5ER4X

Crystal structure of calcium-loaded s100b bound to sc0025
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
90
structure length
90
Chain Sequence
b'MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
molecule tags Metal binding protein/inhibitor
source organism Bos taurus
publication title Novel protein-inhibitor interactions in site 3 of Ca(2+)-bound S100B as discovered by X-ray crystallography.
pubmed doi rcsb
total genus 32
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2015-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00036 EF-hand_1 EF hand
X PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5er4X00
1RECA 3I5HB 3DVKA 1JUOA 2GGZA 3KPXA 1K9KA 1U5IB 1UUSA 2M1UA 2BE4A 1NYAA 1DF0A 1TN4A 1NX3A 1NX1A 4MZJA 2NXQA 1GGZA 3GK4X 1JFJA 1DJXA 3PSRA 1XO5A 1FBVA 5D7FA 1Q80A 2L4IA 1YRUB 2BCAA 1LXFC 2K7CA 4MZLA 3EK7A 1SR6B 3OX6A 4PHMA 3SG3A 2M0RA 1PSRA 1QS7A 4ORCB 1FI6A 2F3ZA 1IQ5A 3D0YB 3DVEA 3SG2A 5I2LA 5D69A 1Y1UA 2RGIA 1KK7Y 5B8IB 2KNEA 1CM4A 1MQ1A 1TNXA 1ZOTB 4FTGA 3PATA 1S26D 1N2DA 2EGDA 4MLWA 3KEVA 2LCPA 1S5GY 2QACA 2ISDA 3BXKA 1WRKA 2KI4C 4GGFA 2LHLA 1EG3A 2VRGA 2PALA 1H8BA 2FCDA 1IG5A 1NWDA 4JQ0D 3IQOA 3NSKA 5KU1A 1F4OA 3TDUA 2L50A 1KQVA 1KFXL 3CWGA 1OMVA 1QLKA 5JOLA 2OS8B 3EVRA 1L7ZA 2O60A 3CR4X 2JTTA 1DJZA 1XFZO 3WHTB 4DUQA 1IGVA 1PALA 2O5GA 5CSNA 4MRXA 4YGCB 5I8NA 2LVVA 1GQMA 1AVSA 4YGBB 2BKIB 4DIRA 4U8DA 1EH2A 4XYNA 3JVTB 4YGDB 1OOJA 4MSPA 4ICBA 4PDZA 4C0JA 3D10A 4GPLB 2Q91A 2ZN9A 5KSZA 5J3XA 2ZN8A 2ZRTA 1WY9A 1NCXA 1DTLA 4QJ3B 4PE0A 5HLVA 3VRNA 3SG6A 1M45A 2OTGC 1ZFSA 2I94A 5HYDA 3PN7B 1UP5A 1S6CA 3SIAA 2JT8A 5CSJA 2QPTA 2WOSA 1QVIY 3DF0B 1E8AA 2KSPA 4XJKB 1B8LA 1SK6D 5K89A 2LP3A 1SNLA 4WQ3A 3SG4A 1RJVA 2V53A 3O78A 1JBAA 3C1VA 1QX2A 1A75A 2NCPA 2KBIA 1X02A 4A4CA 3EVVA 1FI5A 1K9UA 2LMTA 3AAKA 1S36A 1PSBA 2JNXA 2EHBA 4AOMA 1MXEA 4OVNF 1IWQA 1ODBA 2LV7A 2WCFA 3D0YA 1KFXS 1ALWA 1RTP1 1CM1A 4GFTA 2CTNA 2EC6C 1BT6A 1BU3A 1CB1A 2K7DA 1A29A 1QVIZ 2KGRA 4PE7A 3FIAA 3IQQA 3TZ1A 4CPVA 1ZUZA 1L2OB 1CDPA 1S5GZ 5ER5A 2LC5A 3RLZA 1CFFA 2L4HA 3DD4A 1QIVA 1SR6C 1SPYA 2L98A 1JSAA 2I2RE 2K0JA 4R1EA 2K2AA 2HF5A 2OS8C 5AEQA 3GK2A 2JU0A 2H2KA 1UWOA 2LNKA 2P6BB 1A03A 3DVJA 4ORAB 1BF5A 2BE6A 1M39A 1MWNA 2KQYA 1AHRA 1NX2A 4BY4A 4JWQA 5CSIA 2MLFC 3O4YA 3OHMB 1CKKA 1SL7A 3EK8A 2M29A 4GUKA 4Q04A 1RK9A 1YURA 1WLZA 4PHJA 1J7QA 2KAYA 1RROA 3TS5B 2LLSA 3I5GB 1TTXA 2DOQA 2L51A 2GGMA 1YVHA 3ZNIA 2M1KB 2KFGA 4ORBB 2L5XB 1UURA 2LUCA 1IJ6A 4GAOA 1KCYA 1WDCC 1UHNA 2NCOA 1NCZA 1WRZA 1AP4A 1CLLA 2ZRSA 1XK4C 2OTGB 1R6PA 2PRUA 4MBEA 1D1OA 3A8RA 4M2PA 1YX8A 3LK1A 2KAVA 4P2YB 4MN0A 3OB2B 3VRRA 2CNPA 1K94A 4P5OE 2BL0B 5PALA 2KI4B 2LMVA 3SG5A 1JF2A 2I7AA 1F54A 3FWCA 3CR2A 5HKWA 2LVKA 1B9AA 1UHJA 1S3PA 2KFHA 4ETOA 2M3WA 1A4PA 5AXIA 1N65A 2ZKMX 2KBMA 1Y0VH 1IJ5A 1OE9B 4HREE 3RM1A 1BODA 4XJKA 3GK1A 2CXJA 2G9BA 3CR5X 2BL0C 5HLOA 1QX5B 1BJFA 3I5FC 4OKHA 1XA5A 5ER4X 2HETA 1QIWA 2BKHB 2KYFA 1DVIA 2LUXA 2Y5IA 1DJWA 1TNWA 2MHHA 2KDHA 3NXAA 1F55A 3BUWB 3WNXB 3BOWA 4FQOA 1SBJA 3SJSA 2Y1NA 1G8IA 1EL4A 2K2FA 1C07A 2NZ0A 1K2HA 2HQ8A 4NDCA 1SYMA 1S6IA 1B8CA 4N1GA 1IQ3A 1QXPA 1V1GA 1A75B 2AMIA 3QRXA 5TNCA 1KK7Z 4TNCA 2F33A 3BYAA 4F0ZB 2WCEA 3NSIA 2I18A 1GGWA 2LMUA 2WC8A 3LK0A 3DF0A 2LVIA 4QJ4B 2M7LA 1K96A 1OZSA 2WCBA 1OMRA 4AQJA 4L9MA 1JF0A 1DJHA 1MHOA 1R2UA 2CCMA 4NDBA 3OX5A 3LCPC 3TUYC 4CIDA 1YX7A 3E3RA 5CPVA 1IRJA 2PASA 5G08A 1WDCB 1DGUA 2COLB 2H61A 2IS9A 4GBAA 4C0LA 1J7OA 1EJ3A 3LL8B 1TCFA 3CGAA 1U5IA 2JRFA 3VGOA 4OR9B 2LM5A 1XFVO 3IF7A 1YUTA 1SCVA 1DGVA 1OZOA 2A4JA 2JWWA 1NPQA 3SIBA 1RWYA 2SCPA 5AERA 1F70A 1AJ4A 3KHEA 2LHIA 1L2OC 2Y4QA 3I5FB 2WORA 3O6BA 2LVJA 4NDDA 1B8RA 1LKJA 2KFFA 3JTDC 1TOPA 1KK8C 1SKTA 2BCBA 2MRDA 2JXLA 4MEWA 1XK4A 2AUCA 2L2EA 3FS7A 4I5KA 4ZCVA 4M2QA 1ALVA 1SW8A 1QASA 4OCIA 4HSZA 2JT3A 4IL1A 1TNQA 1QV0A 2KOTA 5F6TA 3TDIA 2JTZA 2KHNA 1EG4A 1SMGA 4C0KA 1MUXA 3FWBA 2E30A 1OSAA 3JTDB 1DMOA 3KO0A 1J7PA 3WXAA 1F8HA 1NP8A 1YR5A 1PK0D 5DKNA 4D1EA 1B47A 1JC2A 5KTYA 4YGAA 2KAXA 1IKUA 4PE4A 4N1FA 2CT9A 2G2BA 2LLUA 2PMYA 2BECA 1SCMC 4PALA 1PRWA 3TS5C 1KQMC 2ZNEA 4DRWA 1CFCA 1CDLA 1ZACA 4HRGA 1VRKA 2EC6B 5IBWA 2LANA 2K7OA 1V1FA 3F45A 3I5IB 2CBLA 1TNPA 1B4CA 1DT7B 1FPWA 4A4BA 1J1EA 2M97A 4YI9A 1KK8B 4MZKA 3BQ3A 1LVCD 1KWOC 1KFUS 1JFKA 1SL9A 1DJIA 1UHHA 1PVAA 1TIZA 1UHIA 4I5JA 1G4YR 4I5NB 1BR4B 3EVUA 5DKRA 3NSOA 1TCOB 1XFWO 3AKBA 1KSOA 5AANA 1AK8A 1B1GA 1CMFA 1CLBA 1A2XA 3DVMA 2F2PA 3CLNA 1K93D 1UHKA 2MBXA 1KSMA 3VRPA 1XFYO 3KF9A 2F2OA 1YTZC 3LLEA 2LE9B 2B1UA 1HQVA 3I5IC 2JNFA 3SG7A 4CFRA 1YRTB 2MA2A 2GV5A 2PSRA 3MSEB 1CMGA 4JPZB 1JWDA 1G33A 1LA0A 3BUOB 1H4BA 1S1EA 3BOWB 4GNKB 1M46A 1QTXA 3ICBA 4MRYA 1PVBA 5CSFA 1FF1A 2LAPA 3PLFB 3PALA 1QLSA 2JULA 4N5XA 1B7TZ 1KQMB 2MJWB 1DF0B 1XFUO 1F71A 1LINA 3BUNB 1MF8B 2HPSA 2TN4A 3BUMB 3H4SE 3I5HC 1SL8A 1C7VA 1XFXO 3PN7C 3PM8A 1PULA 1NUBA 2D8NA 3EKHA 2ZFDA 1MR8A 3EK4A 2ZNDA 1Y1XA 4WQ2A 2M49B 3NSLA 4UPGA 5GQQC 3JVTC 1C7WA 1M31A 5I2QA 1BG1A 1BOCA 2SASA 1QJTA 1CDMA 2NLNA 3O2PA 3PFVA 2KQ6A 1AUIB 3ZWHA 4DCKA 1S6JA 1QATA 1YUSA 1ZMZA 2R2IA 4CFQA 1FW4A 1J7RA 1YUUA 1WRLA 3VROA 4YI8A 2PVBA 1SRAA 4PCWA 2LP2A 2E6WA 2KGBC 1Y1AA 3K21A 1RFJA 1IH0A 1DJYA 4PHKA 3I5GC 3CTNA 1BR1B 2BBMA 2BBNA 3A4UB 1CDNA 1W7JB 1LA3A 4PE1A 3AKAA 1EXRA 1CTRA 3OP0A 1K9PA 1AJ5A 1NSHA 1XVJA 2F3YA 2H61C 1W7IB 5HKZA 1QV1A 1CNPA 1J1DA 2JZIA 3HCMA 4I5LB 5AFPA 3HX4A 2WNDA 2L0PA 1Y6WA 5DKQA 3CZTX 3TDZA 4ZCUA 1K90D 3EKJA 4GGNA 1TRFA 4M2OA 1OQPA 3WHUB 1BLQA 1CLMA 2MLEC 2K61A 2MAZA 1K95A 1NCYA 2JOJA 4BY5A 4DS7A 1B7TY 3CS1A 1KFUL 2FCEA 4WRIA 2K8MB 1QX7A 3TUYB 4QJ5B 2Q4UA 4GGFC 4YRUA 2AAOA 2KYCA 4CLNA 4YBHB 2FOTA 4NQGA 1OMDA 4AQIA 4USLA 2HQWA 1KWOB 1MXLC 2JC2A 4YGEB 5BPJA 4E68A 1YVLA 1NX0A 1GJYA 1N0YA 2JQ6A 3OB1B 3GOFA 5FYXA 1DJGA 2BCXA 2JXCA 3M0WA 2K7BA 1NIWA 2Y1MA 2JPTA 1M63B 2FJUB 2KI6C 1F4QA 1SCMB 1SY9A 4HRHA 3BUXB 1K8UA 4PHNA 1J55A 3AAJA 5HKYA 5JJGA 2KI6D 1HT9A 5I2OA 1CFDA 4MVFA 1BMOA 1WLMA 4OV2A 2JT0A 2LLTA 2F8PA 2M8UA 1CFPA 1XYDA 2M9GA 3VRQA 2M7NA 2OPOA
chains in the Genus database with same CATH superfamily
1RECA 3I5HB 2L5YA 3DVKA 1JUOA 2GGZA 2H8VA 3D75A 5FI7A 3FE6A 3KPXA 1K9KA 1U5IB 1UUSA 2M1UA 2BE4A 3N7HA 1NYAA 3D78A 1DF0A 1TN4A 1NX3A 4JKTA 1NX1A 4MZJA 3CZ0A 3OGNA 2NXQA 1GGZA 3GK4X 1JFJA 1DJXA 3PSRA 1XO5A 1FBVA 5D7FA 1Q80A 3CZ1A 2L4IA 1YRUB 2BCAA 1LXFC 2K7CA 4MZLA 3EK7A 1SR6B 3OX6A 4PHMA 3SG3A 2M0RA 1PSRA 1QS7A 4ORCB 1FI6A 2F3ZA 1IQ5A 3D0YB 3DVEA 1Z4HA 3SG2A 1XFRA 5I2LA 5D69A 1Y1UA 2RGIA 1KK7Y 5B8IB 2KNEA 1CM4A 1MQ1A 1TNXA 1ZOTB 4FTGA 1ORGA 1QWVA 3PATA 1S26D 1N2DA 2EGDA 4MLWA 3KEVA 2LCPA 1S5GY 2QACA 2ISDA 3BXKA 1WRKA 2KI4C 4GGFA 2LHLA 1EG3A 2QEHA 2VRGA 2PALA 1H8BA 2FCDA 1IG5A 1NWDA 4JQ0D 3IQOA 3NSKA 5KU1A 1F4OA 3TDUA 4IJ7A 4JD9A 2L50A 1KQVA 1KFXL 3CWGA 1OMVA 1QLKA 5JOLA 2OS8B 3EVRA 1L7ZA 2O60A 3CR4X 2JTTA 1DQEA 3DXLA 1DJZA 1XFZO 3WHTB 4DUQA 1IGVA 1PALA 2O5GA 5CSNA 4MRXA 4YGCB 5I8NA 3EG5B 2LVVA 1GQMA 1AVSA 4YGBB 2BKIB 3D73A 4U8DA 4DIRA 1EH2A 4XYNA 3JVTB 4YGDB 1OOJA 4MSPA 4ICBA 4PDZA 4C0JA 3D10A 4GPLB 2Q91A 2ZN9A 5KSZA 5J3XA 2ZN8A 2ZRTA 1WY9A 1NCXA 1DTLA 4QJ3B 4PE0A 5HLVA 3VRNA 2WCHA 3SG6A 1M45A 2OTGC 1ZFSA 2WCLA 2I94A 5HYDA 3PN7B 1UP5A 1S6CA 3SIAA 2JT8A 5CSJA 2QPTA 2WOSA 1IIOA 2GTEA 1QVIY 3DF0B 1E8AA 2KSPA 4XJKB 1B8LA 1SK6D 4F7FA 2LP3A 2ERBA 1SNLA 5K89A 4WQ3A 3SG4A 1RJVA 2V53A 3O78A 1JBAA 3C1VA 1QX2A 1A75A 2NCPA 2KBIA 1X02A 3PJIA 4A4CA 3EVVA 1FI5A 1K9UA 2LMTA 3AAKA 1S36A 1PSBA 2JNXA 2EHBA 5DICA 4AOMA 1OW4A 1MXEA 4OVNF 1IWQA 1ODBA 2LV7A 3CYZA 2WCFA 3D0YA 1KFXS 1ALWA 1RTP1 1CM1A 4GFTA 2CTNA 2EC6C 1BT6A 1BU3A 1CB1A 2K7DA 1A29A 1QVIZ 2KGRA 4PE7A 3FIAA 3IQQA 3TZ1A 4CPVA 1ZUZA 1L2OB 1CDPA 1S5GZ 5ER5A 2LC5A 3RLZA 2KPHA 1CFFA 3S0BA 1W9ZA 2L4HA 3DD4A 1QIVA 1SR6C 1SPYA 1Z2CB 2L98A 1JSAA 2I2RE 2K0JA 4R1EA 4PT1A 2K2AA 3K1EA 2HF5A 3PM2A 1OOHA 2OS8C 5AEQA 3GK2A 2JU0A 5I94A 2H2KA 1UWOA 2LNKA 2P6BB 1A03A 1T14A 3DVJA 3BJHA 4ORAB 1BF5A 2BE6A 1M39A 1MWNA 2KQYA 1AHRA 1NX2A 4BY4A 4JWQA 5CSIA 2MLFC 3O4YA 3OHMB 1CKKA 1SL7A 3EK8A 2M29A 4GUKA 4Q04A 1RK9A 1YURA 1WLZA 4PHJA 3B6XA 2KAYA 1RROA 3TS5B 1J7QA 2LLSA 3I5GB 1TTXA 2DOQA 3D77A 2L51A 2GGMA 3R1VA 1YVHA 3ZNIA 2M1KB 2KFGA 3L47A 4ORBB 2L5XB 1UURA 2LUCA 1IJ6A 4GAOA 1KCYA 3CABA 1WDCC 1UHNA 2NCOA 1NCZA 1WRZA 1AP4A 3FE8A 1CLLA 2ZRSA 1XK4C 2OTGB 1R6PA 2PRUA 4FQTA 4MBEA 3A8RA 4M2PA 1D1OA 1YX8A 3UNWA 3LK1A 2KAVA 4P2YB 4MN0A 3OB2B 3VRRA 2CNPA 1K94A 4P5OE 2BL0B 5PALA 2KI4B 2LMVA 3SG5A 1JF2A 2I7AA 4INWA 1C3YA 1F54A 3FWCA 3CR2A 5HKWA 2QEOA 2LVKA 1B9AA 1UHJA 1S3PA 2KFHA 4ETOA 3OBVA 2M3WA 1A4PA 5AXIA 1N65A 2ZKMX 2KBMA 1Y0VH 1IJ5A 1OE9B 4HREE 3RM1A 1BODA 4XJKA 3GK1A 2CXJA 2G9BA 1TUJA 2BL0C 3CR5X 5HLOA 1QX5B 1BJFA 3I5FC 4OKHA 2WCJA 2PYQA 1XA5A 2QEVA 5ER4X 2HETA 1QIWA 2BKHB 2KYFA 3B88A 1DVIA 2LUXA 2Y5IA 1DJWA 1TNWA 2MHHA 2KDHA 3NXAA 1F55A 3BUWB 3WNXB 3BOWA 4FQOA 1SBJA 3SJSA 2Y1NA 1G8IA 1EL4A 2K2FA 1C07A 2NZ0A 1K2HA 2HQ8A 3DYEA 4NDCA 1SYMA 1S6IA 1B8CA 4N1GA 1IQ3A 1QXPA 1V1GA 5FI6A 1A75B 2AMIA 3QRXA 2WCKA 1KK7Z 1OOIX 5TNCA 4TNCA 2F33A 3BYAA 3O4XA 4F0ZB 2WCEA 3NSIA 2I18A 1GGWA 2LMUA 2WC8A 3LK0A 3DF0A 2LVIA 4QJ4B 2M7LA 1K96A 1C3ZA 1OZSA 1OMRA 2WCBA 4AQJA 4L9MA 1JF0A 1DJHA 1MHOA 1R2UA 2CCMA 4NDBA 3OX5A 3LCPC 3TUYC 4CIDA 1YX7A 3E3RA 5CPVA 1IRJA 2PASA 5D3OA 1WDCB 1DGUA 5G08A 2COLB 2H61A 2IS9A 4GBAA 4C0LA 1J7OA 1EJ3A 3LL8B 2WCMA 1TCFA 3CGAA 1U5IA 2JRFA 3R1OA 4OR9B 2BAPA 2LM5A 1XFVO 3IF7A 3VGOA 3S0GA 1YUTA 1SCVA 1DGVA 1OZOA 2A4JA 2JWWA 1NPQA 3SIBA 1RWYA 3S0FA 2SCPA 5AERA 1F70A 1AJ4A 3KHEA 2LHIA 1L2OC 2Y4QA 3I5FB 2WORA 3O6BA 2LVJA 4NDDA 1B8RA 1LKJA 2KFFA 3JTDC 1TOPA 1KK8C 1SKTA 2BCBA 2MRDA 2JXLA 4MEWA 3S0DA 1XK4A 2AUCA 2L2EA 3FS7A 4I5KA 4ZCVA 4M2QA 1ALVA 1SW8A 1QASA 4OCIA 4HSZA 2JT3A 4IL1A 1TNQA 1QV0A 2KOTA 5F6TA 3TDIA 2JTZA 3VB1A 2KHNA 1EG4A 1SMGA 4C0KA 1MUXA 2PQLA 3FWBA 2E30A 1OSAA 3JTDB 1DMOA 3KO0A 3S0AA 3B7AA 1J7PA 3SS3A 3WXAA 1F8HA 1NP8A 1YR5A 1PK0D 5DKNA 4D1EA 1B47A 5FI2A 1JC2A 4KYNA 4YGAA 2KAXA 5KTYA 1IKUA 4PE4A 4N1FA 2CT9A 2G2BA 2LLUA 3BFHA 3R1PA 2PMYA 2BECA 1SCMC 4PALA 1PRWA 3TS5C 1KQMC 2ZNEA 4DRWA 1CFCA 1CDLA 1ZACA 4HRGA 3FE9A 2L2CA 1VRKA 2EC6B 5IBWA 1GM0A 2LANA 2K7OA 1V1FA 3F45A 3I5IB 2CBLA 1TNPA 3NHIA 1B4CA 1DT7B 1FPWA 4A4BA 1J1EA 2M97A 4YI9A 1KK8B 4MZKA 3BQ3A 1LVCD 1KWOC 1KFUS 1JFKA 1SL9A 1DJIA 1UHHA 1PVAA 1TIZA 1UHIA 4I5JA 1G4YR 4I5NB 1BR4B 3EVUA 5DKRA 3NSOA 1TCOB 1XFWO 3AKBA 1KSOA 5AANA 1AK8A 1B1GA 1CMFA 1CLBA 1A2XA 3DVMA 1DELA 2F2PA 3CLNA 1K93D 1UHKA 3NHTA 2YGUA 2MBXA 2QEBA 1KSMA 3VRPA 1XFYO 3KF9A 2F2OA 1YTZC 3LLEA 2LE9B 2B1UA 1HQVA 3I5IC 2JNFA 4OZDA 3SG7A 4CFRA 1YRTB 2MA2A 3Q8IA 2GV5A 2PSRA 3MSEB 1CMGA 4JPZB 1JWDA 3NGVA 1G33A 1LA0A 3BUOB 1H4BA 3D74A 1S1EA 3BOWB 4GNKB 1M46A 1TWOA 1QTXA 3ICBA 4MRYA 1PVBA 5CSFA 1FF1A 2LAPA 3D76A 3PLFB 3PALA 1QLSA 2JULA 4N5XA 1B7TZ 1KQMB 2MJWB 1DF0B 1XFUO 1F71A 1LINA 3BUNB 1MF8B 2HPSA 2TN4A 3BUMB 3H4SE 3I5HC 1SL8A 1C7VA 1XFXO 3PN7C 3PM8A 1PULA 1NUBA 2D8NA 3EKHA 2ZFDA 3L4AA 3CDNA 1MR8A 3B86A 3EK4A 2ZNDA 3S0EA 1Y1XA 3BFAA 1LS8A 4WQ2A 2M49B 3NSLA 4UPGA 3R72A 3JVTC 5GQQC 1C7WA 1M31A 5I2QA 1BG1A 1BOCA 2SASA 1QJTA 1CDMA 2NLNA 3DY9A 3O2PA 3PFVA 2KQ6A 1AUIB 3ZWHA 4DCKA 1S6JA 1QATA 1YUSA 1ZMZA 2R2IA 2WC5A 1FW4A 3L4LA 4CFQA 1J7RA 1YUUA 1WRLA 2FJYA 3VROA 4YI8A 2PVBA 1SRAA 4PCWA 2LP2A 2E6WA 3V2LA 2KGBC 1Y1AA 3K21A 1RFJA 1IH0A 1DJYA 4PHKA 3I5GC 3CTNA 1BR1B 2BBMA 2BBNA 3A4UB 1CDNA 1P28A 3SS5A 1W7JB 1DEKA 1LA3A 4PE1A 3AKAA 1EXRA 5HL1A 1CTRA 3OP0A 1K9PA 1AJ5A 1NSHA 1XVJA 2F3YA 2H61C 1W7IB 5HKZA 1QV1A 1CNPA 1J1DA 2JZIA 3CZ2A 3HCMA 4I5LB 5AFPA 3HX4A 2WNDA 2L0PA 1Y6WA 5DKQA 2WC6A 3CZTX 3TDZA 2KLEA 4ZCUA 3UO9A 1K90D 3EKJA 4GGNA 1TRFA 1DC1A 4M2OA 1OQPA 3WHUB 1BLQA 1CLMA 2MLEC 2K61A 2MAZA 1K95A 1NCYA 2JOJA 4INXA 4BY5A 3DZTA 4DS7A 1B7TY 3CS1A 1KFUL 2FCEA 2K60A 4WRIA 2K8MB 1QX7A 1OOGA 3IVTA 3TUYB 4QJ5B 2Q4UA 4GGFC 4YRUA 2AAOA 2KYCA 5EL2A 4CLNA 4YBHB 2FOTA 3B87A 4NQGA 1OMDA 4AQIA 4USLA 2HQWA 1KWOB 1MXLC 2BNXA 2JC2A 4YGEB 2QDIA 5BPJA 3RZSA 4E68A 1YVLA 3BFBA 1NX0A 1GJYA 1N0YA 2JQ6A 3OB1B 3GOFA 3QMEA 1DJGA 2BCXA 5FYXA 2P71A 2JXCA 3M0WA 2K7BA 1NIWA 1TUZA 2JPTA 1M63B 2FJUB 2KI6C 2Y1MA 1F4QA 1SCMB 1SY9A 4HRHA 3BUXB 1K8UA 4PHNA 1J55A 3AAJA 5HKYA 1OOFA 5JJGA 2KI6D 2KLDA 1HT9A 5I2OA 1CFDA 4MVFA 1BMOA 1WLMA 4OV2A 2JT0A 2LLTA 2JPOA 2F8PA 2M8UA 1CFPA 2P70A 1XYDA 2M9GA 3VRQA 2M7NA 3SS4A 2OPOA 1SSEB
chains in the Genus database with same CATH topology
1RECA 3I5HB 3DVKA 1JUOA 2GGZA 3KPXA 1K9KA 1U5IB 1UUSA 2M1UA 2BE4A 1NYAA 1DF0A 1TN4A 1NX3A 1NX1A 4MZJA 2NXQA 1GGZA 3GK4X 1JFJA 1DJXA 3PSRA 1XO5A 1FBVA 5D7FA 1Q80A 2L4IA 1YRUB 2BCAA 1LXFC 2K7CA 4MZLA 3EK7A 1SR6B 3OX6A 4PHMA 3SG3A 2M0RA 1PSRA 1QS7A 4ORCB 1FI6A 2F3ZA 1IQ5A 3D0YB 3DVEA 3SG2A 5I2LA 5D69A 1Y1UA 2RGIA 1KK7Y 5B8IB 2KNEA 1CM4A 1MQ1A 1TNXA 1ZOTB 4FTGA 3PATA 1S26D 1N2DA 2EGDA 4MLWA 3KEVA 2LCPA 1S5GY 2QACA 2ISDA 3BXKA 1WRKA 2KI4C 4GGFA 2LHLA 1EG3A 2VRGA 2PALA 1H8BA 2FCDA 1IG5A 1NWDA 4JQ0D 3IQOA 3NSKA 5KU1A 1F4OA 3TDUA 2L50A 1KQVA 1KFXL 3CWGA 1OMVA 1QLKA 5JOLA 2OS8B 3EVRA 1L7ZA 2O60A 3CR4X 2JTTA 1DJZA 1XFZO 3WHTB 4DUQA 1IGVA 1PALA 2O5GA 5CSNA 4MRXA 4YGCB 5I8NA 2LVVA 1GQMA 1AVSA 4YGBB 2BKIB 4DIRA 4U8DA 1EH2A 4XYNA 3JVTB 4YGDB 1OOJA 4MSPA 4ICBA 4PDZA 4C0JA 3D10A 4GPLB 2Q91A 2ZN9A 5KSZA 5J3XA 2ZN8A 2ZRTA 1WY9A 1NCXA 1DTLA 4QJ3B 4PE0A 5HLVA 3VRNA 3SG6A 1M45A 2OTGC 1ZFSA 2I94A 5HYDA 3PN7B 1UP5A 1S6CA 3SIAA 2JT8A 5CSJA 2QPTA 2WOSA 1QVIY 3DF0B 1E8AA 2KSPA 4XJKB 1B8LA 1SK6D 5K89A 2LP3A 1SNLA 4WQ3A 3SG4A 1RJVA 2V53A 3O78A 1JBAA 3C1VA 1QX2A 1A75A 2NCPA 2KBIA 1X02A 4A4CA 3EVVA 1FI5A 1K9UA 2LMTA 3AAKA 1S36A 1PSBA 2JNXA 2EHBA 4AOMA 1MXEA 4OVNF 1IWQA 1ODBA 2LV7A 2WCFA 3D0YA 1KFXS 1ALWA 1RTP1 1CM1A 4GFTA 2CTNA 2EC6C 1BT6A 1BU3A 1CB1A 2K7DA 1A29A 1QVIZ 2KGRA 4PE7A 3FIAA 3IQQA 3TZ1A 4CPVA 1ZUZA 1L2OB 1CDPA 1S5GZ 5ER5A 2LC5A 3RLZA 1CFFA 2L4HA 3DD4A 1QIVA 1SR6C 1SPYA 2L98A 1JSAA 2I2RE 2K0JA 4R1EA 2K2AA 2HF5A 2OS8C 5AEQA 3GK2A 2JU0A 2H2KA 1UWOA 2LNKA 2P6BB 1A03A 3DVJA 4ORAB 1BF5A 2BE6A 1M39A 1MWNA 2KQYA 1AHRA 1NX2A 4BY4A 4JWQA 5CSIA 2MLFC 3O4YA 3OHMB 1CKKA 1SL7A 3EK8A 2M29A 4GUKA 4Q04A 1RK9A 1YURA 1WLZA 4PHJA 1J7QA 2KAYA 1RROA 3TS5B 2LLSA 3I5GB 1TTXA 2DOQA 2L51A 2GGMA 1YVHA 3ZNIA 2M1KB 2KFGA 4ORBB 2L5XB 1UURA 2LUCA 1IJ6A 4GAOA 1KCYA 1WDCC 1UHNA 2NCOA 1NCZA 1WRZA 1AP4A 1CLLA 2ZRSA 1XK4C 2OTGB 1R6PA 2PRUA 4MBEA 1D1OA 3A8RA 4M2PA 1YX8A 3LK1A 2KAVA 4P2YB 4MN0A 3OB2B 3VRRA 2CNPA 1K94A 4P5OE 2BL0B 5PALA 2KI4B 2LMVA 3SG5A 1JF2A 2I7AA 1F54A 3FWCA 3CR2A 5HKWA 2LVKA 1B9AA 1UHJA 1S3PA 2KFHA 4ETOA 2M3WA 1A4PA 5AXIA 1N65A 2ZKMX 2KBMA 1Y0VH 1IJ5A 1OE9B 4HREE 3RM1A 1BODA 4XJKA 3GK1A 2CXJA 2G9BA 3CR5X 2BL0C 5HLOA 1QX5B 1BJFA 3I5FC 4OKHA 1XA5A 5ER4X 2HETA 1QIWA 2BKHB 2KYFA 1DVIA 2LUXA 2Y5IA 1DJWA 1TNWA 2MHHA 2KDHA 3NXAA 1F55A 3BUWB 3WNXB 3BOWA 4FQOA 1SBJA 3SJSA 2Y1NA 1G8IA 1EL4A 2K2FA 1C07A 2NZ0A 1K2HA 2HQ8A 4NDCA 1SYMA 1S6IA 1B8CA 4N1GA 1IQ3A 1QXPA 1V1GA 1A75B 2AMIA 3QRXA 5TNCA 1KK7Z 4TNCA 2F33A 3BYAA 4F0ZB 2WCEA 3NSIA 2I18A 1GGWA 2LMUA 2WC8A 3LK0A 3DF0A 2LVIA 4QJ4B 2M7LA 1K96A 1OZSA 2WCBA 1OMRA 4AQJA 4L9MA 1JF0A 1DJHA 1MHOA 1R2UA 2CCMA 4NDBA 3OX5A 3LCPC 3TUYC 4CIDA 1YX7A 3E3RA 5CPVA 1IRJA 2PASA 5G08A 1WDCB 1DGUA 2COLB 2H61A 2IS9A 4GBAA 4C0LA 1J7OA 1EJ3A 3LL8B 1TCFA 3CGAA 1U5IA 2JRFA 3VGOA 4OR9B 2LM5A 1XFVO 3IF7A 1YUTA 1SCVA 1DGVA 1OZOA 2A4JA 2JWWA 1NPQA 3SIBA 1RWYA 2SCPA 5AERA 1F70A 1AJ4A 3KHEA 2LHIA 1L2OC 2Y4QA 3I5FB 2WORA 3O6BA 2LVJA 4NDDA 1B8RA 1LKJA 2KFFA 3JTDC 1TOPA 1KK8C 1SKTA 2BCBA 2MRDA 2JXLA 4MEWA 1XK4A 2AUCA 2L2EA 3FS7A 4I5KA 4ZCVA 4M2QA 1ALVA 1SW8A 1QASA 4OCIA 4HSZA 2JT3A 4IL1A 1TNQA 1QV0A 2KOTA 5F6TA 3TDIA 2JTZA 2KHNA 1EG4A 1SMGA 4C0KA 1MUXA 3FWBA 2E30A 1OSAA 3JTDB 1DMOA 3KO0A 1J7PA 3WXAA 1F8HA 1NP8A 1YR5A 1PK0D 5DKNA 4D1EA 1B47A 1JC2A 5KTYA 4YGAA 2KAXA 1IKUA 4PE4A 4N1FA 2CT9A 2G2BA 2LLUA 2PMYA 2BECA 1SCMC 4PALA 1PRWA 3TS5C 1KQMC 2ZNEA 4DRWA 1CFCA 1CDLA 1ZACA 4HRGA 1VRKA 2EC6B 5IBWA 2LANA 2K7OA 1V1FA 3F45A 3I5IB 2CBLA 1TNPA 1B4CA 1DT7B 1FPWA 4A4BA 1J1EA 2M97A 4YI9A 1KK8B 4MZKA 3BQ3A 1LVCD 1KWOC 1KFUS 1JFKA 1SL9A 1DJIA 1UHHA 1PVAA 1TIZA 1UHIA 4I5JA 1G4YR 4I5NB 1BR4B 3EVUA 5DKRA 3NSOA 1TCOB 1XFWO 3AKBA 1KSOA 5AANA 1AK8A 1B1GA 1CMFA 1CLBA 1A2XA 3DVMA 2F2PA 3CLNA 1K93D 1UHKA 2MBXA 1KSMA 3VRPA 1XFYO 3KF9A 2F2OA 1YTZC 3LLEA 2LE9B 2B1UA 1HQVA 3I5IC 2JNFA 3SG7A 4CFRA 1YRTB 2MA2A 2GV5A 2PSRA 3MSEB 1CMGA 4JPZB 1JWDA 1G33A 1LA0A 3BUOB 1H4BA 1S1EA 3BOWB 4GNKB 1M46A 1QTXA 3ICBA 4MRYA 1PVBA 5CSFA 1FF1A 2LAPA 3PLFB 3PALA 1QLSA 2JULA 4N5XA 1B7TZ 1KQMB 2MJWB 1DF0B 1XFUO 1F71A 1LINA 3BUNB 1MF8B 2HPSA 2TN4A 3BUMB 3H4SE 3I5HC 1SL8A 1C7VA 1XFXO 3PN7C 3PM8A 1PULA 1NUBA 2D8NA 3EKHA 2ZFDA 1MR8A 3EK4A 2ZNDA 1Y1XA 4WQ2A 2M49B 3NSLA 4UPGA 5GQQC 3JVTC 1C7WA 1M31A 5I2QA 1BG1A 1BOCA 2SASA 1QJTA 1CDMA 2NLNA 3O2PA 3PFVA 2KQ6A 1AUIB 3ZWHA 4DCKA 1S6JA 1QATA 1YUSA 1ZMZA 2R2IA 4CFQA 1FW4A 1J7RA 1YUUA 1WRLA 3VROA 4YI8A 2PVBA 1SRAA 4PCWA 2LP2A 2E6WA 2KGBC 1Y1AA 3K21A 1RFJA 1IH0A 1DJYA 4PHKA 3I5GC 3CTNA 1BR1B 2BBMA 2BBNA 3A4UB 1CDNA 1W7JB 1LA3A 4PE1A 3AKAA 1EXRA 1CTRA 3OP0A 1K9PA 1AJ5A 1NSHA 1XVJA 2F3YA 2H61C 1W7IB 5HKZA 1QV1A 1CNPA 1J1DA 2JZIA 3HCMA 4I5LB 5AFPA 3HX4A 2WNDA 2L0PA 1Y6WA 5DKQA 3CZTX 3TDZA 4ZCUA 1K90D 3EKJA 4GGNA 1TRFA 4M2OA 1OQPA 3WHUB 1BLQA 1CLMA 2MLEC 2K61A 2MAZA 1K95A 1NCYA 2JOJA 4BY5A 4DS7A 1B7TY 3CS1A 1KFUL 2FCEA 4WRIA 2K8MB 1QX7A 3TUYB 4QJ5B 2Q4UA 4GGFC 4YRUA 2AAOA 2KYCA 4CLNA 4YBHB 2FOTA 4NQGA 1OMDA 4AQIA 4USLA 2HQWA 1KWOB 1MXLC 2JC2A 4YGEB 5BPJA 4E68A 1YVLA 1NX0A 1GJYA 1N0YA 2JQ6A 3OB1B 3GOFA 5FYXA 1DJGA 2BCXA 2JXCA 3M0WA 2K7BA 1NIWA 2Y1MA 2JPTA 1M63B 2FJUB 2KI6C 1F4QA 1SCMB 1SY9A 4HRHA 3BUXB 1K8UA 4PHNA 1J55A 3AAJA 5HKYA 5JJGA 2KI6D 1HT9A 5I2OA 1CFDA 4MVFA 1BMOA 1WLMA 4OV2A 2JT0A 2LLTA 2F8PA 2M8UA 1CFPA 1XYDA 2M9GA 3VRQA 2M7NA 2OPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1REC A;  3I5H B;  3DVK A;  1JUO A;  2GGZ A;  3KPX A;  1K9K A;  1U5I B;  1UUS A;  2M1U A;  2BE4 A;  1NYA A;  1DF0 A;  1TN4 A;  1NX3 A;  1NX1 A;  4MZJ A;  2NXQ A;  1GGZ A;  3GK4 X;  1JFJ A;  1DJX A;  3PSR A;  1XO5 A;  1FBV A;  5D7F A;  1Q80 A;  2L4I A;  1YRU B;  2BCA A;  1LXF C;  2K7C A;  4MZL A;  3EK7 A;  1SR6 B;  3OX6 A;  4PHM A;  3SG3 A;  2M0R A;  1PSR A;  1QS7 A;  4ORC B;  1FI6 A;  2F3Z A;  1IQ5 A;  3D0Y B;  3DVE A;  3SG2 A;  5I2L A;  5D69 A;  1Y1U A;  2RGI A;  1KK7 Y;  5B8I B;  2KNE A;  1CM4 A;  1MQ1 A;  1TNX A;  1ZOT B;  4FTG A;  3PAT A;  1S26 D;  1N2D A;  2EGD A;  4MLW A;  3KEV A;  2LCP A;  1S5G Y;  2QAC A;  2ISD A;  3BXK A;  1WRK A;  2KI4 C;  4GGF A;  2LHL A;  1EG3 A;  2VRG A;  2PAL A;  1H8B A;  2FCD A;  1IG5 A;  1NWD A;  4JQ0 D;  3IQO A;  3NSK A;  5KU1 A;  1F4O A;  3TDU A;  2L50 A;  1KQV A;  1KFX L;  3CWG A;  1OMV A;  1QLK A;  5JOL A;  2OS8 B;  3EVR A;  1L7Z A;  2O60 A;  3CR4 X;  2JTT A;  1DJZ A;  1XFZ O;  3WHT B;  4DUQ A;  1IGV A;  1PAL A;  2O5G A;  5CSN A;  4MRX A;  4YGC B;  5I8N A;  2LVV A;  1GQM A;  1AVS A;  4YGB B;  2BKI B;  4DIR A;  4U8D A;  1EH2 A;  4XYN A;  3JVT B;  4YGD B;  1OOJ A;  4MSP A;  4ICB A;  4PDZ A;  4C0J A;  3D10 A;  4GPL B;  2Q91 A;  2ZN9 A;  5KSZ A;  5J3X A;  2ZN8 A;  2ZRT A;  1WY9 A;  1NCX A;  1DTL A;  4QJ3 B;  4PE0 A;  5HLV A;  3VRN A;  3SG6 A;  1M45 A;  2OTG C;  1ZFS A;  2I94 A;  5HYD A;  3PN7 B;  1UP5 A;  1S6C A;  3SIA A;  2JT8 A;  5CSJ A;  2QPT A;  2WOS A;  1QVI Y;  3DF0 B;  1E8A A;  2KSP A;  4XJK B;  1B8L A;  1SK6 D;  5K89 A;  2LP3 A;  1SNL A;  4WQ3 A;  3SG4 A;  1RJV A;  2V53 A;  3O78 A;  1JBA A;  3C1V A;  1QX2 A;  1A75 A;  2NCP A;  2KBI A;  1X02 A;  4A4C A;  3EVV A;  1FI5 A;  1K9U A;  2LMT A;  3AAK A;  1S36 A;  1PSB A;  2JNX A;  2EHB A;  4AOM A;  1MXE A;  4OVN F;  1IWQ A;  1ODB A;  2LV7 A;  2WCF A;  3D0Y A;  1KFX S;  1ALW A;  1RTP 1;  1CM1 A;  4GFT A;  2CTN A;  2EC6 C;  1BT6 A;  1BU3 A;  1CB1 A;  2K7D A;  1A29 A;  1QVI Z;  2KGR A;  4PE7 A;  3FIA A;  3IQQ A;  3TZ1 A;  4CPV A;  1ZUZ A;  1L2O B;  1CDP A;  1S5G Z;  5ER5 A;  2LC5 A;  3RLZ A;  1CFF A;  2L4H A;  3DD4 A;  1QIV A;  1SR6 C;  1SPY A;  2L98 A;  1JSA A;  2I2R E;  2K0J A;  4R1E A;  2K2A A;  2HF5 A;  2OS8 C;  5AEQ A;  3GK2 A;  2JU0 A;  2H2K A;  1UWO A;  2LNK A;  2P6B B;  1A03 A;  3DVJ A;  4ORA B;  1BF5 A;  2BE6 A;  1M39 A;  1MWN A;  2KQY A;  1AHR A;  1NX2 A;  4BY4 A;  4JWQ A;  5CSI A;  2MLF C;  3O4Y A;  3OHM B;  1CKK A;  1SL7 A;  3EK8 A;  2M29 A;  4GUK A;  4Q04 A;  1RK9 A;  1YUR A;  1WLZ A;  4PHJ A;  1J7Q A;  2KAY A;  1RRO A;  3TS5 B;  2LLS A;  3I5G B;  1TTX A;  2DOQ A;  2L51 A;  2GGM A;  1YVH A;  3ZNI A;  2M1K B;  2KFG A;  4ORB B;  2L5X B;  1UUR A;  2LUC A;  1IJ6 A;  4GAO A;  1KCY A;  1WDC C;  1UHN A;  2NCO A;  1NCZ A;  1WRZ A;  1AP4 A;  1CLL A;  2ZRS A;  1XK4 C;  2OTG B;  1R6P A;  2PRU A;  4MBE A;  1D1O A;  3A8R A;  4M2P A;  1YX8 A;  3LK1 A;  2KAV A;  4P2Y B;  4MN0 A;  3OB2 B;  3VRR A;  2CNP A;  1K94 A;  4P5O E;  2BL0 B;  5PAL A;  2KI4 B;  2LMV A;  3SG5 A;  1JF2 A;  2I7A A;  1F54 A;  3FWC A;  3CR2 A;  5HKW A;  2LVK A;  1B9A A;  1UHJ A;  1S3P A;  2KFH A;  4ETO A;  2M3W A;  1A4P A;  5AXI A;  1N65 A;  2ZKM X;  2KBM A;  1Y0V H;  1IJ5 A;  1OE9 B;  4HRE E;  3RM1 A;  1BOD A;  4XJK A;  3GK1 A;  2CXJ A;  2G9B A;  3CR5 X;  2BL0 C;  5HLO A;  1QX5 B;  1BJF A;  3I5F C;  4OKH A;  1XA5 A;  5ER4 X;  2HET A;  1QIW A;  2BKH B;  2KYF A;  1DVI A;  2LUX A;  2Y5I A;  1DJW A;  1TNW A;  2MHH A;  2KDH A;  3NXA A;  1F55 A;  3BUW B;  3WNX B;  3BOW A;  4FQO A;  1SBJ A;  3SJS A;  2Y1N A;  1G8I A;  1EL4 A;  2K2F A;  1C07 A;  2NZ0 A;  1K2H A;  2HQ8 A;  4NDC A;  1SYM A;  1S6I A;  1B8C A;  4N1G A;  1IQ3 A;  1QXP A;  1V1G A;  1A75 B;  2AMI A;  3QRX A;  5TNC A;  1KK7 Z;  4TNC A;  2F33 A;  3BYA A;  4F0Z B;  2WCE A;  3NSI A;  2I18 A;  1GGW A;  2LMU A;  2WC8 A;  3LK0 A;  3DF0 A;  2LVI A;  4QJ4 B;  2M7L A;  1K96 A;  1OZS A;  2WCB A;  1OMR A;  4AQJ A;  4L9M A;  1JF0 A;  1DJH A;  1MHO A;  1R2U A;  2CCM A;  4NDB A;  3OX5 A;  3LCP C;  3TUY C;  4CID A;  1YX7 A;  3E3R A;  5CPV A;  1IRJ A;  2PAS A;  5G08 A;  1WDC B;  1DGU A;  2COL B;  2H61 A;  2IS9 A;  4GBA A;  4C0L A;  1J7O A;  1EJ3 A;  3LL8 B;  1TCF A;  3CGA A;  1U5I A;  2JRF A;  3VGO A;  4OR9 B;  2LM5 A;  1XFV O;  3IF7 A;  1YUT A;  1SCV A;  1DGV A;  1OZO A;  2A4J A;  2JWW A;  1NPQ A;  3SIB A;  1RWY A;  2SCP A;  5AER A;  1F70 A;  1AJ4 A;  3KHE A;  2LHI A;  1L2O C;  2Y4Q A;  3I5F B;  2WOR A;  3O6B A;  2LVJ A;  4NDD A;  1B8R A;  1LKJ A;  2KFF A;  3JTD C;  1TOP A;  1KK8 C;  1SKT A;  2BCB A;  2MRD A;  2JXL A;  4MEW A;  1XK4 A;  2AUC A;  2L2E A;  3FS7 A;  4I5K A;  4ZCV A;  4M2Q A;  1ALV A;  1SW8 A;  1QAS A;  4OCI A;  4HSZ A;  2JT3 A;  4IL1 A;  1TNQ A;  1QV0 A;  2KOT A;  5F6T A;  3TDI A;  2JTZ A;  2KHN A;  1EG4 A;  1SMG A;  4C0K A;  1MUX A;  3FWB A;  2E30 A;  1OSA A;  3JTD B;  1DMO A;  3KO0 A;  1J7P A;  3WXA A;  1F8H A;  1NP8 A;  1YR5 A;  1PK0 D;  5DKN A;  4D1E A;  1B47 A;  1JC2 A;  5KTY A;  4YGA A;  2KAX A;  1IKU A;  4PE4 A;  4N1F A;  2CT9 A;  2G2B A;  2LLU A;  2PMY A;  2BEC A;  1SCM C;  4PAL A;  1PRW A;  3TS5 C;  1KQM C;  2ZNE A;  4DRW A;  1CFC A;  1CDL A;  1ZAC A;  4HRG A;  1VRK A;  2EC6 B;  5IBW A;  2LAN A;  2K7O A;  1V1F A;  3F45 A;  3I5I B;  2CBL A;  1TNP A;  1B4C A;  1DT7 B;  1FPW A;  4A4B A;  1J1E A;  2M97 A;  4YI9 A;  1KK8 B;  4MZK A;  3BQ3 A;  1LVC D;  1KWO C;  1KFU S;  1JFK A;  1SL9 A;  1DJI A;  1UHH A;  1PVA A;  1TIZ A;  1UHI A;  4I5J A;  1G4Y R;  4I5N B;  1BR4 B;  3EVU A;  5DKR A;  3NSO A;  1TCO B;  1XFW O;  3AKB A;  1KSO A;  5AAN A;  1AK8 A;  1B1G A;  1CMF A;  1CLB A;  1A2X A;  3DVM A;  2F2P A;  3CLN A;  1K93 D;  1UHK A;  2MBX A;  1KSM A;  3VRP A;  1XFY O;  3KF9 A;  2F2O A;  1YTZ C;  3LLE A;  2LE9 B;  2B1U A;  1HQV A;  3I5I C;  2JNF A;  3SG7 A;  4CFR A;  1YRT B;  2MA2 A;  2GV5 A;  2PSR A;  3MSE B;  1CMG A;  4JPZ B;  1JWD A;  1G33 A;  1LA0 A;  3BUO B;  1H4B A;  1S1E A;  3BOW B;  4GNK B;  1M46 A;  1QTX A;  3ICB A;  4MRY A;  1PVB A;  5CSF A;  1FF1 A;  2LAP A;  3PLF B;  3PAL A;  1QLS A;  2JUL A;  4N5X A;  1B7T Z;  1KQM B;  2MJW B;  1DF0 B;  1XFU O;  1F71 A;  1LIN A;  3BUN B;  1MF8 B;  2HPS A;  2TN4 A;  3BUM B;  3H4S E;  3I5H C;  1SL8 A;  1C7V A;  1XFX O;  3PN7 C;  3PM8 A;  1PUL A;  1NUB A;  2D8N A;  3EKH A;  2ZFD A;  1MR8 A;  3EK4 A;  2ZND A;  1Y1X A;  4WQ2 A;  2M49 B;  3NSL A;  4UPG A;  5GQQ C;  3JVT C;  1C7W A;  1M31 A;  5I2Q A;  1BG1 A;  1BOC A;  2SAS A;  1QJT A;  1CDM A;  2NLN A;  3O2P A;  3PFV A;  2KQ6 A;  1AUI B;  3ZWH A;  4DCK A;  1S6J A;  1QAT A;  1YUS A;  1ZMZ A;  2R2I A;  4CFQ A;  1FW4 A;  1J7R A;  1YUU A;  1WRL A;  3VRO A;  4YI8 A;  2PVB A;  1SRA A;  4PCW A;  2LP2 A;  2E6W A;  2KGB C;  1Y1A A;  3K21 A;  1RFJ A;  1IH0 A;  1DJY A;  4PHK A;  3I5G C;  3CTN A;  1BR1 B;  2BBM A;  2BBN A;  3A4U B;  1CDN A;  1W7J B;  1LA3 A;  4PE1 A;  3AKA A;  1EXR A;  1CTR A;  3OP0 A;  1K9P A;  1AJ5 A;  1NSH A;  1XVJ A;  2F3Y A;  2H61 C;  1W7I B;  5HKZ A;  1QV1 A;  1CNP A;  1J1D A;  2JZI A;  3HCM A;  4I5L B;  5AFP A;  3HX4 A;  2WND A;  2L0P A;  1Y6W A;  5DKQ A;  3CZT X;  3TDZ A;  4ZCU A;  1K90 D;  3EKJ A;  4GGN A;  1TRF A;  4M2O A;  1OQP A;  3WHU B;  1BLQ A;  1CLM A;  2MLE C;  2K61 A;  2MAZ A;  1K95 A;  1NCY A;  2JOJ A;  4BY5 A;  4DS7 A;  1B7T Y;  3CS1 A;  1KFU L;  2FCE A;  4WRI A;  2K8M B;  1QX7 A;  3TUY B;  4QJ5 B;  2Q4U A;  4GGF C;  4YRU A;  2AAO A;  2KYC A;  4CLN A;  4YBH B;  2FOT A;  4NQG A;  1OMD A;  4AQI A;  4USL A;  2HQW A;  1KWO B;  1MXL C;  2JC2 A;  4YGE B;  5BPJ A;  4E68 A;  1YVL A;  1NX0 A;  1GJY A;  1N0Y A;  2JQ6 A;  3OB1 B;  3GOF A;  5FYX A;  1DJG A;  2BCX A;  2JXC A;  3M0W A;  2K7B A;  1NIW A;  2Y1M A;  2JPT A;  1M63 B;  2FJU B;  2KI6 C;  1F4Q A;  1SCM B;  1SY9 A;  4HRH A;  3BUX B;  1K8U A;  4PHN A;  1J55 A;  3AAJ A;  5HKY A;  5JJG A;  2KI6 D;  1HT9 A;  5I2O A;  1CFD A;  4MVF A;  1BMO A;  1WLM A;  4OV2 A;  2JT0 A;  2LLT A;  2F8P A;  2M8U A;  1CFP A;  1XYD A;  2M9G A;  3VRQ A;  2M7N A;  2OPO A; 
#chains in the Genus database with same CATH topology
 1REC A;  3I5H B;  2L5Y A;  3DVK A;  1JUO A;  2GGZ A;  2H8V A;  3D75 A;  5FI7 A;  3FE6 A;  3KPX A;  1K9K A;  1U5I B;  1UUS A;  2M1U A;  2BE4 A;  3N7H A;  1NYA A;  3D78 A;  1DF0 A;  1TN4 A;  1NX3 A;  4JKT A;  1NX1 A;  4MZJ A;  3CZ0 A;  3OGN A;  2NXQ A;  1GGZ A;  3GK4 X;  1JFJ A;  1DJX A;  3PSR A;  1XO5 A;  1FBV A;  5D7F A;  1Q80 A;  3CZ1 A;  2L4I A;  1YRU B;  2BCA A;  1LXF C;  2K7C A;  4MZL A;  3EK7 A;  1SR6 B;  3OX6 A;  4PHM A;  3SG3 A;  2M0R A;  1PSR A;  1QS7 A;  4ORC B;  1FI6 A;  2F3Z A;  1IQ5 A;  3D0Y B;  3DVE A;  1Z4H A;  3SG2 A;  1XFR A;  5I2L A;  5D69 A;  1Y1U A;  2RGI A;  1KK7 Y;  5B8I B;  2KNE A;  1CM4 A;  1MQ1 A;  1TNX A;  1ZOT B;  4FTG A;  1ORG A;  1QWV A;  3PAT A;  1S26 D;  1N2D A;  2EGD A;  4MLW A;  3KEV A;  2LCP A;  1S5G Y;  2QAC A;  2ISD A;  3BXK A;  1WRK A;  2KI4 C;  4GGF A;  2LHL A;  1EG3 A;  2QEH A;  2VRG A;  2PAL A;  1H8B A;  2FCD A;  1IG5 A;  1NWD A;  4JQ0 D;  3IQO A;  3NSK A;  5KU1 A;  1F4O A;  3TDU A;  4IJ7 A;  4JD9 A;  2L50 A;  1KQV A;  1KFX L;  3CWG A;  1OMV A;  1QLK A;  5JOL A;  2OS8 B;  3EVR A;  1L7Z A;  2O60 A;  3CR4 X;  2JTT A;  1DQE A;  3DXL A;  1DJZ A;  1XFZ O;  3WHT B;  4DUQ A;  1IGV A;  1PAL A;  2O5G A;  5CSN A;  4MRX A;  4YGC B;  5I8N A;  3EG5 B;  2LVV A;  1GQM A;  1AVS A;  4YGB B;  2BKI B;  3D73 A;  4U8D A;  4DIR A;  1EH2 A;  4XYN A;  3JVT B;  4YGD B;  1OOJ A;  4MSP A;  4ICB A;  4PDZ A;  4C0J A;  3D10 A;  4GPL B;  2Q91 A;  2ZN9 A;  5KSZ A;  5J3X A;  2ZN8 A;  2ZRT A;  1WY9 A;  1NCX A;  1DTL A;  4QJ3 B;  4PE0 A;  5HLV A;  3VRN A;  2WCH A;  3SG6 A;  1M45 A;  2OTG C;  1ZFS A;  2WCL A;  2I94 A;  5HYD A;  3PN7 B;  1UP5 A;  1S6C A;  3SIA A;  2JT8 A;  5CSJ A;  2QPT A;  2WOS A;  1IIO A;  2GTE A;  1QVI Y;  3DF0 B;  1E8A A;  2KSP A;  4XJK B;  1B8L A;  1SK6 D;  4F7F A;  2LP3 A;  2ERB A;  1SNL A;  5K89 A;  4WQ3 A;  3SG4 A;  1RJV A;  2V53 A;  3O78 A;  1JBA A;  3C1V A;  1QX2 A;  1A75 A;  2NCP A;  2KBI A;  1X02 A;  3PJI A;  4A4C A;  3EVV A;  1FI5 A;  1K9U A;  2LMT A;  3AAK A;  1S36 A;  1PSB A;  2JNX A;  2EHB A;  5DIC A;  4AOM A;  1OW4 A;  1MXE A;  4OVN F;  1IWQ A;  1ODB A;  2LV7 A;  3CYZ A;  2WCF A;  3D0Y A;  1KFX S;  1ALW A;  1RTP 1;  1CM1 A;  4GFT A;  2CTN A;  2EC6 C;  1BT6 A;  1BU3 A;  1CB1 A;  2K7D A;  1A29 A;  1QVI Z;  2KGR A;  4PE7 A;  3FIA A;  3IQQ A;  3TZ1 A;  4CPV A;  1ZUZ A;  1L2O B;  1CDP A;  1S5G Z;  5ER5 A;  2LC5 A;  3RLZ A;  2KPH A;  1CFF A;  3S0B A;  1W9Z A;  2L4H A;  3DD4 A;  1QIV A;  1SR6 C;  1SPY A;  1Z2C B;  2L98 A;  1JSA A;  2I2R E;  2K0J A;  4R1E A;  4PT1 A;  2K2A A;  3K1E A;  2HF5 A;  3PM2 A;  1OOH A;  2OS8 C;  5AEQ A;  3GK2 A;  2JU0 A;  5I94 A;  2H2K A;  1UWO A;  2LNK A;  2P6B B;  1A03 A;  1T14 A;  3DVJ A;  3BJH A;  4ORA B;  1BF5 A;  2BE6 A;  1M39 A;  1MWN A;  2KQY A;  1AHR A;  1NX2 A;  4BY4 A;  4JWQ A;  5CSI A;  2MLF C;  3O4Y A;  3OHM B;  1CKK A;  1SL7 A;  3EK8 A;  2M29 A;  4GUK A;  4Q04 A;  1RK9 A;  1YUR A;  1WLZ A;  4PHJ A;  3B6X A;  2KAY A;  1RRO A;  3TS5 B;  1J7Q A;  2LLS A;  3I5G B;  1TTX A;  2DOQ A;  3D77 A;  2L51 A;  2GGM A;  3R1V A;  1YVH A;  3ZNI A;  2M1K B;  2KFG A;  3L47 A;  4ORB B;  2L5X B;  1UUR A;  2LUC A;  1IJ6 A;  4GAO A;  1KCY A;  3CAB A;  1WDC C;  1UHN A;  2NCO A;  1NCZ A;  1WRZ A;  1AP4 A;  3FE8 A;  1CLL A;  2ZRS A;  1XK4 C;  2OTG B;  1R6P A;  2PRU A;  4FQT A;  4MBE A;  3A8R A;  4M2P A;  1D1O A;  1YX8 A;  3UNW A;  3LK1 A;  2KAV A;  4P2Y B;  4MN0 A;  3OB2 B;  3VRR A;  2CNP A;  1K94 A;  4P5O E;  2BL0 B;  5PAL A;  2KI4 B;  2LMV A;  3SG5 A;  1JF2 A;  2I7A A;  4INW A;  1C3Y A;  1F54 A;  3FWC A;  3CR2 A;  5HKW A;  2QEO A;  2LVK A;  1B9A A;  1UHJ A;  1S3P A;  2KFH A;  4ETO A;  3OBV A;  2M3W A;  1A4P A;  5AXI A;  1N65 A;  2ZKM X;  2KBM A;  1Y0V H;  1IJ5 A;  1OE9 B;  4HRE E;  3RM1 A;  1BOD A;  4XJK A;  3GK1 A;  2CXJ A;  2G9B A;  1TUJ A;  2BL0 C;  3CR5 X;  5HLO A;  1QX5 B;  1BJF A;  3I5F C;  4OKH A;  2WCJ A;  2PYQ A;  1XA5 A;  2QEV A;  5ER4 X;  2HET A;  1QIW A;  2BKH B;  2KYF A;  3B88 A;  1DVI A;  2LUX A;  2Y5I A;  1DJW A;  1TNW A;  2MHH A;  2KDH A;  3NXA A;  1F55 A;  3BUW B;  3WNX B;  3BOW A;  4FQO A;  1SBJ A;  3SJS A;  2Y1N A;  1G8I A;  1EL4 A;  2K2F A;  1C07 A;  2NZ0 A;  1K2H A;  2HQ8 A;  3DYE A;  4NDC A;  1SYM A;  1S6I A;  1B8C A;  4N1G A;  1IQ3 A;  1QXP A;  1V1G A;  5FI6 A;  1A75 B;  2AMI A;  3QRX A;  2WCK A;  1KK7 Z;  1OOI X;  5TNC A;  4TNC A;  2F33 A;  3BYA A;  3O4X A;  4F0Z B;  2WCE A;  3NSI A;  2I18 A;  1GGW A;  2LMU A;  2WC8 A;  3LK0 A;  3DF0 A;  2LVI A;  4QJ4 B;  2M7L A;  1K96 A;  1C3Z A;  1OZS A;  1OMR A;  2WCB A;  4AQJ A;  4L9M A;  1JF0 A;  1DJH A;  1MHO A;  1R2U A;  2CCM A;  4NDB A;  3OX5 A;  3LCP C;  3TUY C;  4CID A;  1YX7 A;  3E3R A;  5CPV A;  1IRJ A;  2PAS A;  5D3O A;  1WDC B;  1DGU A;  5G08 A;  2COL B;  2H61 A;  2IS9 A;  4GBA A;  4C0L A;  1J7O A;  1EJ3 A;  3LL8 B;  2WCM A;  1TCF A;  3CGA A;  1U5I A;  2JRF A;  3R1O A;  4OR9 B;  2BAP A;  2LM5 A;  1XFV O;  3IF7 A;  3VGO A;  3S0G A;  1YUT A;  1SCV A;  1DGV A;  1OZO A;  2A4J A;  2JWW A;  1NPQ A;  3SIB A;  1RWY A;  3S0F A;  2SCP A;  5AER A;  1F70 A;  1AJ4 A;  3KHE A;  2LHI A;  1L2O C;  2Y4Q A;  3I5F B;  2WOR A;  3O6B A;  2LVJ A;  4NDD A;  1B8R A;  1LKJ A;  2KFF A;  3JTD C;  1TOP A;  1KK8 C;  1SKT A;  2BCB A;  2MRD A;  2JXL A;  4MEW A;  3S0D A;  1XK4 A;  2AUC A;  2L2E A;  3FS7 A;  4I5K A;  4ZCV A;  4M2Q A;  1ALV A;  1SW8 A;  1QAS A;  4OCI A;  4HSZ A;  2JT3 A;  4IL1 A;  1TNQ A;  1QV0 A;  2KOT A;  5F6T A;  3TDI A;  2JTZ A;  3VB1 A;  2KHN A;  1EG4 A;  1SMG A;  4C0K A;  1MUX A;  2PQL A;  3FWB A;  2E30 A;  1OSA A;  3JTD B;  1DMO A;  3KO0 A;  3S0A A;  3B7A A;  1J7P A;  3SS3 A;  3WXA A;  1F8H A;  1NP8 A;  1YR5 A;  1PK0 D;  5DKN A;  4D1E A;  1B47 A;  5FI2 A;  1JC2 A;  4KYN A;  4YGA A;  2KAX A;  5KTY A;  1IKU A;  4PE4 A;  4N1F A;  2CT9 A;  2G2B A;  2LLU A;  3BFH A;  3R1P A;  2PMY A;  2BEC A;  1SCM C;  4PAL A;  1PRW A;  3TS5 C;  1KQM C;  2ZNE A;  4DRW A;  1CFC A;  1CDL A;  1ZAC A;  4HRG A;  3FE9 A;  2L2C A;  1VRK A;  2EC6 B;  5IBW A;  1GM0 A;  2LAN A;  2K7O A;  1V1F A;  3F45 A;  3I5I B;  2CBL A;  1TNP A;  3NHI A;  1B4C A;  1DT7 B;  1FPW A;  4A4B A;  1J1E A;  2M97 A;  4YI9 A;  1KK8 B;  4MZK A;  3BQ3 A;  1LVC D;  1KWO C;  1KFU S;  1JFK A;  1SL9 A;  1DJI A;  1UHH A;  1PVA A;  1TIZ A;  1UHI A;  4I5J A;  1G4Y R;  4I5N B;  1BR4 B;  3EVU A;  5DKR A;  3NSO A;  1TCO B;  1XFW O;  3AKB A;  1KSO A;  5AAN A;  1AK8 A;  1B1G A;  1CMF A;  1CLB A;  1A2X A;  3DVM A;  1DEL A;  2F2P A;  3CLN A;  1K93 D;  1UHK A;  3NHT A;  2YGU A;  2MBX A;  2QEB A;  1KSM A;  3VRP A;  1XFY O;  3KF9 A;  2F2O A;  1YTZ C;  3LLE A;  2LE9 B;  2B1U A;  1HQV A;  3I5I C;  2JNF A;  4OZD A;  3SG7 A;  4CFR A;  1YRT B;  2MA2 A;  3Q8I A;  2GV5 A;  2PSR A;  3MSE B;  1CMG A;  4JPZ B;  1JWD A;  3NGV A;  1G33 A;  1LA0 A;  3BUO B;  1H4B A;  3D74 A;  1S1E A;  3BOW B;  4GNK B;  1M46 A;  1TWO A;  1QTX A;  3ICB A;  4MRY A;  1PVB A;  5CSF A;  1FF1 A;  2LAP A;  3D76 A;  3PLF B;  3PAL A;  1QLS A;  2JUL A;  4N5X A;  1B7T Z;  1KQM B;  2MJW B;  1DF0 B;  1XFU O;  1F71 A;  1LIN A;  3BUN B;  1MF8 B;  2HPS A;  2TN4 A;  3BUM B;  3H4S E;  3I5H C;  1SL8 A;  1C7V A;  1XFX O;  3PN7 C;  3PM8 A;  1PUL A;  1NUB A;  2D8N A;  3EKH A;  2ZFD A;  3L4A A;  3CDN A;  1MR8 A;  3B86 A;  3EK4 A;  2ZND A;  3S0E A;  1Y1X A;  3BFA A;  1LS8 A;  4WQ2 A;  2M49 B;  3NSL A;  4UPG A;  3R72 A;  3JVT C;  5GQQ C;  1C7W A;  1M31 A;  5I2Q A;  1BG1 A;  1BOC A;  2SAS A;  1QJT A;  1CDM A;  2NLN A;  3DY9 A;  3O2P A;  3PFV A;  2KQ6 A;  1AUI B;  3ZWH A;  4DCK A;  1S6J A;  1QAT A;  1YUS A;  1ZMZ A;  2R2I A;  2WC5 A;  1FW4 A;  3L4L A;  4CFQ A;  1J7R A;  1YUU A;  1WRL A;  2FJY A;  3VRO A;  4YI8 A;  2PVB A;  1SRA A;  4PCW A;  2LP2 A;  2E6W A;  3V2L A;  2KGB C;  1Y1A A;  3K21 A;  1RFJ A;  1IH0 A;  1DJY A;  4PHK A;  3I5G C;  3CTN A;  1BR1 B;  2BBM A;  2BBN A;  3A4U B;  1CDN A;  1P28 A;  3SS5 A;  1W7J B;  1DEK A;  1LA3 A;  4PE1 A;  3AKA A;  1EXR A;  5HL1 A;  1CTR A;  3OP0 A;  1K9P A;  1AJ5 A;  1NSH A;  1XVJ A;  2F3Y A;  2H61 C;  1W7I B;  5HKZ A;  1QV1 A;  1CNP A;  1J1D A;  2JZI A;  3CZ2 A;  3HCM A;  4I5L B;  5AFP A;  3HX4 A;  2WND A;  2L0P A;  1Y6W A;  5DKQ A;  2WC6 A;  3CZT X;  3TDZ A;  2KLE A;  4ZCU A;  3UO9 A;  1K90 D;  3EKJ A;  4GGN A;  1TRF A;  1DC1 A;  4M2O A;  1OQP A;  3WHU B;  1BLQ A;  1CLM A;  2MLE C;  2K61 A;  2MAZ A;  1K95 A;  1NCY A;  2JOJ A;  4INX A;  4BY5 A;  3DZT A;  4DS7 A;  1B7T Y;  3CS1 A;  1KFU L;  2FCE A;  2K60 A;  4WRI A;  2K8M B;  1QX7 A;  1OOG A;  3IVT A;  3TUY B;  4QJ5 B;  2Q4U A;  4GGF C;  4YRU A;  2AAO A;  2KYC A;  5EL2 A;  4CLN A;  4YBH B;  2FOT A;  3B87 A;  4NQG A;  1OMD A;  4AQI A;  4USL A;  2HQW A;  1KWO B;  1MXL C;  2BNX A;  2JC2 A;  4YGE B;  2QDI A;  5BPJ A;  3RZS A;  4E68 A;  1YVL A;  3BFB A;  1NX0 A;  1GJY A;  1N0Y A;  2JQ6 A;  3OB1 B;  3GOF A;  3QME A;  1DJG A;  2BCX A;  5FYX A;  2P71 A;  2JXC A;  3M0W A;  2K7B A;  1NIW A;  1TUZ A;  2JPT A;  1M63 B;  2FJU B;  2KI6 C;  2Y1M A;  1F4Q A;  1SCM B;  1SY9 A;  4HRH A;  3BUX B;  1K8U A;  4PHN A;  1J55 A;  3AAJ A;  5HKY A;  1OOF A;  5JJG A;  2KI6 D;  2KLD A;  1HT9 A;  5I2O A;  1CFD A;  4MVF A;  1BMO A;  1WLM A;  4OV2 A;  2JT0 A;  2LLT A;  2JPO A;  2F8P A;  2M8U A;  1CFP A;  2P70 A;  1XYD A;  2M9G A;  3VRQ A;  2M7N A;  3SS4 A;  2OPO A;  1SSE B; 
#chains in the Genus database with same CATH homology
 1REC A;  3I5H B;  3DVK A;  1JUO A;  2GGZ A;  3KPX A;  1K9K A;  1U5I B;  1UUS A;  2M1U A;  2BE4 A;  1NYA A;  1DF0 A;  1TN4 A;  1NX3 A;  1NX1 A;  4MZJ A;  2NXQ A;  1GGZ A;  3GK4 X;  1JFJ A;  1DJX A;  3PSR A;  1XO5 A;  1FBV A;  5D7F A;  1Q80 A;  2L4I A;  1YRU B;  2BCA A;  1LXF C;  2K7C A;  4MZL A;  3EK7 A;  1SR6 B;  3OX6 A;  4PHM A;  3SG3 A;  2M0R A;  1PSR A;  1QS7 A;  4ORC B;  1FI6 A;  2F3Z A;  1IQ5 A;  3D0Y B;  3DVE A;  3SG2 A;  5I2L A;  5D69 A;  1Y1U A;  2RGI A;  1KK7 Y;  5B8I B;  2KNE A;  1CM4 A;  1MQ1 A;  1TNX A;  1ZOT B;  4FTG A;  3PAT A;  1S26 D;  1N2D A;  2EGD A;  4MLW A;  3KEV A;  2LCP A;  1S5G Y;  2QAC A;  2ISD A;  3BXK A;  1WRK A;  2KI4 C;  4GGF A;  2LHL A;  1EG3 A;  2VRG A;  2PAL A;  1H8B A;  2FCD A;  1IG5 A;  1NWD A;  4JQ0 D;  3IQO A;  3NSK A;  5KU1 A;  1F4O A;  3TDU A;  2L50 A;  1KQV A;  1KFX L;  3CWG A;  1OMV A;  1QLK A;  5JOL A;  2OS8 B;  3EVR A;  1L7Z A;  2O60 A;  3CR4 X;  2JTT A;  1DJZ A;  1XFZ O;  3WHT B;  4DUQ A;  1IGV A;  1PAL A;  2O5G A;  5CSN A;  4MRX A;  4YGC B;  5I8N A;  2LVV A;  1GQM A;  1AVS A;  4YGB B;  2BKI B;  4DIR A;  4U8D A;  1EH2 A;  4XYN A;  3JVT B;  4YGD B;  1OOJ A;  4MSP A;  4ICB A;  4PDZ A;  4C0J A;  3D10 A;  4GPL B;  2Q91 A;  2ZN9 A;  5KSZ A;  5J3X A;  2ZN8 A;  2ZRT A;  1WY9 A;  1NCX A;  1DTL A;  4QJ3 B;  4PE0 A;  5HLV A;  3VRN A;  3SG6 A;  1M45 A;  2OTG C;  1ZFS A;  2I94 A;  5HYD A;  3PN7 B;  1UP5 A;  1S6C A;  3SIA A;  2JT8 A;  5CSJ A;  2QPT A;  2WOS A;  1QVI Y;  3DF0 B;  1E8A A;  2KSP A;  4XJK B;  1B8L A;  1SK6 D;  5K89 A;  2LP3 A;  1SNL A;  4WQ3 A;  3SG4 A;  1RJV A;  2V53 A;  3O78 A;  1JBA A;  3C1V A;  1QX2 A;  1A75 A;  2NCP A;  2KBI A;  1X02 A;  4A4C A;  3EVV A;  1FI5 A;  1K9U A;  2LMT A;  3AAK A;  1S36 A;  1PSB A;  2JNX A;  2EHB A;  4AOM A;  1MXE A;  4OVN F;  1IWQ A;  1ODB A;  2LV7 A;  2WCF A;  3D0Y A;  1KFX S;  1ALW A;  1RTP 1;  1CM1 A;  4GFT A;  2CTN A;  2EC6 C;  1BT6 A;  1BU3 A;  1CB1 A;  2K7D A;  1A29 A;  1QVI Z;  2KGR A;  4PE7 A;  3FIA A;  3IQQ A;  3TZ1 A;  4CPV A;  1ZUZ A;  1L2O B;  1CDP A;  1S5G Z;  5ER5 A;  2LC5 A;  3RLZ A;  1CFF A;  2L4H A;  3DD4 A;  1QIV A;  1SR6 C;  1SPY A;  2L98 A;  1JSA A;  2I2R E;  2K0J A;  4R1E A;  2K2A A;  2HF5 A;  2OS8 C;  5AEQ A;  3GK2 A;  2JU0 A;  2H2K A;  1UWO A;  2LNK A;  2P6B B;  1A03 A;  3DVJ A;  4ORA B;  1BF5 A;  2BE6 A;  1M39 A;  1MWN A;  2KQY A;  1AHR A;  1NX2 A;  4BY4 A;  4JWQ A;  5CSI A;  2MLF C;  3O4Y A;  3OHM B;  1CKK A;  1SL7 A;  3EK8 A;  2M29 A;  4GUK A;  4Q04 A;  1RK9 A;  1YUR A;  1WLZ A;  4PHJ A;  1J7Q A;  2KAY A;  1RRO A;  3TS5 B;  2LLS A;  3I5G B;  1TTX A;  2DOQ A;  2L51 A;  2GGM A;  1YVH A;  3ZNI A;  2M1K B;  2KFG A;  4ORB B;  2L5X B;  1UUR A;  2LUC A;  1IJ6 A;  4GAO A;  1KCY A;  1WDC C;  1UHN A;  2NCO A;  1NCZ A;  1WRZ A;  1AP4 A;  1CLL A;  2ZRS A;  1XK4 C;  2OTG B;  1R6P A;  2PRU A;  4MBE A;  1D1O A;  3A8R A;  4M2P A;  1YX8 A;  3LK1 A;  2KAV A;  4P2Y B;  4MN0 A;  3OB2 B;  3VRR A;  2CNP A;  1K94 A;  4P5O E;  2BL0 B;  5PAL A;  2KI4 B;  2LMV A;  3SG5 A;  1JF2 A;  2I7A A;  1F54 A;  3FWC A;  3CR2 A;  5HKW A;  2LVK A;  1B9A A;  1UHJ A;  1S3P A;  2KFH A;  4ETO A;  2M3W A;  1A4P A;  5AXI A;  1N65 A;  2ZKM X;  2KBM A;  1Y0V H;  1IJ5 A;  1OE9 B;  4HRE E;  3RM1 A;  1BOD A;  4XJK A;  3GK1 A;  2CXJ A;  2G9B A;  3CR5 X;  2BL0 C;  5HLO A;  1QX5 B;  1BJF A;  3I5F C;  4OKH A;  1XA5 A;  5ER4 X;  2HET A;  1QIW A;  2BKH B;  2KYF A;  1DVI A;  2LUX A;  2Y5I A;  1DJW A;  1TNW A;  2MHH A;  2KDH A;  3NXA A;  1F55 A;  3BUW B;  3WNX B;  3BOW A;  4FQO A;  1SBJ A;  3SJS A;  2Y1N A;  1G8I A;  1EL4 A;  2K2F A;  1C07 A;  2NZ0 A;  1K2H A;  2HQ8 A;  4NDC A;  1SYM A;  1S6I A;  1B8C A;  4N1G A;  1IQ3 A;  1QXP A;  1V1G A;  1A75 B;  2AMI A;  3QRX A;  5TNC A;  1KK7 Z;  4TNC A;  2F33 A;  3BYA A;  4F0Z B;  2WCE A;  3NSI A;  2I18 A;  1GGW A;  2LMU A;  2WC8 A;  3LK0 A;  3DF0 A;  2LVI A;  4QJ4 B;  2M7L A;  1K96 A;  1OZS A;  2WCB A;  1OMR A;  4AQJ A;  4L9M A;  1JF0 A;  1DJH A;  1MHO A;  1R2U A;  2CCM A;  4NDB A;  3OX5 A;  3LCP C;  3TUY C;  4CID A;  1YX7 A;  3E3R A;  5CPV A;  1IRJ A;  2PAS A;  5G08 A;  1WDC B;  1DGU A;  2COL B;  2H61 A;  2IS9 A;  4GBA A;  4C0L A;  1J7O A;  1EJ3 A;  3LL8 B;  1TCF A;  3CGA A;  1U5I A;  2JRF A;  3VGO A;  4OR9 B;  2LM5 A;  1XFV O;  3IF7 A;  1YUT A;  1SCV A;  1DGV A;  1OZO A;  2A4J A;  2JWW A;  1NPQ A;  3SIB A;  1RWY A;  2SCP A;  5AER A;  1F70 A;  1AJ4 A;  3KHE A;  2LHI A;  1L2O C;  2Y4Q A;  3I5F B;  2WOR A;  3O6B A;  2LVJ A;  4NDD A;  1B8R A;  1LKJ A;  2KFF A;  3JTD C;  1TOP A;  1KK8 C;  1SKT A;  2BCB A;  2MRD A;  2JXL A;  4MEW A;  1XK4 A;  2AUC A;  2L2E A;  3FS7 A;  4I5K A;  4ZCV A;  4M2Q A;  1ALV A;  1SW8 A;  1QAS A;  4OCI A;  4HSZ A;  2JT3 A;  4IL1 A;  1TNQ A;  1QV0 A;  2KOT A;  5F6T A;  3TDI A;  2JTZ A;  2KHN A;  1EG4 A;  1SMG A;  4C0K A;  1MUX A;  3FWB A;  2E30 A;  1OSA A;  3JTD B;  1DMO A;  3KO0 A;  1J7P A;  3WXA A;  1F8H A;  1NP8 A;  1YR5 A;  1PK0 D;  5DKN A;  4D1E A;  1B47 A;  1JC2 A;  5KTY A;  4YGA A;  2KAX A;  1IKU A;  4PE4 A;  4N1F A;  2CT9 A;  2G2B A;  2LLU A;  2PMY A;  2BEC A;  1SCM C;  4PAL A;  1PRW A;  3TS5 C;  1KQM C;  2ZNE A;  4DRW A;  1CFC A;  1CDL A;  1ZAC A;  4HRG A;  1VRK A;  2EC6 B;  5IBW A;  2LAN A;  2K7O A;  1V1F A;  3F45 A;  3I5I B;  2CBL A;  1TNP A;  1B4C A;  1DT7 B;  1FPW A;  4A4B A;  1J1E A;  2M97 A;  4YI9 A;  1KK8 B;  4MZK A;  3BQ3 A;  1LVC D;  1KWO C;  1KFU S;  1JFK A;  1SL9 A;  1DJI A;  1UHH A;  1PVA A;  1TIZ A;  1UHI A;  4I5J A;  1G4Y R;  4I5N B;  1BR4 B;  3EVU A;  5DKR A;  3NSO A;  1TCO B;  1XFW O;  3AKB A;  1KSO A;  5AAN A;  1AK8 A;  1B1G A;  1CMF A;  1CLB A;  1A2X A;  3DVM A;  2F2P A;  3CLN A;  1K93 D;  1UHK A;  2MBX A;  1KSM A;  3VRP A;  1XFY O;  3KF9 A;  2F2O A;  1YTZ C;  3LLE A;  2LE9 B;  2B1U A;  1HQV A;  3I5I C;  2JNF A;  3SG7 A;  4CFR A;  1YRT B;  2MA2 A;  2GV5 A;  2PSR A;  3MSE B;  1CMG A;  4JPZ B;  1JWD A;  1G33 A;  1LA0 A;  3BUO B;  1H4B A;  1S1E A;  3BOW B;  4GNK B;  1M46 A;  1QTX A;  3ICB A;  4MRY A;  1PVB A;  5CSF A;  1FF1 A;  2LAP A;  3PLF B;  3PAL A;  1QLS A;  2JUL A;  4N5X A;  1B7T Z;  1KQM B;  2MJW B;  1DF0 B;  1XFU O;  1F71 A;  1LIN A;  3BUN B;  1MF8 B;  2HPS A;  2TN4 A;  3BUM B;  3H4S E;  3I5H C;  1SL8 A;  1C7V A;  1XFX O;  3PN7 C;  3PM8 A;  1PUL A;  1NUB A;  2D8N A;  3EKH A;  2ZFD A;  1MR8 A;  3EK4 A;  2ZND A;  1Y1X A;  4WQ2 A;  2M49 B;  3NSL A;  4UPG A;  5GQQ C;  3JVT C;  1C7W A;  1M31 A;  5I2Q A;  1BG1 A;  1BOC A;  2SAS A;  1QJT A;  1CDM A;  2NLN A;  3O2P A;  3PFV A;  2KQ6 A;  1AUI B;  3ZWH A;  4DCK A;  1S6J A;  1QAT A;  1YUS A;  1ZMZ A;  2R2I A;  4CFQ A;  1FW4 A;  1J7R A;  1YUU A;  1WRL A;  3VRO A;  4YI8 A;  2PVB A;  1SRA A;  4PCW A;  2LP2 A;  2E6W A;  2KGB C;  1Y1A A;  3K21 A;  1RFJ A;  1IH0 A;  1DJY A;  4PHK A;  3I5G C;  3CTN A;  1BR1 B;  2BBM A;  2BBN A;  3A4U B;  1CDN A;  1W7J B;  1LA3 A;  4PE1 A;  3AKA A;  1EXR A;  1CTR A;  3OP0 A;  1K9P A;  1AJ5 A;  1NSH A;  1XVJ A;  2F3Y A;  2H61 C;  1W7I B;  5HKZ A;  1QV1 A;  1CNP A;  1J1D A;  2JZI A;  3HCM A;  4I5L B;  5AFP A;  3HX4 A;  2WND A;  2L0P A;  1Y6W A;  5DKQ A;  3CZT X;  3TDZ A;  4ZCU A;  1K90 D;  3EKJ A;  4GGN A;  1TRF A;  4M2O A;  1OQP A;  3WHU B;  1BLQ A;  1CLM A;  2MLE C;  2K61 A;  2MAZ A;  1K95 A;  1NCY A;  2JOJ A;  4BY5 A;  4DS7 A;  1B7T Y;  3CS1 A;  1KFU L;  2FCE A;  4WRI A;  2K8M B;  1QX7 A;  3TUY B;  4QJ5 B;  2Q4U A;  4GGF C;  4YRU A;  2AAO A;  2KYC A;  4CLN A;  4YBH B;  2FOT A;  4NQG A;  1OMD A;  4AQI A;  4USL A;  2HQW A;  1KWO B;  1MXL C;  2JC2 A;  4YGE B;  5BPJ A;  4E68 A;  1YVL A;  1NX0 A;  1GJY A;  1N0Y A;  2JQ6 A;  3OB1 B;  3GOF A;  5FYX A;  1DJG A;  2BCX A;  2JXC A;  3M0W A;  2K7B A;  1NIW A;  2Y1M A;  2JPT A;  1M63 B;  2FJU B;  2KI6 C;  1F4Q A;  1SCM B;  1SY9 A;  4HRH A;  3BUX B;  1K8U A;  4PHN A;  1J55 A;  3AAJ A;  5HKY A;  5JJG A;  2KI6 D;  1HT9 A;  5I2O A;  1CFD A;  4MVF A;  1BMO A;  1WLM A;  4OV2 A;  2JT0 A;  2LLT A;  2F8P A;  2M8U A;  1CFP A;  1XYD A;  2M9G A;  3VRQ A;  2M7N A;  2OPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...