2K61A

Solution structure of cam complexed to dapk peptide
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
146
structure length
146
Chain Sequence
QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGDGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin
publication title Accurate solution structures of proteins from X-ray data and a minimal set of NMR data: calmodulin-peptide complexes as examples.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 39
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2008-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2k61A00
1QS7A 2LLTA 1K9KA 1SL8A 2CXJA 1IWQA 2HETA 2QPTA 2KOTA 2Q4UA 3FIAA 3FS7A 1DJYA 3I5FC 1YVHA 3AAJA 5B8IB 2KBIA 1QLKA 1YRUB 1KWOB 2F3ZA 3HX4A 2LCPA 2KAVA 3PLFB 1D1OA 1J55A 1XFUO 1Y1AA 3CLNA 1CFCA 2ZNEA 1KCYA 4PCWA 4QJ3B 4GAOA 2L51A 1NCZA 3BUOB 4GGNA 4YGEB 3CWGA 1M46A 1Y1UA 3HCMA 4MRXA 1S3PA 3IQOA 4WRIA 1JC2A 2LANA 4Q04A 4GNKB 2COLB 1IH0A 4WQ2A 2FCEA 1DJIA 3BOWB 3M0WA 1YVLA 1KFUS 1ZFSA 4NDDA 3NSLA 4I5KA 2LVIA 3BUNB 1TNXA 1V1GA 2LE9B 4GUKA 4U8DA 2JOJA 2WORA 1F70A 3DVEA 4JWQA 1TRFA 4PHNA 3SJSA 3PN7B 1UHJA 2G9BA 3LK1A 2OS8B 3TZ1A 1FF1A 1K93D 1OMDA 2DOQA 3CR5X 1F55A 2KHNA 2H61C 1MF8B 1OMVA 4PDZA 2K61A 4MVFA 3EK8A 3GOFA 3SG5A 4GGFC 1L2OB 2Y5IA 3C1VA 1GGWA 1Y6WA 1F4OA 4PHMA 2M1KB 2ZN8A 4ETOA 2KBMA 1K96A 2L4HA 5TNCA 1UURA 1SKTA 1B8RA 2L98A 4CIDA 1XA5A 1K95A 1B7TY 2G2BA 1XVJA 2MLFC 1L7ZA 2A4JA 1BG1A 2E6WA 2K2FA 2O5GA 2JC2A 3CTNA 5K89A 2JNFA 3O78A 2H61A 3KF9A 1AP4A 5CSNA 1SPYA 3EK7A 4P5OE 1DGVA 4QJ5B 4QJ4B 1B8LA 4GGFA 1ZMZA 2AAOA 3K21A 4M2QA 2JT0A 1S6CA 1A75A 1TN4A 3O6BA 1PSBA 1YUUA 2SASA 4YI9A 1DMOA 3EKHA 1GQMA 2LUCA 1BODA 1NCXA 3AAKA 1HT9A 3BXKA 1HQVA 3EVUA 2LVJA 2R2IA 2L2EA 3D10A 4PE4A 2JTTA 3BUXB 1OZSA 4DRWA 4UPGA 1SCMB 1OZOA 2LHIA 1SK6D 2MJWB 4HSZA 3TDUA 1IKUA 1K8UA 3PSRA 3CZTX 1XFWO 4YGDB 1LXFC 2LVVA 4GFTA 1YX8A 4NDCA 1UHKA 1KQMC 2BCXA 2K0JA 1KFXS 1M63B 1H4BA 2FCDA 2KAYA 4PE1A 2LMVA 1S6JA 1F71A 1QV1A 1QVIZ 2LM5A 1NIWA 2P6BB 1WDCB 3GK2A 5AANA 1WLZA 2LP2A 2PSRA 3VROA 3TUYC 3SG7A 1BR4B 4FTGA 2GV5A 2OTGB 3EVRA 1Y1XA 2KQ6A 4CFQA 2KYCA 1JFJA 1AHRA 1BMOA 1NWDA 4C0JA 1XO5A 3OP0A 5FYXA 2JQ6A 5BPJA 4CPVA 5HKZA 5J3XA 1SNLA 2BL0B 1TCOB 2K7BA 3JTDB 1SR6C 4YI8A 1FI5A 2KGBC 1KFUL 3OB1B 3WNXB 3I5HC 1KSOA 1SCMC 2L5XB 4I5JA 3I5IB 3TS5C 1A29A 2MAZA 2CNPA 2F33A 1MR8A 1RJVA 2FJUB 2ISDA 4BY4A 2JT3A 1MXEA 4XJKB 2PALA 1AK8A 4CLNA 2JNXA 1TNWA 2WCBA 2F2PA 4N5XA 4YGAA 4C0KA 2NZ0A 2M97A 3DVKA 2BBMA 2CT9A 5JJGA 3I5GC 4NQGA 1B8CA 4PE0A 1F4QA 1MWNA 4JPZB 3LLEA 3DF0A 1XYDA 2KI4B 1DJXA 5KSZA 4BY5A 3KO0A 4ZCUA 1A2XA 5I2LA 1RK9A 1QJTA 1C7WA 2FOTA 1UP5A 4MN0A 4PALA 4YBHB 2H2KA 4F0ZB 2CCMA 1IJ5A 2KNEA 2GGZA 1JBAA 1KWOC 4E68A 2KGRA 2I2RE 3A8RA 1JFKA 1PRWA 4ZCVA 4OV2A 3EKJA 3WHTB 5AFPA 4PHJA 3ZNIA 1OOJA 2EHBA 1TCFA 1K9UA 1XFYO 2BE4A 2M8UA 1EG3A 2EGDA 2K7DA 1H8BA 2O60A 2JRFA 1RECA 3FWBA 4WQ3A 1X02A 3NXAA 1FPWA 2EC6B 3DVJA 2LLSA 4ORAB 2VRGA 1JWDA 2HQWA 2HF5A 1K9PA 4M2OA 1G8IA 1KSMA 4YGCB 3GK1A 1KK8B 1J7RA 2KFGA 1W7JB 3EK4A 1AUIB 1YUSA 1N2DA 4HRHA 2RGIA 3PN7C 2JPTA 5HKYA 1XFZO 3FWCA 4DS7A 2OS8C 2BECA 2MLEC 3LL8B 4OCIA 1SW8A 3PALA 3SG2A 4HREE 4DUQA 5CPVA 1ODBA 1NPQA 3BOWA 1CM1A 2Y1NA 2M7NA 4OR9B 3D0YB 1BOCA 1L2OC 1UHIA 2ZKMX 2AUCA 1VRKA 1JUOA 1MUXA 2LUXA 1IGVA 2CTNA 1A03A 3OX6A 5D7FA 3BQ3A 3PATA 1PK0D 1NX2A 4ORBB 1MQ1A 1DF0B 1M39A 1XFVO 4R1EA 3E3RA 1CTRA 2I7AA 1KK7Y 3NSIA 4FQOA 4YGBB 5DKNA 3DVMA 1QX2A 2LNKA 5DKQA 1QTXA 1WY9A 1DJGA 1G33A 2GGMA 5HLVA 2HQ8A 1FI6A 1CLBA 2LC5A 1CDMA 3JVTB 1BLQA 1EH2A 1W7IB 4N1FA 1YUTA 1A4PA 2LHLA 1PSRA 1JF0A 1UHNA 1MHOA 2WCEA 5CSJA 5ER4X 1B1GA 2KDHA 1NX3A 4P2YB 2MBXA 2F8PA 1TIZA 2BKHB 3MSEB 4MBEA 2AMIA 2JXCA 2K2AA 2KFFA 3I5FB 1LVCD 4I5NB 2Y1MA 5AEQA 1PVAA 4A4BA 1BF5A 1BU3A 2PVBA 1MXLC 1YR5A 1LA3A 1OQPA 1CNPA 2LMUA 1S1EA 2WOSA 1CMGA 4CFRA 1RFJA 4A4CA 1TOPA 3CR2A 1SL7A 1AJ4A 1S5GY 5CSIA 1SY9A 4JQ0D 3AKBA 1EL4A 2F3YA 1B4CA 1F54A 1QX5B 1CFPA 2ZRSA 1CB1A 2LMTA 1LINA 3ICBA 2WNDA 1QASA 1CLLA 1WRZA 1M45A 1UWOA 2BE6A 1UHHA 3CR4X 2PASA 3OX5A 1M31A 2JTZA 2M9GA 1K90D 3SG4A 3ZWHA 2M1UA 2ZFDA 3D0YA 4M2PA 2WC8A 1TNQA 4MLWA 3VRQA 1SL9A 1CKKA 4MZJA 4GBAA 1RTP1 1YRTB 1YTZC 1WDCC 4N1GA 1QX7A 5GQQC 1DF0A 5JOLA 1AJ5A 1XK4C 1WRLA 1B7TZ 1U5IB 1DJHA 2OTGC 2QACA 2M3WA 1YURA 3VRNA 1PULA 2NXQA 3WHUB 1J1DA 1CM4A 1CLMA 4ICBA 1BJFA 2MHHA 1WLMA 1Y0VH 4MSPA 1K2HA 2BL0C 3JTDC 2Q91A 5HYDA 3LCPC 3KEVA 3WXAA 2M0RA 4PE7A 1RROA 5I2QA 2LP3A 1A75B 3I5IC 1ZUZA 1QVIY 1EJ3A 1C7VA 1N65A 1GJYA 2NLNA 1ALVA 3EVVA 4AOMA 1EG4A 1QV0A 1DTLA 1OMRA 2I94A 3OB2B 3H4SE 1Q80A 1XK4A 4XYNA 3CS1A 3SG3A 1B9AA 1ZOTB 3PM8A 2CBLA 3AKAA 2K7OA 1CFDA 1JF2A 4L9MA 4OKHA 1DJWA 3IQQA 1IJ6A 5HLOA 2NCPA 4AQIA 3DD4A 2KI6C 3SIBA 4C0LA 1K94A 3TDZA 1DGUA 2K8MB 3GK4X 1KK7Z 1ALWA 1DVIA 1S26D 3VRRA 2OPOA 4MRYA 2M49B 4NDBA 2JXLA 2M29A 1NCYA 5PALA 1J7OA 5HKWA 1B47A 1NUBA 1QLSA 2KI4C 1NP8A 1S6IA 2ZN9A 1CDPA 2JWWA 5AXIA 2M7LA 3NSOA 2D8NA 3O2PA 5KTYA 2JULA 1R2UA 2WCFA 1BT6A 1J1EA 3NSKA 4XJKA 5ER5A 5I8NA 3RLZA 1CFFA 3BUWB 3BUMB 3F45A 3QRXA 5D69A 4YRUA 2K7CA 3SG6A 2BKIB 2HPSA 2Y4QA 4TNCA 1PVBA 2JU0A 3VGOA 2B1UA 2L4IA 2MRDA 1WRKA 1KFXL 1U5IA 3SIAA 2PMYA 1OSAA 1IQ3A 4AQJA 2LVKA 2BBNA 1SMGA 1QXPA 1SBJA 1SCVA 3IF7A 1OE9B 1S5GZ 2KYFA 1IQ5A 1TNPA 1KQMB 2L50A 3CGAA 1TTXA 1G4YR 2NCOA 1IRJA 5KU1A 1QATA 1YX7A 1J7PA 4MEWA 2JZIA 1DT7B 1E8AA 1R6PA 2BCAA 3A4UB 3RM1A 2EC6C 1N0YA 2KAXA 4D1EA 1QIWA 4DIRA 1CMFA 3TUYB 1CDNA 1NSHA 2KSPA 1KK8C 1DJZA 2F2OA 3OHMB 4PHKA 1LA0A 4GPLB 2E30A 5DKRA 2MA2A 1FW4A 3KHEA 1FBVA 2BCBA 2SCPA 2ZNDA 4ORCB 5CSFA 2KFHA 4MZLA 1JSAA 1EXRA 1SR6B 1F8HA 1QIVA 2LAPA 3I5HB 3KPXA 4USLA 1RWYA 2LLUA 5G08A 3TS5B 2ZRTA 1V1FA 3DF0B 1SRAA 4I5LB 1ZACA 1UUSA 4DCKA 1XFXO 2KI6D 1IG5A 1S36A 2TN4A 4OVNF 1SYMA 3BYAA 3O4YA 3PFVA 2JT8A 1GGZA 1C07A 1AVSA 2PRUA 3LK0A 5F6TA 1LKJA 2KQYA 4IL1A 1PALA 4MZKA 1NYAA 3TDIA 2I18A 2L0PA 2LV7A 2IS9A 2V53A 5I2OA 3JVTC 1J7QA 3I5GB 5IBWA 3VRPA 1BR1B 1CDLA 1NX1A 1KQVA 1NX0A 4HRGA 5AERA
chains in the Genus database with same CATH superfamily
1QS7A 2LLTA 1K9KA 1SL8A 2CXJA 1IWQA 2HETA 2QPTA 2KOTA 2Q4UA 3FIAA 3FS7A 1DJYA 3I5FC 1YVHA 3AAJA 5B8IB 5HL1A 2KBIA 1QLKA 2KLEA 1YRUB 1KWOB 2F3ZA 2WCLA 2LCPA 2KAVA 3HX4A 3PLFB 1J55A 1XFUO 1D1OA 2L2CA 1Y1AA 3CLNA 1CFCA 2ZNEA 1KCYA 4PCWA 4QJ3B 4GAOA 2L51A 1NCZA 3QMEA 3RZSA 3BUOB 4GGNA 4YGEB 3CWGA 3CZ1A 1M46A 1Y1UA 3HCMA 4MRXA 1S3PA 3IQOA 4WRIA 1JC2A 2LANA 4Q04A 4GNKB 2COLB 1IH0A 4WQ2A 2FCEA 3S0FA 1DJIA 3NGVA 3BOWB 1OOFA 3M0WA 1YVLA 1KFUS 1ZFSA 4NDDA 3CABA 3NSLA 4I5KA 2LVIA 3BUNB 1TNXA 3OGNA 1V1GA 2LE9B 5I94A 4INXA 4GUKA 4U8DA 2JOJA 2WORA 1F70A 3DVEA 4JWQA 1TRFA 4PHNA 3SJSA 3PN7B 1UHJA 2G9BA 3LK1A 2OS8B 3TZ1A 1FF1A 1K93D 1OMDA 2DOQA 3CR5X 1F55A 2KHNA 2H61C 1MF8B 1OMVA 4PDZA 2K61A 4MVFA 3EK8A 3GOFA 3SG5A 2BAPA 4GGFC 1L2OB 2Y5IA 3C1VA 1GGWA 1Y6WA 1F4OA 4PHMA 2KLDA 2M1KB 2ZN8A 4ETOA 2KBMA 1K96A 2L4HA 2QDIA 5TNCA 1UURA 1SKTA 3S0AA 1B8RA 2L98A 4CIDA 2H8VA 1XA5A 1K95A 1B7TY 2G2BA 3D77A 1XVJA 2MLFC 1L7ZA 1TUJA 2A4JA 1BG1A 2E6WA 2K2FA 2O5GA 3D74A 3FE6A 1DEKA 2JC2A 3CTNA 3B86A 2JNFA 5K89A 3O78A 2H61A 3KF9A 1AP4A 5CSNA 1SPYA 3EK7A 4P5OE 1DGVA 4QJ5B 4QJ4B 2QEVA 1B8LA 4GGFA 1ZMZA 2AAOA 3K21A 4M2QA 2JT0A 1S6CA 2BNXA 1A75A 1TN4A 3O6BA 1PSBA 1YUUA 2SASA 4YI9A 1DMOA 3EKHA 1GQMA 2LUCA 2WCJA 1NCXA 3AAKA 1BODA 3SS4A 1HT9A 3BXKA 5JOLA 1HQVA 3EVUA 2FJYA 2LVJA 2L2EA 2R2IA 3D10A 2JTTA 3BUXB 4PE4A 5D3OA 1OZSA 2PQLA 4DRWA 4UPGA 1SCMB 1OOIX 1OZOA 1SK6D 2LHIA 2MJWB 4HSZA 3S0BA 1K8UA 3TDUA 1IKUA 1OW4A 1OOGA 3PSRA 3CZTX 1XFWO 4YGDB 1LXFC 2LVVA 4GFTA 1YX8A 3CDNA 4NDCA 1UHKA 1LS8A 1KQMC 2BCXA 2K0JA 1KFXS 1M63B 1H4BA 2FCDA 3CZ2A 2KAYA 4PE1A 5DICA 2LMVA 1S6JA 1F71A 2WC6A 1QV1A 1QVIZ 2LM5A 1NIWA 2P6BB 1WDCB 3GK2A 5AANA 1WLZA 2LP2A 2PSRA 3VROA 3TUYC 3SG7A 1BR4B 4FTGA 2GV5A 2OTGB 3EVRA 1Y1XA 2KQ6A 4CFQA 2KYCA 1JFJA 3L4LA 1AHRA 1BMOA 1NWDA 4C0JA 1XO5A 3OP0A 5FYXA 2JQ6A 5BPJA 4CPVA 3PM2A 5HKZA 5J3XA 1SNLA 2BL0B 1TCOB 2GTEA 2K7BA 3JTDB 1SR6C 4YI8A 1FI5A 2KGBC 1KFUL 3OB1B 3WNXB 2P71A 3I5HC 1KSOA 1SCMC 2L5XB 4I5JA 3I5IB 3TS5C 1A29A 2MAZA 2CNPA 2F33A 1MR8A 1Z2CB 1RJVA 2FJUB 2ISDA 3DXLA 4BY4A 2JT3A 3B6XA 1MXEA 3CYZA 4XJKB 2PALA 3VB1A 1AK8A 4CLNA 2JNXA 3V2LA 3D78A 3BFAA 1TNWA 2WCBA 2F2PA 4N5XA 1QWVA 4YGAA 4C0KA 2NZ0A 2M97A 3DVKA 1ORGA 2BBMA 2CT9A 5JJGA 3I5GC 4NQGA 1B8CA 4PE0A 1F4QA 1MWNA 4JPZB 3LLEA 3DF0A 3B88A 1XYDA 2KI4B 1IIOA 1DJXA 5KSZA 4BY5A 3KO0A 4ZCUA 1A2XA 3B87A 1RK9A 5I2LA 1QJTA 1C7WA 2FOTA 1UP5A 4MN0A 4PALA 4YBHB 2H2KA 2YGUA 2CCMA 1IJ5A 4F0ZB 2KNEA 3D75A 2GGZA 1JBAA 1KWOC 4E68A 2KGRA 2I2RE 3Q8IA 3A8RA 1JFKA 1PRWA 4ZCVA 1C3ZA 4OV2A 3EKJA 3WHTB 5AFPA 3L4AA 4PHJA 4INWA 3ZNIA 1OOJA 2EHBA 1TCFA 1K9UA 1XFYO 2BE4A 2M8UA 3EG5B 3R1VA 1EG3A 2EGDA 2K7DA 1H8BA 2O60A 2JRFA 3SS3A 1RECA 3FWBA 1GM0A 4WQ3A 1X02A 3NXAA 1FPWA 2EC6B 3DVJA 2LLSA 3IVTA 4ORAB 2VRGA 5FI7A 1DELA 1JWDA 3FE8A 4KYNA 2HQWA 2HF5A 1K9PA 4M2OA 1G8IA 1KSMA 4YGCB 3GK1A 1KK8B 1J7RA 2KFGA 2ERBA 1W7JB 3EK4A 1AUIB 1YUSA 5KU1A 1N2DA 4HRHA 2RGIA 3NHIA 3PN7C 2JPTA 5HKYA 1XFZO 3FWCA 4DS7A 2OS8C 2BECA 2MLEC 3LL8B 4OCIA 1SW8A 3PALA 3SG2A 4HREE 4DUQA 1SSEB 5CPVA 1ODBA 1NPQA 1T14A 3BOWA 1CM1A 2Y1NA 2M7NA 4JKTA 4OR9B 3D0YB 1BOCA 1L2OC 1UHIA 3DY9A 2ZKMX 2AUCA 1VRKA 1JUOA 1MUXA 2LUXA 1IGVA 2CTNA 3PJIA 1A03A 3OX6A 5D7FA 3BQ3A 3PATA 1PK0D 1NX2A 4ORBB 1MQ1A 1DF0B 1M39A 1XFVO 4R1EA 3E3RA 1CTRA 2I7AA 3CZ0A 1KK7Y 3NSIA 4FQOA 4YGBB 5DKNA 3DVMA 1QX2A 2LNKA 5DKQA 1QTXA 1WY9A 1DJGA 1G33A 2GGMA 5HLVA 2HQ8A 3BFHA 1CLBA 2LC5A 1FI6A 1CDMA 3JVTB 5EL2A 1BLQA 1W7IB 1EH2A 3O4XA 4N1FA 1YUTA 1A4PA 2LHLA 1PSRA 1JF0A 1UHNA 1MHOA 2WCEA 5CSJA 5ER4X 1B1GA 2KDHA 1NX3A 4P2YB 2MBXA 2F8PA 1TIZA 3K1EA 2BKHB 3MSEB 3N7HA 2AMIA 4MBEA 2JXCA 2K2AA 2KFFA 2P70A 3I5FB 3UNWA 1LVCD 4I5NB 2Y1MA 5AEQA 1PVAA 4A4BA 1BF5A 1BU3A 2PVBA 1MXLC 1YR5A 1LA3A 1OQPA 1CNPA 3S0DA 2LMUA 5FI2A 1S1EA 2WOSA 1CMGA 2WCHA 1RFJA 4A4CA 4CFRA 1TOPA 3CR2A 1P28A 1SL7A 1AJ4A 1S5GY 5CSIA 1SY9A 3NHTA 4JQ0D 3AKBA 1EL4A 2F3YA 2WCMA 1B4CA 1F54A 1QX5B 1CFPA 2ZRSA 1CB1A 3L47A 2LMTA 1LINA 3ICBA 2WNDA 1QASA 1CLLA 3R72A 1WRZA 1M45A 1UWOA 2BE6A 1UHHA 3CR4X 2PASA 3OX5A 1M31A 3R1PA 2JTZA 2M9GA 1K90D 3SG4A 3ZWHA 2M1UA 2ZFDA 3D0YA 4M2PA 2WC8A 1TNQA 4MLWA 3VRQA 1SL9A 1CKKA 4MZJA 4GBAA 1RTP1 1YRTB 1YTZC 1WDCC 4N1GA 1QX7A 3FE9A 1DF0A 5GQQC 1AJ5A 1XK4C 1WRLA 1B7TZ 1U5IB 1DJHA 2OTGC 2QACA 2M3WA 1YURA 3VRNA 1PULA 2NXQA 3WHUB 1J1DA 1TUZA 1CM4A 1CLMA 4ICBA 1BJFA 2MHHA 1WLMA 1Y0VH 4MSPA 1K2HA 2BL0C 1DC1A 3JTDC 2Q91A 3OBVA 5HYDA 3LCPC 3KEVA 3WXAA 2M0RA 4PE7A 1RROA 5I2QA 2LP3A 1A75B 1W9ZA 3I5IC 1ZUZA 1QVIY 1EJ3A 1C7VA 1N65A 1GJYA 2NLNA 1ALVA 3EVVA 4AOMA 1EG4A 1QV0A 1DTLA 1OMRA 2I94A 3OB2B 3H4SE 5FI6A 1Q80A 1XK4A 4XYNA 3CS1A 4OZDA 1B9AA 1ZOTB 3PM8A 3SG3A 2CBLA 3AKAA 2K7OA 3D73A 1CFDA 1JF2A 4L9MA 4OKHA 1DJWA 3IQQA 1TWOA 1IJ6A 5HLOA 2NCPA 4AQIA 3DD4A 2KI6C 2JPOA 3SIBA 4C0LA 1K94A 3TDZA 1DGUA 2K8MB 2QEOA 1KK7Z 3GK4X 3B7AA 1ALWA 1DVIA 1S26D 3VRRA 2OPOA 4MRYA 2M49B 4NDBA 2JXLA 2M29A 1NCYA 5PALA 1J7OA 5HKWA 1B47A 1NUBA 1QLSA 2KI4C 1NP8A 1S6IA 1C3YA 2ZN9A 1CDPA 2JWWA 5AXIA 2M7LA 3NSOA 1Z4HA 2D8NA 3D76A 3O2PA 5KTYA 2JULA 1R2UA 2WCFA 1BT6A 1J1EA 3NSKA 1XFRA 4XJKA 5ER5A 3SS5A 3RLZA 3DYEA 5I8NA 1CFFA 3BUWB 3BUMB 3F45A 1OOHA 3QRXA 5D69A 4YRUA 2K7CA 3SG6A 2BKIB 2HPSA 2Y4QA 4TNCA 1PVBA 2JU0A 3VGOA 2B1UA 2L4IA 2MRDA 1WRKA 1KFXL 1U5IA 3SIAA 2PMYA 1OSAA 4PT1A 1IQ3A 4AQJA 2LVKA 2BBNA 1SMGA 1QXPA 2PYQA 1SBJA 1SCVA 2L5YA 3IF7A 1OE9B 1S5GZ 2KYFA 1IQ5A 1TNPA 1KQMB 2L50A 3CGAA 1TTXA 1G4YR 2NCOA 1IRJA 3DZTA 1QATA 1YX7A 2K60A 1J7PA 4MEWA 2JZIA 1DT7B 3BFBA 1E8AA 1R6PA 2BCAA 3A4UB 3RM1A 2EC6C 1N0YA 2KAXA 4D1EA 1QIWA 4DIRA 4JD9A 1CMFA 4IJ7A 3TUYB 1CDNA 1NSHA 2KSPA 1KK8C 1DJZA 2F2OA 3OHMB 4PHKA 2QEHA 1LA0A 4GPLB 2E30A 5DKRA 3S0GA 2MA2A 1FW4A 3KHEA 1FBVA 2BCBA 2SCPA 2ZNDA 4ORCB 5CSFA 2KFHA 4FQTA 4MZLA 1JSAA 1EXRA 1SR6B 2WC5A 1F8HA 1QIVA 2LAPA 3I5HB 3KPXA 4USLA 3UO9A 1RWYA 2LLUA 2KPHA 5G08A 3TS5B 2ZRTA 2WCKA 1V1FA 3BJHA 3DF0B 1SRAA 4I5LB 1ZACA 1UUSA 4F7FA 4DCKA 1XFXO 2KI6D 2QEBA 1IG5A 1S36A 2TN4A 4OVNF 3S0EA 1SYMA 3BYAA 3O4YA 3PFVA 2JT8A 1GGZA 1C07A 1AVSA 2PRUA 3LK0A 5F6TA 1LKJA 2KQYA 4IL1A 1PALA 4MZKA 1NYAA 3TDIA 2I18A 2L0PA 2LV7A 2IS9A 2V53A 5I2OA 3JVTC 1DQEA 3R1OA 1J7QA 3I5GB 5IBWA 3VRPA 1BR1B 1CDLA 1NX1A 1KQVA 1NX0A 4HRGA 5AERA
chains in the Genus database with same CATH topology
1QS7A 2LLTA 1K9KA 1SL8A 2CXJA 1IWQA 2HETA 2QPTA 2KOTA 2Q4UA 3FIAA 3FS7A 1DJYA 3I5FC 1YVHA 3AAJA 5B8IB 2KBIA 1QLKA 1YRUB 1KWOB 2F3ZA 3HX4A 2LCPA 2KAVA 3PLFB 1D1OA 1J55A 1XFUO 1Y1AA 3CLNA 1CFCA 2ZNEA 1KCYA 4PCWA 4QJ3B 4GAOA 2L51A 1NCZA 3BUOB 4GGNA 4YGEB 3CWGA 1M46A 1Y1UA 3HCMA 4MRXA 1S3PA 3IQOA 4WRIA 1JC2A 2LANA 4Q04A 4GNKB 2COLB 1IH0A 4WQ2A 2FCEA 1DJIA 3BOWB 3M0WA 1YVLA 1KFUS 1ZFSA 4NDDA 3NSLA 4I5KA 2LVIA 3BUNB 1TNXA 1V1GA 2LE9B 4GUKA 4U8DA 2JOJA 2WORA 1F70A 3DVEA 4JWQA 1TRFA 4PHNA 3SJSA 3PN7B 1UHJA 2G9BA 3LK1A 2OS8B 3TZ1A 1FF1A 1K93D 1OMDA 2DOQA 3CR5X 1F55A 2KHNA 2H61C 1MF8B 1OMVA 4PDZA 2K61A 4MVFA 3EK8A 3GOFA 3SG5A 4GGFC 1L2OB 2Y5IA 3C1VA 1GGWA 1Y6WA 1F4OA 4PHMA 2M1KB 2ZN8A 4ETOA 2KBMA 1K96A 2L4HA 5TNCA 1UURA 1SKTA 1B8RA 2L98A 4CIDA 1XA5A 1K95A 1B7TY 2G2BA 1XVJA 2MLFC 1L7ZA 2A4JA 1BG1A 2E6WA 2K2FA 2O5GA 2JC2A 3CTNA 5K89A 2JNFA 3O78A 2H61A 3KF9A 1AP4A 5CSNA 1SPYA 3EK7A 4P5OE 1DGVA 4QJ5B 4QJ4B 1B8LA 4GGFA 1ZMZA 2AAOA 3K21A 4M2QA 2JT0A 1S6CA 1A75A 1TN4A 3O6BA 1PSBA 1YUUA 2SASA 4YI9A 1DMOA 3EKHA 1GQMA 2LUCA 1BODA 1NCXA 3AAKA 1HT9A 3BXKA 1HQVA 3EVUA 2LVJA 2R2IA 2L2EA 3D10A 4PE4A 2JTTA 3BUXB 1OZSA 4DRWA 4UPGA 1SCMB 1OZOA 2LHIA 1SK6D 2MJWB 4HSZA 3TDUA 1IKUA 1K8UA 3PSRA 3CZTX 1XFWO 4YGDB 1LXFC 2LVVA 4GFTA 1YX8A 4NDCA 1UHKA 1KQMC 2BCXA 2K0JA 1KFXS 1M63B 1H4BA 2FCDA 2KAYA 4PE1A 2LMVA 1S6JA 1F71A 1QV1A 1QVIZ 2LM5A 1NIWA 2P6BB 1WDCB 3GK2A 5AANA 1WLZA 2LP2A 2PSRA 3VROA 3TUYC 3SG7A 1BR4B 4FTGA 2GV5A 2OTGB 3EVRA 1Y1XA 2KQ6A 4CFQA 2KYCA 1JFJA 1AHRA 1BMOA 1NWDA 4C0JA 1XO5A 3OP0A 5FYXA 2JQ6A 5BPJA 4CPVA 5HKZA 5J3XA 1SNLA 2BL0B 1TCOB 2K7BA 3JTDB 1SR6C 4YI8A 1FI5A 2KGBC 1KFUL 3OB1B 3WNXB 3I5HC 1KSOA 1SCMC 2L5XB 4I5JA 3I5IB 3TS5C 1A29A 2MAZA 2CNPA 2F33A 1MR8A 1RJVA 2FJUB 2ISDA 4BY4A 2JT3A 1MXEA 4XJKB 2PALA 1AK8A 4CLNA 2JNXA 1TNWA 2WCBA 2F2PA 4N5XA 4YGAA 4C0KA 2NZ0A 2M97A 3DVKA 2BBMA 2CT9A 5JJGA 3I5GC 4NQGA 1B8CA 4PE0A 1F4QA 1MWNA 4JPZB 3LLEA 3DF0A 1XYDA 2KI4B 1DJXA 5KSZA 4BY5A 3KO0A 4ZCUA 1A2XA 5I2LA 1RK9A 1QJTA 1C7WA 2FOTA 1UP5A 4MN0A 4PALA 4YBHB 2H2KA 4F0ZB 2CCMA 1IJ5A 2KNEA 2GGZA 1JBAA 1KWOC 4E68A 2KGRA 2I2RE 3A8RA 1JFKA 1PRWA 4ZCVA 4OV2A 3EKJA 3WHTB 5AFPA 4PHJA 3ZNIA 1OOJA 2EHBA 1TCFA 1K9UA 1XFYO 2BE4A 2M8UA 1EG3A 2EGDA 2K7DA 1H8BA 2O60A 2JRFA 1RECA 3FWBA 4WQ3A 1X02A 3NXAA 1FPWA 2EC6B 3DVJA 2LLSA 4ORAB 2VRGA 1JWDA 2HQWA 2HF5A 1K9PA 4M2OA 1G8IA 1KSMA 4YGCB 3GK1A 1KK8B 1J7RA 2KFGA 1W7JB 3EK4A 1AUIB 1YUSA 1N2DA 4HRHA 2RGIA 3PN7C 2JPTA 5HKYA 1XFZO 3FWCA 4DS7A 2OS8C 2BECA 2MLEC 3LL8B 4OCIA 1SW8A 3PALA 3SG2A 4HREE 4DUQA 5CPVA 1ODBA 1NPQA 3BOWA 1CM1A 2Y1NA 2M7NA 4OR9B 3D0YB 1BOCA 1L2OC 1UHIA 2ZKMX 2AUCA 1VRKA 1JUOA 1MUXA 2LUXA 1IGVA 2CTNA 1A03A 3OX6A 5D7FA 3BQ3A 3PATA 1PK0D 1NX2A 4ORBB 1MQ1A 1DF0B 1M39A 1XFVO 4R1EA 3E3RA 1CTRA 2I7AA 1KK7Y 3NSIA 4FQOA 4YGBB 5DKNA 3DVMA 1QX2A 2LNKA 5DKQA 1QTXA 1WY9A 1DJGA 1G33A 2GGMA 5HLVA 2HQ8A 1FI6A 1CLBA 2LC5A 1CDMA 3JVTB 1BLQA 1EH2A 1W7IB 4N1FA 1YUTA 1A4PA 2LHLA 1PSRA 1JF0A 1UHNA 1MHOA 2WCEA 5CSJA 5ER4X 1B1GA 2KDHA 1NX3A 4P2YB 2MBXA 2F8PA 1TIZA 2BKHB 3MSEB 4MBEA 2AMIA 2JXCA 2K2AA 2KFFA 3I5FB 1LVCD 4I5NB 2Y1MA 5AEQA 1PVAA 4A4BA 1BF5A 1BU3A 2PVBA 1MXLC 1YR5A 1LA3A 1OQPA 1CNPA 2LMUA 1S1EA 2WOSA 1CMGA 4CFRA 1RFJA 4A4CA 1TOPA 3CR2A 1SL7A 1AJ4A 1S5GY 5CSIA 1SY9A 4JQ0D 3AKBA 1EL4A 2F3YA 1B4CA 1F54A 1QX5B 1CFPA 2ZRSA 1CB1A 2LMTA 1LINA 3ICBA 2WNDA 1QASA 1CLLA 1WRZA 1M45A 1UWOA 2BE6A 1UHHA 3CR4X 2PASA 3OX5A 1M31A 2JTZA 2M9GA 1K90D 3SG4A 3ZWHA 2M1UA 2ZFDA 3D0YA 4M2PA 2WC8A 1TNQA 4MLWA 3VRQA 1SL9A 1CKKA 4MZJA 4GBAA 1RTP1 1YRTB 1YTZC 1WDCC 4N1GA 1QX7A 5GQQC 1DF0A 5JOLA 1AJ5A 1XK4C 1WRLA 1B7TZ 1U5IB 1DJHA 2OTGC 2QACA 2M3WA 1YURA 3VRNA 1PULA 2NXQA 3WHUB 1J1DA 1CM4A 1CLMA 4ICBA 1BJFA 2MHHA 1WLMA 1Y0VH 4MSPA 1K2HA 2BL0C 3JTDC 2Q91A 5HYDA 3LCPC 3KEVA 3WXAA 2M0RA 4PE7A 1RROA 5I2QA 2LP3A 1A75B 3I5IC 1ZUZA 1QVIY 1EJ3A 1C7VA 1N65A 1GJYA 2NLNA 1ALVA 3EVVA 4AOMA 1EG4A 1QV0A 1DTLA 1OMRA 2I94A 3OB2B 3H4SE 1Q80A 1XK4A 4XYNA 3CS1A 3SG3A 1B9AA 1ZOTB 3PM8A 2CBLA 3AKAA 2K7OA 1CFDA 1JF2A 4L9MA 4OKHA 1DJWA 3IQQA 1IJ6A 5HLOA 2NCPA 4AQIA 3DD4A 2KI6C 3SIBA 4C0LA 1K94A 3TDZA 1DGUA 2K8MB 3GK4X 1KK7Z 1ALWA 1DVIA 1S26D 3VRRA 2OPOA 4MRYA 2M49B 4NDBA 2JXLA 2M29A 1NCYA 5PALA 1J7OA 5HKWA 1B47A 1NUBA 1QLSA 2KI4C 1NP8A 1S6IA 2ZN9A 1CDPA 2JWWA 5AXIA 2M7LA 3NSOA 2D8NA 3O2PA 5KTYA 2JULA 1R2UA 2WCFA 1BT6A 1J1EA 3NSKA 4XJKA 5ER5A 5I8NA 3RLZA 1CFFA 3BUWB 3BUMB 3F45A 3QRXA 5D69A 4YRUA 2K7CA 3SG6A 2BKIB 2HPSA 2Y4QA 4TNCA 1PVBA 2JU0A 3VGOA 2B1UA 2L4IA 2MRDA 1WRKA 1KFXL 1U5IA 3SIAA 2PMYA 1OSAA 1IQ3A 4AQJA 2LVKA 2BBNA 1SMGA 1QXPA 1SBJA 1SCVA 3IF7A 1OE9B 1S5GZ 2KYFA 1IQ5A 1TNPA 1KQMB 2L50A 3CGAA 1TTXA 1G4YR 2NCOA 1IRJA 5KU1A 1QATA 1YX7A 1J7PA 4MEWA 2JZIA 1DT7B 1E8AA 1R6PA 2BCAA 3A4UB 3RM1A 2EC6C 1N0YA 2KAXA 4D1EA 1QIWA 4DIRA 1CMFA 3TUYB 1CDNA 1NSHA 2KSPA 1KK8C 1DJZA 2F2OA 3OHMB 4PHKA 1LA0A 4GPLB 2E30A 5DKRA 2MA2A 1FW4A 3KHEA 1FBVA 2BCBA 2SCPA 2ZNDA 4ORCB 5CSFA 2KFHA 4MZLA 1JSAA 1EXRA 1SR6B 1F8HA 1QIVA 2LAPA 3I5HB 3KPXA 4USLA 1RWYA 2LLUA 5G08A 3TS5B 2ZRTA 1V1FA 3DF0B 1SRAA 4I5LB 1ZACA 1UUSA 4DCKA 1XFXO 2KI6D 1IG5A 1S36A 2TN4A 4OVNF 1SYMA 3BYAA 3O4YA 3PFVA 2JT8A 1GGZA 1C07A 1AVSA 2PRUA 3LK0A 5F6TA 1LKJA 2KQYA 4IL1A 1PALA 4MZKA 1NYAA 3TDIA 2I18A 2L0PA 2LV7A 2IS9A 2V53A 5I2OA 3JVTC 1J7QA 3I5GB 5IBWA 3VRPA 1BR1B 1CDLA 1NX1A 1KQVA 1NX0A 4HRGA 5AERA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QS7 A;  2LLT A;  1K9K A;  1SL8 A;  2CXJ A;  1IWQ A;  2HET A;  2QPT A;  2KOT A;  2Q4U A;  3FIA A;  3FS7 A;  1DJY A;  3I5F C;  1YVH A;  3AAJ A;  5B8I B;  2KBI A;  1QLK A;  1YRU B;  1KWO B;  2F3Z A;  3HX4 A;  2LCP A;  2KAV A;  3PLF B;  1D1O A;  1J55 A;  1XFU O;  1Y1A A;  3CLN A;  1CFC A;  2ZNE A;  1KCY A;  4PCW A;  4QJ3 B;  4GAO A;  2L51 A;  1NCZ A;  3BUO B;  4GGN A;  4YGE B;  3CWG A;  1M46 A;  1Y1U A;  3HCM A;  4MRX A;  1S3P A;  3IQO A;  4WRI A;  1JC2 A;  2LAN A;  4Q04 A;  4GNK B;  2COL B;  1IH0 A;  4WQ2 A;  2FCE A;  1DJI A;  3BOW B;  3M0W A;  1YVL A;  1KFU S;  1ZFS A;  4NDD A;  3NSL A;  4I5K A;  2LVI A;  3BUN B;  1TNX A;  1V1G A;  2LE9 B;  4GUK A;  4U8D A;  2JOJ A;  2WOR A;  1F70 A;  3DVE A;  4JWQ A;  1TRF A;  4PHN A;  3SJS A;  3PN7 B;  1UHJ A;  2G9B A;  3LK1 A;  2OS8 B;  3TZ1 A;  1FF1 A;  1K93 D;  1OMD A;  2DOQ A;  3CR5 X;  1F55 A;  2KHN A;  2H61 C;  1MF8 B;  1OMV A;  4PDZ A;  2K61 A;  4MVF A;  3EK8 A;  3GOF A;  3SG5 A;  4GGF C;  1L2O B;  2Y5I A;  3C1V A;  1GGW A;  1Y6W A;  1F4O A;  4PHM A;  2M1K B;  2ZN8 A;  4ETO A;  2KBM A;  1K96 A;  2L4H A;  5TNC A;  1UUR A;  1SKT A;  1B8R A;  2L98 A;  4CID A;  1XA5 A;  1K95 A;  1B7T Y;  2G2B A;  1XVJ A;  2MLF C;  1L7Z A;  2A4J A;  1BG1 A;  2E6W A;  2K2F A;  2O5G A;  2JC2 A;  3CTN A;  5K89 A;  2JNF A;  3O78 A;  2H61 A;  3KF9 A;  1AP4 A;  5CSN A;  1SPY A;  3EK7 A;  4P5O E;  1DGV A;  4QJ5 B;  4QJ4 B;  1B8L A;  4GGF A;  1ZMZ A;  2AAO A;  3K21 A;  4M2Q A;  2JT0 A;  1S6C A;  1A75 A;  1TN4 A;  3O6B A;  1PSB A;  1YUU A;  2SAS A;  4YI9 A;  1DMO A;  3EKH A;  1GQM A;  2LUC A;  1BOD A;  1NCX A;  3AAK A;  1HT9 A;  3BXK A;  1HQV A;  3EVU A;  2LVJ A;  2R2I A;  2L2E A;  3D10 A;  4PE4 A;  2JTT A;  3BUX B;  1OZS A;  4DRW A;  4UPG A;  1SCM B;  1OZO A;  2LHI A;  1SK6 D;  2MJW B;  4HSZ A;  3TDU A;  1IKU A;  1K8U A;  3PSR A;  3CZT X;  1XFW O;  4YGD B;  1LXF C;  2LVV A;  4GFT A;  1YX8 A;  4NDC A;  1UHK A;  1KQM C;  2BCX A;  2K0J A;  1KFX S;  1M63 B;  1H4B A;  2FCD A;  2KAY A;  4PE1 A;  2LMV A;  1S6J A;  1F71 A;  1QV1 A;  1QVI Z;  2LM5 A;  1NIW A;  2P6B B;  1WDC B;  3GK2 A;  5AAN A;  1WLZ A;  2LP2 A;  2PSR A;  3VRO A;  3TUY C;  3SG7 A;  1BR4 B;  4FTG A;  2GV5 A;  2OTG B;  3EVR A;  1Y1X A;  2KQ6 A;  4CFQ A;  2KYC A;  1JFJ A;  1AHR A;  1BMO A;  1NWD A;  4C0J A;  1XO5 A;  3OP0 A;  5FYX A;  2JQ6 A;  5BPJ A;  4CPV A;  5HKZ A;  5J3X A;  1SNL A;  2BL0 B;  1TCO B;  2K7B A;  3JTD B;  1SR6 C;  4YI8 A;  1FI5 A;  2KGB C;  1KFU L;  3OB1 B;  3WNX B;  3I5H C;  1KSO A;  1SCM C;  2L5X B;  4I5J A;  3I5I B;  3TS5 C;  1A29 A;  2MAZ A;  2CNP A;  2F33 A;  1MR8 A;  1RJV A;  2FJU B;  2ISD A;  4BY4 A;  2JT3 A;  1MXE A;  4XJK B;  2PAL A;  1AK8 A;  4CLN A;  2JNX A;  1TNW A;  2WCB A;  2F2P A;  4N5X A;  4YGA A;  4C0K A;  2NZ0 A;  2M97 A;  3DVK A;  2BBM A;  2CT9 A;  5JJG A;  3I5G C;  4NQG A;  1B8C A;  4PE0 A;  1F4Q A;  1MWN A;  4JPZ B;  3LLE A;  3DF0 A;  1XYD A;  2KI4 B;  1DJX A;  5KSZ A;  4BY5 A;  3KO0 A;  4ZCU A;  1A2X A;  5I2L A;  1RK9 A;  1QJT A;  1C7W A;  2FOT A;  1UP5 A;  4MN0 A;  4PAL A;  4YBH B;  2H2K A;  4F0Z B;  2CCM A;  1IJ5 A;  2KNE A;  2GGZ A;  1JBA A;  1KWO C;  4E68 A;  2KGR A;  2I2R E;  3A8R A;  1JFK A;  1PRW A;  4ZCV A;  4OV2 A;  3EKJ A;  3WHT B;  5AFP A;  4PHJ A;  3ZNI A;  1OOJ A;  2EHB A;  1TCF A;  1K9U A;  1XFY O;  2BE4 A;  2M8U A;  1EG3 A;  2EGD A;  2K7D A;  1H8B A;  2O60 A;  2JRF A;  1REC A;  3FWB A;  4WQ3 A;  1X02 A;  3NXA A;  1FPW A;  2EC6 B;  3DVJ A;  2LLS A;  4ORA B;  2VRG A;  1JWD A;  2HQW A;  2HF5 A;  1K9P A;  4M2O A;  1G8I A;  1KSM A;  4YGC B;  3GK1 A;  1KK8 B;  1J7R A;  2KFG A;  1W7J B;  3EK4 A;  1AUI B;  1YUS A;  1N2D A;  4HRH A;  2RGI A;  3PN7 C;  2JPT A;  5HKY A;  1XFZ O;  3FWC A;  4DS7 A;  2OS8 C;  2BEC A;  2MLE C;  3LL8 B;  4OCI A;  1SW8 A;  3PAL A;  3SG2 A;  4HRE E;  4DUQ A;  5CPV A;  1ODB A;  1NPQ A;  3BOW A;  1CM1 A;  2Y1N A;  2M7N A;  4OR9 B;  3D0Y B;  1BOC A;  1L2O C;  1UHI A;  2ZKM X;  2AUC A;  1VRK A;  1JUO A;  1MUX A;  2LUX A;  1IGV A;  2CTN A;  1A03 A;  3OX6 A;  5D7F A;  3BQ3 A;  3PAT A;  1PK0 D;  1NX2 A;  4ORB B;  1MQ1 A;  1DF0 B;  1M39 A;  1XFV O;  4R1E A;  3E3R A;  1CTR A;  2I7A A;  1KK7 Y;  3NSI A;  4FQO A;  4YGB B;  5DKN A;  3DVM A;  1QX2 A;  2LNK A;  5DKQ A;  1QTX A;  1WY9 A;  1DJG A;  1G33 A;  2GGM A;  5HLV A;  2HQ8 A;  1FI6 A;  1CLB A;  2LC5 A;  1CDM A;  3JVT B;  1BLQ A;  1EH2 A;  1W7I B;  4N1F A;  1YUT A;  1A4P A;  2LHL A;  1PSR A;  1JF0 A;  1UHN A;  1MHO A;  2WCE A;  5CSJ A;  5ER4 X;  1B1G A;  2KDH A;  1NX3 A;  4P2Y B;  2MBX A;  2F8P A;  1TIZ A;  2BKH B;  3MSE B;  4MBE A;  2AMI A;  2JXC A;  2K2A A;  2KFF A;  3I5F B;  1LVC D;  4I5N B;  2Y1M A;  5AEQ A;  1PVA A;  4A4B A;  1BF5 A;  1BU3 A;  2PVB A;  1MXL C;  1YR5 A;  1LA3 A;  1OQP A;  1CNP A;  2LMU A;  1S1E A;  2WOS A;  1CMG A;  4CFR A;  1RFJ A;  4A4C A;  1TOP A;  3CR2 A;  1SL7 A;  1AJ4 A;  1S5G Y;  5CSI A;  1SY9 A;  4JQ0 D;  3AKB A;  1EL4 A;  2F3Y A;  1B4C A;  1F54 A;  1QX5 B;  1CFP A;  2ZRS A;  1CB1 A;  2LMT A;  1LIN A;  3ICB A;  2WND A;  1QAS A;  1CLL A;  1WRZ A;  1M45 A;  1UWO A;  2BE6 A;  1UHH A;  3CR4 X;  2PAS A;  3OX5 A;  1M31 A;  2JTZ A;  2M9G A;  1K90 D;  3SG4 A;  3ZWH A;  2M1U A;  2ZFD A;  3D0Y A;  4M2P A;  2WC8 A;  1TNQ A;  4MLW A;  3VRQ A;  1SL9 A;  1CKK A;  4MZJ A;  4GBA A;  1RTP 1;  1YRT B;  1YTZ C;  1WDC C;  4N1G A;  1QX7 A;  5GQQ C;  1DF0 A;  5JOL A;  1AJ5 A;  1XK4 C;  1WRL A;  1B7T Z;  1U5I B;  1DJH A;  2OTG C;  2QAC A;  2M3W A;  1YUR A;  3VRN A;  1PUL A;  2NXQ A;  3WHU B;  1J1D A;  1CM4 A;  1CLM A;  4ICB A;  1BJF A;  2MHH A;  1WLM A;  1Y0V H;  4MSP A;  1K2H A;  2BL0 C;  3JTD C;  2Q91 A;  5HYD A;  3LCP C;  3KEV A;  3WXA A;  2M0R A;  4PE7 A;  1RRO A;  5I2Q A;  2LP3 A;  1A75 B;  3I5I C;  1ZUZ A;  1QVI Y;  1EJ3 A;  1C7V A;  1N65 A;  1GJY A;  2NLN A;  1ALV A;  3EVV A;  4AOM A;  1EG4 A;  1QV0 A;  1DTL A;  1OMR A;  2I94 A;  3OB2 B;  3H4S E;  1Q80 A;  1XK4 A;  4XYN A;  3CS1 A;  3SG3 A;  1B9A A;  1ZOT B;  3PM8 A;  2CBL A;  3AKA A;  2K7O A;  1CFD A;  1JF2 A;  4L9M A;  4OKH A;  1DJW A;  3IQQ A;  1IJ6 A;  5HLO A;  2NCP A;  4AQI A;  3DD4 A;  2KI6 C;  3SIB A;  4C0L A;  1K94 A;  3TDZ A;  1DGU A;  2K8M B;  3GK4 X;  1KK7 Z;  1ALW A;  1DVI A;  1S26 D;  3VRR A;  2OPO A;  4MRY A;  2M49 B;  4NDB A;  2JXL A;  2M29 A;  1NCY A;  5PAL A;  1J7O A;  5HKW A;  1B47 A;  1NUB A;  1QLS A;  2KI4 C;  1NP8 A;  1S6I A;  2ZN9 A;  1CDP A;  2JWW A;  5AXI A;  2M7L A;  3NSO A;  2D8N A;  3O2P A;  5KTY A;  2JUL A;  1R2U A;  2WCF A;  1BT6 A;  1J1E A;  3NSK A;  4XJK A;  5ER5 A;  5I8N A;  3RLZ A;  1CFF A;  3BUW B;  3BUM B;  3F45 A;  3QRX A;  5D69 A;  4YRU A;  2K7C A;  3SG6 A;  2BKI B;  2HPS A;  2Y4Q A;  4TNC A;  1PVB A;  2JU0 A;  3VGO A;  2B1U A;  2L4I A;  2MRD A;  1WRK A;  1KFX L;  1U5I A;  3SIA A;  2PMY A;  1OSA A;  1IQ3 A;  4AQJ A;  2LVK A;  2BBN A;  1SMG A;  1QXP A;  1SBJ A;  1SCV A;  3IF7 A;  1OE9 B;  1S5G Z;  2KYF A;  1IQ5 A;  1TNP A;  1KQM B;  2L50 A;  3CGA A;  1TTX A;  1G4Y R;  2NCO A;  1IRJ A;  5KU1 A;  1QAT A;  1YX7 A;  1J7P A;  4MEW A;  2JZI A;  1DT7 B;  1E8A A;  1R6P A;  2BCA A;  3A4U B;  3RM1 A;  2EC6 C;  1N0Y A;  2KAX A;  4D1E A;  1QIW A;  4DIR A;  1CMF A;  3TUY B;  1CDN A;  1NSH A;  2KSP A;  1KK8 C;  1DJZ A;  2F2O A;  3OHM B;  4PHK A;  1LA0 A;  4GPL B;  2E30 A;  5DKR A;  2MA2 A;  1FW4 A;  3KHE A;  1FBV A;  2BCB A;  2SCP A;  2ZND A;  4ORC B;  5CSF A;  2KFH A;  4MZL A;  1JSA A;  1EXR A;  1SR6 B;  1F8H A;  1QIV A;  2LAP A;  3I5H B;  3KPX A;  4USL A;  1RWY A;  2LLU A;  5G08 A;  3TS5 B;  2ZRT A;  1V1F A;  3DF0 B;  1SRA A;  4I5L B;  1ZAC A;  1UUS A;  4DCK A;  1XFX O;  2KI6 D;  1IG5 A;  1S36 A;  2TN4 A;  4OVN F;  1SYM A;  3BYA A;  3O4Y A;  3PFV A;  2JT8 A;  1GGZ A;  1C07 A;  1AVS A;  2PRU A;  3LK0 A;  5F6T A;  1LKJ A;  2KQY A;  4IL1 A;  1PAL A;  4MZK A;  1NYA A;  3TDI A;  2I18 A;  2L0P A;  2LV7 A;  2IS9 A;  2V53 A;  5I2O A;  3JVT C;  1J7Q A;  3I5G B;  5IBW A;  3VRP A;  1BR1 B;  1CDL A;  1NX1 A;  1KQV A;  1NX0 A;  4HRG A;  5AER A; 
#chains in the Genus database with same CATH topology
 1QS7 A;  2LLT A;  1K9K A;  1SL8 A;  2CXJ A;  1IWQ A;  2HET A;  2QPT A;  2KOT A;  2Q4U A;  3FIA A;  3FS7 A;  1DJY A;  3I5F C;  1YVH A;  3AAJ A;  5B8I B;  5HL1 A;  2KBI A;  1QLK A;  2KLE A;  1YRU B;  1KWO B;  2F3Z A;  2WCL A;  2LCP A;  2KAV A;  3HX4 A;  3PLF B;  1J55 A;  1XFU O;  1D1O A;  2L2C A;  1Y1A A;  3CLN A;  1CFC A;  2ZNE A;  1KCY A;  4PCW A;  4QJ3 B;  4GAO A;  2L51 A;  1NCZ A;  3QME A;  3RZS A;  3BUO B;  4GGN A;  4YGE B;  3CWG A;  3CZ1 A;  1M46 A;  1Y1U A;  3HCM A;  4MRX A;  1S3P A;  3IQO A;  4WRI A;  1JC2 A;  2LAN A;  4Q04 A;  4GNK B;  2COL B;  1IH0 A;  4WQ2 A;  2FCE A;  3S0F A;  1DJI A;  3NGV A;  3BOW B;  1OOF A;  3M0W A;  1YVL A;  1KFU S;  1ZFS A;  4NDD A;  3CAB A;  3NSL A;  4I5K A;  2LVI A;  3BUN B;  1TNX A;  3OGN A;  1V1G A;  2LE9 B;  5I94 A;  4INX A;  4GUK A;  4U8D A;  2JOJ A;  2WOR A;  1F70 A;  3DVE A;  4JWQ A;  1TRF A;  4PHN A;  3SJS A;  3PN7 B;  1UHJ A;  2G9B A;  3LK1 A;  2OS8 B;  3TZ1 A;  1FF1 A;  1K93 D;  1OMD A;  2DOQ A;  3CR5 X;  1F55 A;  2KHN A;  2H61 C;  1MF8 B;  1OMV A;  4PDZ A;  2K61 A;  4MVF A;  3EK8 A;  3GOF A;  3SG5 A;  2BAP A;  4GGF C;  1L2O B;  2Y5I A;  3C1V A;  1GGW A;  1Y6W A;  1F4O A;  4PHM A;  2KLD A;  2M1K B;  2ZN8 A;  4ETO A;  2KBM A;  1K96 A;  2L4H A;  2QDI A;  5TNC A;  1UUR A;  1SKT A;  3S0A A;  1B8R A;  2L98 A;  4CID A;  2H8V A;  1XA5 A;  1K95 A;  1B7T Y;  2G2B A;  3D77 A;  1XVJ A;  2MLF C;  1L7Z A;  1TUJ A;  2A4J A;  1BG1 A;  2E6W A;  2K2F A;  2O5G A;  3D74 A;  3FE6 A;  1DEK A;  2JC2 A;  3CTN A;  3B86 A;  2JNF A;  5K89 A;  3O78 A;  2H61 A;  3KF9 A;  1AP4 A;  5CSN A;  1SPY A;  3EK7 A;  4P5O E;  1DGV A;  4QJ5 B;  4QJ4 B;  2QEV A;  1B8L A;  4GGF A;  1ZMZ A;  2AAO A;  3K21 A;  4M2Q A;  2JT0 A;  1S6C A;  2BNX A;  1A75 A;  1TN4 A;  3O6B A;  1PSB A;  1YUU A;  2SAS A;  4YI9 A;  1DMO A;  3EKH A;  1GQM A;  2LUC A;  2WCJ A;  1NCX A;  3AAK A;  1BOD A;  3SS4 A;  1HT9 A;  3BXK A;  5JOL A;  1HQV A;  3EVU A;  2FJY A;  2LVJ A;  2L2E A;  2R2I A;  3D10 A;  2JTT A;  3BUX B;  4PE4 A;  5D3O A;  1OZS A;  2PQL A;  4DRW A;  4UPG A;  1SCM B;  1OOI X;  1OZO A;  1SK6 D;  2LHI A;  2MJW B;  4HSZ A;  3S0B A;  1K8U A;  3TDU A;  1IKU A;  1OW4 A;  1OOG A;  3PSR A;  3CZT X;  1XFW O;  4YGD B;  1LXF C;  2LVV A;  4GFT A;  1YX8 A;  3CDN A;  4NDC A;  1UHK A;  1LS8 A;  1KQM C;  2BCX A;  2K0J A;  1KFX S;  1M63 B;  1H4B A;  2FCD A;  3CZ2 A;  2KAY A;  4PE1 A;  5DIC A;  2LMV A;  1S6J A;  1F71 A;  2WC6 A;  1QV1 A;  1QVI Z;  2LM5 A;  1NIW A;  2P6B B;  1WDC B;  3GK2 A;  5AAN A;  1WLZ A;  2LP2 A;  2PSR A;  3VRO A;  3TUY C;  3SG7 A;  1BR4 B;  4FTG A;  2GV5 A;  2OTG B;  3EVR A;  1Y1X A;  2KQ6 A;  4CFQ A;  2KYC A;  1JFJ A;  3L4L A;  1AHR A;  1BMO A;  1NWD A;  4C0J A;  1XO5 A;  3OP0 A;  5FYX A;  2JQ6 A;  5BPJ A;  4CPV A;  3PM2 A;  5HKZ A;  5J3X A;  1SNL A;  2BL0 B;  1TCO B;  2GTE A;  2K7B A;  3JTD B;  1SR6 C;  4YI8 A;  1FI5 A;  2KGB C;  1KFU L;  3OB1 B;  3WNX B;  2P71 A;  3I5H C;  1KSO A;  1SCM C;  2L5X B;  4I5J A;  3I5I B;  3TS5 C;  1A29 A;  2MAZ A;  2CNP A;  2F33 A;  1MR8 A;  1Z2C B;  1RJV A;  2FJU B;  2ISD A;  3DXL A;  4BY4 A;  2JT3 A;  3B6X A;  1MXE A;  3CYZ A;  4XJK B;  2PAL A;  3VB1 A;  1AK8 A;  4CLN A;  2JNX A;  3V2L A;  3D78 A;  3BFA A;  1TNW A;  2WCB A;  2F2P A;  4N5X A;  1QWV A;  4YGA A;  4C0K A;  2NZ0 A;  2M97 A;  3DVK A;  1ORG A;  2BBM A;  2CT9 A;  5JJG A;  3I5G C;  4NQG A;  1B8C A;  4PE0 A;  1F4Q A;  1MWN A;  4JPZ B;  3LLE A;  3DF0 A;  3B88 A;  1XYD A;  2KI4 B;  1IIO A;  1DJX A;  5KSZ A;  4BY5 A;  3KO0 A;  4ZCU A;  1A2X A;  3B87 A;  1RK9 A;  5I2L A;  1QJT A;  1C7W A;  2FOT A;  1UP5 A;  4MN0 A;  4PAL A;  4YBH B;  2H2K A;  2YGU A;  2CCM A;  1IJ5 A;  4F0Z B;  2KNE A;  3D75 A;  2GGZ A;  1JBA A;  1KWO C;  4E68 A;  2KGR A;  2I2R E;  3Q8I A;  3A8R A;  1JFK A;  1PRW A;  4ZCV A;  1C3Z A;  4OV2 A;  3EKJ A;  3WHT B;  5AFP A;  3L4A A;  4PHJ A;  4INW A;  3ZNI A;  1OOJ A;  2EHB A;  1TCF A;  1K9U A;  1XFY O;  2BE4 A;  2M8U A;  3EG5 B;  3R1V A;  1EG3 A;  2EGD A;  2K7D A;  1H8B A;  2O60 A;  2JRF A;  3SS3 A;  1REC A;  3FWB A;  1GM0 A;  4WQ3 A;  1X02 A;  3NXA A;  1FPW A;  2EC6 B;  3DVJ A;  2LLS A;  3IVT A;  4ORA B;  2VRG A;  5FI7 A;  1DEL A;  1JWD A;  3FE8 A;  4KYN A;  2HQW A;  2HF5 A;  1K9P A;  4M2O A;  1G8I A;  1KSM A;  4YGC B;  3GK1 A;  1KK8 B;  1J7R A;  2KFG A;  2ERB A;  1W7J B;  3EK4 A;  1AUI B;  1YUS A;  5KU1 A;  1N2D A;  4HRH A;  2RGI A;  3NHI A;  3PN7 C;  2JPT A;  5HKY A;  1XFZ O;  3FWC A;  4DS7 A;  2OS8 C;  2BEC A;  2MLE C;  3LL8 B;  4OCI A;  1SW8 A;  3PAL A;  3SG2 A;  4HRE E;  4DUQ A;  1SSE B;  5CPV A;  1ODB A;  1NPQ A;  1T14 A;  3BOW A;  1CM1 A;  2Y1N A;  2M7N A;  4JKT A;  4OR9 B;  3D0Y B;  1BOC A;  1L2O C;  1UHI A;  3DY9 A;  2ZKM X;  2AUC A;  1VRK A;  1JUO A;  1MUX A;  2LUX A;  1IGV A;  2CTN A;  3PJI A;  1A03 A;  3OX6 A;  5D7F A;  3BQ3 A;  3PAT A;  1PK0 D;  1NX2 A;  4ORB B;  1MQ1 A;  1DF0 B;  1M39 A;  1XFV O;  4R1E A;  3E3R A;  1CTR A;  2I7A A;  3CZ0 A;  1KK7 Y;  3NSI A;  4FQO A;  4YGB B;  5DKN A;  3DVM A;  1QX2 A;  2LNK A;  5DKQ A;  1QTX A;  1WY9 A;  1DJG A;  1G33 A;  2GGM A;  5HLV A;  2HQ8 A;  3BFH A;  1CLB A;  2LC5 A;  1FI6 A;  1CDM A;  3JVT B;  5EL2 A;  1BLQ A;  1W7I B;  1EH2 A;  3O4X A;  4N1F A;  1YUT A;  1A4P A;  2LHL A;  1PSR A;  1JF0 A;  1UHN A;  1MHO A;  2WCE A;  5CSJ A;  5ER4 X;  1B1G A;  2KDH A;  1NX3 A;  4P2Y B;  2MBX A;  2F8P A;  1TIZ A;  3K1E A;  2BKH B;  3MSE B;  3N7H A;  2AMI A;  4MBE A;  2JXC A;  2K2A A;  2KFF A;  2P70 A;  3I5F B;  3UNW A;  1LVC D;  4I5N B;  2Y1M A;  5AEQ A;  1PVA A;  4A4B A;  1BF5 A;  1BU3 A;  2PVB A;  1MXL C;  1YR5 A;  1LA3 A;  1OQP A;  1CNP A;  3S0D A;  2LMU A;  5FI2 A;  1S1E A;  2WOS A;  1CMG A;  2WCH A;  1RFJ A;  4A4C A;  4CFR A;  1TOP A;  3CR2 A;  1P28 A;  1SL7 A;  1AJ4 A;  1S5G Y;  5CSI A;  1SY9 A;  3NHT A;  4JQ0 D;  3AKB A;  1EL4 A;  2F3Y A;  2WCM A;  1B4C A;  1F54 A;  1QX5 B;  1CFP A;  2ZRS A;  1CB1 A;  3L47 A;  2LMT A;  1LIN A;  3ICB A;  2WND A;  1QAS A;  1CLL A;  3R72 A;  1WRZ A;  1M45 A;  1UWO A;  2BE6 A;  1UHH A;  3CR4 X;  2PAS A;  3OX5 A;  1M31 A;  3R1P A;  2JTZ A;  2M9G A;  1K90 D;  3SG4 A;  3ZWH A;  2M1U A;  2ZFD A;  3D0Y A;  4M2P A;  2WC8 A;  1TNQ A;  4MLW A;  3VRQ A;  1SL9 A;  1CKK A;  4MZJ A;  4GBA A;  1RTP 1;  1YRT B;  1YTZ C;  1WDC C;  4N1G A;  1QX7 A;  3FE9 A;  1DF0 A;  5GQQ C;  1AJ5 A;  1XK4 C;  1WRL A;  1B7T Z;  1U5I B;  1DJH A;  2OTG C;  2QAC A;  2M3W A;  1YUR A;  3VRN A;  1PUL A;  2NXQ A;  3WHU B;  1J1D A;  1TUZ A;  1CM4 A;  1CLM A;  4ICB A;  1BJF A;  2MHH A;  1WLM A;  1Y0V H;  4MSP A;  1K2H A;  2BL0 C;  1DC1 A;  3JTD C;  2Q91 A;  3OBV A;  5HYD A;  3LCP C;  3KEV A;  3WXA A;  2M0R A;  4PE7 A;  1RRO A;  5I2Q A;  2LP3 A;  1A75 B;  1W9Z A;  3I5I C;  1ZUZ A;  1QVI Y;  1EJ3 A;  1C7V A;  1N65 A;  1GJY A;  2NLN A;  1ALV A;  3EVV A;  4AOM A;  1EG4 A;  1QV0 A;  1DTL A;  1OMR A;  2I94 A;  3OB2 B;  3H4S E;  5FI6 A;  1Q80 A;  1XK4 A;  4XYN A;  3CS1 A;  4OZD A;  1B9A A;  1ZOT B;  3PM8 A;  3SG3 A;  2CBL A;  3AKA A;  2K7O A;  3D73 A;  1CFD A;  1JF2 A;  4L9M A;  4OKH A;  1DJW A;  3IQQ A;  1TWO A;  1IJ6 A;  5HLO A;  2NCP A;  4AQI A;  3DD4 A;  2KI6 C;  2JPO A;  3SIB A;  4C0L A;  1K94 A;  3TDZ A;  1DGU A;  2K8M B;  2QEO A;  1KK7 Z;  3GK4 X;  3B7A A;  1ALW A;  1DVI A;  1S26 D;  3VRR A;  2OPO A;  4MRY A;  2M49 B;  4NDB A;  2JXL A;  2M29 A;  1NCY A;  5PAL A;  1J7O A;  5HKW A;  1B47 A;  1NUB A;  1QLS A;  2KI4 C;  1NP8 A;  1S6I A;  1C3Y A;  2ZN9 A;  1CDP A;  2JWW A;  5AXI A;  2M7L A;  3NSO A;  1Z4H A;  2D8N A;  3D76 A;  3O2P A;  5KTY A;  2JUL A;  1R2U A;  2WCF A;  1BT6 A;  1J1E A;  3NSK A;  1XFR A;  4XJK A;  5ER5 A;  3SS5 A;  3RLZ A;  3DYE A;  5I8N A;  1CFF A;  3BUW B;  3BUM B;  3F45 A;  1OOH A;  3QRX A;  5D69 A;  4YRU A;  2K7C A;  3SG6 A;  2BKI B;  2HPS A;  2Y4Q A;  4TNC A;  1PVB A;  2JU0 A;  3VGO A;  2B1U A;  2L4I A;  2MRD A;  1WRK A;  1KFX L;  1U5I A;  3SIA A;  2PMY A;  1OSA A;  4PT1 A;  1IQ3 A;  4AQJ A;  2LVK A;  2BBN A;  1SMG A;  1QXP A;  2PYQ A;  1SBJ A;  1SCV A;  2L5Y A;  3IF7 A;  1OE9 B;  1S5G Z;  2KYF A;  1IQ5 A;  1TNP A;  1KQM B;  2L50 A;  3CGA A;  1TTX A;  1G4Y R;  2NCO A;  1IRJ A;  3DZT A;  1QAT A;  1YX7 A;  2K60 A;  1J7P A;  4MEW A;  2JZI A;  1DT7 B;  3BFB A;  1E8A A;  1R6P A;  2BCA A;  3A4U B;  3RM1 A;  2EC6 C;  1N0Y A;  2KAX A;  4D1E A;  1QIW A;  4DIR A;  4JD9 A;  1CMF A;  4IJ7 A;  3TUY B;  1CDN A;  1NSH A;  2KSP A;  1KK8 C;  1DJZ A;  2F2O A;  3OHM B;  4PHK A;  2QEH A;  1LA0 A;  4GPL B;  2E30 A;  5DKR A;  3S0G A;  2MA2 A;  1FW4 A;  3KHE A;  1FBV A;  2BCB A;  2SCP A;  2ZND A;  4ORC B;  5CSF A;  2KFH A;  4FQT A;  4MZL A;  1JSA A;  1EXR A;  1SR6 B;  2WC5 A;  1F8H A;  1QIV A;  2LAP A;  3I5H B;  3KPX A;  4USL A;  3UO9 A;  1RWY A;  2LLU A;  2KPH A;  5G08 A;  3TS5 B;  2ZRT A;  2WCK A;  1V1F A;  3BJH A;  3DF0 B;  1SRA A;  4I5L B;  1ZAC A;  1UUS A;  4F7F A;  4DCK A;  1XFX O;  2KI6 D;  2QEB A;  1IG5 A;  1S36 A;  2TN4 A;  4OVN F;  3S0E A;  1SYM A;  3BYA A;  3O4Y A;  3PFV A;  2JT8 A;  1GGZ A;  1C07 A;  1AVS A;  2PRU A;  3LK0 A;  5F6T A;  1LKJ A;  2KQY A;  4IL1 A;  1PAL A;  4MZK A;  1NYA A;  3TDI A;  2I18 A;  2L0P A;  2LV7 A;  2IS9 A;  2V53 A;  5I2O A;  3JVT C;  1DQE A;  3R1O A;  1J7Q A;  3I5G B;  5IBW A;  3VRP A;  1BR1 B;  1CDL A;  1NX1 A;  1KQV A;  1NX0 A;  4HRG A;  5AER A; 
#chains in the Genus database with same CATH homology
 1QS7 A;  2LLT A;  1K9K A;  1SL8 A;  2CXJ A;  1IWQ A;  2HET A;  2QPT A;  2KOT A;  2Q4U A;  3FIA A;  3FS7 A;  1DJY A;  3I5F C;  1YVH A;  3AAJ A;  5B8I B;  2KBI A;  1QLK A;  1YRU B;  1KWO B;  2F3Z A;  3HX4 A;  2LCP A;  2KAV A;  3PLF B;  1D1O A;  1J55 A;  1XFU O;  1Y1A A;  3CLN A;  1CFC A;  2ZNE A;  1KCY A;  4PCW A;  4QJ3 B;  4GAO A;  2L51 A;  1NCZ A;  3BUO B;  4GGN A;  4YGE B;  3CWG A;  1M46 A;  1Y1U A;  3HCM A;  4MRX A;  1S3P A;  3IQO A;  4WRI A;  1JC2 A;  2LAN A;  4Q04 A;  4GNK B;  2COL B;  1IH0 A;  4WQ2 A;  2FCE A;  1DJI A;  3BOW B;  3M0W A;  1YVL A;  1KFU S;  1ZFS A;  4NDD A;  3NSL A;  4I5K A;  2LVI A;  3BUN B;  1TNX A;  1V1G A;  2LE9 B;  4GUK A;  4U8D A;  2JOJ A;  2WOR A;  1F70 A;  3DVE A;  4JWQ A;  1TRF A;  4PHN A;  3SJS A;  3PN7 B;  1UHJ A;  2G9B A;  3LK1 A;  2OS8 B;  3TZ1 A;  1FF1 A;  1K93 D;  1OMD A;  2DOQ A;  3CR5 X;  1F55 A;  2KHN A;  2H61 C;  1MF8 B;  1OMV A;  4PDZ A;  2K61 A;  4MVF A;  3EK8 A;  3GOF A;  3SG5 A;  4GGF C;  1L2O B;  2Y5I A;  3C1V A;  1GGW A;  1Y6W A;  1F4O A;  4PHM A;  2M1K B;  2ZN8 A;  4ETO A;  2KBM A;  1K96 A;  2L4H A;  5TNC A;  1UUR A;  1SKT A;  1B8R A;  2L98 A;  4CID A;  1XA5 A;  1K95 A;  1B7T Y;  2G2B A;  1XVJ A;  2MLF C;  1L7Z A;  2A4J A;  1BG1 A;  2E6W A;  2K2F A;  2O5G A;  2JC2 A;  3CTN A;  5K89 A;  2JNF A;  3O78 A;  2H61 A;  3KF9 A;  1AP4 A;  5CSN A;  1SPY A;  3EK7 A;  4P5O E;  1DGV A;  4QJ5 B;  4QJ4 B;  1B8L A;  4GGF A;  1ZMZ A;  2AAO A;  3K21 A;  4M2Q A;  2JT0 A;  1S6C A;  1A75 A;  1TN4 A;  3O6B A;  1PSB A;  1YUU A;  2SAS A;  4YI9 A;  1DMO A;  3EKH A;  1GQM A;  2LUC A;  1BOD A;  1NCX A;  3AAK A;  1HT9 A;  3BXK A;  1HQV A;  3EVU A;  2LVJ A;  2R2I A;  2L2E A;  3D10 A;  4PE4 A;  2JTT A;  3BUX B;  1OZS A;  4DRW A;  4UPG A;  1SCM B;  1OZO A;  2LHI A;  1SK6 D;  2MJW B;  4HSZ A;  3TDU A;  1IKU A;  1K8U A;  3PSR A;  3CZT X;  1XFW O;  4YGD B;  1LXF C;  2LVV A;  4GFT A;  1YX8 A;  4NDC A;  1UHK A;  1KQM C;  2BCX A;  2K0J A;  1KFX S;  1M63 B;  1H4B A;  2FCD A;  2KAY A;  4PE1 A;  2LMV A;  1S6J A;  1F71 A;  1QV1 A;  1QVI Z;  2LM5 A;  1NIW A;  2P6B B;  1WDC B;  3GK2 A;  5AAN A;  1WLZ A;  2LP2 A;  2PSR A;  3VRO A;  3TUY C;  3SG7 A;  1BR4 B;  4FTG A;  2GV5 A;  2OTG B;  3EVR A;  1Y1X A;  2KQ6 A;  4CFQ A;  2KYC A;  1JFJ A;  1AHR A;  1BMO A;  1NWD A;  4C0J A;  1XO5 A;  3OP0 A;  5FYX A;  2JQ6 A;  5BPJ A;  4CPV A;  5HKZ A;  5J3X A;  1SNL A;  2BL0 B;  1TCO B;  2K7B A;  3JTD B;  1SR6 C;  4YI8 A;  1FI5 A;  2KGB C;  1KFU L;  3OB1 B;  3WNX B;  3I5H C;  1KSO A;  1SCM C;  2L5X B;  4I5J A;  3I5I B;  3TS5 C;  1A29 A;  2MAZ A;  2CNP A;  2F33 A;  1MR8 A;  1RJV A;  2FJU B;  2ISD A;  4BY4 A;  2JT3 A;  1MXE A;  4XJK B;  2PAL A;  1AK8 A;  4CLN A;  2JNX A;  1TNW A;  2WCB A;  2F2P A;  4N5X A;  4YGA A;  4C0K A;  2NZ0 A;  2M97 A;  3DVK A;  2BBM A;  2CT9 A;  5JJG A;  3I5G C;  4NQG A;  1B8C A;  4PE0 A;  1F4Q A;  1MWN A;  4JPZ B;  3LLE A;  3DF0 A;  1XYD A;  2KI4 B;  1DJX A;  5KSZ A;  4BY5 A;  3KO0 A;  4ZCU A;  1A2X A;  5I2L A;  1RK9 A;  1QJT A;  1C7W A;  2FOT A;  1UP5 A;  4MN0 A;  4PAL A;  4YBH B;  2H2K A;  4F0Z B;  2CCM A;  1IJ5 A;  2KNE A;  2GGZ A;  1JBA A;  1KWO C;  4E68 A;  2KGR A;  2I2R E;  3A8R A;  1JFK A;  1PRW A;  4ZCV A;  4OV2 A;  3EKJ A;  3WHT B;  5AFP A;  4PHJ A;  3ZNI A;  1OOJ A;  2EHB A;  1TCF A;  1K9U A;  1XFY O;  2BE4 A;  2M8U A;  1EG3 A;  2EGD A;  2K7D A;  1H8B A;  2O60 A;  2JRF A;  1REC A;  3FWB A;  4WQ3 A;  1X02 A;  3NXA A;  1FPW A;  2EC6 B;  3DVJ A;  2LLS A;  4ORA B;  2VRG A;  1JWD A;  2HQW A;  2HF5 A;  1K9P A;  4M2O A;  1G8I A;  1KSM A;  4YGC B;  3GK1 A;  1KK8 B;  1J7R A;  2KFG A;  1W7J B;  3EK4 A;  1AUI B;  1YUS A;  1N2D A;  4HRH A;  2RGI A;  3PN7 C;  2JPT A;  5HKY A;  1XFZ O;  3FWC A;  4DS7 A;  2OS8 C;  2BEC A;  2MLE C;  3LL8 B;  4OCI A;  1SW8 A;  3PAL A;  3SG2 A;  4HRE E;  4DUQ A;  5CPV A;  1ODB A;  1NPQ A;  3BOW A;  1CM1 A;  2Y1N A;  2M7N A;  4OR9 B;  3D0Y B;  1BOC A;  1L2O C;  1UHI A;  2ZKM X;  2AUC A;  1VRK A;  1JUO A;  1MUX A;  2LUX A;  1IGV A;  2CTN A;  1A03 A;  3OX6 A;  5D7F A;  3BQ3 A;  3PAT A;  1PK0 D;  1NX2 A;  4ORB B;  1MQ1 A;  1DF0 B;  1M39 A;  1XFV O;  4R1E A;  3E3R A;  1CTR A;  2I7A A;  1KK7 Y;  3NSI A;  4FQO A;  4YGB B;  5DKN A;  3DVM A;  1QX2 A;  2LNK A;  5DKQ A;  1QTX A;  1WY9 A;  1DJG A;  1G33 A;  2GGM A;  5HLV A;  2HQ8 A;  1FI6 A;  1CLB A;  2LC5 A;  1CDM A;  3JVT B;  1BLQ A;  1EH2 A;  1W7I B;  4N1F A;  1YUT A;  1A4P A;  2LHL A;  1PSR A;  1JF0 A;  1UHN A;  1MHO A;  2WCE A;  5CSJ A;  5ER4 X;  1B1G A;  2KDH A;  1NX3 A;  4P2Y B;  2MBX A;  2F8P A;  1TIZ A;  2BKH B;  3MSE B;  4MBE A;  2AMI A;  2JXC A;  2K2A A;  2KFF A;  3I5F B;  1LVC D;  4I5N B;  2Y1M A;  5AEQ A;  1PVA A;  4A4B A;  1BF5 A;  1BU3 A;  2PVB A;  1MXL C;  1YR5 A;  1LA3 A;  1OQP A;  1CNP A;  2LMU A;  1S1E A;  2WOS A;  1CMG A;  4CFR A;  1RFJ A;  4A4C A;  1TOP A;  3CR2 A;  1SL7 A;  1AJ4 A;  1S5G Y;  5CSI A;  1SY9 A;  4JQ0 D;  3AKB A;  1EL4 A;  2F3Y A;  1B4C A;  1F54 A;  1QX5 B;  1CFP A;  2ZRS A;  1CB1 A;  2LMT A;  1LIN A;  3ICB A;  2WND A;  1QAS A;  1CLL A;  1WRZ A;  1M45 A;  1UWO A;  2BE6 A;  1UHH A;  3CR4 X;  2PAS A;  3OX5 A;  1M31 A;  2JTZ A;  2M9G A;  1K90 D;  3SG4 A;  3ZWH A;  2M1U A;  2ZFD A;  3D0Y A;  4M2P A;  2WC8 A;  1TNQ A;  4MLW A;  3VRQ A;  1SL9 A;  1CKK A;  4MZJ A;  4GBA A;  1RTP 1;  1YRT B;  1YTZ C;  1WDC C;  4N1G A;  1QX7 A;  5GQQ C;  1DF0 A;  5JOL A;  1AJ5 A;  1XK4 C;  1WRL A;  1B7T Z;  1U5I B;  1DJH A;  2OTG C;  2QAC A;  2M3W A;  1YUR A;  3VRN A;  1PUL A;  2NXQ A;  3WHU B;  1J1D A;  1CM4 A;  1CLM A;  4ICB A;  1BJF A;  2MHH A;  1WLM A;  1Y0V H;  4MSP A;  1K2H A;  2BL0 C;  3JTD C;  2Q91 A;  5HYD A;  3LCP C;  3KEV A;  3WXA A;  2M0R A;  4PE7 A;  1RRO A;  5I2Q A;  2LP3 A;  1A75 B;  3I5I C;  1ZUZ A;  1QVI Y;  1EJ3 A;  1C7V A;  1N65 A;  1GJY A;  2NLN A;  1ALV A;  3EVV A;  4AOM A;  1EG4 A;  1QV0 A;  1DTL A;  1OMR A;  2I94 A;  3OB2 B;  3H4S E;  1Q80 A;  1XK4 A;  4XYN A;  3CS1 A;  3SG3 A;  1B9A A;  1ZOT B;  3PM8 A;  2CBL A;  3AKA A;  2K7O A;  1CFD A;  1JF2 A;  4L9M A;  4OKH A;  1DJW A;  3IQQ A;  1IJ6 A;  5HLO A;  2NCP A;  4AQI A;  3DD4 A;  2KI6 C;  3SIB A;  4C0L A;  1K94 A;  3TDZ A;  1DGU A;  2K8M B;  3GK4 X;  1KK7 Z;  1ALW A;  1DVI A;  1S26 D;  3VRR A;  2OPO A;  4MRY A;  2M49 B;  4NDB A;  2JXL A;  2M29 A;  1NCY A;  5PAL A;  1J7O A;  5HKW A;  1B47 A;  1NUB A;  1QLS A;  2KI4 C;  1NP8 A;  1S6I A;  2ZN9 A;  1CDP A;  2JWW A;  5AXI A;  2M7L A;  3NSO A;  2D8N A;  3O2P A;  5KTY A;  2JUL A;  1R2U A;  2WCF A;  1BT6 A;  1J1E A;  3NSK A;  4XJK A;  5ER5 A;  5I8N A;  3RLZ A;  1CFF A;  3BUW B;  3BUM B;  3F45 A;  3QRX A;  5D69 A;  4YRU A;  2K7C A;  3SG6 A;  2BKI B;  2HPS A;  2Y4Q A;  4TNC A;  1PVB A;  2JU0 A;  3VGO A;  2B1U A;  2L4I A;  2MRD A;  1WRK A;  1KFX L;  1U5I A;  3SIA A;  2PMY A;  1OSA A;  1IQ3 A;  4AQJ A;  2LVK A;  2BBN A;  1SMG A;  1QXP A;  1SBJ A;  1SCV A;  3IF7 A;  1OE9 B;  1S5G Z;  2KYF A;  1IQ5 A;  1TNP A;  1KQM B;  2L50 A;  3CGA A;  1TTX A;  1G4Y R;  2NCO A;  1IRJ A;  5KU1 A;  1QAT A;  1YX7 A;  1J7P A;  4MEW A;  2JZI A;  1DT7 B;  1E8A A;  1R6P A;  2BCA A;  3A4U B;  3RM1 A;  2EC6 C;  1N0Y A;  2KAX A;  4D1E A;  1QIW A;  4DIR A;  1CMF A;  3TUY B;  1CDN A;  1NSH A;  2KSP A;  1KK8 C;  1DJZ A;  2F2O A;  3OHM B;  4PHK A;  1LA0 A;  4GPL B;  2E30 A;  5DKR A;  2MA2 A;  1FW4 A;  3KHE A;  1FBV A;  2BCB A;  2SCP A;  2ZND A;  4ORC B;  5CSF A;  2KFH A;  4MZL A;  1JSA A;  1EXR A;  1SR6 B;  1F8H A;  1QIV A;  2LAP A;  3I5H B;  3KPX A;  4USL A;  1RWY A;  2LLU A;  5G08 A;  3TS5 B;  2ZRT A;  1V1F A;  3DF0 B;  1SRA A;  4I5L B;  1ZAC A;  1UUS A;  4DCK A;  1XFX O;  2KI6 D;  1IG5 A;  1S36 A;  2TN4 A;  4OVN F;  1SYM A;  3BYA A;  3O4Y A;  3PFV A;  2JT8 A;  1GGZ A;  1C07 A;  1AVS A;  2PRU A;  3LK0 A;  5F6T A;  1LKJ A;  2KQY A;  4IL1 A;  1PAL A;  4MZK A;  1NYA A;  3TDI A;  2I18 A;  2L0P A;  2LV7 A;  2IS9 A;  2V53 A;  5I2O A;  3JVT C;  1J7Q A;  3I5G B;  5IBW A;  3VRP A;  1BR1 B;  1CDL A;  1NX1 A;  1KQV A;  1NX0 A;  4HRG A;  5AER A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...