2WCLA

Structure of bmori gobp2 (general odorant binding protein 2) with (8e, 10z)-hexadecadien-1-ol
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
141
structure length
141
Chain Sequence
TAEVMSHVTAHFGKTLEECREESGLSVDILDEFKHFWSDDFDVVHRELGCAIICMSNKFSLMDDDVRMHHVNMDEYIKSFPNGQVLAEKMVKLIHNCEKQFDTETDDCTRVVKVAACFKEDSRKEGIAPEVAMVEAVIEKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENERAL ODORANT-BINDING PROTEIN 1
publication title Characterisation of Bombyx Mori Odorant-Binding Proteins Reveals that a General Odorant-Binding Protein Discriminates between Sex Pheromone Components.
pubmed doi rcsb
source organism Bombyx mori
molecule tags Transport protein
total genus 52
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2wclA00
3B86A 3S0AA 1DQEA 3CYZA 2P71A 3NGVA 3DY9A 3D75A 1ORGA 3QMEA 3D73A 3DZTA 3L4LA 4F7FA 3L4AA 2P70A 3CDNA 2WCJA 3S0BA 1TWOA 3NHTA 3FE6A 3BFHA 3DXLA 3L47A 2QDIA 1QWVA 2WCLA 3D74A 3R72A 3RZSA 3S0FA 3FE8A 3N7HA 2QEOA 4PT1A 1TUJA 3CABA 4INXA 3VB1A 3NHIA 4FQTA 1GM0A 1OW4A 3CZ1A 5EL2A 3D78A 3BJHA 3CZ0A 3R1OA 3BFAA 2FJYA 1OOIX 4INWA 3DYEA 1OOGA 3CZ2A 3B88A 3D76A 3D77A 1LS8A 2KPHA 2L2CA 4JD9A 3K1EA 2QEVA 3S0EA 1T14A 3S0GA 2ERBA 3B87A 1XFRA 2PQLA 2WC5A 1C3YA 2WC6A 1OOHA 2QEHA 3V2LA 4OZDA 3B7AA 3B6XA 3BFBA 1P28A 2WCHA 2WCMA 3S0DA 2GTEA 3PJIA 2H8VA 2JPOA 3R1PA 3Q8IA 2WCKA 5DICA 3FE9A 1C3ZA 1OOFA 3OGNA 2QEBA 3R1VA
chains in the Genus database with same CATH superfamily
3B86A 5HKWA 4DCKA 1NX1A 1HQVA 4WQ2A 1PK0D 2WORA 3D0YB 3C1VA 3RM1A 3VGOA 4MVFA 3LK1A 1AUIB 2JULA 3TS5C 2JOJA 1ALWA 3D73A 1QX7A 3DVJA 2QACA 1NPQA 3DZTA 2H61C 4PHJA 5GQQC 2JQ6A 2F3YA 3AAJA 2CBLA 3CDNA 1TRFA 3RLZA 1KQMB 1UUSA 2BE6A 1BU3A 1FBVA 3BFHA 4CPVA 4DS7A 5I2OA 4ETOA 5I8NA 3PN7C 2QDIA 1K93D 1QWVA 3R72A 3RZSA 3DVKA 1XFVO 3VRNA 3NSOA 4QJ5B 3I5HC 1SNLA 1XFUO 3TUYC 2NLNA 3A8RA 4ORCB 2K8MB 3UNWA 4CFRA 5AANA 2PALA 2QEOA 1UURA 4PT1A 2K7OA 1RTP1 1TOPA 3PLFB 1JF2A 1YURA 4AQJA 1QATA 2KI4B 2HF5A 4JPZB 3EVVA 3I5GC 1NYAA 5PALA 2GGZA 1S6JA 2ZNDA 2FJUB 1XFWO 1JWDA 3FS7A 3NHIA 1OMDA 1IQ3A 2ZFDA 1F54A 1GM0A 2MA2A 3CS1A 1DELA 4E68A 1PVAA 2B1UA 5D7FA 3D78A 3BJHA 2OTGB 1UP5A 1JSAA 1CDLA 1MXEA 3BXKA 5ER5A 1XFZO 2KDHA 1QLKA 1TUZA 1SMGA 1OZSA 2BECA 1SL8A 3DYEA 3EK7A 4YGAA 3D0YA 1NX3A 1TTXA 3I5FB 3SS5A 1W7JB 1Y1UA 2KPHA 2LAPA 2JNXA 1G8IA 4KYNA 1Q80A 2K2FA 5HLVA 1DJGA 1AK8A 3AKBA 1IRJA 1PALA 1SSEB 3GK1A 4N1GA 1IWQA 2QEVA 3S0EA 4YRUA 3FWBA 2F8PA 2LANA 2LVKA 2M3WA 1IIOA 1R2UA 1DTLA 3BOWB 5IBWA 5FI7A 1BG1A 4MRYA 2HQWA 3S0GA 1FF1A 3SS3A 1EH2A 1XFRA 4CLNA 4YBHB 5HLOA 4A4BA 5HYDA 1OZOA 1IJ5A 2QEHA 5AERA 3PALA 1AP4A 4PALA 1QX5B 1F8HA 2KSPA 2CNPA 3PATA 2KBIA 1K94A 2JU0A 2BAPA 3O78A 5DKRA 2G2BA 2LLSA 1SR6B 1KQMC 4OR9B 1KFUS 1SBJA 3S0DA 1YUTA 1Z4HA 2LC5A 1CLBA 1V1GA 2KBMA 3FE9A 1CB1A 3TZ1A 2IS9A 1TCOB 1NX0A 4PHKA 1M63B 1SL7A 3VRPA 2F33A 1CM4A 4M2QA 3WHTB 1YX8A 1MF8B 1CLLA 3A4UB 3DVMA 3KHEA 1DJYA 2MBXA 2F2OA 1JFJA 2KFGA 2MAZA 4MZJA 5FI6A 4GGFA 3NGVA 1NUBA 3SIBA 3HCMA 1KK8B 5JOLA 2KAYA 1S36A 1KFUL 1YR5A 3JVTB 1DJHA 4ICBA 4GGNA 1RJVA 2LMVA 1S5GZ 3L4LA 3L4AA 2PYQA 1J1EA 1SCMC 2KI6D 2WCJA 1XYDA 1TNXA 1TWOA 2I7AA 3NHTA 5I2LA 1K9UA 5DKNA 3S0BA 4HREE 1JUOA 2KLDA 2M7NA 1J7OA 1YVLA 2NZ0A 3CLNA 3DXLA 3BOWA 3OBVA 2H61A 2PSRA 1QV0A 2JNFA 1BMOA 2WCLA 1H8BA 1GJYA 2KYCA 1JFKA 4YGEB 4C0JA 4D1EA 2K61A 3FE8A 2JTZA 3FWCA 1XA5A 1NCYA 2KQYA 5DKQA 2SCPA 3I5FC 1RECA 4L9MA 4YGDB 1LVCD 5FYXA 4IJ7A 2KOTA 1TUJA 2NCPA 2JT0A 1JBAA 2ISDA 4CIDA 1RFJA 1QS7A 2L98A 2EC6B 3E3RA 3SG7A 1S3PA 2L51A 4INXA 1B47A 1YUUA 2YGUA 5AEQA 3EK8A 2FOTA 1Y1XA 1WLZA 3OX6A 5HL1A 1WRKA 4Q04A 4YGBB 3BUWB 1OW4A 3CZ1A 1CFFA 2CT9A 1KWOB 1MHOA 1UHIA 3PFVA 4YI9A 2L4IA 3OX5A 2NCOA 1F55A 1N0YA 2LM5A 5BPJA 3TDZA 2BCAA 2GGMA 1V1FA 3R1OA 3BFAA 2PASA 1CFCA 1EL4A 4HRHA 1J7PA 1SR6C 1ALVA 5TNCA 1OOGA 2KHNA 5K89A 2EHBA 3PSRA 2OS8C 3BQ3A 2M97A 4ZCUA 1LS8A 4JD9A 3ZWHA 4R1EA 4MRXA 1L2OC 1PSRA 2BKHB 2JXCA 3K1EA 1RROA 2RGIA 2PMYA 1K9KA 1KK7Y 2FCEA 3EKHA 1BR1B 2I2RE 2LNKA 3CTNA 1OOJA 1K8UA 4PDZA 4JKTA 3VRQA 1C07A 2ERBA 4GPLB 3SJSA 2E30A 3OB2B 1SCMB 1SW8A 1QIVA 3B87A 1SL9A 2BL0B 3O2PA 4PHNA 3VROA 5I94A 1OOHA 3EG5B 1EJ3A 1KK8C 1WRZA 4ORAB 2WNDA 1B4CA 1CNPA 2F3ZA 3JVTC 1BJFA 3O4YA 4NDDA 1LA0A 4OZDA 2M9GA 2CTNA 1YRTB 2GV5A 4XJKB 1QJTA 4QJ4B 1CM1A 3CZTX 3NSIA 3VRRA 2BCXA 2K7BA 1XFYO 1OSAA 5D3OA 1F4QA 3BUOB 1SK6D 1Y6WA 2JRFA 1Z2CB 1K2HA 3IQOA 4N1FA 3DF0B 1S1EA 1YX7A 4M2PA 3LK0A 1B8LA 2M1UA 1GGZA 4M2OA 1NCXA 2WCFA 1QVIZ 1OOFA 4PE7A 1U5IB 1NCZA 2D8NA 2ZRSA 3OGNA 2KAVA 3R1VA 1DEKA 2JPTA 3S0AA 4GAOA 2M49B 4MEWA 2LMUA 1DQEA 1KFXL 3CYZA 2EC6C 1B7TZ 1UHKA 2BE4A 3DY9A 3D75A 1OMVA 4GUKA 1ODBA 4DIRA 1NWDA 1DJZA 1ORGA 4MZKA 1IJ6A 1L7ZA 1LA3A 3QMEA 4GBAA 1KCYA 2LP3A 4WRIA 1FW4A 1DJIA 1OE9B 1KWOC 1XVJA 2KFHA 2OS8B 2PRUA 2NXQA 2MLFC 2ZN9A 3FE6A 2HQ8A 5CPVA 1L2OB 3UO9A 1B8CA 1A29A 3D74A 3NSLA 4MZLA 1QIWA 2BNXA 3BUXB 3BYAA 5J3XA 2LE9B 3FIAA 3AKAA 2Y1MA 5ER4X 2LVVA 4PHMA 2M7LA 3SG6A 1DGVA 1DT7B 1IG5A 1N2DA 1A75B 3KO0A 3N7HA 1IH0A 1DJXA 2JC2A 2JT3A 1BOCA 1PSBA 2O60A 1K96A 3F45A 2LVJA 4XJKA 4AQIA 1GGWA 1A4PA 4U8DA 2BKIB 1QLSA 1ZFSA 2A4JA 2O5GA 1RWYA 1XFXO 2AUCA 3O6BA 2PVBA 1M46A 4BY5A 4ZCVA 5HKZA 1NX2A 1ZMZA 1IGVA 2BL0C 4YI8A 5EL2A 2BBMA 1XK4C 2WCEA 1F70A 1JF0A 4YGCB 2Q91A 2FCDA 5G08A 5D69A 1WRLA 4BY4A 1EG4A 3PM2A 1CFPA 1YVHA 4MN0A 2K60A 1TNPA 2L0PA 2FJYA 2KYFA 1DVIA 1MWNA 3LLEA 1OOIX 4P2YB 5CSIA 3EVRA 1CKKA 2LHIA 1BF5A 2L4HA 1K90D 2M29A 1X02A 2LVIA 3K21A 1W9ZA 1F4OA 2L5YA 1KSOA 3B88A 1GQMA 3CZ2A 3D77A 3TDUA 2JT8A 1WLMA 1H4BA 2L2CA 2WOSA 1UWOA 2R2IA 1PULA 1SCVA 1S5GY 2VRGA 3GOFA 3WHUB 4OKHA 1KSMA 4PE1A 5KU1A 1AJ5A 3CR4X 2KAXA 1TNWA 2JTTA 1B8RA 1TIZA 2F2PA 1SY9A 2COLB 2G9BA 3TDIA 1DC1A 1JC2A 2KGBC 2PQLA 1G4YR 1QV1A 2LLUA 2WC5A 2WC6A 5AFPA 1C3YA 1QX2A 2M8UA 1C7WA 1CMGA 2L2EA 4NDBA 1A2XA 2KGRA 5I2QA 3SG5A 4WQ3A 1A75A 1HT9A 1F71A 2I18A 2K7CA 3B7AA 1TCFA 3WNXB 1BR4B 1ZOTB 5HKYA 2LMTA 1M45A 3B6XA 1KK7Z 2WCMA 1UHNA 3CWGA 2ZN8A 2CXJA 1TN4A 2H8VA 2LUXA 2MJWB 3PJIA 4HRGA 3MSEB 1IQ5A 2WCKA 5DICA 2KI6C 3SG2A 3EK4A 2LLTA 5F6TA 1S6CA 5CSNA 4QJ3B 1YRUB 1IKUA 3CR5X 3SIAA 1W7IB 1FI6A 1R6PA 4GFTA 1UHJA 3GK2A 1G33A 2EGDA 1CDPA 3CR2A 1C3ZA 4ORBB 2BCBA 1K95A 3QRXA 1KQVA 3NSKA 3SS4A 1DGUA 1RK9A 2K2AA 4PE0A 1E8AA 3JTDB 2L50A 4I5LB 2P71A 3IF7A 3D10A 1N65A 1QASA 1ZUZA 5CSFA 3LCPC 4C0LA 1BLQA 1KFXS 1J7RA 1QXPA 3PM8A 1LXFC 1VRKA 4F7FA 2LUCA 1C7VA 2BBNA 2P70A 2AAOA 2MLEC 1DF0B 3I5IB 1J7QA 3IQQA 4OV2A 1B9AA 3H4SE 1MQ1A 5CSJA 1CDNA 2M0RA 3L47A 2WCBA 2QPTA 2JZIA 4OCIA 1CFDA 1A03A 4F0ZB 4P5OE 1QTXA 1YUSA 3BUMB 3S0FA 5JJGA 2K0JA 1EG3A 1DMOA 4PE4A 3M0WA 2M1KB 4FTGA 2E6WA 4UPGA 1WDCB 2QEBA 3DVEA 3ZNIA 1AVSA 1OMRA 5KSZA 2Y5IA 1J55A 3CABA 3IVTA 3OHMB 1TNQA 1NSHA 2SASA 3OP0A 2KNEA 3OB1B 3VB1A 2K7DA 1LINA 3TS5B 3DD4A 3AAKA 1OQPA 4CFQA 4FQTA 5AXIA 1S6IA 4USLA 2HETA 1AHRA 2I94A 1MUXA 3EVUA 4MLWA 3KF9A 1Y0VH 2ZRTA 4IL1A 4XYNA 1AJ4A 3BUNB 2JWWA 1Y1AA 1BODA 1MXLC 3CZ0A 1B1GA 1QVIY 3PN7B 4PCWA 1SKTA 1XK4A 2KQ6A 1PRWA 4DRWA 1PVBA 4INWA 3GK4X 2P6BB 4MBEA 4N5XA 3I5HB 3TUYB 1S26D 3HX4A 1LKJA 1B7TY 2Q4UA 2TN4A 5B8IB 3D76A 4I5NB 1UHHA 3CGAA 1D1OA 1XO5A 1SYMA 4FQOA 2JXLA 2Y1NA 4I5KA 2CCMA 1M31A 1T14A 1CTRA 3I5GB 1FPWA 4A4CA 4GNKB 1DJWA 3NXAA 1DF0A 3DF0A 1FI5A 3KEVA 2LHLA 4AOMA 1M39A 1CMFA 3KPXA 3JTDC 2MHHA 4OVNF 4TNCA 2KFFA 2Y4QA 3SG4A 4MSPA 1CLMA 1U5IA 4JQ0D 3WXAA 2KI4C 2LCPA 3V2LA 1J1DA 1WY9A 1ZACA 2DOQA 2OPOA 4NQGA 2LP2A 4DUQA 2H2KA 3BFBA 1EXRA 4I5JA 1K9PA 1MR8A 1P28A 2HPSA 2WCHA 3I5IC 3O4XA 1YTZC 1SRAA 2GTEA 4HSZA 1NIWA 2JPOA 2L5XB 3EKJA 3R1PA 2OTGC 5KTYA 3Q8IA 1CDMA 2MRDA 2V53A 3SG3A 2WC8A 2ZKMX 5FI2A 2AMIA 4JWQA 2KLEA 1BT6A 4GGFC 2ZNEA 3LL8B 4C0KA 4NDCA 2LV7A 1SPYA 3ICBA 1WDCC 1NP8A
chains in the Genus database with same CATH topology
3B86A 3S0AA 1DQEA 3CYZA 2P71A 3NGVA 3DY9A 3D75A 1ORGA 3QMEA 3D73A 3DZTA 3L4LA 4F7FA 3L4AA 2P70A 3CDNA 2WCJA 3S0BA 1TWOA 3NHTA 3FE6A 3BFHA 3DXLA 3L47A 2QDIA 1QWVA 2WCLA 3D74A 3R72A 3RZSA 3S0FA 3FE8A 3N7HA 2QEOA 4PT1A 1TUJA 3CABA 4INXA 3VB1A 3NHIA 4FQTA 1GM0A 1OW4A 3CZ1A 5EL2A 3D78A 3BJHA 3CZ0A 3R1OA 3BFAA 2FJYA 1OOIX 4INWA 3DYEA 1OOGA 3CZ2A 3B88A 3D76A 3D77A 1LS8A 2KPHA 2L2CA 4JD9A 3K1EA 2QEVA 3S0EA 1T14A 3S0GA 2ERBA 3B87A 1XFRA 2PQLA 2WC5A 1C3YA 2WC6A 1OOHA 2QEHA 3V2LA 4OZDA 3B7AA 3B6XA 3BFBA 1P28A 2WCHA 2WCMA 3S0DA 2GTEA 3PJIA 2H8VA 2JPOA 3R1PA 3Q8IA 2WCKA 5DICA 3FE9A 1C3ZA 1OOFA 3OGNA 2QEBA 3R1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B86 A;  3S0A A;  1DQE A;  3CYZ A;  2P71 A;  3NGV A;  3DY9 A;  3D75 A;  1ORG A;  3QME A;  3D73 A;  3DZT A;  3L4L A;  4F7F A;  3L4A A;  2P70 A;  3CDN A;  2WCJ A;  3S0B A;  1TWO A;  3NHT A;  3FE6 A;  3BFH A;  3DXL A;  3L47 A;  2QDI A;  1QWV A;  2WCL A;  3D74 A;  3R72 A;  3RZS A;  3S0F A;  3FE8 A;  3N7H A;  2QEO A;  4PT1 A;  1TUJ A;  3CAB A;  4INX A;  3VB1 A;  3NHI A;  4FQT A;  1GM0 A;  1OW4 A;  3CZ1 A;  5EL2 A;  3D78 A;  3BJH A;  3CZ0 A;  3R1O A;  3BFA A;  2FJY A;  1OOI X;  4INW A;  3DYE A;  1OOG A;  3CZ2 A;  3B88 A;  3D76 A;  3D77 A;  1LS8 A;  2KPH A;  2L2C A;  4JD9 A;  3K1E A;  2QEV A;  3S0E A;  1T14 A;  3S0G A;  2ERB A;  3B87 A;  1XFR A;  2PQL A;  2WC5 A;  1C3Y A;  2WC6 A;  1OOH A;  2QEH A;  3V2L A;  4OZD A;  3B7A A;  3B6X A;  3BFB A;  1P28 A;  2WCH A;  2WCM A;  3S0D A;  2GTE A;  3PJI A;  2H8V A;  2JPO A;  3R1P A;  3Q8I A;  2WCK A;  5DIC A;  3FE9 A;  1C3Z A;  1OOF A;  3OGN A;  2QEB A;  3R1V A; 
#chains in the Genus database with same CATH topology
 3B86 A;  5HKW A;  4DCK A;  1NX1 A;  1HQV A;  4WQ2 A;  1PK0 D;  2WOR A;  3D0Y B;  3C1V A;  3RM1 A;  3VGO A;  4MVF A;  3LK1 A;  1AUI B;  2JUL A;  3TS5 C;  2JOJ A;  1ALW A;  3D73 A;  1QX7 A;  3DVJ A;  2QAC A;  1NPQ A;  3DZT A;  2H61 C;  4PHJ A;  5GQQ C;  2JQ6 A;  2F3Y A;  3AAJ A;  2CBL A;  3CDN A;  1TRF A;  3RLZ A;  1KQM B;  1UUS A;  2BE6 A;  1BU3 A;  1FBV A;  3BFH A;  4CPV A;  4DS7 A;  5I2O A;  4ETO A;  5I8N A;  3PN7 C;  2QDI A;  1K93 D;  1QWV A;  3R72 A;  3RZS A;  3DVK A;  1XFV O;  3VRN A;  3NSO A;  4QJ5 B;  3I5H C;  1SNL A;  1XFU O;  3TUY C;  2NLN A;  3A8R A;  4ORC B;  2K8M B;  3UNW A;  4CFR A;  5AAN A;  2PAL A;  2QEO A;  1UUR A;  4PT1 A;  2K7O A;  1RTP 1;  1TOP A;  3PLF B;  1JF2 A;  1YUR A;  4AQJ A;  1QAT A;  2KI4 B;  2HF5 A;  4JPZ B;  3EVV A;  3I5G C;  1NYA A;  5PAL A;  2GGZ A;  1S6J A;  2ZND A;  2FJU B;  1XFW O;  1JWD A;  3FS7 A;  3NHI A;  1OMD A;  1IQ3 A;  2ZFD A;  1F54 A;  1GM0 A;  2MA2 A;  3CS1 A;  1DEL A;  4E68 A;  1PVA A;  2B1U A;  5D7F A;  3D78 A;  3BJH A;  2OTG B;  1UP5 A;  1JSA A;  1CDL A;  1MXE A;  3BXK A;  5ER5 A;  1XFZ O;  2KDH A;  1QLK A;  1TUZ A;  1SMG A;  1OZS A;  2BEC A;  1SL8 A;  3DYE A;  3EK7 A;  4YGA A;  3D0Y A;  1NX3 A;  1TTX A;  3I5F B;  3SS5 A;  1W7J B;  1Y1U A;  2KPH A;  2LAP A;  2JNX A;  1G8I A;  4KYN A;  1Q80 A;  2K2F A;  5HLV A;  1DJG A;  1AK8 A;  3AKB A;  1IRJ A;  1PAL A;  1SSE B;  3GK1 A;  4N1G A;  1IWQ A;  2QEV A;  3S0E A;  4YRU A;  3FWB A;  2F8P A;  2LAN A;  2LVK A;  2M3W A;  1IIO A;  1R2U A;  1DTL A;  3BOW B;  5IBW A;  5FI7 A;  1BG1 A;  4MRY A;  2HQW A;  3S0G A;  1FF1 A;  3SS3 A;  1EH2 A;  1XFR A;  4CLN A;  4YBH B;  5HLO A;  4A4B A;  5HYD A;  1OZO A;  1IJ5 A;  2QEH A;  5AER A;  3PAL A;  1AP4 A;  4PAL A;  1QX5 B;  1F8H A;  2KSP A;  2CNP A;  3PAT A;  2KBI A;  1K94 A;  2JU0 A;  2BAP A;  3O78 A;  5DKR A;  2G2B A;  2LLS A;  1SR6 B;  1KQM C;  4OR9 B;  1KFU S;  1SBJ A;  3S0D A;  1YUT A;  1Z4H A;  2LC5 A;  1CLB A;  1V1G A;  2KBM A;  3FE9 A;  1CB1 A;  3TZ1 A;  2IS9 A;  1TCO B;  1NX0 A;  4PHK A;  1M63 B;  1SL7 A;  3VRP A;  2F33 A;  1CM4 A;  4M2Q A;  3WHT B;  1YX8 A;  1MF8 B;  1CLL A;  3A4U B;  3DVM A;  3KHE A;  1DJY A;  2MBX A;  2F2O A;  1JFJ A;  2KFG A;  2MAZ A;  4MZJ A;  5FI6 A;  4GGF A;  3NGV A;  1NUB A;  3SIB A;  3HCM A;  1KK8 B;  5JOL A;  2KAY A;  1S36 A;  1KFU L;  1YR5 A;  3JVT B;  1DJH A;  4ICB A;  4GGN A;  1RJV A;  2LMV A;  1S5G Z;  3L4L A;  3L4A A;  2PYQ A;  1J1E A;  1SCM C;  2KI6 D;  2WCJ A;  1XYD A;  1TNX A;  1TWO A;  2I7A A;  3NHT A;  5I2L A;  1K9U A;  5DKN A;  3S0B A;  4HRE E;  1JUO A;  2KLD A;  2M7N A;  1J7O A;  1YVL A;  2NZ0 A;  3CLN A;  3DXL A;  3BOW A;  3OBV A;  2H61 A;  2PSR A;  1QV0 A;  2JNF A;  1BMO A;  2WCL A;  1H8B A;  1GJY A;  2KYC A;  1JFK A;  4YGE B;  4C0J A;  4D1E A;  2K61 A;  3FE8 A;  2JTZ A;  3FWC A;  1XA5 A;  1NCY A;  2KQY A;  5DKQ A;  2SCP A;  3I5F C;  1REC A;  4L9M A;  4YGD B;  1LVC D;  5FYX A;  4IJ7 A;  2KOT A;  1TUJ A;  2NCP A;  2JT0 A;  1JBA A;  2ISD A;  4CID A;  1RFJ A;  1QS7 A;  2L98 A;  2EC6 B;  3E3R A;  3SG7 A;  1S3P A;  2L51 A;  4INX A;  1B47 A;  1YUU A;  2YGU A;  5AEQ A;  3EK8 A;  2FOT A;  1Y1X A;  1WLZ A;  3OX6 A;  5HL1 A;  1WRK A;  4Q04 A;  4YGB B;  3BUW B;  1OW4 A;  3CZ1 A;  1CFF A;  2CT9 A;  1KWO B;  1MHO A;  1UHI A;  3PFV A;  4YI9 A;  2L4I A;  3OX5 A;  2NCO A;  1F55 A;  1N0Y A;  2LM5 A;  5BPJ A;  3TDZ A;  2BCA A;  2GGM A;  1V1F A;  3R1O A;  3BFA A;  2PAS A;  1CFC A;  1EL4 A;  4HRH A;  1J7P A;  1SR6 C;  1ALV A;  5TNC A;  1OOG A;  2KHN A;  5K89 A;  2EHB A;  3PSR A;  2OS8 C;  3BQ3 A;  2M97 A;  4ZCU A;  1LS8 A;  4JD9 A;  3ZWH A;  4R1E A;  4MRX A;  1L2O C;  1PSR A;  2BKH B;  2JXC A;  3K1E A;  1RRO A;  2RGI A;  2PMY A;  1K9K A;  1KK7 Y;  2FCE A;  3EKH A;  1BR1 B;  2I2R E;  2LNK A;  3CTN A;  1OOJ A;  1K8U A;  4PDZ A;  4JKT A;  3VRQ A;  1C07 A;  2ERB A;  4GPL B;  3SJS A;  2E30 A;  3OB2 B;  1SCM B;  1SW8 A;  1QIV A;  3B87 A;  1SL9 A;  2BL0 B;  3O2P A;  4PHN A;  3VRO A;  5I94 A;  1OOH A;  3EG5 B;  1EJ3 A;  1KK8 C;  1WRZ A;  4ORA B;  2WND A;  1B4C A;  1CNP A;  2F3Z A;  3JVT C;  1BJF A;  3O4Y A;  4NDD A;  1LA0 A;  4OZD A;  2M9G A;  2CTN A;  1YRT B;  2GV5 A;  4XJK B;  1QJT A;  4QJ4 B;  1CM1 A;  3CZT X;  3NSI A;  3VRR A;  2BCX A;  2K7B A;  1XFY O;  1OSA A;  5D3O A;  1F4Q A;  3BUO B;  1SK6 D;  1Y6W A;  2JRF A;  1Z2C B;  1K2H A;  3IQO A;  4N1F A;  3DF0 B;  1S1E A;  1YX7 A;  4M2P A;  3LK0 A;  1B8L A;  2M1U A;  1GGZ A;  4M2O A;  1NCX A;  2WCF A;  1QVI Z;  1OOF A;  4PE7 A;  1U5I B;  1NCZ A;  2D8N A;  2ZRS A;  3OGN A;  2KAV A;  3R1V A;  1DEK A;  2JPT A;  3S0A A;  4GAO A;  2M49 B;  4MEW A;  2LMU A;  1DQE A;  1KFX L;  3CYZ A;  2EC6 C;  1B7T Z;  1UHK A;  2BE4 A;  3DY9 A;  3D75 A;  1OMV A;  4GUK A;  1ODB A;  4DIR A;  1NWD A;  1DJZ A;  1ORG A;  4MZK A;  1IJ6 A;  1L7Z A;  1LA3 A;  3QME A;  4GBA A;  1KCY A;  2LP3 A;  4WRI A;  1FW4 A;  1DJI A;  1OE9 B;  1KWO C;  1XVJ A;  2KFH A;  2OS8 B;  2PRU A;  2NXQ A;  2MLF C;  2ZN9 A;  3FE6 A;  2HQ8 A;  5CPV A;  1L2O B;  3UO9 A;  1B8C A;  1A29 A;  3D74 A;  3NSL A;  4MZL A;  1QIW A;  2BNX A;  3BUX B;  3BYA A;  5J3X A;  2LE9 B;  3FIA A;  3AKA A;  2Y1M A;  5ER4 X;  2LVV A;  4PHM A;  2M7L A;  3SG6 A;  1DGV A;  1DT7 B;  1IG5 A;  1N2D A;  1A75 B;  3KO0 A;  3N7H A;  1IH0 A;  1DJX A;  2JC2 A;  2JT3 A;  1BOC A;  1PSB A;  2O60 A;  1K96 A;  3F45 A;  2LVJ A;  4XJK A;  4AQI A;  1GGW A;  1A4P A;  4U8D A;  2BKI B;  1QLS A;  1ZFS A;  2A4J A;  2O5G A;  1RWY A;  1XFX O;  2AUC A;  3O6B A;  2PVB A;  1M46 A;  4BY5 A;  4ZCV A;  5HKZ A;  1NX2 A;  1ZMZ A;  1IGV A;  2BL0 C;  4YI8 A;  5EL2 A;  2BBM A;  1XK4 C;  2WCE A;  1F70 A;  1JF0 A;  4YGC B;  2Q91 A;  2FCD A;  5G08 A;  5D69 A;  1WRL A;  4BY4 A;  1EG4 A;  3PM2 A;  1CFP A;  1YVH A;  4MN0 A;  2K60 A;  1TNP A;  2L0P A;  2FJY A;  2KYF A;  1DVI A;  1MWN A;  3LLE A;  1OOI X;  4P2Y B;  5CSI A;  3EVR A;  1CKK A;  2LHI A;  1BF5 A;  2L4H A;  1K90 D;  2M29 A;  1X02 A;  2LVI A;  3K21 A;  1W9Z A;  1F4O A;  2L5Y A;  1KSO A;  3B88 A;  1GQM A;  3CZ2 A;  3D77 A;  3TDU A;  2JT8 A;  1WLM A;  1H4B A;  2L2C A;  2WOS A;  1UWO A;  2R2I A;  1PUL A;  1SCV A;  1S5G Y;  2VRG A;  3GOF A;  3WHU B;  4OKH A;  1KSM A;  4PE1 A;  5KU1 A;  1AJ5 A;  3CR4 X;  2KAX A;  1TNW A;  2JTT A;  1B8R A;  1TIZ A;  2F2P A;  1SY9 A;  2COL B;  2G9B A;  3TDI A;  1DC1 A;  1JC2 A;  2KGB C;  2PQL A;  1G4Y R;  1QV1 A;  2LLU A;  2WC5 A;  2WC6 A;  5AFP A;  1C3Y A;  1QX2 A;  2M8U A;  1C7W A;  1CMG A;  2L2E A;  4NDB A;  1A2X A;  2KGR A;  5I2Q A;  3SG5 A;  4WQ3 A;  1A75 A;  1HT9 A;  1F71 A;  2I18 A;  2K7C A;  3B7A A;  1TCF A;  3WNX B;  1BR4 B;  1ZOT B;  5HKY A;  2LMT A;  1M45 A;  3B6X A;  1KK7 Z;  2WCM A;  1UHN A;  3CWG A;  2ZN8 A;  2CXJ A;  1TN4 A;  2H8V A;  2LUX A;  2MJW B;  3PJI A;  4HRG A;  3MSE B;  1IQ5 A;  2WCK A;  5DIC A;  2KI6 C;  3SG2 A;  3EK4 A;  2LLT A;  5F6T A;  1S6C A;  5CSN A;  4QJ3 B;  1YRU B;  1IKU A;  3CR5 X;  3SIA A;  1W7I B;  1FI6 A;  1R6P A;  4GFT A;  1UHJ A;  3GK2 A;  1G33 A;  2EGD A;  1CDP A;  3CR2 A;  1C3Z A;  4ORB B;  2BCB A;  1K95 A;  3QRX A;  1KQV A;  3NSK A;  3SS4 A;  1DGU A;  1RK9 A;  2K2A A;  4PE0 A;  1E8A A;  3JTD B;  2L50 A;  4I5L B;  2P71 A;  3IF7 A;  3D10 A;  1N65 A;  1QAS A;  1ZUZ A;  5CSF A;  3LCP C;  4C0L A;  1BLQ A;  1KFX S;  1J7R A;  1QXP A;  3PM8 A;  1LXF C;  1VRK A;  4F7F A;  2LUC A;  1C7V A;  2BBN A;  2P70 A;  2AAO A;  2MLE C;  1DF0 B;  3I5I B;  1J7Q A;  3IQQ A;  4OV2 A;  1B9A A;  3H4S E;  1MQ1 A;  5CSJ A;  1CDN A;  2M0R A;  3L47 A;  2WCB A;  2QPT A;  2JZI A;  4OCI A;  1CFD A;  1A03 A;  4F0Z B;  4P5O E;  1QTX A;  1YUS A;  3BUM B;  3S0F A;  5JJG A;  2K0J A;  1EG3 A;  1DMO A;  4PE4 A;  3M0W A;  2M1K B;  4FTG A;  2E6W A;  4UPG A;  1WDC B;  2QEB A;  3DVE A;  3ZNI A;  1AVS A;  1OMR A;  5KSZ A;  2Y5I A;  1J55 A;  3CAB A;  3IVT A;  3OHM B;  1TNQ A;  1NSH A;  2SAS A;  3OP0 A;  2KNE A;  3OB1 B;  3VB1 A;  2K7D A;  1LIN A;  3TS5 B;  3DD4 A;  3AAK A;  1OQP A;  4CFQ A;  4FQT A;  5AXI A;  1S6I A;  4USL A;  2HET A;  1AHR A;  2I94 A;  1MUX A;  3EVU A;  4MLW A;  3KF9 A;  1Y0V H;  2ZRT A;  4IL1 A;  4XYN A;  1AJ4 A;  3BUN B;  2JWW A;  1Y1A A;  1BOD A;  1MXL C;  3CZ0 A;  1B1G A;  1QVI Y;  3PN7 B;  4PCW A;  1SKT A;  1XK4 A;  2KQ6 A;  1PRW A;  4DRW A;  1PVB A;  4INW A;  3GK4 X;  2P6B B;  4MBE A;  4N5X A;  3I5H B;  3TUY B;  1S26 D;  3HX4 A;  1LKJ A;  1B7T Y;  2Q4U A;  2TN4 A;  5B8I B;  3D76 A;  4I5N B;  1UHH A;  3CGA A;  1D1O A;  1XO5 A;  1SYM A;  4FQO A;  2JXL A;  2Y1N A;  4I5K A;  2CCM A;  1M31 A;  1T14 A;  1CTR A;  3I5G B;  1FPW A;  4A4C A;  4GNK B;  1DJW A;  3NXA A;  1DF0 A;  3DF0 A;  1FI5 A;  3KEV A;  2LHL A;  4AOM A;  1M39 A;  1CMF A;  3KPX A;  3JTD C;  2MHH A;  4OVN F;  4TNC A;  2KFF A;  2Y4Q A;  3SG4 A;  4MSP A;  1CLM A;  1U5I A;  4JQ0 D;  3WXA A;  2KI4 C;  2LCP A;  3V2L A;  1J1D A;  1WY9 A;  1ZAC A;  2DOQ A;  2OPO A;  4NQG A;  2LP2 A;  4DUQ A;  2H2K A;  3BFB A;  1EXR A;  4I5J A;  1K9P A;  1MR8 A;  1P28 A;  2HPS A;  2WCH A;  3I5I C;  3O4X A;  1YTZ C;  1SRA A;  2GTE A;  4HSZ A;  1NIW A;  2JPO A;  2L5X B;  3EKJ A;  3R1P A;  2OTG C;  5KTY A;  3Q8I A;  1CDM A;  2MRD A;  2V53 A;  3SG3 A;  2WC8 A;  2ZKM X;  5FI2 A;  2AMI A;  4JWQ A;  2KLE A;  1BT6 A;  4GGF C;  2ZNE A;  3LL8 B;  4C0K A;  4NDC A;  2LV7 A;  1SPY A;  3ICB A;  1WDC C;  1NP8 A; 
#chains in the Genus database with same CATH homology
 3B86 A;  3S0A A;  1DQE A;  3CYZ A;  2P71 A;  3NGV A;  3DY9 A;  3D75 A;  1ORG A;  3QME A;  3D73 A;  3DZT A;  3L4L A;  4F7F A;  3L4A A;  2P70 A;  3CDN A;  2WCJ A;  3S0B A;  1TWO A;  3NHT A;  3FE6 A;  3BFH A;  3DXL A;  3L47 A;  2QDI A;  1QWV A;  2WCL A;  3D74 A;  3R72 A;  3RZS A;  3S0F A;  3FE8 A;  3N7H A;  2QEO A;  4PT1 A;  1TUJ A;  3CAB A;  4INX A;  3VB1 A;  3NHI A;  4FQT A;  1GM0 A;  1OW4 A;  3CZ1 A;  5EL2 A;  3D78 A;  3BJH A;  3CZ0 A;  3R1O A;  3BFA A;  2FJY A;  1OOI X;  4INW A;  3DYE A;  1OOG A;  3CZ2 A;  3B88 A;  3D76 A;  3D77 A;  1LS8 A;  2KPH A;  2L2C A;  4JD9 A;  3K1E A;  2QEV A;  3S0E A;  1T14 A;  3S0G A;  2ERB A;  3B87 A;  1XFR A;  2PQL A;  2WC5 A;  1C3Y A;  2WC6 A;  1OOH A;  2QEH A;  3V2L A;  4OZD A;  3B7A A;  3B6X A;  3BFB A;  1P28 A;  2WCH A;  2WCM A;  3S0D A;  2GTE A;  3PJI A;  2H8V A;  2JPO A;  3R1P A;  3Q8I A;  2WCK A;  5DIC A;  3FE9 A;  1C3Z A;  1OOF A;  3OGN A;  2QEB A;  3R1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...