3D75A

Crystal structure of a pheromone binding protein mutant d35n, from apis mellifera, at ph 5.5
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
117
structure length
117
Chain Sequence
DWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVNKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pheromone-binding protein ASP1
publication title Queen bee pheromone binding protein pH-induced domain swapping favors pheromone release
pubmed doi rcsb
source organism Apis mellifera
molecule tags Pheromone binding protein
total genus 37
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3d75A00
3S0EA 3K1EA 2ERBA 1QWVA 2WCJA 2WC6A 2WC5A 3S0GA 2H8VA 2KPHA 2QEBA 3FE8A 3D75A 1C3ZA 3BFHA 3B7AA 1T14A 2P71A 3R1OA 1OW4A 3NGVA 3D73A 3OGNA 3CABA 3CDNA 3N7HA 4INXA 3B88A 2WCHA 3B86A 1DQEA 3Q8IA 2L2CA 5EL2A 4OZDA 3R72A 3NHTA 3CZ2A 2QDIA 3RZSA 3VB1A 3FE6A 3S0FA 2GTEA 3FE9A 2JPOA 3QMEA 1TUJA 3L4AA 3BJHA 3D76A 3V2LA 3DYEA 3R1PA 5DICA 1OOIX 4JD9A 4PT1A 3DZTA 2QEHA 3S0AA 3S0BA 1OOHA 1ORGA 2QEOA 3D77A 3S0DA 3BFAA 1LS8A 3NHIA 1XFRA 3CZ1A 3BFBA 2QEVA 3CYZA 1OOFA 4FQTA 1C3YA 2PQLA 1OOGA 3PJIA 4F7FA 2P70A 3CZ0A 2WCLA 3DY9A 2WCMA 1TWOA 3R1VA 2WCKA 3D78A 1GM0A 2FJYA 3B6XA 3L4LA 4INWA 3L47A 3D74A 3B87A 1P28A 3DXLA
chains in the Genus database with same CATH superfamily
5D7FA 1ZACA 2KOTA 2WCEA 3LL8B 3K1EA 2I18A 2WNDA 1TCFA 2KGBC 2Y4QA 4MRXA 1H8BA 3HCMA 4GUKA 5K89A 4WRIA 1NYAA 1Q80A 1QWVA 2WCJA 1B8RA 1TUZA 1BJFA 2WCFA 1SW8A 2ZN9A 1A03A 3VROA 2CCMA 2ZRSA 3B7AA 3BFHA 1K9PA 2BKIB 4PDZA 1JF2A 2P71A 5KU1A 1F71A 2LCPA 2MAZA 3DVMA 2I7AA 2KNEA 1JC2A 2BBMA 2G9BA 4MZKA 4YI8A 2PASA 1M39A 3I5IC 1IKUA 4INXA 1YTZC 4OKHA 1E8AA 3IF7A 1AHRA 5I94A 1DQEA 4PHNA 5EL2A 3VRNA 1VRKA 4WQ2A 3R72A 2EHBA 2RGIA 4IL1A 1SCVA 4I5KA 1Y6WA 1MQ1A 4PE4A 1S5GZ 1DF0B 3GK2A 4AQJA 1EL4A 5HYDA 3CZ2A 1TIZA 2QDIA 4XYNA 4WQ3A 2PALA 4A4BA 4PCWA 1BG1A 1EH2A 3BOWB 1QVIZ 3S0FA 4A4CA 1KQMB 4YI9A 1IWQA 3BYAA 3LCPC 3UO9A 2PRUA 3PLFB 1MXLC 1OQPA 4MVFA 4E68A 1BODA 5I8NA 1DJYA 2LP2A 1UHJA 1UURA 3DVKA 2MHHA 1R6PA 1DELA 2BNXA 1CM1A 3NXAA 1QS7A 3PN7B 4IJ7A 1BR4B 3TS5B 2L4IA 4N1FA 1NP8A 1M46A 2KI6C 1GJYA 1RK9A 1DVIA 1FBVA 2JXCA 1QIWA 1QVIY 2BBNA 1IRJA 3H4SE 1PSRA 1WY9A 3I5HC 3IVTA 5G08A 2KI4C 5DKQA 1M63B 3V2LA 3DYEA 5HLVA 2BCXA 2ZFDA 1FPWA 1IJ6A 4ORCB 1UHNA 5DICA 1OOIX 1W9ZA 1XFUO 2BAPA 1QV0A 2JQ6A 1QX2A 2KFFA 4C0KA 1F4QA 1H4BA 2QEHA 4ORAB 1IQ5A 1G4YR 1Y1XA 1NX0A 1NWDA 1QIVA 2H2KA 4PHMA 3IQOA 3EG5B 1CLLA 1NIWA 3CWGA 3S0BA 1ORGA 3I5FB 1XVJA 2BL0B 1DEKA 3D0YB 2JT0A 3O6BA 2GGMA 2NCPA 3WXAA 3NHIA 2K8MB 3VRRA 5I2OA 2OS8C 1DC1A 1J1DA 1A29A 2L5XB 1DF0A 1OMVA 3CZ1A 2LLUA 2FOTA 2K2FA 2KI6D 4MBEA 4ETOA 1CFFA 1TNQA 1Y0VH 3E3RA 2EC6C 3BOWA 5HLOA 1QTXA 1CTRA 5TNCA 2M7NA 5CSNA 2M7LA 1GGZA 1XFYO 1OOGA 2ZNEA 3AAKA 2NZ0A 3PM8A 4M2OA 3KF9A 3VRPA 1NUBA 2BE6A 1F4OA 2K61A 3TDUA 4TNCA 4M2QA 4CLNA 3R1VA 1BMOA 2WCKA 1L2OB 4KYNA 1CLMA 5JOLA 5AXIA 5ER4X 5FI7A 4YGCB 1RTP1 2KQ6A 1GM0A 1PVBA 3SG7A 3L4LA 1XFZO 3AKBA 4MLWA 4HSZA 3SG3A 4F0ZB 3SIAA 2LHLA 1PRWA 1YURA 1B9AA 2M1KB 3LK0A 4PHJA 2K7CA 2E30A 2K0JA 4MEWA 2LLSA 3PATA 3TZ1A 2WC6A 1ZOTB 5IBWA 2H8VA 3D0YA 2GGZA 3I5GB 2LAPA 5DKRA 1C3ZA 3IQQA 4PALA 2F8PA 3O78A 1AVSA 1NCXA 2AUCA 3R1OA 3BXKA 4M2PA 3DVEA 5HKZA 3D73A 3CABA 2LNKA 2KSPA 3PM2A 4L9MA 4XJKB 2HQWA 4YBHB 5HKWA 1IQ3A 2JPTA 2NCOA 3B88A 2LVVA 1IG5A 1W7IB 2DOQA 2Q4UA 1B8LA 1B1GA 1K2HA 3Q8IA 3OX5A 2M0RA 1K96A 4GBAA 1B8CA 2LE9B 1KQMC 1BU3A 3RLZA 3JVTB 1A4PA 1UHKA 1RWYA 4U8DA 3SG4A 3JTDC 1A75A 3PN7C 1HT9A 1OOJA 1JUOA 3MSEB 4P5OE 4Q04A 3SG2A 1CKKA 1S1EA 3WHTB 2KGRA 3SS5A 1N2DA 1YVLA 1KWOB 1PSBA 3DF0B 4HRGA 3TDZA 1JBAA 3FWCA 3NSOA 4ZCUA 1SR6C 1FI6A 5BPJA 1SL9A 1D1OA 2JPOA 1U5IB 3RM1A 1ZUZA 4I5JA 5CSJA 5HKYA 3QMEA 1TUJA 1FI5A 3L4AA 4DRWA 1WRLA 1YR5A 1KK8B 3BJHA 4MN0A 1L7ZA 3KHEA 2LLTA 4I5NB 2MLEC 2WOSA 2BCBA 5DKNA 1B7TZ 1YUTA 1WDCB 1CDPA 4PT1A 3I5FC 4YRUA 1NCZA 4XJKA 1UHHA 2K60A 2LC5A 1QATA 2MJWB 1BT6A 1OMDA 1OSAA 2M9GA 4GGFA 2WORA 1DJHA 1SCMB 4UPGA 1J7QA 1FF1A 2KBIA 2QEOA 5AFPA 4MRYA 1CMFA 1WLMA 2I94A 4QJ4B 1B7TY 1ALVA 2L2EA 3F45A 1EJ3A 4GAOA 3KO0A 1SYMA 1TOPA 1DJWA 4MZJA 2OTGB 1TCOB 2KDHA 2F3YA 1GGWA 1RFJA 1MF8B 1UHIA 4BY4A 1BR1B 1IIOA 3LK1A 2JT8A 1G33A 3BUOB 2KYCA 2LVKA 1KFXL 2K2AA 2LVJA 3DF0A 1SL8A 2K7DA 1SBJA 1L2OC 1XK4A 2LMUA 3OB2B 2P70A 3CGAA 1UUSA 3CZ0A 1U5IA 1WRZA 1QASA 2WCMA 1KSOA 2AAOA 2KYFA 3AAJA 3OBVA 3BUXB 4INWA 3EVUA 3D74A 1OE9B 3B87A 1DGVA 2GV5A 1YVHA 3DXLA 1C07A 2HPSA 2NLNA 2I2RE 3QRXA 1OZSA 2SASA 3I5IB 1IH0A 1TRFA 1K9UA 2FCEA 4YGDB 1DMOA 3A4UB 2CTNA 2ERBA 4OCIA 2O60A 1DJGA 3M0WA 4GGNA 1N0YA 1XFXO 2F33A 3ICBA 4GPLB 3AKAA 3S0GA 4CPVA 3FWBA 2QEBA 3FE8A 2HQ8A 1QX7A 2MRDA 4GGFC 5CSIA 2FJUB 1ZMZA 3EK4A 2BCAA 2M97A 1OW4A 2KLEA 2PYQA 2L98A 1CDLA 1UWOA 1S6IA 2M1UA 2JT3A 1G8IA 3N7HA 1AP4A 1B47A 5I2QA 5GQQC 2KAVA 2R2IA 3BUMB 2Y5IA 2WCHA 1CDMA 3DD4A 2F3ZA 2JZIA 1Z2CB 3EK7A 1YX7A 1BOCA 3NHTA 1M45A 1NSHA 3D10A 1XFVO 2JNXA 4BY5A 1NX1A 1KWOC 1EG4A 2JULA 1JSAA 3VB1A 4DUQA 3OX6A 1CFCA 1XK4C 2L0PA 2JC2A 3DVJA 1F55A 2TN4A 1XO5A 5AEQA 1J7RA 3BUNB 4CFRA 3BQ3A 4PE7A 4GFTA 1N65A 1LVCD 1S3PA 1KK8C 2JWWA 1LKJA 2L4HA 2O5GA 2P6BB 1S36A 2SCPA 4JQ0D 2BECA 3C1VA 4CIDA 1BF5A 3FE9A 4R1EA 3CZTX 1DTLA 2KQYA 3FIAA 1WDCC 1CMGA 1QV1A 2EGDA 2CXJA 1XYDA 3D76A 1NPQA 2COLB 1QX5B 2OS8B 3LLEA 3R1PA 1AUIB 3HX4A 2CNPA 3SG6A 1CFDA 1KFXS 4AQIA 1YX8A 1IGVA 1RJVA 2EC6B 2KBMA 3DZTA 1OMRA 4NDDA 5PALA 1V1FA 2IS9A 2KLDA 1LA0A 1S6CA 2FCDA 3CR2A 4OVNF 3ZWHA 3ZNIA 1MR8A 3NSKA 2OTGC 2Q91A 3TS5C 1EG3A 3O4XA 1FW4A 3S0AA 1J1EA 1OOHA 1SMGA 3D77A 1X02A 3EK8A 4C0JA 5FI2A 1YRTB 3S0DA 3NSIA 1SPYA 2KFGA 3A8RA 2JTTA 5AERA 1TTXA 1XFRA 1LXFC 3K21A 2LM5A 1RECA 3OP0A 2H61A 3BFBA 3CYZA 1DJIA 3OB1B 2LHIA 1NX2A 5D69A 1KFUL 1JFJA 1V1GA 3WHUB 3GK4X 3FS7A 3O4YA 4FQTA 1F70A 2WC8A 1QXPA 1KK7Z 1C3YA 2Y1NA 4N5XA 2MBXA 1TNPA 1SL7A 2VRGA 1XA5A 2Y1MA 2QACA 4JPZB 1DJXA 2K7BA 5FYXA 1Y1UA 2WCBA 3PJIA 4NDCA 1SY9A 2BL0C 3EVRA 2MA2A 1Z4HA 5I2LA 1Y1AA 2WCLA 1QJTA 5CSFA 3DY9A 4OV2A 4FTGA 3TUYB 4YGBB 4DIRA 1KK7Y 4YGAA 1TN4A 2FJYA 4OR9B 1DT7B 1P28A 5KSZA 3UNWA 1K94A 4I5LB 4PE0A 3S0EA 2PVBA 4NDBA 1SNLA 2L50A 5AANA 1GQMA 1PVAA 1SK6D 3SIBA 1HQVA 4QJ5B 1CFPA 4MZLA 2D8NA 2A4JA 4JWQA 2WC5A 4YGEB 1PULA 2KPHA 2G2BA 1A2XA 3D75A 2B1UA 1AJ5A 1CB1A 3GK1A 1T14A 2OPOA 3NGVA 3CLNA 2K7OA 3CDNA 3JTDB 3OGNA 1WRKA 2BE4A 1NCYA 1S5GY 1PK0D 4PHKA 2BKHB 3GOFA 2JOJA 3TDIA 2KFHA 2PSRA 2JRFA 4HRHA 1YRUB 2M8UA 3SJSA 2H61C 1SR6B 3B86A 2L2CA 5HL1A 4ICBA 4ZCVA 1F8HA 3CTNA 1C7WA 1K8UA 3I5GC 4OZDA 3CS1A 2M49B 3OHMB 2M29A 1R2UA 5B8IB 3CR5X 5F6TA 1K9KA 1SKTA 3RZSA 4NQGA 4P2YB 1F54A 3FE6A 4GNKB 2LMVA 5J3XA 2JNFA 3EKHA 2GTEA 3EKJA 2CBLA 3WNXB 1CNPA 5ER5A 1S6JA 2KHNA 2LUCA 1SSEB 4HREE 1KSMA 2CT9A 3SG5A 2QPTA 1OZOA 1XFWO 2ZKMX 4PE1A 3EVVA 5KTYA 5D3OA 1JF0A 3JVTC 1ALWA 4USLA 5JJGA 1J7PA 1BLQA 4FQOA 1J7OA 1KFUS 1LINA 2NXQA 1DJZA 1NX3A 2HF5A 2LVIA 1EXRA 2F2PA 3PSRA 4JD9A 2ZNDA 2LANA 3I5HB 1SRAA 3KEVA 3PALA 1JFKA 2KI4B 1QLKA 4ORBB 2MLFC 3VGOA 4QJ3B 2JU0A 1YUSA 1YUUA 3BUWB 2LMTA 4MSPA 3SS4A 1C7VA 4DS7A 5CPVA 4AOMA 3CR4X 1AK8A 1LA3A 2ZN8A 2ZRTA 3BFAA 1A75B 1LS8A 2PMYA 1KCYA 3VRQA 2L51A 2LP3A 3NSLA 4N1GA 1KQVA 1UP5A 1W7JB 2JTZA 2QEVA 1MXEA 1CM4A 1K95A 1MHOA 1OOFA 1DGUA 2M3WA 2L5YA 2V53A 1TNWA 4DCKA 4D1EA 5FI6A 2PQLA 2E6WA 1SCMC 3TUYC 4F7FA 1K90D 2F2OA 1JWDA 3KPXA 1K93D 3SS3A 1IJ5A 1MUXA 1PALA 1ZFSA 2JXLA 3O2PA 2ISDA 2KAYA 1TNXA 2KAXA 1M31A 1S26D 2LV7A 1TWOA 3PFVA 2LUXA 1ODBA 1MWNA 1QLSA 3D78A 1B4CA 4CFQA 1CLBA 4C0LA 1WLZA 2AMIA 3B6XA 1J55A 2HETA 3L47A 1AJ4A 1CDNA 1RROA 4JKTA 2YGUA
chains in the Genus database with same CATH topology
3S0EA 3K1EA 2ERBA 1QWVA 2WCJA 2WC6A 2WC5A 3S0GA 2H8VA 2KPHA 2QEBA 3FE8A 3D75A 1C3ZA 3BFHA 3B7AA 1T14A 2P71A 3R1OA 1OW4A 3NGVA 3D73A 3OGNA 3CABA 3CDNA 3N7HA 4INXA 3B88A 2WCHA 3B86A 1DQEA 3Q8IA 2L2CA 5EL2A 4OZDA 3R72A 3NHTA 3CZ2A 2QDIA 3RZSA 3VB1A 3FE6A 3S0FA 2GTEA 3FE9A 2JPOA 3QMEA 1TUJA 3L4AA 3BJHA 3D76A 3V2LA 3DYEA 3R1PA 5DICA 1OOIX 4JD9A 4PT1A 3DZTA 2QEHA 3S0AA 3S0BA 1OOHA 1ORGA 2QEOA 3D77A 3S0DA 3BFAA 1LS8A 3NHIA 1XFRA 3CZ1A 3BFBA 2QEVA 3CYZA 1OOFA 4FQTA 1C3YA 2PQLA 1OOGA 3PJIA 4F7FA 2P70A 3CZ0A 2WCLA 3DY9A 2WCMA 1TWOA 3R1VA 2WCKA 3D78A 1GM0A 2FJYA 3B6XA 3L4LA 4INWA 3L47A 3D74A 3B87A 1P28A 3DXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S0E A;  3K1E A;  2ERB A;  1QWV A;  2WCJ A;  2WC6 A;  2WC5 A;  3S0G A;  2H8V A;  2KPH A;  2QEB A;  3FE8 A;  3D75 A;  1C3Z A;  3BFH A;  3B7A A;  1T14 A;  2P71 A;  3R1O A;  1OW4 A;  3NGV A;  3D73 A;  3OGN A;  3CAB A;  3CDN A;  3N7H A;  4INX A;  3B88 A;  2WCH A;  3B86 A;  1DQE A;  3Q8I A;  2L2C A;  5EL2 A;  4OZD A;  3R72 A;  3NHT A;  3CZ2 A;  2QDI A;  3RZS A;  3VB1 A;  3FE6 A;  3S0F A;  2GTE A;  3FE9 A;  2JPO A;  3QME A;  1TUJ A;  3L4A A;  3BJH A;  3D76 A;  3V2L A;  3DYE A;  3R1P A;  5DIC A;  1OOI X;  4JD9 A;  4PT1 A;  3DZT A;  2QEH A;  3S0A A;  3S0B A;  1OOH A;  1ORG A;  2QEO A;  3D77 A;  3S0D A;  3BFA A;  1LS8 A;  3NHI A;  1XFR A;  3CZ1 A;  3BFB A;  2QEV A;  3CYZ A;  1OOF A;  4FQT A;  1C3Y A;  2PQL A;  1OOG A;  3PJI A;  4F7F A;  2P70 A;  3CZ0 A;  2WCL A;  3DY9 A;  2WCM A;  1TWO A;  3R1V A;  2WCK A;  3D78 A;  1GM0 A;  2FJY A;  3B6X A;  3L4L A;  4INW A;  3L47 A;  3D74 A;  3B87 A;  1P28 A;  3DXL A; 
#chains in the Genus database with same CATH topology
 5D7F A;  1ZAC A;  2KOT A;  2WCE A;  3LL8 B;  3K1E A;  2I18 A;  2WND A;  1TCF A;  2KGB C;  2Y4Q A;  4MRX A;  1H8B A;  3HCM A;  4GUK A;  5K89 A;  4WRI A;  1NYA A;  1Q80 A;  1QWV A;  2WCJ A;  1B8R A;  1TUZ A;  1BJF A;  2WCF A;  1SW8 A;  2ZN9 A;  1A03 A;  3VRO A;  2CCM A;  2ZRS A;  3B7A A;  3BFH A;  1K9P A;  2BKI B;  4PDZ A;  1JF2 A;  2P71 A;  5KU1 A;  1F71 A;  2LCP A;  2MAZ A;  3DVM A;  2I7A A;  2KNE A;  1JC2 A;  2BBM A;  2G9B A;  4MZK A;  4YI8 A;  2PAS A;  1M39 A;  3I5I C;  1IKU A;  4INX A;  1YTZ C;  4OKH A;  1E8A A;  3IF7 A;  1AHR A;  5I94 A;  1DQE A;  4PHN A;  5EL2 A;  3VRN A;  1VRK A;  4WQ2 A;  3R72 A;  2EHB A;  2RGI A;  4IL1 A;  1SCV A;  4I5K A;  1Y6W A;  1MQ1 A;  4PE4 A;  1S5G Z;  1DF0 B;  3GK2 A;  4AQJ A;  1EL4 A;  5HYD A;  3CZ2 A;  1TIZ A;  2QDI A;  4XYN A;  4WQ3 A;  2PAL A;  4A4B A;  4PCW A;  1BG1 A;  1EH2 A;  3BOW B;  1QVI Z;  3S0F A;  4A4C A;  1KQM B;  4YI9 A;  1IWQ A;  3BYA A;  3LCP C;  3UO9 A;  2PRU A;  3PLF B;  1MXL C;  1OQP A;  4MVF A;  4E68 A;  1BOD A;  5I8N A;  1DJY A;  2LP2 A;  1UHJ A;  1UUR A;  3DVK A;  2MHH A;  1R6P A;  1DEL A;  2BNX A;  1CM1 A;  3NXA A;  1QS7 A;  3PN7 B;  4IJ7 A;  1BR4 B;  3TS5 B;  2L4I A;  4N1F A;  1NP8 A;  1M46 A;  2KI6 C;  1GJY A;  1RK9 A;  1DVI A;  1FBV A;  2JXC A;  1QIW A;  1QVI Y;  2BBN A;  1IRJ A;  3H4S E;  1PSR A;  1WY9 A;  3I5H C;  3IVT A;  5G08 A;  2KI4 C;  5DKQ A;  1M63 B;  3V2L A;  3DYE A;  5HLV A;  2BCX A;  2ZFD A;  1FPW A;  1IJ6 A;  4ORC B;  1UHN A;  5DIC A;  1OOI X;  1W9Z A;  1XFU O;  2BAP A;  1QV0 A;  2JQ6 A;  1QX2 A;  2KFF A;  4C0K A;  1F4Q A;  1H4B A;  2QEH A;  4ORA B;  1IQ5 A;  1G4Y R;  1Y1X A;  1NX0 A;  1NWD A;  1QIV A;  2H2K A;  4PHM A;  3IQO A;  3EG5 B;  1CLL A;  1NIW A;  3CWG A;  3S0B A;  1ORG A;  3I5F B;  1XVJ A;  2BL0 B;  1DEK A;  3D0Y B;  2JT0 A;  3O6B A;  2GGM A;  2NCP A;  3WXA A;  3NHI A;  2K8M B;  3VRR A;  5I2O A;  2OS8 C;  1DC1 A;  1J1D A;  1A29 A;  2L5X B;  1DF0 A;  1OMV A;  3CZ1 A;  2LLU A;  2FOT A;  2K2F A;  2KI6 D;  4MBE A;  4ETO A;  1CFF A;  1TNQ A;  1Y0V H;  3E3R A;  2EC6 C;  3BOW A;  5HLO A;  1QTX A;  1CTR A;  5TNC A;  2M7N A;  5CSN A;  2M7L A;  1GGZ A;  1XFY O;  1OOG A;  2ZNE A;  3AAK A;  2NZ0 A;  3PM8 A;  4M2O A;  3KF9 A;  3VRP A;  1NUB A;  2BE6 A;  1F4O A;  2K61 A;  3TDU A;  4TNC A;  4M2Q A;  4CLN A;  3R1V A;  1BMO A;  2WCK A;  1L2O B;  4KYN A;  1CLM A;  5JOL A;  5AXI A;  5ER4 X;  5FI7 A;  4YGC B;  1RTP 1;  2KQ6 A;  1GM0 A;  1PVB A;  3SG7 A;  3L4L A;  1XFZ O;  3AKB A;  4MLW A;  4HSZ A;  3SG3 A;  4F0Z B;  3SIA A;  2LHL A;  1PRW A;  1YUR A;  1B9A A;  2M1K B;  3LK0 A;  4PHJ A;  2K7C A;  2E30 A;  2K0J A;  4MEW A;  2LLS A;  3PAT A;  3TZ1 A;  2WC6 A;  1ZOT B;  5IBW A;  2H8V A;  3D0Y A;  2GGZ A;  3I5G B;  2LAP A;  5DKR A;  1C3Z A;  3IQQ A;  4PAL A;  2F8P A;  3O78 A;  1AVS A;  1NCX A;  2AUC A;  3R1O A;  3BXK A;  4M2P A;  3DVE A;  5HKZ A;  3D73 A;  3CAB A;  2LNK A;  2KSP A;  3PM2 A;  4L9M A;  4XJK B;  2HQW A;  4YBH B;  5HKW A;  1IQ3 A;  2JPT A;  2NCO A;  3B88 A;  2LVV A;  1IG5 A;  1W7I B;  2DOQ A;  2Q4U A;  1B8L A;  1B1G A;  1K2H A;  3Q8I A;  3OX5 A;  2M0R A;  1K96 A;  4GBA A;  1B8C A;  2LE9 B;  1KQM C;  1BU3 A;  3RLZ A;  3JVT B;  1A4P A;  1UHK A;  1RWY A;  4U8D A;  3SG4 A;  3JTD C;  1A75 A;  3PN7 C;  1HT9 A;  1OOJ A;  1JUO A;  3MSE B;  4P5O E;  4Q04 A;  3SG2 A;  1CKK A;  1S1E A;  3WHT B;  2KGR A;  3SS5 A;  1N2D A;  1YVL A;  1KWO B;  1PSB A;  3DF0 B;  4HRG A;  3TDZ A;  1JBA A;  3FWC A;  3NSO A;  4ZCU A;  1SR6 C;  1FI6 A;  5BPJ A;  1SL9 A;  1D1O A;  2JPO A;  1U5I B;  3RM1 A;  1ZUZ A;  4I5J A;  5CSJ A;  5HKY A;  3QME A;  1TUJ A;  1FI5 A;  3L4A A;  4DRW A;  1WRL A;  1YR5 A;  1KK8 B;  3BJH A;  4MN0 A;  1L7Z A;  3KHE A;  2LLT A;  4I5N B;  2MLE C;  2WOS A;  2BCB A;  5DKN A;  1B7T Z;  1YUT A;  1WDC B;  1CDP A;  4PT1 A;  3I5F C;  4YRU A;  1NCZ A;  4XJK A;  1UHH A;  2K60 A;  2LC5 A;  1QAT A;  2MJW B;  1BT6 A;  1OMD A;  1OSA A;  2M9G A;  4GGF A;  2WOR A;  1DJH A;  1SCM B;  4UPG A;  1J7Q A;  1FF1 A;  2KBI A;  2QEO A;  5AFP A;  4MRY A;  1CMF A;  1WLM A;  2I94 A;  4QJ4 B;  1B7T Y;  1ALV A;  2L2E A;  3F45 A;  1EJ3 A;  4GAO A;  3KO0 A;  1SYM A;  1TOP A;  1DJW A;  4MZJ A;  2OTG B;  1TCO B;  2KDH A;  2F3Y A;  1GGW A;  1RFJ A;  1MF8 B;  1UHI A;  4BY4 A;  1BR1 B;  1IIO A;  3LK1 A;  2JT8 A;  1G33 A;  3BUO B;  2KYC A;  2LVK A;  1KFX L;  2K2A A;  2LVJ A;  3DF0 A;  1SL8 A;  2K7D A;  1SBJ A;  1L2O C;  1XK4 A;  2LMU A;  3OB2 B;  2P70 A;  3CGA A;  1UUS A;  3CZ0 A;  1U5I A;  1WRZ A;  1QAS A;  2WCM A;  1KSO A;  2AAO A;  2KYF A;  3AAJ A;  3OBV A;  3BUX B;  4INW A;  3EVU A;  3D74 A;  1OE9 B;  3B87 A;  1DGV A;  2GV5 A;  1YVH A;  3DXL A;  1C07 A;  2HPS A;  2NLN A;  2I2R E;  3QRX A;  1OZS A;  2SAS A;  3I5I B;  1IH0 A;  1TRF A;  1K9U A;  2FCE A;  4YGD B;  1DMO A;  3A4U B;  2CTN A;  2ERB A;  4OCI A;  2O60 A;  1DJG A;  3M0W A;  4GGN A;  1N0Y A;  1XFX O;  2F33 A;  3ICB A;  4GPL B;  3AKA A;  3S0G A;  4CPV A;  3FWB A;  2QEB A;  3FE8 A;  2HQ8 A;  1QX7 A;  2MRD A;  4GGF C;  5CSI A;  2FJU B;  1ZMZ A;  3EK4 A;  2BCA A;  2M97 A;  1OW4 A;  2KLE A;  2PYQ A;  2L98 A;  1CDL A;  1UWO A;  1S6I A;  2M1U A;  2JT3 A;  1G8I A;  3N7H A;  1AP4 A;  1B47 A;  5I2Q A;  5GQQ C;  2KAV A;  2R2I A;  3BUM B;  2Y5I A;  2WCH A;  1CDM A;  3DD4 A;  2F3Z A;  2JZI A;  1Z2C B;  3EK7 A;  1YX7 A;  1BOC A;  3NHT A;  1M45 A;  1NSH A;  3D10 A;  1XFV O;  2JNX A;  4BY5 A;  1NX1 A;  1KWO C;  1EG4 A;  2JUL A;  1JSA A;  3VB1 A;  4DUQ A;  3OX6 A;  1CFC A;  1XK4 C;  2L0P A;  2JC2 A;  3DVJ A;  1F55 A;  2TN4 A;  1XO5 A;  5AEQ A;  1J7R A;  3BUN B;  4CFR A;  3BQ3 A;  4PE7 A;  4GFT A;  1N65 A;  1LVC D;  1S3P A;  1KK8 C;  2JWW A;  1LKJ A;  2L4H A;  2O5G A;  2P6B B;  1S36 A;  2SCP A;  4JQ0 D;  2BEC A;  3C1V A;  4CID A;  1BF5 A;  3FE9 A;  4R1E A;  3CZT X;  1DTL A;  2KQY A;  3FIA A;  1WDC C;  1CMG A;  1QV1 A;  2EGD A;  2CXJ A;  1XYD A;  3D76 A;  1NPQ A;  2COL B;  1QX5 B;  2OS8 B;  3LLE A;  3R1P A;  1AUI B;  3HX4 A;  2CNP A;  3SG6 A;  1CFD A;  1KFX S;  4AQI A;  1YX8 A;  1IGV A;  1RJV A;  2EC6 B;  2KBM A;  3DZT A;  1OMR A;  4NDD A;  5PAL A;  1V1F A;  2IS9 A;  2KLD A;  1LA0 A;  1S6C A;  2FCD A;  3CR2 A;  4OVN F;  3ZWH A;  3ZNI A;  1MR8 A;  3NSK A;  2OTG C;  2Q91 A;  3TS5 C;  1EG3 A;  3O4X A;  1FW4 A;  3S0A A;  1J1E A;  1OOH A;  1SMG A;  3D77 A;  1X02 A;  3EK8 A;  4C0J A;  5FI2 A;  1YRT B;  3S0D A;  3NSI A;  1SPY A;  2KFG A;  3A8R A;  2JTT A;  5AER A;  1TTX A;  1XFR A;  1LXF C;  3K21 A;  2LM5 A;  1REC A;  3OP0 A;  2H61 A;  3BFB A;  3CYZ A;  1DJI A;  3OB1 B;  2LHI A;  1NX2 A;  5D69 A;  1KFU L;  1JFJ A;  1V1G A;  3WHU B;  3GK4 X;  3FS7 A;  3O4Y A;  4FQT A;  1F70 A;  2WC8 A;  1QXP A;  1KK7 Z;  1C3Y A;  2Y1N A;  4N5X A;  2MBX A;  1TNP A;  1SL7 A;  2VRG A;  1XA5 A;  2Y1M A;  2QAC A;  4JPZ B;  1DJX A;  2K7B A;  5FYX A;  1Y1U A;  2WCB A;  3PJI A;  4NDC A;  1SY9 A;  2BL0 C;  3EVR A;  2MA2 A;  1Z4H A;  5I2L A;  1Y1A A;  2WCL A;  1QJT A;  5CSF A;  3DY9 A;  4OV2 A;  4FTG A;  3TUY B;  4YGB B;  4DIR A;  1KK7 Y;  4YGA A;  1TN4 A;  2FJY A;  4OR9 B;  1DT7 B;  1P28 A;  5KSZ A;  3UNW A;  1K94 A;  4I5L B;  4PE0 A;  3S0E A;  2PVB A;  4NDB A;  1SNL A;  2L50 A;  5AAN A;  1GQM A;  1PVA A;  1SK6 D;  3SIB A;  1HQV A;  4QJ5 B;  1CFP A;  4MZL A;  2D8N A;  2A4J A;  4JWQ A;  2WC5 A;  4YGE B;  1PUL A;  2KPH A;  2G2B A;  1A2X A;  3D75 A;  2B1U A;  1AJ5 A;  1CB1 A;  3GK1 A;  1T14 A;  2OPO A;  3NGV A;  3CLN A;  2K7O A;  3CDN A;  3JTD B;  3OGN A;  1WRK A;  2BE4 A;  1NCY A;  1S5G Y;  1PK0 D;  4PHK A;  2BKH B;  3GOF A;  2JOJ A;  3TDI A;  2KFH A;  2PSR A;  2JRF A;  4HRH A;  1YRU B;  2M8U A;  3SJS A;  2H61 C;  1SR6 B;  3B86 A;  2L2C A;  5HL1 A;  4ICB A;  4ZCV A;  1F8H A;  3CTN A;  1C7W A;  1K8U A;  3I5G C;  4OZD A;  3CS1 A;  2M49 B;  3OHM B;  2M29 A;  1R2U A;  5B8I B;  3CR5 X;  5F6T A;  1K9K A;  1SKT A;  3RZS A;  4NQG A;  4P2Y B;  1F54 A;  3FE6 A;  4GNK B;  2LMV A;  5J3X A;  2JNF A;  3EKH A;  2GTE A;  3EKJ A;  2CBL A;  3WNX B;  1CNP A;  5ER5 A;  1S6J A;  2KHN A;  2LUC A;  1SSE B;  4HRE E;  1KSM A;  2CT9 A;  3SG5 A;  2QPT A;  1OZO A;  1XFW O;  2ZKM X;  4PE1 A;  3EVV A;  5KTY A;  5D3O A;  1JF0 A;  3JVT C;  1ALW A;  4USL A;  5JJG A;  1J7P A;  1BLQ A;  4FQO A;  1J7O A;  1KFU S;  1LIN A;  2NXQ A;  1DJZ A;  1NX3 A;  2HF5 A;  2LVI A;  1EXR A;  2F2P A;  3PSR A;  4JD9 A;  2ZND A;  2LAN A;  3I5H B;  1SRA A;  3KEV A;  3PAL A;  1JFK A;  2KI4 B;  1QLK A;  4ORB B;  2MLF C;  3VGO A;  4QJ3 B;  2JU0 A;  1YUS A;  1YUU A;  3BUW B;  2LMT A;  4MSP A;  3SS4 A;  1C7V A;  4DS7 A;  5CPV A;  4AOM A;  3CR4 X;  1AK8 A;  1LA3 A;  2ZN8 A;  2ZRT A;  3BFA A;  1A75 B;  1LS8 A;  2PMY A;  1KCY A;  3VRQ A;  2L51 A;  2LP3 A;  3NSL A;  4N1G A;  1KQV A;  1UP5 A;  1W7J B;  2JTZ A;  2QEV A;  1MXE A;  1CM4 A;  1K95 A;  1MHO A;  1OOF A;  1DGU A;  2M3W A;  2L5Y A;  2V53 A;  1TNW A;  4DCK A;  4D1E A;  5FI6 A;  2PQL A;  2E6W A;  1SCM C;  3TUY C;  4F7F A;  1K90 D;  2F2O A;  1JWD A;  3KPX A;  1K93 D;  3SS3 A;  1IJ5 A;  1MUX A;  1PAL A;  1ZFS A;  2JXL A;  3O2P A;  2ISD A;  2KAY A;  1TNX A;  2KAX A;  1M31 A;  1S26 D;  2LV7 A;  1TWO A;  3PFV A;  2LUX A;  1ODB A;  1MWN A;  1QLS A;  3D78 A;  1B4C A;  4CFQ A;  1CLB A;  4C0L A;  1WLZ A;  2AMI A;  3B6X A;  1J55 A;  2HET A;  3L47 A;  1AJ4 A;  1CDN A;  1RRO A;  4JKT A;  2YGU A; 
#chains in the Genus database with same CATH homology
 3S0E A;  3K1E A;  2ERB A;  1QWV A;  2WCJ A;  2WC6 A;  2WC5 A;  3S0G A;  2H8V A;  2KPH A;  2QEB A;  3FE8 A;  3D75 A;  1C3Z A;  3BFH A;  3B7A A;  1T14 A;  2P71 A;  3R1O A;  1OW4 A;  3NGV A;  3D73 A;  3OGN A;  3CAB A;  3CDN A;  3N7H A;  4INX A;  3B88 A;  2WCH A;  3B86 A;  1DQE A;  3Q8I A;  2L2C A;  5EL2 A;  4OZD A;  3R72 A;  3NHT A;  3CZ2 A;  2QDI A;  3RZS A;  3VB1 A;  3FE6 A;  3S0F A;  2GTE A;  3FE9 A;  2JPO A;  3QME A;  1TUJ A;  3L4A A;  3BJH A;  3D76 A;  3V2L A;  3DYE A;  3R1P A;  5DIC A;  1OOI X;  4JD9 A;  4PT1 A;  3DZT A;  2QEH A;  3S0A A;  3S0B A;  1OOH A;  1ORG A;  2QEO A;  3D77 A;  3S0D A;  3BFA A;  1LS8 A;  3NHI A;  1XFR A;  3CZ1 A;  3BFB A;  2QEV A;  3CYZ A;  1OOF A;  4FQT A;  1C3Y A;  2PQL A;  1OOG A;  3PJI A;  4F7F A;  2P70 A;  3CZ0 A;  2WCL A;  3DY9 A;  2WCM A;  1TWO A;  3R1V A;  2WCK A;  3D78 A;  1GM0 A;  2FJY A;  3B6X A;  3L4L A;  4INW A;  3L47 A;  3D74 A;  3B87 A;  1P28 A;  3DXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...