2WCLA

Structure of bmori gobp2 (general odorant binding protein 2) with (8e, 10z)-hexadecadien-1-ol
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
141
structure length
141
Chain Sequence
TAEVMSHVTAHFGKTLEECREESGLSVDILDEFKHFWSDDFDVVHRELGCAIICMSNKFSLMDDDVRMHHVNMDEYIKSFPNGQVLAEKMVKLIHNCEKQFDTETDDCTRVVKVAACFKEDSRKEGIAPEVAMVEAVIEKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords GENERAL ODORANT-BINDING PROTEIN 1
publication title Characterisation of Bombyx Mori Odorant-Binding Proteins Reveals that a General Odorant-Binding Protein Discriminates between Sex Pheromone Components.
pubmed doi rcsb
source organism Bombyx mori
total genus 52
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2wclA00
1XFRA 2WCJA 3VB1A 3D76A 2PQLA 3BFBA 1OOIX 3CZ1A 3R1VA 2WCKA 3S0BA 3BFAA 2WC5A 2L2CA 1OW4A 3D77A 2QEHA 1TWOA 2GTEA 2KPHA 2QEVA 3CZ0A 3NHTA 1TUJA 3BJHA 2QEOA 3PJIA 3QMEA 3R1PA 1P28A 3DZTA 2JPOA 4JD9A 2ERBA 3Q8IA 3K1EA 3V2LA 3FE8A 3CDNA 2QDIA 2WCMA 3S0AA 2WCLA 1LS8A 1OOHA 3L47A 3BFHA 1C3YA 3L4AA 5EL2A 3S0GA 3FE9A 4INWA 1ORGA 3S0EA 3B86A 1T14A 3OGNA 2WCHA 2WC6A 3RZSA 3N7HA 3B87A 3DXLA 3CABA 3NGVA 3S0FA 3DYEA 3NHIA 3CZ2A 3D78A 1QWVA 3S0DA 3D75A 1C3ZA 3B88A 4F7FA 3R72A 2H8VA 4FQTA 2P70A 3D73A 3D74A 3DY9A 3R1OA 2FJYA 1OOGA 3FE6A 1OOFA 1DQEA 3CYZA 4INXA 3L4LA 2QEBA 3B6XA 3B7AA 2P71A 5DICA 4PT1A 4OZDA 1GM0A
chains in the Genus database with same CATH superfamily
1E8AA 1DJHA 3VROA 2M29A 3AAKA 1M39A 3OB2B 3EVVA 3LK0A 2ZNEA 2WCJA 3OX5A 1NX0A 1B8CA 2PQLA 2SCPA 4GFTA 3KF9A 4YI8A 1W7JB 2LMTA 3SS5A 4KYNA 2WORA 2KDHA 3S0BA 1BG1A 1BOCA 1UHHA 4GGNA 4HREE 4QJ3B 1TNQA 1WDCB 2L2EA 1C7VA 1IIOA 1K9KA 5HYDA 1PSBA 4MZKA 5CSFA 4JWQA 2WC8A 2K0JA 1WLZA 2L51A 3EK7A 1TUJA 2ZRSA 2ZRTA 4JQ0D 1RK9A 2KNEA 1QX7A 1CTRA 2LVJA 1QATA 2QEOA 3QMEA 3NXAA 4NDBA 1AUIB 1IQ3A 1Y1XA 3EG5B 3R1PA 1RROA 5K89A 1YTZC 2H61C 4JD9A 2ERBA 1CDMA 2PVBA 3OB1B 2JQ6A 2K7OA 1CDNA 5CSJA 3KHEA 4XJKA 2LCPA 1SCVA 1XFWO 5FI6A 5HKWA 1B1GA 2Y1MA 2KLDA 4OCIA 1DJIA 2BL0C 3O4YA 1IGVA 4P2YB 3ICBA 1SK6D 1B47A 2KGRA 1W9ZA 2YGUA 2I7AA 4GPLB 2Y4QA 3D0YB 4MN0A 1LS8A 2QACA 1K94A 1OOHA 2JXLA 2VRGA 4XJKB 4E68A 1A29A 3L47A 5DKNA 5G08A 1QXPA 2F3ZA 2NLNA 1ALVA 4CIDA 2K61A 5GQQC 2LV7A 1ZOTB 1DJZA 4OKHA 3SG6A 2AUCA 3BQ3A 3GK1A 1DEKA 3EK8A 1FF1A 2LC5A 1J1EA 2KBIA 2WCBA 3TDZA 5HLVA 1PRWA 5FI2A 1QJTA 2LP2A 2LLUA 4GGFA 5TNCA 3TUYB 2GGZA 3GK4X 1SL7A 4N5XA 1JC2A 1SPYA 3EVRA 1S3PA 4PALA 1TN4A 1IWQA 1QIWA 1XFUO 1A2XA 2M7NA 3DVJA 2AAOA 3SIAA 2NXQA 4PE7A 4DIRA 3HX4A 2HETA 4UPGA 1SR6B 1F71A 1MF8B 4BY5A 1OE9B 1F54A 1K95A 2L5YA 2L0PA 3CABA 2P6BB 2JC2A 1BF5A 3DYEA 1XK4A 2EHBA 5I2QA 3I5IC 1PULA 2K7CA 3I5HC 4JPZB 2Q4UA 1A75A 4C0LA 1UURA 1X02A 2E6WA 4F0ZB 3I5GC 4OVNF 2PSRA 1FI6A 3D73A 2LUCA 2WCEA 1BLQA 1F4QA 2ZNDA 3M0WA 1RFJA 1A03A 3BUWB 4R1EA 2LAPA 3VGOA 1S5GZ 3FE6A 1A75B 5JJGA 1QLSA 1CFCA 2PRUA 2KFHA 1CFPA 3B6XA 1DF0A 1IJ6A 2LLTA 1MR8A 2GV5A 2KBMA 5DICA 2SASA 2V53A 2MBXA 4CFQA 2E30A 1DJXA 2ZKMX 5I94A 4MBEA 3DVEA 3OHMB 1KWOB 4YI9A 1S26D 2HQ8A 1Z2CB 3GOFA 4WQ3A 4ETOA 1DF0B 3DD4A 3IVTA 3BFBA 3LK1A 1KK7Z 1GJYA 3CZ1A 3R1VA 4PDZA 1IH0A 2ZFDA 3OBVA 4GBAA 1SNLA 1XA5A 2LLSA 4HRHA 2QEHA 3WXAA 3E3RA 3EKHA 1DMOA 3RLZA 1AHRA 2GTEA 1QV1A 3SG2A 2KPHA 1UUSA 1K9UA 2PASA 5BPJA 1OQPA 2QPTA 4I5KA 1H8BA 1N0YA 3UO9A 1B8LA 1CM4A 1S5GY 3I5FC 2MJWB 5AANA 1AVSA 3BUOB 1S1EA 2WNDA 2CBLA 5FYXA 1AK8A 1DT7B 1YURA 3DZTA 3CR4X 3JTDC 2COLB 2M49B 3BUXB 3I5HB 1UHKA 4QJ5B 2NZ0A 1JF0A 3K1EA 1DC1A 2CTNA 1MQ1A 3O6BA 1JUOA 1LA0A 4PHMA 3SS4A 2ZN9A 3ZWHA 3FE8A 2JRFA 1CMGA 1MHOA 1NCXA 1JFJA 2QDIA 1EJ3A 3FIAA 1JFKA 2OTGC 4BY4A 5D7FA 1ALWA 2JU0A 1YVLA 1K9PA 1KK7Y 3SIBA 4YBHB 2LVVA 4MZLA 5CSIA 1MXEA 1J7RA 1SL8A 2LHIA 2B1UA 4PHKA 1B7TZ 4ZCVA 3WHTB 2KI4C 3S0GA 1KFXS 3F45A 3S0EA 2K7BA 2L98A 5PALA 3PLFB 1ZMZA 1TCFA 2CCMA 3D0YA 1CMFA 1SMGA 2BCXA 1G4YR 1YR5A 2HPSA 2KI6D 1NUBA 4PE4A 1LA3A 1QX2A 1XVJA 2WCHA 5ER5A 5AEQA 2WC6A 2BKIB 1IKUA 3PM2A 5I2OA 1EG3A 3KO0A 2M9GA 1KCYA 2M7LA 1KQMC 1LVCD 3VRPA 4I5NB 3RZSA 3TZ1A 2EGDA 2BBNA 2KYCA 5ER4X 3B87A 1SSEB 1YUSA 1CFDA 3DXLA 1PALA 1YX7A 2EC6C 1DTLA 4YGDB 3DVKA 5IBWA 1MWNA 3EKJA 1J7OA 1QWVA 3PN7B 2JT8A 3D75A 3S0DA 3B88A 1UHIA 3O78A 1Q80A 3SG4A 3I5FB 2K8MB 1WRLA 1XFVO 4FQTA 4WQ2A 4PCWA 3TS5B 2G9BA 2FCEA 1IJ5A 3WNXB 2G2BA 3JTDB 3R1OA 1B7TY 3CTNA 4M2PA 1PVAA 1CKKA 1BT6A 3MSEB 5AERA 3BUMB 3CYZA 2KLEA 4INXA 2MRDA 4ORCB 2PALA 3BXKA 1QV0A 4NQGA 2F33A 3LL8B 1XYDA 1ZFSA 4YGEB 3SG3A 2P71A 1SCMC 1RTP1 2OTGB 1EL4A 2I18A 2JPTA 4PHJA 3FS7A 1CFFA 1S6CA 2H61A 4MRYA 4CLNA 1K2HA 4A4CA 1NPQA 1XFRA 2OS8C 4MEWA 4YGAA 2L4IA 1YRTB 1TIZA 3AAJA 3VB1A 1OMRA 1KSMA 1MXLC 3D76A 3FWBA 2FCDA 1KFXL 4NDCA 1TNXA 5D3OA 3TDUA 1OOIX 5HKYA 3BYAA 1EG4A 2WCKA 3CWGA 1TUZA 1IQ5A 2WC5A 4I5JA 3VRQA 2KFGA 1EH2A 1HQVA 4OR9B 4ORBB 1Y1UA 3O4XA 1BJFA 1XFZO 1ZACA 2MHHA 1G8IA 3IQQA 2KFFA 2LVIA 3JVTC 3CZ0A 1NX1A 2PMYA 3NHTA 1TNPA 1M31A 2F2OA 1YRUB 1DJGA 2BL0B 3BJHA 3QRXA 1KQMB 1F55A 3PJIA 2LMVA 1CM1A 2CNPA 1QIVA 1PK0D 1K90D 1QVIZ 1YVHA 2HF5A 2LMUA 4MLWA 2JWWA 1B9AA 1CLBA 2JPOA 4OV2A 4U8DA 4GAOA 2Y5IA 3VRNA 1WDCC 2LNKA 2ZN8A 1M45A 1G33A 1WRZA 1XFXO 2F3YA 2JNFA 1SL9A 3V2LA 1CB1A 1M63B 1H4BA 5DKQA 1ZUZA 3FWCA 5DKRA 3CDNA 1WRKA 1L2OC 2NCOA 2JOJA 1SW8A 3PATA 2WCMA 1NSHA 4AQIA 2OPOA 3BUNB 5D69A 2Y1NA 3C1VA 2LUXA 1DGVA 1S6JA 2JNXA 3RM1A 1JWDA 2HQWA 1D1OA 1QTXA 1C3YA 3L4AA 2BAPA 1Z4HA 2I94A 2KSPA 2M8UA 2H2KA 2BCAA 4P5OE 2M0RA 3FE9A 1SCMB 2JZIA 4INWA 1KSOA 1XO5A 3AKAA 2L5XB 4Q04A 3I5IB 3TDIA 3OGNA 1LKJA 2JXCA 3A8RA 5HL1A 2ISDA 2MAZA 1CDLA 3I5GB 4C0JA 1DELA 4DS7A 4DCKA 2WOSA 1LINA 4L9MA 2LP3A 1GQMA 4PE1A 2K2FA 1J1DA 3AKBA 1S36A 3CLNA 1V1FA 1FW4A 3N7HA 3H4SE 1BODA 2LHLA 3A4UB 1YX8A 1N65A 3NGVA 3NSLA 1SY9A 4DRWA 5F6TA 3D10A 3TUYC 1FPWA 3CZTX 1EXRA 3EK4A 4USLA 2KGBC 5B8IB 3JVTB 1KFUS 2BECA 1J7QA 2D8NA 2KQYA 1CNPA 1GGWA 2CXJA 5J3XA 2BKHB 3LCPC 1CLMA 3OP0A 3SG5A 4A4BA 1QX5B 2TN4A 3R72A 2H8VA 1NCYA 2R2IA 1RECA 1BR1B 1SKTA 1SR6C 3D74A 1B4CA 2PYQA 3CR5X 4GGFC 1KK8C 1AP4A 1PVBA 2BCBA 5HLOA 3IF7A 1K8UA 1Y0VH 1NP8A 3DVMA 2QEBA 1B8RA 3B7AA 2M97A 2M1UA 2K60A 2BNXA 4N1GA 1L2OB 4PT1A 3NSIA 3O2PA 1TTXA 2FJUB 5FI7A 1GM0A 5CSNA 1FBVA 3PFVA 4I5LB 4MVFA 2LE9B 1XFYO 4DUQA 1XK4C 3KPXA 1SYMA 2KI6C 1NYAA 5I8NA 2JTZA 3OX6A 2CT9A 2MLFC 3BFAA 4MSPA 5KSZA 3NSKA 2KOTA 1WLMA 2L2CA 1OW4A 2LVKA 3D77A 1TWOA 5JOLA 1NX3A 3K21A 5CPVA 1IG5A 4M2QA 1IRJA 4MRXA 4CFRA 1KWOC 1TOPA 2QEVA 4D1EA 2K7DA 2KYFA 4YGCB 4HSZA 4YGBB 5KTYA 1OMDA 1Y6WA 1A4PA 3HCMA 2DOQA 2MA2A 2F8PA 1P28A 1RWYA 1DJYA 1S6IA 1DVIA 2F2PA 3KEVA 1TCOB 2JTTA 1KFUL 1NX2A 2BBMA 3Q8IA 1VRKA 4XYNA 2JT3A 2KI4B 1FI5A 4ICBA 1F70A 1V1GA 3CS1A 2L50A 3SS3A 5AFPA 2WCFA 4ORAB 1UWOA 4PHNA 1U5IA 1JF2A 1YUTA 3S0AA 2KAXA 2GGMA 3WHUB 1N2DA 1YUUA 1ODBA 1KK8B 2JT0A 1UP5A 2RGIA 2WCLA 2BE6A 4M2OA 1SRAA 3SG7A 1KQVA 2AMIA 1PSRA 3CR2A 2L4HA 1BU3A 1DJWA 1QASA 1TNWA 3BFHA 4ZCUA 3IQOA 1HT9A 1F4OA 1OOJA 1CLLA 2LANA 4N1FA 2IS9A 1AJ4A 5EL2A 1C07A 1F8HA 1R2UA 2I2RE 4YRUA 4AOMA 3CGAA 1U5IB 4NDDA 2JULA 1ORGA 2BE4A 2KQ6A 4FQOA 5AXIA 1J7PA 1NIWA 1MUXA 1DGUA 2EC6B 1QS7A 3B86A 1UHJA 1T14A 1R6PA 5I2LA 2KHNA 4WRIA 4C0KA 4HRGA 1OZSA 1SBJA 2KAYA 1JBAA 4CPVA 1C7WA 3TS5C 2O5GA 1L7ZA 4GNKB 2O60A 1QLKA 3BOWA 3UNWA 5HKZA 3GK2A 1NCZA 3S0FA 2M1KB 5KU1A 4QJ4B 2NCPA 3NHIA 4TNCA 1M46A 3CZ2A 2A4JA 3D78A 3LLEA 3PSRA 1C3ZA 3DF0A 4F7FA 4IJ7A 1J55A 1JSAA 2P70A 3ZNIA 2FOTA 3SJSA 1AJ5A 1OMVA 4GUKA 3BOWB 4JKTA 1WY9A 1OZOA 2OS8B 1K96A 1Y1AA 3DY9A 2FJYA 2MLEC 4FTGA 2LM5A 1OOGA 3VRRA 2M3WA 1QVIY 1OOFA 1DQEA 2KAVA 4AQJA 2K2AA 1LXFC 3L4LA 3DF0B 3PALA 3PN7C 1BR4B 1CDPA 3PM8A 4MZJA 3EVUA 4IL1A 1NWDA 1BMOA 1OSAA 1K93D 1RJVA 1TRFA 1UHNA 1GGZA 3NSOA 4OZDA 2Q91A 1W7IB 4PE0A
chains in the Genus database with same CATH topology
1XFRA 2WCJA 3VB1A 3D76A 2PQLA 3BFBA 1OOIX 3CZ1A 3R1VA 2WCKA 3S0BA 3BFAA 2WC5A 2L2CA 1OW4A 3D77A 2QEHA 1TWOA 2GTEA 2KPHA 2QEVA 3CZ0A 3NHTA 1TUJA 3BJHA 2QEOA 3PJIA 3QMEA 3R1PA 1P28A 3DZTA 2JPOA 4JD9A 2ERBA 3Q8IA 3K1EA 3V2LA 3FE8A 3CDNA 2QDIA 2WCMA 3S0AA 2WCLA 1LS8A 1OOHA 3L47A 3BFHA 1C3YA 3L4AA 5EL2A 3S0GA 3FE9A 4INWA 1ORGA 3S0EA 3B86A 1T14A 3OGNA 2WCHA 2WC6A 3RZSA 3N7HA 3B87A 3DXLA 3CABA 3NGVA 3S0FA 3DYEA 3NHIA 3CZ2A 3D78A 1QWVA 3S0DA 3D75A 1C3ZA 3B88A 4F7FA 3R72A 2H8VA 4FQTA 2P70A 3D73A 3D74A 3DY9A 3R1OA 2FJYA 1OOGA 3FE6A 1OOFA 1DQEA 3CYZA 4INXA 3L4LA 2QEBA 3B6XA 3B7AA 2P71A 5DICA 4PT1A 4OZDA 1GM0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XFR A;  2WCJ A;  3VB1 A;  3D76 A;  2PQL A;  3BFB A;  1OOI X;  3CZ1 A;  3R1V A;  2WCK A;  3S0B A;  3BFA A;  2WC5 A;  2L2C A;  1OW4 A;  3D77 A;  2QEH A;  1TWO A;  2GTE A;  2KPH A;  2QEV A;  3CZ0 A;  3NHT A;  1TUJ A;  3BJH A;  2QEO A;  3PJI A;  3QME A;  3R1P A;  1P28 A;  3DZT A;  2JPO A;  4JD9 A;  2ERB A;  3Q8I A;  3K1E A;  3V2L A;  3FE8 A;  3CDN A;  2QDI A;  2WCM A;  3S0A A;  2WCL A;  1LS8 A;  1OOH A;  3L47 A;  3BFH A;  1C3Y A;  3L4A A;  5EL2 A;  3S0G A;  3FE9 A;  4INW A;  1ORG A;  3S0E A;  3B86 A;  1T14 A;  3OGN A;  2WCH A;  2WC6 A;  3RZS A;  3N7H A;  3B87 A;  3DXL A;  3CAB A;  3NGV A;  3S0F A;  3DYE A;  3NHI A;  3CZ2 A;  3D78 A;  1QWV A;  3S0D A;  3D75 A;  1C3Z A;  3B88 A;  4F7F A;  3R72 A;  2H8V A;  4FQT A;  2P70 A;  3D73 A;  3D74 A;  3DY9 A;  3R1O A;  2FJY A;  1OOG A;  3FE6 A;  1OOF A;  1DQE A;  3CYZ A;  4INX A;  3L4L A;  2QEB A;  3B6X A;  3B7A A;  2P71 A;  5DIC A;  4PT1 A;  4OZD A;  1GM0 A; 
#chains in the Genus database with same CATH topology
 1E8A A;  1DJH A;  3VRO A;  2M29 A;  3AAK A;  1M39 A;  3OB2 B;  3EVV A;  3LK0 A;  2ZNE A;  2WCJ A;  3OX5 A;  1NX0 A;  1B8C A;  2PQL A;  2SCP A;  4GFT A;  3KF9 A;  4YI8 A;  1W7J B;  2LMT A;  3SS5 A;  4KYN A;  2WOR A;  2KDH A;  3S0B A;  1BG1 A;  1BOC A;  1UHH A;  4GGN A;  4HRE E;  4QJ3 B;  1TNQ A;  1WDC B;  2L2E A;  1C7V A;  1IIO A;  1K9K A;  5HYD A;  1PSB A;  4MZK A;  5CSF A;  4JWQ A;  2WC8 A;  2K0J A;  1WLZ A;  2L51 A;  3EK7 A;  1TUJ A;  2ZRS A;  2ZRT A;  4JQ0 D;  1RK9 A;  2KNE A;  1QX7 A;  1CTR A;  2LVJ A;  1QAT A;  2QEO A;  3QME A;  3NXA A;  4NDB A;  1AUI B;  1IQ3 A;  1Y1X A;  3EG5 B;  3R1P A;  1RRO A;  5K89 A;  1YTZ C;  2H61 C;  4JD9 A;  2ERB A;  1CDM A;  2PVB A;  3OB1 B;  2JQ6 A;  2K7O A;  1CDN A;  5CSJ A;  3KHE A;  4XJK A;  2LCP A;  1SCV A;  1XFW O;  5FI6 A;  5HKW A;  1B1G A;  2Y1M A;  2KLD A;  4OCI A;  1DJI A;  2BL0 C;  3O4Y A;  1IGV A;  4P2Y B;  3ICB A;  1SK6 D;  1B47 A;  2KGR A;  1W9Z A;  2YGU A;  2I7A A;  4GPL B;  2Y4Q A;  3D0Y B;  4MN0 A;  1LS8 A;  2QAC A;  1K94 A;  1OOH A;  2JXL A;  2VRG A;  4XJK B;  4E68 A;  1A29 A;  3L47 A;  5DKN A;  5G08 A;  1QXP A;  2F3Z A;  2NLN A;  1ALV A;  4CID A;  2K61 A;  5GQQ C;  2LV7 A;  1ZOT B;  1DJZ A;  4OKH A;  3SG6 A;  2AUC A;  3BQ3 A;  3GK1 A;  1DEK A;  3EK8 A;  1FF1 A;  2LC5 A;  1J1E A;  2KBI A;  2WCB A;  3TDZ A;  5HLV A;  1PRW A;  5FI2 A;  1QJT A;  2LP2 A;  2LLU A;  4GGF A;  5TNC A;  3TUY B;  2GGZ A;  3GK4 X;  1SL7 A;  4N5X A;  1JC2 A;  1SPY A;  3EVR A;  1S3P A;  4PAL A;  1TN4 A;  1IWQ A;  1QIW A;  1XFU O;  1A2X A;  2M7N A;  3DVJ A;  2AAO A;  3SIA A;  2NXQ A;  4PE7 A;  4DIR A;  3HX4 A;  2HET A;  4UPG A;  1SR6 B;  1F71 A;  1MF8 B;  4BY5 A;  1OE9 B;  1F54 A;  1K95 A;  2L5Y A;  2L0P A;  3CAB A;  2P6B B;  2JC2 A;  1BF5 A;  3DYE A;  1XK4 A;  2EHB A;  5I2Q A;  3I5I C;  1PUL A;  2K7C A;  3I5H C;  4JPZ B;  2Q4U A;  1A75 A;  4C0L A;  1UUR A;  1X02 A;  2E6W A;  4F0Z B;  3I5G C;  4OVN F;  2PSR A;  1FI6 A;  3D73 A;  2LUC A;  2WCE A;  1BLQ A;  1F4Q A;  2ZND A;  3M0W A;  1RFJ A;  1A03 A;  3BUW B;  4R1E A;  2LAP A;  3VGO A;  1S5G Z;  3FE6 A;  1A75 B;  5JJG A;  1QLS A;  1CFC A;  2PRU A;  2KFH A;  1CFP A;  3B6X A;  1DF0 A;  1IJ6 A;  2LLT A;  1MR8 A;  2GV5 A;  2KBM A;  5DIC A;  2SAS A;  2V53 A;  2MBX A;  4CFQ A;  2E30 A;  1DJX A;  2ZKM X;  5I94 A;  4MBE A;  3DVE A;  3OHM B;  1KWO B;  4YI9 A;  1S26 D;  2HQ8 A;  1Z2C B;  3GOF A;  4WQ3 A;  4ETO A;  1DF0 B;  3DD4 A;  3IVT A;  3BFB A;  3LK1 A;  1KK7 Z;  1GJY A;  3CZ1 A;  3R1V A;  4PDZ A;  1IH0 A;  2ZFD A;  3OBV A;  4GBA A;  1SNL A;  1XA5 A;  2LLS A;  4HRH A;  2QEH A;  3WXA A;  3E3R A;  3EKH A;  1DMO A;  3RLZ A;  1AHR A;  2GTE A;  1QV1 A;  3SG2 A;  2KPH A;  1UUS A;  1K9U A;  2PAS A;  5BPJ A;  1OQP A;  2QPT A;  4I5K A;  1H8B A;  1N0Y A;  3UO9 A;  1B8L A;  1CM4 A;  1S5G Y;  3I5F C;  2MJW B;  5AAN A;  1AVS A;  3BUO B;  1S1E A;  2WND A;  2CBL A;  5FYX A;  1AK8 A;  1DT7 B;  1YUR A;  3DZT A;  3CR4 X;  3JTD C;  2COL B;  2M49 B;  3BUX B;  3I5H B;  1UHK A;  4QJ5 B;  2NZ0 A;  1JF0 A;  3K1E A;  1DC1 A;  2CTN A;  1MQ1 A;  3O6B A;  1JUO A;  1LA0 A;  4PHM A;  3SS4 A;  2ZN9 A;  3ZWH A;  3FE8 A;  2JRF A;  1CMG A;  1MHO A;  1NCX A;  1JFJ A;  2QDI A;  1EJ3 A;  3FIA A;  1JFK A;  2OTG C;  4BY4 A;  5D7F A;  1ALW A;  2JU0 A;  1YVL A;  1K9P A;  1KK7 Y;  3SIB A;  4YBH B;  2LVV A;  4MZL A;  5CSI A;  1MXE A;  1J7R A;  1SL8 A;  2LHI A;  2B1U A;  4PHK A;  1B7T Z;  4ZCV A;  3WHT B;  2KI4 C;  3S0G A;  1KFX S;  3F45 A;  3S0E A;  2K7B A;  2L98 A;  5PAL A;  3PLF B;  1ZMZ A;  1TCF A;  2CCM A;  3D0Y A;  1CMF A;  1SMG A;  2BCX A;  1G4Y R;  1YR5 A;  2HPS A;  2KI6 D;  1NUB A;  4PE4 A;  1LA3 A;  1QX2 A;  1XVJ A;  2WCH A;  5ER5 A;  5AEQ A;  2WC6 A;  2BKI B;  1IKU A;  3PM2 A;  5I2O A;  1EG3 A;  3KO0 A;  2M9G A;  1KCY A;  2M7L A;  1KQM C;  1LVC D;  3VRP A;  4I5N B;  3RZS A;  3TZ1 A;  2EGD A;  2BBN A;  2KYC A;  5ER4 X;  3B87 A;  1SSE B;  1YUS A;  1CFD A;  3DXL A;  1PAL A;  1YX7 A;  2EC6 C;  1DTL A;  4YGD B;  3DVK A;  5IBW A;  1MWN A;  3EKJ A;  1J7O A;  1QWV A;  3PN7 B;  2JT8 A;  3D75 A;  3S0D A;  3B88 A;  1UHI A;  3O78 A;  1Q80 A;  3SG4 A;  3I5F B;  2K8M B;  1WRL A;  1XFV O;  4FQT A;  4WQ2 A;  4PCW A;  3TS5 B;  2G9B A;  2FCE A;  1IJ5 A;  3WNX B;  2G2B A;  3JTD B;  3R1O A;  1B7T Y;  3CTN A;  4M2P A;  1PVA A;  1CKK A;  1BT6 A;  3MSE B;  5AER A;  3BUM B;  3CYZ A;  2KLE A;  4INX A;  2MRD A;  4ORC B;  2PAL A;  3BXK A;  1QV0 A;  4NQG A;  2F33 A;  3LL8 B;  1XYD A;  1ZFS A;  4YGE B;  3SG3 A;  2P71 A;  1SCM C;  1RTP 1;  2OTG B;  1EL4 A;  2I18 A;  2JPT A;  4PHJ A;  3FS7 A;  1CFF A;  1S6C A;  2H61 A;  4MRY A;  4CLN A;  1K2H A;  4A4C A;  1NPQ A;  1XFR A;  2OS8 C;  4MEW A;  4YGA A;  2L4I A;  1YRT B;  1TIZ A;  3AAJ A;  3VB1 A;  1OMR A;  1KSM A;  1MXL C;  3D76 A;  3FWB A;  2FCD A;  1KFX L;  4NDC A;  1TNX A;  5D3O A;  3TDU A;  1OOI X;  5HKY A;  3BYA A;  1EG4 A;  2WCK A;  3CWG A;  1TUZ A;  1IQ5 A;  2WC5 A;  4I5J A;  3VRQ A;  2KFG A;  1EH2 A;  1HQV A;  4OR9 B;  4ORB B;  1Y1U A;  3O4X A;  1BJF A;  1XFZ O;  1ZAC A;  2MHH A;  1G8I A;  3IQQ A;  2KFF A;  2LVI A;  3JVT C;  3CZ0 A;  1NX1 A;  2PMY A;  3NHT A;  1TNP A;  1M31 A;  2F2O A;  1YRU B;  1DJG A;  2BL0 B;  3BJH A;  3QRX A;  1KQM B;  1F55 A;  3PJI A;  2LMV A;  1CM1 A;  2CNP A;  1QIV A;  1PK0 D;  1K90 D;  1QVI Z;  1YVH A;  2HF5 A;  2LMU A;  4MLW A;  2JWW A;  1B9A A;  1CLB A;  2JPO A;  4OV2 A;  4U8D A;  4GAO A;  2Y5I A;  3VRN A;  1WDC C;  2LNK A;  2ZN8 A;  1M45 A;  1G33 A;  1WRZ A;  1XFX O;  2F3Y A;  2JNF A;  1SL9 A;  3V2L A;  1CB1 A;  1M63 B;  1H4B A;  5DKQ A;  1ZUZ A;  3FWC A;  5DKR A;  3CDN A;  1WRK A;  1L2O C;  2NCO A;  2JOJ A;  1SW8 A;  3PAT A;  2WCM A;  1NSH A;  4AQI A;  2OPO A;  3BUN B;  5D69 A;  2Y1N A;  3C1V A;  2LUX A;  1DGV A;  1S6J A;  2JNX A;  3RM1 A;  1JWD A;  2HQW A;  1D1O A;  1QTX A;  1C3Y A;  3L4A A;  2BAP A;  1Z4H A;  2I94 A;  2KSP A;  2M8U A;  2H2K A;  2BCA A;  4P5O E;  2M0R A;  3FE9 A;  1SCM B;  2JZI A;  4INW A;  1KSO A;  1XO5 A;  3AKA A;  2L5X B;  4Q04 A;  3I5I B;  3TDI A;  3OGN A;  1LKJ A;  2JXC A;  3A8R A;  5HL1 A;  2ISD A;  2MAZ A;  1CDL A;  3I5G B;  4C0J A;  1DEL A;  4DS7 A;  4DCK A;  2WOS A;  1LIN A;  4L9M A;  2LP3 A;  1GQM A;  4PE1 A;  2K2F A;  1J1D A;  3AKB A;  1S36 A;  3CLN A;  1V1F A;  1FW4 A;  3N7H A;  3H4S E;  1BOD A;  2LHL A;  3A4U B;  1YX8 A;  1N65 A;  3NGV A;  3NSL A;  1SY9 A;  4DRW A;  5F6T A;  3D10 A;  3TUY C;  1FPW A;  3CZT X;  1EXR A;  3EK4 A;  4USL A;  2KGB C;  5B8I B;  3JVT B;  1KFU S;  2BEC A;  1J7Q A;  2D8N A;  2KQY A;  1CNP A;  1GGW A;  2CXJ A;  5J3X A;  2BKH B;  3LCP C;  1CLM A;  3OP0 A;  3SG5 A;  4A4B A;  1QX5 B;  2TN4 A;  3R72 A;  2H8V A;  1NCY A;  2R2I A;  1REC A;  1BR1 B;  1SKT A;  1SR6 C;  3D74 A;  1B4C A;  2PYQ A;  3CR5 X;  4GGF C;  1KK8 C;  1AP4 A;  1PVB A;  2BCB A;  5HLO A;  3IF7 A;  1K8U A;  1Y0V H;  1NP8 A;  3DVM A;  2QEB A;  1B8R A;  3B7A A;  2M97 A;  2M1U A;  2K60 A;  2BNX A;  4N1G A;  1L2O B;  4PT1 A;  3NSI A;  3O2P A;  1TTX A;  2FJU B;  5FI7 A;  1GM0 A;  5CSN A;  1FBV A;  3PFV A;  4I5L B;  4MVF A;  2LE9 B;  1XFY O;  4DUQ A;  1XK4 C;  3KPX A;  1SYM A;  2KI6 C;  1NYA A;  5I8N A;  2JTZ A;  3OX6 A;  2CT9 A;  2MLF C;  3BFA A;  4MSP A;  5KSZ A;  3NSK A;  2KOT A;  1WLM A;  2L2C A;  1OW4 A;  2LVK A;  3D77 A;  1TWO A;  5JOL A;  1NX3 A;  3K21 A;  5CPV A;  1IG5 A;  4M2Q A;  1IRJ A;  4MRX A;  4CFR A;  1KWO C;  1TOP A;  2QEV A;  4D1E A;  2K7D A;  2KYF A;  4YGC B;  4HSZ A;  4YGB B;  5KTY A;  1OMD A;  1Y6W A;  1A4P A;  3HCM A;  2DOQ A;  2MA2 A;  2F8P A;  1P28 A;  1RWY A;  1DJY A;  1S6I A;  1DVI A;  2F2P A;  3KEV A;  1TCO B;  2JTT A;  1KFU L;  1NX2 A;  2BBM A;  3Q8I A;  1VRK A;  4XYN A;  2JT3 A;  2KI4 B;  1FI5 A;  4ICB A;  1F70 A;  1V1G A;  3CS1 A;  2L50 A;  3SS3 A;  5AFP A;  2WCF A;  4ORA B;  1UWO A;  4PHN A;  1U5I A;  1JF2 A;  1YUT A;  3S0A A;  2KAX A;  2GGM A;  3WHU B;  1N2D A;  1YUU A;  1ODB A;  1KK8 B;  2JT0 A;  1UP5 A;  2RGI A;  2WCL A;  2BE6 A;  4M2O A;  1SRA A;  3SG7 A;  1KQV A;  2AMI A;  1PSR A;  3CR2 A;  2L4H A;  1BU3 A;  1DJW A;  1QAS A;  1TNW A;  3BFH A;  4ZCU A;  3IQO A;  1HT9 A;  1F4O A;  1OOJ A;  1CLL A;  2LAN A;  4N1F A;  2IS9 A;  1AJ4 A;  5EL2 A;  1C07 A;  1F8H A;  1R2U A;  2I2R E;  4YRU A;  4AOM A;  3CGA A;  1U5I B;  4NDD A;  2JUL A;  1ORG A;  2BE4 A;  2KQ6 A;  4FQO A;  5AXI A;  1J7P A;  1NIW A;  1MUX A;  1DGU A;  2EC6 B;  1QS7 A;  3B86 A;  1UHJ A;  1T14 A;  1R6P A;  5I2L A;  2KHN A;  4WRI A;  4C0K A;  4HRG A;  1OZS A;  1SBJ A;  2KAY A;  1JBA A;  4CPV A;  1C7W A;  3TS5 C;  2O5G A;  1L7Z A;  4GNK B;  2O60 A;  1QLK A;  3BOW A;  3UNW A;  5HKZ A;  3GK2 A;  1NCZ A;  3S0F A;  2M1K B;  5KU1 A;  4QJ4 B;  2NCP A;  3NHI A;  4TNC A;  1M46 A;  3CZ2 A;  2A4J A;  3D78 A;  3LLE A;  3PSR A;  1C3Z A;  3DF0 A;  4F7F A;  4IJ7 A;  1J55 A;  1JSA A;  2P70 A;  3ZNI A;  2FOT A;  3SJS A;  1AJ5 A;  1OMV A;  4GUK A;  3BOW B;  4JKT A;  1WY9 A;  1OZO A;  2OS8 B;  1K96 A;  1Y1A A;  3DY9 A;  2FJY A;  2MLE C;  4FTG A;  2LM5 A;  1OOG A;  3VRR A;  2M3W A;  1QVI Y;  1OOF A;  1DQE A;  2KAV A;  4AQJ A;  2K2A A;  1LXF C;  3L4L A;  3DF0 B;  3PAL A;  3PN7 C;  1BR4 B;  1CDP A;  3PM8 A;  4MZJ A;  3EVU A;  4IL1 A;  1NWD A;  1BMO A;  1OSA A;  1K93 D;  1RJV A;  1TRF A;  1UHN A;  1GGZ A;  3NSO A;  4OZD A;  2Q91 A;  1W7I B;  4PE0 A; 
#chains in the Genus database with same CATH homology
 1XFR A;  2WCJ A;  3VB1 A;  3D76 A;  2PQL A;  3BFB A;  1OOI X;  3CZ1 A;  3R1V A;  2WCK A;  3S0B A;  3BFA A;  2WC5 A;  2L2C A;  1OW4 A;  3D77 A;  2QEH A;  1TWO A;  2GTE A;  2KPH A;  2QEV A;  3CZ0 A;  3NHT A;  1TUJ A;  3BJH A;  2QEO A;  3PJI A;  3QME A;  3R1P A;  1P28 A;  3DZT A;  2JPO A;  4JD9 A;  2ERB A;  3Q8I A;  3K1E A;  3V2L A;  3FE8 A;  3CDN A;  2QDI A;  2WCM A;  3S0A A;  2WCL A;  1LS8 A;  1OOH A;  3L47 A;  3BFH A;  1C3Y A;  3L4A A;  5EL2 A;  3S0G A;  3FE9 A;  4INW A;  1ORG A;  3S0E A;  3B86 A;  1T14 A;  3OGN A;  2WCH A;  2WC6 A;  3RZS A;  3N7H A;  3B87 A;  3DXL A;  3CAB A;  3NGV A;  3S0F A;  3DYE A;  3NHI A;  3CZ2 A;  3D78 A;  1QWV A;  3S0D A;  3D75 A;  1C3Z A;  3B88 A;  4F7F A;  3R72 A;  2H8V A;  4FQT A;  2P70 A;  3D73 A;  3D74 A;  3DY9 A;  3R1O A;  2FJY A;  1OOG A;  3FE6 A;  1OOF A;  1DQE A;  3CYZ A;  4INX A;  3L4L A;  2QEB A;  3B6X A;  3B7A A;  2P71 A;  5DIC A;  4PT1 A;  4OZD A;  1GM0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...