7 A;  4OCI A;  2GV5 A;  3SS3 A;  2TN4 A;  1B8R A;  1UHH A;  1WRL A;  1XA5 A;  1TNW A;  2LAP A;  4YGB B;  3BOW B;  1DJZ A;  5DIC A;  3VGO A;  1JFJ A;  4BY5 A;  4PE0 A;  2ZN9 A;  1A03 A;  4PHN A;  1OOI X;  1K2H A;  5HKY A;  2JWW A;  2WCK A;  1FI6 A;  2K60 A;  1Y6W A;  1JF2 A;  3NSO A;  3NGV A;  4HRG A;  1PVA A;  3I5H B;  3R1V A;  3F45 A;  3SG7 A;  3VRR A;  2CXJ A;  1YVH A;  1WLM A;  4I5N B;  1SRA A;  1XFZ O;  3BFH A;  2KHN A;  3B87 A;  3CZ2 A;  3HX4 A;  4GUK A;  2LVK A;  3D76 A;  4N1F A;  4MZL A;  1REC A;  2L2E A;  2ISD A;  1WDC B;  1J7P A;  1XO5 A;  2K7B A;  4GAO A;  1MQ1 A;  4CFQ A;  1B8C A;  1NCZ A;  2BCX A;  3BJH A;  4I5L B;  1PSR A;  2M49 B;  3CWG A;  3SG2 A;  3L47 A;  5I2Q A;  1XVJ A;  3D0Y A;  2BBN A;  2K2A A;  1CM1 A;  4F0Z B;  1KSM A;  4INX A;  1FF1 A;  5HKW A;  1UHI A;  2P71 A;  1IG5 A;  1YX8 A;  2JT3 A;  2PSR A;  1CMF A;  3DVJ A;  1MF8 B;  2F2O A;  1B4C A;  3CTN A;  4OKH A;  1TOP A;  3SJS A;  1WLZ A;  2OTG C;  3WXA A;  1DT7 B;  4OR9 B;  1SCV A;  1Y1A A;  2F33 A;  3RZS A;  1B8L A;  1W9Z A;  3NXA A;  5F6T A;  2BL0 C;  2ZKM X;  1V1G A;  1OOH A;  2PAS A;  1KK8 C;  1OW4 A;  1SBJ A;  5CSF A;  4DIR A;  1G33 A;  1SPY A;  2KI6 D;  2BKI B;  2K0J A;  1OMD A;  4JQ0 D;  5JOL A;  2MAZ A;  1EG4 A;  2AMI A;  1CFD A;  4ORA B;  4DUQ A;  1JSA A;  4GGF C;  4YBH B;  1F70 A;  5HYD A;  4I5J A;  1L2O B;  3PSR A;  2WC5 A;  2LUC A;  1QIV A;  3B7A A;  2CNP A;  3EVV A;  1J7Q A;  1QS7 A;  3PLF B;  1CTR A;  4UPG A;  5D69 A;  1SW8 A;  2JQ6 A;  4C0K A;  1JBA A;  1IWQ A;  1YUS A;  2CCM A;  2PMY A;  2M0R A;  2YGU A;  3E3R A;  1TIZ A;  3CLN A;  1AVS A;  2KAV A;  4I5K A;  3LK1 A;  1C7W A;  2KYF A;  4MRX A;  1DQE A;  2QDI A;  2ZRS A;  3O4Y A;  1QJT A;  3TZ1 A;  1DJH A;  2JT8 A;  1OOJ A;  4PE4 A;  5I94 A;  4N5X A;  2WCM A;  3TUY C;  2CTN A;  1PK0 D;  5AXI A;  3N7H A;  3CZT X;  3BXK A;  2M3W A;  4KYN A;  1JFK A;  4FQO A;  1AJ5 A;  2M29 A;  2F3Y A;  2KYC A;  4M2Q A;  4PHK A;  1DJY A;  2LUX A;  2EC6 C;  3VRO A;  3JTD C;  4FQT A;  4GPL B;  3TDI A;  4BY4 A;  2OTG B;  5FI7 A;  3PM8 A;  1MR8 A;  4C0J A;  1TRF A;  2LCP A;  4MEW A;  3PAL A;  2I18 A;  2L4I A;  1KWO C;  1KK8 B;  1J1D A;  1MHO A;  5ER5 A;  1LKJ A;  3PJI A;  3AAJ A;  2BE6 A;  2KI6 C;  2NXQ A;  3LCP C;  2KDH A;  1OOF A;  1Y0V H;  1H4B A;  1NPQ A;  2LVV A;  1ALW A;  4HRE E;  1CLM A;  2LV7 A;  1QXP A;  3TDZ A;  5AEQ A;  4IJ7 A;  1PSB A;  1KQV A;  4GFT A;  1MXL C;  4GNK B;  2KBI A;  1AK8 A;  1UP5 A;  2QEO A;  1K90 D;  4OV2 A;  1A2X A;  1A75 A;  3GOF A;  2L0P A;  1KQM B;  1N0Y A;  4E68 A;  1M31 A;  1QX5 B;  1TUJ A;  2H8V A;  3VRP A;  3OGN A;  5ER4 X;  1YUR A;  2WC6 A;  1A75 B;  4MRY A;  3UO9 A;  3AKB A;  3IVT A;  1CDL A;  1LVC D;  1SL7 A;  2LAN A;  3FE9 A;  1BOC A;  2LLT A;  1E8A A;  4M2P A;  4QJ4 B;  1SL8 A;  2O5G A;  1SL9 A;  2EGD A;  4YGC B;  3BQ3 A;  4A4C A;  3EK4 A;  3SS5 A;  4ORB B;  1YRU B;  3S0F A;  2Y5I A;  4ETO A;  3O6B A;  4C0L A;  2O60 A;  1DC1 A;  5CSI A;  1ZUZ A;  2QEH A;  1NX0 A;  2EC6 B;  4NDC A;  1JC2 A;  2LC5 A;  3JTD B;  1M45 A;  2K2F A;  4D1E A;  3L4A A;  2Y1M A;  1J7R A;  3NSK A;  5KSZ A;  1ZFS A;  1SCM B;  1CDP A;  3B6X A;  1N65 A;  2Q4U A;  5IBW A;  3A4U B;  2F3Z A;  3QME A;  3DD4 A;  2QEB A;  3KEV A;  1UWO A;  2M1K B;  4QJ5 B;  2H61 C;  1OOG A;  1XK4 A;  1M63 B;  1Z2C B;  1BU3 A;  3JVT C;  1GGW A;  3D10 A;  1CFF A;  2OS8 C;  3CR4 X;  1SYM A;  3BFA A;  1XFY O;  2E30 A;  3D77 A;  4PCW A;  4YGD B;  1AP4 A;  2KFG A;  1VRK A;  2VRG A;  2KAX A;  1QVI Z;  2L4H A;  2JTT A; 
#chains in the Genus database with same CATH homology
 2ZNE A;  1KK7 Z;  5D7F A;  1QX7 A;  2EHB A;  4L9M A;  1SNL A;  1TTX A;  1IGV A;  1NX3 A;  3BYA A;  1NCY A;  2JUL A;  3RM1 A;  3GK4 X;  1QIW A;  1U5I A;  3WHT B;  1XFU O;  1EH2 A;  1R2U A;  1IRJ A;  2L51 A;  1AHR A;  3NSI A;  4N1G A;  1PAL A;  3KO0 A;  5KTY A;  3BUX B;  1KCY A;  1LXF C;  4CLN A;  1FI5 A;  1K9U A;  4YI8 A;  3AAK A;  1U5I B;  1YUU A;  1QVI Y;  2LP3 A;  1M39 A;  1KK7 Y;  2I94 A;  2MBX A;  3OB2 B;  1DJG A;  1RRO A;  2KBM A;  4PE7 A;  1BR1 B;  1CFP A;  2P6B B;  2B1U A;  1K8U A;  1TN4 A;  1W7J B;  4AQJ A;  3H4S E;  1B47 A;  1BJF A;  1LA0 A;  2WOR A;  4HSZ A;  1IH0 A;  1PRW A;  2BEC A;  3PFV A;  1ZAC A;  2PAL A;  2F8P A;  1NCX A;  1SKT A;  4MZK A;  4OVN F;  1G4Y R;  1DGU A;  3SIA A;  2WCF A;  2ZND A;  1RFJ A;  4DCK A;  4U8D A;  4GGN A;  4MLW A;  1HQV A;  1X02 A;  3BUW B;  1CKK A;  4Q04 A;  3TDU A;  1BF5 A;  4ORC B;  1DMO A;  3LK0 A;  2CBL A;  2COL B;  1JUO A;  3JVT B;  2OS8 B;  2FCE A;  3EKH A;  1AJ4 A;  3IQQ A;  3A8R A;  2KGB C;  4P2Y B;  1BR4 B;  2Y4Q A;  1GQM A;  2LP2 A;  5I2L A;  1OMV A;  1S5G Z;  1OQP A;  3SIB A;  4TNC A;  3WHU B;  4YGE B;  1SMG A;  3NSL A;  1OE9 B;  4CFR A;  2K61 A;  1KFX L;  2WCB A;  1DJX A;  1OZS A;  4HRH A;  1C7V A;  1NUB A;  3PN7 C;  3ZNI A;  3O78 A;  2KQ6 A;  1CLL A;  2KNE A;  1UHJ A;  2IS9 A;  1IJ6 A;  1UHK A;  2LHL A;  1NYA A;  3DVM A;  2MLF C;  2LNK A;  1S3P A;  2BL0 B;  2JNF A;  2JOJ A;  4JWQ A;  3VRN A;  4GGF A;  4ZCU A;  2Q91 A;  1GGZ A;  1S5G Y;  1SR6 C;  1K96 A;  1NX1 A;  3LL8 B;  1BOD A;  5HKZ A;  1NX2 A;  1IKU A;  1S6I A;  1QAT A;  4WRI A;  2WOS A;  1QLS A;  1JF0 A;  2JZI A;  2AUC A;  2K7O A;  3EKJ A;  1CB1 A;  3IQO A;  3MSE B;  3OB1 B;  3SG6 A;  2OPO A;  1QLK A;  1TCO B;  4PHJ A;  5K89 A;  1M46 A;  1J55 A;  1MUX A;  2V53 A;  3DF0 B;  2D8N A;  1A4P A;  4QJ3 B;  1WY9 A;  2L98 A;  1WDC C;  2BE4 A;  1HT9 A;  1KFU L;  3AKA A;  4FTG A;  3TUY B;  2JT0 A;  2R2I A;  5CSN A;  3ZWH A;  1MXE A;  4WQ3 A;  3GK2 A;  2K8M B;  1RWY A;  1CNP A;  3OX6 A;  2AAO A;  2BCA A;  2FCD A;  2FJU B;  2RGI A;  2WCE A;  1DGV A;  3DVE A;  5GQQ C;  5TNC A;  4AOM A;  1N2D A;  5G08 A;  4YI9 A;  2BKH B;  3PN7 B;  2H2K A;  1B9A A;  1S6J A;  3DVK A;  2LHI A;  4ICB A;  4IL1 A;  5FYX A;  3BUO B;  1LIN A;  2LMV A;  3GK1 A;  2MJW B;  2MLE C;  3CR5 X;  1KWO B;  1RK9 A;  2JXC A;  1AUI B;  1ALV A;  1K94 A;  2KAY A;  1QV1 A;  2HPS A;  2ZFD A;  1WRK A;  3I5F C;  1OZO A;  2LM5 A;  1PUL A;  2JTZ A;  2LLS A;  1SR6 B;  3EVU A;  1CLB A;  3CS1 A;  1BG1 A;  1GJY A;  3RLZ A;  1YX7 A;  1DJI A;  1L2O C;  2LVI A;  1C07 A;  1F4O A;  1IQ3 A;  1F8H A;  4YGA A;  4CID A;  4MVF A;  2JC2 A;  2ZN8 A;  2L50 A;  4WQ2 A;  1Y1X A;  2M7L A;  2G2B A;  1EG3 A;  2NCP A;  2FOT A;  2KI4 C;  4PDZ A;  1IQ5 A;  1WRZ A;  3I5I C;  3SG4 A;  1CFC A;  4MBE A;  3OP0 A;  2CT9 A;  4GBA A;  2K7C A;  2WND A;  2E6W A;  2M1U A;  1ZMZ A;  3K21 A;  1BMO A;  2JNX A;  1EJ3 A;  1K9P A;  3OX5 A;  1NSH A;  1FBV A;  4MZJ A;  1BT6 A;  1XFV O;  2LMT A;  1XFW O;  4JPZ B;  3ICB A;  1G8I A;  4PE1 A;  2KSP A;  2BCB A;  3D0Y B;  2KOT A;  2HQ8 A;  1CM4 A;  3FIA A;  2H61 A;  2M8U A;  5B8I B;  4NQG A;  3KF9 A;  1QV0 A;  1A29 A;  3HCM A;  1BLQ A;  5DKN A;  2Y1N A;  1F71 A;  1EL4 A;  1L7Z A;  1QX2 A;  4MN0 A;  1RTP 1;  3SG5 A;  2NLN A;  3I5F B;  3PAT A;  1DTL A;  2I2R E;  3CGA A;  1TNX A;  3C1V A;  3I5G C;  2LE9 B;  1B1G A;  3OHM B;  5HLO A;  1NP8 A;  2I7A A;  3FWB A;  3BUM B;  2KFF A;  1OMR A;  2KGR A;  5I2O A;  1CDM A;  3CR2 A;  2GGZ A;  1D1O A;  1F54 A;  1ZOT B;  1QAS A;  1K95 A;  1S6C A;  1YUT A;  1QTX A;  2HQW A;  1KQM C;  1NWD A;  2KI4 B;  1KFX S;  1KSO A;  1XFX O;  2MA2 A;  3TS5 C;  2SCP A;  5I8N A;  1JWD A;  3I5I B;  3EK8 A;  3KHE A;  1RJV A;  2A4J A;  2DOQ A;  3M0W A;  4P5O E;  4PAL A;  5JJG A;  3VRQ A;  2K7D A;  1W7I B;  2LLU A;  2HET A;  2MRD A;  5CPV A;  1UUS A;  2M97 A;  3FWC A;  2NZ0 A;  2MHH A;  3O2P A;  5J3X A;  2PVB A;  1Q80 A;  4XJK A;  5HLV A;  2GGM A;  1OSA A;  1DVI A;  4A4B A;  2JXL A;  1CMG A;  3LLE A;  4NDD A;  5BPJ A;  2LMU A;  4DS7 A;  3WNX B;  5KU1 A;  1TNQ A;  1H8B A;  1XYD A;  4XJK B;  3DF0 A;  4R1E A;  4YRU A;  1SCM C;  3I5H C;  1LA3 A;  1B7T Z;  5DKR A;  3QRX A;  3EVR A;  1S26 D;  1F55 A;  5CSJ A;  1R6P A;  5PAL A;  3I5G B;  1F4Q A;  2QAC A;  2KQY A;  1DF0 A;  4DRW A;  1DJW A;  2HF5 A;  2QPT A;  1UHN A;  3IF7 A;  3KPX A;  3BUN B;  1TNP A;  1XK4 C;  2M9G A;  4M2O A;  2JU0 A;  1KFU S;  3SG3 A;  2G9B A;  2JRF A;  2NCO A;  4ZCV A;  2L5X B;  1J1E A;  2F2P A;  4PHM A;  1CDN A;  1SY9 A;  1DF0 B;  1K9K A;  5AAN A;  1YVL A;  2BBM A;  5AER A;  1B7T Y;  1V1F A;  2LVJ A;  4CPV A;  1YTZ C;  1YR5 A;  2SAS A;  3TS5 B;  1NIW A;  5DKQ A;  1TCF A;  2JPT A;  4AQI A;  1S1E A;  2M7N A;  1ODB A;  1EXR A;  2WC8 A;  5AFP A;  1UUR A;  1FW4 A;  1IJ5 A;  1MWN A;  1S36 A;  4XYN A;  1PVB A;  2KFH A;  3BOW A;  4USL A;  1K93 D;  4MSP A;  1FPW A;  1J7O A;  3EK7 A;  2ZRT A;  1YRT B;  2PRU A;  1SK6 D;  1Y1U A;  3FS7 A;  4OCI A;  2GV5 A;  2TN4 A;  1B8R A;  1UHH A;  1WRL A;  1XA5 A;  1TNW A;  2LAP A;  4YGB B;  3BOW B;  1DJZ A;  3VGO A;  1JFJ A;  4BY5 A;  4PE0 A;  2ZN9 A;  1A03 A;  4PHN A;  1K2H A;  5HKY A;  2JWW A;  1FI6 A;  1Y6W A;  1JF2 A;  3NSO A;  4HRG A;  1PVA A;  3I5H B;  3F45 A;  3SG7 A;  3VRR A;  2CXJ A;  1YVH A;  1WLM A;  4I5N B;  1SRA A;  1XFZ O;  4MZL A;  2KHN A;  4NDB A;  3HX4 A;  4GUK A;  2LVK A;  4N1F A;  2ISD A;  1REC A;  2L2E A;  1WDC B;  1J7P A;  1XO5 A;  2K7B A;  4GAO A;  1MQ1 A;  4CFQ A;  1B8C A;  1NCZ A;  2BCX A;  4I5L B;  1PSR A;  2M49 B;  3CWG A;  3SG2 A;  5I2Q A;  1XVJ A;  3D0Y A;  2BBN A;  2K2A A;  1CM1 A;  4F0Z B;  1KSM A;  1FF1 A;  5HKW A;  1UHI A;  1IG5 A;  1YX8 A;  2JT3 A;  2PSR A;  1CMF A;  3DVJ A;  1MF8 B;  2F2O A;  1B4C A;  3CTN A;  4OKH A;  1TOP A;  3SJS A;  1WLZ A;  2OTG C;  3WXA A;  1DT7 B;  4OR9 B;  1SCV A;  1Y1A A;  2F33 A;  1B8L A;  3NXA A;  5F6T A;  2BL0 C;  2ZKM X;  1V1G A;  2PAS A;  1KK8 C;  1SBJ A;  5CSF A;  4DIR A;  1G33 A;  1SPY A;  2KI6 D;  2BKI B;  2K0J A;  1OMD A;  4JQ0 D;  5JOL A;  2MAZ A;  1EG4 A;  2AMI A;  1CFD A;  4ORA B;  4DUQ A;  1JSA A;  4GGF C;  4YBH B;  1F70 A;  5HYD A;  4I5J A;  1L2O B;  3PSR A;  2LUC A;  1QIV A;  3EVV A;  2CNP A;  1J7Q A;  1QS7 A;  3PLF B;  1CTR A;  4UPG A;  5D69 A;  1SW8 A;  2JQ6 A;  4C0K A;  1JBA A;  1IWQ A;  1YUS A;  2CCM A;  2PMY A;  2M0R A;  3E3R A;  1TIZ A;  3CLN A;  1AVS A;  2KAV A;  4I5K A;  3LK1 A;  1C7W A;  2KYF A;  4MRX A;  2ZRS A;  3O4Y A;  1QJT A;  3TZ1 A;  1DJH A;  2JT8 A;  1OOJ A;  4PE4 A;  4N5X A;  3TUY C;  2CTN A;  1PK0 D;  5AXI A;  3CZT X;  3BXK A;  2M3W A;  1JFK A;  4FQO A;  1AJ5 A;  2M29 A;  2F3Y A;  2KYC A;  4M2Q A;  4PHK A;  1DJY A;  2LUX A;  2EC6 C;  3VRO A;  3JTD C;  4GPL B;  3TDI A;  4BY4 A;  2OTG B;  4C0J A;  3PM8 A;  1MR8 A;  1TRF A;  2LCP A;  4MEW A;  3PAL A;  2I18 A;  2L4I A;  1KWO C;  1KK8 B;  1J1D A;  1MHO A;  5ER5 A;  1LKJ A;  3AAJ A;  2BE6 A;  2KI6 C;  2NXQ A;  3LCP C;  2KDH A;  1Y0V H;  1H4B A;  1NPQ A;  2LVV A;  1ALW A;  4HRE E;  1CLM A;  2LV7 A;  1QXP A;  3TDZ A;  5AEQ A;  1PSB A;  1KQV A;  4GFT A;  1MXL C;  4GNK B;  2KBI A;  1AK8 A;  1UP5 A;  1K90 D;  4OV2 A;  1A2X A;  1A75 A;  3GOF A;  2L0P A;  1KQM B;  1N0Y A;  4E68 A;  1M31 A;  1QX5 B;  3VRP A;  5ER4 X;  1YUR A;  1A75 B;  4MRY A;  3AKB A;  1CDL A;  1LVC D;  1SL7 A;  2LAN A;  1BOC A;  2LLT A;  1E8A A;  4M2P A;  4QJ4 B;  1SL8 A;  2O5G A;  1SL9 A;  2EGD A;  4YGC B;  3BQ3 A;  4A4C A;  3EK4 A;  4ORB B;  1YRU B;  2Y5I A;  4ETO A;  3O6B A;  4C0L A;  2O60 A;  5CSI A;  1ZUZ A;  1NX0 A;  2EC6 B;  4NDC A;  1JC2 A;  2LC5 A;  3JTD B;  1M45 A;  2K2F A;  4D1E A;  2Y1M A;  1J7R A;  3NSK A;  5KSZ A;  1ZFS A;  1SCM B;  1CDP A;  1N65 A;  2Q4U A;  5IBW A;  3A4U B;  2F3Z A;  3DD4 A;  3KEV A;  1UWO A;  2M1K B;  4QJ5 B;  2H61 C;  1XK4 A;  1M63 B;  1BU3 A;  3JVT C;  1GGW A;  3D10 A;  1CFF A;  2OS8 C;  3CR4 X;  1SYM A;  4YGD B;  1XFY O;  2E30 A;  4PCW A;  1AP4 A;  2KFG A;  1VRK A;  2VRG A;  2KAX A;  1QVI Z;  2L4H A;  2JTT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...