5ER4X

Crystal structure of calcium-loaded s100b bound to sc0025
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
90
structure length
90
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel protein-inhibitor interactions in site 3 of Ca(2+)-bound S100B as discovered by X-ray crystallography.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein/inhibitor
molecule keywords Protein S100-B
total genus 32
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2015-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00036 EF-hand_1 EF hand
X PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5er4X00
5AFPA 3EKJA 3PM8A 1OSAA 4YI8A 3OHMB 2L98A 1K93D 1QASA 1LVCD 2ZRSA 3PSRA 5D7FA 2M1KB 3O6BA 4CFRA 4TNCA 1MUXA 3WHTB 3PLFB 4USLA 1L2OC 1CLLA 1RTP1 2EHBA 1IWQA 1U5IA 1SKTA 1UHNA 2LUXA 4N1FA 1S1EA 4XJKB 2LANA 2OTGB 2GV5A 3GK2A 2FOTA 3CR4X 3HX4A 1IG5A 5D69A 2NLNA 1KK8B 2JC2A 3WNXB 3JVTC 4AOMA 3BUOB 1S36A 1WRKA 3CGAA 1JFJA 1JSAA 2MRDA 1SR6B 1ZOTB 5FYXA 3CWGA 1BR1B 3I5HC 3TUYC 2KOTA 1PRWA 4PHKA 3KHEA 3EK8A 2ZNDA 1C07A 1FI5A 3D10A 2KAXA 3GK4X 2L2EA 2WC8A 5I2LA 2RGIA 5JJGA 5KU1A 4PHMA 1XFXO 4PALA 1X02A 2LHIA 1UHKA 5B8IB 1NX2A 1UHHA 2COLB 4ORCB 4PCWA 3VRRA 1C7VA 1F55A 2M49B 5JOLA 2OPOA 2JNXA 1KWOB 2BCAA 2KQYA 4XJKA 2KAVA 5AANA 4DIRA 4PHNA 2CT9A 2WCFA 1F8HA 1OE9B 1LKJA 1J7PA 3SG7A 3SJSA 1RECA 1CFCA 1JF0A 1NX3A 1WY9A 2V53A 1NP8A 5GQQC 3RM1A 5HKYA 1GGZA 1IRJA 2QACA 1PULA 1J1DA 3PN7B 4QJ3B 2WORA 2JRFA 1TIZA 3TDIA 1J7QA 1BMOA 5I2OA 1K96A 2EGDA 1XK4A 1H8BA 4ICBA 1JC2A 1TN4A 1OZOA 3C1VA 3EKHA 4GAOA 2Q91A 2MLEC 4PE7A 4NDCA 1CFFA 2F2PA 3CZTX 3IQQA 3LCPC 3KEVA 3K21A 2WOSA 4HSZA 2K7OA 4BY4A 1FBVA 1QLKA 3TDUA 5BPJA 1SCMC 1QX7A 1CKKA 4GGFA 3I5FB 4E68A 2E6WA 2LUCA 2LVVA 2AMIA 1UHIA 1J55A 1EXRA 5F6TA 3I5GB 3VRPA 4OR9B 3WXAA 1FW4A 4MSPA 1MWNA 2K7BA 2LNKA 3TS5C 1CMFA 1IQ3A 1CDLA 1KQVA 2L4IA 4PE0A 2M97A 1WLMA 1K9UA 1LA3A 1A2XA 1ZUZA 3BYAA 2LLTA 5AXIA 2PALA 1BLQA 5HKZA 3HCMA 3CTNA 4YGDB 1L2OB 2GGMA 2O60A 3O4YA 4HRHA 4I5KA 4U8DA 2KI4B 1BG1A 2TN4A 2KI6C 1BT6A 3DVJA 2PASA 1JUOA 1QVIY 1WDCB 1CDNA 3OB2B 4NQGA 4PHJA 3TS5B 1Y0VH 1XFWO 1LINA 1QLSA 4GUKA 3NSKA 4MZKA 1HT9A 2KHNA 4ORAB 3A8RA 1IKUA 1QIVA 2BE6A 2LAPA 1BJFA 3BOWB 1B9AA 1S5GZ 1EG3A 2F3YA 3VROA 1OZSA 1YUUA 4QJ4B 1W7JB 2QPTA 1SCVA 2KBMA 4GGNA 3FIAA 1WRLA 1UWOA 2H2KA 1B1GA 1DJZA 1V1FA 2L5XB 4GFTA 1S6JA 4AQJA 4CPVA 1BF5A 4GNKB 3OX6A 4N5XA 1QIWA 4MLWA 3NSLA 1KSMA 1BU3A 3D0YB 3FWBA 5DKNA 2R2IA 4F0ZB 1XFZO 2I7AA 1A75B 2ZFDA 3SG5A 4OCIA 1OQPA 1KCYA 3PALA 2MA2A 2A4JA 1BOCA 2K2AA 4PE4A 2WCEA 1QS7A 2LV7A 1YTZC 2JT0A 1N2DA 4MVFA 1NWDA 1KQMB 2PVBA 4A4CA 1IJ5A 2EC6C 1DTLA 1YVHA 3NSOA 3FWCA 1NSHA 1AJ4A 1EJ3A 4ZCVA 1JBAA 3ZNIA 1A4PA 1B8LA 1KK7Y 1TNWA 4BY5A 4QJ5B 3A4UB 4HREE 3NXAA 1JWDA 1TNPA 2K8MB 1H4BA 2BBMA 4A4BA 3AAKA 4MBEA 4R1EA 3PN7C 2KFFA 1FPWA 1M63B 3SG6A 2F33A 1V1GA 1W7IB 2Y5IA 1S6CA 1YX7A 3CR5X 3MSEB 4Q04A 1PSBA 1BR4B 1CM4A 1ZFSA 2M29A 1KFXL 1KQMC 2WCBA 1E8AA 3DF0B 1CFDA 3CLNA 1YVLA 3FS7A 4PDZA 5CSIA 2FJUB 2JPTA 3BOWA 1VRKA 3AKAA 2HQWA 2M3WA 1AP4A 2SASA 2JULA 2MAZA 2F2OA 1TCOB 4CIDA 1K8UA 3SIAA 1S5GY 1F4OA 3ICBA 2G2BA 3F45A 4XYNA 1A75A 2AAOA 2G9BA 2VRGA 1QV0A 1WRZA 2CXJA 3VGOA 1RJVA 4YGEB 1DGUA 1WLZA 1U5IB 3TDZA 1K95A 4MRYA 3JVTB 1YURA 2BCBA 1SR6C 1Y1AA 2L51A 1MHOA 5IBWA 1YX8A 1TNQA 1G33A 2HQ8A 2JU0A 1C7WA 1ALWA 2NCOA 2Y4QA 4L9MA 1JF2A 4UPGA 2LVJA 4I5NB 2MLFC 2PMYA 1M46A 2PSRA 5K89A 2JTTA 1RWYA 1DJHA 2D8NA 3EK4A 1S26D 2HETA 2KGBC 5I2QA 1Y6WA 2K2FA 1BODA 2LHLA 1KSOA 2JT3A 2JZIA 4OKHA 4M2QA 1GGWA 1PVAA 1A03A 3VRQA 4M2OA 1AHRA 2LLUA 3BUMB 2K7CA 3LL8B 1ALVA 3O78A 5HLOA 1DT7B 5HKWA 2BKHB 5ER4X 2E30A 3BUXB 2CCMA 2H61C 4IL1A 1SL8A 1DVIA 1PK0D 2BCXA 5DKRA 1CDMA 2NCPA 3LK0A 2LMTA 2ZKMX 1DGVA 2P6BB 1K9KA 4P5OE 2NXQA 1CM1A 3OB1B 2KI6D 1J7RA 1DJIA 4HRGA 3JTDB 1SY9A 2Y1MA 1KK7Z 3O2PA 4D1EA 1OMRA 2M0RA 4FQOA 1CNPA 3KPXA 1S3PA 4GGFC 1NYAA 3DF0A 2L50A 1WDCC 3PFVA 1ZMZA 2I18A 4MZJA 1MXEA 5CSFA 1UHJA 4FTGA 1B4CA 1CTRA 2I94A 1B7TZ 2M8UA 2LMVA 5CSJA 2GGZA 1DJGA 4DRWA 1TTXA 1QATA 2L0PA 1YUTA 1EL4A 2DOQA 1KWOC 3E3RA 5CSNA 5TNCA 2LP2A 1DF0A 4OV2A 3SIBA 2ISDA 1MXLC 4CLNA 2LMUA 1PALA 2LM5A 1YR5A 1QTXA 1DJXA 2CBLA 3SG2A 1QXPA 4YBHB 1KK8C 2CNPA 1XO5A 1SYMA 2BL0B 2KFGA 2LCPA 2Y1NA 3SG3A 5KSZA 3I5GC 3WHUB 2KGRA 1B8RA 2SCPA 4C0KA 2O5GA 3QRXA 1DJYA 2KYFA 2JXCA 1EG4A 2JQ6A 3OX5A 1UURA 1DMOA 1J1EA 2L4HA 3GOFA 1IQ5A 3BUWB 5ER5A 2AUCA 3IQOA 4ORBB 3AKBA 2BECA 3KO0A 1XVJA 4YGCB 1F71A 1GQMA 1NX0A 1M39A 4JPZB 1UUSA 2WNDA 4ETOA 2EC6B 2KQ6A 2MJWB 3I5IB 1NCZA 1NCYA 3LK1A 2HPSA 1SW8A 3DVMA 3BQ3A 4WQ3A 1NCXA 1PSRA 3GK1A 5CPVA 4CFQA 2KBIA 3AAJA 2MBXA 2BKIB 3BUNB 2H61A 1OMVA 2KAYA 1KFUS 2ZRTA 3LLEA 1D1OA 1YRTB 2HF5A 4MEWA 4YRUA 4DUQA 1TOPA 2LE9B 2LLSA 2LP3A 1SCMB 3TZ1A 1FF1A 1A29A 4JWQA 1FI6A 1SPYA 5AEQA 3DD4A 2OS8C 1QX5B 1HQVA 2MHHA 1KFXS 1AJ5A 1DF0B 1K94A 1M45A 2ZNEA 2OTGC 4I5JA 1RFJA 3I5IC 1SMGA 1JFKA 1N65A 2LC5A 1IH0A 1PVBA 1CB1A 5KTYA 1TCFA 1B7TY 1XFYO 3DVKA 2M7NA 1GJYA 4YGBB 2KYCA 2LVIA 3OP0A 1NPQA 1EH2A 3H4SE 4MRXA 2JXLA 2BBNA 3CR2A 2KNEA 4C0LA 1TNXA 3EK7A 3SG4A 1CFPA 3ZWHA 2NZ0A 4JQ0D 2LVKA 1F54A 1R6PA 4PE1A 2JNFA 2BL0C 1SL9A 2F3ZA 4DS7A 2M7LA 1M31A 4MZLA 2BE4A 4YI9A 2KI4C 1K90D 5HLVA 5PALA 3DVEA 1SBJA 3IF7A 1KFUL 1K2HA 2B1UA 1MR8A 1XFVO 3RLZA 1ODBA 1AK8A 1NUBA 1DJWA 1RROA 1R2UA 4GBAA 2KFHA 1LA0A 1SNLA 4NDDA 1TRFA 1K9PA 2I2RE 1F4QA 1QVIZ 1S6IA 1OOJA 2Q4UA 1IJ6A 2F8PA 1XA5A 2JWWA 1B47A 1B8CA 1QX2A 3D0YA 1NX1A 2PRUA 4OVNF 4N1GA 1YUSA 4AQIA 4MN0A 5AERA 1Y1UA 1L7ZA 4M2PA 1ZACA 2M9GA 2K7DA 1J7OA 1CLMA 1F70A 1SRAA 4YGAA 2JOJA 1CDPA 3BXKA 2IS9A 3I5HB 3TUYB 1SK6D 1QV1A 4ZCUA 1Y1XA 1IGVA 3EVRA 1QJTA 2KDHA 1MQ1A 2ZN9A 3EVVA 3PATA 1AUIB 3NSIA 4WQ2A 4WRIA 1XK4C 4DCKA 5DKQA 1LXFC 4NDBA 1XYDA 2FCEA 1G4YR 4GPLB 1UP5A 1YRUB 3JTDC 1OMDA 4C0JA 2OS8B 5HYDA 2CTNA 3I5FC 2ZN8A 4P2YB 1RK9A 3M0WA 2KSPA 2K0JA 1MF8B 3KF9A 5I8NA 1XFUO 1N0YA 2JT8A 1AVSA 1NIWA 4I5LB 2M1UA 1Q80A 1G8IA 2FCDA 2K61A 2JTZA 3EVUA 1CMGA 5G08A 3CS1A 1CLBA 3VRNA 5J3XA 1SL7A
chains in the Genus database with same CATH superfamily
5AFPA 3EKJA 3PM8A 1OSAA 1OOFA 4INXA 3OHMB 4YI8A 2L98A 1K93D 1QASA 1LVCD 2ZRSA 3PSRA 5D7FA 2PQLA 2M1KB 3S0GA 3O6BA 4CFRA 4F7FA 4TNCA 1MUXA 3WHTB 3PLFB 4USLA 1L2OC 5HL1A 1CLLA 1RTP1 2EHBA 1IWQA 1U5IA 3Q8IA 1SKTA 1UHNA 2LUXA 4N1FA 1S1EA 4XJKB 3L4AA 2LANA 2OTGB 2GV5A 3GK2A 2FOTA 3CR4X 3HX4A 1IG5A 5D69A 2NLNA 1KK8B 2JC2A 3WNXB 3JVTC 4AOMA 3BUOB 1S36A 1WRKA 3CGAA 1JFJA 1JSAA 2MRDA 2YGUA 1SR6B 1ZOTB 5FYXA 3CWGA 1BR1B 3I5HC 3TUYC 2KOTA 3DYEA 1PRWA 4PHKA 3KHEA 3EK8A 2ZNDA 3B88A 1C07A 1FI5A 3D10A 2KAXA 3GK4X 2L2EA 2WC8A 5I2LA 2RGIA 5JJGA 5KU1A 4PHMA 1XFXO 4PALA 1X02A 2LHIA 1UHKA 5B8IB 1NX2A 1UHHA 2COLB 4ORCB 3PJIA 4PCWA 3VRRA 1C7VA 2M49B 1F55A 5JOLA 2OPOA 2JNXA 1KWOB 2BCAA 2KQYA 4XJKA 1W9ZA 2KAVA 5AANA 4DIRA 4PHNA 2CT9A 2WCFA 3OGNA 3S0BA 1OE9B 1LKJA 1J7PA 1F8HA 3SG7A 3SJSA 1RECA 3FE6A 1CFCA 1JF0A 1NX3A 1WY9A 2V53A 2H8VA 1NP8A 5GQQC 3RM1A 5HKYA 1GGZA 1IRJA 3D73A 2QACA 2P71A 1OOIX 1PULA 1J1DA 3PN7B 4QJ3B 2WORA 2JRFA 1TIZA 3TDIA 1J7QA 1BMOA 5I2OA 1K96A 2EGDA 1XK4A 1H8BA 4ICBA 1JC2A 1TN4A 1OZOA 3C1VA 3EKHA 4GAOA 2Q91A 1ORGA 3R72A 2MLEC 4PE7A 4NDCA 1CFFA 2F2PA 3CZTX 3IQQA 3LCPC 1Z2CB 3KEVA 3K21A 2WOSA 3D75A 4HSZA 2K7OA 4BY4A 1FBVA 1QLKA 3D76A 3TDUA 1SCMC 1QX7A 5BPJA 1CKKA 4GGFA 3I5FB 3SS5A 4E68A 2E6WA 2LUCA 2LVVA 5D3OA 2AMIA 1UHIA 1J55A 1EXRA 5F6TA 3I5GB 3VRPA 4OR9B 3K1EA 3WXAA 1FW4A 4MSPA 1MWNA 1P28A 2K7BA 2LNKA 3BFHA 3TS5C 1CMFA 1IQ3A 1CDLA 1KQVA 2L4IA 4PE0A 3FE9A 2M97A 1WLMA 1K9UA 1LA3A 1A2XA 1ZUZA 1DEKA 3BYAA 2LLTA 5AXIA 3RZSA 2PALA 1BLQA 5HKZA 3HCMA 3CTNA 4YGDB 2P70A 1L2OB 3L47A 2GGMA 2O60A 3S0DA 3O4YA 3S0EA 4HRHA 2K60A 4I5KA 4U8DA 2KI4B 1BG1A 2TN4A 2KI6C 1BT6A 3DVJA 2PASA 1JUOA 1QVIY 1WDCB 1CDNA 3OB2B 3CABA 3B6XA 2FJYA 4NQGA 4PHJA 3TS5B 1Y0VH 1XFWO 3SS4A 3PM2A 1LINA 1QLSA 4GUKA 3NSKA 4MZKA 1HT9A 2KHNA 2WCKA 3A8RA 3OBVA 4ORAB 1IKUA 1QIVA 2BE6A 2LAPA 1BJFA 3BOWB 1B9AA 1S5GZ 1EG3A 2F3YA 3VROA 1OZSA 1YUUA 2QEHA 3D78A 4QJ4B 1W7JB 2QPTA 1SCVA 2KBMA 4GGNA 3FIAA 1WRLA 3BFAA 1UWOA 2H2KA 2QDIA 1DJZA 1B1GA 1V1FA 2L5XB 4GFTA 1S6JA 4AQJA 4CPVA 1BF5A 4GNKB 3OX6A 4N5XA 1QIWA 4MLWA 3NSLA 1DQEA 1KSMA 1BU3A 3D0YB 3FWBA 5DKNA 2R2IA 4F0ZB 1XFZO 2I7AA 1A75B 2ZFDA 3SG5A 3CYZA 4OCIA 1OQPA 1KCYA 3PALA 1C3YA 1DELA 2MA2A 2A4JA 1BOCA 2K2AA 4PE4A 2WCEA 1QS7A 2LV7A 1YTZC 2JT0A 1N2DA 4MVFA 3DY9A 1NWDA 5FI2A 1KQMB 2PVBA 2WC6A 4A4CA 1IJ5A 2EC6C 1DTLA 1YVHA 3NSOA 3FWCA 1NSHA 1AJ4A 1EJ3A 4ZCVA 1JBAA 3CZ0A 3ZNIA 1A4PA 1B8LA 1KK7Y 1TNWA 4BY5A 4QJ5B 2WCLA 2WCMA 3A4UB 4HREE 3NXAA 1JWDA 1TNPA 2K8MB 1XFRA 1H4BA 2BBMA 4A4BA 3AAKA 4MBEA 4R1EA 3PN7C 2KFFA 1FPWA 1M63B 3SG6A 2F33A 1V1GA 1W7IB 2Y5IA 1S6CA 1YX7A 2QEVA 3CR5X 3MSEB 1PSBA 4Q04A 3N7HA 1BR4B 1CM4A 1ZFSA 2M29A 1KFXL 1KQMC 2WCBA 1E8AA 3DF0B 1CFDA 2L2CA 3CLNA 1YVLA 3FS7A 4PDZA 5CSIA 2FJUB 2WCHA 1TUJA 2JPTA 3BOWA 1VRKA 2KLEA 1TWOA 2HQWA 2M3WA 3AKAA 1AP4A 2SASA 2JULA 2MAZA 2F2OA 1TCOB 4CIDA 1K8UA 3SIAA 1S5GY 1F4OA 3ICBA 2G2BA 3B87A 3F45A 4XYNA 1A75A 2AAOA 1TUZA 2G9BA 1Z4HA 2VRGA 1QV0A 1WRZA 2CXJA 1QWVA 3VGOA 1RJVA 4YGEB 5DICA 1DGUA 1WLZA 1U5IB 3TDZA 1K95A 3V2LA 3NHTA 4MRYA 3R1PA 3JVTB 1YURA 2BCBA 1SR6C 1Y1AA 2L51A 1MHOA 5IBWA 1YX8A 1TNQA 1G33A 2HQ8A 2JU0A 1C7WA 1ALWA 2NCOA 2Y4QA 4L9MA 1JF2A 4UPGA 2LVJA 4I5NB 2MLFC 2PMYA 1M46A 2PSRA 5K89A 2JTTA 5I94A 1RWYA 1DJHA 2D8NA 3EK4A 1S26D 2HETA 2KGBC 5I2QA 1Y6WA 3B7AA 3UNWA 2K2FA 1BODA 2LHLA 1KSOA 2JT3A 2JZIA 4OKHA 4M2QA 1GGWA 1PVAA 1A03A 3VRQA 4M2OA 1AHRA 1LS8A 2LLUA 3BUMB 2K7CA 3LL8B 1ALVA 3O78A 5HLOA 1DT7B 5HKWA 2BKHB 4IJ7A 5ER4X 2E30A 3BUXB 2CCMA 2H61C 4IL1A 1SL8A 1DVIA 1PK0D 2BCXA 5DKRA 1CDMA 2NCPA 3LK0A 2LMTA 2ZKMX 1DGVA 2P6BB 1K9KA 4P5OE 2NXQA 1CM1A 3D77A 3OB1B 1OW4A 2QEBA 2KI6D 1J7RA 1DJIA 4HRGA 3JTDB 1SY9A 2Y1MA 1KK7Z 3O2PA 4D1EA 1OMRA 2M0RA 3CZ2A 4FQOA 3KPXA 1CNPA 1S3PA 4GGFC 2BAPA 1NYAA 3DF0A 2L50A 1WDCC 3PFVA 1ZMZA 2I18A 4MZJA 1MXEA 4PT1A 3UO9A 5CSFA 1UHJA 4FTGA 1B4CA 1CTRA 2I94A 1B7TZ 2QEOA 2M8UA 2LMVA 5CSJA 2GGZA 1DJGA 2ERBA 4DRWA 5FI7A 1TTXA 1QATA 2L0PA 1YUTA 1EL4A 2DOQA 1KWOC 3E3RA 5CSNA 5TNCA 2LP2A 1DF0A 4OV2A 3SIBA 2ISDA 1MXLC 4CLNA 2LMUA 1PALA 2LM5A 1YR5A 1QTXA 1DJXA 2CBLA 3SG2A 3VB1A 1QXPA 4YBHB 2GTEA 1KK8C 2BNXA 1XO5A 1SYMA 2BL0B 2CNPA 2KFGA 2LCPA 2PYQA 2Y1NA 3SG3A 5KSZA 3I5GC 3WHUB 2KGRA 1B8RA 2SCPA 4C0KA 2O5GA 1OOHA 3L4LA 1DJYA 3QRXA 2KYFA 2JXCA 1EG4A 2JQ6A 3OX5A 1UURA 1DMOA 1J1EA 2L4HA 3GOFA 1IQ5A 3BUWB 4OZDA 5ER5A 2AUCA 3IQOA 4ORBB 3AKBA 2BECA 3KO0A 1XVJA 4YGCB 1F71A 1GQMA 2WC5A 1NX0A 1M39A 4JPZB 1UUSA 2WNDA 4ETOA 2EC6B 3DZTA 2KQ6A 2MJWB 3I5IB 4KYNA 1NCZA 1NCYA 3LK1A 2HPSA 1SW8A 3DVMA 3BQ3A 4WQ3A 1NCXA 3B86A 1PSRA 3BFBA 3GK1A 5CPVA 2KBIA 3AAJA 2MBXA 4CFQA 2BKIB 3BUNB 2H61A 1OMVA 2KAYA 1KFUS 2ZRTA 3LLEA 4FQTA 1D1OA 1YRTB 2HF5A 4MEWA 4YRUA 4DUQA 1TOPA 2LE9B 2LLSA 2LP3A 3R1VA 1SCMB 3S0FA 3TZ1A 1FF1A 1A29A 3EG5B 4JWQA 1FI6A 1SPYA 3CZ1A 5AEQA 3DD4A 2OS8C 1QX5B 1HQVA 2MHHA 1KFXS 1AJ5A 1DF0B 1K94A 1M45A 2ZNEA 1DC1A 2OTGC 4I5JA 1RFJA 3NGVA 3I5IC 1SMGA 1JFKA 1N65A 2LC5A 1IH0A 2JPOA 1PVBA 1CB1A 5KTYA 1TCFA 1B7TY 1XFYO 3DVKA 2M7NA 1GJYA 4YGBB 2KYCA 2LVIA 3OP0A 1NPQA 1EH2A 3H4SE 4MRXA 2JXLA 2BBNA 3CR2A 2KNEA 4JKTA 4C0LA 5EL2A 1TNXA 3EK7A 3NHIA 3FE8A 2L5YA 1C3ZA 3SG4A 1CFPA 3ZWHA 2NZ0A 4JQ0D 2KLDA 2LVKA 1F54A 1R6PA 4PE1A 2JNFA 1T14A 2BL0C 1SL9A 2F3ZA 4DS7A 2M7LA 1M31A 4MZLA 2BE4A 4YI9A 2KI4C 1K90D 3IVTA 5HLVA 5PALA 3DVEA 1SBJA 3IF7A 1KFUL 4INWA 2B1UA 1MR8A 1XFVO 1K2HA 3RLZA 1ODBA 1AK8A 1NUBA 1DJWA 1RROA 1R2UA 4GBAA 2KFHA 1IIOA 1LA0A 1SNLA 4NDDA 1TRFA 1K9PA 2I2RE 1F4QA 1QVIZ 1S6IA 1OOJA 2Q4UA 1IJ6A 1XA5A 2F8PA 2JWWA 1B47A 1B8CA 1QX2A 3D0YA 1NX1A 3O4XA 2PRUA 4OVNF 4N1GA 1YUSA 4AQIA 4MN0A 5AERA 1Y1UA 3R1OA 1L7ZA 4M2PA 1ZACA 1SSEB 2M9GA 2K7DA 3BJHA 1J7OA 1CLMA 1F70A 1SRAA 4YGAA 2JOJA 1CDPA 3BXKA 2IS9A 3I5HB 3TUYB 1SK6D 1QV1A 4ZCUA 1Y1XA 1IGVA 3EVRA 1QJTA 2KDHA 1MQ1A 2ZN9A 3EVVA 3PATA 1AUIB 3NSIA 4WQ2A 4WRIA 1XK4C 4DCKA 5DKQA 1LXFC 4NDBA 1XYDA 2FCEA 1G4YR 4GPLB 1UP5A 1YRUB 3D74A 3QMEA 3JTDC 1OMDA 4C0JA 2OS8B 5HYDA 2CTNA 3I5FC 2KPHA 2ZN8A 4P2YB 1RK9A 3CDNA 3M0WA 2KSPA 2K0JA 1MF8B 3DXLA 3KF9A 1XFUO 4JD9A 3SS3A 5I8NA 1N0YA 2JT8A 1AVSA 5FI6A 1NIWA 4I5LB 2M1UA 3S0AA 1Q80A 1G8IA 2FCDA 2K61A 2JTZA 3EVUA 1CMGA 5G08A 3CS1A 2WCJA 1CLBA 1GM0A 3VRNA 1OOGA 5J3XA 1SL7A
chains in the Genus database with same CATH topology
5AFPA 3EKJA 3PM8A 1OSAA 4YI8A 3OHMB 2L98A 1K93D 1QASA 1LVCD 2ZRSA 3PSRA 5D7FA 2M1KB 3O6BA 4CFRA 4TNCA 1MUXA 3WHTB 3PLFB 4USLA 1L2OC 1CLLA 1RTP1 2EHBA 1IWQA 1U5IA 1SKTA 1UHNA 2LUXA 4N1FA 1S1EA 4XJKB 2LANA 2OTGB 2GV5A 3GK2A 2FOTA 3CR4X 3HX4A 1IG5A 5D69A 2NLNA 1KK8B 2JC2A 3WNXB 3JVTC 4AOMA 3BUOB 1S36A 1WRKA 3CGAA 1JFJA 1JSAA 2MRDA 1SR6B 1ZOTB 5FYXA 3CWGA 1BR1B 3I5HC 3TUYC 2KOTA 1PRWA 4PHKA 3KHEA 3EK8A 2ZNDA 1C07A 1FI5A 3D10A 2KAXA 3GK4X 2L2EA 2WC8A 5I2LA 2RGIA 5JJGA 5KU1A 4PHMA 1XFXO 4PALA 1X02A 2LHIA 1UHKA 5B8IB 1NX2A 1UHHA 2COLB 4ORCB 4PCWA 3VRRA 1C7VA 1F55A 2M49B 5JOLA 2OPOA 2JNXA 1KWOB 2BCAA 2KQYA 4XJKA 2KAVA 5AANA 4DIRA 4PHNA 2CT9A 2WCFA 1F8HA 1OE9B 1LKJA 1J7PA 3SG7A 3SJSA 1RECA 1CFCA 1JF0A 1NX3A 1WY9A 2V53A 1NP8A 5GQQC 3RM1A 5HKYA 1GGZA 1IRJA 2QACA 1PULA 1J1DA 3PN7B 4QJ3B 2WORA 2JRFA 1TIZA 3TDIA 1J7QA 1BMOA 5I2OA 1K96A 2EGDA 1XK4A 1H8BA 4ICBA 1JC2A 1TN4A 1OZOA 3C1VA 3EKHA 4GAOA 2Q91A 2MLEC 4PE7A 4NDCA 1CFFA 2F2PA 3CZTX 3IQQA 3LCPC 3KEVA 3K21A 2WOSA 4HSZA 2K7OA 4BY4A 1FBVA 1QLKA 3TDUA 5BPJA 1SCMC 1QX7A 1CKKA 4GGFA 3I5FB 4E68A 2E6WA 2LUCA 2LVVA 2AMIA 1UHIA 1J55A 1EXRA 5F6TA 3I5GB 3VRPA 4OR9B 3WXAA 1FW4A 4MSPA 1MWNA 2K7BA 2LNKA 3TS5C 1CMFA 1IQ3A 1CDLA 1KQVA 2L4IA 4PE0A 2M97A 1WLMA 1K9UA 1LA3A 1A2XA 1ZUZA 3BYAA 2LLTA 5AXIA 2PALA 1BLQA 5HKZA 3HCMA 3CTNA 4YGDB 1L2OB 2GGMA 2O60A 3O4YA 4HRHA 4I5KA 4U8DA 2KI4B 1BG1A 2TN4A 2KI6C 1BT6A 3DVJA 2PASA 1JUOA 1QVIY 1WDCB 1CDNA 3OB2B 4NQGA 4PHJA 3TS5B 1Y0VH 1XFWO 1LINA 1QLSA 4GUKA 3NSKA 4MZKA 1HT9A 2KHNA 4ORAB 3A8RA 1IKUA 1QIVA 2BE6A 2LAPA 1BJFA 3BOWB 1B9AA 1S5GZ 1EG3A 2F3YA 3VROA 1OZSA 1YUUA 4QJ4B 1W7JB 2QPTA 1SCVA 2KBMA 4GGNA 3FIAA 1WRLA 1UWOA 2H2KA 1B1GA 1DJZA 1V1FA 2L5XB 4GFTA 1S6JA 4AQJA 4CPVA 1BF5A 4GNKB 3OX6A 4N5XA 1QIWA 4MLWA 3NSLA 1KSMA 1BU3A 3D0YB 3FWBA 5DKNA 2R2IA 4F0ZB 1XFZO 2I7AA 1A75B 2ZFDA 3SG5A 4OCIA 1OQPA 1KCYA 3PALA 2MA2A 2A4JA 1BOCA 2K2AA 4PE4A 2WCEA 1QS7A 2LV7A 1YTZC 2JT0A 1N2DA 4MVFA 1NWDA 1KQMB 2PVBA 4A4CA 1IJ5A 2EC6C 1DTLA 1YVHA 3NSOA 3FWCA 1NSHA 1AJ4A 1EJ3A 4ZCVA 1JBAA 3ZNIA 1A4PA 1B8LA 1KK7Y 1TNWA 4BY5A 4QJ5B 3A4UB 4HREE 3NXAA 1JWDA 1TNPA 2K8MB 1H4BA 2BBMA 4A4BA 3AAKA 4MBEA 4R1EA 3PN7C 2KFFA 1FPWA 1M63B 3SG6A 2F33A 1V1GA 1W7IB 2Y5IA 1S6CA 1YX7A 3CR5X 3MSEB 4Q04A 1PSBA 1BR4B 1CM4A 1ZFSA 2M29A 1KFXL 1KQMC 2WCBA 1E8AA 3DF0B 1CFDA 3CLNA 1YVLA 3FS7A 4PDZA 5CSIA 2FJUB 2JPTA 3BOWA 1VRKA 3AKAA 2HQWA 2M3WA 1AP4A 2SASA 2JULA 2MAZA 2F2OA 1TCOB 4CIDA 1K8UA 3SIAA 1S5GY 1F4OA 3ICBA 2G2BA 3F45A 4XYNA 1A75A 2AAOA 2G9BA 2VRGA 1QV0A 1WRZA 2CXJA 3VGOA 1RJVA 4YGEB 1DGUA 1WLZA 1U5IB 3TDZA 1K95A 4MRYA 3JVTB 1YURA 2BCBA 1SR6C 1Y1AA 2L51A 1MHOA 5IBWA 1YX8A 1TNQA 1G33A 2HQ8A 2JU0A 1C7WA 1ALWA 2NCOA 2Y4QA 4L9MA 1JF2A 4UPGA 2LVJA 4I5NB 2MLFC 2PMYA 1M46A 2PSRA 5K89A 2JTTA 1RWYA 1DJHA 2D8NA 3EK4A 1S26D 2HETA 2KGBC 5I2QA 1Y6WA 2K2FA 1BODA 2LHLA 1KSOA 2JT3A 2JZIA 4OKHA 4M2QA 1GGWA 1PVAA 1A03A 3VRQA 4M2OA 1AHRA 2LLUA 3BUMB 2K7CA 3LL8B 1ALVA 3O78A 5HLOA 1DT7B 5HKWA 2BKHB 5ER4X 2E30A 3BUXB 2CCMA 2H61C 4IL1A 1SL8A 1DVIA 1PK0D 2BCXA 5DKRA 1CDMA 2NCPA 3LK0A 2LMTA 2ZKMX 1DGVA 2P6BB 1K9KA 4P5OE 2NXQA 1CM1A 3OB1B 2KI6D 1J7RA 1DJIA 4HRGA 3JTDB 1SY9A 2Y1MA 1KK7Z 3O2PA 4D1EA 1OMRA 2M0RA 4FQOA 1CNPA 3KPXA 1S3PA 4GGFC 1NYAA 3DF0A 2L50A 1WDCC 3PFVA 1ZMZA 2I18A 4MZJA 1MXEA 5CSFA 1UHJA 4FTGA 1B4CA 1CTRA 2I94A 1B7TZ 2M8UA 2LMVA 5CSJA 2GGZA 1DJGA 4DRWA 1TTXA 1QATA 2L0PA 1YUTA 1EL4A 2DOQA 1KWOC 3E3RA 5CSNA 5TNCA 2LP2A 1DF0A 4OV2A 3SIBA 2ISDA 1MXLC 4CLNA 2LMUA 1PALA 2LM5A 1YR5A 1QTXA 1DJXA 2CBLA 3SG2A 1QXPA 4YBHB 1KK8C 2CNPA 1XO5A 1SYMA 2BL0B 2KFGA 2LCPA 2Y1NA 3SG3A 5KSZA 3I5GC 3WHUB 2KGRA 1B8RA 2SCPA 4C0KA 2O5GA 3QRXA 1DJYA 2KYFA 2JXCA 1EG4A 2JQ6A 3OX5A 1UURA 1DMOA 1J1EA 2L4HA 3GOFA 1IQ5A 3BUWB 5ER5A 2AUCA 3IQOA 4ORBB 3AKBA 2BECA 3KO0A 1XVJA 4YGCB 1F71A 1GQMA 1NX0A 1M39A 4JPZB 1UUSA 2WNDA 4ETOA 2EC6B 2KQ6A 2MJWB 3I5IB 1NCZA 1NCYA 3LK1A 2HPSA 1SW8A 3DVMA 3BQ3A 4WQ3A 1NCXA 1PSRA 3GK1A 5CPVA 4CFQA 2KBIA 3AAJA 2MBXA 2BKIB 3BUNB 2H61A 1OMVA 2KAYA 1KFUS 2ZRTA 3LLEA 1D1OA 1YRTB 2HF5A 4MEWA 4YRUA 4DUQA 1TOPA 2LE9B 2LLSA 2LP3A 1SCMB 3TZ1A 1FF1A 1A29A 4JWQA 1FI6A 1SPYA 5AEQA 3DD4A 2OS8C 1QX5B 1HQVA 2MHHA 1KFXS 1AJ5A 1DF0B 1K94A 1M45A 2ZNEA 2OTGC 4I5JA 1RFJA 3I5IC 1SMGA 1JFKA 1N65A 2LC5A 1IH0A 1PVBA 1CB1A 5KTYA 1TCFA 1B7TY 1XFYO 3DVKA 2M7NA 1GJYA 4YGBB 2KYCA 2LVIA 3OP0A 1NPQA 1EH2A 3H4SE 4MRXA 2JXLA 2BBNA 3CR2A 2KNEA 4C0LA 1TNXA 3EK7A 3SG4A 1CFPA 3ZWHA 2NZ0A 4JQ0D 2LVKA 1F54A 1R6PA 4PE1A 2JNFA 2BL0C 1SL9A 2F3ZA 4DS7A 2M7LA 1M31A 4MZLA 2BE4A 4YI9A 2KI4C 1K90D 5HLVA 5PALA 3DVEA 1SBJA 3IF7A 1KFUL 1K2HA 2B1UA 1MR8A 1XFVO 3RLZA 1ODBA 1AK8A 1NUBA 1DJWA 1RROA 1R2UA 4GBAA 2KFHA 1LA0A 1SNLA 4NDDA 1TRFA 1K9PA 2I2RE 1F4QA 1QVIZ 1S6IA 1OOJA 2Q4UA 1IJ6A 2F8PA 1XA5A 2JWWA 1B47A 1B8CA 1QX2A 3D0YA 1NX1A 2PRUA 4OVNF 4N1GA 1YUSA 4AQIA 4MN0A 5AERA 1Y1UA 1L7ZA 4M2PA 1ZACA 2M9GA 2K7DA 1J7OA 1CLMA 1F70A 1SRAA 4YGAA 2JOJA 1CDPA 3BXKA 2IS9A 3I5HB 3TUYB 1SK6D 1QV1A 4ZCUA 1Y1XA 1IGVA 3EVRA 1QJTA 2KDHA 1MQ1A 2ZN9A 3EVVA 3PATA 1AUIB 3NSIA 4WQ2A 4WRIA 1XK4C 4DCKA 5DKQA 1LXFC 4NDBA 1XYDA 2FCEA 1G4YR 4GPLB 1UP5A 1YRUB 3JTDC 1OMDA 4C0JA 2OS8B 5HYDA 2CTNA 3I5FC 2ZN8A 4P2YB 1RK9A 3M0WA 2KSPA 2K0JA 1MF8B 3KF9A 5I8NA 1XFUO 1N0YA 2JT8A 1AVSA 1NIWA 4I5LB 2M1UA 1Q80A 1G8IA 2FCDA 2K61A 2JTZA 3EVUA 1CMGA 5G08A 3CS1A 1CLBA 3VRNA 5J3XA 1SL7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AFP A;  3EKJ A;  3PM8 A;  1OSA A;  4YI8 A;  3OHM B;  2L98 A;  1K93 D;  1QAS A;  1LVC D;  2ZRS A;  3PSR A;  5D7F A;  2M1K B;  3O6B A;  4CFR A;  4TNC A;  1MUX A;  3WHT B;  3PLF B;  4USL A;  1L2O C;  1CLL A;  1RTP 1;  2EHB A;  1IWQ A;  1U5I A;  1SKT A;  1UHN A;  2LUX A;  4N1F A;  1S1E A;  4XJK B;  2LAN A;  2OTG B;  2GV5 A;  3GK2 A;  2FOT A;  3CR4 X;  3HX4 A;  1IG5 A;  5D69 A;  2NLN A;  1KK8 B;  2JC2 A;  3WNX B;  3JVT C;  4AOM A;  3BUO B;  1S36 A;  1WRK A;  3CGA A;  1JFJ A;  1JSA A;  2MRD A;  1SR6 B;  1ZOT B;  5FYX A;  3CWG A;  1BR1 B;  3I5H C;  3TUY C;  2KOT A;  1PRW A;  4PHK A;  3KHE A;  3EK8 A;  2ZND A;  1C07 A;  1FI5 A;  3D10 A;  2KAX A;  3GK4 X;  2L2E A;  2WC8 A;  5I2L A;  2RGI A;  5JJG A;  5KU1 A;  4PHM A;  1XFX O;  4PAL A;  1X02 A;  2LHI A;  1UHK A;  5B8I B;  1NX2 A;  1UHH A;  2COL B;  4ORC B;  4PCW A;  3VRR A;  1C7V A;  1F55 A;  2M49 B;  5JOL A;  2OPO A;  2JNX A;  1KWO B;  2BCA A;  2KQY A;  4XJK A;  2KAV A;  5AAN A;  4DIR A;  4PHN A;  2CT9 A;  2WCF A;  1F8H A;  1OE9 B;  1LKJ A;  1J7P A;  3SG7 A;  3SJS A;  1REC A;  1CFC A;  1JF0 A;  1NX3 A;  1WY9 A;  2V53 A;  1NP8 A;  5GQQ C;  3RM1 A;  5HKY A;  1GGZ A;  1IRJ A;  2QAC A;  1PUL A;  1J1D A;  3PN7 B;  4QJ3 B;  2WOR A;  2JRF A;  1TIZ A;  3TDI A;  1J7Q A;  1BMO A;  5I2O A;  1K96 A;  2EGD A;  1XK4 A;  1H8B A;  4ICB A;  1JC2 A;  1TN4 A;  1OZO A;  3C1V A;  3EKH A;  4GAO A;  2Q91 A;  2MLE C;  4PE7 A;  4NDC A;  1CFF A;  2F2P A;  3CZT X;  3IQQ A;  3LCP C;  3KEV A;  3K21 A;  2WOS A;  4HSZ A;  2K7O A;  4BY4 A;  1FBV A;  1QLK A;  3TDU A;  5BPJ A;  1SCM C;  1QX7 A;  1CKK A;  4GGF A;  3I5F B;  4E68 A;  2E6W A;  2LUC A;  2LVV A;  2AMI A;  1UHI A;  1J55 A;  1EXR A;  5F6T A;  3I5G B;  3VRP A;  4OR9 B;  3WXA A;  1FW4 A;  4MSP A;  1MWN A;  2K7B A;  2LNK A;  3TS5 C;  1CMF A;  1IQ3 A;  1CDL A;  1KQV A;  2L4I A;  4PE0 A;  2M97 A;  1WLM A;  1K9U A;  1LA3 A;  1A2X A;  1ZUZ A;  3BYA A;  2LLT A;  5AXI A;  2PAL A;  1BLQ A;  5HKZ A;  3HCM A;  3CTN A;  4YGD B;  1L2O B;  2GGM A;  2O60 A;  3O4Y A;  4HRH A;  4I5K A;  4U8D A;  2KI4 B;  1BG1 A;  2TN4 A;  2KI6 C;  1BT6 A;  3DVJ A;  2PAS A;  1JUO A;  1QVI Y;  1WDC B;  1CDN A;  3OB2 B;  4NQG A;  4PHJ A;  3TS5 B;  1Y0V H;  1XFW O;  1LIN A;  1QLS A;  4GUK A;  3NSK A;  4MZK A;  1HT9 A;  2KHN A;  4ORA B;  3A8R A;  1IKU A;  1QIV A;  2BE6 A;  2LAP A;  1BJF A;  3BOW B;  1B9A A;  1S5G Z;  1EG3 A;  2F3Y A;  3VRO A;  1OZS A;  1YUU A;  4QJ4 B;  1W7J B;  2QPT A;  1SCV A;  2KBM A;  4GGN A;  3FIA A;  1WRL A;  1UWO A;  2H2K A;  1B1G A;  1DJZ A;  1V1F A;  2L5X B;  4GFT A;  1S6J A;  4AQJ A;  4CPV A;  1BF5 A;  4GNK B;  3OX6 A;  4N5X A;  1QIW A;  4MLW A;  3NSL A;  1KSM A;  1BU3 A;  3D0Y B;  3FWB A;  5DKN A;  2R2I A;  4F0Z B;  1XFZ O;  2I7A A;  1A75 B;  2ZFD A;  3SG5 A;  4OCI A;  1OQP A;  1KCY A;  3PAL A;  2MA2 A;  2A4J A;  1BOC A;  2K2A A;  4PE4 A;  2WCE A;  1QS7 A;  2LV7 A;  1YTZ C;  2JT0 A;  1N2D A;  4MVF A;  1NWD A;  1KQM B;  2PVB A;  4A4C A;  1IJ5 A;  2EC6 C;  1DTL A;  1YVH A;  3NSO A;  3FWC A;  1NSH A;  1AJ4 A;  1EJ3 A;  4ZCV A;  1JBA A;  3ZNI A;  1A4P A;  1B8L A;  1KK7 Y;  1TNW A;  4BY5 A;  4QJ5 B;  3A4U B;  4HRE E;  3NXA A;  1JWD A;  1TNP A;  2K8M B;  1H4B A;  2BBM A;  4A4B A;  3AAK A;  4MBE A;  4R1E A;  3PN7 C;  2KFF A;  1FPW A;  1M63 B;  3SG6 A;  2F33 A;  1V1G A;  1W7I B;  2Y5I A;  1S6C A;  1YX7 A;  3CR5 X;  3MSE B;  4Q04 A;  1PSB A;  1BR4 B;  1CM4 A;  1ZFS A;  2M29 A;  1KFX L;  1KQM C;  2WCB A;  1E8A A;  3DF0 B;  1CFD A;  3CLN A;  1YVL A;  3FS7 A;  4PDZ A;  5CSI A;  2FJU B;  2JPT A;  3BOW A;  1VRK A;  3AKA A;  2HQW A;  2M3W A;  1AP4 A;  2SAS A;  2JUL A;  2MAZ A;  2F2O A;  1TCO B;  4CID A;  1K8U A;  3SIA A;  1S5G Y;  1F4O A;  3ICB A;  2G2B A;  3F45 A;  4XYN A;  1A75 A;  2AAO A;  2G9B A;  2VRG A;  1QV0 A;  1WRZ A;  2CXJ A;  3VGO A;  1RJV A;  4YGE B;  1DGU A;  1WLZ A;  1U5I B;  3TDZ A;  1K95 A;  4MRY A;  3JVT B;  1YUR A;  2BCB A;  1SR6 C;  1Y1A A;  2L51 A;  1MHO A;  5IBW A;  1YX8 A;  1TNQ A;  1G33 A;  2HQ8 A;  2JU0 A;  1C7W A;  1ALW A;  2NCO A;  2Y4Q A;  4L9M A;  1JF2 A;  4UPG A;  2LVJ A;  4I5N B;  2MLF C;  2PMY A;  1M46 A;  2PSR A;  5K89 A;  2JTT A;  1RWY A;  1DJH A;  2D8N A;  3EK4 A;  1S26 D;  2HET A;  2KGB C;  5I2Q A;  1Y6W A;  2K2F A;  1BOD A;  2LHL A;  1KSO A;  2JT3 A;  2JZI A;  4OKH A;  4M2Q A;  1GGW A;  1PVA A;  1A03 A;  3VRQ A;  4M2O A;  1AHR A;  2LLU A;  3BUM B;  2K7C A;  3LL8 B;  1ALV A;  3O78 A;  5HLO A;  1DT7 B;  5HKW A;  2BKH B;  5ER4 X;  2E30 A;  3BUX B;  2CCM A;  2H61 C;  4IL1 A;  1SL8 A;  1DVI A;  1PK0 D;  2BCX A;  5DKR A;  1CDM A;  2NCP A;  3LK0 A;  2LMT A;  2ZKM X;  1DGV A;  2P6B B;  1K9K A;  4P5O E;  2NXQ A;  1CM1 A;  3OB1 B;  2KI6 D;  1J7R A;  1DJI A;  4HRG A;  3JTD B;  1SY9 A;  2Y1M A;  1KK7 Z;  3O2P A;  4D1E A;  1OMR A;  2M0R A;  4FQO A;  1CNP A;  3KPX A;  1S3P A;  4GGF C;  1NYA A;  3DF0 A;  2L50 A;  1WDC C;  3PFV A;  1ZMZ A;  2I18 A;  4MZJ A;  1MXE A;  5CSF A;  1UHJ A;  4FTG A;  1B4C A;  1CTR A;  2I94 A;  1B7T Z;  2M8U A;  2LMV A;  5CSJ A;  2GGZ A;  1DJG A;  4DRW A;  1TTX A;  1QAT A;  2L0P A;  1YUT A;  1EL4 A;  2DOQ A;  1KWO C;  3E3R A;  5CSN A;  5TNC A;  2LP2 A;  1DF0 A;  4OV2 A;  3SIB A;  2ISD A;  1MXL C;  4CLN A;  2LMU A;  1PAL A;  2LM5 A;  1YR5 A;  1QTX A;  1DJX A;  2CBL A;  3SG2 A;  1QXP A;  4YBH B;  1KK8 C;  2CNP A;  1XO5 A;  1SYM A;  2BL0 B;  2KFG A;  2LCP A;  2Y1N A;  3SG3 A;  5KSZ A;  3I5G C;  3WHU B;  2KGR A;  1B8R A;  2SCP A;  4C0K A;  2O5G A;  3QRX A;  1DJY A;  2KYF A;  2JXC A;  1EG4 A;  2JQ6 A;  3OX5 A;  1UUR A;  1DMO A;  1J1E A;  2L4H A;  3GOF A;  1IQ5 A;  3BUW B;  5ER5 A;  2AUC A;  3IQO A;  4ORB B;  3AKB A;  2BEC A;  3KO0 A;  1XVJ A;  4YGC B;  1F71 A;  1GQM A;  1NX0 A;  1M39 A;  4JPZ B;  1UUS A;  2WND A;  4ETO A;  2EC6 B;  2KQ6 A;  2MJW B;  3I5I B;  1NCZ A;  1NCY A;  3LK1 A;  2HPS A;  1SW8 A;  3DVM A;  3BQ3 A;  4WQ3 A;  1NCX A;  1PSR A;  3GK1 A;  5CPV A;  4CFQ A;  2KBI A;  3AAJ A;  2MBX A;  2BKI B;  3BUN B;  2H61 A;  1OMV A;  2KAY A;  1KFU S;  2ZRT A;  3LLE A;  1D1O A;  1YRT B;  2HF5 A;  4MEW A;  4YRU A;  4DUQ A;  1TOP A;  2LE9 B;  2LLS A;  2LP3 A;  1SCM B;  3TZ1 A;  1FF1 A;  1A29 A;  4JWQ A;  1FI6 A;  1SPY A;  5AEQ A;  3DD4 A;  2OS8 C;  1QX5 B;  1HQV A;  2MHH A;  1KFX S;  1AJ5 A;  1DF0 B;  1K94 A;  1M45 A;  2ZNE A;  2OTG C;  4I5J A;  1RFJ A;  3I5I C;  1SMG A;  1JFK A;  1N65 A;  2LC5 A;  1IH0 A;  1PVB A;  1CB1 A;  5KTY A;  1TCF A;  1B7T Y;  1XFY O;  3DVK A;  2M7N A;  1GJY A;  4YGB B;  2KYC A;  2LVI A;  3OP0 A;  1NPQ A;  1EH2 A;  3H4S E;  4MRX A;  2JXL A;  2BBN A;  3CR2 A;  2KNE A;  4C0L A;  1TNX A;  3EK7 A;  3SG4 A;  1CFP A;  3ZWH A;  2NZ0 A;  4JQ0 D;  2LVK A;  1F54 A;  1R6P A;  4PE1 A;  2JNF A;  2BL0 C;  1SL9 A;  2F3Z A;  4DS7 A;  2M7L A;  1M31 A;  4MZL A;  2BE4 A;  4YI9 A;  2KI4 C;  1K90 D;  5HLV A;  5PAL A;  3DVE A;  1SBJ A;  3IF7 A;  1KFU L;  1K2H A;  2B1U A;  1MR8 A;  1XFV O;  3RLZ A;  1ODB A;  1AK8 A;  1NUB A;  1DJW A;  1RRO A;  1R2U A;  4GBA A;  2KFH A;  1LA0 A;  1SNL A;  4NDD A;  1TRF A;  1K9P A;  2I2R E;  1F4Q A;  1QVI Z;  1S6I A;  1OOJ A;  2Q4U A;  1IJ6 A;  2F8P A;  1XA5 A;  2JWW A;  1B47 A;  1B8C A;  1QX2 A;  3D0Y A;  1NX1 A;  2PRU A;  4OVN F;  4N1G A;  1YUS A;  4AQI A;  4MN0 A;  5AER A;  1Y1U A;  1L7Z A;  4M2P A;  1ZAC A;  2M9G A;  2K7D A;  1J7O A;  1CLM A;  1F70 A;  1SRA A;  4YGA A;  2JOJ A;  1CDP A;  3BXK A;  2IS9 A;  3I5H B;  3TUY B;  1SK6 D;  1QV1 A;  4ZCU A;  1Y1X A;  1IGV A;  3EVR A;  1QJT A;  2KDH A;  1MQ1 A;  2ZN9 A;  3EVV A;  3PAT A;  1AUI B;  3NSI A;  4WQ2 A;  4WRI A;  1XK4 C;  4DCK A;  5DKQ A;  1LXF C;  4NDB A;  1XYD A;  2FCE A;  1G4Y R;  4GPL B;  1UP5 A;  1YRU B;  3JTD C;  1OMD A;  4C0J A;  2OS8 B;  5HYD A;  2CTN A;  3I5F C;  2ZN8 A;  4P2Y B;  1RK9 A;  3M0W A;  2KSP A;  2K0J A;  1MF8 B;  3KF9 A;  5I8N A;  1XFU O;  1N0Y A;  2JT8 A;  1AVS A;  1NIW A;  4I5L B;  2M1U A;  1Q80 A;  1G8I A;  2FCD A;  2K61 A;  2JTZ A;  3EVU A;  1CMG A;  5G08 A;  3CS1 A;  1CLB A;  3VRN A;  5J3X A;  1SL7 A; 
#chains in the Genus database with same CATH topology
 5AFP A;  3EKJ A;  3PM8 A;  1OSA A;  1OOF A;  4INX A;  3OHM B;  4YI8 A;  2L98 A;  1K93 D;  1QAS A;  1LVC D;  2ZRS A;  3PSR A;  5D7F A;  2PQL A;  2M1K B;  3S0G A;  3O6B A;  4CFR A;  4F7F A;  4TNC A;  1MUX A;  3WHT B;  3PLF B;  4USL A;  1L2O C;  5HL1 A;  1CLL A;  1RTP 1;  2EHB A;  1IWQ A;  1U5I A;  3Q8I A;  1SKT A;  1UHN A;  2LUX A;  4N1F A;  1S1E A;  4XJK B;  3L4A A;  2LAN A;  2OTG B;  2GV5 A;  3GK2 A;  2FOT A;  3CR4 X;  3HX4 A;  1IG5 A;  5D69 A;  2NLN A;  1KK8 B;  2JC2 A;  3WNX B;  3JVT C;  4AOM A;  3BUO B;  1S36 A;  1WRK A;  3CGA A;  1JFJ A;  1JSA A;  2MRD A;  2YGU A;  1SR6 B;  1ZOT B;  5FYX A;  3CWG A;  1BR1 B;  3I5H C;  3TUY C;  2KOT A;  3DYE A;  1PRW A;  4PHK A;  3KHE A;  3EK8 A;  2ZND A;  3B88 A;  1C07 A;  1FI5 A;  3D10 A;  2KAX A;  3GK4 X;  2L2E A;  2WC8 A;  5I2L A;  2RGI A;  5JJG A;  5KU1 A;  4PHM A;  1XFX O;  4PAL A;  1X02 A;  2LHI A;  1UHK A;  5B8I B;  1NX2 A;  1UHH A;  2COL B;  4ORC B;  3PJI A;  4PCW A;  3VRR A;  1C7V A;  2M49 B;  1F55 A;  5JOL A;  2OPO A;  2JNX A;  1KWO B;  2BCA A;  2KQY A;  4XJK A;  1W9Z A;  2KAV A;  5AAN A;  4DIR A;  4PHN A;  2CT9 A;  2WCF A;  3OGN A;  3S0B A;  1OE9 B;  1LKJ A;  1J7P A;  1F8H A;  3SG7 A;  3SJS A;  1REC A;  3FE6 A;  1CFC A;  1JF0 A;  1NX3 A;  1WY9 A;  2V53 A;  2H8V A;  1NP8 A;  5GQQ C;  3RM1 A;  5HKY A;  1GGZ A;  1IRJ A;  3D73 A;  2QAC A;  2P71 A;  1OOI X;  1PUL A;  1J1D A;  3PN7 B;  4QJ3 B;  2WOR A;  2JRF A;  1TIZ A;  3TDI A;  1J7Q A;  1BMO A;  5I2O A;  1K96 A;  2EGD A;  1XK4 A;  1H8B A;  4ICB A;  1JC2 A;  1TN4 A;  1OZO A;  3C1V A;  3EKH A;  4GAO A;  2Q91 A;  1ORG A;  3R72 A;  2MLE C;  4PE7 A;  4NDC A;  1CFF A;  2F2P A;  3CZT X;  3IQQ A;  3LCP C;  1Z2C B;  3KEV A;  3K21 A;  2WOS A;  3D75 A;  4HSZ A;  2K7O A;  4BY4 A;  1FBV A;  1QLK A;  3D76 A;  3TDU A;  1SCM C;  1QX7 A;  5BPJ A;  1CKK A;  4GGF A;  3I5F B;  3SS5 A;  4E68 A;  2E6W A;  2LUC A;  2LVV A;  5D3O A;  2AMI A;  1UHI A;  1J55 A;  1EXR A;  5F6T A;  3I5G B;  3VRP A;  4OR9 B;  3K1E A;  3WXA A;  1FW4 A;  4MSP A;  1MWN A;  1P28 A;  2K7B A;  2LNK A;  3BFH A;  3TS5 C;  1CMF A;  1IQ3 A;  1CDL A;  1KQV A;  2L4I A;  4PE0 A;  3FE9 A;  2M97 A;  1WLM A;  1K9U A;  1LA3 A;  1A2X A;  1ZUZ A;  1DEK A;  3BYA A;  2LLT A;  5AXI A;  3RZS A;  2PAL A;  1BLQ A;  5HKZ A;  3HCM A;  3CTN A;  4YGD B;  2P70 A;  1L2O B;  3L47 A;  2GGM A;  2O60 A;  3S0D A;  3O4Y A;  3S0E A;  4HRH A;  2K60 A;  4I5K A;  4U8D A;  2KI4 B;  1BG1 A;  2TN4 A;  2KI6 C;  1BT6 A;  3DVJ A;  2PAS A;  1JUO A;  1QVI Y;  1WDC B;  1CDN A;  3OB2 B;  3CAB A;  3B6X A;  2FJY A;  4NQG A;  4PHJ A;  3TS5 B;  1Y0V H;  1XFW O;  3SS4 A;  3PM2 A;  1LIN A;  1QLS A;  4GUK A;  3NSK A;  4MZK A;  1HT9 A;  2KHN A;  2WCK A;  3A8R A;  3OBV A;  4ORA B;  1IKU A;  1QIV A;  2BE6 A;  2LAP A;  1BJF A;  3BOW B;  1B9A A;  1S5G Z;  1EG3 A;  2F3Y A;  3VRO A;  1OZS A;  1YUU A;  2QEH A;  3D78 A;  4QJ4 B;  1W7J B;  2QPT A;  1SCV A;  2KBM A;  4GGN A;  3FIA A;  1WRL A;  3BFA A;  1UWO A;  2H2K A;  2QDI A;  1DJZ A;  1B1G A;  1V1F A;  2L5X B;  4GFT A;  1S6J A;  4AQJ A;  4CPV A;  1BF5 A;  4GNK B;  3OX6 A;  4N5X A;  1QIW A;  4MLW A;  3NSL A;  1DQE A;  1KSM A;  1BU3 A;  3D0Y B;  3FWB A;  5DKN A;  2R2I A;  4F0Z B;  1XFZ O;  2I7A A;  1A75 B;  2ZFD A;  3SG5 A;  3CYZ A;  4OCI A;  1OQP A;  1KCY A;  3PAL A;  1C3Y A;  1DEL A;  2MA2 A;  2A4J A;  1BOC A;  2K2A A;  4PE4 A;  2WCE A;  1QS7 A;  2LV7 A;  1YTZ C;  2JT0 A;  1N2D A;  4MVF A;  3DY9 A;  1NWD A;  5FI2 A;  1KQM B;  2PVB A;  2WC6 A;  4A4C A;  1IJ5 A;  2EC6 C;  1DTL A;  1YVH A;  3NSO A;  3FWC A;  1NSH A;  1AJ4 A;  1EJ3 A;  4ZCV A;  1JBA A;  3CZ0 A;  3ZNI A;  1A4P A;  1B8L A;  1KK7 Y;  1TNW A;  4BY5 A;  4QJ5 B;  2WCL A;  2WCM A;  3A4U B;  4HRE E;  3NXA A;  1JWD A;  1TNP A;  2K8M B;  1XFR A;  1H4B A;  2BBM A;  4A4B A;  3AAK A;  4MBE A;  4R1E A;  3PN7 C;  2KFF A;  1FPW A;  1M63 B;  3SG6 A;  2F33 A;  1V1G A;  1W7I B;  2Y5I A;  1S6C A;  1YX7 A;  2QEV A;  3CR5 X;  3MSE B;  1PSB A;  4Q04 A;  3N7H A;  1BR4 B;  1CM4 A;  1ZFS A;  2M29 A;  1KFX L;  1KQM C;  2WCB A;  1E8A A;  3DF0 B;  1CFD A;  2L2C A;  3CLN A;  1YVL A;  3FS7 A;  4PDZ A;  5CSI A;  2FJU B;  2WCH A;  1TUJ A;  2JPT A;  3BOW A;  1VRK A;  2KLE A;  1TWO A;  2HQW A;  2M3W A;  3AKA A;  1AP4 A;  2SAS A;  2JUL A;  2MAZ A;  2F2O A;  1TCO B;  4CID A;  1K8U A;  3SIA A;  1S5G Y;  1F4O A;  3ICB A;  2G2B A;  3B87 A;  3F45 A;  4XYN A;  1A75 A;  2AAO A;  1TUZ A;  2G9B A;  1Z4H A;  2VRG A;  1QV0 A;  1WRZ A;  2CXJ A;  1QWV A;  3VGO A;  1RJV A;  4YGE B;  5DIC A;  1DGU A;  1WLZ A;  1U5I B;  3TDZ A;  1K95 A;  3V2L A;  3NHT A;  4MRY A;  3R1P A;  3JVT B;  1YUR A;  2BCB A;  1SR6 C;  1Y1A A;  2L51 A;  1MHO A;  5IBW A;  1YX8 A;  1TNQ A;  1G33 A;  2HQ8 A;  2JU0 A;  1C7W A;  1ALW A;  2NCO A;  2Y4Q A;  4L9M A;  1JF2 A;  4UPG A;  2LVJ A;  4I5N B;  2MLF C;  2PMY A;  1M46 A;  2PSR A;  5K89 A;  2JTT A;  5I94 A;  1RWY A;  1DJH A;  2D8N A;  3EK4 A;  1S26 D;  2HET A;  2KGB C;  5I2Q A;  1Y6W A;  3B7A A;  3UNW A;  2K2F A;  1BOD A;  2LHL A;  1KSO A;  2JT3 A;  2JZI A;  4OKH A;  4M2Q A;  1GGW A;  1PVA A;  1A03 A;  3VRQ A;  4M2O A;  1AHR A;  1LS8 A;  2LLU A;  3BUM B;  2K7C A;  3LL8 B;  1ALV A;  3O78 A;  5HLO A;  1DT7 B;  5HKW A;  2BKH B;  4IJ7 A;  5ER4 X;  2E30 A;  3BUX B;  2CCM A;  2H61 C;  4IL1 A;  1SL8 A;  1DVI A;  1PK0 D;  2BCX A;  5DKR A;  1CDM A;  2NCP A;  3LK0 A;  2LMT A;  2ZKM X;  1DGV A;  2P6B B;  1K9K A;  4P5O E;  2NXQ A;  1CM1 A;  3D77 A;  3OB1 B;  1OW4 A;  2QEB A;  2KI6 D;  1J7R A;  1DJI A;  4HRG A;  3JTD B;  1SY9 A;  2Y1M A;  1KK7 Z;  3O2P A;  4D1E A;  1OMR A;  2M0R A;  3CZ2 A;  4FQO A;  3KPX A;  1CNP A;  1S3P A;  4GGF C;  2BAP A;  1NYA A;  3DF0 A;  2L50 A;  1WDC C;  3PFV A;  1ZMZ A;  2I18 A;  4MZJ A;  1MXE A;  4PT1 A;  3UO9 A;  5CSF A;  1UHJ A;  4FTG A;  1B4C A;  1CTR A;  2I94 A;  1B7T Z;  2QEO A;  2M8U A;  2LMV A;  5CSJ A;  2GGZ A;  1DJG A;  2ERB A;  4DRW A;  5FI7 A;  1TTX A;  1QAT A;  2L0P A;  1YUT A;  1EL4 A;  2DOQ A;  1KWO C;  3E3R A;  5CSN A;  5TNC A;  2LP2 A;  1DF0 A;  4OV2 A;  3SIB A;  2ISD A;  1MXL C;  4CLN A;  2LMU A;  1PAL A;  2LM5 A;  1YR5 A;  1QTX A;  1DJX A;  2CBL A;  3SG2 A;  3VB1 A;  1QXP A;  4YBH B;  2GTE A;  1KK8 C;  2BNX A;  1XO5 A;  1SYM A;  2BL0 B;  2CNP A;  2KFG A;  2LCP A;  2PYQ A;  2Y1N A;  3SG3 A;  5KSZ A;  3I5G C;  3WHU B;  2KGR A;  1B8R A;  2SCP A;  4C0K A;  2O5G A;  1OOH A;  3L4L A;  1DJY A;  3QRX A;  2KYF A;  2JXC A;  1EG4 A;  2JQ6 A;  3OX5 A;  1UUR A;  1DMO A;  1J1E A;  2L4H A;  3GOF A;  1IQ5 A;  3BUW B;  4OZD A;  5ER5 A;  2AUC A;  3IQO A;  4ORB B;  3AKB A;  2BEC A;  3KO0 A;  1XVJ A;  4YGC B;  1F71 A;  1GQM A;  2WC5 A;  1NX0 A;  1M39 A;  4JPZ B;  1UUS A;  2WND A;  4ETO A;  2EC6 B;  3DZT A;  2KQ6 A;  2MJW B;  3I5I B;  4KYN A;  1NCZ A;  1NCY A;  3LK1 A;  2HPS A;  1SW8 A;  3DVM A;  3BQ3 A;  4WQ3 A;  1NCX A;  3B86 A;  1PSR A;  3BFB A;  3GK1 A;  5CPV A;  2KBI A;  3AAJ A;  2MBX A;  4CFQ A;  2BKI B;  3BUN B;  2H61 A;  1OMV A;  2KAY A;  1KFU S;  2ZRT A;  3LLE A;  4FQT A;  1D1O A;  1YRT B;  2HF5 A;  4MEW A;  4YRU A;  4DUQ A;  1TOP A;  2LE9 B;  2LLS A;  2LP3 A;  3R1V A;  1SCM B;  3S0F A;  3TZ1 A;  1FF1 A;  1A29 A;  3EG5 B;  4JWQ A;  1FI6 A;  1SPY A;  3CZ1 A;  5AEQ A;  3DD4 A;  2OS8 C;  1QX5 B;  1HQV A;  2MHH A;  1KFX S;  1AJ5 A;  1DF0 B;  1K94 A;  1M45 A;  2ZNE A;  1DC1 A;  2OTG C;  4I5J A;  1RFJ A;  3NGV A;  3I5I C;  1SMG A;  1JFK A;  1N65 A;  2LC5 A;  1IH0 A;  2JPO A;  1PVB A;  1CB1 A;  5KTY A;  1TCF A;  1B7T Y;  1XFY O;  3DVK A;  2M7N A;  1GJY A;  4YGB B;  2KYC A;  2LVI A;  3OP0 A;  1NPQ A;  1EH2 A;  3H4S E;  4MRX A;  2JXL A;  2BBN A;  3CR2 A;  2KNE A;  4JKT A;  4C0L A;  5EL2 A;  1TNX A;  3EK7 A;  3NHI A;  3FE8 A;  2L5Y A;  1C3Z A;  3SG4 A;  1CFP A;  3ZWH A;  2NZ0 A;  4JQ0 D;  2KLD A;  2LVK A;  1F54 A;  1R6P A;  4PE1 A;  2JNF A;  1T14 A;  2BL0 C;  1SL9 A;  2F3Z A;  4DS7 A;  2M7L A;  1M31 A;  4MZL A;  2BE4 A;  4YI9 A;  2KI4 C;  1K90 D;  3IVT A;  5HLV A;  5PAL A;  3DVE A;  1SBJ A;  3IF7 A;  1KFU L;  4INW A;  2B1U A;  1MR8 A;  1XFV O;  1K2H A;  3RLZ A;  1ODB A;  1AK8 A;  1NUB A;  1DJW A;  1RRO A;  1R2U A;  4GBA A;  2KFH A;  1IIO A;  1LA0 A;  1SNL A;  4NDD A;  1TRF A;  1K9P A;  2I2R E;  1F4Q A;  1QVI Z;  1S6I A;  1OOJ A;  2Q4U A;  1IJ6 A;  1XA5 A;  2F8P A;  2JWW A;  1B47 A;  1B8C A;  1QX2 A;  3D0Y A;  1NX1 A;  3O4X A;  2PRU A;  4OVN F;  4N1G A;  1YUS A;  4AQI A;  4MN0 A;  5AER A;  1Y1U A;  3R1O A;  1L7Z A;  4M2P A;  1ZAC A;  1SSE B;  2M9G A;  2K7D A;  3BJH A;  1J7O A;  1CLM A;  1F70 A;  1SRA A;  4YGA A;  2JOJ A;  1CDP A;  3BXK A;  2IS9 A;  3I5H B;  3TUY B;  1SK6 D;  1QV1 A;  4ZCU A;  1Y1X A;  1IGV A;  3EVR A;  1QJT A;  2KDH A;  1MQ1 A;  2ZN9 A;  3EVV A;  3PAT A;  1AUI B;  3NSI A;  4WQ2 A;  4WRI A;  1XK4 C;  4DCK A;  5DKQ A;  1LXF C;  4NDB A;  1XYD A;  2FCE A;  1G4Y R;  4GPL B;  1UP5 A;  1YRU B;  3D74 A;  3QME A;  3JTD C;  1OMD A;  4C0J A;  2OS8 B;  5HYD A;  2CTN A;  3I5F C;  2KPH A;  2ZN8 A;  4P2Y B;  1RK9 A;  3CDN A;  3M0W A;  2KSP A;  2K0J A;  1MF8 B;  3DXL A;  3KF9 A;  1XFU O;  4JD9 A;  3SS3 A;  5I8N A;  1N0Y A;  2JT8 A;  1AVS A;  5FI6 A;  1NIW A;  4I5L B;  2M1U A;  3S0A A;  1Q80 A;  1G8I A;  2FCD A;  2K61 A;  2JTZ A;  3EVU A;  1CMG A;  5G08 A;  3CS1 A;  2WCJ A;  1CLB A;  1GM0 A;  3VRN A;  1OOG A;  5J3X A;  1SL7 A; 
#chains in the Genus database with same CATH homology
 5AFP A;  3EKJ A;  3PM8 A;  1OSA A;  4YI8 A;  3OHM B;  2L98 A;  1K93 D;  1QAS A;  1LVC D;  2ZRS A;  3PSR A;  5D7F A;  2M1K B;  3O6B A;  4CFR A;  4TNC A;  1MUX A;  3WHT B;  3PLF B;  4USL A;  1L2O C;  1CLL A;  1RTP 1;  2EHB A;  1IWQ A;  1U5I A;  1SKT A;  1UHN A;  2LUX A;  4N1F A;  1S1E A;  4XJK B;  2LAN A;  2OTG B;  2GV5 A;  3GK2 A;  2FOT A;  3CR4 X;  3HX4 A;  1IG5 A;  5D69 A;  2NLN A;  1KK8 B;  2JC2 A;  3WNX B;  3JVT C;  4AOM A;  3BUO B;  1S36 A;  1WRK A;  3CGA A;  1JFJ A;  1JSA A;  2MRD A;  1SR6 B;  1ZOT B;  5FYX A;  3CWG A;  1BR1 B;  3I5H C;  3TUY C;  2KOT A;  1PRW A;  4PHK A;  3KHE A;  3EK8 A;  2ZND A;  1C07 A;  1FI5 A;  3D10 A;  2KAX A;  3GK4 X;  2L2E A;  2WC8 A;  5I2L A;  2RGI A;  5JJG A;  5KU1 A;  4PHM A;  1XFX O;  4PAL A;  1X02 A;  2LHI A;  1UHK A;  5B8I B;  1NX2 A;  1UHH A;  2COL B;  4ORC B;  4PCW A;  3VRR A;  1C7V A;  1F55 A;  2M49 B;  5JOL A;  2OPO A;  2JNX A;  1KWO B;  2BCA A;  2KQY A;  4XJK A;  2KAV A;  5AAN A;  4DIR A;  4PHN A;  2CT9 A;  2WCF A;  1F8H A;  1OE9 B;  1LKJ A;  1J7P A;  3SG7 A;  3SJS A;  1REC A;  1CFC A;  1JF0 A;  1NX3 A;  1WY9 A;  2V53 A;  1NP8 A;  5GQQ C;  3RM1 A;  5HKY A;  1GGZ A;  1IRJ A;  2QAC A;  1PUL A;  1J1D A;  3PN7 B;  4QJ3 B;  2WOR A;  2JRF A;  1TIZ A;  3TDI A;  1J7Q A;  1BMO A;  5I2O A;  1K96 A;  2EGD A;  1XK4 A;  1H8B A;  4ICB A;  1JC2 A;  1TN4 A;  1OZO A;  3C1V A;  3EKH A;  4GAO A;  2Q91 A;  2MLE C;  4PE7 A;  4NDC A;  1CFF A;  2F2P A;  3CZT X;  3IQQ A;  3LCP C;  3KEV A;  3K21 A;  2WOS A;  4HSZ A;  2K7O A;  4BY4 A;  1FBV A;  1QLK A;  3TDU A;  5BPJ A;  1SCM C;  1QX7 A;  1CKK A;  4GGF A;  3I5F B;  4E68 A;  2E6W A;  2LUC A;  2LVV A;  2AMI A;  1UHI A;  1J55 A;  1EXR A;  5F6T A;  3I5G B;  3VRP A;  4OR9 B;  3WXA A;  1FW4 A;  4MSP A;  1MWN A;  2K7B A;  2LNK A;  3TS5 C;  1CMF A;  1IQ3 A;  1CDL A;  1KQV A;  2L4I A;  4PE0 A;  2M97 A;  1WLM A;  1K9U A;  1LA3 A;  1A2X A;  1ZUZ A;  3BYA A;  2LLT A;  5AXI A;  2PAL A;  1BLQ A;  5HKZ A;  3HCM A;  3CTN A;  4YGD B;  1L2O B;  2GGM A;  2O60 A;  3O4Y A;  4HRH A;  4I5K A;  4U8D A;  2KI4 B;  1BG1 A;  2TN4 A;  2KI6 C;  1BT6 A;  3DVJ A;  2PAS A;  1JUO A;  1QVI Y;  1WDC B;  1CDN A;  3OB2 B;  4NQG A;  4PHJ A;  3TS5 B;  1Y0V H;  1XFW O;  1LIN A;  1QLS A;  4GUK A;  3NSK A;  4MZK A;  1HT9 A;  2KHN A;  4ORA B;  3A8R A;  1IKU A;  1QIV A;  2BE6 A;  2LAP A;  1BJF A;  3BOW B;  1B9A A;  1S5G Z;  1EG3 A;  2F3Y A;  3VRO A;  1OZS A;  1YUU A;  4QJ4 B;  1W7J B;  2QPT A;  1SCV A;  2KBM A;  4GGN A;  3FIA A;  1WRL A;  1UWO A;  2H2K A;  1B1G A;  1DJZ A;  1V1F A;  2L5X B;  4GFT A;  1S6J A;  4AQJ A;  4CPV A;  1BF5 A;  4GNK B;  3OX6 A;  4N5X A;  1QIW A;  4MLW A;  3NSL A;  1KSM A;  1BU3 A;  3D0Y B;  3FWB A;  5DKN A;  2R2I A;  4F0Z B;  1XFZ O;  2I7A A;  1A75 B;  2ZFD A;  3SG5 A;  4OCI A;  1OQP A;  1KCY A;  3PAL A;  2MA2 A;  2A4J A;  1BOC A;  2K2A A;  4PE4 A;  2WCE A;  1QS7 A;  2LV7 A;  1YTZ C;  2JT0 A;  1N2D A;  4MVF A;  1NWD A;  1KQM B;  2PVB A;  4A4C A;  1IJ5 A;  2EC6 C;  1DTL A;  1YVH A;  3NSO A;  3FWC A;  1NSH A;  1AJ4 A;  1EJ3 A;  4ZCV A;  1JBA A;  3ZNI A;  1A4P A;  1B8L A;  1KK7 Y;  1TNW A;  4BY5 A;  4QJ5 B;  3A4U B;  4HRE E;  3NXA A;  1JWD A;  1TNP A;  2K8M B;  1H4B A;  2BBM A;  4A4B A;  3AAK A;  4MBE A;  4R1E A;  3PN7 C;  2KFF A;  1FPW A;  1M63 B;  3SG6 A;  2F33 A;  1V1G A;  1W7I B;  2Y5I A;  1S6C A;  1YX7 A;  3CR5 X;  3MSE B;  4Q04 A;  1PSB A;  1BR4 B;  1CM4 A;  1ZFS A;  2M29 A;  1KFX L;  1KQM C;  2WCB A;  1E8A A;  3DF0 B;  1CFD A;  3CLN A;  1YVL A;  3FS7 A;  4PDZ A;  5CSI A;  2FJU B;  2JPT A;  3BOW A;  1VRK A;  3AKA A;  2HQW A;  2M3W A;  1AP4 A;  2SAS A;  2JUL A;  2MAZ A;  2F2O A;  1TCO B;  4CID A;  1K8U A;  3SIA A;  1S5G Y;  1F4O A;  3ICB A;  2G2B A;  3F45 A;  4XYN A;  1A75 A;  2AAO A;  2G9B A;  2VRG A;  1QV0 A;  1WRZ A;  2CXJ A;  3VGO A;  1RJV A;  4YGE B;  1DGU A;  1WLZ A;  1U5I B;  3TDZ A;  1K95 A;  4MRY A;  3JVT B;  1YUR A;  2BCB A;  1SR6 C;  1Y1A A;  2L51 A;  1MHO A;  5IBW A;  1YX8 A;  1TNQ A;  1G33 A;  2HQ8 A;  2JU0 A;  1C7W A;  1ALW A;  2NCO A;  2Y4Q A;  4L9M A;  1JF2 A;  4UPG A;  2LVJ A;  4I5N B;  2MLF C;  2PMY A;  1M46 A;  2PSR A;  5K89 A;  2JTT A;  1RWY A;  1DJH A;  2D8N A;  3EK4 A;  1S26 D;  2HET A;  2KGB C;  5I2Q A;  1Y6W A;  2K2F A;  1BOD A;  2LHL A;  1KSO A;  2JT3 A;  2JZI A;  4OKH A;  4M2Q A;  1GGW A;  1PVA A;  1A03 A;  3VRQ A;  4M2O A;  1AHR A;  2LLU A;  3BUM B;  2K7C A;  3LL8 B;  1ALV A;  3O78 A;  5HLO A;  1DT7 B;  5HKW A;  2BKH B;  5ER4 X;  2E30 A;  3BUX B;  2CCM A;  2H61 C;  4IL1 A;  1SL8 A;  1DVI A;  1PK0 D;  2BCX A;  5DKR A;  1CDM A;  2NCP A;  3LK0 A;  2LMT A;  2ZKM X;  1DGV A;  2P6B B;  1K9K A;  4P5O E;  2NXQ A;  1CM1 A;  3OB1 B;  2KI6 D;  1J7R A;  1DJI A;  4HRG A;  3JTD B;  1SY9 A;  2Y1M A;  1KK7 Z;  3O2P A;  4D1E A;  1OMR A;  2M0R A;  4FQO A;  1CNP A;  3KPX A;  1S3P A;  4GGF C;  1NYA A;  3DF0 A;  2L50 A;  1WDC C;  3PFV A;  1ZMZ A;  2I18 A;  4MZJ A;  1MXE A;  5CSF A;  1UHJ A;  4FTG A;  1B4C A;  1CTR A;  2I94 A;  1B7T Z;  2M8U A;  2LMV A;  5CSJ A;  2GGZ A;  1DJG A;  4DRW A;  1TTX A;  1QAT A;  2L0P A;  1YUT A;  1EL4 A;  2DOQ A;  1KWO C;  3E3R A;  5CSN A;  5TNC A;  2LP2 A;  1DF0 A;  4OV2 A;  3SIB A;  2ISD A;  1MXL C;  4CLN A;  2LMU A;  1PAL A;  2LM5 A;  1YR5 A;  1QTX A;  1DJX A;  2CBL A;  3SG2 A;  1QXP A;  4YBH B;  1KK8 C;  2CNP A;  1XO5 A;  1SYM A;  2BL0 B;  2KFG A;  2LCP A;  2Y1N A;  3SG3 A;  5KSZ A;  3I5G C;  3WHU B;  2KGR A;  1B8R A;  2SCP A;  4C0K A;  2O5G A;  3QRX A;  1DJY A;  2KYF A;  2JXC A;  1EG4 A;  2JQ6 A;  3OX5 A;  1UUR A;  1DMO A;  1J1E A;  2L4H A;  3GOF A;  1IQ5 A;  3BUW B;  5ER5 A;  2AUC A;  3IQO A;  4ORB B;  3AKB A;  2BEC A;  3KO0 A;  1XVJ A;  4YGC B;  1F71 A;  1GQM A;  1NX0 A;  1M39 A;  4JPZ B;  1UUS A;  2WND A;  4ETO A;  2EC6 B;  2KQ6 A;  2MJW B;  3I5I B;  1NCZ A;  1NCY A;  3LK1 A;  2HPS A;  1SW8 A;  3DVM A;  3BQ3 A;  4WQ3 A;  1NCX A;  1PSR A;  3GK1 A;  5CPV A;  4CFQ A;  2KBI A;  3AAJ A;  2MBX A;  2BKI B;  3BUN B;  2H61 A;  1OMV A;  2KAY A;  1KFU S;  2ZRT A;  3LLE A;  1D1O A;  1YRT B;  2HF5 A;  4MEW A;  4YRU A;  4DUQ A;  1TOP A;  2LE9 B;  2LLS A;  2LP3 A;  1SCM B;  3TZ1 A;  1FF1 A;  1A29 A;  4JWQ A;  1FI6 A;  1SPY A;  5AEQ A;  3DD4 A;  2OS8 C;  1QX5 B;  1HQV A;  2MHH A;  1KFX S;  1AJ5 A;  1DF0 B;  1K94 A;  1M45 A;  2ZNE A;  2OTG C;  4I5J A;  1RFJ A;  3I5I C;  1SMG A;  1JFK A;  1N65 A;  2LC5 A;  1IH0 A;  1PVB A;  1CB1 A;  5KTY A;  1TCF A;  1B7T Y;  1XFY O;  3DVK A;  2M7N A;  1GJY A;  4YGB B;  2KYC A;  2LVI A;  3OP0 A;  1NPQ A;  1EH2 A;  3H4S E;  4MRX A;  2JXL A;  2BBN A;  3CR2 A;  2KNE A;  4C0L A;  1TNX A;  3EK7 A;  3SG4 A;  1CFP A;  3ZWH A;  2NZ0 A;  4JQ0 D;  2LVK A;  1F54 A;  1R6P A;  4PE1 A;  2JNF A;  2BL0 C;  1SL9 A;  2F3Z A;  4DS7 A;  2M7L A;  1M31 A;  4MZL A;  2BE4 A;  4YI9 A;  2KI4 C;  1K90 D;  5HLV A;  5PAL A;  3DVE A;  1SBJ A;  3IF7 A;  1KFU L;  1K2H A;  2B1U A;  1MR8 A;  1XFV O;  3RLZ A;  1ODB A;  1AK8 A;  1NUB A;  1DJW A;  1RRO A;  1R2U A;  4GBA A;  2KFH A;  1LA0 A;  1SNL A;  4NDD A;  1TRF A;  1K9P A;  2I2R E;  1F4Q A;  1QVI Z;  1S6I A;  1OOJ A;  2Q4U A;  1IJ6 A;  2F8P A;  1XA5 A;  2JWW A;  1B47 A;  1B8C A;  1QX2 A;  3D0Y A;  1NX1 A;  2PRU A;  4OVN F;  4N1G A;  1YUS A;  4AQI A;  4MN0 A;  5AER A;  1Y1U A;  1L7Z A;  4M2P A;  1ZAC A;  2M9G A;  2K7D A;  1J7O A;  1CLM A;  1F70 A;  1SRA A;  4YGA A;  2JOJ A;  1CDP A;  3BXK A;  2IS9 A;  3I5H B;  3TUY B;  1SK6 D;  1QV1 A;  4ZCU A;  1Y1X A;  1IGV A;  3EVR A;  1QJT A;  2KDH A;  1MQ1 A;  2ZN9 A;  3EVV A;  3PAT A;  1AUI B;  3NSI A;  4WQ2 A;  4WRI A;  1XK4 C;  4DCK A;  5DKQ A;  1LXF C;  4NDB A;  1XYD A;  2FCE A;  1G4Y R;  4GPL B;  1UP5 A;  1YRU B;  3JTD C;  1OMD A;  4C0J A;  2OS8 B;  5HYD A;  2CTN A;  3I5F C;  2ZN8 A;  4P2Y B;  1RK9 A;  3M0W A;  2KSP A;  2K0J A;  1MF8 B;  3KF9 A;  5I8N A;  1XFU O;  1N0Y A;  2JT8 A;  1AVS A;  1NIW A;  4I5L B;  2M1U A;  1Q80 A;  1G8I A;  2FCD A;  2K61 A;  2JTZ A;  3EVU A;  1CMG A;  5G08 A;  3CS1 A;  1CLB A;  3VRN A;  5J3X A;  1SL7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...