5ER4X

Crystal structure of calcium-loaded s100b bound to sc0025
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
90
structure length
90
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title Novel protein-inhibitor interactions in site 3 of Ca(2+)-bound S100B as discovered by X-ray crystallography.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein/inhibitor
total genus 32
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2015-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00036 EF-hand_1 EF hand
X PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5er4X00
1SK6D 2EC6B 4GGNA 1DGVA 5CSFA 2SCPA 1KK7Z 4PHMA 4D1EA 3BUOB 3SG5A 4UPGA 1DMOA 1FI5A 1B9AA 1BU3A 2K7OA 2KYCA 2OS8B 3LCPC 4PE4A 1BR4B 5GQQC 2LVKA 2WCBA 1OZOA 3K21A 1UP5A 2BL0B 3OX6A 1NSHA 3SG4A 1DJYA 1DJHA 1S6IA 1DVIA 4ORCB 1JFJA 1C07A 1TIZA 2AAOA 1DJGA 1B8CA 2LMVA 1K96A 1LXFC 2FJUB 3PALA 4ORAB 3SIBA 4AQJA 3I5HC 3D0YA 1G8IA 3DVJA 4YGEB 1J55A 2KBIA 2I2RE 3KPXA 1LVCD 1ALWA 1QIVA 4FTGA 2KBMA 2CNPA 3NSKA 3WHUB 1DGUA 2JNFA 3TDUA 2HPSA 5I2QA 4CFRA 2O60A 5D69A 3M0WA 1QX2A 1B7TY 1X02A 2M49B 2Y4QA 3LK1A 2FCEA 5AFPA 1XFVO 4ZCVA 3CR4X 2ZRSA 3DD4A 5ER4X 1CM1A 2OS8C 2GGZA 4HRGA 1J7PA 1R2UA 1JFKA 1OQPA 2BL0C 2LAPA 1BOCA 2ISDA 1CFDA 2G2BA 1PULA 1FI6A 2JOJA 2KYFA 4ICBA 1QX7A 4YI8A 4WQ3A 2JRFA 1CFPA 2KQYA 4C0LA 2JTZA 2JXLA 2L2EA 2WC8A 1KCYA 2TN4A 1EL4A 3BUMB 2LUCA 1J7RA 1N2DA 4P2YB 4F0ZB 1CKKA 1OMDA 1CDNA 3WHTB 1M46A 1MXEA 4YGBB 1QVIZ 1WRZA 3I5IB 5CSNA 3VRNA 1J7OA 2LANA 5HKWA 3DVMA 1DT7B 1XO5A 1EH2A 1OSAA 2E30A 2WCEA 4MRXA 4N5XA 1KFXL 1QS7A 3PN7B 4JPZB 4NDDA 1RFJA 3DF0A 3WXAA 1RWYA 2ZKMX 1NCZA 4PE1A 2HQ8A 3FIAA 4QJ4B 1BG1A 1MHOA 1AK8A 2CCMA 4E68A 1YUUA 1XK4C 4GBAA 3D0YB 5BPJA 4ETOA 2CTNA 2WCFA 2KQ6A 1PSRA 1IH0A 1ZOTB 4QJ5B 1MWNA 1ALVA 5HKYA 3MSEB 1F55A 5DKNA 2JT8A 1PK0D 2P6BB 1RJVA 3BUXB 1DJIA 5G08A 4C0JA 1NX1A 1CDPA 4CLNA 1SMGA 1SRAA 1SW8A 4IL1A 1W7JB 1K9UA 3I5IC 1JF0A 1Y1AA 4ZCUA 3I5FB 1QV1A 2I94A 3NSLA 2G9BA 1SBJA 1S5GY 2LM5A 3PN7C 5K89A 3SG7A 2F2PA 1GGZA 1SL8A 4PDZA 1TTXA 2BKIB 1AJ4A 3CLNA 1PVAA 4GAOA 1F71A 1KFXS 3O6BA 4NDBA 5IBWA 2L51A 4YGAA 2H2KA 3GK4X 2JT0A 1SPYA 3BOWA 1UURA 3F45A 1M39A 2KGRA 1TOPA 5CSIA 3ZWHA 1KK8B 4GPLB 1Y6WA 2KNEA 1K2HA 4I5KA 1IQ3A 3SG6A 2BCBA 1NUBA 3A4UB 3DF0B 1QLKA 4R1EA 2L98A 5TNCA 4GGFA 1JC2A 3I5FC 3GOFA 1Y0VH 1FF1A 2R2IA 3KEVA 4MZKA 4YI9A 2KFGA 1A29A 3LK0A 4WRIA 3PLFB 1QIWA 2KI4B 3O4YA 1NIWA 2RGIA 3PM8A 1A4PA 2FOTA 1A2XA 4JWQA 2LVIA 1J1DA 3AKBA 1E8AA 2M9GA 3AKAA 1B1GA 2KI6D 3EK7A 1LKJA 4I5LB 3TS5B 2BCAA 2F3YA 1SNLA 4P5OE 5AXIA 1ZACA 2KI6C 1KK8C 2L50A 1UHKA 2I7AA 1S36A 3EKHA 1UHIA 4A4BA 1KFUL 2SASA 1S26D 2KGBC 2Q4UA 4DCKA 4MRYA 1K9PA 2LLUA 2AUCA 3AAKA 4AOMA 1MR8A 2EC6C 1H8BA 1KWOB 2KOTA 1K8UA 3OX5A 4N1GA 3VRQA 1FPWA 3ZNIA 1N0YA 3SG2A 2LUXA 2MA2A 2BCXA 1EG3A 2K7BA 1SR6B 2KI4C 1EXRA 1U5IA 3BOWB 4XJKB 4AQIA 1SCMB 2LP3A 3EKJA 2I18A 1SL9A 2K61A 4MBEA 4A4CA 1SKTA 5KTYA 3EVUA 2HF5A 4I5JA 5DKQA 2OTGB 2V53A 5AERA 1TCOB 2JULA 5I2LA 1HT9A 3TS5C 1M31A 4HSZA 1NCYA 2JNXA 3BQ3A 2H61A 2LP2A 4GNKB 1A75A 4MEWA 1QLSA 2COLB 4MVFA 1K9KA 2BE4A 1B47A 1XFZO 3C1VA 2CBLA 4DS7A 1S6JA 2M29A 1NYAA 1YX8A 4BY5A 3FWBA 1YRUB 1C7WA 1WDCB 3EVRA 2L0PA 3OHMB 4U8DA 2Y5IA 2K8MB 1NX3A 1KWOC 2MLFC 1GQMA 3A8RA 4OCIA 2F3ZA 1KFUS 4OV2A 5KU1A 3EK4A 4M2PA 3KHEA 1NWDA 2PMYA 4M2OA 1SR6C 3CGAA 1R6PA 1K94A 3NSIA 3SJSA 2L4HA 1PVBA 1SCMC 5KSZA 4OVNF 1AP4A 5JOLA 2MHHA 5HLOA 5PALA 1K90D 1MXLC 2KDHA 1M45A 3IQQA 2MBXA 3KO0A 4MZLA 1Y1XA 1QATA 1CM4A 1TRFA 4YRUA 1ZUZA 2M8UA 2KAXA 2OPOA 1DF0A 2M1KB 4YGCB 4ORBB 1BMOA 2NXQA 1TNWA 4HREE 1MQ1A 1PSBA 2PRUA 2Y1NA 1SCVA 1XFUO 4PHJA 1TCFA 5HYDA 2JWWA 2LLTA 1S1EA 1G33A 1WDCC 2KFHA 1AHRA 3BXKA 1G4YR 1SY9A 3E3RA 1BJFA 1UUSA 2NZ0A 4CPVA 4C0KA 1LINA 1NCXA 1D1OA 3FWCA 2BBMA 1MUXA 4DIRA 3BYAA 5D7FA 3LL8B 1JSAA 1YTZC 1CLLA 1A75B 2M7NA 2PSRA 2ZNDA 1RROA 1YX7A 2F8PA 2JT3A 4DUQA 3SIAA 1YVHA 2BKHB 2JU0A 1F4QA 1TNXA 3NSOA 1KK7Y 3IQOA 2ZRTA 1OE9B 5B8IB 1CFCA 3QRXA 2EHBA 4PHKA 3CWGA 4Q04A 3HCMA 3HX4A 2JTTA 3TDZA 4CFQA 2M0RA 4FQOA 2JC2A 1GJYA 1UHHA 2M1UA 2K7DA 4MLWA 3D10A 1WY9A 2CT9A 4PCWA 3VGOA 2MRDA 1DTLA 1WLZA 3DVEA 1Q80A 1XYDA 2PVBA 1RTP1 1KSOA 1B4CA 3OP0A 1IQ5A 1JWDA 1S5GZ 1B8LA 1RK9A 2WORA 3GK2A 3KF9A 3PFVA 4PHNA 1N65A 1XK4A 2F33A 2KAVA 2B1UA 2KSPA 2LVJA 1BODA 3RM1A 1C7VA 1DF0B 1TNQA 1Y1UA 2O5GA 1CLMA 2LVVA 1IGVA 1W7IB 1UHNA 1AUIB 1QASA 1XFXO 2L5XB 4M2QA 1AVSA 1PALA 3OB2B 1F4OA 2ZN8A 1YUTA 1XFYO 3VRRA 4XYNA 1IKUA 1OZSA 1YR5A 2JZIA 1F8HA 3GK1A 1H4BA 1TN4A 4MN0A 2VRGA 1SL7A 4GUKA 1CNPA 3EVVA 1CDLA 4JQ0D 3PATA 1KQMB 2K7CA 1IRJA 1XVJA 2M3WA 1JBAA 1AJ5A 4OKHA 1ZMZA 2WNDA 3LLEA 1J1EA 4PALA 2NLNA 4NQGA 1QVIY 1J7QA 2AMIA 1LA3A 1ODBA 1JF2A 2QACA 3ICBA 5JJGA 4GFTA 1YUSA 1XA5A 2ZN9A 2BBNA 1FBVA 1IJ6A 1QX5B 2IS9A 1K93D 1OMRA 2CXJA 1CB1A 1WRLA 1VRKA 2JXCA 5AEQA 1NX2A 2QPTA 1NP8A 1B8RA 2MLEC 1XFWO 4BY4A 2LE9B 3O2PA 1BF5A 1BLQA 1KSMA 1NPQA 1OOJA 4WQ2A 5HKZA 3I5GB 2L4IA 1IWQA 2PALA 3JVTB 5CPVA 2HETA 2HQWA 1KQMC 2ZFDA 1JUOA 2LNKA 4TNCA 3TUYB 1RECA 2EGDA 3VROA 4OR9B 1GGWA 3CR2A 1B7TZ 1L2OB 1WRKA 1IJ5A 3IF7A 3TZ1A 3EK8A 4MZJA 1M63B 2F2OA 1YRTB 2OTGC 1QJTA 3H4SE 3WNXB 3AAJA 2JQ6A 3FS7A 2NCPA 5AANA 5I2OA 2LMUA 2LCPA 2LHLA 3BUWB 1DJWA 2FCDA 2MJWB 3RLZA 1A03A 4GGFC 2KHNA 5J3XA 2LLSA 2NCOA 2M7LA 5HLVA 3CR5X 1BR1B 2Q91A 3CS1A 1U5IB 4L9MA 4MSPA 1F70A 2M97A 5DKRA 3I5GC 3JVTC 2Y1MA 2BE6A 1LA0A 1S6CA 4PE7A 4PE0A 1S3PA 1QV0A 3TUYC 1ZFSA 5ER5A 1UHJA 3JTDB 1DJZA 1DJXA 4I5NB 1NX0A 3DVKA 1L2OC 1IG5A 4HRHA 1QTXA 3O78A 5F6TA 1K95A 1CDMA 1YURA 1SYMA 3CZTX 1EJ3A 3VRPA 1WLMA 1F54A 5CSJA 1CFFA 2LHIA 2MAZA 3BUNB 4QJ3B 1TNPA 2BECA 2PASA 2A4JA 4USLA 1FW4A 1HQVA 1EG4A 1MF8B 1PRWA 4CIDA 4YGDB 1CMFA 2K0JA 2JPTA 2KFFA 2LV7A 2WOSA 4DRWA 1V1FA 1L7ZA 3OB1B 1CMGA 2D8NA 4XJKA 2KAYA 5I8NA 3NXAA 3TDIA 2LMTA 1QXPA 3JTDC 4NDCA 3I5HB 2GV5A 2H61C 1CTRA 3SG3A 5FYXA 1CLBA 2DOQA 1BT6A 3CTNA 1OMVA 1KQVA 1UWOA 2ZNEA 4YBHB 1YVLA 2K2FA 2K2AA 2E6WA 2LC5A 4N1FA 2GGMA 3PSRA 1V1GA
chains in the Genus database with same CATH superfamily
1SK6D 2EC6B 4GGNA 1DGVA 5CSFA 2QEVA 2SCPA 1KK7Z 4OZDA 4PHMA 4D1EA 3BUOB 3CYZA 3SG5A 4UPGA 1DMOA 3PJIA 1FI5A 1B9AA 1BU3A 2H8VA 2K7OA 2KYCA 2OS8B 3LCPC 4PE4A 1BR4B 5GQQC 2LVKA 2WCBA 1OZOA 3K21A 3CZ1A 1UP5A 2BL0B 3OX6A 1NSHA 3SG4A 1DJYA 1DJHA 1S6IA 2PYQA 1DVIA 3D75A 4ORCB 1JFJA 1C07A 1TIZA 2AAOA 1DJGA 1B8CA 2LMVA 3B87A 1K96A 1LXFC 2FJUB 3CZ0A 3PALA 4ORAB 3SIBA 4AQJA 3I5HC 3D0YA 1G8IA 3DVJA 4YGEB 2QEOA 1J55A 5DICA 2KBIA 2I2RE 3KPXA 1LVCD 1ALWA 1QIVA 4FTGA 2KBMA 2CNPA 3NSKA 3WHUB 1C3YA 1DGUA 2JNFA 1DELA 3TDUA 2HPSA 5I2QA 4CFRA 2O60A 5D69A 3M0WA 1QX2A 1B7TY 1X02A 2M49B 2Y4QA 3LK1A 2FCEA 5AFPA 1XFVO 4ZCVA 3CR4X 2ZRSA 3DD4A 5ER4X 1QWVA 3NGVA 1CM1A 2OS8C 1P28A 2GGZA 4HRGA 1J7PA 1R2UA 1JFKA 1OQPA 2BL0C 2LAPA 1BOCA 4IJ7A 2ISDA 1CFDA 2G2BA 1PULA 1FI6A 2JOJA 2KYFA 4ICBA 1QX7A 4YI8A 4WQ3A 2JRFA 1CFPA 2KQYA 4C0LA 2JTZA 2JXLA 2L2EA 2WC8A 1KCYA 2TN4A 1EL4A 3BUMB 2LUCA 1J7RA 1N2DA 4P2YB 4F0ZB 1CKKA 1OMDA 2WCLA 1CDNA 3WHTB 1M46A 1MXEA 4YGBB 1QVIZ 1WRZA 3I5IB 5CSNA 3VRNA 1J7OA 2LANA 5HKWA 3DVMA 1DT7B 1XO5A 1EH2A 1OSAA 2E30A 2KPHA 2WCEA 4MRXA 4N5XA 1KFXL 3R1PA 3S0GA 1QS7A 3PN7B 3QMEA 5HL1A 4JPZB 4NDDA 1RFJA 1ORGA 3DF0A 3S0BA 3WXAA 1RWYA 2ZKMX 1NCZA 4PE1A 5FI7A 2HQ8A 3FIAA 4QJ4B 1BG1A 1MHOA 3OBVA 1AK8A 2L2CA 2CCMA 4E68A 1YUUA 1XK4C 4GBAA 3D0YB 5BPJA 4ETOA 2CTNA 2WCFA 2KQ6A 1PSRA 1IH0A 5I94A 1ZOTB 4QJ5B 1MWNA 1GM0A 1ALVA 5HKYA 3MSEB 1F55A 5DKNA 2JT8A 3S0FA 2WC5A 1PK0D 2P6BB 1RJVA 3BUXB 1DJIA 3D78A 3N7HA 5G08A 1NX1A 4C0JA 1CDPA 4CLNA 1SMGA 1SRAA 1SW8A 4IL1A 1W7JB 1K9UA 3S0DA 3I5IC 3R1OA 1JF0A 1Y1AA 3D73A 4ZCUA 3I5FB 1QV1A 2I94A 3NSLA 2G9BA 1SBJA 1S5GY 2LM5A 3PN7C 5K89A 3SG7A 2F2PA 1GGZA 2P70A 1SL8A 4PDZA 1TTXA 2BKIB 1AJ4A 3CLNA 1PVAA 2P71A 3R72A 4GAOA 1F71A 1OW4A 1KFXS 3O6BA 4NDBA 5IBWA 2L51A 4YGAA 2H2KA 3GK4X 1DEKA 2JT0A 3L4AA 1SPYA 3BOWA 1UURA 3F45A 1M39A 2KGRA 1TOPA 5CSIA 3ZWHA 1KK8B 4GPLB 1Y6WA 3K1EA 3CDNA 2KNEA 1K2HA 4FQTA 4I5KA 1IQ3A 3SG6A 2BCBA 1NUBA 3A4UB 3DF0B 1QLKA 4R1EA 2L98A 5TNCA 4GGFA 1JC2A 3I5FC 3NHTA 3GOFA 1Y0VH 1FF1A 2R2IA 3KEVA 4MZKA 4YI9A 2KFGA 1A29A 3LK0A 3O4XA 3PLFB 1QIWA 2KI4B 3O4YA 1NIWA 2RGIA 3PM8A 1A4PA 1W9ZA 2FOTA 1A2XA 4JWQA 2LVIA 1J1DA 3AKBA 1E8AA 2M9GA 3AKAA 1B1GA 2KI6D 3EK7A 1LKJA 2KLDA 4I5LB 3TS5B 3DY9A 2BCAA 2F3YA 1SNLA 4P5OE 5AXIA 1ZACA 2KI6C 1KK8C 2L50A 1UHKA 2I7AA 1S36A 3EKHA 1UHIA 4A4BA 1KFUL 2SASA 1S26D 2KGBC 2Q4UA 4DCKA 4MRYA 1K9PA 2LLUA 3B86A 2AUCA 3D74A 3AAKA 4AOMA 1MR8A 2EC6C 3R1VA 1H8BA 1KWOB 2K60A 2KOTA 1K8UA 3OX5A 4N1GA 5FI6A 3VRQA 3ZNIA 1FPWA 1N0YA 3SG2A 2LUXA 2MA2A 2BCXA 1EG3A 2K7BA 2PQLA 1SR6B 2KI4C 1EXRA 1U5IA 3BOWB 4XJKB 4AQIA 1SCMB 2LP3A 3EKJA 2I18A 1SL9A 1T14A 2K61A 4MBEA 4A4CA 1SKTA 3CZ2A 3EVUA 3FE9A 3S0EA 2HF5A 4I5JA 5DKQA 2OTGB 5KTYA 2V53A 5AERA 1TCOB 2JULA 5I2LA 3UNWA 1HT9A 3TS5C 1M31A 4HSZA 3V2LA 3NHIA 1NCYA 3UO9A 2JNXA 3BQ3A 5D3OA 2H61A 2LP2A 4GNKB 1A75A 4MEWA 1QLSA 2COLB 4MVFA 1K9KA 2BE4A 1B47A 1XFZO 3C1VA 2CBLA 4DS7A 1S6JA 2M29A 1NYAA 1YX8A 4JKTA 4F7FA 4BY5A 3FWBA 1YRUB 1C7WA 1WDCB 3EVRA 2L0PA 3OHMB 4U8DA 2Y5IA 2K8MB 1NX3A 1KWOC 2MLFC 1GQMA 3A8RA 4OCIA 2F3ZA 1KFUS 4OV2A 5KU1A 3SS4A 3EK4A 4M2PA 3KHEA 1NWDA 2PMYA 4M2OA 1SR6C 3CGAA 1R6PA 1K94A 3NSIA 3SJSA 2L4HA 2WCKA 1PVBA 1SCMC 5KSZA 1XFRA 4OVNF 1AP4A 5JOLA 3B6XA 2MHHA 4PT1A 4JD9A 5HLOA 5PALA 1K90D 1MXLC 2KDHA 1M45A 3IQQA 2MBXA 3KO0A 4MZLA 3DZTA 1Y1XA 1QATA 1CM4A 1TRFA 4YRUA 1ZUZA 2M8UA 2KAXA 1LS8A 2OPOA 2KLEA 2WCMA 3CABA 1DF0A 2M1KB 4YGCB 4ORBB 1BMOA 2NXQA 1TNWA 4HREE 1MQ1A 1PSBA 2PRUA 2Y1NA 1SCVA 1XFUO 4PHJA 1TCFA 5HYDA 2JWWA 2LLTA 2WC6A 1S1EA 1G33A 1WDCC 2KFHA 1AHRA 4KYNA 3BFAA 3BXKA 1G4YR 1DQEA 1SY9A 1TUZA 1BJFA 1UUSA 2NZ0A 3E3RA 4C0KA 1LINA 4CPVA 1NCXA 1D1OA 3FWCA 2BBMA 1MUXA 2JPOA 4DIRA 3BYAA 5D7FA 3LL8B 3SS3A 1JSAA 1Z2CB 1OOGA 1YTZC 1CLLA 1A75B 2M7NA 2PSRA 2ZNDA 1RROA 1YX7A 2F8PA 2JT3A 3FE8A 4DUQA 3SIAA 1YVHA 2GTEA 4INWA 2BKHB 2JU0A 1F4QA 1TNXA 3NSOA 1KK7Y 3IQOA 2ZRTA 1OE9B 3VB1A 5B8IB 3QRXA 2EHBA 4PHKA 1CFCA 3CWGA 4Q04A 3HCMA 3HX4A 2JTTA 3TDZA 4CFQA 2M0RA 4FQOA 2JC2A 1GJYA 1UHHA 1OOIX 2K7DA 2M1UA 4MLWA 3D10A 1WY9A 2CT9A 4PCWA 3VGOA 1SSEB 3BFBA 2MRDA 1DTLA 1WLZA 3DVEA 1Q80A 1XYDA 2PVBA 1RTP1 2WCJA 1KSOA 1B4CA 3OP0A 1IQ5A 3EG5B 1S5GZ 1B8LA 1RK9A 2WORA 3GK2A 3KF9A 1JWDA 3PFVA 4PHNA 1N65A 1XK4A 2F33A 2KAVA 2B1UA 2KSPA 2LVJA 1BODA 3RM1A 1C7VA 3B88A 1DF0B 1TNQA 1Y1UA 2O5GA 1TUJA 1CLMA 1DC1A 2LVVA 1IGVA 1W7IB 1TWOA 2FJYA 1UHNA 1AUIB 1QASA 1XFXO 2L5XB 4M2QA 1AVSA 1PALA 3OB2B 1F4OA 2ZN8A 1YUTA 3L47A 1XFYO 3VRRA 4XYNA 1IKUA 1OZSA 3Q8IA 1YR5A 2JZIA 1F8HA 3GK1A 1H4BA 1TN4A 4MN0A 2VRGA 1SL7A 2QEBA 4GUKA 3EVVA 1CDLA 1CNPA 4JQ0D 3PATA 1KQMB 2K7CA 1IRJA 1XVJA 3SS5A 2M3WA 1JBAA 1AJ5A 4OKHA 1ZMZA 2WNDA 3LLEA 1IIOA 1J1EA 4PALA 2NLNA 3DYEA 4NQGA 3PM2A 1QVIY 1J7QA 2AMIA 1LA3A 1ODBA 1JF2A 2QACA 3ICBA 5JJGA 4GFTA 1YUSA 1XA5A 2ZN9A 2BBNA 3BJHA 1FBVA 1IJ6A 1QX5B 2IS9A 1K93D 1OMRA 2CXJA 1CB1A 1WRLA 1VRKA 2JXCA 5AEQA 1NX2A 2QPTA 1NP8A 3B7AA 1B8RA 2MLEC 1XFWO 4BY4A 2LE9B 3O2PA 1BF5A 1BLQA 1KSMA 4INXA 1NPQA 1OOJA 4WQ2A 5HKZA 5FI2A 3I5GB 2L4IA 1IWQA 2PALA 3JVTB 5CPVA 2HETA 2HQWA 1KQMC 2ZFDA 1JUOA 2LNKA 4TNCA 5EL2A 3TUYB 1RECA 2EGDA 3VROA 4OR9B 1GGWA 1OOHA 3CR2A 1B7TZ 1L2OB 1WRKA 1IJ5A 3IF7A 2BAPA 3TZ1A 3EK8A 4MZJA 1M63B 2F2OA 1YRTB 2OTGC 1QJTA 3H4SE 3WNXB 3AAJA 2JQ6A 3FS7A 2NCPA 5AANA 5I2OA 2LMUA 3DXLA 2LCPA 2LHLA 3BUWB 3D77A 1DJWA 2FCDA 2MJWB 3RLZA 1A03A 4GGFC 2KHNA 5J3XA 2LLSA 2NCOA 2M7LA 5HLVA 3CR5X 1BR1B 2Q91A 3CS1A 1U5IB 3BFHA 4L9MA 4MSPA 1F70A 2M97A 5DKRA 3I5GC 3JVTC 1OOFA 2Y1MA 2BE6A 1LA0A 1S6CA 4PE7A 4PE0A 1S3PA 1QV0A 3TUYC 1ZFSA 5ER5A 1UHJA 2YGUA 3JTDB 1DJZA 4WRIA 1DJXA 3L4LA 1NX0A 4I5NB 3DVKA 1L2OC 1IG5A 4HRHA 1QTXA 3O78A 5F6TA 3RZSA 1K95A 1CDMA 1YURA 1SYMA 3CZTX 3IVTA 1EJ3A 3VRPA 1WLMA 1F54A 5CSJA 2L5YA 1CFFA 2LHIA 2MAZA 3BUNB 4QJ3B 1TNPA 3S0AA 2BECA 2PASA 2A4JA 2QEHA 2WCHA 4USLA 2ERBA 1FW4A 1HQVA 1EG4A 1MF8B 1PRWA 4CIDA 4YGDB 1CMFA 2QDIA 2K0JA 2JPTA 2KFFA 2LV7A 2WOSA 4DRWA 1V1FA 1L7ZA 3OB1B 1CMGA 2D8NA 4XJKA 2KAYA 3FE6A 5I8NA 3NXAA 3OGNA 1C3ZA 3TDIA 2LMTA 1QXPA 3JTDC 4NDCA 3D76A 3I5HB 2BNXA 2GV5A 1CTRA 2H61C 5FYXA 3SG3A 1CLBA 2DOQA 1BT6A 3CTNA 1OMVA 1KQVA 1UWOA 2ZNEA 1Z4HA 1YVLA 2K2FA 2K2AA 2E6WA 2LC5A 4YBHB 4N1FA 2GGMA 3PSRA 1V1GA
chains in the Genus database with same CATH topology
1SK6D 2EC6B 4GGNA 1DGVA 5CSFA 2SCPA 1KK7Z 4PHMA 4D1EA 3BUOB 3SG5A 4UPGA 1DMOA 1FI5A 1B9AA 1BU3A 2K7OA 2KYCA 2OS8B 3LCPC 4PE4A 1BR4B 5GQQC 2LVKA 2WCBA 1OZOA 3K21A 1UP5A 2BL0B 3OX6A 1NSHA 3SG4A 1DJYA 1DJHA 1S6IA 1DVIA 4ORCB 1JFJA 1C07A 1TIZA 2AAOA 1DJGA 1B8CA 2LMVA 1K96A 1LXFC 2FJUB 3PALA 4ORAB 3SIBA 4AQJA 3I5HC 3D0YA 1G8IA 3DVJA 4YGEB 1J55A 2KBIA 2I2RE 3KPXA 1LVCD 1ALWA 1QIVA 4FTGA 2KBMA 2CNPA 3NSKA 3WHUB 1DGUA 2JNFA 3TDUA 2HPSA 5I2QA 4CFRA 2O60A 5D69A 3M0WA 1QX2A 1B7TY 1X02A 2M49B 2Y4QA 3LK1A 2FCEA 5AFPA 1XFVO 4ZCVA 3CR4X 2ZRSA 3DD4A 5ER4X 1CM1A 2OS8C 2GGZA 4HRGA 1J7PA 1R2UA 1JFKA 1OQPA 2BL0C 2LAPA 1BOCA 2ISDA 1CFDA 2G2BA 1PULA 1FI6A 2JOJA 2KYFA 4ICBA 1QX7A 4YI8A 4WQ3A 2JRFA 1CFPA 2KQYA 4C0LA 2JTZA 2JXLA 2L2EA 2WC8A 1KCYA 2TN4A 1EL4A 3BUMB 2LUCA 1J7RA 1N2DA 4P2YB 4F0ZB 1CKKA 1OMDA 1CDNA 3WHTB 1M46A 1MXEA 4YGBB 1QVIZ 1WRZA 3I5IB 5CSNA 3VRNA 1J7OA 2LANA 5HKWA 3DVMA 1DT7B 1XO5A 1EH2A 1OSAA 2E30A 2WCEA 4MRXA 4N5XA 1KFXL 1QS7A 3PN7B 4JPZB 4NDDA 1RFJA 3DF0A 3WXAA 1RWYA 2ZKMX 1NCZA 4PE1A 2HQ8A 3FIAA 4QJ4B 1BG1A 1MHOA 1AK8A 2CCMA 4E68A 1YUUA 1XK4C 4GBAA 3D0YB 5BPJA 4ETOA 2CTNA 2WCFA 2KQ6A 1PSRA 1IH0A 1ZOTB 4QJ5B 1MWNA 1ALVA 5HKYA 3MSEB 1F55A 5DKNA 2JT8A 1PK0D 2P6BB 1RJVA 3BUXB 1DJIA 5G08A 4C0JA 1NX1A 1CDPA 4CLNA 1SMGA 1SRAA 1SW8A 4IL1A 1W7JB 1K9UA 3I5IC 1JF0A 1Y1AA 4ZCUA 3I5FB 1QV1A 2I94A 3NSLA 2G9BA 1SBJA 1S5GY 2LM5A 3PN7C 5K89A 3SG7A 2F2PA 1GGZA 1SL8A 4PDZA 1TTXA 2BKIB 1AJ4A 3CLNA 1PVAA 4GAOA 1F71A 1KFXS 3O6BA 4NDBA 5IBWA 2L51A 4YGAA 2H2KA 3GK4X 2JT0A 1SPYA 3BOWA 1UURA 3F45A 1M39A 2KGRA 1TOPA 5CSIA 3ZWHA 1KK8B 4GPLB 1Y6WA 2KNEA 1K2HA 4I5KA 1IQ3A 3SG6A 2BCBA 1NUBA 3A4UB 3DF0B 1QLKA 4R1EA 2L98A 5TNCA 4GGFA 1JC2A 3I5FC 3GOFA 1Y0VH 1FF1A 2R2IA 3KEVA 4MZKA 4YI9A 2KFGA 1A29A 3LK0A 4WRIA 3PLFB 1QIWA 2KI4B 3O4YA 1NIWA 2RGIA 3PM8A 1A4PA 2FOTA 1A2XA 4JWQA 2LVIA 1J1DA 3AKBA 1E8AA 2M9GA 3AKAA 1B1GA 2KI6D 3EK7A 1LKJA 4I5LB 3TS5B 2BCAA 2F3YA 1SNLA 4P5OE 5AXIA 1ZACA 2KI6C 1KK8C 2L50A 1UHKA 2I7AA 1S36A 3EKHA 1UHIA 4A4BA 1KFUL 2SASA 1S26D 2KGBC 2Q4UA 4DCKA 4MRYA 1K9PA 2LLUA 2AUCA 3AAKA 4AOMA 1MR8A 2EC6C 1H8BA 1KWOB 2KOTA 1K8UA 3OX5A 4N1GA 3VRQA 1FPWA 3ZNIA 1N0YA 3SG2A 2LUXA 2MA2A 2BCXA 1EG3A 2K7BA 1SR6B 2KI4C 1EXRA 1U5IA 3BOWB 4XJKB 4AQIA 1SCMB 2LP3A 3EKJA 2I18A 1SL9A 2K61A 4MBEA 4A4CA 1SKTA 5KTYA 3EVUA 2HF5A 4I5JA 5DKQA 2OTGB 2V53A 5AERA 1TCOB 2JULA 5I2LA 1HT9A 3TS5C 1M31A 4HSZA 1NCYA 2JNXA 3BQ3A 2H61A 2LP2A 4GNKB 1A75A 4MEWA 1QLSA 2COLB 4MVFA 1K9KA 2BE4A 1B47A 1XFZO 3C1VA 2CBLA 4DS7A 1S6JA 2M29A 1NYAA 1YX8A 4BY5A 3FWBA 1YRUB 1C7WA 1WDCB 3EVRA 2L0PA 3OHMB 4U8DA 2Y5IA 2K8MB 1NX3A 1KWOC 2MLFC 1GQMA 3A8RA 4OCIA 2F3ZA 1KFUS 4OV2A 5KU1A 3EK4A 4M2PA 3KHEA 1NWDA 2PMYA 4M2OA 1SR6C 3CGAA 1R6PA 1K94A 3NSIA 3SJSA 2L4HA 1PVBA 1SCMC 5KSZA 4OVNF 1AP4A 5JOLA 2MHHA 5HLOA 5PALA 1K90D 1MXLC 2KDHA 1M45A 3IQQA 2MBXA 3KO0A 4MZLA 1Y1XA 1QATA 1CM4A 1TRFA 4YRUA 1ZUZA 2M8UA 2KAXA 2OPOA 1DF0A 2M1KB 4YGCB 4ORBB 1BMOA 2NXQA 1TNWA 4HREE 1MQ1A 1PSBA 2PRUA 2Y1NA 1SCVA 1XFUO 4PHJA 1TCFA 5HYDA 2JWWA 2LLTA 1S1EA 1G33A 1WDCC 2KFHA 1AHRA 3BXKA 1G4YR 1SY9A 3E3RA 1BJFA 1UUSA 2NZ0A 4CPVA 4C0KA 1LINA 1NCXA 1D1OA 3FWCA 2BBMA 1MUXA 4DIRA 3BYAA 5D7FA 3LL8B 1JSAA 1YTZC 1CLLA 1A75B 2M7NA 2PSRA 2ZNDA 1RROA 1YX7A 2F8PA 2JT3A 4DUQA 3SIAA 1YVHA 2BKHB 2JU0A 1F4QA 1TNXA 3NSOA 1KK7Y 3IQOA 2ZRTA 1OE9B 5B8IB 1CFCA 3QRXA 2EHBA 4PHKA 3CWGA 4Q04A 3HCMA 3HX4A 2JTTA 3TDZA 4CFQA 2M0RA 4FQOA 2JC2A 1GJYA 1UHHA 2M1UA 2K7DA 4MLWA 3D10A 1WY9A 2CT9A 4PCWA 3VGOA 2MRDA 1DTLA 1WLZA 3DVEA 1Q80A 1XYDA 2PVBA 1RTP1 1KSOA 1B4CA 3OP0A 1IQ5A 1JWDA 1S5GZ 1B8LA 1RK9A 2WORA 3GK2A 3KF9A 3PFVA 4PHNA 1N65A 1XK4A 2F33A 2KAVA 2B1UA 2KSPA 2LVJA 1BODA 3RM1A 1C7VA 1DF0B 1TNQA 1Y1UA 2O5GA 1CLMA 2LVVA 1IGVA 1W7IB 1UHNA 1AUIB 1QASA 1XFXO 2L5XB 4M2QA 1AVSA 1PALA 3OB2B 1F4OA 2ZN8A 1YUTA 1XFYO 3VRRA 4XYNA 1IKUA 1OZSA 1YR5A 2JZIA 1F8HA 3GK1A 1H4BA 1TN4A 4MN0A 2VRGA 1SL7A 4GUKA 1CNPA 3EVVA 1CDLA 4JQ0D 3PATA 1KQMB 2K7CA 1IRJA 1XVJA 2M3WA 1JBAA 1AJ5A 4OKHA 1ZMZA 2WNDA 3LLEA 1J1EA 4PALA 2NLNA 4NQGA 1QVIY 1J7QA 2AMIA 1LA3A 1ODBA 1JF2A 2QACA 3ICBA 5JJGA 4GFTA 1YUSA 1XA5A 2ZN9A 2BBNA 1FBVA 1IJ6A 1QX5B 2IS9A 1K93D 1OMRA 2CXJA 1CB1A 1WRLA 1VRKA 2JXCA 5AEQA 1NX2A 2QPTA 1NP8A 1B8RA 2MLEC 1XFWO 4BY4A 2LE9B 3O2PA 1BF5A 1BLQA 1KSMA 1NPQA 1OOJA 4WQ2A 5HKZA 3I5GB 2L4IA 1IWQA 2PALA 3JVTB 5CPVA 2HETA 2HQWA 1KQMC 2ZFDA 1JUOA 2LNKA 4TNCA 3TUYB 1RECA 2EGDA 3VROA 4OR9B 1GGWA 3CR2A 1B7TZ 1L2OB 1WRKA 1IJ5A 3IF7A 3TZ1A 3EK8A 4MZJA 1M63B 2F2OA 1YRTB 2OTGC 1QJTA 3H4SE 3WNXB 3AAJA 2JQ6A 3FS7A 2NCPA 5AANA 5I2OA 2LMUA 2LCPA 2LHLA 3BUWB 1DJWA 2FCDA 2MJWB 3RLZA 1A03A 4GGFC 2KHNA 5J3XA 2LLSA 2NCOA 2M7LA 5HLVA 3CR5X 1BR1B 2Q91A 3CS1A 1U5IB 4L9MA 4MSPA 1F70A 2M97A 5DKRA 3I5GC 3JVTC 2Y1MA 2BE6A 1LA0A 1S6CA 4PE7A 4PE0A 1S3PA 1QV0A 3TUYC 1ZFSA 5ER5A 1UHJA 3JTDB 1DJZA 1DJXA 4I5NB 1NX0A 3DVKA 1L2OC 1IG5A 4HRHA 1QTXA 3O78A 5F6TA 1K95A 1CDMA 1YURA 1SYMA 3CZTX 1EJ3A 3VRPA 1WLMA 1F54A 5CSJA 1CFFA 2LHIA 2MAZA 3BUNB 4QJ3B 1TNPA 2BECA 2PASA 2A4JA 4USLA 1FW4A 1HQVA 1EG4A 1MF8B 1PRWA 4CIDA 4YGDB 1CMFA 2K0JA 2JPTA 2KFFA 2LV7A 2WOSA 4DRWA 1V1FA 1L7ZA 3OB1B 1CMGA 2D8NA 4XJKA 2KAYA 5I8NA 3NXAA 3TDIA 2LMTA 1QXPA 3JTDC 4NDCA 3I5HB 2GV5A 2H61C 1CTRA 3SG3A 5FYXA 1CLBA 2DOQA 1BT6A 3CTNA 1OMVA 1KQVA 1UWOA 2ZNEA 4YBHB 1YVLA 2K2FA 2K2AA 2E6WA 2LC5A 4N1FA 2GGMA 3PSRA 1V1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SK6 D;  2EC6 B;  4GGN A;  1DGV A;  5CSF A;  2SCP A;  1KK7 Z;  4PHM A;  4D1E A;  3BUO B;  3SG5 A;  4UPG A;  1DMO A;  1FI5 A;  1B9A A;  1BU3 A;  2K7O A;  2KYC A;  2OS8 B;  3LCP C;  4PE4 A;  1BR4 B;  5GQQ C;  2LVK A;  2WCB A;  1OZO A;  3K21 A;  1UP5 A;  2BL0 B;  3OX6 A;  1NSH A;  3SG4 A;  1DJY A;  1DJH A;  1S6I A;  1DVI A;  4ORC B;  1JFJ A;  1C07 A;  1TIZ A;  2AAO A;  1DJG A;  1B8C A;  2LMV A;  1K96 A;  1LXF C;  2FJU B;  3PAL A;  4ORA B;  3SIB A;  4AQJ A;  3I5H C;  3D0Y A;  1G8I A;  3DVJ A;  4YGE B;  1J55 A;  2KBI A;  2I2R E;  3KPX A;  1LVC D;  1ALW A;  1QIV A;  4FTG A;  2KBM A;  2CNP A;  3NSK A;  3WHU B;  1DGU A;  2JNF A;  3TDU A;  2HPS A;  5I2Q A;  4CFR A;  2O60 A;  5D69 A;  3M0W A;  1QX2 A;  1B7T Y;  1X02 A;  2M49 B;  2Y4Q A;  3LK1 A;  2FCE A;  5AFP A;  1XFV O;  4ZCV A;  3CR4 X;  2ZRS A;  3DD4 A;  5ER4 X;  1CM1 A;  2OS8 C;  2GGZ A;  4HRG A;  1J7P A;  1R2U A;  1JFK A;  1OQP A;  2BL0 C;  2LAP A;  1BOC A;  2ISD A;  1CFD A;  2G2B A;  1PUL A;  1FI6 A;  2JOJ A;  2KYF A;  4ICB A;  1QX7 A;  4YI8 A;  4WQ3 A;  2JRF A;  1CFP A;  2KQY A;  4C0L A;  2JTZ A;  2JXL A;  2L2E A;  2WC8 A;  1KCY A;  2TN4 A;  1EL4 A;  3BUM B;  2LUC A;  1J7R A;  1N2D A;  4P2Y B;  4F0Z B;  1CKK A;  1OMD A;  1CDN A;  3WHT B;  1M46 A;  1MXE A;  4YGB B;  1QVI Z;  1WRZ A;  3I5I B;  5CSN A;  3VRN A;  1J7O A;  2LAN A;  5HKW A;  3DVM A;  1DT7 B;  1XO5 A;  1EH2 A;  1OSA A;  2E30 A;  2WCE A;  4MRX A;  4N5X A;  1KFX L;  1QS7 A;  3PN7 B;  4JPZ B;  4NDD A;  1RFJ A;  3DF0 A;  3WXA A;  1RWY A;  2ZKM X;  1NCZ A;  4PE1 A;  2HQ8 A;  3FIA A;  4QJ4 B;  1BG1 A;  1MHO A;  1AK8 A;  2CCM A;  4E68 A;  1YUU A;  1XK4 C;  4GBA A;  3D0Y B;  5BPJ A;  4ETO A;  2CTN A;  2WCF A;  2KQ6 A;  1PSR A;  1IH0 A;  1ZOT B;  4QJ5 B;  1MWN A;  1ALV A;  5HKY A;  3MSE B;  1F55 A;  5DKN A;  2JT8 A;  1PK0 D;  2P6B B;  1RJV A;  3BUX B;  1DJI A;  5G08 A;  4C0J A;  1NX1 A;  1CDP A;  4CLN A;  1SMG A;  1SRA A;  1SW8 A;  4IL1 A;  1W7J B;  1K9U A;  3I5I C;  1JF0 A;  1Y1A A;  4ZCU A;  3I5F B;  1QV1 A;  2I94 A;  3NSL A;  2G9B A;  1SBJ A;  1S5G Y;  2LM5 A;  3PN7 C;  5K89 A;  3SG7 A;  2F2P A;  1GGZ A;  1SL8 A;  4PDZ A;  1TTX A;  2BKI B;  1AJ4 A;  3CLN A;  1PVA A;  4GAO A;  1F71 A;  1KFX S;  3O6B A;  4NDB A;  5IBW A;  2L51 A;  4YGA A;  2H2K A;  3GK4 X;  2JT0 A;  1SPY A;  3BOW A;  1UUR A;  3F45 A;  1M39 A;  2KGR A;  1TOP A;  5CSI A;  3ZWH A;  1KK8 B;  4GPL B;  1Y6W A;  2KNE A;  1K2H A;  4I5K A;  1IQ3 A;  3SG6 A;  2BCB A;  1NUB A;  3A4U B;  3DF0 B;  1QLK A;  4R1E A;  2L98 A;  5TNC A;  4GGF A;  1JC2 A;  3I5F C;  3GOF A;  1Y0V H;  1FF1 A;  2R2I A;  3KEV A;  4MZK A;  4YI9 A;  2KFG A;  1A29 A;  3LK0 A;  4WRI A;  3PLF B;  1QIW A;  2KI4 B;  3O4Y A;  1NIW A;  2RGI A;  3PM8 A;  1A4P A;  2FOT A;  1A2X A;  4JWQ A;  2LVI A;  1J1D A;  3AKB A;  1E8A A;  2M9G A;  3AKA A;  1B1G A;  2KI6 D;  3EK7 A;  1LKJ A;  4I5L B;  3TS5 B;  2BCA A;  2F3Y A;  1SNL A;  4P5O E;  5AXI A;  1ZAC A;  2KI6 C;  1KK8 C;  2L50 A;  1UHK A;  2I7A A;  1S36 A;  3EKH A;  1UHI A;  4A4B A;  1KFU L;  2SAS A;  1S26 D;  2KGB C;  2Q4U A;  4DCK A;  4MRY A;  1K9P A;  2LLU A;  2AUC A;  3AAK A;  4AOM A;  1MR8 A;  2EC6 C;  1H8B A;  1KWO B;  2KOT A;  1K8U A;  3OX5 A;  4N1G A;  3VRQ A;  1FPW A;  3ZNI A;  1N0Y A;  3SG2 A;  2LUX A;  2MA2 A;  2BCX A;  1EG3 A;  2K7B A;  1SR6 B;  2KI4 C;  1EXR A;  1U5I A;  3BOW B;  4XJK B;  4AQI A;  1SCM B;  2LP3 A;  3EKJ A;  2I18 A;  1SL9 A;  2K61 A;  4MBE A;  4A4C A;  1SKT A;  5KTY A;  3EVU A;  2HF5 A;  4I5J A;  5DKQ A;  2OTG B;  2V53 A;  5AER A;  1TCO B;  2JUL A;  5I2L A;  1HT9 A;  3TS5 C;  1M31 A;  4HSZ A;  1NCY A;  2JNX A;  3BQ3 A;  2H61 A;  2LP2 A;  4GNK B;  1A75 A;  4MEW A;  1QLS A;  2COL B;  4MVF A;  1K9K A;  2BE4 A;  1B47 A;  1XFZ O;  3C1V A;  2CBL A;  4DS7 A;  1S6J A;  2M29 A;  1NYA A;  1YX8 A;  4BY5 A;  3FWB A;  1YRU B;  1C7W A;  1WDC B;  3EVR A;  2L0P A;  3OHM B;  4U8D A;  2Y5I A;  2K8M B;  1NX3 A;  1KWO C;  2MLF C;  1GQM A;  3A8R A;  4OCI A;  2F3Z A;  1KFU S;  4OV2 A;  5KU1 A;  3EK4 A;  4M2P A;  3KHE A;  1NWD A;  2PMY A;  4M2O A;  1SR6 C;  3CGA A;  1R6P A;  1K94 A;  3NSI A;  3SJS A;  2L4H A;  1PVB A;  1SCM C;  5KSZ A;  4OVN F;  1AP4 A;  5JOL A;  2MHH A;  5HLO A;  5PAL A;  1K90 D;  1MXL C;  2KDH A;  1M45 A;  3IQQ A;  2MBX A;  3KO0 A;  4MZL A;  1Y1X A;  1QAT A;  1CM4 A;  1TRF A;  4YRU A;  1ZUZ A;  2M8U A;  2KAX A;  2OPO A;  1DF0 A;  2M1K B;  4YGC B;  4ORB B;  1BMO A;  2NXQ A;  1TNW A;  4HRE E;  1MQ1 A;  1PSB A;  2PRU A;  2Y1N A;  1SCV A;  1XFU O;  4PHJ A;  1TCF A;  5HYD A;  2JWW A;  2LLT A;  1S1E A;  1G33 A;  1WDC C;  2KFH A;  1AHR A;  3BXK A;  1G4Y R;  1SY9 A;  3E3R A;  1BJF A;  1UUS A;  2NZ0 A;  4CPV A;  4C0K A;  1LIN A;  1NCX A;  1D1O A;  3FWC A;  2BBM A;  1MUX A;  4DIR A;  3BYA A;  5D7F A;  3LL8 B;  1JSA A;  1YTZ C;  1CLL A;  1A75 B;  2M7N A;  2PSR A;  2ZND A;  1RRO A;  1YX7 A;  2F8P A;  2JT3 A;  4DUQ A;  3SIA A;  1YVH A;  2BKH B;  2JU0 A;  1F4Q A;  1TNX A;  3NSO A;  1KK7 Y;  3IQO A;  2ZRT A;  1OE9 B;  5B8I B;  1CFC A;  3QRX A;  2EHB A;  4PHK A;  3CWG A;  4Q04 A;  3HCM A;  3HX4 A;  2JTT A;  3TDZ A;  4CFQ A;  2M0R A;  4FQO A;  2JC2 A;  1GJY A;  1UHH A;  2M1U A;  2K7D A;  4MLW A;  3D10 A;  1WY9 A;  2CT9 A;  4PCW A;  3VGO A;  2MRD A;  1DTL A;  1WLZ A;  3DVE A;  1Q80 A;  1XYD A;  2PVB A;  1RTP 1;  1KSO A;  1B4C A;  3OP0 A;  1IQ5 A;  1JWD A;  1S5G Z;  1B8L A;  1RK9 A;  2WOR A;  3GK2 A;  3KF9 A;  3PFV A;  4PHN A;  1N65 A;  1XK4 A;  2F33 A;  2KAV A;  2B1U A;  2KSP A;  2LVJ A;  1BOD A;  3RM1 A;  1C7V A;  1DF0 B;  1TNQ A;  1Y1U A;  2O5G A;  1CLM A;  2LVV A;  1IGV A;  1W7I B;  1UHN A;  1AUI B;  1QAS A;  1XFX O;  2L5X B;  4M2Q A;  1AVS A;  1PAL A;  3OB2 B;  1F4O A;  2ZN8 A;  1YUT A;  1XFY O;  3VRR A;  4XYN A;  1IKU A;  1OZS A;  1YR5 A;  2JZI A;  1F8H A;  3GK1 A;  1H4B A;  1TN4 A;  4MN0 A;  2VRG A;  1SL7 A;  4GUK A;  1CNP A;  3EVV A;  1CDL A;  4JQ0 D;  3PAT A;  1KQM B;  2K7C A;  1IRJ A;  1XVJ A;  2M3W A;  1JBA A;  1AJ5 A;  4OKH A;  1ZMZ A;  2WND A;  3LLE A;  1J1E A;  4PAL A;  2NLN A;  4NQG A;  1QVI Y;  1J7Q A;  2AMI A;  1LA3 A;  1ODB A;  1JF2 A;  2QAC A;  3ICB A;  5JJG A;  4GFT A;  1YUS A;  1XA5 A;  2ZN9 A;  2BBN A;  1FBV A;  1IJ6 A;  1QX5 B;  2IS9 A;  1K93 D;  1OMR A;  2CXJ A;  1CB1 A;  1WRL A;  1VRK A;  2JXC A;  5AEQ A;  1NX2 A;  2QPT A;  1NP8 A;  1B8R A;  2MLE C;  1XFW O;  4BY4 A;  2LE9 B;  3O2P A;  1BF5 A;  1BLQ A;  1KSM A;  1NPQ A;  1OOJ A;  4WQ2 A;  5HKZ A;  3I5G B;  2L4I A;  1IWQ A;  2PAL A;  3JVT B;  5CPV A;  2HET A;  2HQW A;  1KQM C;  2ZFD A;  1JUO A;  2LNK A;  4TNC A;  3TUY B;  1REC A;  2EGD A;  3VRO A;  4OR9 B;  1GGW A;  3CR2 A;  1B7T Z;  1L2O B;  1WRK A;  1IJ5 A;  3IF7 A;  3TZ1 A;  3EK8 A;  4MZJ A;  1M63 B;  2F2O A;  1YRT B;  2OTG C;  1QJT A;  3H4S E;  3WNX B;  3AAJ A;  2JQ6 A;  3FS7 A;  2NCP A;  5AAN A;  5I2O A;  2LMU A;  2LCP A;  2LHL A;  3BUW B;  1DJW A;  2FCD A;  2MJW B;  3RLZ A;  1A03 A;  4GGF C;  2KHN A;  5J3X A;  2LLS A;  2NCO A;  2M7L A;  5HLV A;  3CR5 X;  1BR1 B;  2Q91 A;  3CS1 A;  1U5I B;  4L9M A;  4MSP A;  1F70 A;  2M97 A;  5DKR A;  3I5G C;  3JVT C;  2Y1M A;  2BE6 A;  1LA0 A;  1S6C A;  4PE7 A;  4PE0 A;  1S3P A;  1QV0 A;  3TUY C;  1ZFS A;  5ER5 A;  1UHJ A;  3JTD B;  1DJZ A;  1DJX A;  4I5N B;  1NX0 A;  3DVK A;  1L2O C;  1IG5 A;  4HRH A;  1QTX A;  3O78 A;  5F6T A;  1K95 A;  1CDM A;  1YUR A;  1SYM A;  3CZT X;  1EJ3 A;  3VRP A;  1WLM A;  1F54 A;  5CSJ A;  1CFF A;  2LHI A;  2MAZ A;  3BUN B;  4QJ3 B;  1TNP A;  2BEC A;  2PAS A;  2A4J A;  4USL A;  1FW4 A;  1HQV A;  1EG4 A;  1MF8 B;  1PRW A;  4CID A;  4YGD B;  1CMF A;  2K0J A;  2JPT A;  2KFF A;  2LV7 A;  2WOS A;  4DRW A;  1V1F A;  1L7Z A;  3OB1 B;  1CMG A;  2D8N A;  4XJK A;  2KAY A;  5I8N A;  3NXA A;  3TDI A;  2LMT A;  1QXP A;  3JTD C;  4NDC A;  3I5H B;  2GV5 A;  2H61 C;  1CTR A;  3SG3 A;  5FYX A;  1CLB A;  2DOQ A;  1BT6 A;  3CTN A;  1OMV A;  1KQV A;  1UWO A;  2ZNE A;  4YBH B;  1YVL A;  2K2F A;  2K2A A;  2E6W A;  2LC5 A;  4N1F A;  2GGM A;  3PSR A;  1V1G A; 
#chains in the Genus database with same CATH topology
 1SK6 D;  2EC6 B;  4GGN A;  1DGV A;  5CSF A;  2QEV A;  2SCP A;  1KK7 Z;  4OZD A;  4PHM A;  4D1E A;  3BUO B;  3CYZ A;  3SG5 A;  4UPG A;  1DMO A;  3PJI A;  1FI5 A;  1B9A A;  1BU3 A;  2H8V A;  2K7O A;  2KYC A;  2OS8 B;  3LCP C;  4PE4 A;  1BR4 B;  5GQQ C;  2LVK A;  2WCB A;  1OZO A;  3K21 A;  3CZ1 A;  1UP5 A;  2BL0 B;  3OX6 A;  1NSH A;  3SG4 A;  1DJY A;  1DJH A;  1S6I A;  2PYQ A;  1DVI A;  3D75 A;  4ORC B;  1JFJ A;  1C07 A;  1TIZ A;  2AAO A;  1DJG A;  1B8C A;  2LMV A;  3B87 A;  1K96 A;  1LXF C;  2FJU B;  3CZ0 A;  3PAL A;  4ORA B;  3SIB A;  4AQJ A;  3I5H C;  3D0Y A;  1G8I A;  3DVJ A;  4YGE B;  2QEO A;  1J55 A;  5DIC A;  2KBI A;  2I2R E;  3KPX A;  1LVC D;  1ALW A;  1QIV A;  4FTG A;  2KBM A;  2CNP A;  3NSK A;  3WHU B;  1C3Y A;  1DGU A;  2JNF A;  1DEL A;  3TDU A;  2HPS A;  5I2Q A;  4CFR A;  2O60 A;  5D69 A;  3M0W A;  1QX2 A;  1B7T Y;  1X02 A;  2M49 B;  2Y4Q A;  3LK1 A;  2FCE A;  5AFP A;  1XFV O;  4ZCV A;  3CR4 X;  2ZRS A;  3DD4 A;  5ER4 X;  1QWV A;  3NGV A;  1CM1 A;  2OS8 C;  1P28 A;  2GGZ A;  4HRG A;  1J7P A;  1R2U A;  1JFK A;  1OQP A;  2BL0 C;  2LAP A;  1BOC A;  4IJ7 A;  2ISD A;  1CFD A;  2G2B A;  1PUL A;  1FI6 A;  2JOJ A;  2KYF A;  4ICB A;  1QX7 A;  4YI8 A;  4WQ3 A;  2JRF A;  1CFP A;  2KQY A;  4C0L A;  2JTZ A;  2JXL A;  2L2E A;  2WC8 A;  1KCY A;  2TN4 A;  1EL4 A;  3BUM B;  2LUC A;  1J7R A;  1N2D A;  4P2Y B;  4F0Z B;  1CKK A;  1OMD A;  2WCL A;  1CDN A;  3WHT B;  1M46 A;  1MXE A;  4YGB B;  1QVI Z;  1WRZ A;  3I5I B;  5CSN A;  3VRN A;  1J7O A;  2LAN A;  5HKW A;  3DVM A;  1DT7 B;  1XO5 A;  1EH2 A;  1OSA A;  2E30 A;  2KPH A;  2WCE A;  4MRX A;  4N5X A;  1KFX L;  3R1P A;  3S0G A;  1QS7 A;  3PN7 B;  3QME A;  5HL1 A;  4JPZ B;  4NDD A;  1RFJ A;  1ORG A;  3DF0 A;  3S0B A;  3WXA A;  1RWY A;  2ZKM X;  1NCZ A;  4PE1 A;  5FI7 A;  2HQ8 A;  3FIA A;  4QJ4 B;  1BG1 A;  1MHO A;  3OBV A;  1AK8 A;  2L2C A;  2CCM A;  4E68 A;  1YUU A;  1XK4 C;  4GBA A;  3D0Y B;  5BPJ A;  4ETO A;  2CTN A;  2WCF A;  2KQ6 A;  1PSR A;  1IH0 A;  5I94 A;  1ZOT B;  4QJ5 B;  1MWN A;  1GM0 A;  1ALV A;  5HKY A;  3MSE B;  1F55 A;  5DKN A;  2JT8 A;  3S0F A;  2WC5 A;  1PK0 D;  2P6B B;  1RJV A;  3BUX B;  1DJI A;  3D78 A;  3N7H A;  5G08 A;  1NX1 A;  4C0J A;  1CDP A;  4CLN A;  1SMG A;  1SRA A;  1SW8 A;  4IL1 A;  1W7J B;  1K9U A;  3S0D A;  3I5I C;  3R1O A;  1JF0 A;  1Y1A A;  3D73 A;  4ZCU A;  3I5F B;  1QV1 A;  2I94 A;  3NSL A;  2G9B A;  1SBJ A;  1S5G Y;  2LM5 A;  3PN7 C;  5K89 A;  3SG7 A;  2F2P A;  1GGZ A;  2P70 A;  1SL8 A;  4PDZ A;  1TTX A;  2BKI B;  1AJ4 A;  3CLN A;  1PVA A;  2P71 A;  3R72 A;  4GAO A;  1F71 A;  1OW4 A;  1KFX S;  3O6B A;  4NDB A;  5IBW A;  2L51 A;  4YGA A;  2H2K A;  3GK4 X;  1DEK A;  2JT0 A;  3L4A A;  1SPY A;  3BOW A;  1UUR A;  3F45 A;  1M39 A;  2KGR A;  1TOP A;  5CSI A;  3ZWH A;  1KK8 B;  4GPL B;  1Y6W A;  3K1E A;  3CDN A;  2KNE A;  1K2H A;  4FQT A;  4I5K A;  1IQ3 A;  3SG6 A;  2BCB A;  1NUB A;  3A4U B;  3DF0 B;  1QLK A;  4R1E A;  2L98 A;  5TNC A;  4GGF A;  1JC2 A;  3I5F C;  3NHT A;  3GOF A;  1Y0V H;  1FF1 A;  2R2I A;  3KEV A;  4MZK A;  4YI9 A;  2KFG A;  1A29 A;  3LK0 A;  3O4X A;  3PLF B;  1QIW A;  2KI4 B;  3O4Y A;  1NIW A;  2RGI A;  3PM8 A;  1A4P A;  1W9Z A;  2FOT A;  1A2X A;  4JWQ A;  2LVI A;  1J1D A;  3AKB A;  1E8A A;  2M9G A;  3AKA A;  1B1G A;  2KI6 D;  3EK7 A;  1LKJ A;  2KLD A;  4I5L B;  3TS5 B;  3DY9 A;  2BCA A;  2F3Y A;  1SNL A;  4P5O E;  5AXI A;  1ZAC A;  2KI6 C;  1KK8 C;  2L50 A;  1UHK A;  2I7A A;  1S36 A;  3EKH A;  1UHI A;  4A4B A;  1KFU L;  2SAS A;  1S26 D;  2KGB C;  2Q4U A;  4DCK A;  4MRY A;  1K9P A;  2LLU A;  3B86 A;  2AUC A;  3D74 A;  3AAK A;  4AOM A;  1MR8 A;  2EC6 C;  3R1V A;  1H8B A;  1KWO B;  2K60 A;  2KOT A;  1K8U A;  3OX5 A;  4N1G A;  5FI6 A;  3VRQ A;  3ZNI A;  1FPW A;  1N0Y A;  3SG2 A;  2LUX A;  2MA2 A;  2BCX A;  1EG3 A;  2K7B A;  2PQL A;  1SR6 B;  2KI4 C;  1EXR A;  1U5I A;  3BOW B;  4XJK B;  4AQI A;  1SCM B;  2LP3 A;  3EKJ A;  2I18 A;  1SL9 A;  1T14 A;  2K61 A;  4MBE A;  4A4C A;  1SKT A;  3CZ2 A;  3EVU A;  3FE9 A;  3S0E A;  2HF5 A;  4I5J A;  5DKQ A;  2OTG B;  5KTY A;  2V53 A;  5AER A;  1TCO B;  2JUL A;  5I2L A;  3UNW A;  1HT9 A;  3TS5 C;  1M31 A;  4HSZ A;  3V2L A;  3NHI A;  1NCY A;  3UO9 A;  2JNX A;  3BQ3 A;  5D3O A;  2H61 A;  2LP2 A;  4GNK B;  1A75 A;  4MEW A;  1QLS A;  2COL B;  4MVF A;  1K9K A;  2BE4 A;  1B47 A;  1XFZ O;  3C1V A;  2CBL A;  4DS7 A;  1S6J A;  2M29 A;  1NYA A;  1YX8 A;  4JKT A;  4F7F A;  4BY5 A;  3FWB A;  1YRU B;  1C7W A;  1WDC B;  3EVR A;  2L0P A;  3OHM B;  4U8D A;  2Y5I A;  2K8M B;  1NX3 A;  1KWO C;  2MLF C;  1GQM A;  3A8R A;  4OCI A;  2F3Z A;  1KFU S;  4OV2 A;  5KU1 A;  3SS4 A;  3EK4 A;  4M2P A;  3KHE A;  1NWD A;  2PMY A;  4M2O A;  1SR6 C;  3CGA A;  1R6P A;  1K94 A;  3NSI A;  3SJS A;  2L4H A;  2WCK A;  1PVB A;  1SCM C;  5KSZ A;  1XFR A;  4OVN F;  1AP4 A;  5JOL A;  3B6X A;  2MHH A;  4PT1 A;  4JD9 A;  5HLO A;  5PAL A;  1K90 D;  1MXL C;  2KDH A;  1M45 A;  3IQQ A;  2MBX A;  3KO0 A;  4MZL A;  3DZT A;  1Y1X A;  1QAT A;  1CM4 A;  1TRF A;  4YRU A;  1ZUZ A;  2M8U A;  2KAX A;  1LS8 A;  2OPO A;  2KLE A;  2WCM A;  3CAB A;  1DF0 A;  2M1K B;  4YGC B;  4ORB B;  1BMO A;  2NXQ A;  1TNW A;  4HRE E;  1MQ1 A;  1PSB A;  2PRU A;  2Y1N A;  1SCV A;  1XFU O;  4PHJ A;  1TCF A;  5HYD A;  2JWW A;  2LLT A;  2WC6 A;  1S1E A;  1G33 A;  1WDC C;  2KFH A;  1AHR A;  4KYN A;  3BFA A;  3BXK A;  1G4Y R;  1DQE A;  1SY9 A;  1TUZ A;  1BJF A;  1UUS A;  2NZ0 A;  3E3R A;  4C0K A;  1LIN A;  4CPV A;  1NCX A;  1D1O A;  3FWC A;  2BBM A;  1MUX A;  2JPO A;  4DIR A;  3BYA A;  5D7F A;  3LL8 B;  3SS3 A;  1JSA A;  1Z2C B;  1OOG A;  1YTZ C;  1CLL A;  1A75 B;  2M7N A;  2PSR A;  2ZND A;  1RRO A;  1YX7 A;  2F8P A;  2JT3 A;  3FE8 A;  4DUQ A;  3SIA A;  1YVH A;  2GTE A;  4INW A;  2BKH B;  2JU0 A;  1F4Q A;  1TNX A;  3NSO A;  1KK7 Y;  3IQO A;  2ZRT A;  1OE9 B;  3VB1 A;  5B8I B;  3QRX A;  2EHB A;  4PHK A;  1CFC A;  3CWG A;  4Q04 A;  3HCM A;  3HX4 A;  2JTT A;  3TDZ A;  4CFQ A;  2M0R A;  4FQO A;  2JC2 A;  1GJY A;  1UHH A;  1OOI X;  2K7D A;  2M1U A;  4MLW A;  3D10 A;  1WY9 A;  2CT9 A;  4PCW A;  3VGO A;  1SSE B;  3BFB A;  2MRD A;  1DTL A;  1WLZ A;  3DVE A;  1Q80 A;  1XYD A;  2PVB A;  1RTP 1;  2WCJ A;  1KSO A;  1B4C A;  3OP0 A;  1IQ5 A;  3EG5 B;  1S5G Z;  1B8L A;  1RK9 A;  2WOR A;  3GK2 A;  3KF9 A;  1JWD A;  3PFV A;  4PHN A;  1N65 A;  1XK4 A;  2F33 A;  2KAV A;  2B1U A;  2KSP A;  2LVJ A;  1BOD A;  3RM1 A;  1C7V A;  3B88 A;  1DF0 B;  1TNQ A;  1Y1U A;  2O5G A;  1TUJ A;  1CLM A;  1DC1 A;  2LVV A;  1IGV A;  1W7I B;  1TWO A;  2FJY A;  1UHN A;  1AUI B;  1QAS A;  1XFX O;  2L5X B;  4M2Q A;  1AVS A;  1PAL A;  3OB2 B;  1F4O A;  2ZN8 A;  1YUT A;  3L47 A;  1XFY O;  3VRR A;  4XYN A;  1IKU A;  1OZS A;  3Q8I A;  1YR5 A;  2JZI A;  1F8H A;  3GK1 A;  1H4B A;  1TN4 A;  4MN0 A;  2VRG A;  1SL7 A;  2QEB A;  4GUK A;  3EVV A;  1CDL A;  1CNP A;  4JQ0 D;  3PAT A;  1KQM B;  2K7C A;  1IRJ A;  1XVJ A;  3SS5 A;  2M3W A;  1JBA A;  1AJ5 A;  4OKH A;  1ZMZ A;  2WND A;  3LLE A;  1IIO A;  1J1E A;  4PAL A;  2NLN A;  3DYE A;  4NQG A;  3PM2 A;  1QVI Y;  1J7Q A;  2AMI A;  1LA3 A;  1ODB A;  1JF2 A;  2QAC A;  3ICB A;  5JJG A;  4GFT A;  1YUS A;  1XA5 A;  2ZN9 A;  2BBN A;  3BJH A;  1FBV A;  1IJ6 A;  1QX5 B;  2IS9 A;  1K93 D;  1OMR A;  2CXJ A;  1CB1 A;  1WRL A;  1VRK A;  2JXC A;  5AEQ A;  1NX2 A;  2QPT A;  1NP8 A;  3B7A A;  1B8R A;  2MLE C;  1XFW O;  4BY4 A;  2LE9 B;  3O2P A;  1BF5 A;  1BLQ A;  1KSM A;  4INX A;  1NPQ A;  1OOJ A;  4WQ2 A;  5HKZ A;  5FI2 A;  3I5G B;  2L4I A;  1IWQ A;  2PAL A;  3JVT B;  5CPV A;  2HET A;  2HQW A;  1KQM C;  2ZFD A;  1JUO A;  2LNK A;  4TNC A;  5EL2 A;  3TUY B;  1REC A;  2EGD A;  3VRO A;  4OR9 B;  1GGW A;  1OOH A;  3CR2 A;  1B7T Z;  1L2O B;  1WRK A;  1IJ5 A;  3IF7 A;  2BAP A;  3TZ1 A;  3EK8 A;  4MZJ A;  1M63 B;  2F2O A;  1YRT B;  2OTG C;  1QJT A;  3H4S E;  3WNX B;  3AAJ A;  2JQ6 A;  3FS7 A;  2NCP A;  5AAN A;  5I2O A;  2LMU A;  3DXL A;  2LCP A;  2LHL A;  3BUW B;  3D77 A;  1DJW A;  2FCD A;  2MJW B;  3RLZ A;  1A03 A;  4GGF C;  2KHN A;  5J3X A;  2LLS A;  2NCO A;  2M7L A;  5HLV A;  3CR5 X;  1BR1 B;  2Q91 A;  3CS1 A;  1U5I B;  3BFH A;  4L9M A;  4MSP A;  1F70 A;  2M97 A;  5DKR A;  3I5G C;  3JVT C;  1OOF A;  2Y1M A;  2BE6 A;  1LA0 A;  1S6C A;  4PE7 A;  4PE0 A;  1S3P A;  1QV0 A;  3TUY C;  1ZFS A;  5ER5 A;  1UHJ A;  2YGU A;  3JTD B;  1DJZ A;  4WRI A;  1DJX A;  3L4L A;  1NX0 A;  4I5N B;  3DVK A;  1L2O C;  1IG5 A;  4HRH A;  1QTX A;  3O78 A;  5F6T A;  3RZS A;  1K95 A;  1CDM A;  1YUR A;  1SYM A;  3CZT X;  3IVT A;  1EJ3 A;  3VRP A;  1WLM A;  1F54 A;  5CSJ A;  2L5Y A;  1CFF A;  2LHI A;  2MAZ A;  3BUN B;  4QJ3 B;  1TNP A;  3S0A A;  2BEC A;  2PAS A;  2A4J A;  2QEH A;  2WCH A;  4USL A;  2ERB A;  1FW4 A;  1HQV A;  1EG4 A;  1MF8 B;  1PRW A;  4CID A;  4YGD B;  1CMF A;  2QDI A;  2K0J A;  2JPT A;  2KFF A;  2LV7 A;  2WOS A;  4DRW A;  1V1F A;  1L7Z A;  3OB1 B;  1CMG A;  2D8N A;  4XJK A;  2KAY A;  3FE6 A;  5I8N A;  3NXA A;  3OGN A;  1C3Z A;  3TDI A;  2LMT A;  1QXP A;  3JTD C;  4NDC A;  3D76 A;  3I5H B;  2BNX A;  2GV5 A;  1CTR A;  2H61 C;  5FYX A;  3SG3 A;  1CLB A;  2DOQ A;  1BT6 A;  3CTN A;  1OMV A;  1KQV A;  1UWO A;  2ZNE A;  1Z4H A;  1YVL A;  2K2F A;  2K2A A;  2E6W A;  2LC5 A;  4YBH B;  4N1F A;  2GGM A;  3PSR A;  1V1G A; 
#chains in the Genus database with same CATH homology
 1SK6 D;  2EC6 B;  4GGN A;  1DGV A;  5CSF A;  2SCP A;  1KK7 Z;  4PHM A;  4D1E A;  3BUO B;  3SG5 A;  4UPG A;  1DMO A;  1FI5 A;  1B9A A;  1BU3 A;  2K7O A;  2KYC A;  2OS8 B;  3LCP C;  4PE4 A;  1BR4 B;  5GQQ C;  2LVK A;  2WCB A;  1OZO A;  3K21 A;  1UP5 A;  2BL0 B;  3OX6 A;  1NSH A;  3SG4 A;  1DJY A;  1DJH A;  1S6I A;  1DVI A;  4ORC B;  1JFJ A;  1C07 A;  1TIZ A;  2AAO A;  1DJG A;  1B8C A;  2LMV A;  1K96 A;  1LXF C;  2FJU B;  3PAL A;  4ORA B;  3SIB A;  4AQJ A;  3I5H C;  3D0Y A;  1G8I A;  3DVJ A;  4YGE B;  1J55 A;  2KBI A;  2I2R E;  3KPX A;  1LVC D;  1ALW A;  1QIV A;  4FTG A;  2KBM A;  2CNP A;  3NSK A;  3WHU B;  1DGU A;  2JNF A;  3TDU A;  2HPS A;  5I2Q A;  4CFR A;  2O60 A;  5D69 A;  3M0W A;  1QX2 A;  1B7T Y;  1X02 A;  2M49 B;  2Y4Q A;  3LK1 A;  2FCE A;  5AFP A;  1XFV O;  4ZCV A;  3CR4 X;  2ZRS A;  3DD4 A;  5ER4 X;  1CM1 A;  2OS8 C;  2GGZ A;  4HRG A;  1J7P A;  1R2U A;  1JFK A;  1OQP A;  2BL0 C;  2LAP A;  1BOC A;  2ISD A;  1CFD A;  2G2B A;  1PUL A;  1FI6 A;  2JOJ A;  2KYF A;  4ICB A;  1QX7 A;  4YI8 A;  4WQ3 A;  2JRF A;  1CFP A;  2KQY A;  4C0L A;  2JTZ A;  2JXL A;  2L2E A;  2WC8 A;  1KCY A;  2TN4 A;  1EL4 A;  3BUM B;  2LUC A;  1J7R A;  1N2D A;  4P2Y B;  4F0Z B;  1CKK A;  1OMD A;  1CDN A;  3WHT B;  1M46 A;  1MXE A;  4YGB B;  1QVI Z;  1WRZ A;  3I5I B;  5CSN A;  3VRN A;  1J7O A;  2LAN A;  5HKW A;  3DVM A;  1DT7 B;  1XO5 A;  1EH2 A;  1OSA A;  2E30 A;  2WCE A;  4MRX A;  4N5X A;  1KFX L;  1QS7 A;  3PN7 B;  4JPZ B;  4NDD A;  1RFJ A;  3DF0 A;  3WXA A;  1RWY A;  2ZKM X;  1NCZ A;  4PE1 A;  2HQ8 A;  3FIA A;  4QJ4 B;  1BG1 A;  1MHO A;  1AK8 A;  2CCM A;  4E68 A;  1YUU A;  1XK4 C;  4GBA A;  3D0Y B;  5BPJ A;  4ETO A;  2CTN A;  2WCF A;  2KQ6 A;  1PSR A;  1IH0 A;  1ZOT B;  4QJ5 B;  1MWN A;  1ALV A;  5HKY A;  3MSE B;  1F55 A;  5DKN A;  2JT8 A;  1PK0 D;  2P6B B;  1RJV A;  3BUX B;  1DJI A;  5G08 A;  4C0J A;  1NX1 A;  1CDP A;  4CLN A;  1SMG A;  1SRA A;  1SW8 A;  4IL1 A;  1W7J B;  1K9U A;  3I5I C;  1JF0 A;  1Y1A A;  4ZCU A;  3I5F B;  1QV1 A;  2I94 A;  3NSL A;  2G9B A;  1SBJ A;  1S5G Y;  2LM5 A;  3PN7 C;  5K89 A;  3SG7 A;  2F2P A;  1GGZ A;  1SL8 A;  4PDZ A;  1TTX A;  2BKI B;  1AJ4 A;  3CLN A;  1PVA A;  4GAO A;  1F71 A;  1KFX S;  3O6B A;  4NDB A;  5IBW A;  2L51 A;  4YGA A;  2H2K A;  3GK4 X;  2JT0 A;  1SPY A;  3BOW A;  1UUR A;  3F45 A;  1M39 A;  2KGR A;  1TOP A;  5CSI A;  3ZWH A;  1KK8 B;  4GPL B;  1Y6W A;  2KNE A;  1K2H A;  4I5K A;  1IQ3 A;  3SG6 A;  2BCB A;  1NUB A;  3A4U B;  3DF0 B;  1QLK A;  4R1E A;  2L98 A;  5TNC A;  4GGF A;  1JC2 A;  3I5F C;  3GOF A;  1Y0V H;  1FF1 A;  2R2I A;  3KEV A;  4MZK A;  4YI9 A;  2KFG A;  1A29 A;  3LK0 A;  4WRI A;  3PLF B;  1QIW A;  2KI4 B;  3O4Y A;  1NIW A;  2RGI A;  3PM8 A;  1A4P A;  2FOT A;  1A2X A;  4JWQ A;  2LVI A;  1J1D A;  3AKB A;  1E8A A;  2M9G A;  3AKA A;  1B1G A;  2KI6 D;  3EK7 A;  1LKJ A;  4I5L B;  3TS5 B;  2BCA A;  2F3Y A;  1SNL A;  4P5O E;  5AXI A;  1ZAC A;  2KI6 C;  1KK8 C;  2L50 A;  1UHK A;  2I7A A;  1S36 A;  3EKH A;  1UHI A;  4A4B A;  1KFU L;  2SAS A;  1S26 D;  2KGB C;  2Q4U A;  4DCK A;  4MRY A;  1K9P A;  2LLU A;  2AUC A;  3AAK A;  4AOM A;  1MR8 A;  2EC6 C;  1H8B A;  1KWO B;  2KOT A;  1K8U A;  3OX5 A;  4N1G A;  3VRQ A;  1FPW A;  3ZNI A;  1N0Y A;  3SG2 A;  2LUX A;  2MA2 A;  2BCX A;  1EG3 A;  2K7B A;  1SR6 B;  2KI4 C;  1EXR A;  1U5I A;  3BOW B;  4XJK B;  4AQI A;  1SCM B;  2LP3 A;  3EKJ A;  2I18 A;  1SL9 A;  2K61 A;  4MBE A;  4A4C A;  1SKT A;  5KTY A;  3EVU A;  2HF5 A;  4I5J A;  5DKQ A;  2OTG B;  2V53 A;  5AER A;  1TCO B;  2JUL A;  5I2L A;  1HT9 A;  3TS5 C;  1M31 A;  4HSZ A;  1NCY A;  2JNX A;  3BQ3 A;  2H61 A;  2LP2 A;  4GNK B;  1A75 A;  4MEW A;  1QLS A;  2COL B;  4MVF A;  1K9K A;  2BE4 A;  1B47 A;  1XFZ O;  3C1V A;  2CBL A;  4DS7 A;  1S6J A;  2M29 A;  1NYA A;  1YX8 A;  4BY5 A;  3FWB A;  1YRU B;  1C7W A;  1WDC B;  3EVR A;  2L0P A;  3OHM B;  4U8D A;  2Y5I A;  2K8M B;  1NX3 A;  1KWO C;  2MLF C;  1GQM A;  3A8R A;  4OCI A;  2F3Z A;  1KFU S;  4OV2 A;  5KU1 A;  3EK4 A;  4M2P A;  3KHE A;  1NWD A;  2PMY A;  4M2O A;  1SR6 C;  3CGA A;  1R6P A;  1K94 A;  3NSI A;  3SJS A;  2L4H A;  1PVB A;  1SCM C;  5KSZ A;  4OVN F;  1AP4 A;  5JOL A;  2MHH A;  5HLO A;  5PAL A;  1K90 D;  1MXL C;  2KDH A;  1M45 A;  3IQQ A;  2MBX A;  3KO0 A;  4MZL A;  1Y1X A;  1QAT A;  1CM4 A;  1TRF A;  4YRU A;  1ZUZ A;  2M8U A;  2KAX A;  2OPO A;  1DF0 A;  2M1K B;  4YGC B;  4ORB B;  1BMO A;  2NXQ A;  1TNW A;  4HRE E;  1MQ1 A;  1PSB A;  2PRU A;  2Y1N A;  1SCV A;  1XFU O;  4PHJ A;  1TCF A;  5HYD A;  2JWW A;  2LLT A;  1S1E A;  1G33 A;  1WDC C;  2KFH A;  1AHR A;  3BXK A;  1G4Y R;  1SY9 A;  3E3R A;  1BJF A;  1UUS A;  2NZ0 A;  4CPV A;  4C0K A;  1LIN A;  1NCX A;  1D1O A;  3FWC A;  2BBM A;  1MUX A;  4DIR A;  3BYA A;  5D7F A;  3LL8 B;  1JSA A;  1YTZ C;  1CLL A;  1A75 B;  2M7N A;  2PSR A;  2ZND A;  1RRO A;  1YX7 A;  2F8P A;  2JT3 A;  4DUQ A;  3SIA A;  1YVH A;  2BKH B;  2JU0 A;  1F4Q A;  1TNX A;  3NSO A;  1KK7 Y;  3IQO A;  2ZRT A;  1OE9 B;  5B8I B;  1CFC A;  3QRX A;  2EHB A;  4PHK A;  3CWG A;  4Q04 A;  3HCM A;  3HX4 A;  2JTT A;  3TDZ A;  4CFQ A;  2M0R A;  4FQO A;  2JC2 A;  1GJY A;  1UHH A;  2M1U A;  2K7D A;  4MLW A;  3D10 A;  1WY9 A;  2CT9 A;  4PCW A;  3VGO A;  2MRD A;  1DTL A;  1WLZ A;  3DVE A;  1Q80 A;  1XYD A;  2PVB A;  1RTP 1;  1KSO A;  1B4C A;  3OP0 A;  1IQ5 A;  1JWD A;  1S5G Z;  1B8L A;  1RK9 A;  2WOR A;  3GK2 A;  3KF9 A;  3PFV A;  4PHN A;  1N65 A;  1XK4 A;  2F33 A;  2KAV A;  2B1U A;  2KSP A;  2LVJ A;  1BOD A;  3RM1 A;  1C7V A;  1DF0 B;  1TNQ A;  1Y1U A;  2O5G A;  1CLM A;  2LVV A;  1IGV A;  1W7I B;  1UHN A;  1AUI B;  1QAS A;  1XFX O;  2L5X B;  4M2Q A;  1AVS A;  1PAL A;  3OB2 B;  1F4O A;  2ZN8 A;  1YUT A;  1XFY O;  3VRR A;  4XYN A;  1IKU A;  1OZS A;  1YR5 A;  2JZI A;  1F8H A;  3GK1 A;  1H4B A;  1TN4 A;  4MN0 A;  2VRG A;  1SL7 A;  4GUK A;  1CNP A;  3EVV A;  1CDL A;  4JQ0 D;  3PAT A;  1KQM B;  2K7C A;  1IRJ A;  1XVJ A;  2M3W A;  1JBA A;  1AJ5 A;  4OKH A;  1ZMZ A;  2WND A;  3LLE A;  1J1E A;  4PAL A;  2NLN A;  4NQG A;  1QVI Y;  1J7Q A;  2AMI A;  1LA3 A;  1ODB A;  1JF2 A;  2QAC A;  3ICB A;  5JJG A;  4GFT A;  1YUS A;  1XA5 A;  2ZN9 A;  2BBN A;  1FBV A;  1IJ6 A;  1QX5 B;  2IS9 A;  1K93 D;  1OMR A;  2CXJ A;  1CB1 A;  1WRL A;  1VRK A;  2JXC A;  5AEQ A;  1NX2 A;  2QPT A;  1NP8 A;  1B8R A;  2MLE C;  1XFW O;  4BY4 A;  2LE9 B;  3O2P A;  1BF5 A;  1BLQ A;  1KSM A;  1NPQ A;  1OOJ A;  4WQ2 A;  5HKZ A;  3I5G B;  2L4I A;  1IWQ A;  2PAL A;  3JVT B;  5CPV A;  2HET A;  2HQW A;  1KQM C;  2ZFD A;  1JUO A;  2LNK A;  4TNC A;  3TUY B;  1REC A;  2EGD A;  3VRO A;  4OR9 B;  1GGW A;  3CR2 A;  1B7T Z;  1L2O B;  1WRK A;  1IJ5 A;  3IF7 A;  3TZ1 A;  3EK8 A;  4MZJ A;  1M63 B;  2F2O A;  1YRT B;  2OTG C;  1QJT A;  3H4S E;  3WNX B;  3AAJ A;  2JQ6 A;  3FS7 A;  2NCP A;  5AAN A;  5I2O A;  2LMU A;  2LCP A;  2LHL A;  3BUW B;  1DJW A;  2FCD A;  2MJW B;  3RLZ A;  1A03 A;  4GGF C;  2KHN A;  5J3X A;  2LLS A;  2NCO A;  2M7L A;  5HLV A;  3CR5 X;  1BR1 B;  2Q91 A;  3CS1 A;  1U5I B;  4L9M A;  4MSP A;  1F70 A;  2M97 A;  5DKR A;  3I5G C;  3JVT C;  2Y1M A;  2BE6 A;  1LA0 A;  1S6C A;  4PE7 A;  4PE0 A;  1S3P A;  1QV0 A;  3TUY C;  1ZFS A;  5ER5 A;  1UHJ A;  3JTD B;  1DJZ A;  1DJX A;  4I5N B;  1NX0 A;  3DVK A;  1L2O C;  1IG5 A;  4HRH A;  1QTX A;  3O78 A;  5F6T A;  1K95 A;  1CDM A;  1YUR A;  1SYM A;  3CZT X;  1EJ3 A;  3VRP A;  1WLM A;  1F54 A;  5CSJ A;  1CFF A;  2LHI A;  2MAZ A;  3BUN B;  4QJ3 B;  1TNP A;  2BEC A;  2PAS A;  2A4J A;  4USL A;  1FW4 A;  1HQV A;  1EG4 A;  1MF8 B;  1PRW A;  4CID A;  4YGD B;  1CMF A;  2K0J A;  2JPT A;  2KFF A;  2LV7 A;  2WOS A;  4DRW A;  1V1F A;  1L7Z A;  3OB1 B;  1CMG A;  2D8N A;  4XJK A;  2KAY A;  5I8N A;  3NXA A;  3TDI A;  2LMT A;  1QXP A;  3JTD C;  4NDC A;  3I5H B;  2GV5 A;  2H61 C;  1CTR A;  3SG3 A;  5FYX A;  1CLB A;  2DOQ A;  1BT6 A;  3CTN A;  1OMV A;  1KQV A;  1UWO A;  2ZNE A;  4YBH B;  1YVL A;  2K2F A;  2K2A A;  2E6W A;  2LC5 A;  4N1F A;  2GGM A;  3PSR A;  1V1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...