5ER4X

Crystal structure of calcium-loaded s100b bound to sc0025
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
90
structure length
90
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title Novel protein-inhibitor interactions in site 3 of Ca(2+)-bound S100B as discovered by X-ray crystallography.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein/inhibitor
total genus 32
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2015-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00036 EF-hand_1 EF hand
X PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5er4X00
2K2FA 4N1FA 3BYAA 1B1GA 1YTZC 4WQ2A 1DGUA 1MHOA 2K7CA 2GGMA 5AEQA 3SG4A 5CPVA 4OCIA 3VRPA 2JXCA 3CR4X 1B7TZ 1K93D 2KQ6A 2KYCA 3PATA 2CBLA 1KFXL 2Q4UA 3WNXB 5AFPA 3D0YB 2AUCA 5CSJA 3EK7A 1SYMA 1U5IB 2COLB 2LM5A 1JWDA 1KK7Y 1QVIZ 2JU0A 2GV5A 3JVTC 1CFDA 3LL8B 2MHHA 2M49B 2FJUB 3NXAA 2BKHB 4ICBA 5GQQC 4WRIA 3ZNIA 3I5FB 2I18A 4MRXA 4CFRA 2LHIA 1QX7A 1MF8B 4DS7A 3D10A 2KI6C 2ZRSA 1IRJA 2PMYA 2CT9A 4ORBB 1H4BA 2E6WA 2LVKA 4I5JA 2JPTA 1CMGA 2JT3A 4E68A 1X02A 1BT6A 3KO0A 5D69A 4DCKA 2KI4C 4PHNA 4NQGA 1XYDA 2KAYA 2QACA 5CSIA 1PVAA 2ZKMX 1CFFA 4N1GA 2I7AA 1G4YR 1Y6WA 3I5HB 1JF0A 1B8LA 1R6PA 1XO5A 1DJHA 3SG3A 4MEWA 1XFUO 2M8UA 1XFZO 3EK8A 2B1UA 2WNDA 1J7RA 4ZCVA 1UHHA 1CDMA 4GAOA 2WCBA 3CR5X 1DJIA 1W7IB 4DRWA 1NYAA 3KPXA 4YI8A 1QASA 2JT0A 3OB2B 3RLZA 1J7QA 3EVUA 2EGDA 3O6BA 1NP8A 4NDDA 1XA5A 3BOWA 3EKHA 3OP0A 4D1EA 2MLEC 4FTGA 1OOJA 2BE6A 4XYNA 1SK6D 2V53A 3TDUA 3BQ3A 1KFUS 2M1KB 3A8RA 3DVMA 4GFTA 1S6IA 1YR5A 1UWOA 4QJ4B 1WRLA 2M7LA 1RTP1 1AJ4A 2KDHA 3TS5C 4IL1A 1QIVA 1ZACA 2FCDA 3DF0A 4WQ3A 2ZFDA 2FCEA 1ZFSA 4MRYA 5I2LA 1JUOA 4BY4A 1N2DA 2E30A 1SR6B 1NX1A 1WLMA 2OS8B 4I5LB 4ORAB 2JTTA 2L51A 1EG4A 1LINA 3PN7B 3M0WA 4YGAA 4C0JA 2NCOA 2KGBC 2ZN9A 1CM1A 3SIBA 3EVRA 3VRQA 1DT7B 1CDPA 1UHIA 2M29A 5ER4X 2BBMA 2CXJA 2LVIA 3DD4A 1K95A 4MZJA 1SW8A 4DUQA 2JNXA 2M0RA 1JBAA 1S6JA 4CFQA 1UURA 2NZ0A 3NSOA 3PALA 1PVBA 4CLNA 1XVJA 1UHJA 4N5XA 2LP3A 4NDCA 5TNCA 1B9AA 1IQ5A 1K96A 3QRXA 1K90D 2EC6C 2L50A 5DKQA 1KQMB 3KF9A 2CCMA 1IKUA 1TNQA 1TIZA 5AANA 2JOJA 2L0PA 1MXEA 2GGZA 2LANA 1QJTA 1NSHA 1TRFA 1B47A 1PK0D 1EJ3A 3LLEA 3I5IB 4USLA 3VRNA 1XK4A 4UPGA 1QV1A 3NSIA 5PALA 1V1FA 2M1UA 1DJYA 1ZMZA 1CM4A 3PLFB 4Q04A 5JJGA 1IJ6A 3MSEB 1SL7A 2HPSA 4MLWA 2F8PA 1H8BA 1DGVA 3LK0A 4MN0A 1QTXA 2QPTA 2KFHA 3CS1A 3JTDB 5I2OA 1YUUA 3I5GB 2M7NA 2LP2A 2LHLA 2MRDA 1CDNA 2LVVA 3BOWB 3IQQA 1TCOB 1IH0A 3EVVA 3WHUB 2LE9B 3FS7A 1AJ5A 1S26D 4R1EA 5F6TA 3AAJA 4A4CA 2K7OA 1M39A 1LVCD 4HSZA 1N65A 1ALWA 1YX8A 2L5XB 1PSBA 4MZKA 3DF0B 3DVEA 3C1VA 2G9BA 1UP5A 2LVJA 3HCMA 4C0KA 3TDIA 2HETA 2TN4A 3CWGA 1OZSA 3VGOA 4GGNA 1MWNA 1RJVA 2JXLA 3TUYC 2A4JA 1L2OC 5BPJA 3FIAA 3HX4A 1NX3A 2JTZA 4F0ZB 5AERA 1MQ1A 1CMFA 1WRKA 4HRGA 1YRTB 2NXQA 4HREE 1YX7A 3KHEA 1KK8C 1MUXA 2BCXA 3O78A 1N0YA 4MVFA 2O5GA 4PALA 1TNPA 3SJSA 1QX2A 1XFWO 2AMIA 3PFVA 1K8UA 1SCMB 1S3PA 1KFXS 3CZTX 1NPQA 1KWOB 1J1DA 2F3YA 4BY5A 3SIAA 5HLOA 2MJWB 1KK7Z 1FW4A 2BL0C 1PSRA 2SCPA 2OTGC 1IJ5A 3GK1A 4L9MA 1F71A 1IQ3A 4JPZB 1M45A 4GBAA 3BUMB 1DJZA 5DKNA 4PHMA 4ETOA 2H2KA 3SG6A 4PHJA 3NSKA 1QX5B 1WDCC 2L2EA 1S6CA 2BECA 1FI5A 1NCYA 1A75A 3BUXB 1GGZA 2I2RE 3DVJA 5DKRA 3AAKA 1A2XA 4DIRA 5J3XA 2R2IA 4OKHA 3ZWHA 1GQMA 1SRAA 1YUSA 1SCVA 1A03A 5KSZA 3O4YA 3SG7A 1K9UA 3BUWB 3TDZA 2JNFA 1F70A 1NX2A 5K89A 4P5OE 2BE4A 2L4IA 2M3WA 1J1EA 2K61A 1JF2A 1B8RA 2KBMA 1EG3A 3GK2A 2L98A 1A4PA 2CNPA 2MA2A 5KTYA 2AAOA 2WCFA 1UUSA 3LCPC 3E3RA 4P2YB 2RGIA 2KOTA 2KSPA 1LA0A 2ZN8A 1TNXA 2BBNA 2JWWA 2WORA 5HKYA 1S5GY 2O60A 4YGEB 5HKWA 1RK9A 1F4OA 1QATA 1YVLA 3D0YA 3I5FC 2G2BA 3LK1A 2JRFA 1QLSA 1FI6A 1U5IA 1FBVA 5AXIA 1IWQA 1CDLA 1YVHA 1CB1A 1DF0A 2KBIA 1Y0VH 2KFFA 2Y1NA 1HT9A 1FF1A 1AHRA 3JVTB 3F45A 1C7VA 4M2QA 4YGBB 1BOCA 2WCEA 1K9PA 1Y1XA 3OX5A 1BMOA 4OV2A 3O2PA 1LA3A 1SMGA 5HYDA 1QS7A 3BXKA 4XJKA 1VRKA 1A29A 4PE1A 3TUYB 1BR4B 1NCXA 4I5NB 4TNCA 5HKZA 1NCZA 1PRWA 1CNPA 1W7JB 1C7WA 1BG1A 1F4QA 4AQJA 5D7FA 2KHNA 4AQIA 1PALA 2LNKA 2KI4B 3PSRA 1Y1UA 3BUOB 2LLUA 3CTNA 1LKJA 1RWYA 1WLZA 4FQOA 1QLKA 2Y1MA 4QJ3B 1S5GZ 1OZOA 1K9KA 5B8IB 2I94A 1YURA 2JULA 1B8CA 4ZCUA 4PHKA 1M63B 2LCPA 2H61C 2KAVA 4I5KA 1NWDA 3GOFA 1BR1B 4YRUA 1GGWA 1QVIY 1L7ZA 1OMVA 1OMRA 5CSFA 1F54A 1QIWA 1QV0A 2Q91A 1KSMA 1TTXA 2Y5IA 2WOSA 4OR9B 1RROA 2H61A 3DVKA 4C0LA 1SR6C 1RECA 2OS8C 2LC5A 5G08A 4YGDB 2NLNA 1K94A 3PN7C 4GGFC 1J7PA 1OQPA 1B4CA 1TOPA 1ALVA 2PRUA 3TS5B 1R2UA 1DTLA 1TN4A 1CLMA 1XFYO 4GGFA 4MSPA 1JFJA 2Y4QA 1MR8A 2DOQA 2K2AA 2LLTA 2HQ8A 3NSLA 4AOMA 4CIDA 1OMDA 4A4BA 1DVIA 4M2OA 3K21A 1OE9B 1C07A 3CGAA 2L4HA 1DF0B 2K0JA 1KQMC 4JQ0D 1HQVA 3SG2A 1EH2A 4YBHB 1KFUL 1DJGA 1MXLC 2IS9A 1CLBA 5HLVA 2NCPA 1AUIB 2M9GA 4XJKB 1D1OA 1DMOA 1G33A 3I5IC 4GNKB 3KEVA 1TNWA 2EC6B 1SY9A 2MBXA 3AKAA 2P6BB 1GJYA 1CFCA 2WC8A 3GK4X 2KNEA 2LUXA 3CR2A 1Q80A 1TCFA 3JTDC 1J55A 3I5GC 1XFXO 1ZUZA 3WXAA 3RM1A 1SBJA 2MLFC 4OVNF 1AVSA 1M31A 1JC2A 2K8MB 2OPOA 1S1EA 1DJWA 1QXPA 5CSNA 2PALA 5ER5A 1OSAA 1V1GA 2HQWA 3H4SE 2D8NA 1CTRA 1EL4A 3TZ1A 2PASA 1M46A 1IG5A 4PDZA 2KQYA 1UHKA 2JC2A 3BUNB 2KI6D 3OX6A 4YI9A 1AK8A 3IF7A 5I2QA 1KCYA 3IQOA 1NIWA 1SL8A 4HRHA 5JOLA 3VROA 2SASA 3PM8A 1J7OA 2LMVA 4GUKA 5I8NA 2KFGA 3WHTB 1SKTA 3OB1B 4NDBA 1PULA 3SG5A 1JFKA 2F33A 2HF5A 2KGRA 2LMUA 2M97A 3FWCA 4QJ5B 4ORCB 1DJXA 1UHNA 2MAZA 1BJFA 1BU3A 2LUCA 2PVBA 2BCAA 1LXFC 3AKBA 3CLNA 3EK4A 4YGCB 2BCBA 1YUTA 3I5HC 2F2OA 1SL9A 1ODBA 4CPVA 5KU1A 2ZNEA 2EHBA 1SNLA 1BODA 1L2OB 1NX0A 1SCMC 2K7BA 1BLQA 1F55A 4PE0A 1KWOC 3ICBA 5IBWA 2F2PA 2CTNA 3VRRA 1AP4A 1NUBA 1BF5A 1JSAA 4GPLB 2LAPA 4JWQA 1WRZA 2JQ6A 1EXRA 1RFJA 2ZNDA 3A4UB 1WY9A 2FOTA 1F8HA 1K2HA 2LMTA 1CKKA 1B7TY 1KK8B 2VRGA 4MZLA 1XK4C 4M2PA 5FYXA 1S36A 1KSOA 3FWBA 2KAXA 1CFPA 4U8DA 2LLSA 2BKIB 1Y1AA 4PE4A 1FPWA 2ZRTA 1A75B 2BL0B 2OTGB 2K7DA 1G8IA 4PCWA 1IGVA 1CLLA 2F3ZA 2KYFA 2PSRA 1SPYA 3EKJA 1E8AA 2LV7A 2ISDA 2JZIA 1WDCB 4MBEA 4PE7A 1KQVA 2JT8A 1XFVO 3OHMB 1YRUB 1ZOTB
chains in the Genus database with same CATH superfamily
2K2FA 4N1FA 3D75A 3BYAA 1B1GA 1YTZC 4WQ2A 1DGUA 1MHOA 2K7CA 2GGMA 5AEQA 3SG4A 5CPVA 4OCIA 3VRPA 2JXCA 3CR4X 1B7TZ 1K93D 2KQ6A 2KYCA 3PATA 2CBLA 1KFXL 2Q4UA 5I2LA 3WNXB 5AFPA 3D0YB 2AUCA 3B87A 5CSJA 3EK7A 1SYMA 1U5IB 2COLB 2LM5A 1JWDA 1KK7Y 1QVIZ 2JU0A 3DZTA 2GV5A 3JVTC 2PQLA 1CFDA 3LL8B 2MHHA 2M49B 2FJUB 3NXAA 2BKHB 4ICBA 5GQQC 4WRIA 5FI2A 3I5FB 3ZNIA 2I18A 4MRXA 4CFRA 2LHIA 1QX7A 1MF8B 4DS7A 4F7FA 3D10A 2KI6C 2ZRSA 1IRJA 2PMYA 2CT9A 4ORBB 1H4BA 2WCKA 2E6WA 2LVKA 4I5JA 2JPTA 1CMGA 2JT3A 4E68A 1X02A 1BT6A 3KO0A 5D69A 4DCKA 2KI4C 4PHNA 4NQGA 1XYDA 2KAYA 2QACA 5CSIA 1PVAA 2ZKMX 1CFFA 4N1GA 2I7AA 1G4YR 1Y6WA 3I5HB 1JF0A 1B8LA 1R6PA 1XO5A 1DJHA 3SG3A 4MEWA 5FI6A 1XFUO 2M8UA 1XFZO 2BNXA 3EK8A 2B1UA 2WNDA 1J7RA 4ZCVA 1UHHA 1CDMA 4GAOA 2WCBA 3CR5X 1DJIA 1W7IB 4DRWA 1NYAA 3R72A 3KPXA 4YI8A 1QASA 2JT0A 3OB2B 3RLZA 1J7QA 3EVUA 2EGDA 3O6BA 1NP8A 4NDDA 1XA5A 3BOWA 3EKHA 3OP0A 4D1EA 2MLEC 4FTGA 1OOJA 2BE6A 3UNWA 4XYNA 1SK6D 2V53A 3TDUA 3BQ3A 1KFUS 2M1KB 3A8RA 3DVMA 3CZ2A 1S6IA 4GFTA 1YR5A 5DICA 1UWOA 4QJ4B 1WRLA 1P28A 2M7LA 1RTP1 1AJ4A 2KDHA 3TS5C 4IL1A 1QIVA 1ZACA 2FCDA 2WCJA 3DF0A 2ZFDA 2FCEA 1QWVA 1ZFSA 4MRYA 1JUOA 4WQ3A 1N2DA 2E30A 1SR6B 4BY4A 1NX1A 1WLMA 2OS8B 3PJIA 4I5LB 4ORAB 2JTTA 2L51A 1EG4A 1LINA 3PN7B 1W9ZA 3M0WA 4YGAA 3S0GA 4C0JA 1T14A 2NCOA 2KGBC 2ZN9A 1CM1A 3SIBA 3EVRA 3VRQA 3S0FA 1DT7B 1CDPA 1UHIA 2M29A 3B7AA 5ER4X 2BBMA 2CXJA 1TWOA 2LVIA 1K95A 3DD4A 1SW8A 4MZJA 2JNXA 4DUQA 3CABA 2M0RA 1JBAA 1S6JA 2WC6A 1UURA 4CFQA 2NZ0A 2K60A 3NSOA 3PALA 1PVBA 4CLNA 1XVJA 1UHJA 4N5XA 2LP3A 4NDCA 5TNCA 3BJHA 1B9AA 1IQ5A 1K96A 3QRXA 1K90D 1TUZA 2EC6C 2L50A 5DKQA 1KQMB 3KF9A 3L4AA 2CCMA 1IKUA 1TNQA 3D73A 1TIZA 5AANA 2JOJA 2P71A 2L0PA 1MXEA 2GGZA 2LANA 1QJTA 1NSHA 1TRFA 1B47A 1PK0D 1EJ3A 3LLEA 3I5IB 4USLA 3VRNA 1XK4A 4UPGA 1QV1A 3NSIA 5PALA 1V1FA 2M1UA 1DJYA 1ZMZA 1CM4A 3PLFB 4Q04A 5JJGA 1IJ6A 3MSEB 1SL7A 2HPSA 4MLWA 2F8PA 1H8BA 1DGVA 1OOGA 3LK0A 1QTXA 2QPTA 3B6XA 4MN0A 2KFHA 3CS1A 3JTDB 5I2OA 1YUUA 3I5GB 2M7NA 2LP2A 2LHLA 2MRDA 2PYQA 3FE6A 1CDNA 2LVVA 3BOWB 3CYZA 3IQQA 1TCOB 2L5YA 1IH0A 3EVVA 3WHUB 2LE9B 3FS7A 3CDNA 1AJ5A 2QEVA 1S26D 4R1EA 3S0EA 5F6TA 3N7HA 3AAJA 1GM0A 4A4CA 2K7OA 1M39A 1LVCD 4HSZA 1N65A 1ALWA 1YX8A 2L5XB 1PSBA 4MZKA 3DF0B 3DVEA 3C1VA 2G9BA 4IJ7A 1UP5A 2LVJA 3HCMA 3NGVA 4C0KA 3TDIA 2HETA 2TN4A 3CWGA 3L4LA 1OZSA 3VGOA 4GGNA 1MWNA 3V2LA 1RJVA 2JXLA 3DXLA 3TUYC 2A4JA 3CZ0A 1L2OC 3K1EA 5BPJA 3FIAA 3HX4A 3NHTA 1NX3A 2JTZA 4F0ZB 5AERA 1MQ1A 1CMFA 1WRKA 4HRGA 4KYNA 3D76A 1DEKA 1YRTB 2NXQA 4HREE 3R1VA 1YX7A 3KHEA 1KK8C 1MUXA 2BCXA 3O78A 1N0YA 4MVFA 2O5GA 1ORGA 1TNPA 4PALA 1QX2A 1XFWO 3SJSA 1TUJA 2AMIA 3PFVA 1K8UA 1SCMB 1S3PA 1KFXS 2QEHA 2YGUA 1NPQA 1KWOB 1J1DA 2F3YA 3CZTX 3SIAA 4BY5A 1C3YA 5HLOA 2MJWB 1XFRA 1KK7Z 1FW4A 2BL0C 1PSRA 2SCPA 2OTGC 1IJ5A 3GK1A 4L9MA 1F71A 3S0AA 1IQ3A 4INWA 1M45A 4GBAA 4JPZB 3BUMB 1DJZA 3OBVA 5DKNA 4PHMA 4ETOA 2H2KA 2KPHA 4PHJA 3SG6A 3NSKA 1Z2CB 1QX5B 1WDCC 2L2EA 1S6CA 2BECA 3B88A 1FI5A 1NCYA 1A75A 3BUXB 1LS8A 1GGZA 2I2RE 3DVJA 5D3OA 3AAKA 1A2XA 5DKRA 5J3XA 4DIRA 2R2IA 4OKHA 3ZWHA 1GQMA 1SRAA 1YUSA 1SCVA 4OZDA 1A03A 5KSZA 3O4YA 3SG7A 1K9UA 3BUWB 3TDZA 3IVTA 2JNFA 1F70A 1NX2A 5K89A 4P5OE 2BE4A 2L4IA 2M3WA 1J1EA 2K61A 1JF2A 1B8RA 2KBMA 1EG3A 3GK2A 2L98A 3O4XA 1A4PA 3PM2A 2CNPA 2MA2A 5KTYA 2AAOA 2WCFA 1UUSA 3LCPC 3E3RA 4P2YB 2RGIA 2KOTA 2KSPA 1LA0A 2ZN8A 1TNXA 2BBNA 2JWWA 2WORA 5HKYA 1S5GY 2O60A 4YGEB 3BFAA 5HKWA 1RK9A 1F4OA 1OW4A 1QATA 1YVLA 3D0YA 3I5FC 2G2BA 3LK1A 2JRFA 1QLSA 1FI6A 1U5IA 1FBVA 5AXIA 3RZSA 1IWQA 1CDLA 1YVHA 1CB1A 2QEBA 1DF0A 2KBIA 1Y0VH 2KFFA 2Y1NA 1HT9A 1FF1A 1AHRA 3JVTB 3F45A 1C7VA 4M2QA 4YGBB 1BOCA 2WCEA 1K9PA 1Y1XA 3OX5A 1BMOA 4OV2A 3O2PA 1LA3A 1SMGA 5HYDA 1QS7A 3BFBA 3BXKA 4XJKA 1VRKA 1A29A 2QEOA 3BFHA 4PE1A 3TUYB 1BR4B 1NCXA 4I5NB 4TNCA 5HKZA 1NCZA 1PRWA 4PT1A 1CNPA 1W7JB 1C7WA 1BG1A 1F4QA 3SS4A 4AQJA 5D7FA 2KHNA 4AQIA 1PALA 2LNKA 2KI4B 3PSRA 1Y1UA 3BUOB 3S0DA 2LLUA 3CTNA 3B86A 1LKJA 1RWYA 1WLZA 4FQOA 1QLKA 2Y1MA 4QJ3B 1S5GZ 3CZ1A 3D78A 3DYEA 1OZOA 1K9KA 5B8IB 2GTEA 2I94A 1YURA 2JULA 1B8CA 4ZCUA 4FQTA 4PHKA 1M63B 2LCPA 2H61C 2KAVA 4I5KA 4JKTA 1NWDA 3GOFA 1BR1B 4YRUA 1GGWA 1QVIY 1L7ZA 1OMVA 1OMRA 5CSFA 1F54A 1QIWA 1QV0A 2Q91A 1KSMA 1TTXA 2WC5A 2Y5IA 2WOSA 3EG5B 1OOIX 4OR9B 1RROA 2H61A 2H8VA 3DVKA 4C0LA 1SR6C 1RECA 2OS8C 2LC5A 2P70A 5G08A 4YGDB 2NLNA 1K94A 3PN7C 4GGFC 1J7PA 1OQPA 1B4CA 1TOPA 1ALVA 2PRUA 3R1OA 3TS5B 1R2UA 1DTLA 1TN4A 1CLMA 1XFYO 4GGFA 4MSPA 1JFJA 2Y4QA 1MR8A 2DOQA 3OGNA 2K2AA 2LLTA 2HQ8A 2KLEA 3NSLA 3S0BA 4AOMA 4CIDA 1OMDA 4A4BA 1DVIA 4M2OA 3K21A 1OE9B 1C07A 3CGAA 5FI7A 2L4HA 1DF0B 2K0JA 1KQMC 4JQ0D 3R1PA 1HQVA 3SG2A 1EH2A 1OOHA 4YBHB 1KFUL 1DJGA 1MXLC 2IS9A 3UO9A 1CLBA 5HLVA 2NCPA 2KLDA 1AUIB 2M9GA 3FE8A 2QDIA 4XJKB 1D1OA 1DMOA 1G33A 3I5IC 4GNKB 3KEVA 1TNWA 2WCHA 5EL2A 3D77A 2EC6B 1SY9A 2MBXA 3AKAA 2P6BB 1GJYA 1CFCA 2WC8A 3GK4X 2KNEA 2LUXA 3CR2A 1Q80A 1TCFA 3JTDC 1J55A 3I5GC 1XFXO 3VB1A 2WCLA 1ZUZA 3WXAA 3RM1A 1SBJA 2MLFC 4OVNF 1AVSA 1M31A 2ERBA 2K8MB 2OPOA 1S1EA 1JC2A 1DJWA 1QXPA 5CSNA 2PALA 5ER5A 2WCMA 1OSAA 1V1GA 2HQWA 3H4SE 2D8NA 1CTRA 1EL4A 3TZ1A 2PASA 1M46A 1IG5A 2JPOA 4PDZA 2KQYA 1UHKA 2JC2A 3BUNB 2KI6D 3OX6A 3FE9A 5HL1A 1Z4HA 4YI9A 1AK8A 3IF7A 5I2QA 1KCYA 3IQOA 1NIWA 1SL8A 4HRHA 5JOLA 3VROA 4JD9A 3SS5A 2SASA 3PM8A 1J7OA 2LMVA 4GUKA 3NHIA 2KFGA 3WHTB 5I8NA 1IIOA 1SKTA 3OB1B 4NDBA 1PULA 3SG5A 1JFKA 2F33A 2HF5A 2KGRA 2LMUA 2M97A 3FWCA 4QJ5B 4ORCB 1DQEA 1OOFA 1DJXA 1UHNA 2MAZA 1BJFA 1BU3A 2LUCA 2PVBA 2BCAA 1LXFC 3AKBA 3CLNA 3EK4A 4YGCB 2BCBA 1SSEB 1YUTA 3I5HC 3QMEA 2F2OA 1SL9A 1ODBA 3L47A 4CPVA 5KU1A 2ZNEA 2EHBA 1C3ZA 1SNLA 1BODA 1L2OB 1NX0A 1SCMC 2K7BA 1BLQA 1F55A 4PE0A 1KWOC 3ICBA 5IBWA 2F2PA 2CTNA 3VRRA 1AP4A 1NUBA 1BF5A 1JSAA 4GPLB 2LAPA 4JWQA 1WRZA 2JQ6A 1EXRA 3DY9A 1RFJA 2ZNDA 3Q8IA 3A4UB 5I94A 1WY9A 2FOTA 1F8HA 1K2HA 2LMTA 1CKKA 1B7TY 1KK8B 2VRGA 4MZLA 2L2CA 1XK4C 4M2PA 5FYXA 1S36A 1KSOA 3FWBA 2KAXA 1CFPA 4U8DA 2LLSA 2BKIB 1Y1AA 4PE4A 3SS3A 2FJYA 1DC1A 1FPWA 2ZRTA 1A75B 2BL0B 2BAPA 2OTGB 1DELA 2K7DA 1G8IA 4INXA 4PCWA 1IGVA 1CLLA 2F3ZA 2KYFA 2PSRA 1SPYA 3EKJA 1E8AA 2LV7A 2ISDA 2JZIA 1WDCB 4MBEA 4PE7A 1KQVA 2JT8A 1XFVO 3OHMB 3D74A 1YRUB 1ZOTB
chains in the Genus database with same CATH topology
2K2FA 4N1FA 3BYAA 1B1GA 1YTZC 4WQ2A 1DGUA 1MHOA 2K7CA 2GGMA 5AEQA 3SG4A 5CPVA 4OCIA 3VRPA 2JXCA 3CR4X 1B7TZ 1K93D 2KQ6A 2KYCA 3PATA 2CBLA 1KFXL 2Q4UA 3WNXB 5AFPA 3D0YB 2AUCA 5CSJA 3EK7A 1SYMA 1U5IB 2COLB 2LM5A 1JWDA 1KK7Y 1QVIZ 2JU0A 2GV5A 3JVTC 1CFDA 3LL8B 2MHHA 2M49B 2FJUB 3NXAA 2BKHB 4ICBA 5GQQC 4WRIA 3ZNIA 3I5FB 2I18A 4MRXA 4CFRA 2LHIA 1QX7A 1MF8B 4DS7A 3D10A 2KI6C 2ZRSA 1IRJA 2PMYA 2CT9A 4ORBB 1H4BA 2E6WA 2LVKA 4I5JA 2JPTA 1CMGA 2JT3A 4E68A 1X02A 1BT6A 3KO0A 5D69A 4DCKA 2KI4C 4PHNA 4NQGA 1XYDA 2KAYA 2QACA 5CSIA 1PVAA 2ZKMX 1CFFA 4N1GA 2I7AA 1G4YR 1Y6WA 3I5HB 1JF0A 1B8LA 1R6PA 1XO5A 1DJHA 3SG3A 4MEWA 1XFUO 2M8UA 1XFZO 3EK8A 2B1UA 2WNDA 1J7RA 4ZCVA 1UHHA 1CDMA 4GAOA 2WCBA 3CR5X 1DJIA 1W7IB 4DRWA 1NYAA 3KPXA 4YI8A 1QASA 2JT0A 3OB2B 3RLZA 1J7QA 3EVUA 2EGDA 3O6BA 1NP8A 4NDDA 1XA5A 3BOWA 3EKHA 3OP0A 4D1EA 2MLEC 4FTGA 1OOJA 2BE6A 4XYNA 1SK6D 2V53A 3TDUA 3BQ3A 1KFUS 2M1KB 3A8RA 3DVMA 4GFTA 1S6IA 1YR5A 1UWOA 4QJ4B 1WRLA 2M7LA 1RTP1 1AJ4A 2KDHA 3TS5C 4IL1A 1QIVA 1ZACA 2FCDA 3DF0A 4WQ3A 2ZFDA 2FCEA 1ZFSA 4MRYA 5I2LA 1JUOA 4BY4A 1N2DA 2E30A 1SR6B 1NX1A 1WLMA 2OS8B 4I5LB 4ORAB 2JTTA 2L51A 1EG4A 1LINA 3PN7B 3M0WA 4YGAA 4C0JA 2NCOA 2KGBC 2ZN9A 1CM1A 3SIBA 3EVRA 3VRQA 1DT7B 1CDPA 1UHIA 2M29A 5ER4X 2BBMA 2CXJA 2LVIA 3DD4A 1K95A 4MZJA 1SW8A 4DUQA 2JNXA 2M0RA 1JBAA 1S6JA 4CFQA 1UURA 2NZ0A 3NSOA 3PALA 1PVBA 4CLNA 1XVJA 1UHJA 4N5XA 2LP3A 4NDCA 5TNCA 1B9AA 1IQ5A 1K96A 3QRXA 1K90D 2EC6C 2L50A 5DKQA 1KQMB 3KF9A 2CCMA 1IKUA 1TNQA 1TIZA 5AANA 2JOJA 2L0PA 1MXEA 2GGZA 2LANA 1QJTA 1NSHA 1TRFA 1B47A 1PK0D 1EJ3A 3LLEA 3I5IB 4USLA 3VRNA 1XK4A 4UPGA 1QV1A 3NSIA 5PALA 1V1FA 2M1UA 1DJYA 1ZMZA 1CM4A 3PLFB 4Q04A 5JJGA 1IJ6A 3MSEB 1SL7A 2HPSA 4MLWA 2F8PA 1H8BA 1DGVA 3LK0A 4MN0A 1QTXA 2QPTA 2KFHA 3CS1A 3JTDB 5I2OA 1YUUA 3I5GB 2M7NA 2LP2A 2LHLA 2MRDA 1CDNA 2LVVA 3BOWB 3IQQA 1TCOB 1IH0A 3EVVA 3WHUB 2LE9B 3FS7A 1AJ5A 1S26D 4R1EA 5F6TA 3AAJA 4A4CA 2K7OA 1M39A 1LVCD 4HSZA 1N65A 1ALWA 1YX8A 2L5XB 1PSBA 4MZKA 3DF0B 3DVEA 3C1VA 2G9BA 1UP5A 2LVJA 3HCMA 4C0KA 3TDIA 2HETA 2TN4A 3CWGA 1OZSA 3VGOA 4GGNA 1MWNA 1RJVA 2JXLA 3TUYC 2A4JA 1L2OC 5BPJA 3FIAA 3HX4A 1NX3A 2JTZA 4F0ZB 5AERA 1MQ1A 1CMFA 1WRKA 4HRGA 1YRTB 2NXQA 4HREE 1YX7A 3KHEA 1KK8C 1MUXA 2BCXA 3O78A 1N0YA 4MVFA 2O5GA 4PALA 1TNPA 3SJSA 1QX2A 1XFWO 2AMIA 3PFVA 1K8UA 1SCMB 1S3PA 1KFXS 3CZTX 1NPQA 1KWOB 1J1DA 2F3YA 4BY5A 3SIAA 5HLOA 2MJWB 1KK7Z 1FW4A 2BL0C 1PSRA 2SCPA 2OTGC 1IJ5A 3GK1A 4L9MA 1F71A 1IQ3A 4JPZB 1M45A 4GBAA 3BUMB 1DJZA 5DKNA 4PHMA 4ETOA 2H2KA 3SG6A 4PHJA 3NSKA 1QX5B 1WDCC 2L2EA 1S6CA 2BECA 1FI5A 1NCYA 1A75A 3BUXB 1GGZA 2I2RE 3DVJA 5DKRA 3AAKA 1A2XA 4DIRA 5J3XA 2R2IA 4OKHA 3ZWHA 1GQMA 1SRAA 1YUSA 1SCVA 1A03A 5KSZA 3O4YA 3SG7A 1K9UA 3BUWB 3TDZA 2JNFA 1F70A 1NX2A 5K89A 4P5OE 2BE4A 2L4IA 2M3WA 1J1EA 2K61A 1JF2A 1B8RA 2KBMA 1EG3A 3GK2A 2L98A 1A4PA 2CNPA 2MA2A 5KTYA 2AAOA 2WCFA 1UUSA 3LCPC 3E3RA 4P2YB 2RGIA 2KOTA 2KSPA 1LA0A 2ZN8A 1TNXA 2BBNA 2JWWA 2WORA 5HKYA 1S5GY 2O60A 4YGEB 5HKWA 1RK9A 1F4OA 1QATA 1YVLA 3D0YA 3I5FC 2G2BA 3LK1A 2JRFA 1QLSA 1FI6A 1U5IA 1FBVA 5AXIA 1IWQA 1CDLA 1YVHA 1CB1A 1DF0A 2KBIA 1Y0VH 2KFFA 2Y1NA 1HT9A 1FF1A 1AHRA 3JVTB 3F45A 1C7VA 4M2QA 4YGBB 1BOCA 2WCEA 1K9PA 1Y1XA 3OX5A 1BMOA 4OV2A 3O2PA 1LA3A 1SMGA 5HYDA 1QS7A 3BXKA 4XJKA 1VRKA 1A29A 4PE1A 3TUYB 1BR4B 1NCXA 4I5NB 4TNCA 5HKZA 1NCZA 1PRWA 1CNPA 1W7JB 1C7WA 1BG1A 1F4QA 4AQJA 5D7FA 2KHNA 4AQIA 1PALA 2LNKA 2KI4B 3PSRA 1Y1UA 3BUOB 2LLUA 3CTNA 1LKJA 1RWYA 1WLZA 4FQOA 1QLKA 2Y1MA 4QJ3B 1S5GZ 1OZOA 1K9KA 5B8IB 2I94A 1YURA 2JULA 1B8CA 4ZCUA 4PHKA 1M63B 2LCPA 2H61C 2KAVA 4I5KA 1NWDA 3GOFA 1BR1B 4YRUA 1GGWA 1QVIY 1L7ZA 1OMVA 1OMRA 5CSFA 1F54A 1QIWA 1QV0A 2Q91A 1KSMA 1TTXA 2Y5IA 2WOSA 4OR9B 1RROA 2H61A 3DVKA 4C0LA 1SR6C 1RECA 2OS8C 2LC5A 5G08A 4YGDB 2NLNA 1K94A 3PN7C 4GGFC 1J7PA 1OQPA 1B4CA 1TOPA 1ALVA 2PRUA 3TS5B 1R2UA 1DTLA 1TN4A 1CLMA 1XFYO 4GGFA 4MSPA 1JFJA 2Y4QA 1MR8A 2DOQA 2K2AA 2LLTA 2HQ8A 3NSLA 4AOMA 4CIDA 1OMDA 4A4BA 1DVIA 4M2OA 3K21A 1OE9B 1C07A 3CGAA 2L4HA 1DF0B 2K0JA 1KQMC 4JQ0D 1HQVA 3SG2A 1EH2A 4YBHB 1KFUL 1DJGA 1MXLC 2IS9A 1CLBA 5HLVA 2NCPA 1AUIB 2M9GA 4XJKB 1D1OA 1DMOA 1G33A 3I5IC 4GNKB 3KEVA 1TNWA 2EC6B 1SY9A 2MBXA 3AKAA 2P6BB 1GJYA 1CFCA 2WC8A 3GK4X 2KNEA 2LUXA 3CR2A 1Q80A 1TCFA 3JTDC 1J55A 3I5GC 1XFXO 1ZUZA 3WXAA 3RM1A 1SBJA 2MLFC 4OVNF 1AVSA 1M31A 1JC2A 2K8MB 2OPOA 1S1EA 1DJWA 1QXPA 5CSNA 2PALA 5ER5A 1OSAA 1V1GA 2HQWA 3H4SE 2D8NA 1CTRA 1EL4A 3TZ1A 2PASA 1M46A 1IG5A 4PDZA 2KQYA 1UHKA 2JC2A 3BUNB 2KI6D 3OX6A 4YI9A 1AK8A 3IF7A 5I2QA 1KCYA 3IQOA 1NIWA 1SL8A 4HRHA 5JOLA 3VROA 2SASA 3PM8A 1J7OA 2LMVA 4GUKA 5I8NA 2KFGA 3WHTB 1SKTA 3OB1B 4NDBA 1PULA 3SG5A 1JFKA 2F33A 2HF5A 2KGRA 2LMUA 2M97A 3FWCA 4QJ5B 4ORCB 1DJXA 1UHNA 2MAZA 1BJFA 1BU3A 2LUCA 2PVBA 2BCAA 1LXFC 3AKBA 3CLNA 3EK4A 4YGCB 2BCBA 1YUTA 3I5HC 2F2OA 1SL9A 1ODBA 4CPVA 5KU1A 2ZNEA 2EHBA 1SNLA 1BODA 1L2OB 1NX0A 1SCMC 2K7BA 1BLQA 1F55A 4PE0A 1KWOC 3ICBA 5IBWA 2F2PA 2CTNA 3VRRA 1AP4A 1NUBA 1BF5A 1JSAA 4GPLB 2LAPA 4JWQA 1WRZA 2JQ6A 1EXRA 1RFJA 2ZNDA 3A4UB 1WY9A 2FOTA 1F8HA 1K2HA 2LMTA 1CKKA 1B7TY 1KK8B 2VRGA 4MZLA 1XK4C 4M2PA 5FYXA 1S36A 1KSOA 3FWBA 2KAXA 1CFPA 4U8DA 2LLSA 2BKIB 1Y1AA 4PE4A 1FPWA 2ZRTA 1A75B 2BL0B 2OTGB 2K7DA 1G8IA 4PCWA 1IGVA 1CLLA 2F3ZA 2KYFA 2PSRA 1SPYA 3EKJA 1E8AA 2LV7A 2ISDA 2JZIA 1WDCB 4MBEA 4PE7A 1KQVA 2JT8A 1XFVO 3OHMB 1YRUB 1ZOTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K2F A;  4N1F A;  3BYA A;  1B1G A;  1YTZ C;  4WQ2 A;  1DGU A;  1MHO A;  2K7C A;  2GGM A;  5AEQ A;  3SG4 A;  5CPV A;  4OCI A;  3VRP A;  2JXC A;  3CR4 X;  1B7T Z;  1K93 D;  2KQ6 A;  2KYC A;  3PAT A;  2CBL A;  1KFX L;  2Q4U A;  3WNX B;  5AFP A;  3D0Y B;  2AUC A;  5CSJ A;  3EK7 A;  1SYM A;  1U5I B;  2COL B;  2LM5 A;  1JWD A;  1KK7 Y;  1QVI Z;  2JU0 A;  2GV5 A;  3JVT C;  1CFD A;  3LL8 B;  2MHH A;  2M49 B;  2FJU B;  3NXA A;  2BKH B;  4ICB A;  5GQQ C;  4WRI A;  3ZNI A;  3I5F B;  2I18 A;  4MRX A;  4CFR A;  2LHI A;  1QX7 A;  1MF8 B;  4DS7 A;  3D10 A;  2KI6 C;  2ZRS A;  1IRJ A;  2PMY A;  2CT9 A;  4ORB B;  1H4B A;  2E6W A;  2LVK A;  4I5J A;  2JPT A;  1CMG A;  2JT3 A;  4E68 A;  1X02 A;  1BT6 A;  3KO0 A;  5D69 A;  4DCK A;  2KI4 C;  4PHN A;  4NQG A;  1XYD A;  2KAY A;  2QAC A;  5CSI A;  1PVA A;  2ZKM X;  1CFF A;  4N1G A;  2I7A A;  1G4Y R;  1Y6W A;  3I5H B;  1JF0 A;  1B8L A;  1R6P A;  1XO5 A;  1DJH A;  3SG3 A;  4MEW A;  1XFU O;  2M8U A;  1XFZ O;  3EK8 A;  2B1U A;  2WND A;  1J7R A;  4ZCV A;  1UHH A;  1CDM A;  4GAO A;  2WCB A;  3CR5 X;  1DJI A;  1W7I B;  4DRW A;  1NYA A;  3KPX A;  4YI8 A;  1QAS A;  2JT0 A;  3OB2 B;  3RLZ A;  1J7Q A;  3EVU A;  2EGD A;  3O6B A;  1NP8 A;  4NDD A;  1XA5 A;  3BOW A;  3EKH A;  3OP0 A;  4D1E A;  2MLE C;  4FTG A;  1OOJ A;  2BE6 A;  4XYN A;  1SK6 D;  2V53 A;  3TDU A;  3BQ3 A;  1KFU S;  2M1K B;  3A8R A;  3DVM A;  4GFT A;  1S6I A;  1YR5 A;  1UWO A;  4QJ4 B;  1WRL A;  2M7L A;  1RTP 1;  1AJ4 A;  2KDH A;  3TS5 C;  4IL1 A;  1QIV A;  1ZAC A;  2FCD A;  3DF0 A;  4WQ3 A;  2ZFD A;  2FCE A;  1ZFS A;  4MRY A;  5I2L A;  1JUO A;  4BY4 A;  1N2D A;  2E30 A;  1SR6 B;  1NX1 A;  1WLM A;  2OS8 B;  4I5L B;  4ORA B;  2JTT A;  2L51 A;  1EG4 A;  1LIN A;  3PN7 B;  3M0W A;  4YGA A;  4C0J A;  2NCO A;  2KGB C;  2ZN9 A;  1CM1 A;  3SIB A;  3EVR A;  3VRQ A;  1DT7 B;  1CDP A;  1UHI A;  2M29 A;  5ER4 X;  2BBM A;  2CXJ A;  2LVI A;  3DD4 A;  1K95 A;  4MZJ A;  1SW8 A;  4DUQ A;  2JNX A;  2M0R A;  1JBA A;  1S6J A;  4CFQ A;  1UUR A;  2NZ0 A;  3NSO A;  3PAL A;  1PVB A;  4CLN A;  1XVJ A;  1UHJ A;  4N5X A;  2LP3 A;  4NDC A;  5TNC A;  1B9A A;  1IQ5 A;  1K96 A;  3QRX A;  1K90 D;  2EC6 C;  2L50 A;  5DKQ A;  1KQM B;  3KF9 A;  2CCM A;  1IKU A;  1TNQ A;  1TIZ A;  5AAN A;  2JOJ A;  2L0P A;  1MXE A;  2GGZ A;  2LAN A;  1QJT A;  1NSH A;  1TRF A;  1B47 A;  1PK0 D;  1EJ3 A;  3LLE A;  3I5I B;  4USL A;  3VRN A;  1XK4 A;  4UPG A;  1QV1 A;  3NSI A;  5PAL A;  1V1F A;  2M1U A;  1DJY A;  1ZMZ A;  1CM4 A;  3PLF B;  4Q04 A;  5JJG A;  1IJ6 A;  3MSE B;  1SL7 A;  2HPS A;  4MLW A;  2F8P A;  1H8B A;  1DGV A;  3LK0 A;  4MN0 A;  1QTX A;  2QPT A;  2KFH A;  3CS1 A;  3JTD B;  5I2O A;  1YUU A;  3I5G B;  2M7N A;  2LP2 A;  2LHL A;  2MRD A;  1CDN A;  2LVV A;  3BOW B;  3IQQ A;  1TCO B;  1IH0 A;  3EVV A;  3WHU B;  2LE9 B;  3FS7 A;  1AJ5 A;  1S26 D;  4R1E A;  5F6T A;  3AAJ A;  4A4C A;  2K7O A;  1M39 A;  1LVC D;  4HSZ A;  1N65 A;  1ALW A;  1YX8 A;  2L5X B;  1PSB A;  4MZK A;  3DF0 B;  3DVE A;  3C1V A;  2G9B A;  1UP5 A;  2LVJ A;  3HCM A;  4C0K A;  3TDI A;  2HET A;  2TN4 A;  3CWG A;  1OZS A;  3VGO A;  4GGN A;  1MWN A;  1RJV A;  2JXL A;  3TUY C;  2A4J A;  1L2O C;  5BPJ A;  3FIA A;  3HX4 A;  1NX3 A;  2JTZ A;  4F0Z B;  5AER A;  1MQ1 A;  1CMF A;  1WRK A;  4HRG A;  1YRT B;  2NXQ A;  4HRE E;  1YX7 A;  3KHE A;  1KK8 C;  1MUX A;  2BCX A;  3O78 A;  1N0Y A;  4MVF A;  2O5G A;  4PAL A;  1TNP A;  3SJS A;  1QX2 A;  1XFW O;  2AMI A;  3PFV A;  1K8U A;  1SCM B;  1S3P A;  1KFX S;  3CZT X;  1NPQ A;  1KWO B;  1J1D A;  2F3Y A;  4BY5 A;  3SIA A;  5HLO A;  2MJW B;  1KK7 Z;  1FW4 A;  2BL0 C;  1PSR A;  2SCP A;  2OTG C;  1IJ5 A;  3GK1 A;  4L9M A;  1F71 A;  1IQ3 A;  4JPZ B;  1M45 A;  4GBA A;  3BUM B;  1DJZ A;  5DKN A;  4PHM A;  4ETO A;  2H2K A;  3SG6 A;  4PHJ A;  3NSK A;  1QX5 B;  1WDC C;  2L2E A;  1S6C A;  2BEC A;  1FI5 A;  1NCY A;  1A75 A;  3BUX B;  1GGZ A;  2I2R E;  3DVJ A;  5DKR A;  3AAK A;  1A2X A;  4DIR A;  5J3X A;  2R2I A;  4OKH A;  3ZWH A;  1GQM A;  1SRA A;  1YUS A;  1SCV A;  1A03 A;  5KSZ A;  3O4Y A;  3SG7 A;  1K9U A;  3BUW B;  3TDZ A;  2JNF A;  1F70 A;  1NX2 A;  5K89 A;  4P5O E;  2BE4 A;  2L4I A;  2M3W A;  1J1E A;  2K61 A;  1JF2 A;  1B8R A;  2KBM A;  1EG3 A;  3GK2 A;  2L98 A;  1A4P A;  2CNP A;  2MA2 A;  5KTY A;  2AAO A;  2WCF A;  1UUS A;  3LCP C;  3E3R A;  4P2Y B;  2RGI A;  2KOT A;  2KSP A;  1LA0 A;  2ZN8 A;  1TNX A;  2BBN A;  2JWW A;  2WOR A;  5HKY A;  1S5G Y;  2O60 A;  4YGE B;  5HKW A;  1RK9 A;  1F4O A;  1QAT A;  1YVL A;  3D0Y A;  3I5F C;  2G2B A;  3LK1 A;  2JRF A;  1QLS A;  1FI6 A;  1U5I A;  1FBV A;  5AXI A;  1IWQ A;  1CDL A;  1YVH A;  1CB1 A;  1DF0 A;  2KBI A;  1Y0V H;  2KFF A;  2Y1N A;  1HT9 A;  1FF1 A;  1AHR A;  3JVT B;  3F45 A;  1C7V A;  4M2Q A;  4YGB B;  1BOC A;  2WCE A;  1K9P A;  1Y1X A;  3OX5 A;  1BMO A;  4OV2 A;  3O2P A;  1LA3 A;  1SMG A;  5HYD A;  1QS7 A;  3BXK A;  4XJK A;  1VRK A;  1A29 A;  4PE1 A;  3TUY B;  1BR4 B;  1NCX A;  4I5N B;  4TNC A;  5HKZ A;  1NCZ A;  1PRW A;  1CNP A;  1W7J B;  1C7W A;  1BG1 A;  1F4Q A;  4AQJ A;  5D7F A;  2KHN A;  4AQI A;  1PAL A;  2LNK A;  2KI4 B;  3PSR A;  1Y1U A;  3BUO B;  2LLU A;  3CTN A;  1LKJ A;  1RWY A;  1WLZ A;  4FQO A;  1QLK A;  2Y1M A;  4QJ3 B;  1S5G Z;  1OZO A;  1K9K A;  5B8I B;  2I94 A;  1YUR A;  2JUL A;  1B8C A;  4ZCU A;  4PHK A;  1M63 B;  2LCP A;  2H61 C;  2KAV A;  4I5K A;  1NWD A;  3GOF A;  1BR1 B;  4YRU A;  1GGW A;  1QVI Y;  1L7Z A;  1OMV A;  1OMR A;  5CSF A;  1F54 A;  1QIW A;  1QV0 A;  2Q91 A;  1KSM A;  1TTX A;  2Y5I A;  2WOS A;  4OR9 B;  1RRO A;  2H61 A;  3DVK A;  4C0L A;  1SR6 C;  1REC A;  2OS8 C;  2LC5 A;  5G08 A;  4YGD B;  2NLN A;  1K94 A;  3PN7 C;  4GGF C;  1J7P A;  1OQP A;  1B4C A;  1TOP A;  1ALV A;  2PRU A;  3TS5 B;  1R2U A;  1DTL A;  1TN4 A;  1CLM A;  1XFY O;  4GGF A;  4MSP A;  1JFJ A;  2Y4Q A;  1MR8 A;  2DOQ A;  2K2A A;  2LLT A;  2HQ8 A;  3NSL A;  4AOM A;  4CID A;  1OMD A;  4A4B A;  1DVI A;  4M2O A;  3K21 A;  1OE9 B;  1C07 A;  3CGA A;  2L4H A;  1DF0 B;  2K0J A;  1KQM C;  4JQ0 D;  1HQV A;  3SG2 A;  1EH2 A;  4YBH B;  1KFU L;  1DJG A;  1MXL C;  2IS9 A;  1CLB A;  5HLV A;  2NCP A;  1AUI B;  2M9G A;  4XJK B;  1D1O A;  1DMO A;  1G33 A;  3I5I C;  4GNK B;  3KEV A;  1TNW A;  2EC6 B;  1SY9 A;  2MBX A;  3AKA A;  2P6B B;  1GJY A;  1CFC A;  2WC8 A;  3GK4 X;  2KNE A;  2LUX A;  3CR2 A;  1Q80 A;  1TCF A;  3JTD C;  1J55 A;  3I5G C;  1XFX O;  1ZUZ A;  3WXA A;  3RM1 A;  1SBJ A;  2MLF C;  4OVN F;  1AVS A;  1M31 A;  1JC2 A;  2K8M B;  2OPO A;  1S1E A;  1DJW A;  1QXP A;  5CSN A;  2PAL A;  5ER5 A;  1OSA A;  1V1G A;  2HQW A;  3H4S E;  2D8N A;  1CTR A;  1EL4 A;  3TZ1 A;  2PAS A;  1M46 A;  1IG5 A;  4PDZ A;  2KQY A;  1UHK A;  2JC2 A;  3BUN B;  2KI6 D;  3OX6 A;  4YI9 A;  1AK8 A;  3IF7 A;  5I2Q A;  1KCY A;  3IQO A;  1NIW A;  1SL8 A;  4HRH A;  5JOL A;  3VRO A;  2SAS A;  3PM8 A;  1J7O A;  2LMV A;  4GUK A;  5I8N A;  2KFG A;  3WHT B;  1SKT A;  3OB1 B;  4NDB A;  1PUL A;  3SG5 A;  1JFK A;  2F33 A;  2HF5 A;  2KGR A;  2LMU A;  2M97 A;  3FWC A;  4QJ5 B;  4ORC B;  1DJX A;  1UHN A;  2MAZ A;  1BJF A;  1BU3 A;  2LUC A;  2PVB A;  2BCA A;  1LXF C;  3AKB A;  3CLN A;  3EK4 A;  4YGC B;  2BCB A;  1YUT A;  3I5H C;  2F2O A;  1SL9 A;  1ODB A;  4CPV A;  5KU1 A;  2ZNE A;  2EHB A;  1SNL A;  1BOD A;  1L2O B;  1NX0 A;  1SCM C;  2K7B A;  1BLQ A;  1F55 A;  4PE0 A;  1KWO C;  3ICB A;  5IBW A;  2F2P A;  2CTN A;  3VRR A;  1AP4 A;  1NUB A;  1BF5 A;  1JSA A;  4GPL B;  2LAP A;  4JWQ A;  1WRZ A;  2JQ6 A;  1EXR A;  1RFJ A;  2ZND A;  3A4U B;  1WY9 A;  2FOT A;  1F8H A;  1K2H A;  2LMT A;  1CKK A;  1B7T Y;  1KK8 B;  2VRG A;  4MZL A;  1XK4 C;  4M2P A;  5FYX A;  1S36 A;  1KSO A;  3FWB A;  2KAX A;  1CFP A;  4U8D A;  2LLS A;  2BKI B;  1Y1A A;  4PE4 A;  1FPW A;  2ZRT A;  1A75 B;  2BL0 B;  2OTG B;  2K7D A;  1G8I A;  4PCW A;  1IGV A;  1CLL A;  2F3Z A;  2KYF A;  2PSR A;  1SPY A;  3EKJ A;  1E8A A;  2LV7 A;  2ISD A;  2JZI A;  1WDC B;  4MBE A;  4PE7 A;  1KQV A;  2JT8 A;  1XFV O;  3OHM B;  1YRU B;  1ZOT B; 
#chains in the Genus database with same CATH topology
 2K2F A;  4N1F A;  3D75 A;  3BYA A;  1B1G A;  1YTZ C;  4WQ2 A;  1DGU A;  1MHO A;  2K7C A;  2GGM A;  5AEQ A;  3SG4 A;  5CPV A;  4OCI A;  3VRP A;  2JXC A;  3CR4 X;  1B7T Z;  1K93 D;  2KQ6 A;  2KYC A;  3PAT A;  2CBL A;  1KFX L;  2Q4U A;  5I2L A;  3WNX B;  5AFP A;  3D0Y B;  2AUC A;  3B87 A;  5CSJ A;  3EK7 A;  1SYM A;  1U5I B;  2COL B;  2LM5 A;  1JWD A;  1KK7 Y;  1QVI Z;  2JU0 A;  3DZT A;  2GV5 A;  3JVT C;  2PQL A;  1CFD A;  3LL8 B;  2MHH A;  2M49 B;  2FJU B;  3NXA A;  2BKH B;  4ICB A;  5GQQ C;  4WRI A;  5FI2 A;  3I5F B;  3ZNI A;  2I18 A;  4MRX A;  4CFR A;  2LHI A;  1QX7 A;  1MF8 B;  4DS7 A;  4F7F A;  3D10 A;  2KI6 C;  2ZRS A;  1IRJ A;  2PMY A;  2CT9 A;  4ORB B;  1H4B A;  2WCK A;  2E6W A;  2LVK A;  4I5J A;  2JPT A;  1CMG A;  2JT3 A;  4E68 A;  1X02 A;  1BT6 A;  3KO0 A;  5D69 A;  4DCK A;  2KI4 C;  4PHN A;  4NQG A;  1XYD A;  2KAY A;  2QAC A;  5CSI A;  1PVA A;  2ZKM X;  1CFF A;  4N1G A;  2I7A A;  1G4Y R;  1Y6W A;  3I5H B;  1JF0 A;  1B8L A;  1R6P A;  1XO5 A;  1DJH A;  3SG3 A;  4MEW A;  5FI6 A;  1XFU O;  2M8U A;  1XFZ O;  2BNX A;  3EK8 A;  2B1U A;  2WND A;  1J7R A;  4ZCV A;  1UHH A;  1CDM A;  4GAO A;  2WCB A;  3CR5 X;  1DJI A;  1W7I B;  4DRW A;  1NYA A;  3R72 A;  3KPX A;  4YI8 A;  1QAS A;  2JT0 A;  3OB2 B;  3RLZ A;  1J7Q A;  3EVU A;  2EGD A;  3O6B A;  1NP8 A;  4NDD A;  1XA5 A;  3BOW A;  3EKH A;  3OP0 A;  4D1E A;  2MLE C;  4FTG A;  1OOJ A;  2BE6 A;  3UNW A;  4XYN A;  1SK6 D;  2V53 A;  3TDU A;  3BQ3 A;  1KFU S;  2M1K B;  3A8R A;  3DVM A;  3CZ2 A;  1S6I A;  4GFT A;  1YR5 A;  5DIC A;  1UWO A;  4QJ4 B;  1WRL A;  1P28 A;  2M7L A;  1RTP 1;  1AJ4 A;  2KDH A;  3TS5 C;  4IL1 A;  1QIV A;  1ZAC A;  2FCD A;  2WCJ A;  3DF0 A;  2ZFD A;  2FCE A;  1QWV A;  1ZFS A;  4MRY A;  1JUO A;  4WQ3 A;  1N2D A;  2E30 A;  1SR6 B;  4BY4 A;  1NX1 A;  1WLM A;  2OS8 B;  3PJI A;  4I5L B;  4ORA B;  2JTT A;  2L51 A;  1EG4 A;  1LIN A;  3PN7 B;  1W9Z A;  3M0W A;  4YGA A;  3S0G A;  4C0J A;  1T14 A;  2NCO A;  2KGB C;  2ZN9 A;  1CM1 A;  3SIB A;  3EVR A;  3VRQ A;  3S0F A;  1DT7 B;  1CDP A;  1UHI A;  2M29 A;  3B7A A;  5ER4 X;  2BBM A;  2CXJ A;  1TWO A;  2LVI A;  1K95 A;  3DD4 A;  1SW8 A;  4MZJ A;  2JNX A;  4DUQ A;  3CAB A;  2M0R A;  1JBA A;  1S6J A;  2WC6 A;  1UUR A;  4CFQ A;  2NZ0 A;  2K60 A;  3NSO A;  3PAL A;  1PVB A;  4CLN A;  1XVJ A;  1UHJ A;  4N5X A;  2LP3 A;  4NDC A;  5TNC A;  3BJH A;  1B9A A;  1IQ5 A;  1K96 A;  3QRX A;  1K90 D;  1TUZ A;  2EC6 C;  2L50 A;  5DKQ A;  1KQM B;  3KF9 A;  3L4A A;  2CCM A;  1IKU A;  1TNQ A;  3D73 A;  1TIZ A;  5AAN A;  2JOJ A;  2P71 A;  2L0P A;  1MXE A;  2GGZ A;  2LAN A;  1QJT A;  1NSH A;  1TRF A;  1B47 A;  1PK0 D;  1EJ3 A;  3LLE A;  3I5I B;  4USL A;  3VRN A;  1XK4 A;  4UPG A;  1QV1 A;  3NSI A;  5PAL A;  1V1F A;  2M1U A;  1DJY A;  1ZMZ A;  1CM4 A;  3PLF B;  4Q04 A;  5JJG A;  1IJ6 A;  3MSE B;  1SL7 A;  2HPS A;  4MLW A;  2F8P A;  1H8B A;  1DGV A;  1OOG A;  3LK0 A;  1QTX A;  2QPT A;  3B6X A;  4MN0 A;  2KFH A;  3CS1 A;  3JTD B;  5I2O A;  1YUU A;  3I5G B;  2M7N A;  2LP2 A;  2LHL A;  2MRD A;  2PYQ A;  3FE6 A;  1CDN A;  2LVV A;  3BOW B;  3CYZ A;  3IQQ A;  1TCO B;  2L5Y A;  1IH0 A;  3EVV A;  3WHU B;  2LE9 B;  3FS7 A;  3CDN A;  1AJ5 A;  2QEV A;  1S26 D;  4R1E A;  3S0E A;  5F6T A;  3N7H A;  3AAJ A;  1GM0 A;  4A4C A;  2K7O A;  1M39 A;  1LVC D;  4HSZ A;  1N65 A;  1ALW A;  1YX8 A;  2L5X B;  1PSB A;  4MZK A;  3DF0 B;  3DVE A;  3C1V A;  2G9B A;  4IJ7 A;  1UP5 A;  2LVJ A;  3HCM A;  3NGV A;  4C0K A;  3TDI A;  2HET A;  2TN4 A;  3CWG A;  3L4L A;  1OZS A;  3VGO A;  4GGN A;  1MWN A;  3V2L A;  1RJV A;  2JXL A;  3DXL A;  3TUY C;  2A4J A;  3CZ0 A;  1L2O C;  3K1E A;  5BPJ A;  3FIA A;  3HX4 A;  3NHT A;  1NX3 A;  2JTZ A;  4F0Z B;  5AER A;  1MQ1 A;  1CMF A;  1WRK A;  4HRG A;  4KYN A;  3D76 A;  1DEK A;  1YRT B;  2NXQ A;  4HRE E;  3R1V A;  1YX7 A;  3KHE A;  1KK8 C;  1MUX A;  2BCX A;  3O78 A;  1N0Y A;  4MVF A;  2O5G A;  1ORG A;  1TNP A;  4PAL A;  1QX2 A;  1XFW O;  3SJS A;  1TUJ A;  2AMI A;  3PFV A;  1K8U A;  1SCM B;  1S3P A;  1KFX S;  2QEH A;  2YGU A;  1NPQ A;  1KWO B;  1J1D A;  2F3Y A;  3CZT X;  3SIA A;  4BY5 A;  1C3Y A;  5HLO A;  2MJW B;  1XFR A;  1KK7 Z;  1FW4 A;  2BL0 C;  1PSR A;  2SCP A;  2OTG C;  1IJ5 A;  3GK1 A;  4L9M A;  1F71 A;  3S0A A;  1IQ3 A;  4INW A;  1M45 A;  4GBA A;  4JPZ B;  3BUM B;  1DJZ A;  3OBV A;  5DKN A;  4PHM A;  4ETO A;  2H2K A;  2KPH A;  4PHJ A;  3SG6 A;  3NSK A;  1Z2C B;  1QX5 B;  1WDC C;  2L2E A;  1S6C A;  2BEC A;  3B88 A;  1FI5 A;  1NCY A;  1A75 A;  3BUX B;  1LS8 A;  1GGZ A;  2I2R E;  3DVJ A;  5D3O A;  3AAK A;  1A2X A;  5DKR A;  5J3X A;  4DIR A;  2R2I A;  4OKH A;  3ZWH A;  1GQM A;  1SRA A;  1YUS A;  1SCV A;  4OZD A;  1A03 A;  5KSZ A;  3O4Y A;  3SG7 A;  1K9U A;  3BUW B;  3TDZ A;  3IVT A;  2JNF A;  1F70 A;  1NX2 A;  5K89 A;  4P5O E;  2BE4 A;  2L4I A;  2M3W A;  1J1E A;  2K61 A;  1JF2 A;  1B8R A;  2KBM A;  1EG3 A;  3GK2 A;  2L98 A;  3O4X A;  1A4P A;  3PM2 A;  2CNP A;  2MA2 A;  5KTY A;  2AAO A;  2WCF A;  1UUS A;  3LCP C;  3E3R A;  4P2Y B;  2RGI A;  2KOT A;  2KSP A;  1LA0 A;  2ZN8 A;  1TNX A;  2BBN A;  2JWW A;  2WOR A;  5HKY A;  1S5G Y;  2O60 A;  4YGE B;  3BFA A;  5HKW A;  1RK9 A;  1F4O A;  1OW4 A;  1QAT A;  1YVL A;  3D0Y A;  3I5F C;  2G2B A;  3LK1 A;  2JRF A;  1QLS A;  1FI6 A;  1U5I A;  1FBV A;  5AXI A;  3RZS A;  1IWQ A;  1CDL A;  1YVH A;  1CB1 A;  2QEB A;  1DF0 A;  2KBI A;  1Y0V H;  2KFF A;  2Y1N A;  1HT9 A;  1FF1 A;  1AHR A;  3JVT B;  3F45 A;  1C7V A;  4M2Q A;  4YGB B;  1BOC A;  2WCE A;  1K9P A;  1Y1X A;  3OX5 A;  1BMO A;  4OV2 A;  3O2P A;  1LA3 A;  1SMG A;  5HYD A;  1QS7 A;  3BFB A;  3BXK A;  4XJK A;  1VRK A;  1A29 A;  2QEO A;  3BFH A;  4PE1 A;  3TUY B;  1BR4 B;  1NCX A;  4I5N B;  4TNC A;  5HKZ A;  1NCZ A;  1PRW A;  4PT1 A;  1CNP A;  1W7J B;  1C7W A;  1BG1 A;  1F4Q A;  3SS4 A;  4AQJ A;  5D7F A;  2KHN A;  4AQI A;  1PAL A;  2LNK A;  2KI4 B;  3PSR A;  1Y1U A;  3BUO B;  3S0D A;  2LLU A;  3CTN A;  3B86 A;  1LKJ A;  1RWY A;  1WLZ A;  4FQO A;  1QLK A;  2Y1M A;  4QJ3 B;  1S5G Z;  3CZ1 A;  3D78 A;  3DYE A;  1OZO A;  1K9K A;  5B8I B;  2GTE A;  2I94 A;  1YUR A;  2JUL A;  1B8C A;  4ZCU A;  4FQT A;  4PHK A;  1M63 B;  2LCP A;  2H61 C;  2KAV A;  4I5K A;  4JKT A;  1NWD A;  3GOF A;  1BR1 B;  4YRU A;  1GGW A;  1QVI Y;  1L7Z A;  1OMV A;  1OMR A;  5CSF A;  1F54 A;  1QIW A;  1QV0 A;  2Q91 A;  1KSM A;  1TTX A;  2WC5 A;  2Y5I A;  2WOS A;  3EG5 B;  1OOI X;  4OR9 B;  1RRO A;  2H61 A;  2H8V A;  3DVK A;  4C0L A;  1SR6 C;  1REC A;  2OS8 C;  2LC5 A;  2P70 A;  5G08 A;  4YGD B;  2NLN A;  1K94 A;  3PN7 C;  4GGF C;  1J7P A;  1OQP A;  1B4C A;  1TOP A;  1ALV A;  2PRU A;  3R1O A;  3TS5 B;  1R2U A;  1DTL A;  1TN4 A;  1CLM A;  1XFY O;  4GGF A;  4MSP A;  1JFJ A;  2Y4Q A;  1MR8 A;  2DOQ A;  3OGN A;  2K2A A;  2LLT A;  2HQ8 A;  2KLE A;  3NSL A;  3S0B A;  4AOM A;  4CID A;  1OMD A;  4A4B A;  1DVI A;  4M2O A;  3K21 A;  1OE9 B;  1C07 A;  3CGA A;  5FI7 A;  2L4H A;  1DF0 B;  2K0J A;  1KQM C;  4JQ0 D;  3R1P A;  1HQV A;  3SG2 A;  1EH2 A;  1OOH A;  4YBH B;  1KFU L;  1DJG A;  1MXL C;  2IS9 A;  3UO9 A;  1CLB A;  5HLV A;  2NCP A;  2KLD A;  1AUI B;  2M9G A;  3FE8 A;  2QDI A;  4XJK B;  1D1O A;  1DMO A;  1G33 A;  3I5I C;  4GNK B;  3KEV A;  1TNW A;  2WCH A;  5EL2 A;  3D77 A;  2EC6 B;  1SY9 A;  2MBX A;  3AKA A;  2P6B B;  1GJY A;  1CFC A;  2WC8 A;  3GK4 X;  2KNE A;  2LUX A;  3CR2 A;  1Q80 A;  1TCF A;  3JTD C;  1J55 A;  3I5G C;  1XFX O;  3VB1 A;  2WCL A;  1ZUZ A;  3WXA A;  3RM1 A;  1SBJ A;  2MLF C;  4OVN F;  1AVS A;  1M31 A;  2ERB A;  2K8M B;  2OPO A;  1S1E A;  1JC2 A;  1DJW A;  1QXP A;  5CSN A;  2PAL A;  5ER5 A;  2WCM A;  1OSA A;  1V1G A;  2HQW A;  3H4S E;  2D8N A;  1CTR A;  1EL4 A;  3TZ1 A;  2PAS A;  1M46 A;  1IG5 A;  2JPO A;  4PDZ A;  2KQY A;  1UHK A;  2JC2 A;  3BUN B;  2KI6 D;  3OX6 A;  3FE9 A;  5HL1 A;  1Z4H A;  4YI9 A;  1AK8 A;  3IF7 A;  5I2Q A;  1KCY A;  3IQO A;  1NIW A;  1SL8 A;  4HRH A;  5JOL A;  3VRO A;  4JD9 A;  3SS5 A;  2SAS A;  3PM8 A;  1J7O A;  2LMV A;  4GUK A;  3NHI A;  2KFG A;  3WHT B;  5I8N A;  1IIO A;  1SKT A;  3OB1 B;  4NDB A;  1PUL A;  3SG5 A;  1JFK A;  2F33 A;  2HF5 A;  2KGR A;  2LMU A;  2M97 A;  3FWC A;  4QJ5 B;  4ORC B;  1DQE A;  1OOF A;  1DJX A;  1UHN A;  2MAZ A;  1BJF A;  1BU3 A;  2LUC A;  2PVB A;  2BCA A;  1LXF C;  3AKB A;  3CLN A;  3EK4 A;  4YGC B;  2BCB A;  1SSE B;  1YUT A;  3I5H C;  3QME A;  2F2O A;  1SL9 A;  1ODB A;  3L47 A;  4CPV A;  5KU1 A;  2ZNE A;  2EHB A;  1C3Z A;  1SNL A;  1BOD A;  1L2O B;  1NX0 A;  1SCM C;  2K7B A;  1BLQ A;  1F55 A;  4PE0 A;  1KWO C;  3ICB A;  5IBW A;  2F2P A;  2CTN A;  3VRR A;  1AP4 A;  1NUB A;  1BF5 A;  1JSA A;  4GPL B;  2LAP A;  4JWQ A;  1WRZ A;  2JQ6 A;  1EXR A;  3DY9 A;  1RFJ A;  2ZND A;  3Q8I A;  3A4U B;  5I94 A;  1WY9 A;  2FOT A;  1F8H A;  1K2H A;  2LMT A;  1CKK A;  1B7T Y;  1KK8 B;  2VRG A;  4MZL A;  2L2C A;  1XK4 C;  4M2P A;  5FYX A;  1S36 A;  1KSO A;  3FWB A;  2KAX A;  1CFP A;  4U8D A;  2LLS A;  2BKI B;  1Y1A A;  4PE4 A;  3SS3 A;  2FJY A;  1DC1 A;  1FPW A;  2ZRT A;  1A75 B;  2BL0 B;  2BAP A;  2OTG B;  1DEL A;  2K7D A;  1G8I A;  4INX A;  4PCW A;  1IGV A;  1CLL A;  2F3Z A;  2KYF A;  2PSR A;  1SPY A;  3EKJ A;  1E8A A;  2LV7 A;  2ISD A;  2JZI A;  1WDC B;  4MBE A;  4PE7 A;  1KQV A;  2JT8 A;  1XFV O;  3OHM B;  3D74 A;  1YRU B;  1ZOT B; 
#chains in the Genus database with same CATH homology
 2K2F A;  4N1F A;  3BYA A;  1B1G A;  1YTZ C;  4WQ2 A;  1DGU A;  1MHO A;  2K7C A;  2GGM A;  5AEQ A;  3SG4 A;  5CPV A;  4OCI A;  3VRP A;  2JXC A;  3CR4 X;  1B7T Z;  1K93 D;  2KQ6 A;  2KYC A;  3PAT A;  2CBL A;  1KFX L;  2Q4U A;  3WNX B;  5AFP A;  3D0Y B;  2AUC A;  5CSJ A;  3EK7 A;  1SYM A;  1U5I B;  2COL B;  2LM5 A;  1JWD A;  1KK7 Y;  1QVI Z;  2JU0 A;  2GV5 A;  3JVT C;  1CFD A;  3LL8 B;  2MHH A;  2M49 B;  2FJU B;  3NXA A;  2BKH B;  4ICB A;  5GQQ C;  4WRI A;  3ZNI A;  3I5F B;  2I18 A;  4MRX A;  4CFR A;  2LHI A;  1QX7 A;  1MF8 B;  4DS7 A;  3D10 A;  2KI6 C;  2ZRS A;  1IRJ A;  2PMY A;  2CT9 A;  4ORB B;  1H4B A;  2E6W A;  2LVK A;  4I5J A;  2JPT A;  1CMG A;  2JT3 A;  4E68 A;  1X02 A;  1BT6 A;  3KO0 A;  5D69 A;  4DCK A;  2KI4 C;  4PHN A;  4NQG A;  1XYD A;  2KAY A;  2QAC A;  5CSI A;  1PVA A;  2ZKM X;  1CFF A;  4N1G A;  2I7A A;  1G4Y R;  1Y6W A;  3I5H B;  1JF0 A;  1B8L A;  1R6P A;  1XO5 A;  1DJH A;  3SG3 A;  4MEW A;  1XFU O;  2M8U A;  1XFZ O;  3EK8 A;  2B1U A;  2WND A;  1J7R A;  4ZCV A;  1UHH A;  1CDM A;  4GAO A;  2WCB A;  3CR5 X;  1DJI A;  1W7I B;  4DRW A;  1NYA A;  3KPX A;  4YI8 A;  1QAS A;  2JT0 A;  3OB2 B;  3RLZ A;  1J7Q A;  3EVU A;  2EGD A;  3O6B A;  1NP8 A;  4NDD A;  1XA5 A;  3BOW A;  3EKH A;  3OP0 A;  4D1E A;  2MLE C;  4FTG A;  1OOJ A;  2BE6 A;  4XYN A;  1SK6 D;  2V53 A;  3TDU A;  3BQ3 A;  1KFU S;  2M1K B;  3A8R A;  3DVM A;  4GFT A;  1S6I A;  1YR5 A;  1UWO A;  4QJ4 B;  1WRL A;  2M7L A;  1RTP 1;  1AJ4 A;  2KDH A;  3TS5 C;  4IL1 A;  1QIV A;  1ZAC A;  2FCD A;  3DF0 A;  4WQ3 A;  2ZFD A;  2FCE A;  1ZFS A;  4MRY A;  5I2L A;  1JUO A;  4BY4 A;  1N2D A;  2E30 A;  1SR6 B;  1NX1 A;  1WLM A;  2OS8 B;  4I5L B;  4ORA B;  2JTT A;  2L51 A;  1EG4 A;  1LIN A;  3PN7 B;  3M0W A;  4YGA A;  4C0J A;  2NCO A;  2KGB C;  2ZN9 A;  1CM1 A;  3SIB A;  3EVR A;  3VRQ A;  1DT7 B;  1CDP A;  1UHI A;  2M29 A;  5ER4 X;  2BBM A;  2CXJ A;  2LVI A;  3DD4 A;  1K95 A;  4MZJ A;  1SW8 A;  4DUQ A;  2JNX A;  2M0R A;  1JBA A;  1S6J A;  4CFQ A;  1UUR A;  2NZ0 A;  3NSO A;  3PAL A;  1PVB A;  4CLN A;  1XVJ A;  1UHJ A;  4N5X A;  2LP3 A;  4NDC A;  5TNC A;  1B9A A;  1IQ5 A;  1K96 A;  3QRX A;  1K90 D;  2EC6 C;  2L50 A;  5DKQ A;  1KQM B;  3KF9 A;  2CCM A;  1IKU A;  1TNQ A;  1TIZ A;  5AAN A;  2JOJ A;  2L0P A;  1MXE A;  2GGZ A;  2LAN A;  1QJT A;  1NSH A;  1TRF A;  1B47 A;  1PK0 D;  1EJ3 A;  3LLE A;  3I5I B;  4USL A;  3VRN A;  1XK4 A;  4UPG A;  1QV1 A;  3NSI A;  5PAL A;  1V1F A;  2M1U A;  1DJY A;  1ZMZ A;  1CM4 A;  3PLF B;  4Q04 A;  5JJG A;  1IJ6 A;  3MSE B;  1SL7 A;  2HPS A;  4MLW A;  2F8P A;  1H8B A;  1DGV A;  3LK0 A;  4MN0 A;  1QTX A;  2QPT A;  2KFH A;  3CS1 A;  3JTD B;  5I2O A;  1YUU A;  3I5G B;  2M7N A;  2LP2 A;  2LHL A;  2MRD A;  1CDN A;  2LVV A;  3BOW B;  3IQQ A;  1TCO B;  1IH0 A;  3EVV A;  3WHU B;  2LE9 B;  3FS7 A;  1AJ5 A;  1S26 D;  4R1E A;  5F6T A;  3AAJ A;  4A4C A;  2K7O A;  1M39 A;  1LVC D;  4HSZ A;  1N65 A;  1ALW A;  1YX8 A;  2L5X B;  1PSB A;  4MZK A;  3DF0 B;  3DVE A;  3C1V A;  2G9B A;  1UP5 A;  2LVJ A;  3HCM A;  4C0K A;  3TDI A;  2HET A;  2TN4 A;  3CWG A;  1OZS A;  3VGO A;  4GGN A;  1MWN A;  1RJV A;  2JXL A;  3TUY C;  2A4J A;  1L2O C;  5BPJ A;  3FIA A;  3HX4 A;  1NX3 A;  2JTZ A;  4F0Z B;  5AER A;  1MQ1 A;  1CMF A;  1WRK A;  4HRG A;  1YRT B;  2NXQ A;  4HRE E;  1YX7 A;  3KHE A;  1KK8 C;  1MUX A;  2BCX A;  3O78 A;  1N0Y A;  4MVF A;  2O5G A;  4PAL A;  1TNP A;  3SJS A;  1QX2 A;  1XFW O;  2AMI A;  3PFV A;  1K8U A;  1SCM B;  1S3P A;  1KFX S;  3CZT X;  1NPQ A;  1KWO B;  1J1D A;  2F3Y A;  4BY5 A;  3SIA A;  5HLO A;  2MJW B;  1KK7 Z;  1FW4 A;  2BL0 C;  1PSR A;  2SCP A;  2OTG C;  1IJ5 A;  3GK1 A;  4L9M A;  1F71 A;  1IQ3 A;  4JPZ B;  1M45 A;  4GBA A;  3BUM B;  1DJZ A;  5DKN A;  4PHM A;  4ETO A;  2H2K A;  3SG6 A;  4PHJ A;  3NSK A;  1QX5 B;  1WDC C;  2L2E A;  1S6C A;  2BEC A;  1FI5 A;  1NCY A;  1A75 A;  3BUX B;  1GGZ A;  2I2R E;  3DVJ A;  5DKR A;  3AAK A;  1A2X A;  4DIR A;  5J3X A;  2R2I A;  4OKH A;  3ZWH A;  1GQM A;  1SRA A;  1YUS A;  1SCV A;  1A03 A;  5KSZ A;  3O4Y A;  3SG7 A;  1K9U A;  3BUW B;  3TDZ A;  2JNF A;  1F70 A;  1NX2 A;  5K89 A;  4P5O E;  2BE4 A;  2L4I A;  2M3W A;  1J1E A;  2K61 A;  1JF2 A;  1B8R A;  2KBM A;  1EG3 A;  3GK2 A;  2L98 A;  1A4P A;  2CNP A;  2MA2 A;  5KTY A;  2AAO A;  2WCF A;  1UUS A;  3LCP C;  3E3R A;  4P2Y B;  2RGI A;  2KOT A;  2KSP A;  1LA0 A;  2ZN8 A;  1TNX A;  2BBN A;  2JWW A;  2WOR A;  5HKY A;  1S5G Y;  2O60 A;  4YGE B;  5HKW A;  1RK9 A;  1F4O A;  1QAT A;  1YVL A;  3D0Y A;  3I5F C;  2G2B A;  3LK1 A;  2JRF A;  1QLS A;  1FI6 A;  1U5I A;  1FBV A;  5AXI A;  1IWQ A;  1CDL A;  1YVH A;  1CB1 A;  1DF0 A;  2KBI A;  1Y0V H;  2KFF A;  2Y1N A;  1HT9 A;  1FF1 A;  1AHR A;  3JVT B;  3F45 A;  1C7V A;  4M2Q A;  4YGB B;  1BOC A;  2WCE A;  1K9P A;  1Y1X A;  3OX5 A;  1BMO A;  4OV2 A;  3O2P A;  1LA3 A;  1SMG A;  5HYD A;  1QS7 A;  3BXK A;  4XJK A;  1VRK A;  1A29 A;  4PE1 A;  3TUY B;  1BR4 B;  1NCX A;  4I5N B;  4TNC A;  5HKZ A;  1NCZ A;  1PRW A;  1CNP A;  1W7J B;  1C7W A;  1BG1 A;  1F4Q A;  4AQJ A;  5D7F A;  2KHN A;  4AQI A;  1PAL A;  2LNK A;  2KI4 B;  3PSR A;  1Y1U A;  3BUO B;  2LLU A;  3CTN A;  1LKJ A;  1RWY A;  1WLZ A;  4FQO A;  1QLK A;  2Y1M A;  4QJ3 B;  1S5G Z;  1OZO A;  1K9K A;  5B8I B;  2I94 A;  1YUR A;  2JUL A;  1B8C A;  4ZCU A;  4PHK A;  1M63 B;  2LCP A;  2H61 C;  2KAV A;  4I5K A;  1NWD A;  3GOF A;  1BR1 B;  4YRU A;  1GGW A;  1QVI Y;  1L7Z A;  1OMV A;  1OMR A;  5CSF A;  1F54 A;  1QIW A;  1QV0 A;  2Q91 A;  1KSM A;  1TTX A;  2Y5I A;  2WOS A;  4OR9 B;  1RRO A;  2H61 A;  3DVK A;  4C0L A;  1SR6 C;  1REC A;  2OS8 C;  2LC5 A;  5G08 A;  4YGD B;  2NLN A;  1K94 A;  3PN7 C;  4GGF C;  1J7P A;  1OQP A;  1B4C A;  1TOP A;  1ALV A;  2PRU A;  3TS5 B;  1R2U A;  1DTL A;  1TN4 A;  1CLM A;  1XFY O;  4GGF A;  4MSP A;  1JFJ A;  2Y4Q A;  1MR8 A;  2DOQ A;  2K2A A;  2LLT A;  2HQ8 A;  3NSL A;  4AOM A;  4CID A;  1OMD A;  4A4B A;  1DVI A;  4M2O A;  3K21 A;  1OE9 B;  1C07 A;  3CGA A;  2L4H A;  1DF0 B;  2K0J A;  1KQM C;  4JQ0 D;  1HQV A;  3SG2 A;  1EH2 A;  4YBH B;  1KFU L;  1DJG A;  1MXL C;  2IS9 A;  1CLB A;  5HLV A;  2NCP A;  1AUI B;  2M9G A;  4XJK B;  1D1O A;  1DMO A;  1G33 A;  3I5I C;  4GNK B;  3KEV A;  1TNW A;  2EC6 B;  1SY9 A;  2MBX A;  3AKA A;  2P6B B;  1GJY A;  1CFC A;  2WC8 A;  3GK4 X;  2KNE A;  2LUX A;  3CR2 A;  1Q80 A;  1TCF A;  3JTD C;  1J55 A;  3I5G C;  1XFX O;  1ZUZ A;  3WXA A;  3RM1 A;  1SBJ A;  2MLF C;  4OVN F;  1AVS A;  1M31 A;  1JC2 A;  2K8M B;  2OPO A;  1S1E A;  1DJW A;  1QXP A;  5CSN A;  2PAL A;  5ER5 A;  1OSA A;  1V1G A;  2HQW A;  3H4S E;  2D8N A;  1CTR A;  1EL4 A;  3TZ1 A;  2PAS A;  1M46 A;  1IG5 A;  4PDZ A;  2KQY A;  1UHK A;  2JC2 A;  3BUN B;  2KI6 D;  3OX6 A;  4YI9 A;  1AK8 A;  3IF7 A;  5I2Q A;  1KCY A;  3IQO A;  1NIW A;  1SL8 A;  4HRH A;  5JOL A;  3VRO A;  2SAS A;  3PM8 A;  1J7O A;  2LMV A;  4GUK A;  5I8N A;  2KFG A;  3WHT B;  1SKT A;  3OB1 B;  4NDB A;  1PUL A;  3SG5 A;  1JFK A;  2F33 A;  2HF5 A;  2KGR A;  2LMU A;  2M97 A;  3FWC A;  4QJ5 B;  4ORC B;  1DJX A;  1UHN A;  2MAZ A;  1BJF A;  1BU3 A;  2LUC A;  2PVB A;  2BCA A;  1LXF C;  3AKB A;  3CLN A;  3EK4 A;  4YGC B;  2BCB A;  1YUT A;  3I5H C;  2F2O A;  1SL9 A;  1ODB A;  4CPV A;  5KU1 A;  2ZNE A;  2EHB A;  1SNL A;  1BOD A;  1L2O B;  1NX0 A;  1SCM C;  2K7B A;  1BLQ A;  1F55 A;  4PE0 A;  1KWO C;  3ICB A;  5IBW A;  2F2P A;  2CTN A;  3VRR A;  1AP4 A;  1NUB A;  1BF5 A;  1JSA A;  4GPL B;  2LAP A;  4JWQ A;  1WRZ A;  2JQ6 A;  1EXR A;  1RFJ A;  2ZND A;  3A4U B;  1WY9 A;  2FOT A;  1F8H A;  1K2H A;  2LMT A;  1CKK A;  1B7T Y;  1KK8 B;  2VRG A;  4MZL A;  1XK4 C;  4M2P A;  5FYX A;  1S36 A;  1KSO A;  3FWB A;  2KAX A;  1CFP A;  4U8D A;  2LLS A;  2BKI B;  1Y1A A;  4PE4 A;  1FPW A;  2ZRT A;  1A75 B;  2BL0 B;  2OTG B;  2K7D A;  1G8I A;  4PCW A;  1IGV A;  1CLL A;  2F3Z A;  2KYF A;  2PSR A;  1SPY A;  3EKJ A;  1E8A A;  2LV7 A;  2ISD A;  2JZI A;  1WDC B;  4MBE A;  4PE7 A;  1KQV A;  2JT8 A;  1XFV O;  3OHM B;  1YRU B;  1ZOT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...