4OV2A

Crystal structure of c-terminally truncated neuronal calcium sensor (ncs-1) from rattus norvegicus
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
159
structure length
151
Chain Sequence
LTRKTYFTEKEVQQWYKGFIKDCPSGQLDAAGFQKIYKQFFPFGDPTKFATFVFNVFDENKDGRIEFSEFIQALSVTSRGTLDEKLRWAFKLYDLDNDGYITRNEMLDIVDAIYQMVGNTTPEKRVDRIFAMMDKNADGKLTLQEFQEGSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neuronal calcium sensor 1
publication title Crystal structure of C-terminally truncated Neuronal Calcium Sensor (NCS-1) from Rattus norvegicus
rcsb
source organism Rattus norvegicus
molecule tags Calcium binding protein
total genus 56
structure length 151
sequence length 159
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ov2A01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ov2A02
1B47A 4MVFA 3WXAA 2SASA 4DRWA 1S5GY 1UHNA 2PSRA 3IQQA 3TS5B 1NX0A 2ZFDA 1RJVA 5I8NA 1M31A 4QJ5B 2OTGC 1UWOA 1SMGA 1QLKA 5CSNA 5HLOA 2OS8C 1NCYA 2O5GA 1IRJA 4YI8A 3SG4A 2F2OA 1N65A 1OE9B 4MSPA 1B4CA 2JRFA 3OP0A 4MRXA 1J7OA 1PALA 2LMTA 2P6BB 4PE7A 1A2XA 1KQVA 2L2EA 3PFVA 2MHHA 1AHRA 1NCXA 2MJWB 3BXKA 5BPJA 3PN7B 1PK0D 4DUQA 2KI6D 4FTGA 1H4BA 2B1UA 1SL8A 4AQJA 2WNDA 1J55A 4AQIA 2LLUA 5KTYA 3FWBA 1C7WA 3BUOB 2JOJA 4HSZA 5AFPA 1XK4A 1ZUZA 2EC6B 3ICBA 3NSIA 2CCMA 4GGFC 4C0LA 3O4YA 4JPZB 1RTP1 3EVRA 4NDBA 2PMYA 2F33A 1TRFA 1J7RA 5I2OA 1XFYO 1AVSA 1C7VA 3CR2A 1QX5B 2CBLA 2FCDA 2HF5A 1IH0A 3CWGA 1K8UA 1NX1A 3LK1A 1CM4A 3IQOA 2MA2A 3HCMA 1LINA 5I2LA 3I5GC 1K96A 1SNLA 5D69A 2L5XB 1OMRA 2KI6C 4NQGA 1XFVO 3TS5C 3BQ3A 2K7BA 1S6JA 3PM8A 4USLA 2PALA 1DJZA 2LAPA 4DS7A 1OZOA 2L0PA 2ZRTA 4L9MA 4YBHB 1M45A 1SW8A 1YR5A 3SG6A 1YUUA 3KF9A 4GGNA 1SY9A 2K0JA 2KAYA 1B8CA 3PSRA 4N1GA 2Y1MA 1BODA 1NWDA 2AMIA 2ZKMX 2BCAA 1UHIA 2LLTA 1CDNA 2F2PA 3NSLA 3PN7C 1DGVA 2DOQA 4MZKA 1EG3A 4CPVA 3OB2B 1Y1XA 1F71A 1IGVA 3C1VA 4GPLB 2HQWA 1L2OB 3KPXA 2EC6C 3SIAA 1SKTA 1BLQA 1DJWA 2I18A 1KSOA 4ZCUA 1HT9A 1NUBA 2M0RA 1Y0VH 2HETA 1V1FA 2LHIA 2FJUB 2LUCA 4F0ZB 2M9GA 1IQ3A 3A4UB 1YUTA 5DKNA 2KDHA 1RWYA 2KYFA 3NSKA 5AXIA 1S6IA 1B8LA 2L4IA 2KQ6A 1DJYA 5DKQA 2M1KB 2JC2A 3CLNA 3FS7A 4YGAA 1L7ZA 1K9PA 3VRNA 4PHKA 1UHHA 1ZACA 2LMVA 2MRDA 2Q4UA 2LVKA 2MLEC 1WY9A 2MAZA 2M97A 3PALA 1F4OA 2LANA 1BOCA 1DJHA 1CLBA 2BECA 4YRUA 2KSPA 2LVIA 1SL7A 2LHLA 1DMOA 2M7NA 4MZLA 5HKWA 5J3XA 1YX8A 4BY5A 1CLLA 4GAOA 3RLZA 4CFRA 4E68A 1S5GZ 1S3PA 3EK8A 5PALA 1FPWA 2LV7A 1DJGA 1ALVA 1W7IB 3D10A 1CLMA 1S26D 1YURA 1KSMA 1G4YR 2GGZA 4HRGA 1S6CA 1LA3A 2LCPA 5DKRA 4UPGA 1CMFA 1CM1A 1XVJA 1KFUS 4PE4A 2G2BA 1YVLA 1DVIA 2V53A 3BYAA 1LKJA 4PALA 1XYDA 1L2OC 2IS9A 1IKUA 4HRHA 3AKBA 4AOMA 2I94A 1X02A 2QACA 2CNPA 5FYXA 1QX7A 2KAXA 3F45A 5JOLA 4TNCA 2A4JA 2JT0A 1F8HA 2KFHA 1FBVA 2ISDA 1KFXS 2LP2A 1SK6D 2H61A 4OR9B 4D1EA 4PCWA 4CIDA 1RECA 5ER4X 5G08A 5HYDA 4NDDA 3EVUA 3K21A 1BF5A 2NLNA 3D0YA 3DF0A 5KSZA 1G8IA 3EVVA 1DGUA 1QLSA 1TNPA 3DVKA 5HKYA 1QIVA 3I5HB 2ZNEA 4ORAB 2Y1NA 2L4HA 1BR4B 5TNCA 3IF7A 1PSRA 1Y1AA 1QX2A 3ZNIA 1DJIA 1BR1B 4A4BA 3GK2A 2K2AA 1GGZA 1CMGA 1EJ3A 2I7AA 4I5LB 1KWOB 3LLEA 3DF0B 1KK8B 1QATA 1TCOB 1XFZO 3WHUB 3KEVA 1EXRA 1NX3A 2I2RE 2WOSA 4WQ3A 1YUSA 1F55A 1WRKA 2QPTA 2KI4B 5CSJA 1DJXA 3PLFB 4YGBB 1TTXA 4M2OA 2E30A 1EH2A 1K9UA 3JTDB 1GJYA 2JULA 4FQOA 1C07A 1OOJA 1H8BA 1NP8A 3DVJA 1CFPA 1K94A 1YRTB 1B7TZ 2K7OA 4CLNA 4ETOA 4C0KA 1VRKA 2WORA 5AANA 2JXLA 3TUYB 1AUIB 2BKIB 1IWQA 2G9BA 3GOFA 1YX7A 3OHMB 5HLVA 1AP4A 1WDCB 3CR4X 5ER5A 2JQ6A 1B7TY 2KBMA 1WRZA 3O78A 3QRXA 4MEWA 1RK9A 4OVNF 3MSEB 4IL1A 2LM5A 3TDZA 3I5FB 3FWCA 4YGDB 4GFTA 1FI6A 2ZNDA 5F6TA 2BL0B 5B8IB 1A75A 2LNKA 2K8MB 2PRUA 3CGAA 3SG2A 1N2DA 1OMDA 2CT9A 3I5HC 1FF1A 1CFFA 1DF0A 4CFQA 2H2KA 2F3YA 2BBNA 3DVMA 5AEQA 1WLMA 1OMVA 3KHEA 1J7PA 1FI5A 4MN0A 1D1OA 1LVCD 1OZSA 1JFKA 4JQ0D 2JT8A 4ORBB 2JWWA 1JC2A 1A75B 1KWOC 2FCEA 1KK8C 1QTXA 1KFUL 1PRWA 3SJSA 1XK4C 3LK0A 1SCMB 1JWDA 2Y5IA 3EK4A 3OX6A 3VGOA 1YTZC 2KI4C 1J1DA 1XFXO 1DF0B 1JF0A 3I5IB 1MWNA 4WQ2A 5IBWA 2JNXA 1ODBA 1PULA 2LMUA 3NXAA 1F54A 3OB1B 4XJKA 4MBEA 3LCPC 3SG3A 3JTDC 1TIZA 3BUXB 4QJ4B 1BMOA 1NX2A 1U5IA 2JTZA 4GBAA 4OCIA 1SBJA 3M0WA 1KK7Y 2K2FA 2LC5A 2MBXA 2KOTA 1N0YA 1KFXL 1J1EA 4WRIA 3SG5A 3CR5X 3O6BA 5CSIA 3EKJA 2KHNA 2MLFC 3TUYC 2EHBA 2JPTA 2KBIA 2M1UA 2ZN9A 4N5XA 5AERA 2ZN8A 1F70A 2RGIA 1WDCC 1IJ6A 4M2PA 2E6WA 2NCPA 1XO5A 1ZMZA 1B9AA 2JTTA 1KQMB 4HREE 4PE1A 4XJKB 2LUXA 3AKAA 3I5FC 2CTNA 4QJ3B 2BL0C 1PSBA 2BE4A 1M39A 4PHJA 1SRAA 1FW4A 1YRUB 2M29A 3ZWHA 1NYAA 2HPSA 2JNFA 2KFGA 1CFDA 2LE9B 2NXQA 3H4SE 2PVBA 2LP3A 2SCPA 3CS1A 1DTLA 1MXLC 2L50A 5HKZA 4MZJA 1K2HA 3GK1A 5CPVA 1SR6B 5CSFA 2Y4QA 1TN4A 3PATA 2FOTA 4OKHA 2WCEA 2AUCA 1Q80A 2BE6A 3HX4A 1SCMC 3O2PA 4GNKB 3TZ1A 3AAKA 1WRLA 3EKHA 1SPYA 1CDPA 2BCXA 3BUMB 1E8AA 3BUWB 2TN4A 3I5IC 2BBMA 1NIWA 1K93D 3VRPA 1Y6WA 2KAVA 1NCZA 1WLZA 1TOPA 2VRGA 4MRYA 3GK4X 1B8RA 2M7LA 1IJ5A 1SCVA 3JVTB 2NCOA 3WHTB 1OSAA 3VRRA 1B1GA 1PVAA 1IQ5A 1UP5A 1TCFA 1QJTA 3AAJA 1KCYA 4PHMA 2EGDA 4YGCB 4JWQA 1MQ1A 3D0YB 2KGBC 1BT6A 1QV1A 5K89A 1TNWA 1ZFSA 3DD4A 1GGWA 3FIAA 4A4CA 2F8PA 4MLWA 1J7QA 2COLB 1KQMC 4U8DA 1JFJA 2JU0A 4P5OE 2HQ8A 1CKKA 1K95A 1JF2A 1UHKA 2M3WA 1ZOTB 1EG4A 1Y1UA 2AAOA 1AJ4A 2WCBA 3VROA 1CDLA 2O60A 1A29A 2KQYA 2JXCA 2ZRSA 1MHOA 1NSHA 3OX5A 1UHJA 1CB1A 2CXJA 1MF8B 2KGRA 4DIRA 1R6PA 5I2QA 1SR6C 2Q91A 1IG5A 1BG1A 5KU1A 1UUSA 1M46A 1S36A 1BJFA 3NSOA 2JZIA 3KO0A 1G33A 1F4QA 4PE0A 2PASA 4I5JA 5D7FA 1RROA 1BU3A 1CDMA 3VRQA 3TDUA 1OQPA 1K90D 1DT7B 1XFWO 2L51A 2NZ0A 2LVVA 1NPQA 2LLSA 1MR8A 4PHNA 2KYCA 1QV0A 5JJGA 2GV5A 1S1EA 3JVTC 1GQMA 1JUOA 2H61C 2OTGB 4XYNA 5GQQC 1A4PA 1K9KA 2OS8B 3A8RA 4ZCVA 1MUXA 4N1FA 2GGMA 1M63B 2WC8A 1A03A 4GGFA 1V1GA 3SG7A 2D8NA 1TNXA 3EK7A 4M2QA 1KK7Z 3DVEA 1JSAA 4NDCA 4OV2A 1HQVA 4C0JA 1R2UA 2M8UA 2BKHB 1YVHA 1RFJA 3RM1A 4R1EA 1CTRA 4BY4A 1W7JB 4YI9A 1CFCA 1XA5A 1LA0A 2K7DA 4YGEB 3SIBA 1JBAA 3BOWA 1MXEA 2KNEA 3E3RA 3CTNA 3LL8B 2KFFA 2LVJA 1QS7A 2WCFA 3BUNB 1LXFC 4I5KA 1UURA 4ICBA 1QASA 1QVIZ 1AJ5A 1QIWA 2K7CA 2M49B 3CZTX 1U5IB 4Q04A 1SYMA 1SL9A 2L98A 4ORCB 2JT3A 1QXPA 2R2IA 4P2YB 1TNQA 1CNPA 4PDZA 2BCBA 2OPOA 4DCKA 1XFUO 1EL4A 1QVIY 3I5GB 3TDIA 4I5NB 1AK8A 1PVBA 3BOWB 2K61A 3WNXB 2F3ZA 4GUKA 1ALWA
chains in the Genus database with same CATH superfamily
1B47A 4MVFA 3WXAA 2SASA 4DRWA 1S5GY 1UHNA 2PSRA 3IQQA 3TS5B 1NX0A 2ZFDA 1RJVA 1DEKA 1M31A 4QJ5B 5I8NA 2OTGC 1UWOA 1TUJA 1SMGA 1QLKA 5CSNA 5HLOA 2OS8C 1NCYA 2O5GA 1IRJA 4YI8A 3SG4A 2ERBA 2F2OA 1N65A 1OE9B 4MSPA 1B4CA 3Q8IA 3D74A 2JRFA 3OP0A 4MRXA 1J7OA 1PALA 2LMTA 1C3YA 2P6BB 3FE9A 4PE7A 1A2XA 1KQVA 2L2EA 3PFVA 2MHHA 1AHRA 1NCXA 5IBWA 1DQEA 4KYNA 2MJWB 3BXKA 5DICA 5BPJA 3B6XA 1PK0D 3PN7B 2KI6D 4FTGA 4DUQA 2QEHA 1H4BA 2B1UA 1SL8A 4AQJA 2WNDA 1J55A 4AQIA 2LLUA 5KTYA 3FWBA 1C7WA 3BUOB 2JOJA 4HSZA 5AFPA 1XK4A 1ZUZA 2EC6B 3ICBA 3NSIA 2CCMA 4GGFC 4C0LA 3O4YA 4JPZB 1RTP1 3EVRA 4NDBA 2PMYA 2F33A 1TRFA 1J7RA 5I2OA 1XFYO 1AVSA 1C7VA 3CR2A 1QX5B 2CBLA 2FCDA 2HF5A 1IH0A 3CWGA 1K8UA 1NX1A 3LK1A 1CM4A 3IQOA 2MA2A 3BJHA 3HCMA 1LINA 5I2LA 3I5GC 1K96A 1SNLA 5D69A 2L5XB 3DY9A 1OMRA 2KI6C 4FQTA 4NQGA 1XFVO 1OOIX 3TS5C 3BQ3A 2K7BA 3BFBA 1S6JA 3PM8A 4USLA 2PALA 1DJZA 2LAPA 1QWVA 5FI6A 3S0DA 4DS7A 1OZOA 2L0PA 2ZRTA 4L9MA 4YBHB 1M45A 1SW8A 1YR5A 3SG6A 1YUUA 3KF9A 2BNXA 4GGNA 1SY9A 2K0JA 2KAYA 1B8CA 3PSRA 4N1GA 2QEBA 2Y1MA 2PQLA 1BODA 1NWDA 2AMIA 2ZKMX 3N7HA 2BCAA 1UHIA 2LLTA 1CDNA 2F2PA 3NSLA 3R1VA 3PN7C 1DGVA 2DOQA 4MZKA 1EG3A 1C3ZA 3S0GA 3OB2B 4CPVA 1Y1XA 1F71A 1IGVA 3C1VA 4GPLB 2HQWA 1L2OB 3KPXA 2EC6C 3SIAA 1SKTA 1BLQA 1DJWA 2I18A 1KSOA 4ZCUA 5I94A 1HT9A 1NUBA 2M0RA 1Y0VH 2HETA 1V1FA 2LHIA 2FJUB 2LUCA 3D76A 4F0ZB 2M9GA 4INXA 1IQ3A 3A4UB 1YUTA 5DKNA 2KDHA 1RWYA 2KYFA 3NSKA 5AXIA 1S6IA 1B8LA 2L4IA 2KQ6A 1DJYA 5DKQA 2M1KB 2JC2A 3CLNA 3FS7A 4YGAA 1L7ZA 1K9PA 3VRNA 4PHKA 1UHHA 1ZACA 2LMVA 3PM2A 2MRDA 2Q4UA 2LVKA 2MLEC 1WY9A 2MAZA 2M97A 3PALA 1F4OA 2LANA 1BOCA 1DJHA 1CLBA 4IJ7A 2BECA 4YRUA 2KSPA 2LVIA 1SL7A 2LHLA 2WCKA 1DMOA 2M7NA 4OZDA 3O4XA 3BFAA 4MZLA 5HKWA 5FI7A 3R1PA 5J3XA 1YX8A 4BY5A 1CLLA 3CABA 4GAOA 3RLZA 4CFRA 4E68A 1S5GZ 1S3PA 2YGUA 3EK8A 5PALA 2LV7A 1FPWA 1DJGA 1ALVA 1W7IB 3D10A 1CLMA 1S26D 1YURA 3DYEA 1KSMA 1G4YR 2GGZA 4HRGA 1S6CA 1LA3A 2LCPA 5DKRA 4UPGA 1CMFA 1CM1A 2L2CA 3RZSA 1XVJA 1KFUS 4PE4A 2G2BA 1YVLA 1OW4A 1DVIA 2WCJA 2V53A 3BYAA 1LKJA 1TWOA 4PALA 3VB1A 1XYDA 1L2OC 2IS9A 3L4LA 1IKUA 1IIOA 1ORGA 4HRHA 3AKBA 4AOMA 2I94A 1X02A 2QACA 2CNPA 5FYXA 2WC6A 1QX7A 2KAXA 3OBVA 3F45A 5JOLA 4TNCA 2A4JA 2JT0A 1F8HA 2KFHA 1FBVA 2ISDA 1KFXS 2LP2A 1SK6D 2H61A 4OR9B 4D1EA 4PCWA 4CIDA 1RECA 3L47A 5ER4X 5G08A 5HYDA 4NDDA 3EVUA 3K21A 1BF5A 2NLNA 3D0YA 3DF0A 5KSZA 1G8IA 3NHTA 3EVVA 3V2LA 1DGUA 1QLSA 1TNPA 3DVKA 5HKYA 1QIVA 3I5HB 2ZNEA 4ORAB 2Y1NA 2L4HA 3SS5A 1BR4B 5TNCA 3IF7A 1PSRA 1Y1AA 1QX2A 3ZNIA 1DJIA 1BR1B 4A4BA 3GK2A 2K2AA 1GGZA 1CMGA 1EJ3A 3B7AA 2I7AA 4I5LB 1DC1A 1KWOB 3LLEA 3DF0B 1KK8B 1QATA 1TCOB 1XFZO 3WHUB 3KEVA 1EXRA 1NX3A 2I2RE 2WOSA 4WQ3A 2WCHA 1YUSA 1F55A 1WRKA 2QPTA 2KI4B 5CSJA 1DJXA 3PLFB 4YGBB 1TTXA 4M2OA 2E30A 1OOGA 1EH2A 3S0AA 1K9UA 3JTDB 1GJYA 3DZTA 2JULA 4FQOA 1C07A 1OOJA 1H8BA 1NP8A 3DVJA 1SSEB 1K94A 1YRTB 1B7TZ 2K7OA 4CLNA 4ETOA 1CFPA 4C0KA 1VRKA 3D73A 2KLDA 2WORA 5AANA 2JXLA 3TUYB 1AUIB 1IWQA 2BKIB 2G9BA 3GOFA 1YX7A 3OHMB 5HLVA 1AP4A 2P71A 1WDCB 3CR4X 5ER5A 2JQ6A 1B7TY 2KBMA 1WRZA 3O78A 3QRXA 4MEWA 1RK9A 4OVNF 4F7FA 3MSEB 4IL1A 2LM5A 3TDZA 3I5FB 3FWCA 4YGDB 4GFTA 1FI6A 2ZNDA 5F6TA 2BL0B 5B8IB 1A75A 2LNKA 2K8MB 2PRUA 3CGAA 2L5YA 3SG2A 1N2DA 1OMDA 2CT9A 3I5HC 1FF1A 3D75A 1CFFA 2H8VA 1DF0A 4CFQA 2H2KA 3S0EA 2F3YA 2BBNA 3DVMA 5AEQA 1WLMA 1OMVA 3KHEA 1J7PA 1FI5A 4MN0A 1D1OA 3CZ1A 3FE6A 1LVCD 1P28A 1OZSA 1JFKA 4JQ0D 2JT8A 4JKTA 4ORBB 2JWWA 1JC2A 3CZ2A 1A75B 1KWOC 3SS4A 2FCEA 1KK8C 1QTXA 1KFUL 1PRWA 3SJSA 1XK4C 3LK0A 1SCMB 1JWDA 2Y5IA 1T14A 3EK4A 3OX6A 3VGOA 1YTZC 2KI4C 1J1DA 1XFXO 1DF0B 1JF0A 3I5IB 1MWNA 4WQ2A 2QEOA 2QEVA 2JNXA 1ODBA 1PULA 2LMUA 2P70A 3NXAA 1F54A 3OB1B 4XJKA 4MBEA 3LCPC 3SG3A 3JTDC 1TIZA 3BUXB 4QJ4B 1BMOA 1NX2A 1U5IA 2JTZA 2QDIA 4GBAA 4OCIA 1SBJA 3M0WA 1KK7Y 2K2FA 2LC5A 2MBXA 2KOTA 1N0YA 1KFXL 1J1EA 4WRIA 3SG5A 3B88A 3CR5X 3O6BA 3EKJA 2KHNA 3QMEA 2MLFC 5CSIA 3TUYC 2EHBA 2JPTA 2KBIA 2M1UA 2ZN9A 4N5XA 5AERA 2ZN8A 1F70A 2RGIA 1WDCC 1IJ6A 4M2PA 2E6WA 2NCPA 1XO5A 1ZMZA 1B9AA 2JTTA 1KQMB 4HREE 4PE1A 4XJKB 2LUXA 3AKAA 3I5FC 3D78A 2CTNA 4QJ3B 2BL0C 1LS8A 1PSBA 2BE4A 1M39A 4PHJA 3R1OA 1SRAA 1FW4A 1YRUB 2JPOA 2M29A 2PYQA 3IVTA 3ZWHA 1NYAA 2K60A 5HL1A 3UNWA 2HPSA 2JNFA 2KFGA 1CFDA 2LE9B 2NXQA 3H4SE 1DELA 2PVBA 2LP3A 2SCPA 3CS1A 1DTLA 1MXLC 2L50A 2WCLA 5HKZA 4MZJA 1K2HA 3GK1A 1TUZA 5CPVA 1SR6B 5CSFA 2Y4QA 1TN4A 3PATA 2FOTA 4OKHA 2WCEA 2AUCA 1Q80A 2BE6A 3HX4A 1SCMC 3O2PA 4GNKB 3TZ1A 3AAKA 1WRLA 3EKHA 1SPYA 1CDPA 2BCXA 1OOFA 3BUMB 1E8AA 3BUWB 2TN4A 3FE8A 2BBMA 3I5IC 1NIWA 1K93D 3VRPA 3NHIA 1Y6WA 2KAVA 1NCZA 1WLZA 1TOPA 2VRGA 4MRYA 3GK4X 1B8RA 2M7LA 1IJ5A 1SCVA 3JVTB 2NCOA 1Z2CB 3WHTB 1OSAA 3VRRA 2WC5A 1B1GA 1PVAA 1IQ5A 1UP5A 1TCFA 1QJTA 3AAJA 3SS3A 1KCYA 4PHMA 2EGDA 4YGCB 4JWQA 1MQ1A 3D0YB 2KGBC 1BT6A 3B87A 1QV1A 5K89A 1TNWA 1ZFSA 3DD4A 2GTEA 3FIAA 4A4CA 3OGNA 1GGWA 2F8PA 4MLWA 1J7QA 2FJYA 2COLB 1KQMC 4U8DA 1JFJA 1GM0A 2JU0A 4P5OE 2HQ8A 3BFHA 1CKKA 1K95A 1JF2A 1UHKA 2M3WA 1ZOTB 1EG4A 1Y1UA 2AAOA 1AJ4A 2WCBA 3VROA 1CDLA 2O60A 1A29A 2KQYA 2JXCA 4JD9A 2ZRSA 1MHOA 1NSHA 3OX5A 3D77A 1UHJA 1CB1A 2CXJA 1MF8B 2KGRA 3CYZA 4DIRA 1R6PA 5I2QA 1SR6C 2Q91A 1IG5A 1BG1A 5KU1A 1UUSA 5FI2A 1M46A 1S36A 1BJFA 3NSOA 2JZIA 3KO0A 1OOHA 1G33A 1F4QA 4PE0A 2PASA 4I5JA 3CDNA 5D7FA 1RROA 1BU3A 1CDMA 3VRQA 3TDUA 1OQPA 1K90D 1DT7B 1XFWO 2L51A 2NZ0A 3PJIA 2LVVA 1NPQA 2LLSA 3B86A 1MR8A 4PHNA 2KYCA 1QV0A 5JJGA 2GV5A 1S1EA 3JVTC 1GQMA 3EG5B 1JUOA 2H61C 2OTGB 3S0BA 4XYNA 5D3OA 5GQQC 3CZ0A 1A4PA 1K9KA 2OS8B 3A8RA 4ZCVA 1MUXA 4N1FA 2GGMA 1W9ZA 1M63B 3L4AA 2WC8A 1A03A 4GGFA 1V1GA 3SG7A 2D8NA 1TNXA 3EK7A 4M2QA 1KK7Z 3K1EA 2KPHA 3UO9A 3DVEA 1JSAA 4NDCA 4OV2A 1HQVA 4C0JA 1R2UA 2M8UA 2BKHB 2KLEA 1YVHA 1XFRA 1RFJA 3R72A 3RM1A 4R1EA 1CTRA 4BY4A 1W7JB 4YI9A 5EL2A 1XA5A 1LA0A 1CFCA 2K7DA 4YGEB 3SIBA 3S0FA 1JBAA 3BOWA 3DXLA 1MXEA 4INWA 2KNEA 3E3RA 1Z4HA 3CTNA 3LL8B 2WCMA 2KFFA 2LVJA 1QS7A 2WCFA 3BUNB 1LXFC 4I5KA 1UURA 4ICBA 1QASA 1QVIZ 1AJ5A 1QIWA 2K7CA 2M49B 3CZTX 1U5IB 2BAPA 4Q04A 1SYMA 1SL9A 2L98A 4ORCB 2JT3A 3NGVA 1QXPA 2R2IA 4P2YB 1TNQA 1CNPA 4PDZA 2BCBA 4PT1A 2OPOA 4DCKA 1XFUO 1EL4A 1QVIY 3I5GB 3TDIA 4I5NB 1AK8A 1PVBA 3BOWB 2K61A 3WNXB 2F3ZA 4GUKA 1ALWA
chains in the Genus database with same CATH topology
1B47A 4MVFA 3WXAA 2SASA 4DRWA 1S5GY 1UHNA 2PSRA 3IQQA 3TS5B 1NX0A 2ZFDA 1RJVA 5I8NA 1M31A 4QJ5B 2OTGC 1UWOA 1SMGA 1QLKA 5CSNA 5HLOA 2OS8C 1NCYA 2O5GA 1IRJA 4YI8A 3SG4A 2F2OA 1N65A 1OE9B 4MSPA 1B4CA 2JRFA 3OP0A 4MRXA 1J7OA 1PALA 2LMTA 2P6BB 4PE7A 1A2XA 1KQVA 2L2EA 3PFVA 2MHHA 1AHRA 1NCXA 2MJWB 3BXKA 5BPJA 3PN7B 1PK0D 4DUQA 2KI6D 4FTGA 1H4BA 2B1UA 1SL8A 4AQJA 2WNDA 1J55A 4AQIA 2LLUA 5KTYA 3FWBA 1C7WA 3BUOB 2JOJA 4HSZA 5AFPA 1XK4A 1ZUZA 2EC6B 3ICBA 3NSIA 2CCMA 4GGFC 4C0LA 3O4YA 4JPZB 1RTP1 3EVRA 4NDBA 2PMYA 2F33A 1TRFA 1J7RA 5I2OA 1XFYO 1AVSA 1C7VA 3CR2A 1QX5B 2CBLA 2FCDA 2HF5A 1IH0A 3CWGA 1K8UA 1NX1A 3LK1A 1CM4A 3IQOA 2MA2A 3HCMA 1LINA 5I2LA 3I5GC 1K96A 1SNLA 5D69A 2L5XB 1OMRA 2KI6C 4NQGA 1XFVO 3TS5C 3BQ3A 2K7BA 1S6JA 3PM8A 4USLA 2PALA 1DJZA 2LAPA 4DS7A 1OZOA 2L0PA 2ZRTA 4L9MA 4YBHB 1M45A 1SW8A 1YR5A 3SG6A 1YUUA 3KF9A 4GGNA 1SY9A 2K0JA 2KAYA 1B8CA 3PSRA 4N1GA 2Y1MA 1BODA 1NWDA 2AMIA 2ZKMX 2BCAA 1UHIA 2LLTA 1CDNA 2F2PA 3NSLA 3PN7C 1DGVA 2DOQA 4MZKA 1EG3A 4CPVA 3OB2B 1Y1XA 1F71A 1IGVA 3C1VA 4GPLB 2HQWA 1L2OB 3KPXA 2EC6C 3SIAA 1SKTA 1BLQA 1DJWA 2I18A 1KSOA 4ZCUA 1HT9A 1NUBA 2M0RA 1Y0VH 2HETA 1V1FA 2LHIA 2FJUB 2LUCA 4F0ZB 2M9GA 1IQ3A 3A4UB 1YUTA 5DKNA 2KDHA 1RWYA 2KYFA 3NSKA 5AXIA 1S6IA 1B8LA 2L4IA 2KQ6A 1DJYA 5DKQA 2M1KB 2JC2A 3CLNA 3FS7A 4YGAA 1L7ZA 1K9PA 3VRNA 4PHKA 1UHHA 1ZACA 2LMVA 2MRDA 2Q4UA 2LVKA 2MLEC 1WY9A 2MAZA 2M97A 3PALA 1F4OA 2LANA 1BOCA 1DJHA 1CLBA 2BECA 4YRUA 2KSPA 2LVIA 1SL7A 2LHLA 1DMOA 2M7NA 4MZLA 5HKWA 5J3XA 1YX8A 4BY5A 1CLLA 4GAOA 3RLZA 4CFRA 4E68A 1S5GZ 1S3PA 3EK8A 5PALA 1FPWA 2LV7A 1DJGA 1ALVA 1W7IB 3D10A 1CLMA 1S26D 1YURA 1KSMA 1G4YR 2GGZA 4HRGA 1S6CA 1LA3A 2LCPA 5DKRA 4UPGA 1CMFA 1CM1A 1XVJA 1KFUS 4PE4A 2G2BA 1YVLA 1DVIA 2V53A 3BYAA 1LKJA 4PALA 1XYDA 1L2OC 2IS9A 1IKUA 4HRHA 3AKBA 4AOMA 2I94A 1X02A 2QACA 2CNPA 5FYXA 1QX7A 2KAXA 3F45A 5JOLA 4TNCA 2A4JA 2JT0A 1F8HA 2KFHA 1FBVA 2ISDA 1KFXS 2LP2A 1SK6D 2H61A 4OR9B 4D1EA 4PCWA 4CIDA 1RECA 5ER4X 5G08A 5HYDA 4NDDA 3EVUA 3K21A 1BF5A 2NLNA 3D0YA 3DF0A 5KSZA 1G8IA 3EVVA 1DGUA 1QLSA 1TNPA 3DVKA 5HKYA 1QIVA 3I5HB 2ZNEA 4ORAB 2Y1NA 2L4HA 1BR4B 5TNCA 3IF7A 1PSRA 1Y1AA 1QX2A 3ZNIA 1DJIA 1BR1B 4A4BA 3GK2A 2K2AA 1GGZA 1CMGA 1EJ3A 2I7AA 4I5LB 1KWOB 3LLEA 3DF0B 1KK8B 1QATA 1TCOB 1XFZO 3WHUB 3KEVA 1EXRA 1NX3A 2I2RE 2WOSA 4WQ3A 1YUSA 1F55A 1WRKA 2QPTA 2KI4B 5CSJA 1DJXA 3PLFB 4YGBB 1TTXA 4M2OA 2E30A 1EH2A 1K9UA 3JTDB 1GJYA 2JULA 4FQOA 1C07A 1OOJA 1H8BA 1NP8A 3DVJA 1CFPA 1K94A 1YRTB 1B7TZ 2K7OA 4CLNA 4ETOA 4C0KA 1VRKA 2WORA 5AANA 2JXLA 3TUYB 1AUIB 2BKIB 1IWQA 2G9BA 3GOFA 1YX7A 3OHMB 5HLVA 1AP4A 1WDCB 3CR4X 5ER5A 2JQ6A 1B7TY 2KBMA 1WRZA 3O78A 3QRXA 4MEWA 1RK9A 4OVNF 3MSEB 4IL1A 2LM5A 3TDZA 3I5FB 3FWCA 4YGDB 4GFTA 1FI6A 2ZNDA 5F6TA 2BL0B 5B8IB 1A75A 2LNKA 2K8MB 2PRUA 3CGAA 3SG2A 1N2DA 1OMDA 2CT9A 3I5HC 1FF1A 1CFFA 1DF0A 4CFQA 2H2KA 2F3YA 2BBNA 3DVMA 5AEQA 1WLMA 1OMVA 3KHEA 1J7PA 1FI5A 4MN0A 1D1OA 1LVCD 1OZSA 1JFKA 4JQ0D 2JT8A 4ORBB 2JWWA 1JC2A 1A75B 1KWOC 2FCEA 1KK8C 1QTXA 1KFUL 1PRWA 3SJSA 1XK4C 3LK0A 1SCMB 1JWDA 2Y5IA 3EK4A 3OX6A 3VGOA 1YTZC 2KI4C 1J1DA 1XFXO 1DF0B 1JF0A 3I5IB 1MWNA 4WQ2A 5IBWA 2JNXA 1ODBA 1PULA 2LMUA 3NXAA 1F54A 3OB1B 4XJKA 4MBEA 3LCPC 3SG3A 3JTDC 1TIZA 3BUXB 4QJ4B 1BMOA 1NX2A 1U5IA 2JTZA 4GBAA 4OCIA 1SBJA 3M0WA 1KK7Y 2K2FA 2LC5A 2MBXA 2KOTA 1N0YA 1KFXL 1J1EA 4WRIA 3SG5A 3CR5X 3O6BA 5CSIA 3EKJA 2KHNA 2MLFC 3TUYC 2EHBA 2JPTA 2KBIA 2M1UA 2ZN9A 4N5XA 5AERA 2ZN8A 1F70A 2RGIA 1WDCC 1IJ6A 4M2PA 2E6WA 2NCPA 1XO5A 1ZMZA 1B9AA 2JTTA 1KQMB 4HREE 4PE1A 4XJKB 2LUXA 3AKAA 3I5FC 2CTNA 4QJ3B 2BL0C 1PSBA 2BE4A 1M39A 4PHJA 1SRAA 1FW4A 1YRUB 2M29A 3ZWHA 1NYAA 2HPSA 2JNFA 2KFGA 1CFDA 2LE9B 2NXQA 3H4SE 2PVBA 2LP3A 2SCPA 3CS1A 1DTLA 1MXLC 2L50A 5HKZA 4MZJA 1K2HA 3GK1A 5CPVA 1SR6B 5CSFA 2Y4QA 1TN4A 3PATA 2FOTA 4OKHA 2WCEA 2AUCA 1Q80A 2BE6A 3HX4A 1SCMC 3O2PA 4GNKB 3TZ1A 3AAKA 1WRLA 3EKHA 1SPYA 1CDPA 2BCXA 3BUMB 1E8AA 3BUWB 2TN4A 3I5IC 2BBMA 1NIWA 1K93D 3VRPA 1Y6WA 2KAVA 1NCZA 1WLZA 1TOPA 2VRGA 4MRYA 3GK4X 1B8RA 2M7LA 1IJ5A 1SCVA 3JVTB 2NCOA 3WHTB 1OSAA 3VRRA 1B1GA 1PVAA 1IQ5A 1UP5A 1TCFA 1QJTA 3AAJA 1KCYA 4PHMA 2EGDA 4YGCB 4JWQA 1MQ1A 3D0YB 2KGBC 1BT6A 1QV1A 5K89A 1TNWA 1ZFSA 3DD4A 1GGWA 3FIAA 4A4CA 2F8PA 4MLWA 1J7QA 2COLB 1KQMC 4U8DA 1JFJA 2JU0A 4P5OE 2HQ8A 1CKKA 1K95A 1JF2A 1UHKA 2M3WA 1ZOTB 1EG4A 1Y1UA 2AAOA 1AJ4A 2WCBA 3VROA 1CDLA 2O60A 1A29A 2KQYA 2JXCA 2ZRSA 1MHOA 1NSHA 3OX5A 1UHJA 1CB1A 2CXJA 1MF8B 2KGRA 4DIRA 1R6PA 5I2QA 1SR6C 2Q91A 1IG5A 1BG1A 5KU1A 1UUSA 1M46A 1S36A 1BJFA 3NSOA 2JZIA 3KO0A 1G33A 1F4QA 4PE0A 2PASA 4I5JA 5D7FA 1RROA 1BU3A 1CDMA 3VRQA 3TDUA 1OQPA 1K90D 1DT7B 1XFWO 2L51A 2NZ0A 2LVVA 1NPQA 2LLSA 1MR8A 4PHNA 2KYCA 1QV0A 5JJGA 2GV5A 1S1EA 3JVTC 1GQMA 1JUOA 2H61C 2OTGB 4XYNA 5GQQC 1A4PA 1K9KA 2OS8B 3A8RA 4ZCVA 1MUXA 4N1FA 2GGMA 1M63B 2WC8A 1A03A 4GGFA 1V1GA 3SG7A 2D8NA 1TNXA 3EK7A 4M2QA 1KK7Z 3DVEA 1JSAA 4NDCA 4OV2A 1HQVA 4C0JA 1R2UA 2M8UA 2BKHB 1YVHA 1RFJA 3RM1A 4R1EA 1CTRA 4BY4A 1W7JB 4YI9A 1CFCA 1XA5A 1LA0A 2K7DA 4YGEB 3SIBA 1JBAA 3BOWA 1MXEA 2KNEA 3E3RA 3CTNA 3LL8B 2KFFA 2LVJA 1QS7A 2WCFA 3BUNB 1LXFC 4I5KA 1UURA 4ICBA 1QASA 1QVIZ 1AJ5A 1QIWA 2K7CA 2M49B 3CZTX 1U5IB 4Q04A 1SYMA 1SL9A 2L98A 4ORCB 2JT3A 1QXPA 2R2IA 4P2YB 1TNQA 1CNPA 4PDZA 2BCBA 2OPOA 4DCKA 1XFUO 1EL4A 1QVIY 3I5GB 3TDIA 4I5NB 1AK8A 1PVBA 3BOWB 2K61A 3WNXB 2F3ZA 4GUKA 1ALWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B47 A;  4MVF A;  3WXA A;  2SAS A;  4DRW A;  1S5G Y;  1UHN A;  2PSR A;  3IQQ A;  3TS5 B;  1NX0 A;  2ZFD A;  1RJV A;  5I8N A;  1M31 A;  4QJ5 B;  2OTG C;  1UWO A;  1SMG A;  1QLK A;  5CSN A;  5HLO A;  2OS8 C;  1NCY A;  2O5G A;  1IRJ A;  4YI8 A;  3SG4 A;  2F2O A;  1N65 A;  1OE9 B;  4MSP A;  1B4C A;  2JRF A;  3OP0 A;  4MRX A;  1J7O A;  1PAL A;  2LMT A;  2P6B B;  4PE7 A;  1A2X A;  1KQV A;  2L2E A;  3PFV A;  2MHH A;  1AHR A;  1NCX A;  2MJW B;  3BXK A;  5BPJ A;  3PN7 B;  1PK0 D;  4DUQ A;  2KI6 D;  4FTG A;  1H4B A;  2B1U A;  1SL8 A;  4AQJ A;  2WND A;  1J55 A;  4AQI A;  2LLU A;  5KTY A;  3FWB A;  1C7W A;  3BUO B;  2JOJ A;  4HSZ A;  5AFP A;  1XK4 A;  1ZUZ A;  2EC6 B;  3ICB A;  3NSI A;  2CCM A;  4GGF C;  4C0L A;  3O4Y A;  4JPZ B;  1RTP 1;  3EVR A;  4NDB A;  2PMY A;  2F33 A;  1TRF A;  1J7R A;  5I2O A;  1XFY O;  1AVS A;  1C7V A;  3CR2 A;  1QX5 B;  2CBL A;  2FCD A;  2HF5 A;  1IH0 A;  3CWG A;  1K8U A;  1NX1 A;  3LK1 A;  1CM4 A;  3IQO A;  2MA2 A;  3HCM A;  1LIN A;  5I2L A;  3I5G C;  1K96 A;  1SNL A;  5D69 A;  2L5X B;  1OMR A;  2KI6 C;  4NQG A;  1XFV O;  3TS5 C;  3BQ3 A;  2K7B A;  1S6J A;  3PM8 A;  4USL A;  2PAL A;  1DJZ A;  2LAP A;  4DS7 A;  1OZO A;  2L0P A;  2ZRT A;  4L9M A;  4YBH B;  1M45 A;  1SW8 A;  1YR5 A;  3SG6 A;  1YUU A;  3KF9 A;  4GGN A;  1SY9 A;  2K0J A;  2KAY A;  1B8C A;  3PSR A;  4N1G A;  2Y1M A;  1BOD A;  1NWD A;  2AMI A;  2ZKM X;  2BCA A;  1UHI A;  2LLT A;  1CDN A;  2F2P A;  3NSL A;  3PN7 C;  1DGV A;  2DOQ A;  4MZK A;  1EG3 A;  4CPV A;  3OB2 B;  1Y1X A;  1F71 A;  1IGV A;  3C1V A;  4GPL B;  2HQW A;  1L2O B;  3KPX A;  2EC6 C;  3SIA A;  1SKT A;  1BLQ A;  1DJW A;  2I18 A;  1KSO A;  4ZCU A;  1HT9 A;  1NUB A;  2M0R A;  1Y0V H;  2HET A;  1V1F A;  2LHI A;  2FJU B;  2LUC A;  4F0Z B;  2M9G A;  1IQ3 A;  3A4U B;  1YUT A;  5DKN A;  2KDH A;  1RWY A;  2KYF A;  3NSK A;  5AXI A;  1S6I A;  1B8L A;  2L4I A;  2KQ6 A;  1DJY A;  5DKQ A;  2M1K B;  2JC2 A;  3CLN A;  3FS7 A;  4YGA A;  1L7Z A;  1K9P A;  3VRN A;  4PHK A;  1UHH A;  1ZAC A;  2LMV A;  2MRD A;  2Q4U A;  2LVK A;  2MLE C;  1WY9 A;  2MAZ A;  2M97 A;  3PAL A;  1F4O A;  2LAN A;  1BOC A;  1DJH A;  1CLB A;  2BEC A;  4YRU A;  2KSP A;  2LVI A;  1SL7 A;  2LHL A;  1DMO A;  2M7N A;  4MZL A;  5HKW A;  5J3X A;  1YX8 A;  4BY5 A;  1CLL A;  4GAO A;  3RLZ A;  4CFR A;  4E68 A;  1S5G Z;  1S3P A;  3EK8 A;  5PAL A;  1FPW A;  2LV7 A;  1DJG A;  1ALV A;  1W7I B;  3D10 A;  1CLM A;  1S26 D;  1YUR A;  1KSM A;  1G4Y R;  2GGZ A;  4HRG A;  1S6C A;  1LA3 A;  2LCP A;  5DKR A;  4UPG A;  1CMF A;  1CM1 A;  1XVJ A;  1KFU S;  4PE4 A;  2G2B A;  1YVL A;  1DVI A;  2V53 A;  3BYA A;  1LKJ A;  4PAL A;  1XYD A;  1L2O C;  2IS9 A;  1IKU A;  4HRH A;  3AKB A;  4AOM A;  2I94 A;  1X02 A;  2QAC A;  2CNP A;  5FYX A;  1QX7 A;  2KAX A;  3F45 A;  5JOL A;  4TNC A;  2A4J A;  2JT0 A;  1F8H A;  2KFH A;  1FBV A;  2ISD A;  1KFX S;  2LP2 A;  1SK6 D;  2H61 A;  4OR9 B;  4D1E A;  4PCW A;  4CID A;  1REC A;  5ER4 X;  5G08 A;  5HYD A;  4NDD A;  3EVU A;  3K21 A;  1BF5 A;  2NLN A;  3D0Y A;  3DF0 A;  5KSZ A;  1G8I A;  3EVV A;  1DGU A;  1QLS A;  1TNP A;  3DVK A;  5HKY A;  1QIV A;  3I5H B;  2ZNE A;  4ORA B;  2Y1N A;  2L4H A;  1BR4 B;  5TNC A;  3IF7 A;  1PSR A;  1Y1A A;  1QX2 A;  3ZNI A;  1DJI A;  1BR1 B;  4A4B A;  3GK2 A;  2K2A A;  1GGZ A;  1CMG A;  1EJ3 A;  2I7A A;  4I5L B;  1KWO B;  3LLE A;  3DF0 B;  1KK8 B;  1QAT A;  1TCO B;  1XFZ O;  3WHU B;  3KEV A;  1EXR A;  1NX3 A;  2I2R E;  2WOS A;  4WQ3 A;  1YUS A;  1F55 A;  1WRK A;  2QPT A;  2KI4 B;  5CSJ A;  1DJX A;  3PLF B;  4YGB B;  1TTX A;  4M2O A;  2E30 A;  1EH2 A;  1K9U A;  3JTD B;  1GJY A;  2JUL A;  4FQO A;  1C07 A;  1OOJ A;  1H8B A;  1NP8 A;  3DVJ A;  1CFP A;  1K94 A;  1YRT B;  1B7T Z;  2K7O A;  4CLN A;  4ETO A;  4C0K A;  1VRK A;  2WOR A;  5AAN A;  2JXL A;  3TUY B;  1AUI B;  2BKI B;  1IWQ A;  2G9B A;  3GOF A;  1YX7 A;  3OHM B;  5HLV A;  1AP4 A;  1WDC B;  3CR4 X;  5ER5 A;  2JQ6 A;  1B7T Y;  2KBM A;  1WRZ A;  3O78 A;  3QRX A;  4MEW A;  1RK9 A;  4OVN F;  3MSE B;  4IL1 A;  2LM5 A;  3TDZ A;  3I5F B;  3FWC A;  4YGD B;  4GFT A;  1FI6 A;  2ZND A;  5F6T A;  2BL0 B;  5B8I B;  1A75 A;  2LNK A;  2K8M B;  2PRU A;  3CGA A;  3SG2 A;  1N2D A;  1OMD A;  2CT9 A;  3I5H C;  1FF1 A;  1CFF A;  1DF0 A;  4CFQ A;  2H2K A;  2F3Y A;  2BBN A;  3DVM A;  5AEQ A;  1WLM A;  1OMV A;  3KHE A;  1J7P A;  1FI5 A;  4MN0 A;  1D1O A;  1LVC D;  1OZS A;  1JFK A;  4JQ0 D;  2JT8 A;  4ORB B;  2JWW A;  1JC2 A;  1A75 B;  1KWO C;  2FCE A;  1KK8 C;  1QTX A;  1KFU L;  1PRW A;  3SJS A;  1XK4 C;  3LK0 A;  1SCM B;  1JWD A;  2Y5I A;  3EK4 A;  3OX6 A;  3VGO A;  1YTZ C;  2KI4 C;  1J1D A;  1XFX O;  1DF0 B;  1JF0 A;  3I5I B;  1MWN A;  4WQ2 A;  5IBW A;  2JNX A;  1ODB A;  1PUL A;  2LMU A;  3NXA A;  1F54 A;  3OB1 B;  4XJK A;  4MBE A;  3LCP C;  3SG3 A;  3JTD C;  1TIZ A;  3BUX B;  4QJ4 B;  1BMO A;  1NX2 A;  1U5I A;  2JTZ A;  4GBA A;  4OCI A;  1SBJ A;  3M0W A;  1KK7 Y;  2K2F A;  2LC5 A;  2MBX A;  2KOT A;  1N0Y A;  1KFX L;  1J1E A;  4WRI A;  3SG5 A;  3CR5 X;  3O6B A;  5CSI A;  3EKJ A;  2KHN A;  2MLF C;  3TUY C;  2EHB A;  2JPT A;  2KBI A;  2M1U A;  2ZN9 A;  4N5X A;  5AER A;  2ZN8 A;  1F70 A;  2RGI A;  1WDC C;  1IJ6 A;  4M2P A;  2E6W A;  2NCP A;  1XO5 A;  1ZMZ A;  1B9A A;  2JTT A;  1KQM B;  4HRE E;  4PE1 A;  4XJK B;  2LUX A;  3AKA A;  3I5F C;  2CTN A;  4QJ3 B;  2BL0 C;  1PSB A;  2BE4 A;  1M39 A;  4PHJ A;  1SRA A;  1FW4 A;  1YRU B;  2M29 A;  3ZWH A;  1NYA A;  2HPS A;  2JNF A;  2KFG A;  1CFD A;  2LE9 B;  2NXQ A;  3H4S E;  2PVB A;  2LP3 A;  2SCP A;  3CS1 A;  1DTL A;  1MXL C;  2L50 A;  5HKZ A;  4MZJ A;  1K2H A;  3GK1 A;  5CPV A;  1SR6 B;  5CSF A;  2Y4Q A;  1TN4 A;  3PAT A;  2FOT A;  4OKH A;  2WCE A;  2AUC A;  1Q80 A;  2BE6 A;  3HX4 A;  1SCM C;  3O2P A;  4GNK B;  3TZ1 A;  3AAK A;  1WRL A;  3EKH A;  1SPY A;  1CDP A;  2BCX A;  3BUM B;  1E8A A;  3BUW B;  2TN4 A;  3I5I C;  2BBM A;  1NIW A;  1K93 D;  3VRP A;  1Y6W A;  2KAV A;  1NCZ A;  1WLZ A;  1TOP A;  2VRG A;  4MRY A;  3GK4 X;  1B8R A;  2M7L A;  1IJ5 A;  1SCV A;  3JVT B;  2NCO A;  3WHT B;  1OSA A;  3VRR A;  1B1G A;  1PVA A;  1IQ5 A;  1UP5 A;  1TCF A;  1QJT A;  3AAJ A;  1KCY A;  4PHM A;  2EGD A;  4YGC B;  4JWQ A;  1MQ1 A;  3D0Y B;  2KGB C;  1BT6 A;  1QV1 A;  5K89 A;  1TNW A;  1ZFS A;  3DD4 A;  1GGW A;  3FIA A;  4A4C A;  2F8P A;  4MLW A;  1J7Q A;  2COL B;  1KQM C;  4U8D A;  1JFJ A;  2JU0 A;  4P5O E;  2HQ8 A;  1CKK A;  1K95 A;  1JF2 A;  1UHK A;  2M3W A;  1ZOT B;  1EG4 A;  1Y1U A;  2AAO A;  1AJ4 A;  2WCB A;  3VRO A;  1CDL A;  2O60 A;  1A29 A;  2KQY A;  2JXC A;  2ZRS A;  1MHO A;  1NSH A;  3OX5 A;  1UHJ A;  1CB1 A;  2CXJ A;  1MF8 B;  2KGR A;  4DIR A;  1R6P A;  5I2Q A;  1SR6 C;  2Q91 A;  1IG5 A;  1BG1 A;  5KU1 A;  1UUS A;  1M46 A;  1S36 A;  1BJF A;  3NSO A;  2JZI A;  3KO0 A;  1G33 A;  1F4Q A;  4PE0 A;  2PAS A;  4I5J A;  5D7F A;  1RRO A;  1BU3 A;  1CDM A;  3VRQ A;  3TDU A;  1OQP A;  1K90 D;  1DT7 B;  1XFW O;  2L51 A;  2NZ0 A;  2LVV A;  1NPQ A;  2LLS A;  1MR8 A;  4PHN A;  2KYC A;  1QV0 A;  5JJG A;  2GV5 A;  1S1E A;  3JVT C;  1GQM A;  1JUO A;  2H61 C;  2OTG B;  4XYN A;  5GQQ C;  1A4P A;  1K9K A;  2OS8 B;  3A8R A;  4ZCV A;  1MUX A;  4N1F A;  2GGM A;  1M63 B;  2WC8 A;  1A03 A;  4GGF A;  1V1G A;  3SG7 A;  2D8N A;  1TNX A;  3EK7 A;  4M2Q A;  1KK7 Z;  3DVE A;  1JSA A;  4NDC A;  4OV2 A;  1HQV A;  4C0J A;  1R2U A;  2M8U A;  2BKH B;  1YVH A;  1RFJ A;  3RM1 A;  4R1E A;  1CTR A;  4BY4 A;  1W7J B;  4YI9 A;  1CFC A;  1XA5 A;  1LA0 A;  2K7D A;  4YGE B;  3SIB A;  1JBA A;  3BOW A;  1MXE A;  2KNE A;  3E3R A;  3CTN A;  3LL8 B;  2KFF A;  2LVJ A;  1QS7 A;  2WCF A;  3BUN B;  1LXF C;  4I5K A;  1UUR A;  4ICB A;  1QAS A;  1QVI Z;  1AJ5 A;  1QIW A;  2K7C A;  2M49 B;  3CZT X;  1U5I B;  4Q04 A;  1SYM A;  1SL9 A;  2L98 A;  4ORC B;  2JT3 A;  1QXP A;  2R2I A;  4P2Y B;  1TNQ A;  1CNP A;  4PDZ A;  2BCB A;  2OPO A;  4DCK A;  1XFU O;  1EL4 A;  1QVI Y;  3I5G B;  3TDI A;  4I5N B;  1AK8 A;  1PVB A;  3BOW B;  2K61 A;  3WNX B;  2F3Z A;  4GUK A;  1ALW A; 
#chains in the Genus database with same CATH topology
 1B47 A;  4MVF A;  3WXA A;  2SAS A;  4DRW A;  1S5G Y;  1UHN A;  2PSR A;  3IQQ A;  3TS5 B;  1NX0 A;  2ZFD A;  1RJV A;  1DEK A;  1M31 A;  4QJ5 B;  5I8N A;  2OTG C;  1UWO A;  1TUJ A;  1SMG A;  1QLK A;  5CSN A;  5HLO A;  2OS8 C;  1NCY A;  2O5G A;  1IRJ A;  4YI8 A;  3SG4 A;  2ERB A;  2F2O A;  1N65 A;  1OE9 B;  4MSP A;  1B4C A;  3Q8I A;  3D74 A;  2JRF A;  3OP0 A;  4MRX A;  1J7O A;  1PAL A;  2LMT A;  1C3Y A;  2P6B B;  3FE9 A;  4PE7 A;  1A2X A;  1KQV A;  2L2E A;  3PFV A;  2MHH A;  1AHR A;  1NCX A;  5IBW A;  1DQE A;  4KYN A;  2MJW B;  3BXK A;  5DIC A;  5BPJ A;  3B6X A;  1PK0 D;  3PN7 B;  2KI6 D;  4FTG A;  4DUQ A;  2QEH A;  1H4B A;  2B1U A;  1SL8 A;  4AQJ A;  2WND A;  1J55 A;  4AQI A;  2LLU A;  5KTY A;  3FWB A;  1C7W A;  3BUO B;  2JOJ A;  4HSZ A;  5AFP A;  1XK4 A;  1ZUZ A;  2EC6 B;  3ICB A;  3NSI A;  2CCM A;  4GGF C;  4C0L A;  3O4Y A;  4JPZ B;  1RTP 1;  3EVR A;  4NDB A;  2PMY A;  2F33 A;  1TRF A;  1J7R A;  5I2O A;  1XFY O;  1AVS A;  1C7V A;  3CR2 A;  1QX5 B;  2CBL A;  2FCD A;  2HF5 A;  1IH0 A;  3CWG A;  1K8U A;  1NX1 A;  3LK1 A;  1CM4 A;  3IQO A;  2MA2 A;  3BJH A;  3HCM A;  1LIN A;  5I2L A;  3I5G C;  1K96 A;  1SNL A;  5D69 A;  2L5X B;  3DY9 A;  1OMR A;  2KI6 C;  4FQT A;  4NQG A;  1XFV O;  1OOI X;  3TS5 C;  3BQ3 A;  2K7B A;  3BFB A;  1S6J A;  3PM8 A;  4USL A;  2PAL A;  1DJZ A;  2LAP A;  1QWV A;  5FI6 A;  3S0D A;  4DS7 A;  1OZO A;  2L0P A;  2ZRT A;  4L9M A;  4YBH B;  1M45 A;  1SW8 A;  1YR5 A;  3SG6 A;  1YUU A;  3KF9 A;  2BNX A;  4GGN A;  1SY9 A;  2K0J A;  2KAY A;  1B8C A;  3PSR A;  4N1G A;  2QEB A;  2Y1M A;  2PQL A;  1BOD A;  1NWD A;  2AMI A;  2ZKM X;  3N7H A;  2BCA A;  1UHI A;  2LLT A;  1CDN A;  2F2P A;  3NSL A;  3R1V A;  3PN7 C;  1DGV A;  2DOQ A;  4MZK A;  1EG3 A;  1C3Z A;  3S0G A;  3OB2 B;  4CPV A;  1Y1X A;  1F71 A;  1IGV A;  3C1V A;  4GPL B;  2HQW A;  1L2O B;  3KPX A;  2EC6 C;  3SIA A;  1SKT A;  1BLQ A;  1DJW A;  2I18 A;  1KSO A;  4ZCU A;  5I94 A;  1HT9 A;  1NUB A;  2M0R A;  1Y0V H;  2HET A;  1V1F A;  2LHI A;  2FJU B;  2LUC A;  3D76 A;  4F0Z B;  2M9G A;  4INX A;  1IQ3 A;  3A4U B;  1YUT A;  5DKN A;  2KDH A;  1RWY A;  2KYF A;  3NSK A;  5AXI A;  1S6I A;  1B8L A;  2L4I A;  2KQ6 A;  1DJY A;  5DKQ A;  2M1K B;  2JC2 A;  3CLN A;  3FS7 A;  4YGA A;  1L7Z A;  1K9P A;  3VRN A;  4PHK A;  1UHH A;  1ZAC A;  2LMV A;  3PM2 A;  2MRD A;  2Q4U A;  2LVK A;  2MLE C;  1WY9 A;  2MAZ A;  2M97 A;  3PAL A;  1F4O A;  2LAN A;  1BOC A;  1DJH A;  1CLB A;  4IJ7 A;  2BEC A;  4YRU A;  2KSP A;  2LVI A;  1SL7 A;  2LHL A;  2WCK A;  1DMO A;  2M7N A;  4OZD A;  3O4X A;  3BFA A;  4MZL A;  5HKW A;  5FI7 A;  3R1P A;  5J3X A;  1YX8 A;  4BY5 A;  1CLL A;  3CAB A;  4GAO A;  3RLZ A;  4CFR A;  4E68 A;  1S5G Z;  1S3P A;  2YGU A;  3EK8 A;  5PAL A;  2LV7 A;  1FPW A;  1DJG A;  1ALV A;  1W7I B;  3D10 A;  1CLM A;  1S26 D;  1YUR A;  3DYE A;  1KSM A;  1G4Y R;  2GGZ A;  4HRG A;  1S6C A;  1LA3 A;  2LCP A;  5DKR A;  4UPG A;  1CMF A;  1CM1 A;  2L2C A;  3RZS A;  1XVJ A;  1KFU S;  4PE4 A;  2G2B A;  1YVL A;  1OW4 A;  1DVI A;  2WCJ A;  2V53 A;  3BYA A;  1LKJ A;  1TWO A;  4PAL A;  3VB1 A;  1XYD A;  1L2O C;  2IS9 A;  3L4L A;  1IKU A;  1IIO A;  1ORG A;  4HRH A;  3AKB A;  4AOM A;  2I94 A;  1X02 A;  2QAC A;  2CNP A;  5FYX A;  2WC6 A;  1QX7 A;  2KAX A;  3OBV A;  3F45 A;  5JOL A;  4TNC A;  2A4J A;  2JT0 A;  1F8H A;  2KFH A;  1FBV A;  2ISD A;  1KFX S;  2LP2 A;  1SK6 D;  2H61 A;  4OR9 B;  4D1E A;  4PCW A;  4CID A;  1REC A;  3L47 A;  5ER4 X;  5G08 A;  5HYD A;  4NDD A;  3EVU A;  3K21 A;  1BF5 A;  2NLN A;  3D0Y A;  3DF0 A;  5KSZ A;  1G8I A;  3NHT A;  3EVV A;  3V2L A;  1DGU A;  1QLS A;  1TNP A;  3DVK A;  5HKY A;  1QIV A;  3I5H B;  2ZNE A;  4ORA B;  2Y1N A;  2L4H A;  3SS5 A;  1BR4 B;  5TNC A;  3IF7 A;  1PSR A;  1Y1A A;  1QX2 A;  3ZNI A;  1DJI A;  1BR1 B;  4A4B A;  3GK2 A;  2K2A A;  1GGZ A;  1CMG A;  1EJ3 A;  3B7A A;  2I7A A;  4I5L B;  1DC1 A;  1KWO B;  3LLE A;  3DF0 B;  1KK8 B;  1QAT A;  1TCO B;  1XFZ O;  3WHU B;  3KEV A;  1EXR A;  1NX3 A;  2I2R E;  2WOS A;  4WQ3 A;  2WCH A;  1YUS A;  1F55 A;  1WRK A;  2QPT A;  2KI4 B;  5CSJ A;  1DJX A;  3PLF B;  4YGB B;  1TTX A;  4M2O A;  2E30 A;  1OOG A;  1EH2 A;  3S0A A;  1K9U A;  3JTD B;  1GJY A;  3DZT A;  2JUL A;  4FQO A;  1C07 A;  1OOJ A;  1H8B A;  1NP8 A;  3DVJ A;  1SSE B;  1K94 A;  1YRT B;  1B7T Z;  2K7O A;  4CLN A;  4ETO A;  1CFP A;  4C0K A;  1VRK A;  3D73 A;  2KLD A;  2WOR A;  5AAN A;  2JXL A;  3TUY B;  1AUI B;  1IWQ A;  2BKI B;  2G9B A;  3GOF A;  1YX7 A;  3OHM B;  5HLV A;  1AP4 A;  2P71 A;  1WDC B;  3CR4 X;  5ER5 A;  2JQ6 A;  1B7T Y;  2KBM A;  1WRZ A;  3O78 A;  3QRX A;  4MEW A;  1RK9 A;  4OVN F;  4F7F A;  3MSE B;  4IL1 A;  2LM5 A;  3TDZ A;  3I5F B;  3FWC A;  4YGD B;  4GFT A;  1FI6 A;  2ZND A;  5F6T A;  2BL0 B;  5B8I B;  1A75 A;  2LNK A;  2K8M B;  2PRU A;  3CGA A;  2L5Y A;  3SG2 A;  1N2D A;  1OMD A;  2CT9 A;  3I5H C;  1FF1 A;  3D75 A;  1CFF A;  2H8V A;  1DF0 A;  4CFQ A;  2H2K A;  3S0E A;  2F3Y A;  2BBN A;  3DVM A;  5AEQ A;  1WLM A;  1OMV A;  3KHE A;  1J7P A;  1FI5 A;  4MN0 A;  1D1O A;  3CZ1 A;  3FE6 A;  1LVC D;  1P28 A;  1OZS A;  1JFK A;  4JQ0 D;  2JT8 A;  4JKT A;  4ORB B;  2JWW A;  1JC2 A;  3CZ2 A;  1A75 B;  1KWO C;  3SS4 A;  2FCE A;  1KK8 C;  1QTX A;  1KFU L;  1PRW A;  3SJS A;  1XK4 C;  3LK0 A;  1SCM B;  1JWD A;  2Y5I A;  1T14 A;  3EK4 A;  3OX6 A;  3VGO A;  1YTZ C;  2KI4 C;  1J1D A;  1XFX O;  1DF0 B;  1JF0 A;  3I5I B;  1MWN A;  4WQ2 A;  2QEO A;  2QEV A;  2JNX A;  1ODB A;  1PUL A;  2LMU A;  2P70 A;  3NXA A;  1F54 A;  3OB1 B;  4XJK A;  4MBE A;  3LCP C;  3SG3 A;  3JTD C;  1TIZ A;  3BUX B;  4QJ4 B;  1BMO A;  1NX2 A;  1U5I A;  2JTZ A;  2QDI A;  4GBA A;  4OCI A;  1SBJ A;  3M0W A;  1KK7 Y;  2K2F A;  2LC5 A;  2MBX A;  2KOT A;  1N0Y A;  1KFX L;  1J1E A;  4WRI A;  3SG5 A;  3B88 A;  3CR5 X;  3O6B A;  3EKJ A;  2KHN A;  3QME A;  2MLF C;  5CSI A;  3TUY C;  2EHB A;  2JPT A;  2KBI A;  2M1U A;  2ZN9 A;  4N5X A;  5AER A;  2ZN8 A;  1F70 A;  2RGI A;  1WDC C;  1IJ6 A;  4M2P A;  2E6W A;  2NCP A;  1XO5 A;  1ZMZ A;  1B9A A;  2JTT A;  1KQM B;  4HRE E;  4PE1 A;  4XJK B;  2LUX A;  3AKA A;  3I5F C;  3D78 A;  2CTN A;  4QJ3 B;  2BL0 C;  1LS8 A;  1PSB A;  2BE4 A;  1M39 A;  4PHJ A;  3R1O A;  1SRA A;  1FW4 A;  1YRU B;  2JPO A;  2M29 A;  2PYQ A;  3IVT A;  3ZWH A;  1NYA A;  2K60 A;  5HL1 A;  3UNW A;  2HPS A;  2JNF A;  2KFG A;  1CFD A;  2LE9 B;  2NXQ A;  3H4S E;  1DEL A;  2PVB A;  2LP3 A;  2SCP A;  3CS1 A;  1DTL A;  1MXL C;  2L50 A;  2WCL A;  5HKZ A;  4MZJ A;  1K2H A;  3GK1 A;  1TUZ A;  5CPV A;  1SR6 B;  5CSF A;  2Y4Q A;  1TN4 A;  3PAT A;  2FOT A;  4OKH A;  2WCE A;  2AUC A;  1Q80 A;  2BE6 A;  3HX4 A;  1SCM C;  3O2P A;  4GNK B;  3TZ1 A;  3AAK A;  1WRL A;  3EKH A;  1SPY A;  1CDP A;  2BCX A;  1OOF A;  3BUM B;  1E8A A;  3BUW B;  2TN4 A;  3FE8 A;  2BBM A;  3I5I C;  1NIW A;  1K93 D;  3VRP A;  3NHI A;  1Y6W A;  2KAV A;  1NCZ A;  1WLZ A;  1TOP A;  2VRG A;  4MRY A;  3GK4 X;  1B8R A;  2M7L A;  1IJ5 A;  1SCV A;  3JVT B;  2NCO A;  1Z2C B;  3WHT B;  1OSA A;  3VRR A;  2WC5 A;  1B1G A;  1PVA A;  1IQ5 A;  1UP5 A;  1TCF A;  1QJT A;  3AAJ A;  3SS3 A;  1KCY A;  4PHM A;  2EGD A;  4YGC B;  4JWQ A;  1MQ1 A;  3D0Y B;  2KGB C;  1BT6 A;  3B87 A;  1QV1 A;  5K89 A;  1TNW A;  1ZFS A;  3DD4 A;  2GTE A;  3FIA A;  4A4C A;  3OGN A;  1GGW A;  2F8P A;  4MLW A;  1J7Q A;  2FJY A;  2COL B;  1KQM C;  4U8D A;  1JFJ A;  1GM0 A;  2JU0 A;  4P5O E;  2HQ8 A;  3BFH A;  1CKK A;  1K95 A;  1JF2 A;  1UHK A;  2M3W A;  1ZOT B;  1EG4 A;  1Y1U A;  2AAO A;  1AJ4 A;  2WCB A;  3VRO A;  1CDL A;  2O60 A;  1A29 A;  2KQY A;  2JXC A;  4JD9 A;  2ZRS A;  1MHO A;  1NSH A;  3OX5 A;  3D77 A;  1UHJ A;  1CB1 A;  2CXJ A;  1MF8 B;  2KGR A;  3CYZ A;  4DIR A;  1R6P A;  5I2Q A;  1SR6 C;  2Q91 A;  1IG5 A;  1BG1 A;  5KU1 A;  1UUS A;  5FI2 A;  1M46 A;  1S36 A;  1BJF A;  3NSO A;  2JZI A;  3KO0 A;  1OOH A;  1G33 A;  1F4Q A;  4PE0 A;  2PAS A;  4I5J A;  3CDN A;  5D7F A;  1RRO A;  1BU3 A;  1CDM A;  3VRQ A;  3TDU A;  1OQP A;  1K90 D;  1DT7 B;  1XFW O;  2L51 A;  2NZ0 A;  3PJI A;  2LVV A;  1NPQ A;  2LLS A;  3B86 A;  1MR8 A;  4PHN A;  2KYC A;  1QV0 A;  5JJG A;  2GV5 A;  1S1E A;  3JVT C;  1GQM A;  3EG5 B;  1JUO A;  2H61 C;  2OTG B;  3S0B A;  4XYN A;  5D3O A;  5GQQ C;  3CZ0 A;  1A4P A;  1K9K A;  2OS8 B;  3A8R A;  4ZCV A;  1MUX A;  4N1F A;  2GGM A;  1W9Z A;  1M63 B;  3L4A A;  2WC8 A;  1A03 A;  4GGF A;  1V1G A;  3SG7 A;  2D8N A;  1TNX A;  3EK7 A;  4M2Q A;  1KK7 Z;  3K1E A;  2KPH A;  3UO9 A;  3DVE A;  1JSA A;  4NDC A;  4OV2 A;  1HQV A;  4C0J A;  1R2U A;  2M8U A;  2BKH B;  2KLE A;  1YVH A;  1XFR A;  1RFJ A;  3R72 A;  3RM1 A;  4R1E A;  1CTR A;  4BY4 A;  1W7J B;  4YI9 A;  5EL2 A;  1XA5 A;  1LA0 A;  1CFC A;  2K7D A;  4YGE B;  3SIB A;  3S0F A;  1JBA A;  3BOW A;  3DXL A;  1MXE A;  4INW A;  2KNE A;  3E3R A;  1Z4H A;  3CTN A;  3LL8 B;  2WCM A;  2KFF A;  2LVJ A;  1QS7 A;  2WCF A;  3BUN B;  1LXF C;  4I5K A;  1UUR A;  4ICB A;  1QAS A;  1QVI Z;  1AJ5 A;  1QIW A;  2K7C A;  2M49 B;  3CZT X;  1U5I B;  2BAP A;  4Q04 A;  1SYM A;  1SL9 A;  2L98 A;  4ORC B;  2JT3 A;  3NGV A;  1QXP A;  2R2I A;  4P2Y B;  1TNQ A;  1CNP A;  4PDZ A;  2BCB A;  4PT1 A;  2OPO A;  4DCK A;  1XFU O;  1EL4 A;  1QVI Y;  3I5G B;  3TDI A;  4I5N B;  1AK8 A;  1PVB A;  3BOW B;  2K61 A;  3WNX B;  2F3Z A;  4GUK A;  1ALW A; 
#chains in the Genus database with same CATH homology
 1B47 A;  4MVF A;  3WXA A;  2SAS A;  4DRW A;  1S5G Y;  1UHN A;  2PSR A;  3IQQ A;  3TS5 B;  1NX0 A;  2ZFD A;  1RJV A;  5I8N A;  1M31 A;  4QJ5 B;  2OTG C;  1UWO A;  1SMG A;  1QLK A;  5CSN A;  5HLO A;  2OS8 C;  1NCY A;  2O5G A;  1IRJ A;  4YI8 A;  3SG4 A;  2F2O A;  1N65 A;  1OE9 B;  4MSP A;  1B4C A;  2JRF A;  3OP0 A;  4MRX A;  1J7O A;  1PAL A;  2LMT A;  2P6B B;  4PE7 A;  1A2X A;  1KQV A;  2L2E A;  3PFV A;  2MHH A;  1AHR A;  1NCX A;  2MJW B;  3BXK A;  5BPJ A;  3PN7 B;  1PK0 D;  4DUQ A;  2KI6 D;  4FTG A;  1H4B A;  2B1U A;  1SL8 A;  4AQJ A;  2WND A;  1J55 A;  4AQI A;  2LLU A;  5KTY A;  3FWB A;  1C7W A;  3BUO B;  2JOJ A;  4HSZ A;  5AFP A;  1XK4 A;  1ZUZ A;  2EC6 B;  3ICB A;  3NSI A;  2CCM A;  4GGF C;  4C0L A;  3O4Y A;  4JPZ B;  1RTP 1;  3EVR A;  4NDB A;  2PMY A;  2F33 A;  1TRF A;  1J7R A;  5I2O A;  1XFY O;  1AVS A;  1C7V A;  3CR2 A;  1QX5 B;  2CBL A;  2FCD A;  2HF5 A;  1IH0 A;  3CWG A;  1K8U A;  1NX1 A;  3LK1 A;  1CM4 A;  3IQO A;  2MA2 A;  3HCM A;  1LIN A;  5I2L A;  3I5G C;  1K96 A;  1SNL A;  5D69 A;  2L5X B;  1OMR A;  2KI6 C;  4NQG A;  1XFV O;  3TS5 C;  3BQ3 A;  2K7B A;  1S6J A;  3PM8 A;  4USL A;  2PAL A;  1DJZ A;  2LAP A;  4DS7 A;  1OZO A;  2L0P A;  2ZRT A;  4L9M A;  4YBH B;  1M45 A;  1SW8 A;  1YR5 A;  3SG6 A;  1YUU A;  3KF9 A;  4GGN A;  1SY9 A;  2K0J A;  2KAY A;  1B8C A;  3PSR A;  4N1G A;  2Y1M A;  1BOD A;  1NWD A;  2AMI A;  2ZKM X;  2BCA A;  1UHI A;  2LLT A;  1CDN A;  2F2P A;  3NSL A;  3PN7 C;  1DGV A;  2DOQ A;  4MZK A;  1EG3 A;  4CPV A;  3OB2 B;  1Y1X A;  1F71 A;  1IGV A;  3C1V A;  4GPL B;  2HQW A;  1L2O B;  3KPX A;  2EC6 C;  3SIA A;  1SKT A;  1BLQ A;  1DJW A;  2I18 A;  1KSO A;  4ZCU A;  1HT9 A;  1NUB A;  2M0R A;  1Y0V H;  2HET A;  1V1F A;  2LHI A;  2FJU B;  2LUC A;  4F0Z B;  2M9G A;  1IQ3 A;  3A4U B;  1YUT A;  5DKN A;  2KDH A;  1RWY A;  2KYF A;  3NSK A;  5AXI A;  1S6I A;  1B8L A;  2L4I A;  2KQ6 A;  1DJY A;  5DKQ A;  2M1K B;  2JC2 A;  3CLN A;  3FS7 A;  4YGA A;  1L7Z A;  1K9P A;  3VRN A;  4PHK A;  1UHH A;  1ZAC A;  2LMV A;  2MRD A;  2Q4U A;  2LVK A;  2MLE C;  1WY9 A;  2MAZ A;  2M97 A;  3PAL A;  1F4O A;  2LAN A;  1BOC A;  1DJH A;  1CLB A;  2BEC A;  4YRU A;  2KSP A;  2LVI A;  1SL7 A;  2LHL A;  1DMO A;  2M7N A;  4MZL A;  5HKW A;  5J3X A;  1YX8 A;  4BY5 A;  1CLL A;  4GAO A;  3RLZ A;  4CFR A;  4E68 A;  1S5G Z;  1S3P A;  3EK8 A;  5PAL A;  1FPW A;  2LV7 A;  1DJG A;  1ALV A;  1W7I B;  3D10 A;  1CLM A;  1S26 D;  1YUR A;  1KSM A;  1G4Y R;  2GGZ A;  4HRG A;  1S6C A;  1LA3 A;  2LCP A;  5DKR A;  4UPG A;  1CMF A;  1CM1 A;  1XVJ A;  1KFU S;  4PE4 A;  2G2B A;  1YVL A;  1DVI A;  2V53 A;  3BYA A;  1LKJ A;  4PAL A;  1XYD A;  1L2O C;  2IS9 A;  1IKU A;  4HRH A;  3AKB A;  4AOM A;  2I94 A;  1X02 A;  2QAC A;  2CNP A;  5FYX A;  1QX7 A;  2KAX A;  3F45 A;  5JOL A;  4TNC A;  2A4J A;  2JT0 A;  1F8H A;  2KFH A;  1FBV A;  2ISD A;  1KFX S;  2LP2 A;  1SK6 D;  2H61 A;  4OR9 B;  4D1E A;  4PCW A;  4CID A;  1REC A;  5ER4 X;  5G08 A;  5HYD A;  4NDD A;  3EVU A;  3K21 A;  1BF5 A;  2NLN A;  3D0Y A;  3DF0 A;  5KSZ A;  1G8I A;  3EVV A;  1DGU A;  1QLS A;  1TNP A;  3DVK A;  5HKY A;  1QIV A;  3I5H B;  2ZNE A;  4ORA B;  2Y1N A;  2L4H A;  1BR4 B;  5TNC A;  3IF7 A;  1PSR A;  1Y1A A;  1QX2 A;  3ZNI A;  1DJI A;  1BR1 B;  4A4B A;  3GK2 A;  2K2A A;  1GGZ A;  1CMG A;  1EJ3 A;  2I7A A;  4I5L B;  1KWO B;  3LLE A;  3DF0 B;  1KK8 B;  1QAT A;  1TCO B;  1XFZ O;  3WHU B;  3KEV A;  1EXR A;  1NX3 A;  2I2R E;  2WOS A;  4WQ3 A;  1YUS A;  1F55 A;  1WRK A;  2QPT A;  2KI4 B;  5CSJ A;  1DJX A;  3PLF B;  4YGB B;  1TTX A;  4M2O A;  2E30 A;  1EH2 A;  1K9U A;  3JTD B;  1GJY A;  2JUL A;  4FQO A;  1C07 A;  1OOJ A;  1H8B A;  1NP8 A;  3DVJ A;  1CFP A;  1K94 A;  1YRT B;  1B7T Z;  2K7O A;  4CLN A;  4ETO A;  4C0K A;  1VRK A;  2WOR A;  5AAN A;  2JXL A;  3TUY B;  1AUI B;  2BKI B;  1IWQ A;  2G9B A;  3GOF A;  1YX7 A;  3OHM B;  5HLV A;  1AP4 A;  1WDC B;  3CR4 X;  5ER5 A;  2JQ6 A;  1B7T Y;  2KBM A;  1WRZ A;  3O78 A;  3QRX A;  4MEW A;  1RK9 A;  4OVN F;  3MSE B;  4IL1 A;  2LM5 A;  3TDZ A;  3I5F B;  3FWC A;  4YGD B;  4GFT A;  1FI6 A;  2ZND A;  5F6T A;  2BL0 B;  5B8I B;  1A75 A;  2LNK A;  2K8M B;  2PRU A;  3CGA A;  3SG2 A;  1N2D A;  1OMD A;  2CT9 A;  3I5H C;  1FF1 A;  1CFF A;  1DF0 A;  4CFQ A;  2H2K A;  2F3Y A;  2BBN A;  3DVM A;  5AEQ A;  1WLM A;  1OMV A;  3KHE A;  1J7P A;  1FI5 A;  4MN0 A;  1D1O A;  1LVC D;  1OZS A;  1JFK A;  4JQ0 D;  2JT8 A;  4ORB B;  2JWW A;  1JC2 A;  1A75 B;  1KWO C;  2FCE A;  1KK8 C;  1QTX A;  1KFU L;  1PRW A;  3SJS A;  1XK4 C;  3LK0 A;  1SCM B;  1JWD A;  2Y5I A;  3EK4 A;  3OX6 A;  3VGO A;  1YTZ C;  2KI4 C;  1J1D A;  1XFX O;  1DF0 B;  1JF0 A;  3I5I B;  1MWN A;  4WQ2 A;  5IBW A;  2JNX A;  1ODB A;  1PUL A;  2LMU A;  3NXA A;  1F54 A;  3OB1 B;  4XJK A;  4MBE A;  3LCP C;  3SG3 A;  3JTD C;  1TIZ A;  3BUX B;  4QJ4 B;  1BMO A;  1NX2 A;  1U5I A;  2JTZ A;  4GBA A;  4OCI A;  1SBJ A;  3M0W A;  1KK7 Y;  2K2F A;  2LC5 A;  2MBX A;  2KOT A;  1N0Y A;  1KFX L;  1J1E A;  4WRI A;  3SG5 A;  3CR5 X;  3O6B A;  5CSI A;  3EKJ A;  2KHN A;  2MLF C;  3TUY C;  2EHB A;  2JPT A;  2KBI A;  2M1U A;  2ZN9 A;  4N5X A;  5AER A;  2ZN8 A;  1F70 A;  2RGI A;  1WDC C;  1IJ6 A;  4M2P A;  2E6W A;  2NCP A;  1XO5 A;  1ZMZ A;  1B9A A;  2JTT A;  1KQM B;  4HRE E;  4PE1 A;  4XJK B;  2LUX A;  3AKA A;  3I5F C;  2CTN A;  4QJ3 B;  2BL0 C;  1PSB A;  2BE4 A;  1M39 A;  4PHJ A;  1SRA A;  1FW4 A;  1YRU B;  2M29 A;  3ZWH A;  1NYA A;  2HPS A;  2JNF A;  2KFG A;  1CFD A;  2LE9 B;  2NXQ A;  3H4S E;  2PVB A;  2LP3 A;  2SCP A;  3CS1 A;  1DTL A;  1MXL C;  2L50 A;  5HKZ A;  4MZJ A;  1K2H A;  3GK1 A;  5CPV A;  1SR6 B;  5CSF A;  2Y4Q A;  1TN4 A;  3PAT A;  2FOT A;  4OKH A;  2WCE A;  2AUC A;  1Q80 A;  2BE6 A;  3HX4 A;  1SCM C;  3O2P A;  4GNK B;  3TZ1 A;  3AAK A;  1WRL A;  3EKH A;  1SPY A;  1CDP A;  2BCX A;  3BUM B;  1E8A A;  3BUW B;  2TN4 A;  3I5I C;  2BBM A;  1NIW A;  1K93 D;  3VRP A;  1Y6W A;  2KAV A;  1NCZ A;  1WLZ A;  1TOP A;  2VRG A;  4MRY A;  3GK4 X;  1B8R A;  2M7L A;  1IJ5 A;  1SCV A;  3JVT B;  2NCO A;  3WHT B;  1OSA A;  3VRR A;  1B1G A;  1PVA A;  1IQ5 A;  1UP5 A;  1TCF A;  1QJT A;  3AAJ A;  1KCY A;  4PHM A;  2EGD A;  4YGC B;  4JWQ A;  1MQ1 A;  3D0Y B;  2KGB C;  1BT6 A;  1QV1 A;  5K89 A;  1TNW A;  1ZFS A;  3DD4 A;  1GGW A;  3FIA A;  4A4C A;  2F8P A;  4MLW A;  1J7Q A;  2COL B;  1KQM C;  4U8D A;  1JFJ A;  2JU0 A;  4P5O E;  2HQ8 A;  1CKK A;  1K95 A;  1JF2 A;  1UHK A;  2M3W A;  1ZOT B;  1EG4 A;  1Y1U A;  2AAO A;  1AJ4 A;  2WCB A;  3VRO A;  1CDL A;  2O60 A;  1A29 A;  2KQY A;  2JXC A;  2ZRS A;  1MHO A;  1NSH A;  3OX5 A;  1UHJ A;  1CB1 A;  2CXJ A;  1MF8 B;  2KGR A;  4DIR A;  1R6P A;  5I2Q A;  1SR6 C;  2Q91 A;  1IG5 A;  1BG1 A;  5KU1 A;  1UUS A;  1M46 A;  1S36 A;  1BJF A;  3NSO A;  2JZI A;  3KO0 A;  1G33 A;  1F4Q A;  4PE0 A;  2PAS A;  4I5J A;  5D7F A;  1RRO A;  1BU3 A;  1CDM A;  3VRQ A;  3TDU A;  1OQP A;  1K90 D;  1DT7 B;  1XFW O;  2L51 A;  2NZ0 A;  2LVV A;  1NPQ A;  2LLS A;  1MR8 A;  4PHN A;  2KYC A;  1QV0 A;  5JJG A;  2GV5 A;  1S1E A;  3JVT C;  1GQM A;  1JUO A;  2H61 C;  2OTG B;  4XYN A;  5GQQ C;  1A4P A;  1K9K A;  2OS8 B;  3A8R A;  4ZCV A;  1MUX A;  4N1F A;  2GGM A;  1M63 B;  2WC8 A;  1A03 A;  4GGF A;  1V1G A;  3SG7 A;  2D8N A;  1TNX A;  3EK7 A;  4M2Q A;  1KK7 Z;  3DVE A;  1JSA A;  4NDC A;  4OV2 A;  1HQV A;  4C0J A;  1R2U A;  2M8U A;  2BKH B;  1YVH A;  1RFJ A;  3RM1 A;  4R1E A;  1CTR A;  4BY4 A;  1W7J B;  4YI9 A;  1CFC A;  1XA5 A;  1LA0 A;  2K7D A;  4YGE B;  3SIB A;  1JBA A;  3BOW A;  1MXE A;  2KNE A;  3E3R A;  3CTN A;  3LL8 B;  2KFF A;  2LVJ A;  1QS7 A;  2WCF A;  3BUN B;  1LXF C;  4I5K A;  1UUR A;  4ICB A;  1QAS A;  1QVI Z;  1AJ5 A;  1QIW A;  2K7C A;  2M49 B;  3CZT X;  1U5I B;  4Q04 A;  1SYM A;  1SL9 A;  2L98 A;  4ORC B;  2JT3 A;  1QXP A;  2R2I A;  4P2Y B;  1TNQ A;  1CNP A;  4PDZ A;  2BCB A;  2OPO A;  4DCK A;  1XFU O;  1EL4 A;  1QVI Y;  3I5G B;  3TDI A;  4I5N B;  1AK8 A;  1PVB A;  3BOW B;  2K61 A;  3WNX B;  2F3Z A;  4GUK A;  1ALW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...