5ER4X

Crystal structure of calcium-loaded s100b bound to sc0025
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
90
structure length
90
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein/inhibitor
molecule keywords Protein S100-B
publication title Novel protein-inhibitor interactions in site 3 of Ca(2+)-bound S100B as discovered by X-ray crystallography.
pubmed doi rcsb
source organism Bos taurus
total genus 32
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2015-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00036 EF-hand_1 EF hand
X PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5er4X00
5HLOA 2O60A 1KSMA 1M46A 2K8MB 3OX5A 4NDDA 4ORBB 1AHRA 1DGUA 1HT9A 1OSAA 2L4HA 1FPWA 2QPTA 1AJ4A 3IQOA 2M7NA 1AK8A 2H2KA 1KWOC 3JTDB 1KFUS 3SIBA 1OZOA 2JXLA 2LUXA 1QVIZ 1YRUB 3AKAA 1JFJA 1S1EA 1A2XA 2PSRA 2BCAA 2A4JA 2FOTA 1N2DA 1TRFA 3JVTB 4Q04A 5I8NA 1F8HA 1JF0A 1A4PA 3CR2A 1CDMA 3BUOB 5CSJA 2D8NA 1D1OA 4I5JA 1QATA 1NCZA 2KGRA 2MA2A 4ORAB 1K8UA 1AP4A 1CDPA 2KAYA 1S6IA 1B8CA 1L7ZA 1OE9B 2AMIA 1DJZA 3C1VA 3EVUA 5KU1A 3BYAA 4AOMA 1F55A 1KK8B 3QRXA 4XJKB 2MLEC 1YUUA 4MN0A 1RWYA 4E68A 3EK8A 1B8RA 2H61A 1YURA 1TNXA 3TZ1A 3LCPC 2FJUB 1UHNA 3WNXB 1NX3A 1DJWA 2LM5A 1Y1XA 2WCBA 3BUWB 2F33A 2Y4QA 1RECA 4NQGA 1B8LA 1DJHA 3JTDC 3NSLA 4YGEB 2BBMA 2F2PA 3OX6A 2OTGB 1FI6A 2R2IA 1SCMC 4DCKA 1J7RA 2PRUA 5I2OA 2GV5A 1JSAA 1JUOA 2KI6C 3JVTC 2L2EA 3CLNA 2O5GA 4AQIA 2BKIB 4YI9A 2EHBA 2MJWB 5CSFA 1A75A 4ORCB 1PK0D 1K2HA 1EJ3A 1LA3A 1TCFA 1Y0VH 3HX4A 3D0YA 4WQ3A 1J7QA 2LE9B 2V53A 4JPZB 4M2PA 2NCPA 1K93D 4CIDA 4OVNF 4GGFC 2K7CA 1LXFC 1U5IA 4PHKA 4MZJA 1YUSA 1XFWO 1NX0A 2NLNA 1XK4A 1KFXL 1NX1A 1PVAA 1TIZA 2LMUA 5KTYA 4DS7A 1KQVA 2JU0A 1SK6D 1ALWA 1PSRA 4MZLA 4GGNA 2MBXA 4YGBB 1BU3A 2LNKA 3BUNB 2DOQA 1J1EA 1S5GY 4MEWA 1QASA 4N5XA 1H4BA 2FCDA 3PALA 1JBAA 2F2OA 5I2QA 2LHLA 1RFJA 2E30A 1DF0A 1XFXO 1K9KA 1SCVA 5HKWA 2CXJA 1NX2A 2ZN9A 1OOJA 1UP5A 1Y1AA 2LAPA 1QIVA 1BODA 2JNXA 1DT7B 1MWNA 2LLTA 1C7VA 2KNEA 1HQVA 1F54A 5I2LA 1J1DA 1UHHA 1N0YA 1SL9A 1IGVA 5AANA 2K7BA 4YI8A 1FW4A 1TTXA 1NSHA 5AFPA 1B1GA 3CGAA 3BOWA 1TN4A 3NSOA 1CB1A 1AJ5A 1B9AA 3A4UB 3ICBA 2JC2A 1GGZA 3SG4A 4CFRA 1A29A 3FIAA 5PALA 1BOCA 3I5HC 3SG5A 2M3WA 3OB1B 1J7PA 3OB2B 1MF8B 1BR4B 1IJ5A 5AEQA 3SJSA 4UPGA 2KOTA 3PM8A 2VRGA 2HF5A 2KBMA 4N1GA 2JOJA 3M0WA 3EVVA 2KI4B 1TNPA 1LINA 2JQ6A 1JF2A 1LVCD 1IJ6A 1WLZA 1CDNA 3OP0A 4MSPA 1CNPA 2LVVA 1SBJA 1M63B 4HSZA 4F0ZB 1B4CA 3DD4A 2KHNA 1TNQA 2ZN8A 2K61A 4BY5A 5HYDA 2PMYA 2JT8A 4GBAA 4CLNA 2EC6B 3DF0B 4HRHA 2BE6A 3IF7A 1PSBA 1OMRA 2WNDA 4P5OE 3ZNIA 1SR6B 1CLLA 1VRKA 2KQ6A 2LANA 1S3PA 4N1FA 4ZCVA 1B47A 5HLVA 3AAJA 1KK7Z 3RLZA 5IBWA 1ODBA 4WQ2A 3CZTX 2I18A 1SY9A 3ZWHA 2EGDA 1SNLA 1UHIA 4HRGA 4PCWA 1WRLA 1QVIY 2KBIA 1CFPA 5DKQA 2F3ZA 4ETOA 1OQPA 2PALA 2KI4C 4GGFA 1ZFSA 1KSOA 2CT9A 3F45A 4PDZA 5ER4X 3DVJA 1XFYO 1QIWA 4OV2A 2IS9A 3VRNA 3TDIA 4AQJA 1N65A 4PALA 1CMFA 2K7OA 3KPXA 1CMGA 2Y1NA 3FWCA 1J7OA 3BUMB 1DTLA 2MAZA 4NDBA 1YX8A 3RM1A 3VRQA 1IQ5A 2OPOA 2E6WA 1UHJA 2M1UA 2MRDA 1WY9A 2EC6C 3SIAA 4CFQA 1B7TZ 2JTTA 2I2RE 3NSIA 1UHKA 3PFVA 4ZCUA 1CM1A 3K21A 4A4CA 3LK0A 1SR6C 4M2OA 2L0PA 3CWGA 5HKYA 3GK2A 2BE4A 2K2AA 4MLWA 4U8DA 4PE7A 1OZSA 2BCXA 2HPSA 1XFZO 3CR5X 4L9MA 3LL8B 2SASA 1CFDA 1QLKA 5G08A 3TDUA 4DIRA 3CTNA 3O78A 1G8IA 1KK8C 2ZFDA 3GK1A 1NPQA 3D0YB 4TNCA 1X02A 2TN4A 4GFTA 2NCOA 2HQ8A 2LMVA 2LP2A 1PALA 2LCPA 2LV7A 1SYMA 1XO5A 1ZOTB 2AUCA 2KDHA 2M1KB 1C7WA 1IKUA 1DJYA 1W7JB 2CBLA 2MLFC 1NWDA 3NXAA 1CDLA 4A4BA 1KCYA 1DJXA 1JC2A 1CLBA 3I5FB 1BT6A 2OS8B 2OTGC 2K2FA 5J3XA 4D1EA 1Q80A 1SPYA 3E3RA 3AKBA 4YGAA 2BL0B 1CFFA 2Q91A 1QS7A 4OR9B 5KSZA 4PHNA 1KFUL 1A03A 1XVJA 3WHTB 1IRJA 1BMOA 1DVIA 1ZACA 2ZRSA 1EXRA 3EKJA 4PE0A 2K0JA 3O6BA 5DKNA 1DF0B 1QX2A 4R1EA 4GUKA 2HQWA 4PE4A 1CKKA 1MQ1A 2K7DA 2LVJA 4QJ3B 1C07A 2ZKMX 2WCEA 1PVBA 1K95A 4USLA 3I5GB 1MXEA 3LLEA 3CS1A 2NXQA 1BJFA 2LC5A 3VROA 1IWQA 4WRIA 3AAKA 4YBHB 1QV1A 1IH0A 3KHEA 2M97A 1S6JA 3KO0A 1M39A 1RTP1 2KYFA 2BECA 5HKZA 4JWQA 1TOPA 5FYXA 1QJTA 1IQ3A 3A8RA 3PATA 1ZUZA 3EK4A 4GPLB 2KAXA 4YRUA 1K9UA 1PULA 2OS8C 3TS5B 2MHHA 1SKTA 2M0RA 1NCYA 1NP8A 1DGVA 1TCOB 1F71A 4BY4A 1RJVA 5DKRA 1YVLA 2COLB 3WHUB 1RK9A 1GJYA 1H8BA 1IG5A 1G4YR 2GGMA 3H4SE 1QLSA 3IQQA 2FCEA 2LVIA 1OMDA 2P6BB 1SRAA 2QACA 1YTZC 2L98A 3I5GC 4OKHA 3SG3A 2LUCA 1DJGA 4QJ4B 1EH2A 3EK7A 1CTRA 1QXPA 3VGOA 5BPJA 3DF0A 4I5NB 4GAOA 1OMVA 4FQOA 2I7AA 2Y5IA 1MUXA 2ZNEA 5D69A 2JRFA 3PSRA 4MZKA 2SCPA 1E8AA 1M45A 1SCMB 2JTZA 2CTNA 2JULA 3OHMB 3DVKA 1QX7A 3TUYB 1BLQA 1ZMZA 2JPTA 1NIWA 2LLSA 4MBEA 1S6CA 2I94A 3O2PA 3TS5C 5CSIA 2F3YA 1V1GA 1PRWA 1MHOA 4DUQA 2JZIA 4NDCA 4C0KA 2JNFA 4XJKA 1EG4A 1YVHA 2G2BA 2Q4UA 1MXLC 4C0JA 2CNPA 3I5IB 3PN7B 2KFHA 2KGBC 1EL4A 1KK7Y 5JOLA 1XFUO 3FWBA 3LK1A 1F4QA 2KSPA 1WLMA 1NCXA 2G9BA 2KI6D 1QX5B 1NYAA 1QTXA 4QJ5B 1K90D 1XA5A 4XYNA 4ICBA 1YRTB 4I5LB 3SG7A 1M31A 1J55A 1K9PA 3WXAA 1QV0A 1DMOA 3O4YA 1SL8A 3PLFB 3TDZA 2PVBA 1CM4A 3CR4X 5AXIA 2LHIA 2RGIA 1BR1B 5CSNA 3GOFA 4OCIA 4M2QA 2M7LA 1XYDA 1A75B 3EVRA 3TUYC 3BQ3A 3EKHA 4PHMA 4PHJA 5TNCA 2GGZA 3FS7A 1B7TY 1MR8A 1S5GZ 1RROA 4YGDB 2BCBA 1U5IB 2WCFA 3VRRA 4DRWA 2PASA 2M49B 1L2OB 1YR5A 2HETA 3D10A 1SW8A 1AVSA 2ZNDA 1ALVA 1K96A 3I5IC 3PN7C 1Y1UA 5K89A 1BG1A 2CCMA 1DJIA 2WOSA 2H61C 2LP3A 2M9GA 2M8UA 1FF1A 1UURA 2L50A 3I5HB 1F4OA 1WRKA 3NSKA 4YGCB 2L51A 2WC8A 2JWWA 2LVKA 1WDCB 2JXCA 2NZ0A 2KYCA 2LLUA 1KQMB 1W7IB 5JJGA 1BF5A 1GGWA 1CLMA 3KF9A 1WRZA 4I5KA 5F6TA 1K94A 2BKHB 4FTGA 2JT0A 2L4IA 1GQMA 1LA0A 2M29A 1JFKA 1FBVA 1TNWA 2L5XB 1SL7A 1AUIB 2ISDA 1FI5A 1KWOB 2KFFA 2B1UA 1LKJA 2KQYA 2AAOA 2LMTA 2KFGA 1JWDA 1SMGA 1XFVO 3BOWB 4MVFA 3GK4X 1EG3A 3KEVA 2JT3A 4IL1A 4P2YB 1L2OC 2ZRTA 3DVMA 3SG6A 1XK4C 3MSEB 1NUBA 3I5FC 1R2UA 1F70A 4HREE 3BUXB 1Y6WA 3DVEA 4GNKB 5CPVA 1G33A 3VRPA 2Y1MA 1S36A 4PE1A 5ER5A 5GQQC 1KFXS 1UWOA 2BL0C 2WORA 4MRYA 5B8IB 1R6PA 1YUTA 2KAVA 2F8PA 5D7FA 1CFCA 3HCMA 4C0LA 4JQ0D 1YX7A 4MRXA 1UUSA 1V1FA 1WDCC 3SG2A 5AERA 4CPVA 3BXKA 2BBNA 1S26D 1KQMC
chains in the Genus database with same CATH superfamily
1T14A 5HLOA 2O60A 1KSMA 1M46A 2K8MB 3OX5A 4NDDA 4ORBB 1AHRA 1DGUA 1HT9A 1OSAA 2L4HA 1FPWA 2QPTA 1AJ4A 3IQOA 2M7NA 5D3OA 1AK8A 2H2KA 1KWOC 3JTDB 1KFUS 3SIBA 1OZOA 2JXLA 2LUXA 1QVIZ 1YRUB 3AKAA 1JFJA 1S1EA 1A2XA 2PSRA 3CZ2A 3BJHA 2BCAA 2A4JA 2FOTA 1N2DA 1TRFA 3JVTB 4Q04A 5I8NA 1F8HA 1JF0A 1A4PA 3CR2A 1CDMA 3BUOB 2KPHA 5CSJA 2D8NA 1D1OA 4I5JA 1QATA 1NCZA 2KGRA 2MA2A 4ORAB 1K8UA 2ERBA 3FE9A 1AP4A 1CDPA 2KAYA 1S6IA 1B8CA 1L7ZA 1OE9B 2AMIA 3S0GA 1DJZA 3C1VA 3EVUA 5KU1A 3BYAA 4AOMA 1F55A 1KK8B 3QRXA 4XJKB 2MLEC 1YUUA 4MN0A 3BFBA 1OW4A 1RWYA 4E68A 3EK8A 1B8RA 2H61A 1YURA 2WC5A 1TNXA 2FJYA 2WCHA 2FJUB 3LCPC 1UHNA 3TZ1A 3WNXB 1NX3A 1DJWA 2LM5A 1Y1XA 2WCBA 3S0AA 3BUWB 2F33A 1LS8A 1RECA 1Z2CB 2Y4QA 1B8LA 1DJHA 3DXLA 3JTDC 3L4LA 3NSLA 4NQGA 4YGEB 2BBMA 2F2PA 3OX6A 2BAPA 2OTGB 1FI6A 2R2IA 1SCMC 2BNXA 1J7RA 4DCKA 2PRUA 5I2OA 4JD9A 2GV5A 1JSAA 1JUOA 2KI6C 3JVTC 2L2EA 3CLNA 2O5GA 3Q8IA 2BKIB 4AQIA 4F7FA 4YI9A 3OGNA 3CYZA 2EHBA 2MJWB 5CSFA 1A75A 4ORCB 1PK0D 1K2HA 3L47A 1EJ3A 1LA3A 1TCFA 1Y0VH 3HX4A 3D0YA 4WQ3A 1J7QA 2LE9B 2V53A 4JPZB 4M2PA 2NCPA 1K93D 4CIDA 3OBVA 4OVNF 4GGFC 2K7CA 1LXFC 1U5IA 4PHKA 4MZJA 1YUSA 1XFWO 1NX0A 2NLNA 1XK4A 1KFXL 1NX1A 1PVAA 1TIZA 2LMUA 5KTYA 4DS7A 1KQVA 2JU0A 1SK6D 1ALWA 1PSRA 3DYEA 4MZLA 4GGNA 2MBXA 3UO9A 4YGBB 1BU3A 3SS5A 3PJIA 2LNKA 3BUNB 2DOQA 1J1EA 1S5GY 4MEWA 1QASA 4N5XA 1H4BA 2FCDA 2WC6A 3PALA 1JBAA 2F2OA 2WCLA 3EG5B 5I2QA 2LHLA 2WCMA 1RFJA 2E30A 3B7AA 1DF0A 1XFXO 1K9KA 1SCVA 5HKWA 2CXJA 1NX2A 3D74A 2ZN9A 1OOJA 1UP5A 1Y1AA 3NHTA 1TUJA 2LAPA 1QIVA 1BODA 2JNXA 1DT7B 1MWNA 2LLTA 1C7VA 2KNEA 3B87A 1HQVA 1F54A 5I2LA 1J1DA 1UHHA 1N0YA 1SL9A 2QEBA 1IGVA 5AANA 2K7BA 4YI8A 3V2LA 1FW4A 1TTXA 2L5YA 3D73A 1NSHA 5AFPA 1B1GA 3CGAA 3BOWA 1TN4A 3NSOA 1CB1A 1AJ5A 1B9AA 3A4UB 3ICBA 1JWDA 2JC2A 1GGZA 3SG4A 4CFRA 1A29A 3FIAA 5PALA 1BOCA 3I5HC 3QMEA 3SG5A 2M3WA 3OB1B 1J7PA 3OB2B 2JPOA 1MF8B 1BR4B 1IJ5A 5AEQA 3SJSA 4UPGA 4FQTA 2KOTA 3PM8A 2VRGA 2HF5A 2KBMA 4N1GA 2JOJA 3M0WA 3EVVA 2KI4B 1TNPA 5FI6A 1LINA 2JQ6A 1CMFA 1C3YA 1JF2A 1LVCD 3S0EA 1IJ6A 1WLZA 1CDNA 3OP0A 4MSPA 1CNPA 2LVVA 1SBJA 1M63B 4HSZA 4F0ZB 1B4CA 3DD4A 2KHNA 3D75A 1TNQA 2ZN8A 2K61A 4BY5A 5HYDA 2PMYA 2JT8A 4GBAA 4CLNA 2EC6B 3DF0B 4HRHA 2BE6A 3IF7A 1PSBA 1OMRA 3PM2A 2WNDA 4P5OE 3ZNIA 1SR6B 1DC1A 1CLLA 1VRKA 2KQ6A 2LANA 1S3PA 4N1FA 4ZCVA 1B47A 5HLVA 4KYNA 3S0BA 1OOGA 3AAJA 3CZ1A 3SS4A 1KK7Z 3RLZA 5IBWA 1BLQA 1ODBA 4WQ2A 3CZTX 2I18A 1SY9A 3ZWHA 2EGDA 1SNLA 1UHIA 4HRGA 4PCWA 1WRLA 1QVIY 2KBIA 2H8VA 5DKQA 2F3ZA 1CFPA 4ETOA 1OQPA 2PALA 2KI4C 4GGFA 3B86A 1ZFSA 1KSOA 2CT9A 3F45A 4PDZA 5ER4X 3DVJA 1XFYO 1QIWA 4OV2A 2IS9A 3VRNA 3TDIA 4AQJA 1N65A 4PALA 3S0FA 2K7OA 3KPXA 1CMGA 2Y1NA 3FWCA 1J7OA 1IIOA 3BUMB 1DTLA 2MAZA 3FE6A 4NDBA 3NHIA 1YX8A 3D77A 3RM1A 3VRQA 1IQ5A 2OPOA 1OOIX 2E6WA 1UHJA 2M1UA 2MRDA 1WY9A 2EC6C 3SIAA 4CFQA 1B7TZ 3B6XA 2JTTA 2I2RE 3NSIA 1UHKA 2PQLA 3PFVA 1CM1A 3K21A 4ZCUA 3LK0A 1SR6C 4M2OA 2PYQA 4A4CA 2L0PA 3CWGA 5HKYA 3GK2A 3CABA 1OOFA 2BE4A 2K2AA 3DY9A 4MLWA 4U8DA 4PE7A 1OZSA 2BCXA 2HPSA 1XFZO 3CR5X 4L9MA 1OOHA 3LL8B 2SASA 1CFDA 1QLKA 5G08A 3TDUA 4DIRA 3CTNA 3O78A 1G8IA 1KK8C 3N7HA 2ZFDA 3GK1A 1NPQA 3R72A 3D0YB 4TNCA 1X02A 2TN4A 4GFTA 2NCOA 2HQ8A 2LMVA 2LP2A 1PALA 2LCPA 2LV7A 1SYMA 1XO5A 1ZOTB 2AUCA 1DQEA 2KDHA 1C7WA 2M1KB 1DJYA 1IKUA 1W7JB 2CBLA 2MLFC 1NWDA 3NXAA 1CDLA 4A4BA 1KCYA 1DJXA 1JC2A 1CLBA 3I5FB 1BT6A 2OS8B 5I94A 2OTGC 2K2FA 1Z4HA 5J3XA 4D1EA 1Q80A 1SPYA 3E3RA 3AKBA 4YGAA 2BL0B 1CFFA 2Q91A 1QS7A 4OR9B 5KSZA 4PHNA 1KFUL 4INXA 1A03A 1XVJA 3SS3A 3WHTB 1IRJA 1BMOA 1DVIA 1ZACA 2ZRSA 1EXRA 3EKJA 4PE0A 2K0JA 3O6BA 5DKNA 1DF0B 1QX2A 4R1EA 4GUKA 2HQWA 4PE4A 1CKKA 1MQ1A 2K7DA 2LVJA 4QJ3B 1C07A 2ZKMX 2WCEA 1PVBA 1K95A 4USLA 3I5GB 5DICA 2WCKA 1MXEA 3LLEA 3CS1A 3D78A 1ORGA 2NXQA 4INWA 1BJFA 2LC5A 5EL2A 5FI7A 3VROA 1IWQA 4WRIA 3AAKA 4YBHB 1QV1A 1IH0A 3KHEA 2M97A 1S6JA 3KO0A 1M39A 1RTP1 2KYFA 2BECA 5HKZA 4JWQA 1TOPA 5FYXA 1QJTA 1IQ3A 3A8RA 3PATA 1ZUZA 3EK4A 4GPLB 2KAXA 4YRUA 1K9UA 1PULA 2OS8C 3TS5B 2MHHA 1SKTA 2M0RA 1NCYA 3UNWA 1NP8A 1DGVA 3FE8A 1TCOB 1F71A 1W9ZA 4BY4A 1RJVA 5DKRA 1YVLA 3CZ0A 2YGUA 2COLB 3WHUB 1RK9A 1SSEB 1GJYA 1H8BA 1IG5A 1G4YR 2GGMA 3H4SE 1QLSA 3IQQA 2FCEA 2LVIA 1OMDA 2P6BB 1SRAA 2QACA 1YTZC 2L98A 3BFHA 3I5GC 3R1PA 2LUCA 1DJGA 4OKHA 3SG3A 4QJ4B 2KLDA 1EH2A 3EK7A 1CTRA 1QXPA 1TWOA 3VGOA 5BPJA 3DF0A 4I5NB 4GAOA 1OMVA 2P71A 4FQOA 4OZDA 3IVTA 2I7AA 2Y5IA 1MUXA 3R1OA 2ZNEA 5D69A 2JRFA 3PSRA 4MZKA 2KLEA 4PT1A 2SCPA 1E8AA 1M45A 1SCMB 2JTZA 3BFAA 2CTNA 2JULA 3OHMB 3DVKA 1QX7A 3O4XA 3CDNA 3TUYB 1ZMZA 2JPTA 1NIWA 2LLSA 4MBEA 1S6CA 2I94A 3O2PA 3TS5C 5CSIA 2F3YA 1PRWA 1V1GA 1MHOA 4DUQA 2JZIA 4NDCA 2QEOA 4C0KA 2JNFA 4XJKA 1EG4A 1YVHA 2G2BA 2Q4UA 3VB1A 1MXLC 4C0JA 2CNPA 3I5IB 3PN7B 2KFHA 2KGBC 1EL4A 1KK7Y 5JOLA 1XFUO 3FWBA 3LK1A 1F4QA 2KSPA 1WLMA 1NCXA 2G9BA 2KI6D 1QX5B 1NYAA 1QTXA 4QJ5B 1K90D 1DELA 1XA5A 4XYNA 4ICBA 1YRTB 4I5LB 3SG7A 1M31A 1GM0A 1J55A 1K9PA 3WXAA 1QV0A 1DMOA 3O4YA 1SL8A 3R1VA 3PLFB 3TDZA 2PVBA 1CM4A 3CR4X 5AXIA 2LHIA 2RGIA 1BR1B 5CSNA 3GOFA 4OCIA 4JKTA 4M2QA 2M7LA 1XYDA 1A75B 3EVRA 3TUYC 3BQ3A 3EKHA 4PHMA 4PHJA 5TNCA 2GGZA 3RZSA 3FS7A 1B7TY 1MR8A 1DEKA 1RROA 1S5GZ 4YGDB 2BCBA 1U5IB 2WCFA 3VRRA 4DRWA 2PASA 2M49B 3DZTA 1L2OB 3S0DA 1YR5A 2HETA 3D10A 1SW8A 1AVSA 2ZNDA 1ALVA 1K96A 1QWVA 3I5IC 3PN7C 1Y1UA 5K89A 1BG1A 2CCMA 1DJIA 1XFRA 2WOSA 1P28A 2H61C 2LP3A 2M8UA 2M9GA 1FF1A 1UURA 2L50A 2QEHA 3I5HB 1F4OA 1WRKA 3NSKA 4YGCB 2L51A 2WC8A 2JWWA 2LVKA 5FI2A 1WDCB 1TUZA 2QEVA 2JXCA 2NZ0A 2KYCA 2K60A 3D76A 2LLUA 1KQMB 4IJ7A 1W7IB 5JJGA 3NGVA 1BF5A 1GGWA 3L4AA 1CLMA 3KF9A 1WRZA 3B88A 4I5KA 5F6TA 1K94A 2BKHB 4FTGA 2JT0A 3K1EA 2L4IA 1GQMA 1LA0A 2M29A 1JFKA 1FBVA 1TNWA 2L5XB 1SL7A 1AUIB 2ISDA 1C3ZA 2GTEA 2WCJA 1FI5A 1KWOB 2KFFA 2B1UA 2P70A 1LKJA 2KQYA 2AAOA 2LMTA 2KFGA 2QDIA 1SMGA 1XFVO 3BOWB 4MVFA 3GK4X 1EG3A 3KEVA 2JT3A 4IL1A 4P2YB 1L2OC 2ZRTA 3DVMA 3SG6A 1XK4C 3MSEB 1NUBA 3I5FC 1R2UA 1F70A 4HREE 3BUXB 1Y6WA 3DVEA 4GNKB 5CPVA 1G33A 3VRPA 2Y1MA 1S36A 5HL1A 4PE1A 5ER5A 5GQQC 1KFXS 1UWOA 2BL0C 2WORA 4MRYA 5B8IB 1R6PA 1YUTA 2KAVA 2F8PA 5D7FA 1CFCA 2L2CA 3HCMA 4C0LA 4JQ0D 1YX7A 4MRXA 1UUSA 1V1FA 1WDCC 3SG2A 5AERA 4CPVA 3BXKA 2BBNA 1S26D 1KQMC
chains in the Genus database with same CATH topology
5HLOA 2O60A 1KSMA 1M46A 2K8MB 3OX5A 4NDDA 4ORBB 1AHRA 1DGUA 1HT9A 1OSAA 2L4HA 1FPWA 2QPTA 1AJ4A 3IQOA 2M7NA 1AK8A 2H2KA 1KWOC 3JTDB 1KFUS 3SIBA 1OZOA 2JXLA 2LUXA 1QVIZ 1YRUB 3AKAA 1JFJA 1S1EA 1A2XA 2PSRA 2BCAA 2A4JA 2FOTA 1N2DA 1TRFA 3JVTB 4Q04A 5I8NA 1F8HA 1JF0A 1A4PA 3CR2A 1CDMA 3BUOB 5CSJA 2D8NA 1D1OA 4I5JA 1QATA 1NCZA 2KGRA 2MA2A 4ORAB 1K8UA 1AP4A 1CDPA 2KAYA 1S6IA 1B8CA 1L7ZA 1OE9B 2AMIA 1DJZA 3C1VA 3EVUA 5KU1A 3BYAA 4AOMA 1F55A 1KK8B 3QRXA 4XJKB 2MLEC 1YUUA 4MN0A 1RWYA 4E68A 3EK8A 1B8RA 2H61A 1YURA 1TNXA 3TZ1A 3LCPC 2FJUB 1UHNA 3WNXB 1NX3A 1DJWA 2LM5A 1Y1XA 2WCBA 3BUWB 2F33A 2Y4QA 1RECA 4NQGA 1B8LA 1DJHA 3JTDC 3NSLA 4YGEB 2BBMA 2F2PA 3OX6A 2OTGB 1FI6A 2R2IA 1SCMC 4DCKA 1J7RA 2PRUA 5I2OA 2GV5A 1JSAA 1JUOA 2KI6C 3JVTC 2L2EA 3CLNA 2O5GA 4AQIA 2BKIB 4YI9A 2EHBA 2MJWB 5CSFA 1A75A 4ORCB 1PK0D 1K2HA 1EJ3A 1LA3A 1TCFA 1Y0VH 3HX4A 3D0YA 4WQ3A 1J7QA 2LE9B 2V53A 4JPZB 4M2PA 2NCPA 1K93D 4CIDA 4OVNF 4GGFC 2K7CA 1LXFC 1U5IA 4PHKA 4MZJA 1YUSA 1XFWO 1NX0A 2NLNA 1XK4A 1KFXL 1NX1A 1PVAA 1TIZA 2LMUA 5KTYA 4DS7A 1KQVA 2JU0A 1SK6D 1ALWA 1PSRA 4MZLA 4GGNA 2MBXA 4YGBB 1BU3A 2LNKA 3BUNB 2DOQA 1J1EA 1S5GY 4MEWA 1QASA 4N5XA 1H4BA 2FCDA 3PALA 1JBAA 2F2OA 5I2QA 2LHLA 1RFJA 2E30A 1DF0A 1XFXO 1K9KA 1SCVA 5HKWA 2CXJA 1NX2A 2ZN9A 1OOJA 1UP5A 1Y1AA 2LAPA 1QIVA 1BODA 2JNXA 1DT7B 1MWNA 2LLTA 1C7VA 2KNEA 1HQVA 1F54A 5I2LA 1J1DA 1UHHA 1N0YA 1SL9A 1IGVA 5AANA 2K7BA 4YI8A 1FW4A 1TTXA 1NSHA 5AFPA 1B1GA 3CGAA 3BOWA 1TN4A 3NSOA 1CB1A 1AJ5A 1B9AA 3A4UB 3ICBA 2JC2A 1GGZA 3SG4A 4CFRA 1A29A 3FIAA 5PALA 1BOCA 3I5HC 3SG5A 2M3WA 3OB1B 1J7PA 3OB2B 1MF8B 1BR4B 1IJ5A 5AEQA 3SJSA 4UPGA 2KOTA 3PM8A 2VRGA 2HF5A 2KBMA 4N1GA 2JOJA 3M0WA 3EVVA 2KI4B 1TNPA 1LINA 2JQ6A 1JF2A 1LVCD 1IJ6A 1WLZA 1CDNA 3OP0A 4MSPA 1CNPA 2LVVA 1SBJA 1M63B 4HSZA 4F0ZB 1B4CA 3DD4A 2KHNA 1TNQA 2ZN8A 2K61A 4BY5A 5HYDA 2PMYA 2JT8A 4GBAA 4CLNA 2EC6B 3DF0B 4HRHA 2BE6A 3IF7A 1PSBA 1OMRA 2WNDA 4P5OE 3ZNIA 1SR6B 1CLLA 1VRKA 2KQ6A 2LANA 1S3PA 4N1FA 4ZCVA 1B47A 5HLVA 3AAJA 1KK7Z 3RLZA 5IBWA 1ODBA 4WQ2A 3CZTX 2I18A 1SY9A 3ZWHA 2EGDA 1SNLA 1UHIA 4HRGA 4PCWA 1WRLA 1QVIY 2KBIA 1CFPA 5DKQA 2F3ZA 4ETOA 1OQPA 2PALA 2KI4C 4GGFA 1ZFSA 1KSOA 2CT9A 3F45A 4PDZA 5ER4X 3DVJA 1XFYO 1QIWA 4OV2A 2IS9A 3VRNA 3TDIA 4AQJA 1N65A 4PALA 1CMFA 2K7OA 3KPXA 1CMGA 2Y1NA 3FWCA 1J7OA 3BUMB 1DTLA 2MAZA 4NDBA 1YX8A 3RM1A 3VRQA 1IQ5A 2OPOA 2E6WA 1UHJA 2M1UA 2MRDA 1WY9A 2EC6C 3SIAA 4CFQA 1B7TZ 2JTTA 2I2RE 3NSIA 1UHKA 3PFVA 4ZCUA 1CM1A 3K21A 4A4CA 3LK0A 1SR6C 4M2OA 2L0PA 3CWGA 5HKYA 3GK2A 2BE4A 2K2AA 4MLWA 4U8DA 4PE7A 1OZSA 2BCXA 2HPSA 1XFZO 3CR5X 4L9MA 3LL8B 2SASA 1CFDA 1QLKA 5G08A 3TDUA 4DIRA 3CTNA 3O78A 1G8IA 1KK8C 2ZFDA 3GK1A 1NPQA 3D0YB 4TNCA 1X02A 2TN4A 4GFTA 2NCOA 2HQ8A 2LMVA 2LP2A 1PALA 2LCPA 2LV7A 1SYMA 1XO5A 1ZOTB 2AUCA 2KDHA 2M1KB 1C7WA 1IKUA 1DJYA 1W7JB 2CBLA 2MLFC 1NWDA 3NXAA 1CDLA 4A4BA 1KCYA 1DJXA 1JC2A 1CLBA 3I5FB 1BT6A 2OS8B 2OTGC 2K2FA 5J3XA 4D1EA 1Q80A 1SPYA 3E3RA 3AKBA 4YGAA 2BL0B 1CFFA 2Q91A 1QS7A 4OR9B 5KSZA 4PHNA 1KFUL 1A03A 1XVJA 3WHTB 1IRJA 1BMOA 1DVIA 1ZACA 2ZRSA 1EXRA 3EKJA 4PE0A 2K0JA 3O6BA 5DKNA 1DF0B 1QX2A 4R1EA 4GUKA 2HQWA 4PE4A 1CKKA 1MQ1A 2K7DA 2LVJA 4QJ3B 1C07A 2ZKMX 2WCEA 1PVBA 1K95A 4USLA 3I5GB 1MXEA 3LLEA 3CS1A 2NXQA 1BJFA 2LC5A 3VROA 1IWQA 4WRIA 3AAKA 4YBHB 1QV1A 1IH0A 3KHEA 2M97A 1S6JA 3KO0A 1M39A 1RTP1 2KYFA 2BECA 5HKZA 4JWQA 1TOPA 5FYXA 1QJTA 1IQ3A 3A8RA 3PATA 1ZUZA 3EK4A 4GPLB 2KAXA 4YRUA 1K9UA 1PULA 2OS8C 3TS5B 2MHHA 1SKTA 2M0RA 1NCYA 1NP8A 1DGVA 1TCOB 1F71A 4BY4A 1RJVA 5DKRA 1YVLA 2COLB 3WHUB 1RK9A 1GJYA 1H8BA 1IG5A 1G4YR 2GGMA 3H4SE 1QLSA 3IQQA 2FCEA 2LVIA 1OMDA 2P6BB 1SRAA 2QACA 1YTZC 2L98A 3I5GC 4OKHA 3SG3A 2LUCA 1DJGA 4QJ4B 1EH2A 3EK7A 1CTRA 1QXPA 3VGOA 5BPJA 3DF0A 4I5NB 4GAOA 1OMVA 4FQOA 2I7AA 2Y5IA 1MUXA 2ZNEA 5D69A 2JRFA 3PSRA 4MZKA 2SCPA 1E8AA 1M45A 1SCMB 2JTZA 2CTNA 2JULA 3OHMB 3DVKA 1QX7A 3TUYB 1BLQA 1ZMZA 2JPTA 1NIWA 2LLSA 4MBEA 1S6CA 2I94A 3O2PA 3TS5C 5CSIA 2F3YA 1V1GA 1PRWA 1MHOA 4DUQA 2JZIA 4NDCA 4C0KA 2JNFA 4XJKA 1EG4A 1YVHA 2G2BA 2Q4UA 1MXLC 4C0JA 2CNPA 3I5IB 3PN7B 2KFHA 2KGBC 1EL4A 1KK7Y 5JOLA 1XFUO 3FWBA 3LK1A 1F4QA 2KSPA 1WLMA 1NCXA 2G9BA 2KI6D 1QX5B 1NYAA 1QTXA 4QJ5B 1K90D 1XA5A 4XYNA 4ICBA 1YRTB 4I5LB 3SG7A 1M31A 1J55A 1K9PA 3WXAA 1QV0A 1DMOA 3O4YA 1SL8A 3PLFB 3TDZA 2PVBA 1CM4A 3CR4X 5AXIA 2LHIA 2RGIA 1BR1B 5CSNA 3GOFA 4OCIA 4M2QA 2M7LA 1XYDA 1A75B 3EVRA 3TUYC 3BQ3A 3EKHA 4PHMA 4PHJA 5TNCA 2GGZA 3FS7A 1B7TY 1MR8A 1S5GZ 1RROA 4YGDB 2BCBA 1U5IB 2WCFA 3VRRA 4DRWA 2PASA 2M49B 1L2OB 1YR5A 2HETA 3D10A 1SW8A 1AVSA 2ZNDA 1ALVA 1K96A 3I5IC 3PN7C 1Y1UA 5K89A 1BG1A 2CCMA 1DJIA 2WOSA 2H61C 2LP3A 2M9GA 2M8UA 1FF1A 1UURA 2L50A 3I5HB 1F4OA 1WRKA 3NSKA 4YGCB 2L51A 2WC8A 2JWWA 2LVKA 1WDCB 2JXCA 2NZ0A 2KYCA 2LLUA 1KQMB 1W7IB 5JJGA 1BF5A 1GGWA 1CLMA 3KF9A 1WRZA 4I5KA 5F6TA 1K94A 2BKHB 4FTGA 2JT0A 2L4IA 1GQMA 1LA0A 2M29A 1JFKA 1FBVA 1TNWA 2L5XB 1SL7A 1AUIB 2ISDA 1FI5A 1KWOB 2KFFA 2B1UA 1LKJA 2KQYA 2AAOA 2LMTA 2KFGA 1JWDA 1SMGA 1XFVO 3BOWB 4MVFA 3GK4X 1EG3A 3KEVA 2JT3A 4IL1A 4P2YB 1L2OC 2ZRTA 3DVMA 3SG6A 1XK4C 3MSEB 1NUBA 3I5FC 1R2UA 1F70A 4HREE 3BUXB 1Y6WA 3DVEA 4GNKB 5CPVA 1G33A 3VRPA 2Y1MA 1S36A 4PE1A 5ER5A 5GQQC 1KFXS 1UWOA 2BL0C 2WORA 4MRYA 5B8IB 1R6PA 1YUTA 2KAVA 2F8PA 5D7FA 1CFCA 3HCMA 4C0LA 4JQ0D 1YX7A 4MRXA 1UUSA 1V1FA 1WDCC 3SG2A 5AERA 4CPVA 3BXKA 2BBNA 1S26D 1KQMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HLO A;  2O60 A;  1KSM A;  1M46 A;  2K8M B;  3OX5 A;  4NDD A;  4ORB B;  1AHR A;  1DGU A;  1HT9 A;  1OSA A;  2L4H A;  1FPW A;  2QPT A;  1AJ4 A;  3IQO A;  2M7N A;  1AK8 A;  2H2K A;  1KWO C;  3JTD B;  1KFU S;  3SIB A;  1OZO A;  2JXL A;  2LUX A;  1QVI Z;  1YRU B;  3AKA A;  1JFJ A;  1S1E A;  1A2X A;  2PSR A;  2BCA A;  2A4J A;  2FOT A;  1N2D A;  1TRF A;  3JVT B;  4Q04 A;  5I8N A;  1F8H A;  1JF0 A;  1A4P A;  3CR2 A;  1CDM A;  3BUO B;  5CSJ A;  2D8N A;  1D1O A;  4I5J A;  1QAT A;  1NCZ A;  2KGR A;  2MA2 A;  4ORA B;  1K8U A;  1AP4 A;  1CDP A;  2KAY A;  1S6I A;  1B8C A;  1L7Z A;  1OE9 B;  2AMI A;  1DJZ A;  3C1V A;  3EVU A;  5KU1 A;  3BYA A;  4AOM A;  1F55 A;  1KK8 B;  3QRX A;  4XJK B;  2MLE C;  1YUU A;  4MN0 A;  1RWY A;  4E68 A;  3EK8 A;  1B8R A;  2H61 A;  1YUR A;  1TNX A;  3TZ1 A;  3LCP C;  2FJU B;  1UHN A;  3WNX B;  1NX3 A;  1DJW A;  2LM5 A;  1Y1X A;  2WCB A;  3BUW B;  2F33 A;  2Y4Q A;  1REC A;  4NQG A;  1B8L A;  1DJH A;  3JTD C;  3NSL A;  4YGE B;  2BBM A;  2F2P A;  3OX6 A;  2OTG B;  1FI6 A;  2R2I A;  1SCM C;  4DCK A;  1J7R A;  2PRU A;  5I2O A;  2GV5 A;  1JSA A;  1JUO A;  2KI6 C;  3JVT C;  2L2E A;  3CLN A;  2O5G A;  4AQI A;  2BKI B;  4YI9 A;  2EHB A;  2MJW B;  5CSF A;  1A75 A;  4ORC B;  1PK0 D;  1K2H A;  1EJ3 A;  1LA3 A;  1TCF A;  1Y0V H;  3HX4 A;  3D0Y A;  4WQ3 A;  1J7Q A;  2LE9 B;  2V53 A;  4JPZ B;  4M2P A;  2NCP A;  1K93 D;  4CID A;  4OVN F;  4GGF C;  2K7C A;  1LXF C;  1U5I A;  4PHK A;  4MZJ A;  1YUS A;  1XFW O;  1NX0 A;  2NLN A;  1XK4 A;  1KFX L;  1NX1 A;  1PVA A;  1TIZ A;  2LMU A;  5KTY A;  4DS7 A;  1KQV A;  2JU0 A;  1SK6 D;  1ALW A;  1PSR A;  4MZL A;  4GGN A;  2MBX A;  4YGB B;  1BU3 A;  2LNK A;  3BUN B;  2DOQ A;  1J1E A;  1S5G Y;  4MEW A;  1QAS A;  4N5X A;  1H4B A;  2FCD A;  3PAL A;  1JBA A;  2F2O A;  5I2Q A;  2LHL A;  1RFJ A;  2E30 A;  1DF0 A;  1XFX O;  1K9K A;  1SCV A;  5HKW A;  2CXJ A;  1NX2 A;  2ZN9 A;  1OOJ A;  1UP5 A;  1Y1A A;  2LAP A;  1QIV A;  1BOD A;  2JNX A;  1DT7 B;  1MWN A;  2LLT A;  1C7V A;  2KNE A;  1HQV A;  1F54 A;  5I2L A;  1J1D A;  1UHH A;  1N0Y A;  1SL9 A;  1IGV A;  5AAN A;  2K7B A;  4YI8 A;  1FW4 A;  1TTX A;  1NSH A;  5AFP A;  1B1G A;  3CGA A;  3BOW A;  1TN4 A;  3NSO A;  1CB1 A;  1AJ5 A;  1B9A A;  3A4U B;  3ICB A;  2JC2 A;  1GGZ A;  3SG4 A;  4CFR A;  1A29 A;  3FIA A;  5PAL A;  1BOC A;  3I5H C;  3SG5 A;  2M3W A;  3OB1 B;  1J7P A;  3OB2 B;  1MF8 B;  1BR4 B;  1IJ5 A;  5AEQ A;  3SJS A;  4UPG A;  2KOT A;  3PM8 A;  2VRG A;  2HF5 A;  2KBM A;  4N1G A;  2JOJ A;  3M0W A;  3EVV A;  2KI4 B;  1TNP A;  1LIN A;  2JQ6 A;  1JF2 A;  1LVC D;  1IJ6 A;  1WLZ A;  1CDN A;  3OP0 A;  4MSP A;  1CNP A;  2LVV A;  1SBJ A;  1M63 B;  4HSZ A;  4F0Z B;  1B4C A;  3DD4 A;  2KHN A;  1TNQ A;  2ZN8 A;  2K61 A;  4BY5 A;  5HYD A;  2PMY A;  2JT8 A;  4GBA A;  4CLN A;  2EC6 B;  3DF0 B;  4HRH A;  2BE6 A;  3IF7 A;  1PSB A;  1OMR A;  2WND A;  4P5O E;  3ZNI A;  1SR6 B;  1CLL A;  1VRK A;  2KQ6 A;  2LAN A;  1S3P A;  4N1F A;  4ZCV A;  1B47 A;  5HLV A;  3AAJ A;  1KK7 Z;  3RLZ A;  5IBW A;  1ODB A;  4WQ2 A;  3CZT X;  2I18 A;  1SY9 A;  3ZWH A;  2EGD A;  1SNL A;  1UHI A;  4HRG A;  4PCW A;  1WRL A;  1QVI Y;  2KBI A;  1CFP A;  5DKQ A;  2F3Z A;  4ETO A;  1OQP A;  2PAL A;  2KI4 C;  4GGF A;  1ZFS A;  1KSO A;  2CT9 A;  3F45 A;  4PDZ A;  5ER4 X;  3DVJ A;  1XFY O;  1QIW A;  4OV2 A;  2IS9 A;  3VRN A;  3TDI A;  4AQJ A;  1N65 A;  4PAL A;  1CMF A;  2K7O A;  3KPX A;  1CMG A;  2Y1N A;  3FWC A;  1J7O A;  3BUM B;  1DTL A;  2MAZ A;  4NDB A;  1YX8 A;  3RM1 A;  3VRQ A;  1IQ5 A;  2OPO A;  2E6W A;  1UHJ A;  2M1U A;  2MRD A;  1WY9 A;  2EC6 C;  3SIA A;  4CFQ A;  1B7T Z;  2JTT A;  2I2R E;  3NSI A;  1UHK A;  3PFV A;  4ZCU A;  1CM1 A;  3K21 A;  4A4C A;  3LK0 A;  1SR6 C;  4M2O A;  2L0P A;  3CWG A;  5HKY A;  3GK2 A;  2BE4 A;  2K2A A;  4MLW A;  4U8D A;  4PE7 A;  1OZS A;  2BCX A;  2HPS A;  1XFZ O;  3CR5 X;  4L9M A;  3LL8 B;  2SAS A;  1CFD A;  1QLK A;  5G08 A;  3TDU A;  4DIR A;  3CTN A;  3O78 A;  1G8I A;  1KK8 C;  2ZFD A;  3GK1 A;  1NPQ A;  3D0Y B;  4TNC A;  1X02 A;  2TN4 A;  4GFT A;  2NCO A;  2HQ8 A;  2LMV A;  2LP2 A;  1PAL A;  2LCP A;  2LV7 A;  1SYM A;  1XO5 A;  1ZOT B;  2AUC A;  2KDH A;  2M1K B;  1C7W A;  1IKU A;  1DJY A;  1W7J B;  2CBL A;  2MLF C;  1NWD A;  3NXA A;  1CDL A;  4A4B A;  1KCY A;  1DJX A;  1JC2 A;  1CLB A;  3I5F B;  1BT6 A;  2OS8 B;  2OTG C;  2K2F A;  5J3X A;  4D1E A;  1Q80 A;  1SPY A;  3E3R A;  3AKB A;  4YGA A;  2BL0 B;  1CFF A;  2Q91 A;  1QS7 A;  4OR9 B;  5KSZ A;  4PHN A;  1KFU L;  1A03 A;  1XVJ A;  3WHT B;  1IRJ A;  1BMO A;  1DVI A;  1ZAC A;  2ZRS A;  1EXR A;  3EKJ A;  4PE0 A;  2K0J A;  3O6B A;  5DKN A;  1DF0 B;  1QX2 A;  4R1E A;  4GUK A;  2HQW A;  4PE4 A;  1CKK A;  1MQ1 A;  2K7D A;  2LVJ A;  4QJ3 B;  1C07 A;  2ZKM X;  2WCE A;  1PVB A;  1K95 A;  4USL A;  3I5G B;  1MXE A;  3LLE A;  3CS1 A;  2NXQ A;  1BJF A;  2LC5 A;  3VRO A;  1IWQ A;  4WRI A;  3AAK A;  4YBH B;  1QV1 A;  1IH0 A;  3KHE A;  2M97 A;  1S6J A;  3KO0 A;  1M39 A;  1RTP 1;  2KYF A;  2BEC A;  5HKZ A;  4JWQ A;  1TOP A;  5FYX A;  1QJT A;  1IQ3 A;  3A8R A;  3PAT A;  1ZUZ A;  3EK4 A;  4GPL B;  2KAX A;  4YRU A;  1K9U A;  1PUL A;  2OS8 C;  3TS5 B;  2MHH A;  1SKT A;  2M0R A;  1NCY A;  1NP8 A;  1DGV A;  1TCO B;  1F71 A;  4BY4 A;  1RJV A;  5DKR A;  1YVL A;  2COL B;  3WHU B;  1RK9 A;  1GJY A;  1H8B A;  1IG5 A;  1G4Y R;  2GGM A;  3H4S E;  1QLS A;  3IQQ A;  2FCE A;  2LVI A;  1OMD A;  2P6B B;  1SRA A;  2QAC A;  1YTZ C;  2L98 A;  3I5G C;  4OKH A;  3SG3 A;  2LUC A;  1DJG A;  4QJ4 B;  1EH2 A;  3EK7 A;  1CTR A;  1QXP A;  3VGO A;  5BPJ A;  3DF0 A;  4I5N B;  4GAO A;  1OMV A;  4FQO A;  2I7A A;  2Y5I A;  1MUX A;  2ZNE A;  5D69 A;  2JRF A;  3PSR A;  4MZK A;  2SCP A;  1E8A A;  1M45 A;  1SCM B;  2JTZ A;  2CTN A;  2JUL A;  3OHM B;  3DVK A;  1QX7 A;  3TUY B;  1BLQ A;  1ZMZ A;  2JPT A;  1NIW A;  2LLS A;  4MBE A;  1S6C A;  2I94 A;  3O2P A;  3TS5 C;  5CSI A;  2F3Y A;  1V1G A;  1PRW A;  1MHO A;  4DUQ A;  2JZI A;  4NDC A;  4C0K A;  2JNF A;  4XJK A;  1EG4 A;  1YVH A;  2G2B A;  2Q4U A;  1MXL C;  4C0J A;  2CNP A;  3I5I B;  3PN7 B;  2KFH A;  2KGB C;  1EL4 A;  1KK7 Y;  5JOL A;  1XFU O;  3FWB A;  3LK1 A;  1F4Q A;  2KSP A;  1WLM A;  1NCX A;  2G9B A;  2KI6 D;  1QX5 B;  1NYA A;  1QTX A;  4QJ5 B;  1K90 D;  1XA5 A;  4XYN A;  4ICB A;  1YRT B;  4I5L B;  3SG7 A;  1M31 A;  1J55 A;  1K9P A;  3WXA A;  1QV0 A;  1DMO A;  3O4Y A;  1SL8 A;  3PLF B;  3TDZ A;  2PVB A;  1CM4 A;  3CR4 X;  5AXI A;  2LHI A;  2RGI A;  1BR1 B;  5CSN A;  3GOF A;  4OCI A;  4M2Q A;  2M7L A;  1XYD A;  1A75 B;  3EVR A;  3TUY C;  3BQ3 A;  3EKH A;  4PHM A;  4PHJ A;  5TNC A;  2GGZ A;  3FS7 A;  1B7T Y;  1MR8 A;  1S5G Z;  1RRO A;  4YGD B;  2BCB A;  1U5I B;  2WCF A;  3VRR A;  4DRW A;  2PAS A;  2M49 B;  1L2O B;  1YR5 A;  2HET A;  3D10 A;  1SW8 A;  1AVS A;  2ZND A;  1ALV A;  1K96 A;  3I5I C;  3PN7 C;  1Y1U A;  5K89 A;  1BG1 A;  2CCM A;  1DJI A;  2WOS A;  2H61 C;  2LP3 A;  2M9G A;  2M8U A;  1FF1 A;  1UUR A;  2L50 A;  3I5H B;  1F4O A;  1WRK A;  3NSK A;  4YGC B;  2L51 A;  2WC8 A;  2JWW A;  2LVK A;  1WDC B;  2JXC A;  2NZ0 A;  2KYC A;  2LLU A;  1KQM B;  1W7I B;  5JJG A;  1BF5 A;  1GGW A;  1CLM A;  3KF9 A;  1WRZ A;  4I5K A;  5F6T A;  1K94 A;  2BKH B;  4FTG A;  2JT0 A;  2L4I A;  1GQM A;  1LA0 A;  2M29 A;  1JFK A;  1FBV A;  1TNW A;  2L5X B;  1SL7 A;  1AUI B;  2ISD A;  1FI5 A;  1KWO B;  2KFF A;  2B1U A;  1LKJ A;  2KQY A;  2AAO A;  2LMT A;  2KFG A;  1JWD A;  1SMG A;  1XFV O;  3BOW B;  4MVF A;  3GK4 X;  1EG3 A;  3KEV A;  2JT3 A;  4IL1 A;  4P2Y B;  1L2O C;  2ZRT A;  3DVM A;  3SG6 A;  1XK4 C;  3MSE B;  1NUB A;  3I5F C;  1R2U A;  1F70 A;  4HRE E;  3BUX B;  1Y6W A;  3DVE A;  4GNK B;  5CPV A;  1G33 A;  3VRP A;  2Y1M A;  1S36 A;  4PE1 A;  5ER5 A;  5GQQ C;  1KFX S;  1UWO A;  2BL0 C;  2WOR A;  4MRY A;  5B8I B;  1R6P A;  1YUT A;  2KAV A;  2F8P A;  5D7F A;  1CFC A;  3HCM A;  4C0L A;  4JQ0 D;  1YX7 A;  4MRX A;  1UUS A;  1V1F A;  1WDC C;  3SG2 A;  5AER A;  4CPV A;  3BXK A;  2BBN A;  1S26 D;  1KQM C; 
#chains in the Genus database with same CATH topology
 1T14 A;  5HLO A;  2O60 A;  1KSM A;  1M46 A;  2K8M B;  3OX5 A;  4NDD A;  4ORB B;  1AHR A;  1DGU A;  1HT9 A;  1OSA A;  2L4H A;  1FPW A;  2QPT A;  1AJ4 A;  3IQO A;  2M7N A;  5D3O A;  1AK8 A;  2H2K A;  1KWO C;  3JTD B;  1KFU S;  3SIB A;  1OZO A;  2JXL A;  2LUX A;  1QVI Z;  1YRU B;  3AKA A;  1JFJ A;  1S1E A;  1A2X A;  2PSR A;  3CZ2 A;  3BJH A;  2BCA A;  2A4J A;  2FOT A;  1N2D A;  1TRF A;  3JVT B;  4Q04 A;  5I8N A;  1F8H A;  1JF0 A;  1A4P A;  3CR2 A;  1CDM A;  3BUO B;  2KPH A;  5CSJ A;  2D8N A;  1D1O A;  4I5J A;  1QAT A;  1NCZ A;  2KGR A;  2MA2 A;  4ORA B;  1K8U A;  2ERB A;  3FE9 A;  1AP4 A;  1CDP A;  2KAY A;  1S6I A;  1B8C A;  1L7Z A;  1OE9 B;  2AMI A;  3S0G A;  1DJZ A;  3C1V A;  3EVU A;  5KU1 A;  3BYA A;  4AOM A;  1F55 A;  1KK8 B;  3QRX A;  4XJK B;  2MLE C;  1YUU A;  4MN0 A;  3BFB A;  1OW4 A;  1RWY A;  4E68 A;  3EK8 A;  1B8R A;  2H61 A;  1YUR A;  2WC5 A;  1TNX A;  2FJY A;  2WCH A;  2FJU B;  3LCP C;  1UHN A;  3TZ1 A;  3WNX B;  1NX3 A;  1DJW A;  2LM5 A;  1Y1X A;  2WCB A;  3S0A A;  3BUW B;  2F33 A;  1LS8 A;  1REC A;  1Z2C B;  2Y4Q A;  1B8L A;  1DJH A;  3DXL A;  3JTD C;  3L4L A;  3NSL A;  4NQG A;  4YGE B;  2BBM A;  2F2P A;  3OX6 A;  2BAP A;  2OTG B;  1FI6 A;  2R2I A;  1SCM C;  2BNX A;  1J7R A;  4DCK A;  2PRU A;  5I2O A;  4JD9 A;  2GV5 A;  1JSA A;  1JUO A;  2KI6 C;  3JVT C;  2L2E A;  3CLN A;  2O5G A;  3Q8I A;  2BKI B;  4AQI A;  4F7F A;  4YI9 A;  3OGN A;  3CYZ A;  2EHB A;  2MJW B;  5CSF A;  1A75 A;  4ORC B;  1PK0 D;  1K2H A;  3L47 A;  1EJ3 A;  1LA3 A;  1TCF A;  1Y0V H;  3HX4 A;  3D0Y A;  4WQ3 A;  1J7Q A;  2LE9 B;  2V53 A;  4JPZ B;  4M2P A;  2NCP A;  1K93 D;  4CID A;  3OBV A;  4OVN F;  4GGF C;  2K7C A;  1LXF C;  1U5I A;  4PHK A;  4MZJ A;  1YUS A;  1XFW O;  1NX0 A;  2NLN A;  1XK4 A;  1KFX L;  1NX1 A;  1PVA A;  1TIZ A;  2LMU A;  5KTY A;  4DS7 A;  1KQV A;  2JU0 A;  1SK6 D;  1ALW A;  1PSR A;  3DYE A;  4MZL A;  4GGN A;  2MBX A;  3UO9 A;  4YGB B;  1BU3 A;  3SS5 A;  3PJI A;  2LNK A;  3BUN B;  2DOQ A;  1J1E A;  1S5G Y;  4MEW A;  1QAS A;  4N5X A;  1H4B A;  2FCD A;  2WC6 A;  3PAL A;  1JBA A;  2F2O A;  2WCL A;  3EG5 B;  5I2Q A;  2LHL A;  2WCM A;  1RFJ A;  2E30 A;  3B7A A;  1DF0 A;  1XFX O;  1K9K A;  1SCV A;  5HKW A;  2CXJ A;  1NX2 A;  3D74 A;  2ZN9 A;  1OOJ A;  1UP5 A;  1Y1A A;  3NHT A;  1TUJ A;  2LAP A;  1QIV A;  1BOD A;  2JNX A;  1DT7 B;  1MWN A;  2LLT A;  1C7V A;  2KNE A;  3B87 A;  1HQV A;  1F54 A;  5I2L A;  1J1D A;  1UHH A;  1N0Y A;  1SL9 A;  2QEB A;  1IGV A;  5AAN A;  2K7B A;  4YI8 A;  3V2L A;  1FW4 A;  1TTX A;  2L5Y A;  3D73 A;  1NSH A;  5AFP A;  1B1G A;  3CGA A;  3BOW A;  1TN4 A;  3NSO A;  1CB1 A;  1AJ5 A;  1B9A A;  3A4U B;  3ICB A;  1JWD A;  2JC2 A;  1GGZ A;  3SG4 A;  4CFR A;  1A29 A;  3FIA A;  5PAL A;  1BOC A;  3I5H C;  3QME A;  3SG5 A;  2M3W A;  3OB1 B;  1J7P A;  3OB2 B;  2JPO A;  1MF8 B;  1BR4 B;  1IJ5 A;  5AEQ A;  3SJS A;  4UPG A;  4FQT A;  2KOT A;  3PM8 A;  2VRG A;  2HF5 A;  2KBM A;  4N1G A;  2JOJ A;  3M0W A;  3EVV A;  2KI4 B;  1TNP A;  5FI6 A;  1LIN A;  2JQ6 A;  1CMF A;  1C3Y A;  1JF2 A;  1LVC D;  3S0E A;  1IJ6 A;  1WLZ A;  1CDN A;  3OP0 A;  4MSP A;  1CNP A;  2LVV A;  1SBJ A;  1M63 B;  4HSZ A;  4F0Z B;  1B4C A;  3DD4 A;  2KHN A;  3D75 A;  1TNQ A;  2ZN8 A;  2K61 A;  4BY5 A;  5HYD A;  2PMY A;  2JT8 A;  4GBA A;  4CLN A;  2EC6 B;  3DF0 B;  4HRH A;  2BE6 A;  3IF7 A;  1PSB A;  1OMR A;  3PM2 A;  2WND A;  4P5O E;  3ZNI A;  1SR6 B;  1DC1 A;  1CLL A;  1VRK A;  2KQ6 A;  2LAN A;  1S3P A;  4N1F A;  4ZCV A;  1B47 A;  5HLV A;  4KYN A;  3S0B A;  1OOG A;  3AAJ A;  3CZ1 A;  3SS4 A;  1KK7 Z;  3RLZ A;  5IBW A;  1BLQ A;  1ODB A;  4WQ2 A;  3CZT X;  2I18 A;  1SY9 A;  3ZWH A;  2EGD A;  1SNL A;  1UHI A;  4HRG A;  4PCW A;  1WRL A;  1QVI Y;  2KBI A;  2H8V A;  5DKQ A;  2F3Z A;  1CFP A;  4ETO A;  1OQP A;  2PAL A;  2KI4 C;  4GGF A;  3B86 A;  1ZFS A;  1KSO A;  2CT9 A;  3F45 A;  4PDZ A;  5ER4 X;  3DVJ A;  1XFY O;  1QIW A;  4OV2 A;  2IS9 A;  3VRN A;  3TDI A;  4AQJ A;  1N65 A;  4PAL A;  3S0F A;  2K7O A;  3KPX A;  1CMG A;  2Y1N A;  3FWC A;  1J7O A;  1IIO A;  3BUM B;  1DTL A;  2MAZ A;  3FE6 A;  4NDB A;  3NHI A;  1YX8 A;  3D77 A;  3RM1 A;  3VRQ A;  1IQ5 A;  2OPO A;  1OOI X;  2E6W A;  1UHJ A;  2M1U A;  2MRD A;  1WY9 A;  2EC6 C;  3SIA A;  4CFQ A;  1B7T Z;  3B6X A;  2JTT A;  2I2R E;  3NSI A;  1UHK A;  2PQL A;  3PFV A;  1CM1 A;  3K21 A;  4ZCU A;  3LK0 A;  1SR6 C;  4M2O A;  2PYQ A;  4A4C A;  2L0P A;  3CWG A;  5HKY A;  3GK2 A;  3CAB A;  1OOF A;  2BE4 A;  2K2A A;  3DY9 A;  4MLW A;  4U8D A;  4PE7 A;  1OZS A;  2BCX A;  2HPS A;  1XFZ O;  3CR5 X;  4L9M A;  1OOH A;  3LL8 B;  2SAS A;  1CFD A;  1QLK A;  5G08 A;  3TDU A;  4DIR A;  3CTN A;  3O78 A;  1G8I A;  1KK8 C;  3N7H A;  2ZFD A;  3GK1 A;  1NPQ A;  3R72 A;  3D0Y B;  4TNC A;  1X02 A;  2TN4 A;  4GFT A;  2NCO A;  2HQ8 A;  2LMV A;  2LP2 A;  1PAL A;  2LCP A;  2LV7 A;  1SYM A;  1XO5 A;  1ZOT B;  2AUC A;  1DQE A;  2KDH A;  1C7W A;  2M1K B;  1DJY A;  1IKU A;  1W7J B;  2CBL A;  2MLF C;  1NWD A;  3NXA A;  1CDL A;  4A4B A;  1KCY A;  1DJX A;  1JC2 A;  1CLB A;  3I5F B;  1BT6 A;  2OS8 B;  5I94 A;  2OTG C;  2K2F A;  1Z4H A;  5J3X A;  4D1E A;  1Q80 A;  1SPY A;  3E3R A;  3AKB A;  4YGA A;  2BL0 B;  1CFF A;  2Q91 A;  1QS7 A;  4OR9 B;  5KSZ A;  4PHN A;  1KFU L;  4INX A;  1A03 A;  1XVJ A;  3SS3 A;  3WHT B;  1IRJ A;  1BMO A;  1DVI A;  1ZAC A;  2ZRS A;  1EXR A;  3EKJ A;  4PE0 A;  2K0J A;  3O6B A;  5DKN A;  1DF0 B;  1QX2 A;  4R1E A;  4GUK A;  2HQW A;  4PE4 A;  1CKK A;  1MQ1 A;  2K7D A;  2LVJ A;  4QJ3 B;  1C07 A;  2ZKM X;  2WCE A;  1PVB A;  1K95 A;  4USL A;  3I5G B;  5DIC A;  2WCK A;  1MXE A;  3LLE A;  3CS1 A;  3D78 A;  1ORG A;  2NXQ A;  4INW A;  1BJF A;  2LC5 A;  5EL2 A;  5FI7 A;  3VRO A;  1IWQ A;  4WRI A;  3AAK A;  4YBH B;  1QV1 A;  1IH0 A;  3KHE A;  2M97 A;  1S6J A;  3KO0 A;  1M39 A;  1RTP 1;  2KYF A;  2BEC A;  5HKZ A;  4JWQ A;  1TOP A;  5FYX A;  1QJT A;  1IQ3 A;  3A8R A;  3PAT A;  1ZUZ A;  3EK4 A;  4GPL B;  2KAX A;  4YRU A;  1K9U A;  1PUL A;  2OS8 C;  3TS5 B;  2MHH A;  1SKT A;  2M0R A;  1NCY A;  3UNW A;  1NP8 A;  1DGV A;  3FE8 A;  1TCO B;  1F71 A;  1W9Z A;  4BY4 A;  1RJV A;  5DKR A;  1YVL A;  3CZ0 A;  2YGU A;  2COL B;  3WHU B;  1RK9 A;  1SSE B;  1GJY A;  1H8B A;  1IG5 A;  1G4Y R;  2GGM A;  3H4S E;  1QLS A;  3IQQ A;  2FCE A;  2LVI A;  1OMD A;  2P6B B;  1SRA A;  2QAC A;  1YTZ C;  2L98 A;  3BFH A;  3I5G C;  3R1P A;  2LUC A;  1DJG A;  4OKH A;  3SG3 A;  4QJ4 B;  2KLD A;  1EH2 A;  3EK7 A;  1CTR A;  1QXP A;  1TWO A;  3VGO A;  5BPJ A;  3DF0 A;  4I5N B;  4GAO A;  1OMV A;  2P71 A;  4FQO A;  4OZD A;  3IVT A;  2I7A A;  2Y5I A;  1MUX A;  3R1O A;  2ZNE A;  5D69 A;  2JRF A;  3PSR A;  4MZK A;  2KLE A;  4PT1 A;  2SCP A;  1E8A A;  1M45 A;  1SCM B;  2JTZ A;  3BFA A;  2CTN A;  2JUL A;  3OHM B;  3DVK A;  1QX7 A;  3O4X A;  3CDN A;  3TUY B;  1ZMZ A;  2JPT A;  1NIW A;  2LLS A;  4MBE A;  1S6C A;  2I94 A;  3O2P A;  3TS5 C;  5CSI A;  2F3Y A;  1PRW A;  1V1G A;  1MHO A;  4DUQ A;  2JZI A;  4NDC A;  2QEO A;  4C0K A;  2JNF A;  4XJK A;  1EG4 A;  1YVH A;  2G2B A;  2Q4U A;  3VB1 A;  1MXL C;  4C0J A;  2CNP A;  3I5I B;  3PN7 B;  2KFH A;  2KGB C;  1EL4 A;  1KK7 Y;  5JOL A;  1XFU O;  3FWB A;  3LK1 A;  1F4Q A;  2KSP A;  1WLM A;  1NCX A;  2G9B A;  2KI6 D;  1QX5 B;  1NYA A;  1QTX A;  4QJ5 B;  1K90 D;  1DEL A;  1XA5 A;  4XYN A;  4ICB A;  1YRT B;  4I5L B;  3SG7 A;  1M31 A;  1GM0 A;  1J55 A;  1K9P A;  3WXA A;  1QV0 A;  1DMO A;  3O4Y A;  1SL8 A;  3R1V A;  3PLF B;  3TDZ A;  2PVB A;  1CM4 A;  3CR4 X;  5AXI A;  2LHI A;  2RGI A;  1BR1 B;  5CSN A;  3GOF A;  4OCI A;  4JKT A;  4M2Q A;  2M7L A;  1XYD A;  1A75 B;  3EVR A;  3TUY C;  3BQ3 A;  3EKH A;  4PHM A;  4PHJ A;  5TNC A;  2GGZ A;  3RZS A;  3FS7 A;  1B7T Y;  1MR8 A;  1DEK A;  1RRO A;  1S5G Z;  4YGD B;  2BCB A;  1U5I B;  2WCF A;  3VRR A;  4DRW A;  2PAS A;  2M49 B;  3DZT A;  1L2O B;  3S0D A;  1YR5 A;  2HET A;  3D10 A;  1SW8 A;  1AVS A;  2ZND A;  1ALV A;  1K96 A;  1QWV A;  3I5I C;  3PN7 C;  1Y1U A;  5K89 A;  1BG1 A;  2CCM A;  1DJI A;  1XFR A;  2WOS A;  1P28 A;  2H61 C;  2LP3 A;  2M8U A;  2M9G A;  1FF1 A;  1UUR A;  2L50 A;  2QEH A;  3I5H B;  1F4O A;  1WRK A;  3NSK A;  4YGC B;  2L51 A;  2WC8 A;  2JWW A;  2LVK A;  5FI2 A;  1WDC B;  1TUZ A;  2QEV A;  2JXC A;  2NZ0 A;  2KYC A;  2K60 A;  3D76 A;  2LLU A;  1KQM B;  4IJ7 A;  1W7I B;  5JJG A;  3NGV A;  1BF5 A;  1GGW A;  3L4A A;  1CLM A;  3KF9 A;  1WRZ A;  3B88 A;  4I5K A;  5F6T A;  1K94 A;  2BKH B;  4FTG A;  2JT0 A;  3K1E A;  2L4I A;  1GQM A;  1LA0 A;  2M29 A;  1JFK A;  1FBV A;  1TNW A;  2L5X B;  1SL7 A;  1AUI B;  2ISD A;  1C3Z A;  2GTE A;  2WCJ A;  1FI5 A;  1KWO B;  2KFF A;  2B1U A;  2P70 A;  1LKJ A;  2KQY A;  2AAO A;  2LMT A;  2KFG A;  2QDI A;  1SMG A;  1XFV O;  3BOW B;  4MVF A;  3GK4 X;  1EG3 A;  3KEV A;  2JT3 A;  4IL1 A;  4P2Y B;  1L2O C;  2ZRT A;  3DVM A;  3SG6 A;  1XK4 C;  3MSE B;  1NUB A;  3I5F C;  1R2U A;  1F70 A;  4HRE E;  3BUX B;  1Y6W A;  3DVE A;  4GNK B;  5CPV A;  1G33 A;  3VRP A;  2Y1M A;  1S36 A;  5HL1 A;  4PE1 A;  5ER5 A;  5GQQ C;  1KFX S;  1UWO A;  2BL0 C;  2WOR A;  4MRY A;  5B8I B;  1R6P A;  1YUT A;  2KAV A;  2F8P A;  5D7F A;  1CFC A;  2L2C A;  3HCM A;  4C0L A;  4JQ0 D;  1YX7 A;  4MRX A;  1UUS A;  1V1F A;  1WDC C;  3SG2 A;  5AER A;  4CPV A;  3BXK A;  2BBN A;  1S26 D;  1KQM C; 
#chains in the Genus database with same CATH homology
 5HLO A;  2O60 A;  1KSM A;  1M46 A;  2K8M B;  3OX5 A;  4NDD A;  4ORB B;  1AHR A;  1DGU A;  1HT9 A;  1OSA A;  2L4H A;  1FPW A;  2QPT A;  1AJ4 A;  3IQO A;  2M7N A;  1AK8 A;  2H2K A;  1KWO C;  3JTD B;  1KFU S;  3SIB A;  1OZO A;  2JXL A;  2LUX A;  1QVI Z;  1YRU B;  3AKA A;  1JFJ A;  1S1E A;  1A2X A;  2PSR A;  2BCA A;  2A4J A;  2FOT A;  1N2D A;  1TRF A;  3JVT B;  4Q04 A;  5I8N A;  1F8H A;  1JF0 A;  1A4P A;  3CR2 A;  1CDM A;  3BUO B;  5CSJ A;  2D8N A;  1D1O A;  4I5J A;  1QAT A;  1NCZ A;  2KGR A;  2MA2 A;  4ORA B;  1K8U A;  1AP4 A;  1CDP A;  2KAY A;  1S6I A;  1B8C A;  1L7Z A;  1OE9 B;  2AMI A;  1DJZ A;  3C1V A;  3EVU A;  5KU1 A;  3BYA A;  4AOM A;  1F55 A;  1KK8 B;  3QRX A;  4XJK B;  2MLE C;  1YUU A;  4MN0 A;  1RWY A;  4E68 A;  3EK8 A;  1B8R A;  2H61 A;  1YUR A;  1TNX A;  3TZ1 A;  3LCP C;  2FJU B;  1UHN A;  3WNX B;  1NX3 A;  1DJW A;  2LM5 A;  1Y1X A;  2WCB A;  3BUW B;  2F33 A;  2Y4Q A;  1REC A;  4NQG A;  1B8L A;  1DJH A;  3JTD C;  3NSL A;  4YGE B;  2BBM A;  2F2P A;  3OX6 A;  2OTG B;  1FI6 A;  2R2I A;  1SCM C;  4DCK A;  1J7R A;  2PRU A;  5I2O A;  2GV5 A;  1JSA A;  1JUO A;  2KI6 C;  3JVT C;  2L2E A;  3CLN A;  2O5G A;  4AQI A;  2BKI B;  4YI9 A;  2EHB A;  2MJW B;  5CSF A;  1A75 A;  4ORC B;  1PK0 D;  1K2H A;  1EJ3 A;  1LA3 A;  1TCF A;  1Y0V H;  3HX4 A;  3D0Y A;  4WQ3 A;  1J7Q A;  2LE9 B;  2V53 A;  4JPZ B;  4M2P A;  2NCP A;  1K93 D;  4CID A;  4OVN F;  4GGF C;  2K7C A;  1LXF C;  1U5I A;  4PHK A;  4MZJ A;  1YUS A;  1XFW O;  1NX0 A;  2NLN A;  1XK4 A;  1KFX L;  1NX1 A;  1PVA A;  1TIZ A;  2LMU A;  5KTY A;  4DS7 A;  1KQV A;  2JU0 A;  1SK6 D;  1ALW A;  1PSR A;  4MZL A;  4GGN A;  2MBX A;  4YGB B;  1BU3 A;  2LNK A;  3BUN B;  2DOQ A;  1J1E A;  1S5G Y;  4MEW A;  1QAS A;  4N5X A;  1H4B A;  2FCD A;  3PAL A;  1JBA A;  2F2O A;  5I2Q A;  2LHL A;  1RFJ A;  2E30 A;  1DF0 A;  1XFX O;  1K9K A;  1SCV A;  5HKW A;  2CXJ A;  1NX2 A;  2ZN9 A;  1OOJ A;  1UP5 A;  1Y1A A;  2LAP A;  1QIV A;  1BOD A;  2JNX A;  1DT7 B;  1MWN A;  2LLT A;  1C7V A;  2KNE A;  1HQV A;  1F54 A;  5I2L A;  1J1D A;  1UHH A;  1N0Y A;  1SL9 A;  1IGV A;  5AAN A;  2K7B A;  4YI8 A;  1FW4 A;  1TTX A;  1NSH A;  5AFP A;  1B1G A;  3CGA A;  3BOW A;  1TN4 A;  3NSO A;  1CB1 A;  1AJ5 A;  1B9A A;  3A4U B;  3ICB A;  2JC2 A;  1GGZ A;  3SG4 A;  4CFR A;  1A29 A;  3FIA A;  5PAL A;  1BOC A;  3I5H C;  3SG5 A;  2M3W A;  3OB1 B;  1J7P A;  3OB2 B;  1MF8 B;  1BR4 B;  1IJ5 A;  5AEQ A;  3SJS A;  4UPG A;  2KOT A;  3PM8 A;  2VRG A;  2HF5 A;  2KBM A;  4N1G A;  2JOJ A;  3M0W A;  3EVV A;  2KI4 B;  1TNP A;  1LIN A;  2JQ6 A;  1JF2 A;  1LVC D;  1IJ6 A;  1WLZ A;  1CDN A;  3OP0 A;  4MSP A;  1CNP A;  2LVV A;  1SBJ A;  1M63 B;  4HSZ A;  4F0Z B;  1B4C A;  3DD4 A;  2KHN A;  1TNQ A;  2ZN8 A;  2K61 A;  4BY5 A;  5HYD A;  2PMY A;  2JT8 A;  4GBA A;  4CLN A;  2EC6 B;  3DF0 B;  4HRH A;  2BE6 A;  3IF7 A;  1PSB A;  1OMR A;  2WND A;  4P5O E;  3ZNI A;  1SR6 B;  1CLL A;  1VRK A;  2KQ6 A;  2LAN A;  1S3P A;  4N1F A;  4ZCV A;  1B47 A;  5HLV A;  3AAJ A;  1KK7 Z;  3RLZ A;  5IBW A;  1ODB A;  4WQ2 A;  3CZT X;  2I18 A;  1SY9 A;  3ZWH A;  2EGD A;  1SNL A;  1UHI A;  4HRG A;  4PCW A;  1WRL A;  1QVI Y;  2KBI A;  1CFP A;  5DKQ A;  2F3Z A;  4ETO A;  1OQP A;  2PAL A;  2KI4 C;  4GGF A;  1ZFS A;  1KSO A;  2CT9 A;  3F45 A;  4PDZ A;  5ER4 X;  3DVJ A;  1XFY O;  1QIW A;  4OV2 A;  2IS9 A;  3VRN A;  3TDI A;  4AQJ A;  1N65 A;  4PAL A;  1CMF A;  2K7O A;  3KPX A;  1CMG A;  2Y1N A;  3FWC A;  1J7O A;  3BUM B;  1DTL A;  2MAZ A;  4NDB A;  1YX8 A;  3RM1 A;  3VRQ A;  1IQ5 A;  2OPO A;  2E6W A;  1UHJ A;  2M1U A;  2MRD A;  1WY9 A;  2EC6 C;  3SIA A;  4CFQ A;  1B7T Z;  2JTT A;  2I2R E;  3NSI A;  1UHK A;  3PFV A;  4ZCU A;  1CM1 A;  3K21 A;  4A4C A;  3LK0 A;  1SR6 C;  4M2O A;  2L0P A;  3CWG A;  5HKY A;  3GK2 A;  2BE4 A;  2K2A A;  4MLW A;  4U8D A;  4PE7 A;  1OZS A;  2BCX A;  2HPS A;  1XFZ O;  3CR5 X;  4L9M A;  3LL8 B;  2SAS A;  1CFD A;  1QLK A;  5G08 A;  3TDU A;  4DIR A;  3CTN A;  3O78 A;  1G8I A;  1KK8 C;  2ZFD A;  3GK1 A;  1NPQ A;  3D0Y B;  4TNC A;  1X02 A;  2TN4 A;  4GFT A;  2NCO A;  2HQ8 A;  2LMV A;  2LP2 A;  1PAL A;  2LCP A;  2LV7 A;  1SYM A;  1XO5 A;  1ZOT B;  2AUC A;  2KDH A;  2M1K B;  1C7W A;  1IKU A;  1DJY A;  1W7J B;  2CBL A;  2MLF C;  1NWD A;  3NXA A;  1CDL A;  4A4B A;  1KCY A;  1DJX A;  1JC2 A;  1CLB A;  3I5F B;  1BT6 A;  2OS8 B;  2OTG C;  2K2F A;  5J3X A;  4D1E A;  1Q80 A;  1SPY A;  3E3R A;  3AKB A;  4YGA A;  2BL0 B;  1CFF A;  2Q91 A;  1QS7 A;  4OR9 B;  5KSZ A;  4PHN A;  1KFU L;  1A03 A;  1XVJ A;  3WHT B;  1IRJ A;  1BMO A;  1DVI A;  1ZAC A;  2ZRS A;  1EXR A;  3EKJ A;  4PE0 A;  2K0J A;  3O6B A;  5DKN A;  1DF0 B;  1QX2 A;  4R1E A;  4GUK A;  2HQW A;  4PE4 A;  1CKK A;  1MQ1 A;  2K7D A;  2LVJ A;  4QJ3 B;  1C07 A;  2ZKM X;  2WCE A;  1PVB A;  1K95 A;  4USL A;  3I5G B;  1MXE A;  3LLE A;  3CS1 A;  2NXQ A;  1BJF A;  2LC5 A;  3VRO A;  1IWQ A;  4WRI A;  3AAK A;  4YBH B;  1QV1 A;  1IH0 A;  3KHE A;  2M97 A;  1S6J A;  3KO0 A;  1M39 A;  1RTP 1;  2KYF A;  2BEC A;  5HKZ A;  4JWQ A;  1TOP A;  5FYX A;  1QJT A;  1IQ3 A;  3A8R A;  3PAT A;  1ZUZ A;  3EK4 A;  4GPL B;  2KAX A;  4YRU A;  1K9U A;  1PUL A;  2OS8 C;  3TS5 B;  2MHH A;  1SKT A;  2M0R A;  1NCY A;  1NP8 A;  1DGV A;  1TCO B;  1F71 A;  4BY4 A;  1RJV A;  5DKR A;  1YVL A;  2COL B;  3WHU B;  1RK9 A;  1GJY A;  1H8B A;  1IG5 A;  1G4Y R;  2GGM A;  3H4S E;  1QLS A;  3IQQ A;  2FCE A;  2LVI A;  1OMD A;  2P6B B;  1SRA A;  2QAC A;  1YTZ C;  2L98 A;  3I5G C;  4OKH A;  3SG3 A;  2LUC A;  1DJG A;  4QJ4 B;  1EH2 A;  3EK7 A;  1CTR A;  1QXP A;  3VGO A;  5BPJ A;  3DF0 A;  4I5N B;  4GAO A;  1OMV A;  4FQO A;  2I7A A;  2Y5I A;  1MUX A;  2ZNE A;  5D69 A;  2JRF A;  3PSR A;  4MZK A;  2SCP A;  1E8A A;  1M45 A;  1SCM B;  2JTZ A;  2CTN A;  2JUL A;  3OHM B;  3DVK A;  1QX7 A;  3TUY B;  1BLQ A;  1ZMZ A;  2JPT A;  1NIW A;  2LLS A;  4MBE A;  1S6C A;  2I94 A;  3O2P A;  3TS5 C;  5CSI A;  2F3Y A;  1V1G A;  1PRW A;  1MHO A;  4DUQ A;  2JZI A;  4NDC A;  4C0K A;  2JNF A;  4XJK A;  1EG4 A;  1YVH A;  2G2B A;  2Q4U A;  1MXL C;  4C0J A;  2CNP A;  3I5I B;  3PN7 B;  2KFH A;  2KGB C;  1EL4 A;  1KK7 Y;  5JOL A;  1XFU O;  3FWB A;  3LK1 A;  1F4Q A;  2KSP A;  1WLM A;  1NCX A;  2G9B A;  2KI6 D;  1QX5 B;  1NYA A;  1QTX A;  4QJ5 B;  1K90 D;  1XA5 A;  4XYN A;  4ICB A;  1YRT B;  4I5L B;  3SG7 A;  1M31 A;  1J55 A;  1K9P A;  3WXA A;  1QV0 A;  1DMO A;  3O4Y A;  1SL8 A;  3PLF B;  3TDZ A;  2PVB A;  1CM4 A;  3CR4 X;  5AXI A;  2LHI A;  2RGI A;  1BR1 B;  5CSN A;  3GOF A;  4OCI A;  4M2Q A;  2M7L A;  1XYD A;  1A75 B;  3EVR A;  3TUY C;  3BQ3 A;  3EKH A;  4PHM A;  4PHJ A;  5TNC A;  2GGZ A;  3FS7 A;  1B7T Y;  1MR8 A;  1S5G Z;  1RRO A;  4YGD B;  2BCB A;  1U5I B;  2WCF A;  3VRR A;  4DRW A;  2PAS A;  2M49 B;  1L2O B;  1YR5 A;  2HET A;  3D10 A;  1SW8 A;  1AVS A;  2ZND A;  1ALV A;  1K96 A;  3I5I C;  3PN7 C;  1Y1U A;  5K89 A;  1BG1 A;  2CCM A;  1DJI A;  2WOS A;  2H61 C;  2LP3 A;  2M9G A;  2M8U A;  1FF1 A;  1UUR A;  2L50 A;  3I5H B;  1F4O A;  1WRK A;  3NSK A;  4YGC B;  2L51 A;  2WC8 A;  2JWW A;  2LVK A;  1WDC B;  2JXC A;  2NZ0 A;  2KYC A;  2LLU A;  1KQM B;  1W7I B;  5JJG A;  1BF5 A;  1GGW A;  1CLM A;  3KF9 A;  1WRZ A;  4I5K A;  5F6T A;  1K94 A;  2BKH B;  4FTG A;  2JT0 A;  2L4I A;  1GQM A;  1LA0 A;  2M29 A;  1JFK A;  1FBV A;  1TNW A;  2L5X B;  1SL7 A;  1AUI B;  2ISD A;  1FI5 A;  1KWO B;  2KFF A;  2B1U A;  1LKJ A;  2KQY A;  2AAO A;  2LMT A;  2KFG A;  1JWD A;  1SMG A;  1XFV O;  3BOW B;  4MVF A;  3GK4 X;  1EG3 A;  3KEV A;  2JT3 A;  4IL1 A;  4P2Y B;  1L2O C;  2ZRT A;  3DVM A;  3SG6 A;  1XK4 C;  3MSE B;  1NUB A;  3I5F C;  1R2U A;  1F70 A;  4HRE E;  3BUX B;  1Y6W A;  3DVE A;  4GNK B;  5CPV A;  1G33 A;  3VRP A;  2Y1M A;  1S36 A;  4PE1 A;  5ER5 A;  5GQQ C;  1KFX S;  1UWO A;  2BL0 C;  2WOR A;  4MRY A;  5B8I B;  1R6P A;  1YUT A;  2KAV A;  2F8P A;  5D7F A;  1CFC A;  3HCM A;  4C0L A;  4JQ0 D;  1YX7 A;  4MRX A;  1UUS A;  1V1F A;  1WDC C;  3SG2 A;  5AER A;  4CPV A;  3BXK A;  2BBN A;  1S26 D;  1KQM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...