3D75A

Crystal structure of a pheromone binding protein mutant d35n, from apis mellifera, at ph 5.5
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
117
structure length
117
Chain Sequence
DWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVNKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Queen bee pheromone binding protein pH-induced domain swapping favors pheromone release
pubmed doi rcsb
source organism Apis mellifera
molecule tags Pheromone binding protein
molecule keywords Pheromone-binding protein ASP1
total genus 37
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3d75A00
1LS8A 4F7FA 2PQLA 1OW4A 3NHIA 3DZTA 3FE8A 3BJHA 3PJIA 3S0AA 3CZ1A 4FQTA 3RZSA 2WCLA 3FE6A 2QEHA 1C3YA 1QWVA 1TWOA 4INXA 2FJYA 3DXLA 3NGVA 1TUJA 3DY9A 3CABA 2WCKA 3S0GA 3B88A 2QDIA 1OOFA 3BFHA 3R72A 3BFBA 3R1OA 1C3ZA 4PT1A 5DICA 2WCMA 4INWA 3CYZA 2QEOA 2WC6A 2QEBA 2P71A 3S0DA 1XFRA 3N7HA 2WCJA 2JPOA 1P28A 5EL2A 3R1VA 3B86A 2WCHA 3B87A 3Q8IA 1OOHA 3L4AA 3VB1A 3FE9A 3CZ0A 2KPHA 1OOIX 2WC5A 1T14A 3S0FA 3L47A 3K1EA 2L2CA 3S0BA 1GM0A 2ERBA 2GTEA 3B7AA 3BFAA 2H8VA 3CZ2A 3D73A 4JD9A 3NHTA 3CDNA 3V2LA 2QEVA 3D74A 3D76A 4OZDA 1OOGA 3R1PA 1DQEA 3DYEA 2P70A 3D78A 3L4LA 3S0EA 3D77A 3OGNA 3B6XA 1ORGA 3QMEA 3D75A
chains in the Genus database with same CATH superfamily
1B4CA 2Y4QA 4C0JA 1QS7A 1IWQA 3I5IB 4HRHA 1OW4A 1BU3A 1F4OA 5ER5A 1XFXO 2BCAA 2MJWB 4MRYA 2ZFDA 1S3PA 1SL9A 1UHHA 3PJIA 3RM1A 2F33A 2HETA 1QV1A 1IQ3A 2QEHA 5HLOA 2KHNA 1V1GA 3BUMB 1A75A 3TS5B 1QWVA 2WC8A 4M2OA 1OSAA 4ZCVA 5HKWA 1NX2A 4YGBB 1TWOA 5JJGA 1ALVA 2F2PA 2FJYA 1DMOA 3KO0A 2LVJA 1XFUO 3SS4A 2PYQA 3FS7A 4GBAA 1TCFA 4GGFA 1XA5A 2ZNDA 2L4IA 4MSPA 4N1FA 1BJFA 4I5LB 2WCEA 1B47A 1XYDA 4PE4A 2LV7A 4PHKA 4ETOA 1SCMB 4WRIA 1BMOA 4D1EA 4A4BA 2HQ8A 3BFBA 2CT9A 1AJ4A 1TRFA 1CFCA 1IRJA 1M63B 1A29A 1BT6A 2MHHA 3LK1A 2BL0B 2M49B 3EKHA 4ZCUA 5JOLA 2KOTA 1SK6D 4P5OE 2WCMA 3O4YA 2P6BB 3BUOB 1SNLA 1QJTA 3I5FB 1B7TZ 1DJHA 1XK4C 4MZJA 2QEOA 4QJ5B 1YURA 4YBHB 2WC6A 3CR2A 2BL0C 3HCMA 1S6IA 1HT9A 2OPOA 1K9UA 4L9MA 1PULA 1M39A 4P2YB 1LINA 2WCJA 4I5NB 3RLZA 2KGRA 3KHEA 1CMGA 4DUQA 1SY9A 2A4JA 3BUNB 1P28A 2ISDA 3TUYB 2KDHA 1UHJA 2QPTA 1WY9A 2JT0A 1CDPA 2M97A 3R1VA 3UO9A 4CLNA 3OX6A 5F6TA 1L2OB 2GGMA 3VRQA 3B86A 3PFVA 2BE6A 4IJ7A 4DRWA 1JC2A 4UPGA 1NWDA 3I5GC 4U8DA 1K9PA 1UURA 2KSPA 3B87A 3D10A 2CNPA 2CXJA 2Y1MA 1AUIB 4MEWA 1JBAA 3EVRA 1KK8C 4GGFC 1MUXA 1VRKA 1A75B 2M7LA 1S26D 5AANA 4PHNA 3OP0A 2JT3A 4ICBA 2L2CA 2CBLA 3SS5A 4PE7A 1XVJA 1DC1A 2ERBA 1Y0VH 3F45A 1CFPA 1GM0A 2FCEA 1AK8A 3SS3A 3O4XA 2KYFA 1QTXA 2GTEA 3I5FC 2H8VA 2I2RE 2M8UA 3PN7B 5D3OA 4N5XA 1G4YR 3CZ2A 5HLVA 2MBXA 3PLFB 1LXFC 3I5IC 1B8RA 2KI6C 4JKTA 2WORA 4TNCA 3BUWB 5KTYA 4YGDB 5FI2A 5G08A 4NQGA 2MRDA 1KQMC 1J7OA 2Q4UA 2OTGC 3ICBA 1KQVA 3CWGA 2K2FA 2LE9B 3D77A 1KCYA 2LAPA 3TS5C 1ORGA 1KWOC 4PCWA 1ODBA 1JF0A 5GQQC 2JNXA 3PATA 4JWQA 3MSEB 1YUTA 2ZRTA 1K95A 3ZNIA 1K94A 2JXCA 2B1UA 1C7VA 1XFVO 3GK1A 1K8UA 3DZTA 4WQ3A 3DVJA 3FE8A 3NSKA 1PALA 2BKIB 2PRUA 1TTXA 1NX0A 2I94A 2L98A 3RZSA 1EL4A 4XJKB 2WCLA 1FI5A 1C3YA 3JTDC 5TNCA 3WHUB 3EK4A 3OB1B 3CR4X 2K60A 4R1EA 2M7NA 2FCDA 1JWDA 1DGVA 2JC2A 3SIBA 1SR6C 1TN4A 1FF1A 1TCOB 5KU1A 1DGUA 1K2HA 3NGVA 4MZKA 3I5GB 1YRUB 1QIWA 3S0GA 4FTGA 2JTZA 2EC6B 1NIWA 3GK4X 4NDBA 2LHLA 1OOFA 1CFDA 1B8LA 3TUYC 3I5HC 1MR8A 3BFHA 4OV2A 1CDNA 1YUSA 2M1UA 2LMTA 4WQ2A 1WDCB 3NSLA 3DVEA 1UP5A 2LMVA 2KBMA 3IQOA 3IF7A 5DKQA 3R1OA 1F70A 1OE9B 1K96A 2AAOA 2KI4C 2IS9A 1PVAA 3EK7A 2K8MB 1AHRA 3EK8A 5DICA 5DKRA 3DVKA 1ZFSA 1WRKA 4BY5A 4CFRA 4INWA 4NDCA 4KYNA 1JUOA 1QLSA 1ZOTB 1MXLC 1B7TY 1BODA 4AQJA 5I2QA 1J7PA 2M0RA 2QEBA 1DF0A 1MF8B 1Z2CB 2P71A 3DF0A 4MBEA 3S0DA 4F0ZB 1XFRA 1IH0A 1PK0D 1QLKA 2E6WA 2LMUA 2LVKA 5HYDA 2JPOA 1EXRA 3FIAA 3DF0B 3M0WA 2WOSA 1SCMC 2HQWA 3WXAA 1CM1A 2OS8C 3E3RA 1CFFA 1YTZC 2LNKA 3AAJA 1G33A 4GNKB 1CLLA 1K9KA 2VRGA 1UHNA 2LHIA 1XFZO 2MLEC 1CKKA 2LM5A 1NCXA 1U5IA 3KEVA 1S6JA 4YGAA 1NX3A 3VB1A 3FE9A 1BF5A 2JZIA 1OOIX 1CDMA 1WLMA 2BCXA 2K0JA 2NCOA 2WC5A 3S0FA 3OHMB 2V53A 3IQQA 5BPJA 1M46A 3GK2A 3LCPC 3NXAA 1X02A 1M31A 2LC5A 3PALA 2PSRA 2LUXA 4I5KA 3S0BA 2KBIA 4QJ3B 2K2AA 2JU0A 5HKYA 3LLEA 3WNXB 1LA0A 4C0KA 2BBMA 1NUBA 1A2XA 1Z4HA 2F2OA 1IQ5A 2NLNA 1EJ3A 2BCBA 1Y1UA 2JOJA 2L2EA 3NHTA 1H8BA 1XFYO 2PVBA 2KI6D 1BLQA 2LANA 3D74A 2K7DA 1QXPA 3JVTC 4A4CA 2KFGA 2WCFA 3D0YA 3OB2B 1YRTB 4QJ4B 2QACA 2ZNEA 3DYEA 5I94A 1KK7Z 1A03A 3KF9A 2I18A 1UUSA 3QMEA 4C0LA 1OQPA 1Q80A 2JWWA 5DKNA 4F7FA 2PQLA 2ZKMX 2LCPA 2DOQA 2L4HA 1DF0B 3NHIA 4MN0A 2Y5IA 4CPVA 1SCVA 1SYMA 1Y1AA 1QIVA 2KQ6A 3BJHA 3BUXB 1WRLA 1OMRA 1TIZA 2LUCA 3CZ1A 3K21A 4FQTA 5FI6A 4CIDA 1MXEA 2KAVA 3FE6A 1TUZA 1OMVA 3PSRA 1QX5B 5AEQA 2LP2A 1IIOA 1FBVA 4INXA 5J3XA 1W7JB 1LKJA 1RTP1 1EG3A 1M45A 2EGDA 4HRGA 4PALA 2JQ6A 1TUJA 1NCYA 2F3YA 2M9GA 3JVTB 2ZN8A 1CMFA 2LLTA 3FWBA 1J7RA 4I5JA 1IGVA 1SL8A 1L7ZA 5AERA 1W7IB 2QDIA 5ER4X 5AFPA 1OZOA 1UWOA 2LLSA 1MQ1A 2M29A 5CSIA 2PALA 2COLB 2Y1NA 2K7OA 5I2LA 1BR4B 1S5GZ 2BECA 1GGZA 1C3ZA 3UNWA 4PT1A 4MVFA 2JXLA 5D69A 1NSHA 2BE4A 1SRAA 3BQ3A 2F8PA 2L5YA 1NP8A 4DCKA 1FW4A 1RFJA 3TDIA 3GOFA 3OX5A 1S36A 1NPQA 1DELA 3CYZA 3CR5X 1YVHA 2KLDA 2PASA 1J7QA 3VRNA 1AP4A 1U5IB 2MLFC 3O2PA 2D8NA 4MZLA 2G9BA 2MAZA 2NXQA 2BAPA 1TNXA 3AKAA 3EG5B 2LVVA 1CTRA 2K7BA 1DJIA 2ZRSA 4XJKA 1F8HA 3TZ1A 1QVIY 3NSIA 1YUUA 2LLUA 4YI8A 1OMDA 5EL2A 1JSAA 1PVBA 4AOMA 1AJ5A 1ZUZA 4OKHA 1SL7A 5CSFA 3Q8IA 3PM8A 1SMGA 1EG4A 2RGIA 3CGAA 2KPHA 1IJ6A 1GQMA 3CZ0A 4PHJA 4OR9B 1T14A 1UHKA 1QASA 1WRZA 3L47A 4GPLB 4N1GA 4PDZA 1IKUA 1C07A 1JFJA 1PSRA 1XK4A 2KNEA 2I7AA 5KSZA 1J1DA 1RECA 2L5XB 2WCBA 1OZSA 1TNPA 1N65A 1CB1A 1WDCC 2LP3A 1CDLA 5FYXA 1NCZA 1N0YA 5HKZA 1KFXS 3D73A 1FI6A 3V2LA 3BXKA 1DJWA 1S1EA 2QEVA 1XO5A 1KSMA 2H61A 2O60A 2H2KA 1OOGA 4ORBB 2K61A 3R1PA 1CLBA 1KK7Y 3C1VA 1H4BA 1PRWA 3D78A 3L4LA 3S0EA 3VGOA 2PMYA 2K7CA 1MHOA 3B6XA 3I5HB 3OGNA 1SW8A 1LA3A 3BOWB 1V1FA 5I8NA 3IVTA 2SASA 3D75A 1Y1XA 1R6PA 1LVCD 2TN4A 1LS8A 2M3WA 5D7FA 4JPZB 3HX4A 2AUCA 4YGCB 4AQIA 1QX7A 3BYAA 5CSNA 4E68A 3D0YB 2EHBA 1PSBA 1UHIA 2H61C 2ZN9A 3VROA 3S0AA 1F71A 1YR5A 1DT7B 2L0PA 2WNDA 4USLA 1KFUL 1KFXL 1TNWA 5CSJA 1RJVA 2KYCA 2BKHB 1F55A 1Y6WA 1JF2A 2Q91A 3SG4A 4XYNA 1BOCA 1GJYA 2OTGB 1BR1B 1NX1A 1KQMB 3DXLA 1IJ5A 1B8CA 1SPYA 3DD4A 3NSOA 3DY9A 2EC6C 4HREE 2F3ZA 3CABA 1JFKA 1C7WA 1CM4A 1DTLA 2WCKA 5CPVA 4MLWA 3SG2A 4YRUA 1F4QA 2HF5A 3B88A 3TDZA 2KFFA 1SR6B 3R72A 2JPTA 2BBNA 3WHTB 3CTNA 1DJGA 3SG6A 2JNFA 2JTTA 2KLEA 4PE0A 2E30A 1J1EA 1S5GY 3JTDB 4GFTA 2M1KB 2FOTA 1A4PA 1KFUS 1WLZA 1ZMZA 3VRPA 1GGWA 3CLNA 5PALA 1BG1A 1ALWA 1DJYA 3SJSA 4GUKA 1FPWA 3PN7C 1QX2A 2CTNA 3SG7A 3EVVA 2KI4B 3CZTX 3SG5A 4YGEB 1W9ZA 2JULA 1F54A 3QRXA 1B9AA 3N7HA 1L2OC 3FWCA 1KWOB 4M2QA 1B1GA 4OVNF 2OS8B 4GAOA 1G8IA 4BY4A 2NCPA 2R2IA 4NDDA 4DS7A 1CLMA 1KK8B 3LL8B 1QVIZ 5FI7A 1CNPA 5B8IB 3EKJA 1S6CA 1XFWO 2JT8A 2GGZA 2G2BA 1EH2A 2MA2A 2KAXA 3OBVA 4DIRA 2WCHA 2KFHA 1OOHA 3L4AA 5K89A 1TOPA 3O6BA 2O5GA 3AAKA 1D1OA 2YGUA 3EVUA 3O78A 4OCIA 2LVIA 4M2PA 1DVIA 3K1EA 1R2UA 2HPSA 4PHMA 3SIAA 1DJZA 1DJXA 1K93D 1SBJA 1SSEB 2SCPA 1N2DA 2BNXA 5IBWA 3AKBA 4GGNA 3TDUA 2KGBC 1DEKA 1J55A 3B7AA 3BFAA 3CS1A 5I2OA 3BOWA 1YVLA 1IG5A 4YI9A 3DVMA 1YX8A 4ORAB 1QATA 1OOJA 4ORCB 4JD9A 4Q04A 3CDNA 1MWNA 3LK0A 3PM2A 3H4SE 1KSOA 2FJUB 4MRXA 5AXIA 3D76A 4JQ0D 2L50A 4FQOA 3A8RA 1RK9A 4OZDA 1AVSA 1HQVA 1RROA 2KAYA 3ZWHA 1DQEA 2P70A 2AMIA 2L51A 4IL1A 1YX7A 3A4UB 1ZACA 2CCMA 3SG3A 5HL1A 1E8AA 2KQYA 2NZ0A 3KPXA 2GV5A 2JRFA 1TNQA 3VRRA 1NYAA 1SKTA 1RWYA 4PE1A 4HSZA 4CFQA 1K90D 1QV0A
chains in the Genus database with same CATH topology
1LS8A 4F7FA 2PQLA 1OW4A 3NHIA 3DZTA 3FE8A 3BJHA 3PJIA 3S0AA 3CZ1A 4FQTA 3RZSA 2WCLA 3FE6A 2QEHA 1C3YA 1QWVA 1TWOA 4INXA 2FJYA 3DXLA 3NGVA 1TUJA 3DY9A 3CABA 2WCKA 3S0GA 3B88A 2QDIA 1OOFA 3BFHA 3R72A 3BFBA 3R1OA 1C3ZA 4PT1A 5DICA 2WCMA 4INWA 3CYZA 2QEOA 2WC6A 2QEBA 2P71A 3S0DA 1XFRA 3N7HA 2WCJA 2JPOA 1P28A 5EL2A 3R1VA 3B86A 2WCHA 3B87A 3Q8IA 1OOHA 3L4AA 3VB1A 3FE9A 3CZ0A 2KPHA 1OOIX 2WC5A 1T14A 3S0FA 3L47A 3K1EA 2L2CA 3S0BA 1GM0A 2ERBA 2GTEA 3B7AA 3BFAA 2H8VA 3CZ2A 3D73A 4JD9A 3NHTA 3CDNA 3V2LA 2QEVA 3D74A 3D76A 4OZDA 1OOGA 3R1PA 1DQEA 3DYEA 2P70A 3D78A 3L4LA 3S0EA 3D77A 3OGNA 3B6XA 1ORGA 3QMEA 3D75A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LS8 A;  4F7F A;  2PQL A;  1OW4 A;  3NHI A;  3DZT A;  3FE8 A;  3BJH A;  3PJI A;  3S0A A;  3CZ1 A;  4FQT A;  3RZS A;  2WCL A;  3FE6 A;  2QEH A;  1C3Y A;  1QWV A;  1TWO A;  4INX A;  2FJY A;  3DXL A;  3NGV A;  1TUJ A;  3DY9 A;  3CAB A;  2WCK A;  3S0G A;  3B88 A;  2QDI A;  1OOF A;  3BFH A;  3R72 A;  3BFB A;  3R1O A;  1C3Z A;  4PT1 A;  5DIC A;  2WCM A;  4INW A;  3CYZ A;  2QEO A;  2WC6 A;  2QEB A;  2P71 A;  3S0D A;  1XFR A;  3N7H A;  2WCJ A;  2JPO A;  1P28 A;  5EL2 A;  3R1V A;  3B86 A;  2WCH A;  3B87 A;  3Q8I A;  1OOH A;  3L4A A;  3VB1 A;  3FE9 A;  3CZ0 A;  2KPH A;  1OOI X;  2WC5 A;  1T14 A;  3S0F A;  3L47 A;  3K1E A;  2L2C A;  3S0B A;  1GM0 A;  2ERB A;  2GTE A;  3B7A A;  3BFA A;  2H8V A;  3CZ2 A;  3D73 A;  4JD9 A;  3NHT A;  3CDN A;  3V2L A;  2QEV A;  3D74 A;  3D76 A;  4OZD A;  1OOG A;  3R1P A;  1DQE A;  3DYE A;  2P70 A;  3D78 A;  3L4L A;  3S0E A;  3D77 A;  3OGN A;  3B6X A;  1ORG A;  3QME A;  3D75 A; 
#chains in the Genus database with same CATH topology
 1B4C A;  2Y4Q A;  4C0J A;  1QS7 A;  1IWQ A;  3I5I B;  4HRH A;  1OW4 A;  1BU3 A;  1F4O A;  5ER5 A;  1XFX O;  2BCA A;  2MJW B;  4MRY A;  2ZFD A;  1S3P A;  1SL9 A;  1UHH A;  3PJI A;  3RM1 A;  2F33 A;  2HET A;  1QV1 A;  1IQ3 A;  2QEH A;  5HLO A;  2KHN A;  1V1G A;  3BUM B;  1A75 A;  3TS5 B;  1QWV A;  2WC8 A;  4M2O A;  1OSA A;  4ZCV A;  5HKW A;  1NX2 A;  4YGB B;  1TWO A;  5JJG A;  1ALV A;  2F2P A;  2FJY A;  1DMO A;  3KO0 A;  2LVJ A;  1XFU O;  3SS4 A;  2PYQ A;  3FS7 A;  4GBA A;  1TCF A;  4GGF A;  1XA5 A;  2ZND A;  2L4I A;  4MSP A;  4N1F A;  1BJF A;  4I5L B;  2WCE A;  1B47 A;  1XYD A;  4PE4 A;  2LV7 A;  4PHK A;  4ETO A;  1SCM B;  4WRI A;  1BMO A;  4D1E A;  4A4B A;  2HQ8 A;  3BFB A;  2CT9 A;  1AJ4 A;  1TRF A;  1CFC A;  1IRJ A;  1M63 B;  1A29 A;  1BT6 A;  2MHH A;  3LK1 A;  2BL0 B;  2M49 B;  3EKH A;  4ZCU A;  5JOL A;  2KOT A;  1SK6 D;  4P5O E;  2WCM A;  3O4Y A;  2P6B B;  3BUO B;  1SNL A;  1QJT A;  3I5F B;  1B7T Z;  1DJH A;  1XK4 C;  4MZJ A;  2QEO A;  4QJ5 B;  1YUR A;  4YBH B;  2WC6 A;  3CR2 A;  2BL0 C;  3HCM A;  1S6I A;  1HT9 A;  2OPO A;  1K9U A;  4L9M A;  1PUL A;  1M39 A;  4P2Y B;  1LIN A;  2WCJ A;  4I5N B;  3RLZ A;  2KGR A;  3KHE A;  1CMG A;  4DUQ A;  1SY9 A;  2A4J A;  3BUN B;  1P28 A;  2ISD A;  3TUY B;  2KDH A;  1UHJ A;  2QPT A;  1WY9 A;  2JT0 A;  1CDP A;  2M97 A;  3R1V A;  3UO9 A;  4CLN A;  3OX6 A;  5F6T A;  1L2O B;  2GGM A;  3VRQ A;  3B86 A;  3PFV A;  2BE6 A;  4IJ7 A;  4DRW A;  1JC2 A;  4UPG A;  1NWD A;  3I5G C;  4U8D A;  1K9P A;  1UUR A;  2KSP A;  3B87 A;  3D10 A;  2CNP A;  2CXJ A;  2Y1M A;  1AUI B;  4MEW A;  1JBA A;  3EVR A;  1KK8 C;  4GGF C;  1MUX A;  1VRK A;  1A75 B;  2M7L A;  1S26 D;  5AAN A;  4PHN A;  3OP0 A;  2JT3 A;  4ICB A;  2L2C A;  2CBL A;  3SS5 A;  4PE7 A;  1XVJ A;  1DC1 A;  2ERB A;  1Y0V H;  3F45 A;  1CFP A;  1GM0 A;  2FCE A;  1AK8 A;  3SS3 A;  3O4X A;  2KYF A;  1QTX A;  2GTE A;  3I5F C;  2H8V A;  2I2R E;  2M8U A;  3PN7 B;  5D3O A;  4N5X A;  1G4Y R;  3CZ2 A;  5HLV A;  2MBX A;  3PLF B;  1LXF C;  3I5I C;  1B8R A;  2KI6 C;  4JKT A;  2WOR A;  4TNC A;  3BUW B;  5KTY A;  4YGD B;  5FI2 A;  5G08 A;  4NQG A;  2MRD A;  1KQM C;  1J7O A;  2Q4U A;  2OTG C;  3ICB A;  1KQV A;  3CWG A;  2K2F A;  2LE9 B;  3D77 A;  1KCY A;  2LAP A;  3TS5 C;  1ORG A;  1KWO C;  4PCW A;  1ODB A;  1JF0 A;  5GQQ C;  2JNX A;  3PAT A;  4JWQ A;  3MSE B;  1YUT A;  2ZRT A;  1K95 A;  3ZNI A;  1K94 A;  2JXC A;  2B1U A;  1C7V A;  1XFV O;  3GK1 A;  1K8U A;  3DZT A;  4WQ3 A;  3DVJ A;  3FE8 A;  3NSK A;  1PAL A;  2BKI B;  2PRU A;  1TTX A;  1NX0 A;  2I94 A;  2L98 A;  3RZS A;  1EL4 A;  4XJK B;  2WCL A;  1FI5 A;  1C3Y A;  3JTD C;  5TNC A;  3WHU B;  3EK4 A;  3OB1 B;  3CR4 X;  2K60 A;  4R1E A;  2M7N A;  2FCD A;  1JWD A;  1DGV A;  2JC2 A;  3SIB A;  1SR6 C;  1TN4 A;  1FF1 A;  1TCO B;  5KU1 A;  1DGU A;  1K2H A;  3NGV A;  4MZK A;  3I5G B;  1YRU B;  1QIW A;  3S0G A;  4FTG A;  2JTZ A;  2EC6 B;  1NIW A;  3GK4 X;  4NDB A;  2LHL A;  1OOF A;  1CFD A;  1B8L A;  3TUY C;  3I5H C;  1MR8 A;  3BFH A;  4OV2 A;  1CDN A;  1YUS A;  2M1U A;  2LMT A;  4WQ2 A;  1WDC B;  3NSL A;  3DVE A;  1UP5 A;  2LMV A;  2KBM A;  3IQO A;  3IF7 A;  5DKQ A;  3R1O A;  1F70 A;  1OE9 B;  1K96 A;  2AAO A;  2KI4 C;  2IS9 A;  1PVA A;  3EK7 A;  2K8M B;  1AHR A;  3EK8 A;  5DIC A;  5DKR A;  3DVK A;  1ZFS A;  1WRK A;  4BY5 A;  4CFR A;  4INW A;  4NDC A;  4KYN A;  1JUO A;  1QLS A;  1ZOT B;  1MXL C;  1B7T Y;  1BOD A;  4AQJ A;  5I2Q A;  1J7P A;  2M0R A;  2QEB A;  1DF0 A;  1MF8 B;  1Z2C B;  2P71 A;  3DF0 A;  4MBE A;  3S0D A;  4F0Z B;  1XFR A;  1IH0 A;  1PK0 D;  1QLK A;  2E6W A;  2LMU A;  2LVK A;  5HYD A;  2JPO A;  1EXR A;  3FIA A;  3DF0 B;  3M0W A;  2WOS A;  1SCM C;  2HQW A;  3WXA A;  1CM1 A;  2OS8 C;  3E3R A;  1CFF A;  1YTZ C;  2LNK A;  3AAJ A;  1G33 A;  4GNK B;  1CLL A;  1K9K A;  2VRG A;  1UHN A;  2LHI A;  1XFZ O;  2MLE C;  1CKK A;  2LM5 A;  1NCX A;  1U5I A;  3KEV A;  1S6J A;  4YGA A;  1NX3 A;  3VB1 A;  3FE9 A;  1BF5 A;  2JZI A;  1OOI X;  1CDM A;  1WLM A;  2BCX A;  2K0J A;  2NCO A;  2WC5 A;  3S0F A;  3OHM B;  2V53 A;  3IQQ A;  5BPJ A;  1M46 A;  3GK2 A;  3LCP C;  3NXA A;  1X02 A;  1M31 A;  2LC5 A;  3PAL A;  2PSR A;  2LUX A;  4I5K A;  3S0B A;  2KBI A;  4QJ3 B;  2K2A A;  2JU0 A;  5HKY A;  3LLE A;  3WNX B;  1LA0 A;  4C0K A;  2BBM A;  1NUB A;  1A2X A;  1Z4H A;  2F2O A;  1IQ5 A;  2NLN A;  1EJ3 A;  2BCB A;  1Y1U A;  2JOJ A;  2L2E A;  3NHT A;  1H8B A;  1XFY O;  2PVB A;  2KI6 D;  1BLQ A;  2LAN A;  3D74 A;  2K7D A;  1QXP A;  3JVT C;  4A4C A;  2KFG A;  2WCF A;  3D0Y A;  3OB2 B;  1YRT B;  4QJ4 B;  2QAC A;  2ZNE A;  3DYE A;  5I94 A;  1KK7 Z;  1A03 A;  3KF9 A;  2I18 A;  1UUS A;  3QME A;  4C0L A;  1OQP A;  1Q80 A;  2JWW A;  5DKN A;  4F7F A;  2PQL A;  2ZKM X;  2LCP A;  2DOQ A;  2L4H A;  1DF0 B;  3NHI A;  4MN0 A;  2Y5I A;  4CPV A;  1SCV A;  1SYM A;  1Y1A A;  1QIV A;  2KQ6 A;  3BJH A;  3BUX B;  1WRL A;  1OMR A;  1TIZ A;  2LUC A;  3CZ1 A;  3K21 A;  4FQT A;  5FI6 A;  4CID A;  1MXE A;  2KAV A;  3FE6 A;  1TUZ A;  1OMV A;  3PSR A;  1QX5 B;  5AEQ A;  2LP2 A;  1IIO A;  1FBV A;  4INX A;  5J3X A;  1W7J B;  1LKJ A;  1RTP 1;  1EG3 A;  1M45 A;  2EGD A;  4HRG A;  4PAL A;  2JQ6 A;  1TUJ A;  1NCY A;  2F3Y A;  2M9G A;  3JVT B;  2ZN8 A;  1CMF A;  2LLT A;  3FWB A;  1J7R A;  4I5J A;  1IGV A;  1SL8 A;  1L7Z A;  5AER A;  1W7I B;  2QDI A;  5ER4 X;  5AFP A;  1OZO A;  1UWO A;  2LLS A;  1MQ1 A;  2M29 A;  5CSI A;  2PAL A;  2COL B;  2Y1N A;  2K7O A;  5I2L A;  1BR4 B;  1S5G Z;  2BEC A;  1GGZ A;  1C3Z A;  3UNW A;  4PT1 A;  4MVF A;  2JXL A;  5D69 A;  1NSH A;  2BE4 A;  1SRA A;  3BQ3 A;  2F8P A;  2L5Y A;  1NP8 A;  4DCK A;  1FW4 A;  1RFJ A;  3TDI A;  3GOF A;  3OX5 A;  1S36 A;  1NPQ A;  1DEL A;  3CYZ A;  3CR5 X;  1YVH A;  2KLD A;  2PAS A;  1J7Q A;  3VRN A;  1AP4 A;  1U5I B;  2MLF C;  3O2P A;  2D8N A;  4MZL A;  2G9B A;  2MAZ A;  2NXQ A;  2BAP A;  1TNX A;  3AKA A;  3EG5 B;  2LVV A;  1CTR A;  2K7B A;  1DJI A;  2ZRS A;  4XJK A;  1F8H A;  3TZ1 A;  1QVI Y;  3NSI A;  1YUU A;  2LLU A;  4YI8 A;  1OMD A;  5EL2 A;  1JSA A;  1PVB A;  4AOM A;  1AJ5 A;  1ZUZ A;  4OKH A;  1SL7 A;  5CSF A;  3Q8I A;  3PM8 A;  1SMG A;  1EG4 A;  2RGI A;  3CGA A;  2KPH A;  1IJ6 A;  1GQM A;  3CZ0 A;  4PHJ A;  4OR9 B;  1T14 A;  1UHK A;  1QAS A;  1WRZ A;  3L47 A;  4GPL B;  4N1G A;  4PDZ A;  1IKU A;  1C07 A;  1JFJ A;  1PSR A;  1XK4 A;  2KNE A;  2I7A A;  5KSZ A;  1J1D A;  1REC A;  2L5X B;  2WCB A;  1OZS A;  1TNP A;  1N65 A;  1CB1 A;  1WDC C;  2LP3 A;  1CDL A;  5FYX A;  1NCZ A;  1N0Y A;  5HKZ A;  1KFX S;  3D73 A;  1FI6 A;  3V2L A;  3BXK A;  1DJW A;  1S1E A;  2QEV A;  1XO5 A;  1KSM A;  2H61 A;  2O60 A;  2H2K A;  1OOG A;  4ORB B;  2K61 A;  3R1P A;  1CLB A;  1KK7 Y;  3C1V A;  1H4B A;  1PRW A;  3D78 A;  3L4L A;  3S0E A;  3VGO A;  2PMY A;  2K7C A;  1MHO A;  3B6X A;  3I5H B;  3OGN A;  1SW8 A;  1LA3 A;  3BOW B;  1V1F A;  5I8N A;  3IVT A;  2SAS A;  3D75 A;  1Y1X A;  1R6P A;  1LVC D;  2TN4 A;  1LS8 A;  2M3W A;  5D7F A;  4JPZ B;  3HX4 A;  2AUC A;  4YGC B;  4AQI A;  1QX7 A;  3BYA A;  5CSN A;  4E68 A;  3D0Y B;  2EHB A;  1PSB A;  1UHI A;  2H61 C;  2ZN9 A;  3VRO A;  3S0A A;  1F71 A;  1YR5 A;  1DT7 B;  2L0P A;  2WND A;  4USL A;  1KFU L;  1KFX L;  1TNW A;  5CSJ A;  1RJV A;  2KYC A;  2BKH B;  1F55 A;  1Y6W A;  1JF2 A;  2Q91 A;  3SG4 A;  4XYN A;  1BOC A;  1GJY A;  2OTG B;  1BR1 B;  1NX1 A;  1KQM B;  3DXL A;  1IJ5 A;  1B8C A;  1SPY A;  3DD4 A;  3NSO A;  3DY9 A;  2EC6 C;  4HRE E;  2F3Z A;  3CAB A;  1JFK A;  1C7W A;  1CM4 A;  1DTL A;  2WCK A;  5CPV A;  4MLW A;  3SG2 A;  4YRU A;  1F4Q A;  2HF5 A;  3B88 A;  3TDZ A;  2KFF A;  1SR6 B;  3R72 A;  2JPT A;  2BBN A;  3WHT B;  3CTN A;  1DJG A;  3SG6 A;  2JNF A;  2JTT A;  2KLE A;  4PE0 A;  2E30 A;  1J1E A;  1S5G Y;  3JTD B;  4GFT A;  2M1K B;  2FOT A;  1A4P A;  1KFU S;  1WLZ A;  1ZMZ A;  3VRP A;  1GGW A;  3CLN A;  5PAL A;  1BG1 A;  1ALW A;  1DJY A;  3SJS A;  4GUK A;  1FPW A;  3PN7 C;  1QX2 A;  2CTN A;  3SG7 A;  3EVV A;  2KI4 B;  3CZT X;  3SG5 A;  4YGE B;  1W9Z A;  2JUL A;  1F54 A;  3QRX A;  1B9A A;  3N7H A;  1L2O C;  3FWC A;  1KWO B;  4M2Q A;  1B1G A;  4OVN F;  2OS8 B;  4GAO A;  1G8I A;  4BY4 A;  2NCP A;  2R2I A;  4NDD A;  4DS7 A;  1CLM A;  1KK8 B;  3LL8 B;  1QVI Z;  5FI7 A;  1CNP A;  5B8I B;  3EKJ A;  1S6C A;  1XFW O;  2JT8 A;  2GGZ A;  2G2B A;  1EH2 A;  2MA2 A;  2KAX A;  3OBV A;  4DIR A;  2WCH A;  2KFH A;  1OOH A;  3L4A A;  5K89 A;  1TOP A;  3O6B A;  2O5G A;  3AAK A;  1D1O A;  2YGU A;  3EVU A;  3O78 A;  4OCI A;  2LVI A;  4M2P A;  1DVI A;  3K1E A;  1R2U A;  2HPS A;  4PHM A;  3SIA A;  1DJZ A;  1DJX A;  1K93 D;  1SBJ A;  1SSE B;  2SCP A;  1N2D A;  2BNX A;  5IBW A;  3AKB A;  4GGN A;  3TDU A;  2KGB C;  1DEK A;  1J55 A;  3B7A A;  3BFA A;  3CS1 A;  5I2O A;  3BOW A;  1YVL A;  1IG5 A;  4YI9 A;  3DVM A;  1YX8 A;  4ORA B;  1QAT A;  1OOJ A;  4ORC B;  4JD9 A;  4Q04 A;  3CDN A;  1MWN A;  3LK0 A;  3PM2 A;  3H4S E;  1KSO A;  2FJU B;  4MRX A;  5AXI A;  3D76 A;  4JQ0 D;  2L50 A;  4FQO A;  3A8R A;  1RK9 A;  4OZD A;  1AVS A;  1HQV A;  1RRO A;  2KAY A;  3ZWH A;  1DQE A;  2P70 A;  2AMI A;  2L51 A;  4IL1 A;  1YX7 A;  3A4U B;  1ZAC A;  2CCM A;  3SG3 A;  5HL1 A;  1E8A A;  2KQY A;  2NZ0 A;  3KPX A;  2GV5 A;  2JRF A;  1TNQ A;  3VRR A;  1NYA A;  1SKT A;  1RWY A;  4PE1 A;  4HSZ A;  4CFQ A;  1K90 D;  1QV0 A; 
#chains in the Genus database with same CATH homology
 1LS8 A;  4F7F A;  2PQL A;  1OW4 A;  3NHI A;  3DZT A;  3FE8 A;  3BJH A;  3PJI A;  3S0A A;  3CZ1 A;  4FQT A;  3RZS A;  2WCL A;  3FE6 A;  2QEH A;  1C3Y A;  1QWV A;  1TWO A;  4INX A;  2FJY A;  3DXL A;  3NGV A;  1TUJ A;  3DY9 A;  3CAB A;  2WCK A;  3S0G A;  3B88 A;  2QDI A;  1OOF A;  3BFH A;  3R72 A;  3BFB A;  3R1O A;  1C3Z A;  4PT1 A;  5DIC A;  2WCM A;  4INW A;  3CYZ A;  2QEO A;  2WC6 A;  2QEB A;  2P71 A;  3S0D A;  1XFR A;  3N7H A;  2WCJ A;  2JPO A;  1P28 A;  5EL2 A;  3R1V A;  3B86 A;  2WCH A;  3B87 A;  3Q8I A;  1OOH A;  3L4A A;  3VB1 A;  3FE9 A;  3CZ0 A;  2KPH A;  1OOI X;  2WC5 A;  1T14 A;  3S0F A;  3L47 A;  3K1E A;  2L2C A;  3S0B A;  1GM0 A;  2ERB A;  2GTE A;  3B7A A;  3BFA A;  2H8V A;  3CZ2 A;  3D73 A;  4JD9 A;  3NHT A;  3CDN A;  3V2L A;  2QEV A;  3D74 A;  3D76 A;  4OZD A;  1OOG A;  3R1P A;  1DQE A;  3DYE A;  2P70 A;  3D78 A;  3L4L A;  3S0E A;  3D77 A;  3OGN A;  3B6X A;  1ORG A;  3QME A;  3D75 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...