4OV2A

Crystal structure of c-terminally truncated neuronal calcium sensor (ncs-1) from rattus norvegicus
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
159
structure length
151
Chain Sequence
LTRKTYFTEKEVQQWYKGFIKDCPSGQLDAAGFQKIYKQFFPFGDPTKFATFVFNVFDENKDGRIEFSEFIQALSVTSRGTLDEKLRWAFKLYDLDNDGYITRNEMLDIVDAIYQMVGNTTPEKRVDRIFAMMDKNADGKLTLQEFQEGSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium binding protein
molecule keywords Neuronal calcium sensor 1
publication title Crystal structure of C-terminally truncated Neuronal Calcium Sensor (NCS-1) from Rattus norvegicus
rcsb
source organism Rattus norvegicus
total genus 56
structure length 151
sequence length 159
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ov2A01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ov2A02
5HYDA 4DRWA 2I2RE 2KFGA 2LVJA 2LUXA 1CM1A 4CFQA 2K8MB 2LLTA 1DF0A 1DJYA 2H61A 1NIWA 4FTGA 2KBMA 2LHIA 4CPVA 1YTZC 1BOCA 4NDDA 2BKIB 4R1EA 5DKRA 1IH0A 1NX3A 1N0YA 3I5IB 2KI4C 1KFUS 3DVMA 4MSPA 1XFUO 4PHMA 2M49B 2ZNEA 1J7PA 3AAJA 1QIVA 1PSBA 1DJGA 2L50A 4GAOA 2AAOA 2NCPA 2OTGC 2GGMA 2PALA 3CR2A 1WRLA 1NCXA 1EG3A 1DJWA 2JU0A 3AAKA 2BBNA 3BOWB 3LL8B 2LM5A 2A4JA 2D8NA 2QPTA 1JWDA 2M1KB 5HLOA 4U8DA 3DD4A 2LV7A 2M29A 1ZMZA 3H4SE 2M1UA 1AP4A 1CDLA 3EVUA 3WNXB 1QX5B 1TRFA 2M7NA 4PHKA 1OMRA 4HSZA 5ER4X 2K0JA 2KAVA 2TN4A 1J1DA 1QJTA 1HT9A 2CTNA 3LK0A 1Y1AA 2IS9A 3D0YB 2M7LA 2AUCA 4MVFA 1R6PA 2I18A 2KI6D 1NCYA 3I5GC 5HKWA 1L2OB 1F71A 1YX8A 1S3PA 2RGIA 1XYDA 1XK4A 2KFHA 2L51A 2K2AA 1UURA 4OKHA 2JT3A 1QV0A 3PSRA 3BQ3A 1AUIB 3I5HC 3SIBA 1CMFA 1RTP1 2WCFA 2JT8A 4ORAB 2M9GA 3C1VA 1SY9A 2JOJA 2F8PA 4AOMA 1YUTA 2NCOA 2KGRA 1TTXA 1SMGA 1OMDA 3IF7A 1PSRA 5D69A 1QX7A 2BCXA 2JWWA 2PSRA 4PALA 5I8NA 1JUOA 1GGWA 2KDHA 1AJ5A 1EL4A 1LKJA 4GGFC 4YRUA 1RFJA 3A4UB 3SG2A 1CFCA 2BL0C 4YI9A 4M2PA 5JOLA 5JJGA 1B8LA 1JFKA 1MR8A 1NX1A 2LCPA 2KI4B 3FS7A 1JBAA 3CWGA 4IL1A 3CS1A 2L4IA 1QVIZ 1WY9A 1KSMA 1M45A 2G9BA 1B7TZ 2OTGB 3SG7A 2LP2A 4CIDA 1L7ZA 1QATA 1W7IB 1F55A 3AKBA 2I94A 2BE6A 3TDIA 3TS5B 3PLFB 2L4HA 1BR1B 4XJKA 2LP3A 3CTNA 1S6JA 2O5GA 4C0KA 4CLNA 1NWDA 1ALVA 2GV5A 1K94A 2KYFA 1LA0A 1YRUB 2LMUA 4UPGA 2M8UA 3LCPC 1S6IA 1YVHA 2F3YA 2K7BA 1EJ3A 1S6CA 3EK4A 1BF5A 5J3XA 4M2OA 1QLSA 1KK7Y 2LVVA 2MLEC 3RLZA 4QJ5B 1ALWA 2L2EA 3O78A 1Y1XA 2LVKA 1WRZA 1X02A 1QX2A 1GJYA 3QRXA 2H2KA 1LA3A 4PE1A 1IWQA 1GQMA 1M63B 4HRGA 5GQQC 1JC2A 4MZLA 2OPOA 2K7OA 3I5HB 1J1EA 1E8AA 2EC6C 3BUNB 2MJWB 4DUQA 3D0YA 4OR9B 2VRGA 1DTLA 1PULA 1UHNA 1CFFA 4PHJA 4WRIA 4MN0A 4AQIA 2OS8C 2LUCA 4C0JA 1IQ3A 2Y4QA 1J7OA 1CDMA 1A2XA 1A75A 3PN7C 3SG5A 1OMVA 2KAYA 4YGBB 1U5IB 3OP0A 5G08A 2JXCA 2M3WA 4AQJA 1QXPA 2BL0B 5HLVA 3TZ1A 1YR5A 5ER5A 1K9UA 2ZKMX 4OV2A 1OE9B 1UWOA 1G33A 2JTTA 2KYCA 2Q4UA 2O60A 1QIWA 4MRYA 4I5JA 1K90D 3LK1A 3NSLA 3MSEB 4GPLB 1YUSA 4MEWA 3TUYC 4USLA 1ZFSA 2E6WA 1KFXL 2BKHB 2GGZA 1OQPA 3TS5C 3ZNIA 2ISDA 4N1GA 4I5LB 3OHMB 2AMIA 2LMVA 1OZSA 1SBJA 2G2BA 2MHHA 1UHKA 1TOPA 1KSOA 5TNCA 3PALA 4GNKB 2COLB 1KCYA 2FCDA 5K89A 1FW4A 3GK1A 1NYAA 4M2QA 4YGAA 3EKHA 1AK8A 2LHLA 2CT9A 3KO0A 1SL9A 2HF5A 3DF0B 1J7RA 2L5XB 2EC6B 3O4YA 4GGNA 4L9MA 1FI5A 3TDZA 5F6TA 1DJZA 4ICBA 3RM1A 1SW8A 2ZN8A 2K2FA 2OS8B 3BUMB 4YGDB 1QV1A 2LANA 3PN7B 1WRKA 3I5FC 4DIRA 1YX7A 1CLBA 1XFVO 1YRTB 1UHJA 2NLNA 3NSKA 2WOSA 5KU1A 3BUOB 3KPXA 1F70A 1ODBA 2L98A 4GUKA 4YGCB 3OB1B 3PFVA 1R2UA 4FQOA 2R2IA 1NX0A 3FWCA 1KK8C 3IQOA 3DVJA 1A4PA 2Q91A 1AHRA 3WHTB 5CPVA 1DF0B 2KBIA 1W7JB 4I5NB 3AKAA 3GOFA 1KK7Z 4GGFA 5HKZA 2WNDA 1ZACA 1TNWA 1XFWO 3E3RA 3TUYB 4P2YB 3OX5A 3BYAA 4MZJA 5BPJA 1CNPA 1VRKA 3FIAA 2LAPA 1K2HA 1DMOA 5AERA 1PALA 1SCVA 1CFDA 4PE7A 2KOTA 3CLNA 4DCKA 2JQ6A 3OX6A 1YURA 1TCOB 1OOJA 2I7AA 2KAXA 3D10A 2LC5A 1QASA 1PK0D 4A4BA 1IQ5A 5CSNA 4PCWA 2JC2A 1CLMA 5DKQA 1F54A 2M0RA 3BOWA 1A03A 2MRDA 2KQYA 3KHEA 4YBHB 2E30A 4QJ4B 1IKUA 1V1GA 5CSJA 1S5GZ 2ZRSA 4HRHA 4DS7A 2PMYA 1SK6D 5AFPA 1JF0A 1LXFC 1K93D 5AANA 3CZTX 2ZN9A 1IJ5A 1NPQA 1XVJA 2ZFDA 2CBLA 3DVEA 3PATA 4Q04A 4BY4A 4BY5A 1BG1A 1DJHA 1B1GA 2BE4A 2WC8A 5DKNA 1SKTA 1BMOA 1LVCD 1MHOA 1UHIA 3I5FB 3CR5X 3JVTC 2K61A 4ORBB 4ORCB 1SRAA 2K7DA 1IRJA 1RJVA 1Y0VH 1S5GY 1C7VA 3WXAA 1SNLA 1BJFA 1Q80A 1QS7A 1NSHA 5I2QA 3BUXB 2BCAA 3FWBA 1KQMB 2MBXA 4OCIA 1B47A 1G4YR 2MA2A 1NUBA 2PRUA 2Y1MA 5CSIA 1KK8B 2KQ6A 2KFFA 4NDBA 2JPTA 3M0WA 2MAZA 1B9AA 1H8BA 1WLZA 3VRRA 2KNEA 4WQ2A 1UUSA 4PE0A 1CM4A 4YGEB 2H61C 2F2PA 4N5XA 1YVLA 4QJ3B 4PDZA 1CMGA 1B4CA 1S1EA 2JZIA 3VRPA 4E68A 3OB2B 1NP8A 2LNKA 1KFUL 2F33A 1ZUZA 2FOTA 1LINA 1BT6A 2NXQA 1G8IA 1PVAA 5I2LA 3WHUB 1KFXS 4XJKB 1K95A 3JTDC 4I5KA 2HETA 1MF8B 2CCMA 3KEVA 4C0LA 2CXJA 3GK2A 1MUXA 1XFXO 3HCMA 4P5OE 3ZWHA 1SL8A 3PM8A 1EG4A 1RROA 3A8RA 1A29A 4TNCA 5B8IB 5IBWA 1TNPA 1SYMA 3O6BA 2QACA 2LMTA 2NZ0A 1TNXA 3O2PA 4JPZB 4NDCA 1SCMC 1DT7B 2CNPA 1NCZA 4MRXA 4PHNA 2LLSA 1K8UA 1WDCC 2JNXA 1UP5A 1C7WA 1EH2A 1BLQA 3VRNA 4D1EA 1GGZA 2BBMA 1S36A 1ZOTB 2Y5IA 3JVTB 1MQ1A 1XK4C 1Y6WA 1KWOC 3LLEA 3EK8A 1JF2A 1RWYA 4PE4A 4WQ3A 1CLLA 2K7CA 1DGUA 5I2OA 1C07A 2WCEA 4MZKA 1B8CA 1RK9A 1TCFA 1K9PA 1KQMC 3NXAA 1CFPA 1JSAA 1A75B 3SG6A 1CTRA 1J55A 2SCPA 3BXKA 3KF9A 1CDPA 2PASA 1WLMA 1IGVA 1M39A 1EXRA 1U5IA 2WCBA 3BUWB 4NQGA 2JNFA 1XA5A 1MWNA 1HQVA 1N65A 2DOQA 2JULA 5KTYA 1N2DA 1SR6C 3K21A 3GK4X 4OVNF 2PVBA 2FCEA 4CFRA 1H4BA 1NX2A 3SJSA 1F4OA 1FPWA 1K96A 3EK7A 3SIAA 1BU3A 5FYXA 5AXIA 4XYNA 2F3ZA 4JQ0D 5D7FA 1TN4A 4GFTA 5KSZA 2KGBC 2MLFC 2WORA 3JTDB 2HQWA 3EKJA 2JT0A 3CR4X 3EVRA 4ETOA 1FBVA 2KI6C 4GBAA 2ZRTA 1CB1A 1BR4B 2F2OA 5AEQA 3VRQA 1SPYA 3I5IC 2LLUA 2KSPA 1S26D 2L0PA 3SG4A 4HREE 1RECA 1J7QA 2SASA 2EGDA 4N1FA 1XFZO 1DVIA 1KQVA 1D1OA 3ICBA 1AJ4A 2M97A 1SCMB 2BCBA 3VGOA 1CKKA 1QLKA 2JRFA 3VROA 1WDCB 3TDUA 1JFJA 3IQQA 1DGVA 4ZCUA 1QTXA 3NSIA 1TIZA 2Y1NA 1AVSA 1FF1A 2ZNDA 5HKYA 1V1FA 2KHNA 1QVIY 1KWOB 3F45A 1B7TY 3DF0A 1XO5A 3HX4A 1SL7A 1DJXA 1TNQA 4YI8A 2BECA 3I5GB 2V53A 1FI6A 2HPSA 2LE9B 1MXEA 1F4QA 2HQ8A 1K9KA 1BODA 1L2OC 5CSFA 1MXLC 1PRWA 1OZOA 2FJUB 1CDNA 1Y1UA 2JTZA 2P6BB 1IJ6A 3NSOA 1YUUA 3DVKA 4ZCVA 5PALA 4MBEA 4F0ZB 1F8HA 1PVBA 1DJIA 1B8RA 1IG5A 1UHHA 3EVVA 3CGAA 1M46A 1XFYO 4JWQA 1SR6B 1M31A 4MLWA 1OSAA 2JXLA 3SG3A 4A4CA 2B1UA 2EHBA 2LVIA
chains in the Genus database with same CATH superfamily
5HYDA 4DRWA 2I2RE 2KFGA 2LVJA 2LUXA 1CM1A 4CFQA 2K8MB 2LLTA 1DF0A 1DJYA 2H61A 1NIWA 4FTGA 2KBMA 2LHIA 4CPVA 1YTZC 1BOCA 4NDDA 2BKIB 4R1EA 5DKRA 1IH0A 1NX3A 1N0YA 3I5IB 2KI4C 1KFUS 3DVMA 4MSPA 1XFUO 4PHMA 2M49B 2ZNEA 2L2CA 1J7PA 1QWVA 1QIVA 1PSBA 1DJGA 2L50A 3AAJA 2AAOA 4GAOA 2NCPA 2OTGC 2GGMA 2PALA 3CR2A 1WRLA 1NCXA 1EG3A 1DJWA 2H8VA 2JU0A 3AAKA 3CYZA 2BBNA 3L4AA 3R1PA 3BOWB 2KPHA 3LL8B 2LM5A 2A4JA 2D8NA 2QPTA 1JWDA 2M1KB 5HLOA 4U8DA 3DD4A 2LV7A 2M29A 1ZMZA 3H4SE 2M1UA 4OZDA 1AP4A 3SS4A 3S0AA 1CDLA 3EVUA 3WNXB 1QX5B 1TRFA 2M7NA 4PHKA 1OMRA 4HSZA 5ER4X 2K0JA 2KAVA 2TN4A 1J1DA 1QJTA 1HT9A 2CTNA 3LK0A 1Y1AA 2IS9A 3D0YB 2M7LA 2AUCA 4MVFA 2QEOA 1R6PA 2I18A 2KI6D 1NCYA 3I5GC 5HKWA 1L2OB 1F71A 1YX8A 1S3PA 2RGIA 1XYDA 1XK4A 2KFHA 2L51A 2K2AA 1UURA 4OKHA 2JT3A 1QV0A 3PSRA 2BAPA 3BQ3A 1AUIB 3I5HC 3SIBA 1CMFA 1RTP1 2WCFA 2JT8A 4ORAB 2M9GA 3C1VA 1SY9A 2JOJA 2F8PA 4AOMA 3S0BA 1YUTA 2NCOA 2KGRA 1TTXA 1SMGA 1OMDA 3IF7A 3D73A 1PSRA 5D69A 1QX7A 2BCXA 2JWWA 2PSRA 4PALA 5I8NA 1JUOA 1GGWA 2KDHA 1AJ5A 1EL4A 1LKJA 4GGFC 4YRUA 1RFJA 3A4UB 3SG2A 1CFCA 2BL0C 4YI9A 4M2PA 5EL2A 5JOLA 5JJGA 1B8LA 1JFKA 1MR8A 1NX1A 2LCPA 2KI4B 3FS7A 1JBAA 1ORGA 4FQTA 2WCMA 3CWGA 5HL1A 4IL1A 3CS1A 2L4IA 1QVIZ 1WY9A 1KSMA 1M45A 2G9BA 1B7TZ 2OTGB 3EG5B 2LP2A 3SG7A 4CIDA 1L7ZA 1QATA 1W7IB 1F55A 3AKBA 2I94A 2BE6A 3TDIA 3TS5B 3PLFB 2L4HA 4JKTA 1BR1B 4XJKA 2LP3A 3CTNA 1S6JA 2O5GA 4C0KA 4CLNA 1NWDA 1ALVA 2GV5A 1K94A 3VB1A 2KYFA 3DYEA 1LA0A 1YRUB 2LMUA 4UPGA 2M8UA 3LCPC 1YVHA 1S6IA 1OOIX 2F3YA 1EJ3A 2K7BA 1S6CA 3EK4A 1BF5A 5J3XA 4M2OA 1QLSA 1KK7Y 2LVVA 2MLEC 3RLZA 4QJ5B 4F7FA 1W9ZA 1ALWA 2L2EA 3O78A 3BJHA 1Y1XA 2LVKA 1WRZA 1X02A 1QX2A 1GJYA 3QRXA 2H2KA 1LA3A 4PE1A 1IWQA 1GQMA 1M63B 4HRGA 5GQQC 1JC2A 4MZLA 2FJYA 2K7OA 2OPOA 3I5HB 1J1EA 1E8AA 2EC6C 3BUNB 2MJWB 3R72A 4DUQA 3D0YA 2KLDA 2VRGA 4OR9B 1DTLA 1PULA 1UHNA 1CFFA 4PHJA 4WRIA 2K60A 3IVTA 4MN0A 4AQIA 2OS8C 2LUCA 5I94A 4C0JA 1IQ3A 2Y4QA 1J7OA 1CDMA 1A2XA 1A75A 3PN7C 3SG5A 1OMVA 2KAYA 4YGBB 1TUZA 1U5IB 3OP0A 5G08A 2JXCA 2PYQA 2M3WA 4AQJA 1QXPA 2BL0B 5HLVA 3TZ1A 1YR5A 3S0FA 5ER5A 1K9UA 2ZKMX 4OV2A 1OE9B 1UWOA 1G33A 2JTTA 2KYCA 3CZ0A 2Q4UA 2O60A 2BNXA 1QIWA 3OBVA 4MRYA 4I5JA 1K90D 3LK1A 3NSLA 3MSEB 4GPLB 1YUSA 4MEWA 2QEVA 3TUYC 4USLA 1ZFSA 2E6WA 1KFXL 2BKHB 2GGZA 1OQPA 2PQLA 3R1OA 3TS5C 3ZNIA 2ISDA 2ERBA 4N1GA 1OW4A 3OHMB 4I5LB 2AMIA 2LMVA 2KLEA 3B87A 1OZSA 1SBJA 2G2BA 2MHHA 1UHKA 1TOPA 1KSOA 3SS5A 5TNCA 2YGUA 3PALA 4GNKB 2COLB 1KCYA 2FCDA 5K89A 1FW4A 3GK1A 1NYAA 3CZ2A 4M2QA 4YGAA 3EKHA 1AK8A 2LHLA 2CT9A 3B88A 3KO0A 1SL9A 2HF5A 3DF0B 1J7RA 2L5XB 2EC6B 3O4YA 4GGNA 3NHTA 4L9MA 1FI5A 3TDZA 3BFHA 5F6TA 1DJZA 4ICBA 3RM1A 1SW8A 2ZN8A 3L47A 2K2FA 2OS8B 3BUMB 4YGDB 1QV1A 2LANA 3PN7B 1WRKA 3FE6A 3I5FC 4DIRA 1YX7A 3N7HA 3D75A 1CLBA 1XFVO 1YRTB 1DELA 1UHJA 2NLNA 3DZTA 3NSKA 3UNWA 2WCJA 2WOSA 4IJ7A 3L4LA 5KU1A 3BUOB 3KPXA 1F70A 1ODBA 2L98A 4GUKA 4YGCB 1C3ZA 3OB1B 1OOGA 3PFVA 1R2UA 4FQOA 2R2IA 5FI7A 1NX0A 3FWCA 1KK8C 3IQOA 3DVJA 1A4PA 2Q91A 1TWOA 1AHRA 3BFBA 3WHTB 5CPVA 1DF0B 2WCLA 2KBIA 1W7JB 4I5NB 3AKAA 3B6XA 1KK7Z 3D78A 3GOFA 4GGFA 5HKZA 2WNDA 1ZACA 3Q8IA 1TNWA 1XFWO 3E3RA 3TUYB 4P2YB 3OX5A 1LS8A 3BYAA 4MZJA 5BPJA 1VRKA 1CNPA 2GTEA 2LAPA 3FIAA 1DMOA 1K2HA 5AERA 3PJIA 1DC1A 1PALA 1SCVA 1CFDA 4PE7A 2KOTA 3CLNA 4DCKA 3S0DA 2JQ6A 3BFAA 3OX6A 1YURA 1TCOB 1OOJA 2I7AA 5FI2A 2KAXA 3D10A 3PM2A 2LC5A 1QASA 1PK0D 4A4BA 1IQ5A 5CSNA 4PCWA 2JC2A 1CLMA 5DKQA 1F54A 2M0RA 3BOWA 1A03A 2MRDA 2KQYA 3KHEA 4YBHB 3SS3A 2WC6A 2E30A 4QJ4B 2L5YA 1IKUA 1V1GA 5CSJA 3DY9A 1S5GZ 2ZRSA 4HRHA 4DS7A 2PMYA 1SK6D 5AFPA 1JF0A 1LXFC 1K93D 5AANA 3CZTX 1GM0A 2ZN9A 1IJ5A 1NPQA 1XVJA 2ZFDA 2CBLA 3DVEA 3PATA 4Q04A 4BY4A 4BY5A 4INWA 1DJHA 3FE8A 1BG1A 1B1GA 2BE4A 1OOHA 2WC8A 1SKTA 5DKNA 3V2LA 1BMOA 1LVCD 1MHOA 1UHIA 3I5FB 3CR5X 4JD9A 3JVTC 2K61A 4ORBB 4ORCB 1SRAA 2K7DA 1IRJA 1RJVA 1Y0VH 1S5GY 1C7VA 3WXAA 1SNLA 1BJFA 1Q80A 1QS7A 1NSHA 5I2QA 3BUXB 2BCAA 3FWBA 1KQMB 2MBXA 4OCIA 1B47A 1G4YR 2MA2A 1NUBA 2PRUA 2Y1MA 5CSIA 1KK8B 2KQ6A 2KFFA 4NDBA 2JPTA 3M0WA 2MAZA 1B9AA 1H8BA 1WLZA 3VRRA 2KNEA 4WQ2A 1UUSA 4PE0A 1CM4A 4YGEB 2H61C 3B86A 2F2PA 4N5XA 1YVLA 4QJ3B 4PDZA 1CMGA 1B4CA 1S1EA 2JZIA 3VRPA 4E68A 3OB2B 1NP8A 2LNKA 2QEBA 1KFUL 2F33A 1ZUZA 2FOTA 1LINA 1BT6A 1OOFA 2NXQA 1G8IA 1PVAA 5I2LA 3WHUB 1KFXS 4XJKB 1K95A 3K1EA 3JTDC 4I5KA 3FE9A 2HETA 1MF8B 2CCMA 3KEVA 4C0LA 2CXJA 3GK2A 1MUXA 1XFXO 3HCMA 4P5OE 3ZWHA 1SL8A 3PM8A 1EG4A 1RROA 1T14A 1A29A 3A8RA 4TNCA 3CABA 5B8IB 1TNPA 5IBWA 1SYMA 3NHIA 3O6BA 2QACA 2LMTA 2NZ0A 1TNXA 3O2PA 4JPZB 4NDCA 1SCMC 1DT7B 2CNPA 1NCZA 4MRXA 4PHNA 2LLSA 1K8UA 1WDCC 2JNXA 2QDIA 1UP5A 1C7WA 3B7AA 3RZSA 1EH2A 2P71A 1BLQA 3VRNA 3S0EA 4D1EA 1GGZA 2BBMA 1S36A 1ZOTB 2Y5IA 3JVTB 1MQ1A 1XK4C 1Y6WA 1KWOC 3LLEA 3EK8A 1JF2A 1RWYA 3O4XA 4PE4A 4WQ3A 1CLLA 3UO9A 2K7CA 1DGUA 5I2OA 1C07A 2WCEA 4MZKA 1B8CA 1RK9A 1TCFA 1K9PA 1KQMC 1TUJA 3NXAA 1CFPA 1JSAA 1A75B 3SG6A 1CTRA 1J55A 2SCPA 3BXKA 3KF9A 1C3YA 1CDPA 2PASA 1WLMA 1IGVA 1M39A 1EXRA 1U5IA 2WCBA 3BUWB 4NQGA 2JNFA 1XA5A 1MWNA 1HQVA 1N65A 2DOQA 2JULA 5KTYA 1N2DA 1SR6C 3K21A 1Z4HA 3DXLA 3GK4X 3D77A 4OVNF 2PVBA 2FCEA 5D3OA 4CFRA 1NX2A 1H4BA 3SJSA 1F4OA 1FPWA 1K96A 3EK7A 3SIAA 1BU3A 5FYXA 1IIOA 5AXIA 4XYNA 2F3ZA 4JQ0D 5D7FA 1TN4A 4GFTA 3CZ1A 5KSZA 2KGBC 2MLFC 2WORA 3JTDB 2HQWA 3EKJA 2JT0A 3CR4X 3EVRA 4ETOA 1FBVA 2KI6C 4GBAA 2ZRTA 5FI6A 1CB1A 1BR4B 2F2OA 5AEQA 3QMEA 1SPYA 1XFRA 2LLUA 3I5IC 4INXA 3VRQA 2KSPA 1S26D 2WCKA 2L0PA 3D76A 3SG4A 4HREE 1RECA 2JPOA 1P28A 1J7QA 2SASA 2EGDA 4N1FA 3R1VA 1XFZO 2QEHA 1DVIA 5DICA 1D1OA 1KQVA 3OGNA 3ICBA 1AJ4A 2M97A 1SCMB 1DQEA 2BCBA 2WCHA 2P70A 3VGOA 1CKKA 1QLKA 2JRFA 2WC5A 3D74A 1WDCB 3TDUA 3VROA 1JFJA 3IQQA 1DGVA 4ZCUA 1QTXA 3NSIA 1TIZA 2Y1NA 1AVSA 1FF1A 2ZNDA 3S0GA 5HKYA 1V1FA 2KHNA 1QVIY 3CDNA 1KWOB 3F45A 1B7TY 3DF0A 1XO5A 3HX4A 1SL7A 1DJXA 1TNQA 4YI8A 2BECA 3I5GB 2V53A 1FI6A 2HPSA 2LE9B 1MXEA 1F4QA 2HQ8A 1DEKA 1K9KA 1BODA 1L2OC 5CSFA 1MXLC 1PRWA 1OZOA 2FJUB 1CDNA 1Y1UA 2JTZA 1Z2CB 1IJ6A 2P6BB 3NGVA 3NSOA 1SSEB 1YUUA 3DVKA 4ZCVA 5PALA 4MBEA 4F0ZB 1F8HA 1PVBA 1DJIA 1B8RA 4KYNA 1IG5A 4PT1A 1UHHA 3EVVA 3CGAA 1M46A 1XFYO 4JWQA 1SR6B 1M31A 4MLWA 1OSAA 2JXLA 3SG3A 4A4CA 2B1UA 2EHBA 2LVIA
chains in the Genus database with same CATH topology
5HYDA 4DRWA 2I2RE 2KFGA 2LVJA 2LUXA 1CM1A 4CFQA 2K8MB 2LLTA 1DF0A 1DJYA 2H61A 1NIWA 4FTGA 2KBMA 2LHIA 4CPVA 1YTZC 1BOCA 4NDDA 2BKIB 4R1EA 5DKRA 1IH0A 1NX3A 1N0YA 3I5IB 2KI4C 1KFUS 3DVMA 4MSPA 1XFUO 4PHMA 2M49B 2ZNEA 1J7PA 3AAJA 1QIVA 1PSBA 1DJGA 2L50A 4GAOA 2AAOA 2NCPA 2OTGC 2GGMA 2PALA 3CR2A 1WRLA 1NCXA 1EG3A 1DJWA 2JU0A 3AAKA 2BBNA 3BOWB 3LL8B 2LM5A 2A4JA 2D8NA 2QPTA 1JWDA 2M1KB 5HLOA 4U8DA 3DD4A 2LV7A 2M29A 1ZMZA 3H4SE 2M1UA 1AP4A 1CDLA 3EVUA 3WNXB 1QX5B 1TRFA 2M7NA 4PHKA 1OMRA 4HSZA 5ER4X 2K0JA 2KAVA 2TN4A 1J1DA 1QJTA 1HT9A 2CTNA 3LK0A 1Y1AA 2IS9A 3D0YB 2M7LA 2AUCA 4MVFA 1R6PA 2I18A 2KI6D 1NCYA 3I5GC 5HKWA 1L2OB 1F71A 1YX8A 1S3PA 2RGIA 1XYDA 1XK4A 2KFHA 2L51A 2K2AA 1UURA 4OKHA 2JT3A 1QV0A 3PSRA 3BQ3A 1AUIB 3I5HC 3SIBA 1CMFA 1RTP1 2WCFA 2JT8A 4ORAB 2M9GA 3C1VA 1SY9A 2JOJA 2F8PA 4AOMA 1YUTA 2NCOA 2KGRA 1TTXA 1SMGA 1OMDA 3IF7A 1PSRA 5D69A 1QX7A 2BCXA 2JWWA 2PSRA 4PALA 5I8NA 1JUOA 1GGWA 2KDHA 1AJ5A 1EL4A 1LKJA 4GGFC 4YRUA 1RFJA 3A4UB 3SG2A 1CFCA 2BL0C 4YI9A 4M2PA 5JOLA 5JJGA 1B8LA 1JFKA 1MR8A 1NX1A 2LCPA 2KI4B 3FS7A 1JBAA 3CWGA 4IL1A 3CS1A 2L4IA 1QVIZ 1WY9A 1KSMA 1M45A 2G9BA 1B7TZ 2OTGB 3SG7A 2LP2A 4CIDA 1L7ZA 1QATA 1W7IB 1F55A 3AKBA 2I94A 2BE6A 3TDIA 3TS5B 3PLFB 2L4HA 1BR1B 4XJKA 2LP3A 3CTNA 1S6JA 2O5GA 4C0KA 4CLNA 1NWDA 1ALVA 2GV5A 1K94A 2KYFA 1LA0A 1YRUB 2LMUA 4UPGA 2M8UA 3LCPC 1S6IA 1YVHA 2F3YA 2K7BA 1EJ3A 1S6CA 3EK4A 1BF5A 5J3XA 4M2OA 1QLSA 1KK7Y 2LVVA 2MLEC 3RLZA 4QJ5B 1ALWA 2L2EA 3O78A 1Y1XA 2LVKA 1WRZA 1X02A 1QX2A 1GJYA 3QRXA 2H2KA 1LA3A 4PE1A 1IWQA 1GQMA 1M63B 4HRGA 5GQQC 1JC2A 4MZLA 2OPOA 2K7OA 3I5HB 1J1EA 1E8AA 2EC6C 3BUNB 2MJWB 4DUQA 3D0YA 4OR9B 2VRGA 1DTLA 1PULA 1UHNA 1CFFA 4PHJA 4WRIA 4MN0A 4AQIA 2OS8C 2LUCA 4C0JA 1IQ3A 2Y4QA 1J7OA 1CDMA 1A2XA 1A75A 3PN7C 3SG5A 1OMVA 2KAYA 4YGBB 1U5IB 3OP0A 5G08A 2JXCA 2M3WA 4AQJA 1QXPA 2BL0B 5HLVA 3TZ1A 1YR5A 5ER5A 1K9UA 2ZKMX 4OV2A 1OE9B 1UWOA 1G33A 2JTTA 2KYCA 2Q4UA 2O60A 1QIWA 4MRYA 4I5JA 1K90D 3LK1A 3NSLA 3MSEB 4GPLB 1YUSA 4MEWA 3TUYC 4USLA 1ZFSA 2E6WA 1KFXL 2BKHB 2GGZA 1OQPA 3TS5C 3ZNIA 2ISDA 4N1GA 4I5LB 3OHMB 2AMIA 2LMVA 1OZSA 1SBJA 2G2BA 2MHHA 1UHKA 1TOPA 1KSOA 5TNCA 3PALA 4GNKB 2COLB 1KCYA 2FCDA 5K89A 1FW4A 3GK1A 1NYAA 4M2QA 4YGAA 3EKHA 1AK8A 2LHLA 2CT9A 3KO0A 1SL9A 2HF5A 3DF0B 1J7RA 2L5XB 2EC6B 3O4YA 4GGNA 4L9MA 1FI5A 3TDZA 5F6TA 1DJZA 4ICBA 3RM1A 1SW8A 2ZN8A 2K2FA 2OS8B 3BUMB 4YGDB 1QV1A 2LANA 3PN7B 1WRKA 3I5FC 4DIRA 1YX7A 1CLBA 1XFVO 1YRTB 1UHJA 2NLNA 3NSKA 2WOSA 5KU1A 3BUOB 3KPXA 1F70A 1ODBA 2L98A 4GUKA 4YGCB 3OB1B 3PFVA 1R2UA 4FQOA 2R2IA 1NX0A 3FWCA 1KK8C 3IQOA 3DVJA 1A4PA 2Q91A 1AHRA 3WHTB 5CPVA 1DF0B 2KBIA 1W7JB 4I5NB 3AKAA 3GOFA 1KK7Z 4GGFA 5HKZA 2WNDA 1ZACA 1TNWA 1XFWO 3E3RA 3TUYB 4P2YB 3OX5A 3BYAA 4MZJA 5BPJA 1CNPA 1VRKA 3FIAA 2LAPA 1K2HA 1DMOA 5AERA 1PALA 1SCVA 1CFDA 4PE7A 2KOTA 3CLNA 4DCKA 2JQ6A 3OX6A 1YURA 1TCOB 1OOJA 2I7AA 2KAXA 3D10A 2LC5A 1QASA 1PK0D 4A4BA 1IQ5A 5CSNA 4PCWA 2JC2A 1CLMA 5DKQA 1F54A 2M0RA 3BOWA 1A03A 2MRDA 2KQYA 3KHEA 4YBHB 2E30A 4QJ4B 1IKUA 1V1GA 5CSJA 1S5GZ 2ZRSA 4HRHA 4DS7A 2PMYA 1SK6D 5AFPA 1JF0A 1LXFC 1K93D 5AANA 3CZTX 2ZN9A 1IJ5A 1NPQA 1XVJA 2ZFDA 2CBLA 3DVEA 3PATA 4Q04A 4BY4A 4BY5A 1BG1A 1DJHA 1B1GA 2BE4A 2WC8A 5DKNA 1SKTA 1BMOA 1LVCD 1MHOA 1UHIA 3I5FB 3CR5X 3JVTC 2K61A 4ORBB 4ORCB 1SRAA 2K7DA 1IRJA 1RJVA 1Y0VH 1S5GY 1C7VA 3WXAA 1SNLA 1BJFA 1Q80A 1QS7A 1NSHA 5I2QA 3BUXB 2BCAA 3FWBA 1KQMB 2MBXA 4OCIA 1B47A 1G4YR 2MA2A 1NUBA 2PRUA 2Y1MA 5CSIA 1KK8B 2KQ6A 2KFFA 4NDBA 2JPTA 3M0WA 2MAZA 1B9AA 1H8BA 1WLZA 3VRRA 2KNEA 4WQ2A 1UUSA 4PE0A 1CM4A 4YGEB 2H61C 2F2PA 4N5XA 1YVLA 4QJ3B 4PDZA 1CMGA 1B4CA 1S1EA 2JZIA 3VRPA 4E68A 3OB2B 1NP8A 2LNKA 1KFUL 2F33A 1ZUZA 2FOTA 1LINA 1BT6A 2NXQA 1G8IA 1PVAA 5I2LA 3WHUB 1KFXS 4XJKB 1K95A 3JTDC 4I5KA 2HETA 1MF8B 2CCMA 3KEVA 4C0LA 2CXJA 3GK2A 1MUXA 1XFXO 3HCMA 4P5OE 3ZWHA 1SL8A 3PM8A 1EG4A 1RROA 3A8RA 1A29A 4TNCA 5B8IB 5IBWA 1TNPA 1SYMA 3O6BA 2QACA 2LMTA 2NZ0A 1TNXA 3O2PA 4JPZB 4NDCA 1SCMC 1DT7B 2CNPA 1NCZA 4MRXA 4PHNA 2LLSA 1K8UA 1WDCC 2JNXA 1UP5A 1C7WA 1EH2A 1BLQA 3VRNA 4D1EA 1GGZA 2BBMA 1S36A 1ZOTB 2Y5IA 3JVTB 1MQ1A 1XK4C 1Y6WA 1KWOC 3LLEA 3EK8A 1JF2A 1RWYA 4PE4A 4WQ3A 1CLLA 2K7CA 1DGUA 5I2OA 1C07A 2WCEA 4MZKA 1B8CA 1RK9A 1TCFA 1K9PA 1KQMC 3NXAA 1CFPA 1JSAA 1A75B 3SG6A 1CTRA 1J55A 2SCPA 3BXKA 3KF9A 1CDPA 2PASA 1WLMA 1IGVA 1M39A 1EXRA 1U5IA 2WCBA 3BUWB 4NQGA 2JNFA 1XA5A 1MWNA 1HQVA 1N65A 2DOQA 2JULA 5KTYA 1N2DA 1SR6C 3K21A 3GK4X 4OVNF 2PVBA 2FCEA 4CFRA 1H4BA 1NX2A 3SJSA 1F4OA 1FPWA 1K96A 3EK7A 3SIAA 1BU3A 5FYXA 5AXIA 4XYNA 2F3ZA 4JQ0D 5D7FA 1TN4A 4GFTA 5KSZA 2KGBC 2MLFC 2WORA 3JTDB 2HQWA 3EKJA 2JT0A 3CR4X 3EVRA 4ETOA 1FBVA 2KI6C 4GBAA 2ZRTA 1CB1A 1BR4B 2F2OA 5AEQA 3VRQA 1SPYA 3I5IC 2LLUA 2KSPA 1S26D 2L0PA 3SG4A 4HREE 1RECA 1J7QA 2SASA 2EGDA 4N1FA 1XFZO 1DVIA 1KQVA 1D1OA 3ICBA 1AJ4A 2M97A 1SCMB 2BCBA 3VGOA 1CKKA 1QLKA 2JRFA 3VROA 1WDCB 3TDUA 1JFJA 3IQQA 1DGVA 4ZCUA 1QTXA 3NSIA 1TIZA 2Y1NA 1AVSA 1FF1A 2ZNDA 5HKYA 1V1FA 2KHNA 1QVIY 1KWOB 3F45A 1B7TY 3DF0A 1XO5A 3HX4A 1SL7A 1DJXA 1TNQA 4YI8A 2BECA 3I5GB 2V53A 1FI6A 2HPSA 2LE9B 1MXEA 1F4QA 2HQ8A 1K9KA 1BODA 1L2OC 5CSFA 1MXLC 1PRWA 1OZOA 2FJUB 1CDNA 1Y1UA 2JTZA 2P6BB 1IJ6A 3NSOA 1YUUA 3DVKA 4ZCVA 5PALA 4MBEA 4F0ZB 1F8HA 1PVBA 1DJIA 1B8RA 1IG5A 1UHHA 3EVVA 3CGAA 1M46A 1XFYO 4JWQA 1SR6B 1M31A 4MLWA 1OSAA 2JXLA 3SG3A 4A4CA 2B1UA 2EHBA 2LVIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HYD A;  4DRW A;  2I2R E;  2KFG A;  2LVJ A;  2LUX A;  1CM1 A;  4CFQ A;  2K8M B;  2LLT A;  1DF0 A;  1DJY A;  2H61 A;  1NIW A;  4FTG A;  2KBM A;  2LHI A;  4CPV A;  1YTZ C;  1BOC A;  4NDD A;  2BKI B;  4R1E A;  5DKR A;  1IH0 A;  1NX3 A;  1N0Y A;  3I5I B;  2KI4 C;  1KFU S;  3DVM A;  4MSP A;  1XFU O;  4PHM A;  2M49 B;  2ZNE A;  1J7P A;  3AAJ A;  1QIV A;  1PSB A;  1DJG A;  2L50 A;  4GAO A;  2AAO A;  2NCP A;  2OTG C;  2GGM A;  2PAL A;  3CR2 A;  1WRL A;  1NCX A;  1EG3 A;  1DJW A;  2JU0 A;  3AAK A;  2BBN A;  3BOW B;  3LL8 B;  2LM5 A;  2A4J A;  2D8N A;  2QPT A;  1JWD A;  2M1K B;  5HLO A;  4U8D A;  3DD4 A;  2LV7 A;  2M29 A;  1ZMZ A;  3H4S E;  2M1U A;  1AP4 A;  1CDL A;  3EVU A;  3WNX B;  1QX5 B;  1TRF A;  2M7N A;  4PHK A;  1OMR A;  4HSZ A;  5ER4 X;  2K0J A;  2KAV A;  2TN4 A;  1J1D A;  1QJT A;  1HT9 A;  2CTN A;  3LK0 A;  1Y1A A;  2IS9 A;  3D0Y B;  2M7L A;  2AUC A;  4MVF A;  1R6P A;  2I18 A;  2KI6 D;  1NCY A;  3I5G C;  5HKW A;  1L2O B;  1F71 A;  1YX8 A;  1S3P A;  2RGI A;  1XYD A;  1XK4 A;  2KFH A;  2L51 A;  2K2A A;  1UUR A;  4OKH A;  2JT3 A;  1QV0 A;  3PSR A;  3BQ3 A;  1AUI B;  3I5H C;  3SIB A;  1CMF A;  1RTP 1;  2WCF A;  2JT8 A;  4ORA B;  2M9G A;  3C1V A;  1SY9 A;  2JOJ A;  2F8P A;  4AOM A;  1YUT A;  2NCO A;  2KGR A;  1TTX A;  1SMG A;  1OMD A;  3IF7 A;  1PSR A;  5D69 A;  1QX7 A;  2BCX A;  2JWW A;  2PSR A;  4PAL A;  5I8N A;  1JUO A;  1GGW A;  2KDH A;  1AJ5 A;  1EL4 A;  1LKJ A;  4GGF C;  4YRU A;  1RFJ A;  3A4U B;  3SG2 A;  1CFC A;  2BL0 C;  4YI9 A;  4M2P A;  5JOL A;  5JJG A;  1B8L A;  1JFK A;  1MR8 A;  1NX1 A;  2LCP A;  2KI4 B;  3FS7 A;  1JBA A;  3CWG A;  4IL1 A;  3CS1 A;  2L4I A;  1QVI Z;  1WY9 A;  1KSM A;  1M45 A;  2G9B A;  1B7T Z;  2OTG B;  3SG7 A;  2LP2 A;  4CID A;  1L7Z A;  1QAT A;  1W7I B;  1F55 A;  3AKB A;  2I94 A;  2BE6 A;  3TDI A;  3TS5 B;  3PLF B;  2L4H A;  1BR1 B;  4XJK A;  2LP3 A;  3CTN A;  1S6J A;  2O5G A;  4C0K A;  4CLN A;  1NWD A;  1ALV A;  2GV5 A;  1K94 A;  2KYF A;  1LA0 A;  1YRU B;  2LMU A;  4UPG A;  2M8U A;  3LCP C;  1S6I A;  1YVH A;  2F3Y A;  2K7B A;  1EJ3 A;  1S6C A;  3EK4 A;  1BF5 A;  5J3X A;  4M2O A;  1QLS A;  1KK7 Y;  2LVV A;  2MLE C;  3RLZ A;  4QJ5 B;  1ALW A;  2L2E A;  3O78 A;  1Y1X A;  2LVK A;  1WRZ A;  1X02 A;  1QX2 A;  1GJY A;  3QRX A;  2H2K A;  1LA3 A;  4PE1 A;  1IWQ A;  1GQM A;  1M63 B;  4HRG A;  5GQQ C;  1JC2 A;  4MZL A;  2OPO A;  2K7O A;  3I5H B;  1J1E A;  1E8A A;  2EC6 C;  3BUN B;  2MJW B;  4DUQ A;  3D0Y A;  4OR9 B;  2VRG A;  1DTL A;  1PUL A;  1UHN A;  1CFF A;  4PHJ A;  4WRI A;  4MN0 A;  4AQI A;  2OS8 C;  2LUC A;  4C0J A;  1IQ3 A;  2Y4Q A;  1J7O A;  1CDM A;  1A2X A;  1A75 A;  3PN7 C;  3SG5 A;  1OMV A;  2KAY A;  4YGB B;  1U5I B;  3OP0 A;  5G08 A;  2JXC A;  2M3W A;  4AQJ A;  1QXP A;  2BL0 B;  5HLV A;  3TZ1 A;  1YR5 A;  5ER5 A;  1K9U A;  2ZKM X;  4OV2 A;  1OE9 B;  1UWO A;  1G33 A;  2JTT A;  2KYC A;  2Q4U A;  2O60 A;  1QIW A;  4MRY A;  4I5J A;  1K90 D;  3LK1 A;  3NSL A;  3MSE B;  4GPL B;  1YUS A;  4MEW A;  3TUY C;  4USL A;  1ZFS A;  2E6W A;  1KFX L;  2BKH B;  2GGZ A;  1OQP A;  3TS5 C;  3ZNI A;  2ISD A;  4N1G A;  4I5L B;  3OHM B;  2AMI A;  2LMV A;  1OZS A;  1SBJ A;  2G2B A;  2MHH A;  1UHK A;  1TOP A;  1KSO A;  5TNC A;  3PAL A;  4GNK B;  2COL B;  1KCY A;  2FCD A;  5K89 A;  1FW4 A;  3GK1 A;  1NYA A;  4M2Q A;  4YGA A;  3EKH A;  1AK8 A;  2LHL A;  2CT9 A;  3KO0 A;  1SL9 A;  2HF5 A;  3DF0 B;  1J7R A;  2L5X B;  2EC6 B;  3O4Y A;  4GGN A;  4L9M A;  1FI5 A;  3TDZ A;  5F6T A;  1DJZ A;  4ICB A;  3RM1 A;  1SW8 A;  2ZN8 A;  2K2F A;  2OS8 B;  3BUM B;  4YGD B;  1QV1 A;  2LAN A;  3PN7 B;  1WRK A;  3I5F C;  4DIR A;  1YX7 A;  1CLB A;  1XFV O;  1YRT B;  1UHJ A;  2NLN A;  3NSK A;  2WOS A;  5KU1 A;  3BUO B;  3KPX A;  1F70 A;  1ODB A;  2L98 A;  4GUK A;  4YGC B;  3OB1 B;  3PFV A;  1R2U A;  4FQO A;  2R2I A;  1NX0 A;  3FWC A;  1KK8 C;  3IQO A;  3DVJ A;  1A4P A;  2Q91 A;  1AHR A;  3WHT B;  5CPV A;  1DF0 B;  2KBI A;  1W7J B;  4I5N B;  3AKA A;  3GOF A;  1KK7 Z;  4GGF A;  5HKZ A;  2WND A;  1ZAC A;  1TNW A;  1XFW O;  3E3R A;  3TUY B;  4P2Y B;  3OX5 A;  3BYA A;  4MZJ A;  5BPJ A;  1CNP A;  1VRK A;  3FIA A;  2LAP A;  1K2H A;  1DMO A;  5AER A;  1PAL A;  1SCV A;  1CFD A;  4PE7 A;  2KOT A;  3CLN A;  4DCK A;  2JQ6 A;  3OX6 A;  1YUR A;  1TCO B;  1OOJ A;  2I7A A;  2KAX A;  3D10 A;  2LC5 A;  1QAS A;  1PK0 D;  4A4B A;  1IQ5 A;  5CSN A;  4PCW A;  2JC2 A;  1CLM A;  5DKQ A;  1F54 A;  2M0R A;  3BOW A;  1A03 A;  2MRD A;  2KQY A;  3KHE A;  4YBH B;  2E30 A;  4QJ4 B;  1IKU A;  1V1G A;  5CSJ A;  1S5G Z;  2ZRS A;  4HRH A;  4DS7 A;  2PMY A;  1SK6 D;  5AFP A;  1JF0 A;  1LXF C;  1K93 D;  5AAN A;  3CZT X;  2ZN9 A;  1IJ5 A;  1NPQ A;  1XVJ A;  2ZFD A;  2CBL A;  3DVE A;  3PAT A;  4Q04 A;  4BY4 A;  4BY5 A;  1BG1 A;  1DJH A;  1B1G A;  2BE4 A;  2WC8 A;  5DKN A;  1SKT A;  1BMO A;  1LVC D;  1MHO A;  1UHI A;  3I5F B;  3CR5 X;  3JVT C;  2K61 A;  4ORB B;  4ORC B;  1SRA A;  2K7D A;  1IRJ A;  1RJV A;  1Y0V H;  1S5G Y;  1C7V A;  3WXA A;  1SNL A;  1BJF A;  1Q80 A;  1QS7 A;  1NSH A;  5I2Q A;  3BUX B;  2BCA A;  3FWB A;  1KQM B;  2MBX A;  4OCI A;  1B47 A;  1G4Y R;  2MA2 A;  1NUB A;  2PRU A;  2Y1M A;  5CSI A;  1KK8 B;  2KQ6 A;  2KFF A;  4NDB A;  2JPT A;  3M0W A;  2MAZ A;  1B9A A;  1H8B A;  1WLZ A;  3VRR A;  2KNE A;  4WQ2 A;  1UUS A;  4PE0 A;  1CM4 A;  4YGE B;  2H61 C;  2F2P A;  4N5X A;  1YVL A;  4QJ3 B;  4PDZ A;  1CMG A;  1B4C A;  1S1E A;  2JZI A;  3VRP A;  4E68 A;  3OB2 B;  1NP8 A;  2LNK A;  1KFU L;  2F33 A;  1ZUZ A;  2FOT A;  1LIN A;  1BT6 A;  2NXQ A;  1G8I A;  1PVA A;  5I2L A;  3WHU B;  1KFX S;  4XJK B;  1K95 A;  3JTD C;  4I5K A;  2HET A;  1MF8 B;  2CCM A;  3KEV A;  4C0L A;  2CXJ A;  3GK2 A;  1MUX A;  1XFX O;  3HCM A;  4P5O E;  3ZWH A;  1SL8 A;  3PM8 A;  1EG4 A;  1RRO A;  3A8R A;  1A29 A;  4TNC A;  5B8I B;  5IBW A;  1TNP A;  1SYM A;  3O6B A;  2QAC A;  2LMT A;  2NZ0 A;  1TNX A;  3O2P A;  4JPZ B;  4NDC A;  1SCM C;  1DT7 B;  2CNP A;  1NCZ A;  4MRX A;  4PHN A;  2LLS A;  1K8U A;  1WDC C;  2JNX A;  1UP5 A;  1C7W A;  1EH2 A;  1BLQ A;  3VRN A;  4D1E A;  1GGZ A;  2BBM A;  1S36 A;  1ZOT B;  2Y5I A;  3JVT B;  1MQ1 A;  1XK4 C;  1Y6W A;  1KWO C;  3LLE A;  3EK8 A;  1JF2 A;  1RWY A;  4PE4 A;  4WQ3 A;  1CLL A;  2K7C A;  1DGU A;  5I2O A;  1C07 A;  2WCE A;  4MZK A;  1B8C A;  1RK9 A;  1TCF A;  1K9P A;  1KQM C;  3NXA A;  1CFP A;  1JSA A;  1A75 B;  3SG6 A;  1CTR A;  1J55 A;  2SCP A;  3BXK A;  3KF9 A;  1CDP A;  2PAS A;  1WLM A;  1IGV A;  1M39 A;  1EXR A;  1U5I A;  2WCB A;  3BUW B;  4NQG A;  2JNF A;  1XA5 A;  1MWN A;  1HQV A;  1N65 A;  2DOQ A;  2JUL A;  5KTY A;  1N2D A;  1SR6 C;  3K21 A;  3GK4 X;  4OVN F;  2PVB A;  2FCE A;  4CFR A;  1H4B A;  1NX2 A;  3SJS A;  1F4O A;  1FPW A;  1K96 A;  3EK7 A;  3SIA A;  1BU3 A;  5FYX A;  5AXI A;  4XYN A;  2F3Z A;  4JQ0 D;  5D7F A;  1TN4 A;  4GFT A;  5KSZ A;  2KGB C;  2MLF C;  2WOR A;  3JTD B;  2HQW A;  3EKJ A;  2JT0 A;  3CR4 X;  3EVR A;  4ETO A;  1FBV A;  2KI6 C;  4GBA A;  2ZRT A;  1CB1 A;  1BR4 B;  2F2O A;  5AEQ A;  3VRQ A;  1SPY A;  3I5I C;  2LLU A;  2KSP A;  1S26 D;  2L0P A;  3SG4 A;  4HRE E;  1REC A;  1J7Q A;  2SAS A;  2EGD A;  4N1F A;  1XFZ O;  1DVI A;  1KQV A;  1D1O A;  3ICB A;  1AJ4 A;  2M97 A;  1SCM B;  2BCB A;  3VGO A;  1CKK A;  1QLK A;  2JRF A;  3VRO A;  1WDC B;  3TDU A;  1JFJ A;  3IQQ A;  1DGV A;  4ZCU A;  1QTX A;  3NSI A;  1TIZ A;  2Y1N A;  1AVS A;  1FF1 A;  2ZND A;  5HKY A;  1V1F A;  2KHN A;  1QVI Y;  1KWO B;  3F45 A;  1B7T Y;  3DF0 A;  1XO5 A;  3HX4 A;  1SL7 A;  1DJX A;  1TNQ A;  4YI8 A;  2BEC A;  3I5G B;  2V53 A;  1FI6 A;  2HPS A;  2LE9 B;  1MXE A;  1F4Q A;  2HQ8 A;  1K9K A;  1BOD A;  1L2O C;  5CSF A;  1MXL C;  1PRW A;  1OZO A;  2FJU B;  1CDN A;  1Y1U A;  2JTZ A;  2P6B B;  1IJ6 A;  3NSO A;  1YUU A;  3DVK A;  4ZCV A;  5PAL A;  4MBE A;  4F0Z B;  1F8H A;  1PVB A;  1DJI A;  1B8R A;  1IG5 A;  1UHH A;  3EVV A;  3CGA A;  1M46 A;  1XFY O;  4JWQ A;  1SR6 B;  1M31 A;  4MLW A;  1OSA A;  2JXL A;  3SG3 A;  4A4C A;  2B1U A;  2EHB A;  2LVI A; 
#chains in the Genus database with same CATH topology
 5HYD A;  4DRW A;  2I2R E;  2KFG A;  2LVJ A;  2LUX A;  1CM1 A;  4CFQ A;  2K8M B;  2LLT A;  1DF0 A;  1DJY A;  2H61 A;  1NIW A;  4FTG A;  2KBM A;  2LHI A;  4CPV A;  1YTZ C;  1BOC A;  4NDD A;  2BKI B;  4R1E A;  5DKR A;  1IH0 A;  1NX3 A;  1N0Y A;  3I5I B;  2KI4 C;  1KFU S;  3DVM A;  4MSP A;  1XFU O;  4PHM A;  2M49 B;  2ZNE A;  2L2C A;  1J7P A;  1QWV A;  1QIV A;  1PSB A;  1DJG A;  2L50 A;  3AAJ A;  2AAO A;  4GAO A;  2NCP A;  2OTG C;  2GGM A;  2PAL A;  3CR2 A;  1WRL A;  1NCX A;  1EG3 A;  1DJW A;  2H8V A;  2JU0 A;  3AAK A;  3CYZ A;  2BBN A;  3L4A A;  3R1P A;  3BOW B;  2KPH A;  3LL8 B;  2LM5 A;  2A4J A;  2D8N A;  2QPT A;  1JWD A;  2M1K B;  5HLO A;  4U8D A;  3DD4 A;  2LV7 A;  2M29 A;  1ZMZ A;  3H4S E;  2M1U A;  4OZD A;  1AP4 A;  3SS4 A;  3S0A A;  1CDL A;  3EVU A;  3WNX B;  1QX5 B;  1TRF A;  2M7N A;  4PHK A;  1OMR A;  4HSZ A;  5ER4 X;  2K0J A;  2KAV A;  2TN4 A;  1J1D A;  1QJT A;  1HT9 A;  2CTN A;  3LK0 A;  1Y1A A;  2IS9 A;  3D0Y B;  2M7L A;  2AUC A;  4MVF A;  2QEO A;  1R6P A;  2I18 A;  2KI6 D;  1NCY A;  3I5G C;  5HKW A;  1L2O B;  1F71 A;  1YX8 A;  1S3P A;  2RGI A;  1XYD A;  1XK4 A;  2KFH A;  2L51 A;  2K2A A;  1UUR A;  4OKH A;  2JT3 A;  1QV0 A;  3PSR A;  2BAP A;  3BQ3 A;  1AUI B;  3I5H C;  3SIB A;  1CMF A;  1RTP 1;  2WCF A;  2JT8 A;  4ORA B;  2M9G A;  3C1V A;  1SY9 A;  2JOJ A;  2F8P A;  4AOM A;  3S0B A;  1YUT A;  2NCO A;  2KGR A;  1TTX A;  1SMG A;  1OMD A;  3IF7 A;  3D73 A;  1PSR A;  5D69 A;  1QX7 A;  2BCX A;  2JWW A;  2PSR A;  4PAL A;  5I8N A;  1JUO A;  1GGW A;  2KDH A;  1AJ5 A;  1EL4 A;  1LKJ A;  4GGF C;  4YRU A;  1RFJ A;  3A4U B;  3SG2 A;  1CFC A;  2BL0 C;  4YI9 A;  4M2P A;  5EL2 A;  5JOL A;  5JJG A;  1B8L A;  1JFK A;  1MR8 A;  1NX1 A;  2LCP A;  2KI4 B;  3FS7 A;  1JBA A;  1ORG A;  4FQT A;  2WCM A;  3CWG A;  5HL1 A;  4IL1 A;  3CS1 A;  2L4I A;  1QVI Z;  1WY9 A;  1KSM A;  1M45 A;  2G9B A;  1B7T Z;  2OTG B;  3EG5 B;  2LP2 A;  3SG7 A;  4CID A;  1L7Z A;  1QAT A;  1W7I B;  1F55 A;  3AKB A;  2I94 A;  2BE6 A;  3TDI A;  3TS5 B;  3PLF B;  2L4H A;  4JKT A;  1BR1 B;  4XJK A;  2LP3 A;  3CTN A;  1S6J A;  2O5G A;  4C0K A;  4CLN A;  1NWD A;  1ALV A;  2GV5 A;  1K94 A;  3VB1 A;  2KYF A;  3DYE A;  1LA0 A;  1YRU B;  2LMU A;  4UPG A;  2M8U A;  3LCP C;  1YVH A;  1S6I A;  1OOI X;  2F3Y A;  1EJ3 A;  2K7B A;  1S6C A;  3EK4 A;  1BF5 A;  5J3X A;  4M2O A;  1QLS A;  1KK7 Y;  2LVV A;  2MLE C;  3RLZ A;  4QJ5 B;  4F7F A;  1W9Z A;  1ALW A;  2L2E A;  3O78 A;  3BJH A;  1Y1X A;  2LVK A;  1WRZ A;  1X02 A;  1QX2 A;  1GJY A;  3QRX A;  2H2K A;  1LA3 A;  4PE1 A;  1IWQ A;  1GQM A;  1M63 B;  4HRG A;  5GQQ C;  1JC2 A;  4MZL A;  2FJY A;  2K7O A;  2OPO A;  3I5H B;  1J1E A;  1E8A A;  2EC6 C;  3BUN B;  2MJW B;  3R72 A;  4DUQ A;  3D0Y A;  2KLD A;  2VRG A;  4OR9 B;  1DTL A;  1PUL A;  1UHN A;  1CFF A;  4PHJ A;  4WRI A;  2K60 A;  3IVT A;  4MN0 A;  4AQI A;  2OS8 C;  2LUC A;  5I94 A;  4C0J A;  1IQ3 A;  2Y4Q A;  1J7O A;  1CDM A;  1A2X A;  1A75 A;  3PN7 C;  3SG5 A;  1OMV A;  2KAY A;  4YGB B;  1TUZ A;  1U5I B;  3OP0 A;  5G08 A;  2JXC A;  2PYQ A;  2M3W A;  4AQJ A;  1QXP A;  2BL0 B;  5HLV A;  3TZ1 A;  1YR5 A;  3S0F A;  5ER5 A;  1K9U A;  2ZKM X;  4OV2 A;  1OE9 B;  1UWO A;  1G33 A;  2JTT A;  2KYC A;  3CZ0 A;  2Q4U A;  2O60 A;  2BNX A;  1QIW A;  3OBV A;  4MRY A;  4I5J A;  1K90 D;  3LK1 A;  3NSL A;  3MSE B;  4GPL B;  1YUS A;  4MEW A;  2QEV A;  3TUY C;  4USL A;  1ZFS A;  2E6W A;  1KFX L;  2BKH B;  2GGZ A;  1OQP A;  2PQL A;  3R1O A;  3TS5 C;  3ZNI A;  2ISD A;  2ERB A;  4N1G A;  1OW4 A;  3OHM B;  4I5L B;  2AMI A;  2LMV A;  2KLE A;  3B87 A;  1OZS A;  1SBJ A;  2G2B A;  2MHH A;  1UHK A;  1TOP A;  1KSO A;  3SS5 A;  5TNC A;  2YGU A;  3PAL A;  4GNK B;  2COL B;  1KCY A;  2FCD A;  5K89 A;  1FW4 A;  3GK1 A;  1NYA A;  3CZ2 A;  4M2Q A;  4YGA A;  3EKH A;  1AK8 A;  2LHL A;  2CT9 A;  3B88 A;  3KO0 A;  1SL9 A;  2HF5 A;  3DF0 B;  1J7R A;  2L5X B;  2EC6 B;  3O4Y A;  4GGN A;  3NHT A;  4L9M A;  1FI5 A;  3TDZ A;  3BFH A;  5F6T A;  1DJZ A;  4ICB A;  3RM1 A;  1SW8 A;  2ZN8 A;  3L47 A;  2K2F A;  2OS8 B;  3BUM B;  4YGD B;  1QV1 A;  2LAN A;  3PN7 B;  1WRK A;  3FE6 A;  3I5F C;  4DIR A;  1YX7 A;  3N7H A;  3D75 A;  1CLB A;  1XFV O;  1YRT B;  1DEL A;  1UHJ A;  2NLN A;  3DZT A;  3NSK A;  3UNW A;  2WCJ A;  2WOS A;  4IJ7 A;  3L4L A;  5KU1 A;  3BUO B;  3KPX A;  1F70 A;  1ODB A;  2L98 A;  4GUK A;  4YGC B;  1C3Z A;  3OB1 B;  1OOG A;  3PFV A;  1R2U A;  4FQO A;  2R2I A;  5FI7 A;  1NX0 A;  3FWC A;  1KK8 C;  3IQO A;  3DVJ A;  1A4P A;  2Q91 A;  1TWO A;  1AHR A;  3BFB A;  3WHT B;  5CPV A;  1DF0 B;  2WCL A;  2KBI A;  1W7J B;  4I5N B;  3AKA A;  3B6X A;  1KK7 Z;  3D78 A;  3GOF A;  4GGF A;  5HKZ A;  2WND A;  1ZAC A;  3Q8I A;  1TNW A;  1XFW O;  3E3R A;  3TUY B;  4P2Y B;  3OX5 A;  1LS8 A;  3BYA A;  4MZJ A;  5BPJ A;  1VRK A;  1CNP A;  2GTE A;  2LAP A;  3FIA A;  1DMO A;  1K2H A;  5AER A;  3PJI A;  1DC1 A;  1PAL A;  1SCV A;  1CFD A;  4PE7 A;  2KOT A;  3CLN A;  4DCK A;  3S0D A;  2JQ6 A;  3BFA A;  3OX6 A;  1YUR A;  1TCO B;  1OOJ A;  2I7A A;  5FI2 A;  2KAX A;  3D10 A;  3PM2 A;  2LC5 A;  1QAS A;  1PK0 D;  4A4B A;  1IQ5 A;  5CSN A;  4PCW A;  2JC2 A;  1CLM A;  5DKQ A;  1F54 A;  2M0R A;  3BOW A;  1A03 A;  2MRD A;  2KQY A;  3KHE A;  4YBH B;  3SS3 A;  2WC6 A;  2E30 A;  4QJ4 B;  2L5Y A;  1IKU A;  1V1G A;  5CSJ A;  3DY9 A;  1S5G Z;  2ZRS A;  4HRH A;  4DS7 A;  2PMY A;  1SK6 D;  5AFP A;  1JF0 A;  1LXF C;  1K93 D;  5AAN A;  3CZT X;  1GM0 A;  2ZN9 A;  1IJ5 A;  1NPQ A;  1XVJ A;  2ZFD A;  2CBL A;  3DVE A;  3PAT A;  4Q04 A;  4BY4 A;  4BY5 A;  4INW A;  1DJH A;  3FE8 A;  1BG1 A;  1B1G A;  2BE4 A;  1OOH A;  2WC8 A;  1SKT A;  5DKN A;  3V2L A;  1BMO A;  1LVC D;  1MHO A;  1UHI A;  3I5F B;  3CR5 X;  4JD9 A;  3JVT C;  2K61 A;  4ORB B;  4ORC B;  1SRA A;  2K7D A;  1IRJ A;  1RJV A;  1Y0V H;  1S5G Y;  1C7V A;  3WXA A;  1SNL A;  1BJF A;  1Q80 A;  1QS7 A;  1NSH A;  5I2Q A;  3BUX B;  2BCA A;  3FWB A;  1KQM B;  2MBX A;  4OCI A;  1B47 A;  1G4Y R;  2MA2 A;  1NUB A;  2PRU A;  2Y1M A;  5CSI A;  1KK8 B;  2KQ6 A;  2KFF A;  4NDB A;  2JPT A;  3M0W A;  2MAZ A;  1B9A A;  1H8B A;  1WLZ A;  3VRR A;  2KNE A;  4WQ2 A;  1UUS A;  4PE0 A;  1CM4 A;  4YGE B;  2H61 C;  3B86 A;  2F2P A;  4N5X A;  1YVL A;  4QJ3 B;  4PDZ A;  1CMG A;  1B4C A;  1S1E A;  2JZI A;  3VRP A;  4E68 A;  3OB2 B;  1NP8 A;  2LNK A;  2QEB A;  1KFU L;  2F33 A;  1ZUZ A;  2FOT A;  1LIN A;  1BT6 A;  1OOF A;  2NXQ A;  1G8I A;  1PVA A;  5I2L A;  3WHU B;  1KFX S;  4XJK B;  1K95 A;  3K1E A;  3JTD C;  4I5K A;  3FE9 A;  2HET A;  1MF8 B;  2CCM A;  3KEV A;  4C0L A;  2CXJ A;  3GK2 A;  1MUX A;  1XFX O;  3HCM A;  4P5O E;  3ZWH A;  1SL8 A;  3PM8 A;  1EG4 A;  1RRO A;  1T14 A;  1A29 A;  3A8R A;  4TNC A;  3CAB A;  5B8I B;  1TNP A;  5IBW A;  1SYM A;  3NHI A;  3O6B A;  2QAC A;  2LMT A;  2NZ0 A;  1TNX A;  3O2P A;  4JPZ B;  4NDC A;  1SCM C;  1DT7 B;  2CNP A;  1NCZ A;  4MRX A;  4PHN A;  2LLS A;  1K8U A;  1WDC C;  2JNX A;  2QDI A;  1UP5 A;  1C7W A;  3B7A A;  3RZS A;  1EH2 A;  2P71 A;  1BLQ A;  3VRN A;  3S0E A;  4D1E A;  1GGZ A;  2BBM A;  1S36 A;  1ZOT B;  2Y5I A;  3JVT B;  1MQ1 A;  1XK4 C;  1Y6W A;  1KWO C;  3LLE A;  3EK8 A;  1JF2 A;  1RWY A;  3O4X A;  4PE4 A;  4WQ3 A;  1CLL A;  3UO9 A;  2K7C A;  1DGU A;  5I2O A;  1C07 A;  2WCE A;  4MZK A;  1B8C A;  1RK9 A;  1TCF A;  1K9P A;  1KQM C;  1TUJ A;  3NXA A;  1CFP A;  1JSA A;  1A75 B;  3SG6 A;  1CTR A;  1J55 A;  2SCP A;  3BXK A;  3KF9 A;  1C3Y A;  1CDP A;  2PAS A;  1WLM A;  1IGV A;  1M39 A;  1EXR A;  1U5I A;  2WCB A;  3BUW B;  4NQG A;  2JNF A;  1XA5 A;  1MWN A;  1HQV A;  1N65 A;  2DOQ A;  2JUL A;  5KTY A;  1N2D A;  1SR6 C;  3K21 A;  1Z4H A;  3DXL A;  3GK4 X;  3D77 A;  4OVN F;  2PVB A;  2FCE A;  5D3O A;  4CFR A;  1NX2 A;  1H4B A;  3SJS A;  1F4O A;  1FPW A;  1K96 A;  3EK7 A;  3SIA A;  1BU3 A;  5FYX A;  1IIO A;  5AXI A;  4XYN A;  2F3Z A;  4JQ0 D;  5D7F A;  1TN4 A;  4GFT A;  3CZ1 A;  5KSZ A;  2KGB C;  2MLF C;  2WOR A;  3JTD B;  2HQW A;  3EKJ A;  2JT0 A;  3CR4 X;  3EVR A;  4ETO A;  1FBV A;  2KI6 C;  4GBA A;  2ZRT A;  5FI6 A;  1CB1 A;  1BR4 B;  2F2O A;  5AEQ A;  3QME A;  1SPY A;  1XFR A;  2LLU A;  3I5I C;  4INX A;  3VRQ A;  2KSP A;  1S26 D;  2WCK A;  2L0P A;  3D76 A;  3SG4 A;  4HRE E;  1REC A;  2JPO A;  1P28 A;  1J7Q A;  2SAS A;  2EGD A;  4N1F A;  3R1V A;  1XFZ O;  2QEH A;  1DVI A;  5DIC A;  1D1O A;  1KQV A;  3OGN A;  3ICB A;  1AJ4 A;  2M97 A;  1SCM B;  1DQE A;  2BCB A;  2WCH A;  2P70 A;  3VGO A;  1CKK A;  1QLK A;  2JRF A;  2WC5 A;  3D74 A;  1WDC B;  3TDU A;  3VRO A;  1JFJ A;  3IQQ A;  1DGV A;  4ZCU A;  1QTX A;  3NSI A;  1TIZ A;  2Y1N A;  1AVS A;  1FF1 A;  2ZND A;  3S0G A;  5HKY A;  1V1F A;  2KHN A;  1QVI Y;  3CDN A;  1KWO B;  3F45 A;  1B7T Y;  3DF0 A;  1XO5 A;  3HX4 A;  1SL7 A;  1DJX A;  1TNQ A;  4YI8 A;  2BEC A;  3I5G B;  2V53 A;  1FI6 A;  2HPS A;  2LE9 B;  1MXE A;  1F4Q A;  2HQ8 A;  1DEK A;  1K9K A;  1BOD A;  1L2O C;  5CSF A;  1MXL C;  1PRW A;  1OZO A;  2FJU B;  1CDN A;  1Y1U A;  2JTZ A;  1Z2C B;  1IJ6 A;  2P6B B;  3NGV A;  3NSO A;  1SSE B;  1YUU A;  3DVK A;  4ZCV A;  5PAL A;  4MBE A;  4F0Z B;  1F8H A;  1PVB A;  1DJI A;  1B8R A;  4KYN A;  1IG5 A;  4PT1 A;  1UHH A;  3EVV A;  3CGA A;  1M46 A;  1XFY O;  4JWQ A;  1SR6 B;  1M31 A;  4MLW A;  1OSA A;  2JXL A;  3SG3 A;  4A4C A;  2B1U A;  2EHB A;  2LVI A; 
#chains in the Genus database with same CATH homology
 5HYD A;  4DRW A;  2I2R E;  2KFG A;  2LVJ A;  2LUX A;  1CM1 A;  4CFQ A;  2K8M B;  2LLT A;  1DF0 A;  1DJY A;  2H61 A;  1NIW A;  4FTG A;  2KBM A;  2LHI A;  4CPV A;  1YTZ C;  1BOC A;  4NDD A;  2BKI B;  4R1E A;  5DKR A;  1IH0 A;  1NX3 A;  1N0Y A;  3I5I B;  2KI4 C;  1KFU S;  3DVM A;  4MSP A;  1XFU O;  4PHM A;  2M49 B;  2ZNE A;  1J7P A;  3AAJ A;  1QIV A;  1PSB A;  1DJG A;  2L50 A;  4GAO A;  2AAO A;  2NCP A;  2OTG C;  2GGM A;  2PAL A;  3CR2 A;  1WRL A;  1NCX A;  1EG3 A;  1DJW A;  2JU0 A;  3AAK A;  2BBN A;  3BOW B;  3LL8 B;  2LM5 A;  2A4J A;  2D8N A;  2QPT A;  1JWD A;  2M1K B;  5HLO A;  4U8D A;  3DD4 A;  2LV7 A;  2M29 A;  1ZMZ A;  3H4S E;  2M1U A;  1AP4 A;  1CDL A;  3EVU A;  3WNX B;  1QX5 B;  1TRF A;  2M7N A;  4PHK A;  1OMR A;  4HSZ A;  5ER4 X;  2K0J A;  2KAV A;  2TN4 A;  1J1D A;  1QJT A;  1HT9 A;  2CTN A;  3LK0 A;  1Y1A A;  2IS9 A;  3D0Y B;  2M7L A;  2AUC A;  4MVF A;  1R6P A;  2I18 A;  2KI6 D;  1NCY A;  3I5G C;  5HKW A;  1L2O B;  1F71 A;  1YX8 A;  1S3P A;  2RGI A;  1XYD A;  1XK4 A;  2KFH A;  2L51 A;  2K2A A;  1UUR A;  4OKH A;  2JT3 A;  1QV0 A;  3PSR A;  3BQ3 A;  1AUI B;  3I5H C;  3SIB A;  1CMF A;  1RTP 1;  2WCF A;  2JT8 A;  4ORA B;  2M9G A;  3C1V A;  1SY9 A;  2JOJ A;  2F8P A;  4AOM A;  1YUT A;  2NCO A;  2KGR A;  1TTX A;  1SMG A;  1OMD A;  3IF7 A;  1PSR A;  5D69 A;  1QX7 A;  2BCX A;  2JWW A;  2PSR A;  4PAL A;  5I8N A;  1JUO A;  1GGW A;  2KDH A;  1AJ5 A;  1EL4 A;  1LKJ A;  4GGF C;  4YRU A;  1RFJ A;  3A4U B;  3SG2 A;  1CFC A;  2BL0 C;  4YI9 A;  4M2P A;  5JOL A;  5JJG A;  1B8L A;  1JFK A;  1MR8 A;  1NX1 A;  2LCP A;  2KI4 B;  3FS7 A;  1JBA A;  3CWG A;  4IL1 A;  3CS1 A;  2L4I A;  1QVI Z;  1WY9 A;  1KSM A;  1M45 A;  2G9B A;  1B7T Z;  2OTG B;  3SG7 A;  2LP2 A;  4CID A;  1L7Z A;  1QAT A;  1W7I B;  1F55 A;  3AKB A;  2I94 A;  2BE6 A;  3TDI A;  3TS5 B;  3PLF B;  2L4H A;  1BR1 B;  4XJK A;  2LP3 A;  3CTN A;  1S6J A;  2O5G A;  4C0K A;  4CLN A;  1NWD A;  1ALV A;  2GV5 A;  1K94 A;  2KYF A;  1LA0 A;  1YRU B;  2LMU A;  4UPG A;  2M8U A;  3LCP C;  1S6I A;  1YVH A;  2F3Y A;  2K7B A;  1EJ3 A;  1S6C A;  3EK4 A;  1BF5 A;  5J3X A;  4M2O A;  1QLS A;  1KK7 Y;  2LVV A;  2MLE C;  3RLZ A;  4QJ5 B;  1ALW A;  2L2E A;  3O78 A;  1Y1X A;  2LVK A;  1WRZ A;  1X02 A;  1QX2 A;  1GJY A;  3QRX A;  2H2K A;  1LA3 A;  4PE1 A;  1IWQ A;  1GQM A;  1M63 B;  4HRG A;  5GQQ C;  1JC2 A;  4MZL A;  2OPO A;  2K7O A;  3I5H B;  1J1E A;  1E8A A;  2EC6 C;  3BUN B;  2MJW B;  4DUQ A;  3D0Y A;  4OR9 B;  2VRG A;  1DTL A;  1PUL A;  1UHN A;  1CFF A;  4PHJ A;  4WRI A;  4MN0 A;  4AQI A;  2OS8 C;  2LUC A;  4C0J A;  1IQ3 A;  2Y4Q A;  1J7O A;  1CDM A;  1A2X A;  1A75 A;  3PN7 C;  3SG5 A;  1OMV A;  2KAY A;  4YGB B;  1U5I B;  3OP0 A;  5G08 A;  2JXC A;  2M3W A;  4AQJ A;  1QXP A;  2BL0 B;  5HLV A;  3TZ1 A;  1YR5 A;  5ER5 A;  1K9U A;  2ZKM X;  4OV2 A;  1OE9 B;  1UWO A;  1G33 A;  2JTT A;  2KYC A;  2Q4U A;  2O60 A;  1QIW A;  4MRY A;  4I5J A;  1K90 D;  3LK1 A;  3NSL A;  3MSE B;  4GPL B;  1YUS A;  4MEW A;  3TUY C;  4USL A;  1ZFS A;  2E6W A;  1KFX L;  2BKH B;  2GGZ A;  1OQP A;  3TS5 C;  3ZNI A;  2ISD A;  4N1G A;  4I5L B;  3OHM B;  2AMI A;  2LMV A;  1OZS A;  1SBJ A;  2G2B A;  2MHH A;  1UHK A;  1TOP A;  1KSO A;  5TNC A;  3PAL A;  4GNK B;  2COL B;  1KCY A;  2FCD A;  5K89 A;  1FW4 A;  3GK1 A;  1NYA A;  4M2Q A;  4YGA A;  3EKH A;  1AK8 A;  2LHL A;  2CT9 A;  3KO0 A;  1SL9 A;  2HF5 A;  3DF0 B;  1J7R A;  2L5X B;  2EC6 B;  3O4Y A;  4GGN A;  4L9M A;  1FI5 A;  3TDZ A;  5F6T A;  1DJZ A;  4ICB A;  3RM1 A;  1SW8 A;  2ZN8 A;  2K2F A;  2OS8 B;  3BUM B;  4YGD B;  1QV1 A;  2LAN A;  3PN7 B;  1WRK A;  3I5F C;  4DIR A;  1YX7 A;  1CLB A;  1XFV O;  1YRT B;  1UHJ A;  2NLN A;  3NSK A;  2WOS A;  5KU1 A;  3BUO B;  3KPX A;  1F70 A;  1ODB A;  2L98 A;  4GUK A;  4YGC B;  3OB1 B;  3PFV A;  1R2U A;  4FQO A;  2R2I A;  1NX0 A;  3FWC A;  1KK8 C;  3IQO A;  3DVJ A;  1A4P A;  2Q91 A;  1AHR A;  3WHT B;  5CPV A;  1DF0 B;  2KBI A;  1W7J B;  4I5N B;  3AKA A;  3GOF A;  1KK7 Z;  4GGF A;  5HKZ A;  2WND A;  1ZAC A;  1TNW A;  1XFW O;  3E3R A;  3TUY B;  4P2Y B;  3OX5 A;  3BYA A;  4MZJ A;  5BPJ A;  1CNP A;  1VRK A;  3FIA A;  2LAP A;  1K2H A;  1DMO A;  5AER A;  1PAL A;  1SCV A;  1CFD A;  4PE7 A;  2KOT A;  3CLN A;  4DCK A;  2JQ6 A;  3OX6 A;  1YUR A;  1TCO B;  1OOJ A;  2I7A A;  2KAX A;  3D10 A;  2LC5 A;  1QAS A;  1PK0 D;  4A4B A;  1IQ5 A;  5CSN A;  4PCW A;  2JC2 A;  1CLM A;  5DKQ A;  1F54 A;  2M0R A;  3BOW A;  1A03 A;  2MRD A;  2KQY A;  3KHE A;  4YBH B;  2E30 A;  4QJ4 B;  1IKU A;  1V1G A;  5CSJ A;  1S5G Z;  2ZRS A;  4HRH A;  4DS7 A;  2PMY A;  1SK6 D;  5AFP A;  1JF0 A;  1LXF C;  1K93 D;  5AAN A;  3CZT X;  2ZN9 A;  1IJ5 A;  1NPQ A;  1XVJ A;  2ZFD A;  2CBL A;  3DVE A;  3PAT A;  4Q04 A;  4BY4 A;  4BY5 A;  1BG1 A;  1DJH A;  1B1G A;  2BE4 A;  2WC8 A;  5DKN A;  1SKT A;  1BMO A;  1LVC D;  1MHO A;  1UHI A;  3I5F B;  3CR5 X;  3JVT C;  2K61 A;  4ORB B;  4ORC B;  1SRA A;  2K7D A;  1IRJ A;  1RJV A;  1Y0V H;  1S5G Y;  1C7V A;  3WXA A;  1SNL A;  1BJF A;  1Q80 A;  1QS7 A;  1NSH A;  5I2Q A;  3BUX B;  2BCA A;  3FWB A;  1KQM B;  2MBX A;  4OCI A;  1B47 A;  1G4Y R;  2MA2 A;  1NUB A;  2PRU A;  2Y1M A;  5CSI A;  1KK8 B;  2KQ6 A;  2KFF A;  4NDB A;  2JPT A;  3M0W A;  2MAZ A;  1B9A A;  1H8B A;  1WLZ A;  3VRR A;  2KNE A;  4WQ2 A;  1UUS A;  4PE0 A;  1CM4 A;  4YGE B;  2H61 C;  2F2P A;  4N5X A;  1YVL A;  4QJ3 B;  4PDZ A;  1CMG A;  1B4C A;  1S1E A;  2JZI A;  3VRP A;  4E68 A;  3OB2 B;  1NP8 A;  2LNK A;  1KFU L;  2F33 A;  1ZUZ A;  2FOT A;  1LIN A;  1BT6 A;  2NXQ A;  1G8I A;  1PVA A;  5I2L A;  3WHU B;  1KFX S;  4XJK B;  1K95 A;  3JTD C;  4I5K A;  2HET A;  1MF8 B;  2CCM A;  3KEV A;  4C0L A;  2CXJ A;  3GK2 A;  1MUX A;  1XFX O;  3HCM A;  4P5O E;  3ZWH A;  1SL8 A;  3PM8 A;  1EG4 A;  1RRO A;  3A8R A;  1A29 A;  4TNC A;  5B8I B;  5IBW A;  1TNP A;  1SYM A;  3O6B A;  2QAC A;  2LMT A;  2NZ0 A;  1TNX A;  3O2P A;  4JPZ B;  4NDC A;  1SCM C;  1DT7 B;  2CNP A;  1NCZ A;  4MRX A;  4PHN A;  2LLS A;  1K8U A;  1WDC C;  2JNX A;  1UP5 A;  1C7W A;  1EH2 A;  1BLQ A;  3VRN A;  4D1E A;  1GGZ A;  2BBM A;  1S36 A;  1ZOT B;  2Y5I A;  3JVT B;  1MQ1 A;  1XK4 C;  1Y6W A;  1KWO C;  3LLE A;  3EK8 A;  1JF2 A;  1RWY A;  4PE4 A;  4WQ3 A;  1CLL A;  2K7C A;  1DGU A;  5I2O A;  1C07 A;  2WCE A;  4MZK A;  1B8C A;  1RK9 A;  1TCF A;  1K9P A;  1KQM C;  3NXA A;  1CFP A;  1JSA A;  1A75 B;  3SG6 A;  1CTR A;  1J55 A;  2SCP A;  3BXK A;  3KF9 A;  1CDP A;  2PAS A;  1WLM A;  1IGV A;  1M39 A;  1EXR A;  1U5I A;  2WCB A;  3BUW B;  4NQG A;  2JNF A;  1XA5 A;  1MWN A;  1HQV A;  1N65 A;  2DOQ A;  2JUL A;  5KTY A;  1N2D A;  1SR6 C;  3K21 A;  3GK4 X;  4OVN F;  2PVB A;  2FCE A;  4CFR A;  1H4B A;  1NX2 A;  3SJS A;  1F4O A;  1FPW A;  1K96 A;  3EK7 A;  3SIA A;  1BU3 A;  5FYX A;  5AXI A;  4XYN A;  2F3Z A;  4JQ0 D;  5D7F A;  1TN4 A;  4GFT A;  5KSZ A;  2KGB C;  2MLF C;  2WOR A;  3JTD B;  2HQW A;  3EKJ A;  2JT0 A;  3CR4 X;  3EVR A;  4ETO A;  1FBV A;  2KI6 C;  4GBA A;  2ZRT A;  1CB1 A;  1BR4 B;  2F2O A;  5AEQ A;  3VRQ A;  1SPY A;  3I5I C;  2LLU A;  2KSP A;  1S26 D;  2L0P A;  3SG4 A;  4HRE E;  1REC A;  1J7Q A;  2SAS A;  2EGD A;  4N1F A;  1XFZ O;  1DVI A;  1KQV A;  1D1O A;  3ICB A;  1AJ4 A;  2M97 A;  1SCM B;  2BCB A;  3VGO A;  1CKK A;  1QLK A;  2JRF A;  3VRO A;  1WDC B;  3TDU A;  1JFJ A;  3IQQ A;  1DGV A;  4ZCU A;  1QTX A;  3NSI A;  1TIZ A;  2Y1N A;  1AVS A;  1FF1 A;  2ZND A;  5HKY A;  1V1F A;  2KHN A;  1QVI Y;  1KWO B;  3F45 A;  1B7T Y;  3DF0 A;  1XO5 A;  3HX4 A;  1SL7 A;  1DJX A;  1TNQ A;  4YI8 A;  2BEC A;  3I5G B;  2V53 A;  1FI6 A;  2HPS A;  2LE9 B;  1MXE A;  1F4Q A;  2HQ8 A;  1K9K A;  1BOD A;  1L2O C;  5CSF A;  1MXL C;  1PRW A;  1OZO A;  2FJU B;  1CDN A;  1Y1U A;  2JTZ A;  2P6B B;  1IJ6 A;  3NSO A;  1YUU A;  3DVK A;  4ZCV A;  5PAL A;  4MBE A;  4F0Z B;  1F8H A;  1PVB A;  1DJI A;  1B8R A;  1IG5 A;  1UHH A;  3EVV A;  3CGA A;  1M46 A;  1XFY O;  4JWQ A;  1SR6 B;  1M31 A;  4MLW A;  1OSA A;  2JXL A;  3SG3 A;  4A4C A;  2B1U A;  2EHB A;  2LVI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...