2JT0A

Solution structure of f104w cardiac troponin c
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
161
structure length
161
Chain Sequence
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRSMKDDSKGKSEEELSDLFRMWDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein regulator
molecule keywords Troponin C, slow skeletal and cardiac muscles
publication title Effects of Phe-to-Trp mutation and fluorotryptophan incorporation on the solution structure of cardiac troponin C, and analysis of its suitability as a potential probe for in situ NMR studies.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2007-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2jt0A01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2jt0A02
1QX5B 4QJ5B 5FYXA 1FF1A 1ZOTB 1LVCD 2M7NA 3GK1A 1ZMZA 2GV5A 1MWNA 2M0RA 4GGFC 1AUIB 2CBLA 2KAXA 1NUBA 1F54A 4PE0A 2K2FA 1S6CA 4NDCA 3PFVA 2LVVA 2HETA 2F2OA 2JXCA 2I18A 1KFUL 4OV2A 1EG3A 2KOTA 1A4PA 3RLZA 2E6WA 5KSZA 1J55A 2JULA 5D69A 1DF0B 4YRUA 2Y1NA 3VRNA 1SCVA 4PHMA 2KHNA 1SPYA 2BCBA 2G2BA 3DVEA 1JF0A 1SY9A 1K8UA 1QX7A 2FOTA 2MLFC 1QIVA 4ETOA 1LKJA 1UHIA 2LMVA 1BLQA 1OZSA 2LVIA 4A4BA 1J7RA 1XK4A 3I5GB 1FI5A 1J7QA 1YX8A 1F55A 1XYDA 1Y6WA 1BT6A 4YI8A 3LLEA 3VGOA 2HF5A 2K7DA 2VRGA 1OMVA 3H4SE 1DVIA 2A4JA 2I94A 1PSRA 5JOLA 2Y5IA 1Y1AA 5HLOA 1BF5A 1H8BA 1YUTA 2LLSA 1AVSA 1Y0VH 5HKZA 3WHUB 4D1EA 3E3RA 1C7VA 4YGCB 1KFXL 1CDPA 4BY4A 1JSAA 1WDCB 1JFJA 4MSPA 2ZN8A 1SCMC 1R2UA 3QRXA 3D0YA 3TS5B 2KI6D 1MR8A 3BQ3A 3SIAA 3O2PA 1YRUB 3PALA 2LV7A 1BJFA 3O6BA 1M45A 1CFCA 1CLMA 2KNEA 1B7TY 1KQVA 3GOFA 2COLB 4PE4A 1DJIA 1K93D 1RFJA 4MVFA 1F71A 5TNCA 1CM4A 2ZNDA 2M49B 3I5HB 4ORAB 1NSHA 2LAPA 3CGAA 4PCWA 4WQ3A 2F3YA 2LMTA 4U8DA 4GAOA 3BOWA 3JTDB 4I5JA 1IRJA 2CTNA 3I5FB 2KI4B 4DCKA 1F70A 3NSOA 1C07A 1CKKA 2L2EA 1RTP1 5BPJA 1B8RA 3O4YA 1A03A 1CNPA 3PN7B 2SCPA 3GK4X 1XVJA 2M1KB 1JWDA 2PMYA 2I2RE 4OCIA 2K7BA 5AXIA 1CTRA 1Y1XA 3EK7A 1B9AA 1NPQA 1NX1A 1ODBA 4MZLA 1J1EA 1PRWA 3DVJA 2PRUA 1EL4A 3EVRA 1EG4A 2CCMA 1CDLA 1ZUZA 5AERA 2PASA 2PVBA 1PSBA 4HSZA 1TOPA 5B8IB 1OSAA 3CWGA 2F2PA 1GGWA 1K94A 1TTXA 4ZCUA 3SG7A 3SG3A 3D10A 4AOMA 1TN4A 2MRDA 1QIWA 1A29A 2NZ0A 1PVBA 3BYAA 5ER4X 5JJGA 2H2KA 3WNXB 2QACA 4ORBB 3K21A 1S5GY 1V1FA 2IS9A 5CPVA 1K96A 3SG4A 4GPLB 2KI6C 3NSIA 4GUKA 1SL7A 3DF0A 1CLBA 1SL9A 4GGFA 5DKNA 2JT0A 1DTLA 3KPXA 3D0YB 2FCEA 1CMFA 3BXKA 2ZRSA 5AEQA 3BUNB 2WNDA 1R6PA 4Q04A 3SG6A 2K8MB 2ZFDA 3LK1A 4M2QA 1QLSA 5I2LA 4YGEB 1OQPA 3ZNIA 1CMGA 2H61A 3EVVA 1B47A 1MXLC 2BCAA 2H61C 1TNWA 4A4CA 4I5LB 2MHHA 3AAJA 4ORCB 3DD4A 2EGDA 3EK4A 1QV1A 2KYFA 2KAVA 3VROA 1KSOA 4GBAA 3KHEA 2DOQA 4YGAA 1YVLA 1KK8C 2OS8C 1K9PA 1WRZA 4IL1A 1LINA 3BUOB 3JVTB 2JQ6A 2KFHA 2JU0A 3IQQA 3I5IC 2LCPA 1UHHA 1OE9B 1JF2A 1OMDA 1ZACA 2KAYA 2RGIA 3BOWB 1U5IA 5HLVA 1XFWO 4C0KA 1QJTA 2HPSA 1DJZA 1F4QA 2Y1MA 2L98A 3DVMA 2LANA 1CDNA 5HKWA 1YVHA 2OPOA 4OVNF 1YR5A 2M97A 3ZWHA 2EC6B 2G9BA 2BE6A 1PK0D 2JNXA 3AAKA 4NDDA 1L2OC 1DMOA 2BKHB 2M9GA 4CIDA 2GGMA 1E8AA 1HQVA 4ICBA 4ZCVA 2KSPA 2FCDA 2BL0C 1KSMA 4WRIA 1YX7A 2JTTA 2WCEA 2M1UA 1BR4B 1KWOB 1DJYA 4JWQA 5F6TA 1F8HA 1NP8A 2LP2A 2JT8A 1RJVA 2LVJA 1SR6C 3EK8A 3A8RA 4AQIA 1KFUS 3AKAA 1AJ4A 3C1VA 2HQWA 5DKQA 1KCYA 3FS7A 4DRWA 4OR9B 4YGBB 3TUYC 1QLKA 2JZIA 2MA2A 1NIWA 2AMIA 1XFZO 2OTGC 3A4UB 4PHNA 1K9KA 4N1GA 2O5GA 2LM5A 1NX2A 2WCFA 2ISDA 2D8NA 1B4CA 1XFUO 1TNXA 1SK6D 2L50A 4UPGA 3DF0B 3TDIA 1QXPA 1AK8A 5J3XA 4XYNA 3M0WA 2R2IA 1WY9A 3LK0A 4P2YB 4FTGA 2QPTA 3CS1A 1D1OA 4M2PA 2KGBC 5CSJA 2KQYA 1DJHA 1DGVA 1S36A 4USLA 2K61A 3EKJA 1TCFA 1AJ5A 3VRQA 3BUXB 2L4IA 3PATA 3AKBA 5D7FA 3KEVA 1PULA 1B8CA 1SYMA 4DIRA 2FJUB 2JRFA 4MLWA 1G33A 1QVIZ 1PVAA 1B1GA 1YUUA 1QASA 3LCPC 1N65A 1S3PA 2I7AA 4HREE 1DJGA 4OKHA 1OOJA 5AFPA 1EXRA 1DJWA 2JTZA 2KDHA 2EHBA 3VRPA 1NX0A 1QS7A 1N0YA 4CFRA 2AAOA 4MRYA 4FQOA 2Q91A 2K0JA 5DKRA 2KFFA 3IQOA 3CLNA 2B1UA 2KBMA 2M8UA 3RM1A 4DS7A 5KTYA 1Y1UA 2BE4A 1RECA 1WRKA 3NXAA 3CTNA 2JPTA 1MXEA 3I5GC 4XJKA 1DJXA 2PSRA 2ZNEA 4JQ0D 4MBEA 2JWWA 1MF8B 2LC5A 4GNKB 1M46A 4PE1A 2BCXA 1BU3A 1UWOA 1TNQA 5HKYA 2JOJA 1H4BA 1Q80A 1YUSA 4PALA 2BL0B 1KK7Y 1LXFC 1N2DA 1K9UA 2MAZA 5ER5A 1SCMB 1WDCC 1NCZA 2NXQA 1JFKA 2K7CA 1BODA 3TS5C 2PALA 1A75A 1FPWA 4E68A 5I2OA 4GFTA 2O60A 2F33A 2GGZA 3OP0A 2Y4QA 1AHRA 1S6JA 1XFYO 1YTZC 3PSRA 1GGZA 4QJ4B 2LVKA 2P6BB 1M31A 1M63B 1UUSA 2L4HA 1W7JB 1TNPA 3CR2A 4N5XA 3OB2B 4PHKA 2KBIA 4R1EA 3VRRA 1S1EA 2SASA 1UHKA 1SL8A 1W7IB 2Q4UA 3I5HC 4L9MA 1TCOB 2MLEC 1YURA 2LUCA 3FIAA 1NCYA 4NDBA 2ZN9A 4NQGA 5GQQC 3HCMA 3JTDC 4I5KA 2BECA 2L0PA 3I5FC 1EJ3A 2KI4C 1IJ5A 1NYAA 2LE9B 2BKIB 2LLTA 3EVUA 4YBHB 3TDZA 1RWYA 1SMGA 1JC2A 2WC8A 2F3ZA 1FW4A 2K2AA 3CZTX 3PN7C 2NCOA 1K2HA 1DGUA 1SNLA 2KGRA 3FWCA 1CB1A 2E30A 3OX5A 2ZKMX 1BOCA 4TNCA 1KQMC 2HQ8A 2LMUA 5I2QA 1WRLA 1QTXA 5HYDA 1M39A 1S6IA 5CSFA 3OX6A 1CFFA 1CFPA 1WLMA 5IBWA 1BR1B 1SW8A 3O78A 1F4OA 2WORA 3SG5A 2L51A 3EKHA 1B8LA 1BG1A 1IH0A 2K7OA 4PHJA 1CFDA 2AUCA 2L5XB 1SKTA 2M7LA 1AP4A 1QV0A 1XK4C 2KYCA 4XJKB 3WHTB 1OZOA 2F8PA 1UHNA 3NSLA 1BMOA 4CFQA 3MSEB 1ALWA 2KQ6A 1IJ6A 2ZRTA 1IGVA 4F0ZB 1UHJA 3NSKA 2BBNA 4MZJA 1IKUA 1GQMA 4N1FA 3KF9A 1K90D 4PDZA 1J1DA 1RK9A 3SIBA 1J7OA 1RROA 1EH2A 1NCXA 1B7TZ 2CNPA 2V53A 1FBVA 3ICBA 1G4YR 1JBAA 1HT9A 2LUXA 3F45A 4M2OA 1LA3A 4CPVA 3OHMB 1A75B 1TRFA 1L7ZA 1CM1A 5K89A 4MRXA 1UURA 3OB1B 4MN0A 4QJ3B 1IQ3A 4GGNA 1K95A 2LLUA 1G8IA 3CR4X 1PALA 4JPZB 1GJYA 4PE7A 1LA0A 1FI6A 1KK8B 2BBMA 2NLNA 2OS8B 1XO5A 1DF0A 4YGDB 4P5OE 1CDMA 1KFXS 1V1GA 3JVTC 3I5IB 2CT9A 1XA5A 5PALA 5KU1A 1XFXO 1CLLA 4WQ2A 3SJSA 1VRKA 3PLFB 4MZKA 5G08A 3SG2A 1U5IB 1JUOA 4YI9A 3TZ1A 1MUXA 1X02A 1C7WA 1QATA 1QVIY 1OMRA 3LL8B 2NCPA 2KFGA 1SBJA 4DUQA 1IG5A 3TDUA 4I5NB 4HRHA 4CLNA 1DT7B 2EC6C 3CR5X 3GK2A 4AQJA 1KQMB 1IQ5A 1ZFSA 4C0JA 2LNKA 1L2OB 2MBXA 3KO0A 2WOSA 3BUWB 1NWDA 1YRTB 2JNFA 2CXJA 1S26D 4HRGA 1TIZA 1UP5A 3WXAA 4C0LA 1ALVA 2M29A 3BUMB 1J7PA 1KWOC 1WLZA 1NX3A 1S5GZ 1QX2A 2JC2A 2JXLA 1KK7Z 2TN4A 3IF7A 1IWQA 2LHIA 5AANA 2LP3A 5I8NA 1SR6B 3DVKA 3HX4A 1MHOA 2MJWB 4MEWA 3TUYB 1SRAA 5CSIA 1A2XA 2JT3A 3FWBA 3PM8A 1MQ1A 4BY5A 2M3WA 2LHLA 2OTGB 1XFVO 2WCBA 5CSNA
chains in the Genus database with same CATH superfamily
1QX5B 1ORGA 4QJ5B 5FYXA 1FF1A 1ZOTB 1LVCD 3SS4A 2M7NA 3GK1A 1ZMZA 2GV5A 1MWNA 2M0RA 4GGFC 1AUIB 2CBLA 2KAXA 1NUBA 3B86A 3NHTA 1F54A 4PE0A 2K2FA 1S6CA 4NDCA 3PFVA 2LVVA 2HETA 2F2OA 3R1PA 2JXCA 2I18A 1KFUL 4OV2A 1EG3A 2KOTA 1A4PA 3RLZA 2E6WA 5KSZA 1J55A 2JULA 5D69A 5EL2A 1DF0B 4YRUA 2Y1NA 3VRNA 1SCVA 4PHMA 2KHNA 1SPYA 2BCBA 2G2BA 3DVEA 1JF0A 1SY9A 1K8UA 4INWA 1QX7A 2FOTA 2MLFC 1QIVA 4ETOA 1LKJA 1UHIA 2LMVA 1BLQA 1OZSA 2LVIA 4A4BA 1J7RA 1XK4A 3I5GB 1FI5A 1J7QA 3CZ0A 1YX8A 1F55A 1XYDA 1Y6WA 1BT6A 4YI8A 3LLEA 3VGOA 2HF5A 2K7DA 2VRGA 1OMVA 3H4SE 1DVIA 2A4JA 1OOHA 2I94A 1PSRA 5JOLA 2Y5IA 1Y1AA 5HLOA 1BF5A 1H8BA 1YUTA 2LLSA 1AVSA 1Y0VH 5HKZA 3WHUB 4D1EA 3E3RA 1C7VA 4YGCB 1KFXL 1CDPA 4BY4A 1JSAA 1WDCB 1JFJA 4MSPA 2ZN8A 1SCMC 1R2UA 3QRXA 3D0YA 3TS5B 2KI6D 2KLEA 1MR8A 3BQ3A 3SIAA 3O2PA 1YRUB 3PALA 2LV7A 1BJFA 2BNXA 3O6BA 1M45A 1CFCA 1CLMA 2KNEA 1B7TY 1KQVA 3GOFA 2COLB 4PE4A 1DJIA 1K93D 1RFJA 4MVFA 1F71A 2GTEA 5TNCA 1CM4A 2ZNDA 3D74A 2M49B 3I5HB 4ORAB 1NSHA 2LAPA 3CGAA 4PCWA 4WQ3A 2F3YA 2LMTA 4U8DA 2QEHA 5DICA 1Z4HA 4GAOA 3BOWA 3JTDB 4I5JA 1IRJA 2CTNA 3I5FB 2KI4B 4DCKA 1F70A 3NSOA 2KPHA 1C07A 1CKKA 2L2EA 1RTP1 5FI6A 5BPJA 1B8RA 3O4YA 1A03A 1CNPA 3PN7B 2SCPA 2WCJA 3GK4X 1XVJA 2M1KB 1JWDA 2PMYA 3D77A 2I2RE 3S0FA 3BJHA 3D76A 4OCIA 1OOIX 2K7BA 5AXIA 1CTRA 3BFBA 1Y1XA 3EK7A 1B9AA 1NPQA 1NX1A 1ODBA 4MZLA 1J1EA 1PRWA 3DVJA 3PJIA 3R1VA 1DEKA 2PRUA 1EL4A 3EVRA 3UO9A 1EG4A 5FI7A 2CCMA 3NGVA 1CDLA 1ZUZA 5AERA 3OGNA 2PASA 2PVBA 1PSBA 4HSZA 3D78A 1TOPA 5B8IB 1OSAA 3D73A 3CWGA 4JD9A 2F2PA 2P70A 1GGWA 1K94A 1TTXA 3B6XA 4ZCUA 3SG7A 3D10A 3SG3A 4AOMA 1TN4A 2MRDA 1QIWA 1A29A 3OBVA 1TUJA 2NZ0A 1PVBA 3BYAA 5ER4X 5JJGA 2H2KA 2KLDA 3WNXB 2QACA 4ORBB 3K21A 1S5GY 3SS5A 1V1FA 2IS9A 5CPVA 3BFHA 1K96A 3SG4A 4GPLB 2KI6C 3NSIA 4GUKA 3D75A 1SL7A 3DF0A 3SS3A 1SL9A 4GGFA 5DKNA 1CLBA 2JT0A 1DTLA 3KPXA 3D0YB 2FCEA 1CMFA 3BXKA 2ZRSA 5AEQA 2WCHA 3BUNB 2QEVA 1R6PA 2WNDA 4Q04A 3SG6A 2K8MB 2ZFDA 3LK1A 4M2QA 1QLSA 5I2LA 4YGEB 1OQPA 3ZNIA 1C3YA 2H61A 1CMGA 3EVVA 1B47A 1MXLC 1OOGA 2BCAA 1TNWA 2H61C 3PM2A 4A4CA 1DC1A 4I5LB 2MHHA 3AAJA 4ORCB 3DD4A 2EGDA 1C3ZA 3EK4A 1QV1A 2KYFA 2KAVA 3VROA 1KSOA 4GBAA 3KHEA 2DOQA 4YGAA 1YVLA 1KK8C 2OS8C 1K9PA 1WRZA 4IL1A 1LINA 3BUOB 3JVTB 2JQ6A 2KFHA 2JU0A 3IQQA 1TUZA 3I5IC 2LCPA 1UHHA 1OE9B 1JF2A 1OMDA 1ZACA 2KAYA 2RGIA 3BOWB 1U5IA 5HLVA 1XFWO 4C0KA 1QJTA 2HPSA 1DJZA 1F4QA 2Y1MA 1GM0A 2L98A 3DVMA 2LANA 3B88A 1CDNA 3CDNA 3CYZA 1YVHA 2OPOA 4OVNF 1YR5A 5HKWA 2M97A 3ZWHA 2EC6B 2G9BA 2BE6A 1PK0D 3RZSA 2JNXA 3AAKA 4NDDA 1DQEA 1L2OC 1DMOA 2BKHB 2M9GA 4CIDA 2GGMA 1E8AA 1HQVA 4ICBA 4ZCVA 2KSPA 2FCDA 3UNWA 2BL0C 1KSMA 4WRIA 1YX7A 2JTTA 2WCEA 2M1UA 1BR4B 1KWOB 1DJYA 2ERBA 4JWQA 5F6TA 1F8HA 1NP8A 2LP2A 2JT8A 3BFAA 1RJVA 2LVJA 1SR6C 3EK8A 3A8RA 4AQIA 1KFUS 3DY9A 3AKAA 1AJ4A 3C1VA 2HQWA 2K60A 5DKQA 1KCYA 3FS7A 4DRWA 4OR9B 4YGBB 3TUYC 1QLKA 2JZIA 2MA2A 1NIWA 2AMIA 1XFZO 2OTGC 3A4UB 4PHNA 1K9KA 4N1GA 2O5GA 2LM5A 1NX2A 2WCFA 2ISDA 2D8NA 1B4CA 1IIOA 1XFUO 1TNXA 1SK6D 2L50A 4UPGA 3DF0B 3TDIA 1QXPA 1AK8A 5J3XA 4XYNA 3M0WA 2R2IA 1WY9A 3LK0A 4P2YB 4FTGA 2QPTA 3CS1A 1D1OA 4M2PA 2KGBC 5CSJA 2KQYA 1DJHA 2PYQA 1DGVA 1S36A 4USLA 2K61A 3EKJA 1TCFA 1AJ5A 3VRQA 3BUXB 4IJ7A 2L4IA 3PATA 3AKBA 5D7FA 2QDIA 3KEVA 1PULA 1B8CA 1SYMA 4DIRA 2FJUB 2JRFA 4MLWA 1G33A 1QVIZ 1PVAA 2P71A 4FQTA 1B1GA 1YUUA 1QASA 3LCPC 1N65A 1S3PA 2I7AA 4HREE 1DJGA 4OKHA 1OOJA 5AFPA 1EXRA 1DJWA 2JTZA 2KDHA 2EHBA 3QMEA 3VRPA 1NX0A 1QS7A 1N0YA 4CFRA 2AAOA 5I94A 4MRYA 4FQOA 2Q91A 2K0JA 5DKRA 2JPOA 2KFFA 3IQOA 3CLNA 2B1UA 2KBMA 2M8UA 3RM1A 1Z2CB 3S0BA 1Y1UA 4DS7A 2BE4A 1RECA 5KTYA 1WRKA 3NXAA 3B87A 5FI2A 3CTNA 2JPTA 1MXEA 3I5GC 4XJKA 1DJXA 3CZ2A 2PSRA 2ZNEA 3V2LA 3EG5B 4JQ0D 4MBEA 2JWWA 1MF8B 2LC5A 4GNKB 1M46A 1QWVA 4PE1A 2BCXA 1BU3A 4JKTA 1UWOA 4INXA 1LS8A 1TNQA 5HKYA 2JOJA 1H4BA 1Q80A 3L47A 1YUSA 2PQLA 2BL0B 4PALA 1KK7Y 1LXFC 1N2DA 3R1OA 1K9UA 2MAZA 5ER5A 1SCMB 1WDCC 1NCZA 2NXQA 1JFKA 2K7CA 1BODA 3TS5C 2PALA 1A75A 1FPWA 1P28A 4E68A 5I2OA 4GFTA 2O60A 2F33A 2GGZA 3OP0A 3S0AA 2Y4QA 1AHRA 4KYNA 1S6JA 1XFYO 1YTZC 3PSRA 1GGZA 4QJ4B 2LVKA 2P6BB 1M31A 2BAPA 3CABA 1M63B 1UUSA 2L4HA 1W7JB 3VB1A 1TNPA 2WCKA 3CR2A 5D3OA 4N5XA 3OB2B 4PHKA 2KBIA 4R1EA 3VRRA 1S1EA 2L5YA 2SASA 1UHKA 1SL8A 1W7IB 2Q4UA 3I5HC 1TWOA 4L9MA 1TCOB 2MLEC 1YURA 2LUCA 3FIAA 1NCYA 3O4XA 2ZN9A 4NDBA 1T14A 4NQGA 5GQQC 3S0EA 3HCMA 3JTDC 4I5KA 2BECA 2L0PA 3I5FC 1EJ3A 2KI4C 1IJ5A 1NYAA 2LE9B 2BKIB 2LLTA 3EVUA 4YBHB 3TDZA 2WC5A 1RWYA 1SMGA 1JC2A 2WC8A 2F3ZA 1FW4A 2K2AA 3CZTX 3PN7C 2NCOA 1K2HA 4OZDA 1DGUA 1SNLA 2KGRA 3FWCA 1CB1A 2E30A 3OX5A 2ZKMX 1BOCA 4TNCA 1KQMC 2HQ8A 2LMUA 5I2QA 1WRLA 1QTXA 5HL1A 5HYDA 1M39A 1S6IA 5CSFA 3OX6A 1CFFA 1CFPA 1WLMA 5IBWA 1BR1B 1SW8A 3O78A 1F4OA 2WORA 3SG5A 2L51A 3EKHA 1B8LA 1BG1A 1IH0A 2K7OA 4PHJA 1CFDA 2AUCA 2L5XB 2WCLA 1SKTA 2M7LA 1AP4A 1QV0A 1XK4C 2KYCA 4XJKB 3WHTB 1OZOA 2F8PA 1UHNA 2L2CA 1BMOA 3NSLA 4CFQA 3MSEB 1ALWA 2KQ6A 2WCMA 1IJ6A 2ZRTA 1IGVA 1OW4A 4F0ZB 1UHJA 3NSKA 2BBNA 4MZJA 1IKUA 1GQMA 4N1FA 3KF9A 1K90D 4PDZA 1J1DA 1RK9A 3SIBA 1J7OA 1RROA 1EH2A 1NCXA 1B7TZ 2CNPA 2V53A 1FBVA 3ICBA 3FE9A 1G4YR 3N7HA 1JBAA 1HT9A 2LUXA 3F45A 4M2OA 1LA3A 1OOFA 4CPVA 1XFRA 3OHMB 1A75B 1TRFA 1L7ZA 1CM1A 5K89A 4MRXA 1UURA 3OB1B 2FJYA 4MN0A 4QJ3B 1IQ3A 4GGNA 1K95A 3FE8A 2LLUA 1DELA 1G8IA 3CR4X 1PALA 4JPZB 1GJYA 4PE7A 1LA0A 3DZTA 1SSEB 3FE6A 3Q8IA 2YGUA 3IVTA 1FI6A 1KK8B 2BBMA 2NLNA 2OS8B 1XO5A 1DF0A 3B7AA 2WC6A 4P5OE 1CDMA 2QEBA 4YGDB 1KFXS 1V1GA 3JVTC 3I5IB 2CT9A 1XA5A 5PALA 5KU1A 1XFXO 1CLLA 4WQ2A 3S0DA 3L4LA 1VRKA 3PLFB 4MZKA 3SJSA 5G08A 3SG2A 3DXLA 1U5IB 1JUOA 4YI9A 3TZ1A 1MUXA 1X02A 1C7WA 1QATA 1QVIY 1OMRA 3LL8B 2NCPA 2KFGA 3CZ1A 1SBJA 4DUQA 1IG5A 3TDUA 4I5NB 4HRHA 4CLNA 1DT7B 2EC6C 3CR5X 3GK2A 4AQJA 1KQMB 1IQ5A 1ZFSA 4C0JA 2LNKA 1L2OB 2MBXA 3KO0A 2WOSA 3BUWB 1NWDA 1YRTB 2JNFA 4PT1A 2CXJA 1S26D 3R72A 1TIZA 4HRGA 1UP5A 3WXAA 4F7FA 4C0LA 2QEOA 1ALVA 2M29A 3BUMB 1J7PA 1KWOC 1WLZA 1NX3A 1S5GZ 1QX2A 2JC2A 2JXLA 1KK7Z 2TN4A 3IF7A 1IWQA 2LHIA 5AANA 2LP3A 3L4AA 5I8NA 2H8VA 3NHIA 1SR6B 3DVKA 3K1EA 3HX4A 1MHOA 2MJWB 4MEWA 3TUYB 1SRAA 1W9ZA 5CSIA 1A2XA 2JT3A 3FWBA 3PM8A 3DYEA 1MQ1A 4BY5A 2M3WA 2LHLA 2OTGB 3S0GA 1XFVO 2WCBA 5CSNA
chains in the Genus database with same CATH topology
1QX5B 4QJ5B 5FYXA 1FF1A 1ZOTB 1LVCD 2M7NA 3GK1A 1ZMZA 2GV5A 1MWNA 2M0RA 4GGFC 1AUIB 2CBLA 2KAXA 1NUBA 1F54A 4PE0A 2K2FA 1S6CA 4NDCA 3PFVA 2LVVA 2HETA 2F2OA 2JXCA 2I18A 1KFUL 4OV2A 1EG3A 2KOTA 1A4PA 3RLZA 2E6WA 5KSZA 1J55A 2JULA 5D69A 1DF0B 4YRUA 2Y1NA 3VRNA 1SCVA 4PHMA 2KHNA 1SPYA 2BCBA 2G2BA 3DVEA 1JF0A 1SY9A 1K8UA 1QX7A 2FOTA 2MLFC 1QIVA 4ETOA 1LKJA 1UHIA 2LMVA 1BLQA 1OZSA 2LVIA 4A4BA 1J7RA 1XK4A 3I5GB 1FI5A 1J7QA 1YX8A 1F55A 1XYDA 1Y6WA 1BT6A 4YI8A 3LLEA 3VGOA 2HF5A 2K7DA 2VRGA 1OMVA 3H4SE 1DVIA 2A4JA 2I94A 1PSRA 5JOLA 2Y5IA 1Y1AA 5HLOA 1BF5A 1H8BA 1YUTA 2LLSA 1AVSA 1Y0VH 5HKZA 3WHUB 4D1EA 3E3RA 1C7VA 4YGCB 1KFXL 1CDPA 4BY4A 1JSAA 1WDCB 1JFJA 4MSPA 2ZN8A 1SCMC 1R2UA 3QRXA 3D0YA 3TS5B 2KI6D 1MR8A 3BQ3A 3SIAA 3O2PA 1YRUB 3PALA 2LV7A 1BJFA 3O6BA 1M45A 1CFCA 1CLMA 2KNEA 1B7TY 1KQVA 3GOFA 2COLB 4PE4A 1DJIA 1K93D 1RFJA 4MVFA 1F71A 5TNCA 1CM4A 2ZNDA 2M49B 3I5HB 4ORAB 1NSHA 2LAPA 3CGAA 4PCWA 4WQ3A 2F3YA 2LMTA 4U8DA 4GAOA 3BOWA 3JTDB 4I5JA 1IRJA 2CTNA 3I5FB 2KI4B 4DCKA 1F70A 3NSOA 1C07A 1CKKA 2L2EA 1RTP1 5BPJA 1B8RA 3O4YA 1A03A 1CNPA 3PN7B 2SCPA 3GK4X 1XVJA 2M1KB 1JWDA 2PMYA 2I2RE 4OCIA 2K7BA 5AXIA 1CTRA 1Y1XA 3EK7A 1B9AA 1NPQA 1NX1A 1ODBA 4MZLA 1J1EA 1PRWA 3DVJA 2PRUA 1EL4A 3EVRA 1EG4A 2CCMA 1CDLA 1ZUZA 5AERA 2PASA 2PVBA 1PSBA 4HSZA 1TOPA 5B8IB 1OSAA 3CWGA 2F2PA 1GGWA 1K94A 1TTXA 4ZCUA 3SG7A 3SG3A 3D10A 4AOMA 1TN4A 2MRDA 1QIWA 1A29A 2NZ0A 1PVBA 3BYAA 5ER4X 5JJGA 2H2KA 3WNXB 2QACA 4ORBB 3K21A 1S5GY 1V1FA 2IS9A 5CPVA 1K96A 3SG4A 4GPLB 2KI6C 3NSIA 4GUKA 1SL7A 3DF0A 1CLBA 1SL9A 4GGFA 5DKNA 2JT0A 1DTLA 3KPXA 3D0YB 2FCEA 1CMFA 3BXKA 2ZRSA 5AEQA 3BUNB 2WNDA 1R6PA 4Q04A 3SG6A 2K8MB 2ZFDA 3LK1A 4M2QA 1QLSA 5I2LA 4YGEB 1OQPA 3ZNIA 1CMGA 2H61A 3EVVA 1B47A 1MXLC 2BCAA 2H61C 1TNWA 4A4CA 4I5LB 2MHHA 3AAJA 4ORCB 3DD4A 2EGDA 3EK4A 1QV1A 2KYFA 2KAVA 3VROA 1KSOA 4GBAA 3KHEA 2DOQA 4YGAA 1YVLA 1KK8C 2OS8C 1K9PA 1WRZA 4IL1A 1LINA 3BUOB 3JVTB 2JQ6A 2KFHA 2JU0A 3IQQA 3I5IC 2LCPA 1UHHA 1OE9B 1JF2A 1OMDA 1ZACA 2KAYA 2RGIA 3BOWB 1U5IA 5HLVA 1XFWO 4C0KA 1QJTA 2HPSA 1DJZA 1F4QA 2Y1MA 2L98A 3DVMA 2LANA 1CDNA 5HKWA 1YVHA 2OPOA 4OVNF 1YR5A 2M97A 3ZWHA 2EC6B 2G9BA 2BE6A 1PK0D 2JNXA 3AAKA 4NDDA 1L2OC 1DMOA 2BKHB 2M9GA 4CIDA 2GGMA 1E8AA 1HQVA 4ICBA 4ZCVA 2KSPA 2FCDA 2BL0C 1KSMA 4WRIA 1YX7A 2JTTA 2WCEA 2M1UA 1BR4B 1KWOB 1DJYA 4JWQA 5F6TA 1F8HA 1NP8A 2LP2A 2JT8A 1RJVA 2LVJA 1SR6C 3EK8A 3A8RA 4AQIA 1KFUS 3AKAA 1AJ4A 3C1VA 2HQWA 5DKQA 1KCYA 3FS7A 4DRWA 4OR9B 4YGBB 3TUYC 1QLKA 2JZIA 2MA2A 1NIWA 2AMIA 1XFZO 2OTGC 3A4UB 4PHNA 1K9KA 4N1GA 2O5GA 2LM5A 1NX2A 2WCFA 2ISDA 2D8NA 1B4CA 1XFUO 1TNXA 1SK6D 2L50A 4UPGA 3DF0B 3TDIA 1QXPA 1AK8A 5J3XA 4XYNA 3M0WA 2R2IA 1WY9A 3LK0A 4P2YB 4FTGA 2QPTA 3CS1A 1D1OA 4M2PA 2KGBC 5CSJA 2KQYA 1DJHA 1DGVA 1S36A 4USLA 2K61A 3EKJA 1TCFA 1AJ5A 3VRQA 3BUXB 2L4IA 3PATA 3AKBA 5D7FA 3KEVA 1PULA 1B8CA 1SYMA 4DIRA 2FJUB 2JRFA 4MLWA 1G33A 1QVIZ 1PVAA 1B1GA 1YUUA 1QASA 3LCPC 1N65A 1S3PA 2I7AA 4HREE 1DJGA 4OKHA 1OOJA 5AFPA 1EXRA 1DJWA 2JTZA 2KDHA 2EHBA 3VRPA 1NX0A 1QS7A 1N0YA 4CFRA 2AAOA 4MRYA 4FQOA 2Q91A 2K0JA 5DKRA 2KFFA 3IQOA 3CLNA 2B1UA 2KBMA 2M8UA 3RM1A 4DS7A 5KTYA 1Y1UA 2BE4A 1RECA 1WRKA 3NXAA 3CTNA 2JPTA 1MXEA 3I5GC 4XJKA 1DJXA 2PSRA 2ZNEA 4JQ0D 4MBEA 2JWWA 1MF8B 2LC5A 4GNKB 1M46A 4PE1A 2BCXA 1BU3A 1UWOA 1TNQA 5HKYA 2JOJA 1H4BA 1Q80A 1YUSA 4PALA 2BL0B 1KK7Y 1LXFC 1N2DA 1K9UA 2MAZA 5ER5A 1SCMB 1WDCC 1NCZA 2NXQA 1JFKA 2K7CA 1BODA 3TS5C 2PALA 1A75A 1FPWA 4E68A 5I2OA 4GFTA 2O60A 2F33A 2GGZA 3OP0A 2Y4QA 1AHRA 1S6JA 1XFYO 1YTZC 3PSRA 1GGZA 4QJ4B 2LVKA 2P6BB 1M31A 1M63B 1UUSA 2L4HA 1W7JB 1TNPA 3CR2A 4N5XA 3OB2B 4PHKA 2KBIA 4R1EA 3VRRA 1S1EA 2SASA 1UHKA 1SL8A 1W7IB 2Q4UA 3I5HC 4L9MA 1TCOB 2MLEC 1YURA 2LUCA 3FIAA 1NCYA 4NDBA 2ZN9A 4NQGA 5GQQC 3HCMA 3JTDC 4I5KA 2BECA 2L0PA 3I5FC 1EJ3A 2KI4C 1IJ5A 1NYAA 2LE9B 2BKIB 2LLTA 3EVUA 4YBHB 3TDZA 1RWYA 1SMGA 1JC2A 2WC8A 2F3ZA 1FW4A 2K2AA 3CZTX 3PN7C 2NCOA 1K2HA 1DGUA 1SNLA 2KGRA 3FWCA 1CB1A 2E30A 3OX5A 2ZKMX 1BOCA 4TNCA 1KQMC 2HQ8A 2LMUA 5I2QA 1WRLA 1QTXA 5HYDA 1M39A 1S6IA 5CSFA 3OX6A 1CFFA 1CFPA 1WLMA 5IBWA 1BR1B 1SW8A 3O78A 1F4OA 2WORA 3SG5A 2L51A 3EKHA 1B8LA 1BG1A 1IH0A 2K7OA 4PHJA 1CFDA 2AUCA 2L5XB 1SKTA 2M7LA 1AP4A 1QV0A 1XK4C 2KYCA 4XJKB 3WHTB 1OZOA 2F8PA 1UHNA 3NSLA 1BMOA 4CFQA 3MSEB 1ALWA 2KQ6A 1IJ6A 2ZRTA 1IGVA 4F0ZB 1UHJA 3NSKA 2BBNA 4MZJA 1IKUA 1GQMA 4N1FA 3KF9A 1K90D 4PDZA 1J1DA 1RK9A 3SIBA 1J7OA 1RROA 1EH2A 1NCXA 1B7TZ 2CNPA 2V53A 1FBVA 3ICBA 1G4YR 1JBAA 1HT9A 2LUXA 3F45A 4M2OA 1LA3A 4CPVA 3OHMB 1A75B 1TRFA 1L7ZA 1CM1A 5K89A 4MRXA 1UURA 3OB1B 4MN0A 4QJ3B 1IQ3A 4GGNA 1K95A 2LLUA 1G8IA 3CR4X 1PALA 4JPZB 1GJYA 4PE7A 1LA0A 1FI6A 1KK8B 2BBMA 2NLNA 2OS8B 1XO5A 1DF0A 4YGDB 4P5OE 1CDMA 1KFXS 1V1GA 3JVTC 3I5IB 2CT9A 1XA5A 5PALA 5KU1A 1XFXO 1CLLA 4WQ2A 3SJSA 1VRKA 3PLFB 4MZKA 5G08A 3SG2A 1U5IB 1JUOA 4YI9A 3TZ1A 1MUXA 1X02A 1C7WA 1QATA 1QVIY 1OMRA 3LL8B 2NCPA 2KFGA 1SBJA 4DUQA 1IG5A 3TDUA 4I5NB 4HRHA 4CLNA 1DT7B 2EC6C 3CR5X 3GK2A 4AQJA 1KQMB 1IQ5A 1ZFSA 4C0JA 2LNKA 1L2OB 2MBXA 3KO0A 2WOSA 3BUWB 1NWDA 1YRTB 2JNFA 2CXJA 1S26D 4HRGA 1TIZA 1UP5A 3WXAA 4C0LA 1ALVA 2M29A 3BUMB 1J7PA 1KWOC 1WLZA 1NX3A 1S5GZ 1QX2A 2JC2A 2JXLA 1KK7Z 2TN4A 3IF7A 1IWQA 2LHIA 5AANA 2LP3A 5I8NA 1SR6B 3DVKA 3HX4A 1MHOA 2MJWB 4MEWA 3TUYB 1SRAA 5CSIA 1A2XA 2JT3A 3FWBA 3PM8A 1MQ1A 4BY5A 2M3WA 2LHLA 2OTGB 1XFVO 2WCBA 5CSNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QX5 B;  4QJ5 B;  5FYX A;  1FF1 A;  1ZOT B;  1LVC D;  2M7N A;  3GK1 A;  1ZMZ A;  2GV5 A;  1MWN A;  2M0R A;  4GGF C;  1AUI B;  2CBL A;  2KAX A;  1NUB A;  1F54 A;  4PE0 A;  2K2F A;  1S6C A;  4NDC A;  3PFV A;  2LVV A;  2HET A;  2F2O A;  2JXC A;  2I18 A;  1KFU L;  4OV2 A;  1EG3 A;  2KOT A;  1A4P A;  3RLZ A;  2E6W A;  5KSZ A;  1J55 A;  2JUL A;  5D69 A;  1DF0 B;  4YRU A;  2Y1N A;  3VRN A;  1SCV A;  4PHM A;  2KHN A;  1SPY A;  2BCB A;  2G2B A;  3DVE A;  1JF0 A;  1SY9 A;  1K8U A;  1QX7 A;  2FOT A;  2MLF C;  1QIV A;  4ETO A;  1LKJ A;  1UHI A;  2LMV A;  1BLQ A;  1OZS A;  2LVI A;  4A4B A;  1J7R A;  1XK4 A;  3I5G B;  1FI5 A;  1J7Q A;  1YX8 A;  1F55 A;  1XYD A;  1Y6W A;  1BT6 A;  4YI8 A;  3LLE A;  3VGO A;  2HF5 A;  2K7D A;  2VRG A;  1OMV A;  3H4S E;  1DVI A;  2A4J A;  2I94 A;  1PSR A;  5JOL A;  2Y5I A;  1Y1A A;  5HLO A;  1BF5 A;  1H8B A;  1YUT A;  2LLS A;  1AVS A;  1Y0V H;  5HKZ A;  3WHU B;  4D1E A;  3E3R A;  1C7V A;  4YGC B;  1KFX L;  1CDP A;  4BY4 A;  1JSA A;  1WDC B;  1JFJ A;  4MSP A;  2ZN8 A;  1SCM C;  1R2U A;  3QRX A;  3D0Y A;  3TS5 B;  2KI6 D;  1MR8 A;  3BQ3 A;  3SIA A;  3O2P A;  1YRU B;  3PAL A;  2LV7 A;  1BJF A;  3O6B A;  1M45 A;  1CFC A;  1CLM A;  2KNE A;  1B7T Y;  1KQV A;  3GOF A;  2COL B;  4PE4 A;  1DJI A;  1K93 D;  1RFJ A;  4MVF A;  1F71 A;  5TNC A;  1CM4 A;  2ZND A;  2M49 B;  3I5H B;  4ORA B;  1NSH A;  2LAP A;  3CGA A;  4PCW A;  4WQ3 A;  2F3Y A;  2LMT A;  4U8D A;  4GAO A;  3BOW A;  3JTD B;  4I5J A;  1IRJ A;  2CTN A;  3I5F B;  2KI4 B;  4DCK A;  1F70 A;  3NSO A;  1C07 A;  1CKK A;  2L2E A;  1RTP 1;  5BPJ A;  1B8R A;  3O4Y A;  1A03 A;  1CNP A;  3PN7 B;  2SCP A;  3GK4 X;  1XVJ A;  2M1K B;  1JWD A;  2PMY A;  2I2R E;  4OCI A;  2K7B A;  5AXI A;  1CTR A;  1Y1X A;  3EK7 A;  1B9A A;  1NPQ A;  1NX1 A;  1ODB A;  4MZL A;  1J1E A;  1PRW A;  3DVJ A;  2PRU A;  1EL4 A;  3EVR A;  1EG4 A;  2CCM A;  1CDL A;  1ZUZ A;  5AER A;  2PAS A;  2PVB A;  1PSB A;  4HSZ A;  1TOP A;  5B8I B;  1OSA A;  3CWG A;  2F2P A;  1GGW A;  1K94 A;  1TTX A;  4ZCU A;  3SG7 A;  3SG3 A;  3D10 A;  4AOM A;  1TN4 A;  2MRD A;  1QIW A;  1A29 A;  2NZ0 A;  1PVB A;  3BYA A;  5ER4 X;  5JJG A;  2H2K A;  3WNX B;  2QAC A;  4ORB B;  3K21 A;  1S5G Y;  1V1F A;  2IS9 A;  5CPV A;  1K96 A;  3SG4 A;  4GPL B;  2KI6 C;  3NSI A;  4GUK A;  1SL7 A;  3DF0 A;  1CLB A;  1SL9 A;  4GGF A;  5DKN A;  2JT0 A;  1DTL A;  3KPX A;  3D0Y B;  2FCE A;  1CMF A;  3BXK A;  2ZRS A;  5AEQ A;  3BUN B;  2WND A;  1R6P A;  4Q04 A;  3SG6 A;  2K8M B;  2ZFD A;  3LK1 A;  4M2Q A;  1QLS A;  5I2L A;  4YGE B;  1OQP A;  3ZNI A;  1CMG A;  2H61 A;  3EVV A;  1B47 A;  1MXL C;  2BCA A;  2H61 C;  1TNW A;  4A4C A;  4I5L B;  2MHH A;  3AAJ A;  4ORC B;  3DD4 A;  2EGD A;  3EK4 A;  1QV1 A;  2KYF A;  2KAV A;  3VRO A;  1KSO A;  4GBA A;  3KHE A;  2DOQ A;  4YGA A;  1YVL A;  1KK8 C;  2OS8 C;  1K9P A;  1WRZ A;  4IL1 A;  1LIN A;  3BUO B;  3JVT B;  2JQ6 A;  2KFH A;  2JU0 A;  3IQQ A;  3I5I C;  2LCP A;  1UHH A;  1OE9 B;  1JF2 A;  1OMD A;  1ZAC A;  2KAY A;  2RGI A;  3BOW B;  1U5I A;  5HLV A;  1XFW O;  4C0K A;  1QJT A;  2HPS A;  1DJZ A;  1F4Q A;  2Y1M A;  2L98 A;  3DVM A;  2LAN A;  1CDN A;  5HKW A;  1YVH A;  2OPO A;  4OVN F;  1YR5 A;  2M97 A;  3ZWH A;  2EC6 B;  2G9B A;  2BE6 A;  1PK0 D;  2JNX A;  3AAK A;  4NDD A;  1L2O C;  1DMO A;  2BKH B;  2M9G A;  4CID A;  2GGM A;  1E8A A;  1HQV A;  4ICB A;  4ZCV A;  2KSP A;  2FCD A;  2BL0 C;  1KSM A;  4WRI A;  1YX7 A;  2JTT A;  2WCE A;  2M1U A;  1BR4 B;  1KWO B;  1DJY A;  4JWQ A;  5F6T A;  1F8H A;  1NP8 A;  2LP2 A;  2JT8 A;  1RJV A;  2LVJ A;  1SR6 C;  3EK8 A;  3A8R A;  4AQI A;  1KFU S;  3AKA A;  1AJ4 A;  3C1V A;  2HQW A;  5DKQ A;  1KCY A;  3FS7 A;  4DRW A;  4OR9 B;  4YGB B;  3TUY C;  1QLK A;  2JZI A;  2MA2 A;  1NIW A;  2AMI A;  1XFZ O;  2OTG C;  3A4U B;  4PHN A;  1K9K A;  4N1G A;  2O5G A;  2LM5 A;  1NX2 A;  2WCF A;  2ISD A;  2D8N A;  1B4C A;  1XFU O;  1TNX A;  1SK6 D;  2L50 A;  4UPG A;  3DF0 B;  3TDI A;  1QXP A;  1AK8 A;  5J3X A;  4XYN A;  3M0W A;  2R2I A;  1WY9 A;  3LK0 A;  4P2Y B;  4FTG A;  2QPT A;  3CS1 A;  1D1O A;  4M2P A;  2KGB C;  5CSJ A;  2KQY A;  1DJH A;  1DGV A;  1S36 A;  4USL A;  2K61 A;  3EKJ A;  1TCF A;  1AJ5 A;  3VRQ A;  3BUX B;  2L4I A;  3PAT A;  3AKB A;  5D7F A;  3KEV A;  1PUL A;  1B8C A;  1SYM A;  4DIR A;  2FJU B;  2JRF A;  4MLW A;  1G33 A;  1QVI Z;  1PVA A;  1B1G A;  1YUU A;  1QAS A;  3LCP C;  1N65 A;  1S3P A;  2I7A A;  4HRE E;  1DJG A;  4OKH A;  1OOJ A;  5AFP A;  1EXR A;  1DJW A;  2JTZ A;  2KDH A;  2EHB A;  3VRP A;  1NX0 A;  1QS7 A;  1N0Y A;  4CFR A;  2AAO A;  4MRY A;  4FQO A;  2Q91 A;  2K0J A;  5DKR A;  2KFF A;  3IQO A;  3CLN A;  2B1U A;  2KBM A;  2M8U A;  3RM1 A;  4DS7 A;  5KTY A;  1Y1U A;  2BE4 A;  1REC A;  1WRK A;  3NXA A;  3CTN A;  2JPT A;  1MXE A;  3I5G C;  4XJK A;  1DJX A;  2PSR A;  2ZNE A;  4JQ0 D;  4MBE A;  2JWW A;  1MF8 B;  2LC5 A;  4GNK B;  1M46 A;  4PE1 A;  2BCX A;  1BU3 A;  1UWO A;  1TNQ A;  5HKY A;  2JOJ A;  1H4B A;  1Q80 A;  1YUS A;  4PAL A;  2BL0 B;  1KK7 Y;  1LXF C;  1N2D A;  1K9U A;  2MAZ A;  5ER5 A;  1SCM B;  1WDC C;  1NCZ A;  2NXQ A;  1JFK A;  2K7C A;  1BOD A;  3TS5 C;  2PAL A;  1A75 A;  1FPW A;  4E68 A;  5I2O A;  4GFT A;  2O60 A;  2F33 A;  2GGZ A;  3OP0 A;  2Y4Q A;  1AHR A;  1S6J A;  1XFY O;  1YTZ C;  3PSR A;  1GGZ A;  4QJ4 B;  2LVK A;  2P6B B;  1M31 A;  1M63 B;  1UUS A;  2L4H A;  1W7J B;  1TNP A;  3CR2 A;  4N5X A;  3OB2 B;  4PHK A;  2KBI A;  4R1E A;  3VRR A;  1S1E A;  2SAS A;  1UHK A;  1SL8 A;  1W7I B;  2Q4U A;  3I5H C;  4L9M A;  1TCO B;  2MLE C;  1YUR A;  2LUC A;  3FIA A;  1NCY A;  4NDB A;  2ZN9 A;  4NQG A;  5GQQ C;  3HCM A;  3JTD C;  4I5K A;  2BEC A;  2L0P A;  3I5F C;  1EJ3 A;  2KI4 C;  1IJ5 A;  1NYA A;  2LE9 B;  2BKI B;  2LLT A;  3EVU A;  4YBH B;  3TDZ A;  1RWY A;  1SMG A;  1JC2 A;  2WC8 A;  2F3Z A;  1FW4 A;  2K2A A;  3CZT X;  3PN7 C;  2NCO A;  1K2H A;  1DGU A;  1SNL A;  2KGR A;  3FWC A;  1CB1 A;  2E30 A;  3OX5 A;  2ZKM X;  1BOC A;  4TNC A;  1KQM C;  2HQ8 A;  2LMU A;  5I2Q A;  1WRL A;  1QTX A;  5HYD A;  1M39 A;  1S6I A;  5CSF A;  3OX6 A;  1CFF A;  1CFP A;  1WLM A;  5IBW A;  1BR1 B;  1SW8 A;  3O78 A;  1F4O A;  2WOR A;  3SG5 A;  2L51 A;  3EKH A;  1B8L A;  1BG1 A;  1IH0 A;  2K7O A;  4PHJ A;  1CFD A;  2AUC A;  2L5X B;  1SKT A;  2M7L A;  1AP4 A;  1QV0 A;  1XK4 C;  2KYC A;  4XJK B;  3WHT B;  1OZO A;  2F8P A;  1UHN A;  3NSL A;  1BMO A;  4CFQ A;  3MSE B;  1ALW A;  2KQ6 A;  1IJ6 A;  2ZRT A;  1IGV A;  4F0Z B;  1UHJ A;  3NSK A;  2BBN A;  4MZJ A;  1IKU A;  1GQM A;  4N1F A;  3KF9 A;  1K90 D;  4PDZ A;  1J1D A;  1RK9 A;  3SIB A;  1J7O A;  1RRO A;  1EH2 A;  1NCX A;  1B7T Z;  2CNP A;  2V53 A;  1FBV A;  3ICB A;  1G4Y R;  1JBA A;  1HT9 A;  2LUX A;  3F45 A;  4M2O A;  1LA3 A;  4CPV A;  3OHM B;  1A75 B;  1TRF A;  1L7Z A;  1CM1 A;  5K89 A;  4MRX A;  1UUR A;  3OB1 B;  4MN0 A;  4QJ3 B;  1IQ3 A;  4GGN A;  1K95 A;  2LLU A;  1G8I A;  3CR4 X;  1PAL A;  4JPZ B;  1GJY A;  4PE7 A;  1LA0 A;  1FI6 A;  1KK8 B;  2BBM A;  2NLN A;  2OS8 B;  1XO5 A;  1DF0 A;  4YGD B;  4P5O E;  1CDM A;  1KFX S;  1V1G A;  3JVT C;  3I5I B;  2CT9 A;  1XA5 A;  5PAL A;  5KU1 A;  1XFX O;  1CLL A;  4WQ2 A;  3SJS A;  1VRK A;  3PLF B;  4MZK A;  5G08 A;  3SG2 A;  1U5I B;  1JUO A;  4YI9 A;  3TZ1 A;  1MUX A;  1X02 A;  1C7W A;  1QAT A;  1QVI Y;  1OMR A;  3LL8 B;  2NCP A;  2KFG A;  1SBJ A;  4DUQ A;  1IG5 A;  3TDU A;  4I5N B;  4HRH A;  4CLN A;  1DT7 B;  2EC6 C;  3CR5 X;  3GK2 A;  4AQJ A;  1KQM B;  1IQ5 A;  1ZFS A;  4C0J A;  2LNK A;  1L2O B;  2MBX A;  3KO0 A;  2WOS A;  3BUW B;  1NWD A;  1YRT B;  2JNF A;  2CXJ A;  1S26 D;  4HRG A;  1TIZ A;  1UP5 A;  3WXA A;  4C0L A;  1ALV A;  2M29 A;  3BUM B;  1J7P A;  1KWO C;  1WLZ A;  1NX3 A;  1S5G Z;  1QX2 A;  2JC2 A;  2JXL A;  1KK7 Z;  2TN4 A;  3IF7 A;  1IWQ A;  2LHI A;  5AAN A;  2LP3 A;  5I8N A;  1SR6 B;  3DVK A;  3HX4 A;  1MHO A;  2MJW B;  4MEW A;  3TUY B;  1SRA A;  5CSI A;  1A2X A;  2JT3 A;  3FWB A;  3PM8 A;  1MQ1 A;  4BY5 A;  2M3W A;  2LHL A;  2OTG B;  1XFV O;  2WCB A;  5CSN A; 
#chains in the Genus database with same CATH topology
 1QX5 B;  1ORG A;  4QJ5 B;  5FYX A;  1FF1 A;  1ZOT B;  1LVC D;  3SS4 A;  2M7N A;  3GK1 A;  1ZMZ A;  2GV5 A;  1MWN A;  2M0R A;  4GGF C;  1AUI B;  2CBL A;  2KAX A;  1NUB A;  3B86 A;  3NHT A;  1F54 A;  4PE0 A;  2K2F A;  1S6C A;  4NDC A;  3PFV A;  2LVV A;  2HET A;  2F2O A;  3R1P A;  2JXC A;  2I18 A;  1KFU L;  4OV2 A;  1EG3 A;  2KOT A;  1A4P A;  3RLZ A;  2E6W A;  5KSZ A;  1J55 A;  2JUL A;  5D69 A;  5EL2 A;  1DF0 B;  4YRU A;  2Y1N A;  3VRN A;  1SCV A;  4PHM A;  2KHN A;  1SPY A;  2BCB A;  2G2B A;  3DVE A;  1JF0 A;  1SY9 A;  1K8U A;  4INW A;  1QX7 A;  2FOT A;  2MLF C;  1QIV A;  4ETO A;  1LKJ A;  1UHI A;  2LMV A;  1BLQ A;  1OZS A;  2LVI A;  4A4B A;  1J7R A;  1XK4 A;  3I5G B;  1FI5 A;  1J7Q A;  3CZ0 A;  1YX8 A;  1F55 A;  1XYD A;  1Y6W A;  1BT6 A;  4YI8 A;  3LLE A;  3VGO A;  2HF5 A;  2K7D A;  2VRG A;  1OMV A;  3H4S E;  1DVI A;  2A4J A;  1OOH A;  2I94 A;  1PSR A;  5JOL A;  2Y5I A;  1Y1A A;  5HLO A;  1BF5 A;  1H8B A;  1YUT A;  2LLS A;  1AVS A;  1Y0V H;  5HKZ A;  3WHU B;  4D1E A;  3E3R A;  1C7V A;  4YGC B;  1KFX L;  1CDP A;  4BY4 A;  1JSA A;  1WDC B;  1JFJ A;  4MSP A;  2ZN8 A;  1SCM C;  1R2U A;  3QRX A;  3D0Y A;  3TS5 B;  2KI6 D;  2KLE A;  1MR8 A;  3BQ3 A;  3SIA A;  3O2P A;  1YRU B;  3PAL A;  2LV7 A;  1BJF A;  2BNX A;  3O6B A;  1M45 A;  1CFC A;  1CLM A;  2KNE A;  1B7T Y;  1KQV A;  3GOF A;  2COL B;  4PE4 A;  1DJI A;  1K93 D;  1RFJ A;  4MVF A;  1F71 A;  2GTE A;  5TNC A;  1CM4 A;  2ZND A;  3D74 A;  2M49 B;  3I5H B;  4ORA B;  1NSH A;  2LAP A;  3CGA A;  4PCW A;  4WQ3 A;  2F3Y A;  2LMT A;  4U8D A;  2QEH A;  5DIC A;  1Z4H A;  4GAO A;  3BOW A;  3JTD B;  4I5J A;  1IRJ A;  2CTN A;  3I5F B;  2KI4 B;  4DCK A;  1F70 A;  3NSO A;  2KPH A;  1C07 A;  1CKK A;  2L2E A;  1RTP 1;  5FI6 A;  5BPJ A;  1B8R A;  3O4Y A;  1A03 A;  1CNP A;  3PN7 B;  2SCP A;  2WCJ A;  3GK4 X;  1XVJ A;  2M1K B;  1JWD A;  2PMY A;  3D77 A;  2I2R E;  3S0F A;  3BJH A;  3D76 A;  4OCI A;  1OOI X;  2K7B A;  5AXI A;  1CTR A;  3BFB A;  1Y1X A;  3EK7 A;  1B9A A;  1NPQ A;  1NX1 A;  1ODB A;  4MZL A;  1J1E A;  1PRW A;  3DVJ A;  3PJI A;  3R1V A;  1DEK A;  2PRU A;  1EL4 A;  3EVR A;  3UO9 A;  1EG4 A;  5FI7 A;  2CCM A;  3NGV A;  1CDL A;  1ZUZ A;  5AER A;  3OGN A;  2PAS A;  2PVB A;  1PSB A;  4HSZ A;  3D78 A;  1TOP A;  5B8I B;  1OSA A;  3D73 A;  3CWG A;  4JD9 A;  2F2P A;  2P70 A;  1GGW A;  1K94 A;  1TTX A;  3B6X A;  4ZCU A;  3SG7 A;  3D10 A;  3SG3 A;  4AOM A;  1TN4 A;  2MRD A;  1QIW A;  1A29 A;  3OBV A;  1TUJ A;  2NZ0 A;  1PVB A;  3BYA A;  5ER4 X;  5JJG A;  2H2K A;  2KLD A;  3WNX B;  2QAC A;  4ORB B;  3K21 A;  1S5G Y;  3SS5 A;  1V1F A;  2IS9 A;  5CPV A;  3BFH A;  1K96 A;  3SG4 A;  4GPL B;  2KI6 C;  3NSI A;  4GUK A;  3D75 A;  1SL7 A;  3DF0 A;  3SS3 A;  1SL9 A;  4GGF A;  5DKN A;  1CLB A;  2JT0 A;  1DTL A;  3KPX A;  3D0Y B;  2FCE A;  1CMF A;  3BXK A;  2ZRS A;  5AEQ A;  2WCH A;  3BUN B;  2QEV A;  1R6P A;  2WND A;  4Q04 A;  3SG6 A;  2K8M B;  2ZFD A;  3LK1 A;  4M2Q A;  1QLS A;  5I2L A;  4YGE B;  1OQP A;  3ZNI A;  1C3Y A;  2H61 A;  1CMG A;  3EVV A;  1B47 A;  1MXL C;  1OOG A;  2BCA A;  1TNW A;  2H61 C;  3PM2 A;  4A4C A;  1DC1 A;  4I5L B;  2MHH A;  3AAJ A;  4ORC B;  3DD4 A;  2EGD A;  1C3Z A;  3EK4 A;  1QV1 A;  2KYF A;  2KAV A;  3VRO A;  1KSO A;  4GBA A;  3KHE A;  2DOQ A;  4YGA A;  1YVL A;  1KK8 C;  2OS8 C;  1K9P A;  1WRZ A;  4IL1 A;  1LIN A;  3BUO B;  3JVT B;  2JQ6 A;  2KFH A;  2JU0 A;  3IQQ A;  1TUZ A;  3I5I C;  2LCP A;  1UHH A;  1OE9 B;  1JF2 A;  1OMD A;  1ZAC A;  2KAY A;  2RGI A;  3BOW B;  1U5I A;  5HLV A;  1XFW O;  4C0K A;  1QJT A;  2HPS A;  1DJZ A;  1F4Q A;  2Y1M A;  1GM0 A;  2L98 A;  3DVM A;  2LAN A;  3B88 A;  1CDN A;  3CDN A;  3CYZ A;  1YVH A;  2OPO A;  4OVN F;  1YR5 A;  5HKW A;  2M97 A;  3ZWH A;  2EC6 B;  2G9B A;  2BE6 A;  1PK0 D;  3RZS A;  2JNX A;  3AAK A;  4NDD A;  1DQE A;  1L2O C;  1DMO A;  2BKH B;  2M9G A;  4CID A;  2GGM A;  1E8A A;  1HQV A;  4ICB A;  4ZCV A;  2KSP A;  2FCD A;  3UNW A;  2BL0 C;  1KSM A;  4WRI A;  1YX7 A;  2JTT A;  2WCE A;  2M1U A;  1BR4 B;  1KWO B;  1DJY A;  2ERB A;  4JWQ A;  5F6T A;  1F8H A;  1NP8 A;  2LP2 A;  2JT8 A;  3BFA A;  1RJV A;  2LVJ A;  1SR6 C;  3EK8 A;  3A8R A;  4AQI A;  1KFU S;  3DY9 A;  3AKA A;  1AJ4 A;  3C1V A;  2HQW A;  2K60 A;  5DKQ A;  1KCY A;  3FS7 A;  4DRW A;  4OR9 B;  4YGB B;  3TUY C;  1QLK A;  2JZI A;  2MA2 A;  1NIW A;  2AMI A;  1XFZ O;  2OTG C;  3A4U B;  4PHN A;  1K9K A;  4N1G A;  2O5G A;  2LM5 A;  1NX2 A;  2WCF A;  2ISD A;  2D8N A;  1B4C A;  1IIO A;  1XFU O;  1TNX A;  1SK6 D;  2L50 A;  4UPG A;  3DF0 B;  3TDI A;  1QXP A;  1AK8 A;  5J3X A;  4XYN A;  3M0W A;  2R2I A;  1WY9 A;  3LK0 A;  4P2Y B;  4FTG A;  2QPT A;  3CS1 A;  1D1O A;  4M2P A;  2KGB C;  5CSJ A;  2KQY A;  1DJH A;  2PYQ A;  1DGV A;  1S36 A;  4USL A;  2K61 A;  3EKJ A;  1TCF A;  1AJ5 A;  3VRQ A;  3BUX B;  4IJ7 A;  2L4I A;  3PAT A;  3AKB A;  5D7F A;  2QDI A;  3KEV A;  1PUL A;  1B8C A;  1SYM A;  4DIR A;  2FJU B;  2JRF A;  4MLW A;  1G33 A;  1QVI Z;  1PVA A;  2P71 A;  4FQT A;  1B1G A;  1YUU A;  1QAS A;  3LCP C;  1N65 A;  1S3P A;  2I7A A;  4HRE E;  1DJG A;  4OKH A;  1OOJ A;  5AFP A;  1EXR A;  1DJW A;  2JTZ A;  2KDH A;  2EHB A;  3QME A;  3VRP A;  1NX0 A;  1QS7 A;  1N0Y A;  4CFR A;  2AAO A;  5I94 A;  4MRY A;  4FQO A;  2Q91 A;  2K0J A;  5DKR A;  2JPO A;  2KFF A;  3IQO A;  3CLN A;  2B1U A;  2KBM A;  2M8U A;  3RM1 A;  1Z2C B;  3S0B A;  1Y1U A;  4DS7 A;  2BE4 A;  1REC A;  5KTY A;  1WRK A;  3NXA A;  3B87 A;  5FI2 A;  3CTN A;  2JPT A;  1MXE A;  3I5G C;  4XJK A;  1DJX A;  3CZ2 A;  2PSR A;  2ZNE A;  3V2L A;  3EG5 B;  4JQ0 D;  4MBE A;  2JWW A;  1MF8 B;  2LC5 A;  4GNK B;  1M46 A;  1QWV A;  4PE1 A;  2BCX A;  1BU3 A;  4JKT A;  1UWO A;  4INX A;  1LS8 A;  1TNQ A;  5HKY A;  2JOJ A;  1H4B A;  1Q80 A;  3L47 A;  1YUS A;  2PQL A;  2BL0 B;  4PAL A;  1KK7 Y;  1LXF C;  1N2D A;  3R1O A;  1K9U A;  2MAZ A;  5ER5 A;  1SCM B;  1WDC C;  1NCZ A;  2NXQ A;  1JFK A;  2K7C A;  1BOD A;  3TS5 C;  2PAL A;  1A75 A;  1FPW A;  1P28 A;  4E68 A;  5I2O A;  4GFT A;  2O60 A;  2F33 A;  2GGZ A;  3OP0 A;  3S0A A;  2Y4Q A;  1AHR A;  4KYN A;  1S6J A;  1XFY O;  1YTZ C;  3PSR A;  1GGZ A;  4QJ4 B;  2LVK A;  2P6B B;  1M31 A;  2BAP A;  3CAB A;  1M63 B;  1UUS A;  2L4H A;  1W7J B;  3VB1 A;  1TNP A;  2WCK A;  3CR2 A;  5D3O A;  4N5X A;  3OB2 B;  4PHK A;  2KBI A;  4R1E A;  3VRR A;  1S1E A;  2L5Y A;  2SAS A;  1UHK A;  1SL8 A;  1W7I B;  2Q4U A;  3I5H C;  1TWO A;  4L9M A;  1TCO B;  2MLE C;  1YUR A;  2LUC A;  3FIA A;  1NCY A;  3O4X A;  2ZN9 A;  4NDB A;  1T14 A;  4NQG A;  5GQQ C;  3S0E A;  3HCM A;  3JTD C;  4I5K A;  2BEC A;  2L0P A;  3I5F C;  1EJ3 A;  2KI4 C;  1IJ5 A;  1NYA A;  2LE9 B;  2BKI B;  2LLT A;  3EVU A;  4YBH B;  3TDZ A;  2WC5 A;  1RWY A;  1SMG A;  1JC2 A;  2WC8 A;  2F3Z A;  1FW4 A;  2K2A A;  3CZT X;  3PN7 C;  2NCO A;  1K2H A;  4OZD A;  1DGU A;  1SNL A;  2KGR A;  3FWC A;  1CB1 A;  2E30 A;  3OX5 A;  2ZKM X;  1BOC A;  4TNC A;  1KQM C;  2HQ8 A;  2LMU A;  5I2Q A;  1WRL A;  1QTX A;  5HL1 A;  5HYD A;  1M39 A;  1S6I A;  5CSF A;  3OX6 A;  1CFF A;  1CFP A;  1WLM A;  5IBW A;  1BR1 B;  1SW8 A;  3O78 A;  1F4O A;  2WOR A;  3SG5 A;  2L51 A;  3EKH A;  1B8L A;  1BG1 A;  1IH0 A;  2K7O A;  4PHJ A;  1CFD A;  2AUC A;  2L5X B;  2WCL A;  1SKT A;  2M7L A;  1AP4 A;  1QV0 A;  1XK4 C;  2KYC A;  4XJK B;  3WHT B;  1OZO A;  2F8P A;  1UHN A;  2L2C A;  1BMO A;  3NSL A;  4CFQ A;  3MSE B;  1ALW A;  2KQ6 A;  2WCM A;  1IJ6 A;  2ZRT A;  1IGV A;  1OW4 A;  4F0Z B;  1UHJ A;  3NSK A;  2BBN A;  4MZJ A;  1IKU A;  1GQM A;  4N1F A;  3KF9 A;  1K90 D;  4PDZ A;  1J1D A;  1RK9 A;  3SIB A;  1J7O A;  1RRO A;  1EH2 A;  1NCX A;  1B7T Z;  2CNP A;  2V53 A;  1FBV A;  3ICB A;  3FE9 A;  1G4Y R;  3N7H A;  1JBA A;  1HT9 A;  2LUX A;  3F45 A;  4M2O A;  1LA3 A;  1OOF A;  4CPV A;  1XFR A;  3OHM B;  1A75 B;  1TRF A;  1L7Z A;  1CM1 A;  5K89 A;  4MRX A;  1UUR A;  3OB1 B;  2FJY A;  4MN0 A;  4QJ3 B;  1IQ3 A;  4GGN A;  1K95 A;  3FE8 A;  2LLU A;  1DEL A;  1G8I A;  3CR4 X;  1PAL A;  4JPZ B;  1GJY A;  4PE7 A;  1LA0 A;  3DZT A;  1SSE B;  3FE6 A;  3Q8I A;  2YGU A;  3IVT A;  1FI6 A;  1KK8 B;  2BBM A;  2NLN A;  2OS8 B;  1XO5 A;  1DF0 A;  3B7A A;  2WC6 A;  4P5O E;  1CDM A;  2QEB A;  4YGD B;  1KFX S;  1V1G A;  3JVT C;  3I5I B;  2CT9 A;  1XA5 A;  5PAL A;  5KU1 A;  1XFX O;  1CLL A;  4WQ2 A;  3S0D A;  3L4L A;  1VRK A;  3PLF B;  4MZK A;  3SJS A;  5G08 A;  3SG2 A;  3DXL A;  1U5I B;  1JUO A;  4YI9 A;  3TZ1 A;  1MUX A;  1X02 A;  1C7W A;  1QAT A;  1QVI Y;  1OMR A;  3LL8 B;  2NCP A;  2KFG A;  3CZ1 A;  1SBJ A;  4DUQ A;  1IG5 A;  3TDU A;  4I5N B;  4HRH A;  4CLN A;  1DT7 B;  2EC6 C;  3CR5 X;  3GK2 A;  4AQJ A;  1KQM B;  1IQ5 A;  1ZFS A;  4C0J A;  2LNK A;  1L2O B;  2MBX A;  3KO0 A;  2WOS A;  3BUW B;  1NWD A;  1YRT B;  2JNF A;  4PT1 A;  2CXJ A;  1S26 D;  3R72 A;  1TIZ A;  4HRG A;  1UP5 A;  3WXA A;  4F7F A;  4C0L A;  2QEO A;  1ALV A;  2M29 A;  3BUM B;  1J7P A;  1KWO C;  1WLZ A;  1NX3 A;  1S5G Z;  1QX2 A;  2JC2 A;  2JXL A;  1KK7 Z;  2TN4 A;  3IF7 A;  1IWQ A;  2LHI A;  5AAN A;  2LP3 A;  3L4A A;  5I8N A;  2H8V A;  3NHI A;  1SR6 B;  3DVK A;  3K1E A;  3HX4 A;  1MHO A;  2MJW B;  4MEW A;  3TUY B;  1SRA A;  1W9Z A;  5CSI A;  1A2X A;  2JT3 A;  3FWB A;  3PM8 A;  3DYE A;  1MQ1 A;  4BY5 A;  2M3W A;  2LHL A;  2OTG B;  3S0G A;  1XFV O;  2WCB A;  5CSN A; 
#chains in the Genus database with same CATH homology
 1QX5 B;  4QJ5 B;  5FYX A;  1FF1 A;  1ZOT B;  1LVC D;  2M7N A;  3GK1 A;  1ZMZ A;  2GV5 A;  1MWN A;  2M0R A;  4GGF C;  1AUI B;  2CBL A;  2KAX A;  1NUB A;  1F54 A;  4PE0 A;  2K2F A;  1S6C A;  4NDC A;  3PFV A;  2LVV A;  2HET A;  2F2O A;  2JXC A;  2I18 A;  1KFU L;  4OV2 A;  1EG3 A;  2KOT A;  1A4P A;  3RLZ A;  2E6W A;  5KSZ A;  1J55 A;  2JUL A;  5D69 A;  1DF0 B;  4YRU A;  2Y1N A;  3VRN A;  1SCV A;  4PHM A;  2KHN A;  1SPY A;  2BCB A;  2G2B A;  3DVE A;  1JF0 A;  1SY9 A;  1K8U A;  1QX7 A;  2FOT A;  2MLF C;  1QIV A;  4ETO A;  1LKJ A;  1UHI A;  2LMV A;  1BLQ A;  1OZS A;  2LVI A;  4A4B A;  1J7R A;  1XK4 A;  3I5G B;  1FI5 A;  1J7Q A;  1YX8 A;  1F55 A;  1XYD A;  1Y6W A;  1BT6 A;  4YI8 A;  3LLE A;  3VGO A;  2HF5 A;  2K7D A;  2VRG A;  1OMV A;  3H4S E;  1DVI A;  2A4J A;  2I94 A;  1PSR A;  5JOL A;  2Y5I A;  1Y1A A;  5HLO A;  1BF5 A;  1H8B A;  1YUT A;  2LLS A;  1AVS A;  1Y0V H;  5HKZ A;  3WHU B;  4D1E A;  3E3R A;  1C7V A;  4YGC B;  1KFX L;  1CDP A;  4BY4 A;  1JSA A;  1WDC B;  1JFJ A;  4MSP A;  2ZN8 A;  1SCM C;  1R2U A;  3QRX A;  3D0Y A;  3TS5 B;  2KI6 D;  1MR8 A;  3BQ3 A;  3SIA A;  3O2P A;  1YRU B;  3PAL A;  2LV7 A;  1BJF A;  3O6B A;  1M45 A;  1CFC A;  1CLM A;  2KNE A;  1B7T Y;  1KQV A;  3GOF A;  2COL B;  4PE4 A;  1DJI A;  1K93 D;  1RFJ A;  4MVF A;  1F71 A;  5TNC A;  1CM4 A;  2ZND A;  2M49 B;  3I5H B;  4ORA B;  1NSH A;  2LAP A;  3CGA A;  4PCW A;  4WQ3 A;  2F3Y A;  2LMT A;  4U8D A;  4GAO A;  3BOW A;  3JTD B;  4I5J A;  1IRJ A;  2CTN A;  3I5F B;  2KI4 B;  4DCK A;  1F70 A;  3NSO A;  1C07 A;  1CKK A;  2L2E A;  1RTP 1;  5BPJ A;  1B8R A;  3O4Y A;  1A03 A;  1CNP A;  3PN7 B;  2SCP A;  3GK4 X;  1XVJ A;  2M1K B;  1JWD A;  2PMY A;  2I2R E;  4OCI A;  2K7B A;  5AXI A;  1CTR A;  1Y1X A;  3EK7 A;  1B9A A;  1NPQ A;  1NX1 A;  1ODB A;  4MZL A;  1J1E A;  1PRW A;  3DVJ A;  2PRU A;  1EL4 A;  3EVR A;  1EG4 A;  2CCM A;  1CDL A;  1ZUZ A;  5AER A;  2PAS A;  2PVB A;  1PSB A;  4HSZ A;  1TOP A;  5B8I B;  1OSA A;  3CWG A;  2F2P A;  1GGW A;  1K94 A;  1TTX A;  4ZCU A;  3SG7 A;  3SG3 A;  3D10 A;  4AOM A;  1TN4 A;  2MRD A;  1QIW A;  1A29 A;  2NZ0 A;  1PVB A;  3BYA A;  5ER4 X;  5JJG A;  2H2K A;  3WNX B;  2QAC A;  4ORB B;  3K21 A;  1S5G Y;  1V1F A;  2IS9 A;  5CPV A;  1K96 A;  3SG4 A;  4GPL B;  2KI6 C;  3NSI A;  4GUK A;  1SL7 A;  3DF0 A;  1CLB A;  1SL9 A;  4GGF A;  5DKN A;  2JT0 A;  1DTL A;  3KPX A;  3D0Y B;  2FCE A;  1CMF A;  3BXK A;  2ZRS A;  5AEQ A;  3BUN B;  2WND A;  1R6P A;  4Q04 A;  3SG6 A;  2K8M B;  2ZFD A;  3LK1 A;  4M2Q A;  1QLS A;  5I2L A;  4YGE B;  1OQP A;  3ZNI A;  1CMG A;  2H61 A;  3EVV A;  1B47 A;  1MXL C;  2BCA A;  2H61 C;  1TNW A;  4A4C A;  4I5L B;  2MHH A;  3AAJ A;  4ORC B;  3DD4 A;  2EGD A;  3EK4 A;  1QV1 A;  2KYF A;  2KAV A;  3VRO A;  1KSO A;  4GBA A;  3KHE A;  2DOQ A;  4YGA A;  1YVL A;  1KK8 C;  2OS8 C;  1K9P A;  1WRZ A;  4IL1 A;  1LIN A;  3BUO B;  3JVT B;  2JQ6 A;  2KFH A;  2JU0 A;  3IQQ A;  3I5I C;  2LCP A;  1UHH A;  1OE9 B;  1JF2 A;  1OMD A;  1ZAC A;  2KAY A;  2RGI A;  3BOW B;  1U5I A;  5HLV A;  1XFW O;  4C0K A;  1QJT A;  2HPS A;  1DJZ A;  1F4Q A;  2Y1M A;  2L98 A;  3DVM A;  2LAN A;  1CDN A;  5HKW A;  1YVH A;  2OPO A;  4OVN F;  1YR5 A;  2M97 A;  3ZWH A;  2EC6 B;  2G9B A;  2BE6 A;  1PK0 D;  2JNX A;  3AAK A;  4NDD A;  1L2O C;  1DMO A;  2BKH B;  2M9G A;  4CID A;  2GGM A;  1E8A A;  1HQV A;  4ICB A;  4ZCV A;  2KSP A;  2FCD A;  2BL0 C;  1KSM A;  4WRI A;  1YX7 A;  2JTT A;  2WCE A;  2M1U A;  1BR4 B;  1KWO B;  1DJY A;  4JWQ A;  5F6T A;  1F8H A;  1NP8 A;  2LP2 A;  2JT8 A;  1RJV A;  2LVJ A;  1SR6 C;  3EK8 A;  3A8R A;  4AQI A;  1KFU S;  3AKA A;  1AJ4 A;  3C1V A;  2HQW A;  5DKQ A;  1KCY A;  3FS7 A;  4DRW A;  4OR9 B;  4YGB B;  3TUY C;  1QLK A;  2JZI A;  2MA2 A;  1NIW A;  2AMI A;  1XFZ O;  2OTG C;  3A4U B;  4PHN A;  1K9K A;  4N1G A;  2O5G A;  2LM5 A;  1NX2 A;  2WCF A;  2ISD A;  2D8N A;  1B4C A;  1XFU O;  1TNX A;  1SK6 D;  2L50 A;  4UPG A;  3DF0 B;  3TDI A;  1QXP A;  1AK8 A;  5J3X A;  4XYN A;  3M0W A;  2R2I A;  1WY9 A;  3LK0 A;  4P2Y B;  4FTG A;  2QPT A;  3CS1 A;  1D1O A;  4M2P A;  2KGB C;  5CSJ A;  2KQY A;  1DJH A;  1DGV A;  1S36 A;  4USL A;  2K61 A;  3EKJ A;  1TCF A;  1AJ5 A;  3VRQ A;  3BUX B;  2L4I A;  3PAT A;  3AKB A;  5D7F A;  3KEV A;  1PUL A;  1B8C A;  1SYM A;  4DIR A;  2FJU B;  2JRF A;  4MLW A;  1G33 A;  1QVI Z;  1PVA A;  1B1G A;  1YUU A;  1QAS A;  3LCP C;  1N65 A;  1S3P A;  2I7A A;  4HRE E;  1DJG A;  4OKH A;  1OOJ A;  5AFP A;  1EXR A;  1DJW A;  2JTZ A;  2KDH A;  2EHB A;  3VRP A;  1NX0 A;  1QS7 A;  1N0Y A;  4CFR A;  2AAO A;  4MRY A;  4FQO A;  2Q91 A;  2K0J A;  5DKR A;  2KFF A;  3IQO A;  3CLN A;  2B1U A;  2KBM A;  2M8U A;  3RM1 A;  4DS7 A;  5KTY A;  1Y1U A;  2BE4 A;  1REC A;  1WRK A;  3NXA A;  3CTN A;  2JPT A;  1MXE A;  3I5G C;  4XJK A;  1DJX A;  2PSR A;  2ZNE A;  4JQ0 D;  4MBE A;  2JWW A;  1MF8 B;  2LC5 A;  4GNK B;  1M46 A;  4PE1 A;  2BCX A;  1BU3 A;  1UWO A;  1TNQ A;  5HKY A;  2JOJ A;  1H4B A;  1Q80 A;  1YUS A;  4PAL A;  2BL0 B;  1KK7 Y;  1LXF C;  1N2D A;  1K9U A;  2MAZ A;  5ER5 A;  1SCM B;  1WDC C;  1NCZ A;  2NXQ A;  1JFK A;  2K7C A;  1BOD A;  3TS5 C;  2PAL A;  1A75 A;  1FPW A;  4E68 A;  5I2O A;  4GFT A;  2O60 A;  2F33 A;  2GGZ A;  3OP0 A;  2Y4Q A;  1AHR A;  1S6J A;  1XFY O;  1YTZ C;  3PSR A;  1GGZ A;  4QJ4 B;  2LVK A;  2P6B B;  1M31 A;  1M63 B;  1UUS A;  2L4H A;  1W7J B;  1TNP A;  3CR2 A;  4N5X A;  3OB2 B;  4PHK A;  2KBI A;  4R1E A;  3VRR A;  1S1E A;  2SAS A;  1UHK A;  1SL8 A;  1W7I B;  2Q4U A;  3I5H C;  4L9M A;  1TCO B;  2MLE C;  1YUR A;  2LUC A;  3FIA A;  1NCY A;  4NDB A;  2ZN9 A;  4NQG A;  5GQQ C;  3HCM A;  3JTD C;  4I5K A;  2BEC A;  2L0P A;  3I5F C;  1EJ3 A;  2KI4 C;  1IJ5 A;  1NYA A;  2LE9 B;  2BKI B;  2LLT A;  3EVU A;  4YBH B;  3TDZ A;  1RWY A;  1SMG A;  1JC2 A;  2WC8 A;  2F3Z A;  1FW4 A;  2K2A A;  3CZT X;  3PN7 C;  2NCO A;  1K2H A;  1DGU A;  1SNL A;  2KGR A;  3FWC A;  1CB1 A;  2E30 A;  3OX5 A;  2ZKM X;  1BOC A;  4TNC A;  1KQM C;  2HQ8 A;  2LMU A;  5I2Q A;  1WRL A;  1QTX A;  5HYD A;  1M39 A;  1S6I A;  5CSF A;  3OX6 A;  1CFF A;  1CFP A;  1WLM A;  5IBW A;  1BR1 B;  1SW8 A;  3O78 A;  1F4O A;  2WOR A;  3SG5 A;  2L51 A;  3EKH A;  1B8L A;  1BG1 A;  1IH0 A;  2K7O A;  4PHJ A;  1CFD A;  2AUC A;  2L5X B;  1SKT A;  2M7L A;  1AP4 A;  1QV0 A;  1XK4 C;  2KYC A;  4XJK B;  3WHT B;  1OZO A;  2F8P A;  1UHN A;  3NSL A;  1BMO A;  4CFQ A;  3MSE B;  1ALW A;  2KQ6 A;  1IJ6 A;  2ZRT A;  1IGV A;  4F0Z B;  1UHJ A;  3NSK A;  2BBN A;  4MZJ A;  1IKU A;  1GQM A;  4N1F A;  3KF9 A;  1K90 D;  4PDZ A;  1J1D A;  1RK9 A;  3SIB A;  1J7O A;  1RRO A;  1EH2 A;  1NCX A;  1B7T Z;  2CNP A;  2V53 A;  1FBV A;  3ICB A;  1G4Y R;  1JBA A;  1HT9 A;  2LUX A;  3F45 A;  4M2O A;  1LA3 A;  4CPV A;  3OHM B;  1A75 B;  1TRF A;  1L7Z A;  1CM1 A;  5K89 A;  4MRX A;  1UUR A;  3OB1 B;  4MN0 A;  4QJ3 B;  1IQ3 A;  4GGN A;  1K95 A;  2LLU A;  1G8I A;  3CR4 X;  1PAL A;  4JPZ B;  1GJY A;  4PE7 A;  1LA0 A;  1FI6 A;  1KK8 B;  2BBM A;  2NLN A;  2OS8 B;  1XO5 A;  1DF0 A;  4YGD B;  4P5O E;  1CDM A;  1KFX S;  1V1G A;  3JVT C;  3I5I B;  2CT9 A;  1XA5 A;  5PAL A;  5KU1 A;  1XFX O;  1CLL A;  4WQ2 A;  3SJS A;  1VRK A;  3PLF B;  4MZK A;  5G08 A;  3SG2 A;  1U5I B;  1JUO A;  4YI9 A;  3TZ1 A;  1MUX A;  1X02 A;  1C7W A;  1QAT A;  1QVI Y;  1OMR A;  3LL8 B;  2NCP A;  2KFG A;  1SBJ A;  4DUQ A;  1IG5 A;  3TDU A;  4I5N B;  4HRH A;  4CLN A;  1DT7 B;  2EC6 C;  3CR5 X;  3GK2 A;  4AQJ A;  1KQM B;  1IQ5 A;  1ZFS A;  4C0J A;  2LNK A;  1L2O B;  2MBX A;  3KO0 A;  2WOS A;  3BUW B;  1NWD A;  1YRT B;  2JNF A;  2CXJ A;  1S26 D;  4HRG A;  1TIZ A;  1UP5 A;  3WXA A;  4C0L A;  1ALV A;  2M29 A;  3BUM B;  1J7P A;  1KWO C;  1WLZ A;  1NX3 A;  1S5G Z;  1QX2 A;  2JC2 A;  2JXL A;  1KK7 Z;  2TN4 A;  3IF7 A;  1IWQ A;  2LHI A;  5AAN A;  2LP3 A;  5I8N A;  1SR6 B;  3DVK A;  3HX4 A;  1MHO A;  2MJW B;  4MEW A;  3TUY B;  1SRA A;  5CSI A;  1A2X A;  2JT3 A;  3FWB A;  3PM8 A;  1MQ1 A;  4BY5 A;  2M3W A;  2LHL A;  2OTG B;  1XFV O;  2WCB A;  5CSN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...