3D75A

Crystal structure of a pheromone binding protein mutant d35n, from apis mellifera, at ph 5.5
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
117
structure length
117
Chain Sequence
DWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVNKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Pheromone binding protein
molecule keywords Pheromone-binding protein ASP1
publication title Queen bee pheromone binding protein pH-induced domain swapping favors pheromone release
pubmed doi rcsb
source organism Apis mellifera
total genus 37
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3d75A00
3NHTA 1XFRA 2WCHA 3NGVA 3L47A 3BFBA 3B87A 3BFHA 3CDNA 3D77A 2FJYA 1OOHA 4INXA 1C3ZA 5DICA 1OOFA 3CZ1A 1ORGA 1C3YA 3DY9A 2WC5A 1LS8A 3B88A 3V2LA 3PJIA 2H8VA 3K1EA 3CABA 3B86A 3N7HA 1OOIX 3L4LA 3S0BA 3RZSA 3S0AA 3D73A 2WCMA 2KPHA 2WC6A 3DYEA 3R1OA 3S0EA 3D74A 3CYZA 1T14A 2PQLA 3S0DA 3D78A 3L4AA 3FE9A 2QDIA 1QWVA 3BFAA 1P28A 3B6XA 3B7AA 3S0FA 2QEHA 1TUJA 4FQTA 3FE8A 4OZDA 3R72A 1TWOA 2WCJA 2WCLA 2ERBA 3DZTA 2QEOA 4F7FA 4PT1A 2QEVA 3BJHA 1OOGA 3OGNA 3VB1A 2JPOA 3QMEA 3D76A 3R1VA 5EL2A 1GM0A 1DQEA 3DXLA 3D75A 2GTEA 3CZ2A 1OW4A 3FE6A 2P70A 3R1PA 4INWA 2L2CA 2WCKA 3NHIA 3Q8IA 4JD9A 2P71A 3CZ0A 2QEBA 3S0GA
chains in the Genus database with same CATH superfamily
1OOJA 2JPTA 1UURA 1CM4A 1TNQA 1A2XA 1UUSA 2KAVA 3I5GB 5ER5A 2MLEC 5HLVA 1KQMB 2KSPA 4GBAA 4YGEB 1NX1A 1GJYA 1J7PA 1SL7A 3CR2A 2I94A 1B47A 1TOPA 4XYNA 2BAPA 5CSIA 3CDNA 4DRWA 1RTP1 3D77A 1DC1A 2K0JA 2COLB 1QX7A 3O4YA 4AQJA 3RLZA 3DVEA 3HCMA 4YGDB 3A4UB 1FW4A 2JU0A 4WQ2A 3VRQA 4YBHB 2WC5A 1Y1AA 3B88A 2LMVA 1QTXA 4PE4A 4A4BA 3PATA 2LUCA 4MEWA 1S3PA 1DMOA 1SR6C 3CABA 3DF0B 1OOIX 2PALA 3VRPA 2Y5IA 3S0BA 3RZSA 3LK0A 3UO9A 1S5GY 1FF1A 2H61C 1KWOB 3D73A 1AK8A 2M8UA 1UHJA 2FOTA 1SL9A 2LLSA 1S26D 1MUXA 1S6IA 1PK0D 4YI8A 3DD4A 3D78A 1N2DA 1YVLA 1K8UA 3BUOB 3FE9A 3L4AA 1XK4A 1M45A 3O2PA 3QRXA 1XVJA 1P28A 3B7AA 1XFZO 1CFFA 1JBAA 3SIBA 1YX7A 1QS7A 4JKTA 2QEHA 2JZIA 4GGNA 4DS7A 4E68A 1Y0VH 1MWNA 1TWOA 1BJFA 1JSAA 3TS5C 3KEVA 2LV7A 3MSEB 2WCLA 2BECA 3DZTA 2BBMA 2LC5A 5I2LA 2GGZA 4F7FA 1XFYO 1Y1XA 1BU3A 2AAOA 2KFGA 3TDZA 1TRFA 1BOCA 2K61A 5DKQA 1AUIB 1K94A 3QMEA 1K9KA 1G33A 1PVAA 1SCMC 2KYFA 4BY5A 5HKZA 3PN7C 2WC8A 1B8LA 4NQGA 1XK4C 1GM0A 2HQWA 1WDCC 5K89A 2L0PA 1MQ1A 5TNCA 3OB1B 5CSJA 4WRIA 3DXLA 3RM1A 3K21A 1WLMA 1XYDA 1YUSA 3TUYC 1IWQA 1LA3A 1LKJA 2ZN9A 1B1GA 3FS7A 5JJGA 1CLLA 4C0JA 2GTEA 3D0YA 4ETOA 4C0LA 1OW4A 2M29A 3ZNIA 1ALWA 4GFTA 1NPQA 2LNKA 1CM1A 3GK1A 2K7OA 2WORA 3BQ3A 1EH2A 1Y6WA 3R1PA 4INWA 4GUKA 2H2KA 1C7WA 1YR5A 2L2CA 3Q8IA 4JD9A 5G08A 1SYMA 5KU1A 1NWDA 1FI5A 4YGBB 1QV0A 1VRKA 3S0GA 1XFWO 1YRUB 3GK4X 4ICBA 2FCEA 1DT7B 3NHTA 3EVRA 4OV2A 2M9GA 5B8IB 3BOWB 1Z4HA 1SRAA 1EXRA 1DEKA 3NXAA 1XFRA 1F54A 1H8BA 2MHHA 3O6BA 1A29A 5I8NA 5AXIA 2KAXA 1B4CA 4MRYA 1KK8B 1QIVA 3NGVA 1Q80A 1B8RA 2JNFA 3L47A 1F71A 3AKAA 3PFVA 1EG3A 5FI6A 4ZCVA 2O5GA 5AFPA 1S5GZ 2EC6C 3GOFA 1B7TY 3PLFB 5HL1A 2JT8A 4QJ3B 3CS1A 1XA5A 2I2RE 4MRXA 2QACA 3CZTX 5I2OA 2LANA 5ER4X 5DICA 1JUOA 2BL0C 3TZ1A 1JF2A 1OQPA 2KDHA 5D7FA 3IQOA 2KLDA 1C7VA 1C3YA 1MHOA 3EG5B 2FJUB 3DY9A 1LS8A 1J1EA 3JVTC 4L9MA 4PALA 1TIZA 4P2YB 1CDNA 1DGVA 1DGUA 2MA2A 2H8VA 2F2OA 3NSOA 3VRRA 4QJ5B 1V1FA 1W7JB 4JWQA 2I18A 2BE4A 1KSMA 3OB2B 1PRWA 2Q4UA 3S0AA 1WRLA 1KK7Z 2K2AA 4PHJA 2M1UA 1H4BA 3EK7A 2AUCA 4C0KA 2LMTA 2OTGC 5CSFA 3S0EA 1EG4A 3SS3A 1YURA 1AJ5A 2LHIA 1T14A 1G4YR 1YVHA 1FBVA 2MJWB 1SBJA 1TNWA 3S0DA 5D3OA 1QWVA 3BFAA 4HRGA 1TCOB 2IS9A 3AAJA 3I5IB 1BR1B 1TUZA 2SCPA 5PALA 1A75B 2Q91A 1CMGA 3B6XA 1K2HA 1QX5B 1LXFC 1W9ZA 2ISDA 1L2OC 3OX6A 3DF0A 1QVIY 1A03A 2CTNA 1N65A 2LVJA 1PALA 4YGCB 4FQTA 5FI7A 1UHHA 1Z2CB 2JQ6A 2M7NA 3LK1A 3R72A 5HYDA 4D1EA 3I5HB 2MRDA 1QJTA 4N5XA 2JXLA 1NIWA 4R1EA 1R2UA 2Y1NA 2MAZA 4GGFC 2WCJA 3I5GC 2B1UA 3CR4X 1OMVA 1KQMC 2GV5A 3FIAA 5I2QA 4PT1A 2LMUA 1DJYA 4U8DA 5J3XA 2G9BA 3VB1A 2BCAA 3M0WA 1M39A 4QJ4B 1NP8A 4CIDA 4M2QA 1B9AA 2G2BA 1ZUZA 4MLWA 1J7OA 3CGAA 1R6PA 3O78A 1CFCA 4OCIA 2RGIA 4PHMA 1IQ5A 4BY4A 2E30A 2EGDA 1DJGA 3D10A 4ORBB 4I5NB 1RWYA 2HPSA 3CTNA 2P6BB 2MLFC 2LLTA 1AJ4A 1E8AA 2BE6A 1B7TZ 1OMDA 2KNEA 3WNXB 1WDCB 3ICBA 1GGWA 2OS8C 2NXQA 5D69A 4M2OA 1QXPA 3CZ0A 1ZMZA 3I5FB 2ZKMX 3JTDC 1JFKA 4P5OE 2KOTA 4I5JA 1L7ZA 2L5XB 1QV1A 1BG1A 3CWGA 3KF9A 3AAKA 3VGOA 1CDPA 2BBNA 4HSZA 3WHUB 1KFXS 1DELA 2L4IA 1IRJA 2LCPA 2ZNDA 1CMFA 4A4CA 2TN4A 2WOSA 1U5IA 2JT3A 3E3RA 2OPOA 2K8MB 3GK2A 1LA0A 4ZCUA 2BKHB 3B87A 2V53A 2JT0A 1SY9A 3CLNA 3PM2A 4IJ7A 4MZJA 1OOHA 1NCZA 4INXA 3DVKA 3VROA 2KHNA 2JRFA 2M0RA 3LLEA 4ORCB 4YGAA 1SL8A 3CZ1A 2BKIB 5DKRA 1BT6A 2F2PA 1KFUL 3OX5A 1BODA 3PJIA 1DJIA 1N0YA 2NLNA 4M2PA 2JTTA 3K1EA 2K7BA 3N7HA 1IGVA 2CT9A 3L4LA 2MBXA 1IJ5A 1DJWA 2WCFA 1TN4A 1RK9A 4PCWA 5AERA 3SIAA 2LP3A 3PSRA 2E6WA 1SCVA 2WCMA 3KO0A 1QVIZ 1M31A 3ZWHA 1EJ3A 1K95A 1J7QA 2JC2A 1BMOA 3R1OA 4AOMA 3EVUA 1BR4B 3SG7A 3LCPC 4DIRA 1HT9A 1LINA 3D74A 3JVTB 1UP5A 2KQYA 3CYZA 4PDZA 4XJKA 1CLBA 1ALVA 2PQLA 3O4XA 1F4OA 1YRTB 2JWWA 2QDIA 1MF8B 2FCDA 2KLEA 2LLUA 1JFJA 2F3ZA 1KFUS 1MXEA 1YUUA 2M97A 3SG5A 1WRZA 3S0FA 1NSHA 2KFFA 4JQ0D 1BLQA 1YTZC 5AEQA 3DVJA 1CB1A 4MSPA 1TUJA 4GGFA 2KI4C 3FE8A 1SNLA 1NCYA 1ZACA 1AP4A 5KSZA 2KGBC 4WQ3A 1TNXA 2KFHA 1K9UA 2PRUA 2ERBA 1KK8C 3LL8B 2JNXA 3AKBA 1XO5A 3OHMB 2QEVA 3BJHA 1A4PA 1B8CA 1F4QA 1IH0A 1CFPA 1OOGA 1QLSA 1SR6B 1DF0B 1TNPA 2SASA 4OR9B 2PVBA 1J7RA 4I5LB 1A75A 2PMYA 1NYAA 1WLZA 1SK6D 1WY9A 2CBLA 3R1VA 4TNCA 2JULA 4MVFA 3UNWA 4CLNA 1DQEA 5HLOA 1K90D 5HKWA 1YUTA 3BYAA 1DJHA 3EKJA 3IF7A 1M46A 1G8IA 2DOQA 3A8RA 5F6TA 5KTYA 1IIOA 1CFDA 1S6CA 3NSLA 1QATA 4OVNF 1D1OA 1KSOA 4GNKB 1LVCD 4YRUA 5GQQC 2WNDA 1OZSA 2Y4QA 2WCBA 2KI6C 1KQVA 2WCKA 3NHIA 1X02A 2P71A 2CXJA 2QEBA 1S36A 2VRGA 4FQOA 2F33A 3I5IC 4PE0A 3TS5B 1KFXL 5HKYA 1TTXA 2AMIA 1J1DA 1GQMA 1NUBA 1QLKA 2CNPA 2GGMA 2NZ0A 2WCHA 3BUXB 3BXKA 4IL1A 3WHTB 4JPZB 4PE1A 1QIWA 3BFBA 3BFHA 2PYQA 1S6JA 2M7LA 2L4HA 2OS8B 5FI2A 2ZNEA 3SG2A 4YI9A 1CTRA 3PM8A 4DCKA 2FJYA 4MN0A 1SCMB 1XFVO 2JOJA 3JTDB 2F3YA 3PN7B 3BUWB 5CPVA 1SMGA 4HRHA 1C3ZA 1BF5A 3I5HC 1KWOC 1OOFA 2QPTA 4N1FA 3SS4A 1NX0A 1ORGA 3NSIA 2LP2A 4PHKA 1CDLA 4CFRA 2D8NA 3EKHA 3SG4A 1J55A 1OMRA 3V2LA 3SS5A 1CLMA 3TUYB 2KAYA 1RFJA 2I7AA 2F8PA 3NSKA 1KK7Y 1EL4A 3B86A 1UHKA 2WCEA 1RECA 2L2EA 3OBVA 1ODBA 4PE7A 1IG5A 3C1VA 1OZOA 2HQ8A 2R2IA 2KPHA 4PHNA 2JXCA 1GGZA 1S1EA 1DTLA 2PSRA 2L51A 2WC6A 2PASA 1CDMA 2L50A 3DYEA 1WRKA 2L5YA 1AHRA 1IKUA 2L98A 1NX2A 2KBIA 4NDCA 3VRNA 3IQQA 1JF0A 2EHBA 1F55A 1IJ6A 1C07A 4GAOA 3IVTA 4USLA 1K9PA 1PVBA 3TDIA 5JOLA 1XFXO 4CFQA 1F8HA 2M1KB 1UWOA 2HF5A 1K93D 2LVIA 1JC2A 1MXLC 1UHNA 3EK8A 3EVVA 4DUQA 1F70A 2NCPA 2NCOA 1ZOTB 4OKHA 2EC6B 2CCMA 1U5IB 3I5FC 4MZLA 1DJZA 3BOWA 1Y1UA 2ZRTA 2A4JA 4OZDA 3SJSA 4MZKA 2Y1MA 2BL0B 2LHLA 1NCXA 3D0YB 3FWCA 1SKTA 3F45A 1AVSA 2QEOA 3CR5X 2LVKA 2LAPA 3TDUA 1IQ3A 1DJXA 2BNXA 2K7CA 4F0ZB 2JTZA 2LM5A 2K7DA 2BCBA 2LUXA 3OGNA 2YGUA 2ZFDA 1RROA 2JPOA 3EK4A 2ZN8A 4UPGA 3KPXA 1OSAA 1RJVA 2KI4B 3D76A 3SG3A 1QASA 2HETA 1PSRA 1OE9B 1XFUO 1ZFSA 5EL2A 2M49B 4FTGA 1TCFA 2LE9B 3FWBA 4NDBA 2K60A 4MBEA 3SG6A 5BPJA 1CKKA 1QX2A 1CNPA 5CSNA 1PULA 2OTGB 2K2FA 1MR8A 4NDDA 5FYXA 1PSBA 3H4SE 1W7IB 4CPVA 2M3WA 2KQ6A 3WXAA 5AANA 1M63B 4GPLB 1JWDA 3BUMB 3D75A 1NX3A 1SPYA 2LVVA 3PALA 5I94A 4AQIA 4I5KA 1FPWA 4ORAB 3CZ2A 3HX4A 3KHEA 4HREE 1V1GA 3BUNB 3FE6A 4XJKB 1FI6A 2P70A 5IBWA 4N1GA 4Q04A 1KCYA 1SSEB 2KYCA 4KYNA 1YX8A 2BCXA 5DKNA 1HQVA 3DVMA 3OP0A 1DVIA 1L2OB 2KI6D 1DF0A 1SW8A 2O60A 2KBMA 2KGRA 2ZRSA 1UHIA 1K96A 2H61A
chains in the Genus database with same CATH topology
3NHTA 1XFRA 2WCHA 3NGVA 3L47A 3BFBA 3B87A 3BFHA 3CDNA 3D77A 2FJYA 1OOHA 4INXA 1C3ZA 5DICA 1OOFA 3CZ1A 1ORGA 1C3YA 3DY9A 2WC5A 1LS8A 3B88A 3V2LA 3PJIA 2H8VA 3K1EA 3CABA 3B86A 3N7HA 1OOIX 3L4LA 3S0BA 3RZSA 3S0AA 3D73A 2WCMA 2KPHA 2WC6A 3DYEA 3R1OA 3S0EA 3D74A 3CYZA 1T14A 2PQLA 3S0DA 3D78A 3L4AA 3FE9A 2QDIA 1QWVA 3BFAA 1P28A 3B6XA 3B7AA 3S0FA 2QEHA 1TUJA 4FQTA 3FE8A 4OZDA 3R72A 1TWOA 2WCJA 2WCLA 2ERBA 3DZTA 2QEOA 4F7FA 4PT1A 2QEVA 3BJHA 1OOGA 3OGNA 3VB1A 2JPOA 3QMEA 3D76A 3R1VA 5EL2A 1GM0A 1DQEA 3DXLA 3D75A 2GTEA 3CZ2A 1OW4A 3FE6A 2P70A 3R1PA 4INWA 2L2CA 2WCKA 3NHIA 3Q8IA 4JD9A 2P71A 3CZ0A 2QEBA 3S0GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NHT A;  1XFR A;  2WCH A;  3NGV A;  3L47 A;  3BFB A;  3B87 A;  3BFH A;  3CDN A;  3D77 A;  2FJY A;  1OOH A;  4INX A;  1C3Z A;  5DIC A;  1OOF A;  3CZ1 A;  1ORG A;  1C3Y A;  3DY9 A;  2WC5 A;  1LS8 A;  3B88 A;  3V2L A;  3PJI A;  2H8V A;  3K1E A;  3CAB A;  3B86 A;  3N7H A;  1OOI X;  3L4L A;  3S0B A;  3RZS A;  3S0A A;  3D73 A;  2WCM A;  2KPH A;  2WC6 A;  3DYE A;  3R1O A;  3S0E A;  3D74 A;  3CYZ A;  1T14 A;  2PQL A;  3S0D A;  3D78 A;  3L4A A;  3FE9 A;  2QDI A;  1QWV A;  3BFA A;  1P28 A;  3B6X A;  3B7A A;  3S0F A;  2QEH A;  1TUJ A;  4FQT A;  3FE8 A;  4OZD A;  3R72 A;  1TWO A;  2WCJ A;  2WCL A;  2ERB A;  3DZT A;  2QEO A;  4F7F A;  4PT1 A;  2QEV A;  3BJH A;  1OOG A;  3OGN A;  3VB1 A;  2JPO A;  3QME A;  3D76 A;  3R1V A;  5EL2 A;  1GM0 A;  1DQE A;  3DXL A;  3D75 A;  2GTE A;  3CZ2 A;  1OW4 A;  3FE6 A;  2P70 A;  3R1P A;  4INW A;  2L2C A;  2WCK A;  3NHI A;  3Q8I A;  4JD9 A;  2P71 A;  3CZ0 A;  2QEB A;  3S0G A; 
#chains in the Genus database with same CATH topology
 1OOJ A;  2JPT A;  1UUR A;  1CM4 A;  1TNQ A;  1A2X A;  1UUS A;  2KAV A;  3I5G B;  5ER5 A;  2MLE C;  5HLV A;  1KQM B;  2KSP A;  4GBA A;  4YGE B;  1NX1 A;  1GJY A;  1J7P A;  1SL7 A;  3CR2 A;  2I94 A;  1B47 A;  1TOP A;  4XYN A;  2BAP A;  5CSI A;  3CDN A;  4DRW A;  1RTP 1;  3D77 A;  1DC1 A;  2K0J A;  2COL B;  1QX7 A;  3O4Y A;  4AQJ A;  3RLZ A;  3DVE A;  3HCM A;  4YGD B;  3A4U B;  1FW4 A;  2JU0 A;  4WQ2 A;  3VRQ A;  4YBH B;  2WC5 A;  1Y1A A;  3B88 A;  2LMV A;  1QTX A;  4PE4 A;  4A4B A;  3PAT A;  2LUC A;  4MEW A;  1S3P A;  1DMO A;  1SR6 C;  3CAB A;  3DF0 B;  1OOI X;  2PAL A;  3VRP A;  2Y5I A;  3S0B A;  3RZS A;  3LK0 A;  3UO9 A;  1S5G Y;  1FF1 A;  2H61 C;  1KWO B;  3D73 A;  1AK8 A;  2M8U A;  1UHJ A;  2FOT A;  1SL9 A;  2LLS A;  1S26 D;  1MUX A;  1S6I A;  1PK0 D;  4YI8 A;  3DD4 A;  3D78 A;  1N2D A;  1YVL A;  1K8U A;  3BUO B;  3FE9 A;  3L4A A;  1XK4 A;  1M45 A;  3O2P A;  3QRX A;  1XVJ A;  1P28 A;  3B7A A;  1XFZ O;  1CFF A;  1JBA A;  3SIB A;  1YX7 A;  1QS7 A;  4JKT A;  2QEH A;  2JZI A;  4GGN A;  4DS7 A;  4E68 A;  1Y0V H;  1MWN A;  1TWO A;  1BJF A;  1JSA A;  3TS5 C;  3KEV A;  2LV7 A;  3MSE B;  2WCL A;  2BEC A;  3DZT A;  2BBM A;  2LC5 A;  5I2L A;  2GGZ A;  4F7F A;  1XFY O;  1Y1X A;  1BU3 A;  2AAO A;  2KFG A;  3TDZ A;  1TRF A;  1BOC A;  2K61 A;  5DKQ A;  1AUI B;  1K94 A;  3QME A;  1K9K A;  1G33 A;  1PVA A;  1SCM C;  2KYF A;  4BY5 A;  5HKZ A;  3PN7 C;  2WC8 A;  1B8L A;  4NQG A;  1XK4 C;  1GM0 A;  2HQW A;  1WDC C;  5K89 A;  2L0P A;  1MQ1 A;  5TNC A;  3OB1 B;  5CSJ A;  4WRI A;  3DXL A;  3RM1 A;  3K21 A;  1WLM A;  1XYD A;  1YUS A;  3TUY C;  1IWQ A;  1LA3 A;  1LKJ A;  2ZN9 A;  1B1G A;  3FS7 A;  5JJG A;  1CLL A;  4C0J A;  2GTE A;  3D0Y A;  4ETO A;  4C0L A;  1OW4 A;  2M29 A;  3ZNI A;  1ALW A;  4GFT A;  1NPQ A;  2LNK A;  1CM1 A;  3GK1 A;  2K7O A;  2WOR A;  3BQ3 A;  1EH2 A;  1Y6W A;  3R1P A;  4INW A;  4GUK A;  2H2K A;  1C7W A;  1YR5 A;  2L2C A;  3Q8I A;  4JD9 A;  5G08 A;  1SYM A;  5KU1 A;  1NWD A;  1FI5 A;  4YGB B;  1QV0 A;  1VRK A;  3S0G A;  1XFW O;  1YRU B;  3GK4 X;  4ICB A;  2FCE A;  1DT7 B;  3NHT A;  3EVR A;  4OV2 A;  2M9G A;  5B8I B;  3BOW B;  1Z4H A;  1SRA A;  1EXR A;  1DEK A;  3NXA A;  1XFR A;  1F54 A;  1H8B A;  2MHH A;  3O6B A;  1A29 A;  5I8N A;  5AXI A;  2KAX A;  1B4C A;  4MRY A;  1KK8 B;  1QIV A;  3NGV A;  1Q80 A;  1B8R A;  2JNF A;  3L47 A;  1F71 A;  3AKA A;  3PFV A;  1EG3 A;  5FI6 A;  4ZCV A;  2O5G A;  5AFP A;  1S5G Z;  2EC6 C;  3GOF A;  1B7T Y;  3PLF B;  5HL1 A;  2JT8 A;  4QJ3 B;  3CS1 A;  1XA5 A;  2I2R E;  4MRX A;  2QAC A;  3CZT X;  5I2O A;  2LAN A;  5ER4 X;  5DIC A;  1JUO A;  2BL0 C;  3TZ1 A;  1JF2 A;  1OQP A;  2KDH A;  5D7F A;  3IQO A;  2KLD A;  1C7V A;  1C3Y A;  1MHO A;  3EG5 B;  2FJU B;  3DY9 A;  1LS8 A;  1J1E A;  3JVT C;  4L9M A;  4PAL A;  1TIZ A;  4P2Y B;  1CDN A;  1DGV A;  1DGU A;  2MA2 A;  2H8V A;  2F2O A;  3NSO A;  3VRR A;  4QJ5 B;  1V1F A;  1W7J B;  4JWQ A;  2I18 A;  2BE4 A;  1KSM A;  3OB2 B;  1PRW A;  2Q4U A;  3S0A A;  1WRL A;  1KK7 Z;  2K2A A;  4PHJ A;  2M1U A;  1H4B A;  3EK7 A;  2AUC A;  4C0K A;  2LMT A;  2OTG C;  5CSF A;  3S0E A;  1EG4 A;  3SS3 A;  1YUR A;  1AJ5 A;  2LHI A;  1T14 A;  1G4Y R;  1YVH A;  1FBV A;  2MJW B;  1SBJ A;  1TNW A;  3S0D A;  5D3O A;  1QWV A;  3BFA A;  4HRG A;  1TCO B;  2IS9 A;  3AAJ A;  3I5I B;  1BR1 B;  1TUZ A;  2SCP A;  5PAL A;  1A75 B;  2Q91 A;  1CMG A;  3B6X A;  1K2H A;  1QX5 B;  1LXF C;  1W9Z A;  2ISD A;  1L2O C;  3OX6 A;  3DF0 A;  1QVI Y;  1A03 A;  2CTN A;  1N65 A;  2LVJ A;  1PAL A;  4YGC B;  4FQT A;  5FI7 A;  1UHH A;  1Z2C B;  2JQ6 A;  2M7N A;  3LK1 A;  3R72 A;  5HYD A;  4D1E A;  3I5H B;  2MRD A;  1QJT A;  4N5X A;  2JXL A;  1NIW A;  4R1E A;  1R2U A;  2Y1N A;  2MAZ A;  4GGF C;  2WCJ A;  3I5G C;  2B1U A;  3CR4 X;  1OMV A;  1KQM C;  2GV5 A;  3FIA A;  5I2Q A;  4PT1 A;  2LMU A;  1DJY A;  4U8D A;  5J3X A;  2G9B A;  3VB1 A;  2BCA A;  3M0W A;  1M39 A;  4QJ4 B;  1NP8 A;  4CID A;  4M2Q A;  1B9A A;  2G2B A;  1ZUZ A;  4MLW A;  1J7O A;  3CGA A;  1R6P A;  3O78 A;  1CFC A;  4OCI A;  2RGI A;  4PHM A;  1IQ5 A;  4BY4 A;  2E30 A;  2EGD A;  1DJG A;  3D10 A;  4ORB B;  4I5N B;  1RWY A;  2HPS A;  3CTN A;  2P6B B;  2MLF C;  2LLT A;  1AJ4 A;  1E8A A;  2BE6 A;  1B7T Z;  1OMD A;  2KNE A;  3WNX B;  1WDC B;  3ICB A;  1GGW A;  2OS8 C;  2NXQ A;  5D69 A;  4M2O A;  1QXP A;  3CZ0 A;  1ZMZ A;  3I5F B;  2ZKM X;  3JTD C;  1JFK A;  4P5O E;  2KOT A;  4I5J A;  1L7Z A;  2L5X B;  1QV1 A;  1BG1 A;  3CWG A;  3KF9 A;  3AAK A;  3VGO A;  1CDP A;  2BBN A;  4HSZ A;  3WHU B;  1KFX S;  1DEL A;  2L4I A;  1IRJ A;  2LCP A;  2ZND A;  1CMF A;  4A4C A;  2TN4 A;  2WOS A;  1U5I A;  2JT3 A;  3E3R A;  2OPO A;  2K8M B;  3GK2 A;  1LA0 A;  4ZCU A;  2BKH B;  3B87 A;  2V53 A;  2JT0 A;  1SY9 A;  3CLN A;  3PM2 A;  4IJ7 A;  4MZJ A;  1OOH A;  1NCZ A;  4INX A;  3DVK A;  3VRO A;  2KHN A;  2JRF A;  2M0R A;  3LLE A;  4ORC B;  4YGA A;  1SL8 A;  3CZ1 A;  2BKI B;  5DKR A;  1BT6 A;  2F2P A;  1KFU L;  3OX5 A;  1BOD A;  3PJI A;  1DJI A;  1N0Y A;  2NLN A;  4M2P A;  2JTT A;  3K1E A;  2K7B A;  3N7H A;  1IGV A;  2CT9 A;  3L4L A;  2MBX A;  1IJ5 A;  1DJW A;  2WCF A;  1TN4 A;  1RK9 A;  4PCW A;  5AER A;  3SIA A;  2LP3 A;  3PSR A;  2E6W A;  1SCV A;  2WCM A;  3KO0 A;  1QVI Z;  1M31 A;  3ZWH A;  1EJ3 A;  1K95 A;  1J7Q A;  2JC2 A;  1BMO A;  3R1O A;  4AOM A;  3EVU A;  1BR4 B;  3SG7 A;  3LCP C;  4DIR A;  1HT9 A;  1LIN A;  3D74 A;  3JVT B;  1UP5 A;  2KQY A;  3CYZ A;  4PDZ A;  4XJK A;  1CLB A;  1ALV A;  2PQL A;  3O4X A;  1F4O A;  1YRT B;  2JWW A;  2QDI A;  1MF8 B;  2FCD A;  2KLE A;  2LLU A;  1JFJ A;  2F3Z A;  1KFU S;  1MXE A;  1YUU A;  2M97 A;  3SG5 A;  1WRZ A;  3S0F A;  1NSH A;  2KFF A;  4JQ0 D;  1BLQ A;  1YTZ C;  5AEQ A;  3DVJ A;  1CB1 A;  4MSP A;  1TUJ A;  4GGF A;  2KI4 C;  3FE8 A;  1SNL A;  1NCY A;  1ZAC A;  1AP4 A;  5KSZ A;  2KGB C;  4WQ3 A;  1TNX A;  2KFH A;  1K9U A;  2PRU A;  2ERB A;  1KK8 C;  3LL8 B;  2JNX A;  3AKB A;  1XO5 A;  3OHM B;  2QEV A;  3BJH A;  1A4P A;  1B8C A;  1F4Q A;  1IH0 A;  1CFP A;  1OOG A;  1QLS A;  1SR6 B;  1DF0 B;  1TNP A;  2SAS A;  4OR9 B;  2PVB A;  1J7R A;  4I5L B;  1A75 A;  2PMY A;  1NYA A;  1WLZ A;  1SK6 D;  1WY9 A;  2CBL A;  3R1V A;  4TNC A;  2JUL A;  4MVF A;  3UNW A;  4CLN A;  1DQE A;  5HLO A;  1K90 D;  5HKW A;  1YUT A;  3BYA A;  1DJH A;  3EKJ A;  3IF7 A;  1M46 A;  1G8I A;  2DOQ A;  3A8R A;  5F6T A;  5KTY A;  1IIO A;  1CFD A;  1S6C A;  3NSL A;  1QAT A;  4OVN F;  1D1O A;  1KSO A;  4GNK B;  1LVC D;  4YRU A;  5GQQ C;  2WND A;  1OZS A;  2Y4Q A;  2WCB A;  2KI6 C;  1KQV A;  2WCK A;  3NHI A;  1X02 A;  2P71 A;  2CXJ A;  2QEB A;  1S36 A;  2VRG A;  4FQO A;  2F33 A;  3I5I C;  4PE0 A;  3TS5 B;  1KFX L;  5HKY A;  1TTX A;  2AMI A;  1J1D A;  1GQM A;  1NUB A;  1QLK A;  2CNP A;  2GGM A;  2NZ0 A;  2WCH A;  3BUX B;  3BXK A;  4IL1 A;  3WHT B;  4JPZ B;  4PE1 A;  1QIW A;  3BFB A;  3BFH A;  2PYQ A;  1S6J A;  2M7L A;  2L4H A;  2OS8 B;  5FI2 A;  2ZNE A;  3SG2 A;  4YI9 A;  1CTR A;  3PM8 A;  4DCK A;  2FJY A;  4MN0 A;  1SCM B;  1XFV O;  2JOJ A;  3JTD B;  2F3Y A;  3PN7 B;  3BUW B;  5CPV A;  1SMG A;  4HRH A;  1C3Z A;  1BF5 A;  3I5H C;  1KWO C;  1OOF A;  2QPT A;  4N1F A;  3SS4 A;  1NX0 A;  1ORG A;  3NSI A;  2LP2 A;  4PHK A;  1CDL A;  4CFR A;  2D8N A;  3EKH A;  3SG4 A;  1J55 A;  1OMR A;  3V2L A;  3SS5 A;  1CLM A;  3TUY B;  2KAY A;  1RFJ A;  2I7A A;  2F8P A;  3NSK A;  1KK7 Y;  1EL4 A;  3B86 A;  1UHK A;  2WCE A;  1REC A;  2L2E A;  3OBV A;  1ODB A;  4PE7 A;  1IG5 A;  3C1V A;  1OZO A;  2HQ8 A;  2R2I A;  2KPH A;  4PHN A;  2JXC A;  1GGZ A;  1S1E A;  1DTL A;  2PSR A;  2L51 A;  2WC6 A;  2PAS A;  1CDM A;  2L50 A;  3DYE A;  1WRK A;  2L5Y A;  1AHR A;  1IKU A;  2L98 A;  1NX2 A;  2KBI A;  4NDC A;  3VRN A;  3IQQ A;  1JF0 A;  2EHB A;  1F55 A;  1IJ6 A;  1C07 A;  4GAO A;  3IVT A;  4USL A;  1K9P A;  1PVB A;  3TDI A;  5JOL A;  1XFX O;  4CFQ A;  1F8H A;  2M1K B;  1UWO A;  2HF5 A;  1K93 D;  2LVI A;  1JC2 A;  1MXL C;  1UHN A;  3EK8 A;  3EVV A;  4DUQ A;  1F70 A;  2NCP A;  2NCO A;  1ZOT B;  4OKH A;  2EC6 B;  2CCM A;  1U5I B;  3I5F C;  4MZL A;  1DJZ A;  3BOW A;  1Y1U A;  2ZRT A;  2A4J A;  4OZD A;  3SJS A;  4MZK A;  2Y1M A;  2BL0 B;  2LHL A;  1NCX A;  3D0Y B;  3FWC A;  1SKT A;  3F45 A;  1AVS A;  2QEO A;  3CR5 X;  2LVK A;  2LAP A;  3TDU A;  1IQ3 A;  1DJX A;  2BNX A;  2K7C A;  4F0Z B;  2JTZ A;  2LM5 A;  2K7D A;  2BCB A;  2LUX A;  3OGN A;  2YGU A;  2ZFD A;  1RRO A;  2JPO A;  3EK4 A;  2ZN8 A;  4UPG A;  3KPX A;  1OSA A;  1RJV A;  2KI4 B;  3D76 A;  3SG3 A;  1QAS A;  2HET A;  1PSR A;  1OE9 B;  1XFU O;  1ZFS A;  5EL2 A;  2M49 B;  4FTG A;  1TCF A;  2LE9 B;  3FWB A;  4NDB A;  2K60 A;  4MBE A;  3SG6 A;  5BPJ A;  1CKK A;  1QX2 A;  1CNP A;  5CSN A;  1PUL A;  2OTG B;  2K2F A;  1MR8 A;  4NDD A;  5FYX A;  1PSB A;  3H4S E;  1W7I B;  4CPV A;  2M3W A;  2KQ6 A;  3WXA A;  5AAN A;  1M63 B;  4GPL B;  1JWD A;  3BUM B;  3D75 A;  1NX3 A;  1SPY A;  2LVV A;  3PAL A;  5I94 A;  4AQI A;  4I5K A;  1FPW A;  4ORA B;  3CZ2 A;  3HX4 A;  3KHE A;  4HRE E;  1V1G A;  3BUN B;  3FE6 A;  4XJK B;  1FI6 A;  2P70 A;  5IBW A;  4N1G A;  4Q04 A;  1KCY A;  1SSE B;  2KYC A;  4KYN A;  1YX8 A;  2BCX A;  5DKN A;  1HQV A;  3DVM A;  3OP0 A;  1DVI A;  1L2O B;  2KI6 D;  1DF0 A;  1SW8 A;  2O60 A;  2KBM A;  2KGR A;  2ZRS A;  1UHI A;  1K96 A;  2H61 A; 
#chains in the Genus database with same CATH homology
 3NHT A;  1XFR A;  2WCH A;  3NGV A;  3L47 A;  3BFB A;  3B87 A;  3BFH A;  3CDN A;  3D77 A;  2FJY A;  1OOH A;  4INX A;  1C3Z A;  5DIC A;  1OOF A;  3CZ1 A;  1ORG A;  1C3Y A;  3DY9 A;  2WC5 A;  1LS8 A;  3B88 A;  3V2L A;  3PJI A;  2H8V A;  3K1E A;  3CAB A;  3B86 A;  3N7H A;  1OOI X;  3L4L A;  3S0B A;  3RZS A;  3S0A A;  3D73 A;  2WCM A;  2KPH A;  2WC6 A;  3DYE A;  3R1O A;  3S0E A;  3D74 A;  3CYZ A;  1T14 A;  2PQL A;  3S0D A;  3D78 A;  3L4A A;  3FE9 A;  2QDI A;  1QWV A;  3BFA A;  1P28 A;  3B6X A;  3B7A A;  3S0F A;  2QEH A;  1TUJ A;  4FQT A;  3FE8 A;  4OZD A;  3R72 A;  1TWO A;  2WCJ A;  2WCL A;  2ERB A;  3DZT A;  2QEO A;  4F7F A;  4PT1 A;  2QEV A;  3BJH A;  1OOG A;  3OGN A;  3VB1 A;  2JPO A;  3QME A;  3D76 A;  3R1V A;  5EL2 A;  1GM0 A;  1DQE A;  3DXL A;  3D75 A;  2GTE A;  3CZ2 A;  1OW4 A;  3FE6 A;  2P70 A;  3R1P A;  4INW A;  2L2C A;  2WCK A;  3NHI A;  3Q8I A;  4JD9 A;  2P71 A;  3CZ0 A;  2QEB A;  3S0G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...