2K61A

Solution structure of cam complexed to dapk peptide
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
146
structure length
146
Chain Sequence
b'QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGDGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin
publication title Accurate solution structures of proteins from X-ray data and a minimal set of NMR data: calmodulin-peptide complexes as examples.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 39
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2008-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2k61A00
1QATA 3NXAA 4I5JA 4CIDA 2MHHA 2BE6A 1NWDA 2BL0C 1XFWO 4HSZA 1K2HA 2BCBA 1C7VA 1KK8C 1Q80A 3OB2B 4ZCVA 4MZLA 5CPVA 2ZKMX 1K9KA 3SG7A 1N0YA 3TDUA 1CFFA 1XO5A 1KQMC 3CWGA 4GBAA 1HQVA 3KO0A 1EL4A 1R2UA 4N1GA 5HKYA 1WLZA 5D69A 2K2AA 1NYAA 2KFFA 1KFUS 1ZACA 2KBIA 5FYXA 3DVKA 1H8BA 2L50A 2K7BA 2LCPA 3EVVA 2JULA 3AAKA 1LA0A 2QACA 1Y1UA 1CDLA 1TNQA 2WCEA 3PATA 1B47A 1AJ5A 4XJKB 4YRUA 2COLB 2KQ6A 1IQ5A 1RTP1 4WQ3A 1QX5B 1ALVA 3DVJA 3ZNIA 3PSRA 1WY9A 2KGRA 3EK7A 3TUYC 4PE7A 4QJ5B 1Y1XA 2JTTA 1IJ6A 5AEQA 1NCZA 4Q04A 5DKRA 2NCPA 4YI9A 3E3RA 1CTRA 4GPLB 1Y0VH 4TNCA 1JF2A 3BOWA 3I5FC 1QJTA 1IQ3A 2CCMA 4DS7A 3IQQA 1B7TY 2EHBA 4NDCA 1NUBA 2K2FA 1GGZA 4PHNA 1PRWA 3EVRA 2M0RA 4M2OA 4C0KA 2LMTA 3TDZA 1JFKA 2B1UA 3O78A 3LLEA 2WNDA 3GK1A 2OS8B 1OOJA 2BKHB 2LHIA 2LVIA 4C0LA 1H4BA 3CR4X 1K90D 2KI4B 2DOQA 1QLKA 1B4CA 4FQOA 1BLQA 4PHJA 3WHUB 1YUSA 2BCXA 2LUCA 2MLFC 2VRGA 4AQIA 4CPVA 5JOLA 2MAZA 2KGBC 3AAJA 3ICBA 1QS7A 1RECA 5PALA 3I5HC 2Q91A 1SCMB 2K7CA 1QV1A 1TN4A 3PM8A 4N5XA 4MEWA 3O6BA 1S6JA 1TCOB 1OMVA 3SG2A 1F4QA 3KPXA 3WNXB 3O2PA 3BUOB 1SYMA 1VRKA 1SMGA 1YX8A 2LHLA 1DF0B 1FBVA 4ZCUA 4P5OE 2OTGB 3OX6A 3VGOA 3NSLA 1SL7A 4XYNA 4MVFA 3TDIA 1XK4A 1XVJA 2Q4UA 3DVEA 3O4YA 3SG6A 1GGWA 4QJ3B 4YGCB 2A4JA 2LP3A 1F70A 4PDZA 2BBNA 1CDPA 2K7DA 1QXPA 3BUNB 1LINA 1DJZA 1TOPA 4DRWA 4JWQA 5HLOA 1CM4A 1CMGA 1YR5A 5HKZA 2IS9A 5HLVA 4L9MA 4CFRA 2NZ0A 4HREE 1JBAA 2EGDA 1NX2A 1SR6B 1TTXA 1DTLA 4JQ0D 2HQ8A 1FPWA 2WCFA 5B8IB 2AAOA 1EXRA 4CLNA 1BOCA 4E68A 5K89A 2JC2A 2CT9A 2LANA 3LCPC 1XK4C 5AERA 2HPSA 3EK8A 3VRNA 1EJ3A 1AUIB 1OQPA 1TNWA 1K94A 4GGFC 1XFUO 2M1UA 3IF7A 1MUXA 1G33A 2ZRTA 3DF0B 3OX5A 4ICBA 5KTYA 3FIAA 2L0PA 2M1KB 3AKAA 3WHTB 1M31A 3F45A 5I2LA 4N1FA 1YURA 2D8NA 2PASA 1CFCA 4PCWA 3EK4A 5CSFA 4F0ZB 3IQOA 1ZMZA 1S5GZ 4MZJA 3BUWB 2JQ6A 4UPGA 2F3ZA 3GK4X 1IKUA 2I18A 4WRIA 3JVTB 5G08A 1R6PA 3PN7B 1KSMA 1CB1A 3BXKA 2G9BA 2O60A 2M29A 2KYCA 2FOTA 2FJUB 3BUXB 3D0YA 1L2OB 2ZRSA 1CDNA 1EG3A 3SG5A 3A4UB 3I5IB 1A4PA 2JNFA 2F2PA 3OP0A 1J1EA 1YRUB 5I8NA 1CFPA 1J55A 1A2XA 3FS7A 4YGBB 4MBEA 1OZOA 1PSBA 3LK1A 1KFXL 5J3XA 1SNLA 1JWDA 1PK0D 1G8IA 1ZUZA 4A4CA 4I5LB 3JTDB 2M49B 2ZNEA 2I2RE 1A03A 2GGZA 2F2OA 2JPTA 2ZN9A 5KU1A 1GQMA 2CBLA 2HQWA 2MA2A 3CZTX 2OS8C 5ER5A 5F6TA 4MSPA 1V1FA 2JNXA 1S1EA 2LVVA 1PSRA 2KI4C 2TN4A 1DGUA 1BF5A 2JWWA 1NCYA 3GOFA 1W7JB 1XFYO 3TS5B 2WCBA 1AK8A 1BMOA 2NXQA 1KFUL 1UHNA 1AVSA 2WC8A 5DKQA 1A29A 1B9AA 3PALA 4D1EA 1S6CA 1SCMC 4DCKA 1NIWA 1A75A 2ZN8A 1IG5A 1IRJA 3FWCA 4OVNF 4I5KA 1XFVO 3SIBA 1S36A 1MF8B 2BBMA 3NSIA 1J7PA 4MRYA 2KI6C 3PLFB 1QLSA 3SG3A 1Y6WA 5D7FA 1DJWA 1SY9A 2OTGC 1WRKA 3CS1A 4HRGA 4OV2A 1DGVA 1MXEA 3DD4A 5CSIA 5GQQC 2QPTA 1GJYA 1SL8A 1JUOA 2JZIA 2ZFDA 1CMFA 4ORBB 3HX4A 4ORCB 2MJWB 3DF0A 3NSKA 1DVIA 1S5GY 3LL8B 4YGEB 2MLEC 5ER4X 2F8PA 1SBJA 1B8CA 2P6BB 4AQJA 1RK9A 3DVMA 1MHOA 2MBXA 1UWOA 4NQGA 2EC6B 1YTZC 1BG1A 2L2EA 2FCEA 2LP2A 2MRDA 1SR6C 2KI6D 1BJFA 1BR4B 1SPYA 2KHNA 1OZSA 1DJIA 4GGFA 1NX0A 1OE9B 1V1GA 4OR9B 2KBMA 4NDDA 4PE4A 2Y5IA 4YI8A 4WQ2A 1MXLC 3CGAA 1ALWA 1G4YR 2O5GA 1F4OA 2LVJA 3A8RA 1U5IB 3I5GB 5CSNA 1EG4A 1MR8A 1K8UA 1XA5A 2L4HA 4PALA 1K95A 1KK7Z 4XJKA 4OCIA 1DT7B 1UUSA 2G2BA 1JC2A 1IGVA 1UHKA 5AXIA 4HRHA 5AFPA 3EVUA 3VRPA 2JT3A 1RROA 2LLTA 4ORAB 1WRLA 1M45A 1QIVA 2GV5A 1CLLA 3EKHA 1ODBA 2KNEA 2LAPA 2LC5A 1AHRA 4P2YB 2LLUA 1B7TZ 1CLMA 1CM1A 2JRFA 2JTZA 1RWYA 2JU0A 3JVTC 1IJ5A 1DJGA 1XFZO 2KOTA 2SCPA 1S3PA 3PN7C 3BQ3A 5DKNA 4QJ4B 1RFJA 1HT9A 1QIWA 3NSOA 1L2OC 3MSEB 2PMYA 2CXJA 2CNPA 1KWOB 3I5IC 4BY4A 1SKTA 2KQYA 1L7ZA 1DJHA 1WDCB 2LV7A 1CKKA 1BODA 2V53A 1SRAA 2H61C 3H4SE 1JF0A 2M9GA 1XYDA 1JSAA 1KCYA 4YGDB 4IL1A 2LMUA 1NX1A 1TRFA 1K96A 2Y1NA 1C7WA 1UURA 2F33A 2I94A 3JTDC 4C0JA 2BE4A 1RJVA 2H2KA 2M3WA 1J7QA 1CLBA 3KHEA 1N65A 2K7OA 2L4IA 5HKWA 2KFHA 4OKHA 1F8HA 1OSAA 1K9PA 1UHJA 4GFTA 1S26D 4GGNA 3EKJA 1ZOTB 5CSJA 5I2OA 3K21A 1QVIZ 2JT0A 1WRZA 3TS5C 2PSRA 2Y1MA 1YX7A 4PE1A 1X02A 3VRRA 2AMIA 3KEVA 2BL0B 3KF9A 5I2QA 1KQVA 1TNXA 2WORA 1CDMA 1FI5A 1CFDA 1KK8B 1SL9A 1DF0A 1QTXA 2GGMA 1NSHA 2WOSA 1QX7A 1KQMB 1PALA 1B8LA 1QV0A 5KSZA 3RLZA 4DIRA 4USLA 1AP4A 1C07A 1OMRA 2SASA 3OB1B 3GK2A 3AKBA 2JXCA 1SK6D 1EH2A 1KK7Y 1ZFSA 2KAYA 3RM1A 3SJSA 4GAOA 1BR1B 3BUMB 1IWQA 1PVAA 2I7AA 2KAVA 3C1VA 2AUCA 4NDBA 3SG4A 1LA3A 2LLSA 1U5IA 1YUUA 1NX3A 1YRTB 2LUXA 3CTNA 2KFGA 4I5NB 4YGAA 3VRQA 3CR2A 1D1OA 1J7OA 1TCFA 4FTGA 1PULA 1DJXA 4PHKA 4PHMA 2FCDA 4ETOA 3TUYB 2KSPA 1K93D 1LXFC 1FW4A 1S6IA 3CLNA 4GNKB 1YVLA 1CNPA 2EC6C 1MWNA 5TNCA 4AOMA 5BPJA 5JJGA 4M2QA 5AANA 4GUKA 2CTNA 3I5FB 2PVBA 2L98A 1XFXO 3D0YB 2LM5A 1NCXA 2F3YA 4MLWA 3ZWHA 1J7RA 1W7IB 2HF5A 2NCOA 4MZKA 2KDHA 2OPOA 4U8DA 1FI6A 2M7NA 1K9UA 3I5GC 1KSOA 1TIZA 2M8UA 1YUTA 2E30A 1M46A 2PRUA 1B1GA 1PVBA 2LVKA 2BECA 1QASA 4CFQA 1SW8A 2ZNDA 5HYDA 3SIAA 1F54A 1LVCD 2Y4QA 2K0JA 2BKIB 1E8AA 1J1DA 1WLMA 1LKJA 3CR5X 3I5HB 3BOWB 3VROA 2PALA 1QVIY 2H61A 3BYAA 1Y1AA 1JFJA 3PFVA 2KAXA 2M7LA 3M0WA 1AJ4A 4MN0A 4R1EA 1KWOC 1FF1A 2K61A 1WDCC 2ISDA 4A4BA 1F55A 2K8MB 2E6WA 4DUQA 1A75B 2RGIA 2JOJA 1SCVA 1BT6A 1IH0A 1UHHA 4JPZB 3WXAA 1YVHA 3HCMA 1M39A 1NP8A 4MRXA 1UP5A 4M2PA 2R2IA 3D10A 1BU3A 2L51A 3FWBA 2M97A 2NLNA 2HETA 2L5XB 5IBWA 2BCAA 2JXLA 1QX2A 4PE0A 1DJYA 3OHMB 1M63B 1OMDA 2LE9B 2LMVA 2JT8A 1UHIA 3QRXA 1KFXS 4BY5A 3TZ1A 1N2DA 3LK0A 1F71A 1DMOA 1B8RA 1MQ1A 2KYFA 1NPQA 2LNKA 1TNPA 4YBHB
chains in the Genus database with same CATH superfamily
1QATA 3NXAA 4I5JA 4CIDA 2MHHA 2BE6A 1NWDA 2BL0C 1XFWO 4HSZA 1K2HA 2WC6A 2L5YA 2BCBA 2GTEA 1C7VA 1KK8C 1Q80A 3OB2B 4ZCVA 3PJIA 4MZLA 5CPVA 2ZKMX 1K9KA 3SG7A 1N0YA 3B7AA 3TDUA 1CFFA 1XO5A 1KQMC 2PQLA 3CWGA 3Q8IA 4GBAA 1HQVA 3KO0A 3BFHA 1EL4A 1R2UA 4N1GA 5HKYA 1WLZA 5D69A 2K2AA 1NYAA 2KFFA 1KFUS 1ZACA 2KBIA 5FYXA 3DVKA 1H8BA 2L50A 2K7BA 2LCPA 3EVVA 2JULA 3AAKA 1LA0A 2QACA 1Y1UA 1CDLA 1TNQA 2WCEA 1OOFA 3PATA 1B47A 1AJ5A 4XJKB 4YRUA 2COLB 2KQ6A 1IQ5A 1RTP1 4WQ3A 1QX5B 1ALVA 3CYZA 3DVJA 3ZNIA 3PSRA 1WY9A 2KGRA 3EK7A 3TUYC 1LS8A 4PE7A 4QJ5B 1Y1XA 2JTTA 3B86A 1IJ6A 5AEQA 1NCZA 4Q04A 5DKRA 2NCPA 4YI9A 3E3RA 1CTRA 4GPLB 3CABA 1Y0VH 1GM0A 4TNCA 1C3ZA 1JF2A 3BOWA 3I5FC 1QJTA 1QWVA 1IQ3A 2CCMA 4DS7A 3IQQA 1T14A 1B7TY 2EHBA 2BNXA 1NUBA 4NDCA 2K2FA 3K1EA 1GGZA 4PHNA 1PRWA 3EVRA 2M0RA 4M2OA 4C0KA 2LMTA 3TDZA 1JFKA 2KPHA 2B1UA 3O78A 3LLEA 2WNDA 3GK1A 5HL1A 2OS8B 1OOJA 2BKHB 2LHIA 2LVIA 4C0LA 1H4BA 3CR4X 1K90D 2KI4B 2DOQA 3NGVA 1QLKA 1B4CA 4FQOA 1BLQA 4PHJA 3WHUB 1YUSA 2BCXA 2LUCA 2MLFC 2VRGA 2WCHA 4AQIA 4CPVA 5JOLA 2MAZA 2KGBC 3AAJA 4IJ7A 3ICBA 1QS7A 1RECA 5PALA 3I5HC 2Q91A 1SCMB 2K7CA 1QV1A 1TN4A 3PM8A 4N5XA 1DC1A 4MEWA 3O6BA 1S6JA 3L4AA 1TCOB 1OMVA 3SG2A 2BAPA 3SS4A 2WCKA 1F4QA 3N7HA 3D76A 3KPXA 3WNXB 3O2PA 2QEVA 3BUOB 1SYMA 1VRKA 1SMGA 1YX8A 2LHLA 3B88A 1DF0B 1FBVA 4ZCUA 4P5OE 2OTGB 3OX6A 3VGOA 3NSLA 1SL7A 4XYNA 3O4XA 4MVFA 1XK4A 3TDIA 1XVJA 3PM2A 2Q4UA 3DVEA 3O4YA 3SG6A 1GGWA 4QJ3B 4YGCB 2A4JA 2LP3A 1F70A 4PDZA 2BBNA 3BFBA 3CZ2A 1CDPA 3R72A 2K7DA 1QXPA 3BUNB 1LINA 1DJZA 1TOPA 4DRWA 4JWQA 5HLOA 1CM4A 1CMGA 1YR5A 5HKZA 2IS9A 5HLVA 4L9MA 3FE9A 4CFRA 2NZ0A 4HREE 2FJYA 2WCLA 1JBAA 1DELA 1Z2CB 2EGDA 1OOIX 1NX2A 1SR6B 1TTXA 1DTLA 4JQ0D 2HQ8A 1FPWA 2WCFA 5B8IB 2AAOA 1EXRA 4CLNA 1BOCA 4E68A 5K89A 2JC2A 2CT9A 2LANA 3DYEA 3LCPC 1XK4C 5AERA 3NHTA 1OOHA 2HPSA 3EK8A 3B87A 3VRNA 1EJ3A 3D78A 1AUIB 1OQPA 1TNWA 1K94A 4GGFC 1XFUO 2M1UA 3IF7A 1MUXA 1G33A 2ZRTA 3DF0B 3OX5A 4ICBA 5KTYA 3R1PA 3FIAA 2L0PA 2M1KB 3AKAA 3WHTB 1M31A 3F45A 5I2LA 4N1FA 1YURA 2D8NA 2PASA 1CFCA 4PCWA 3EK4A 5CSFA 4F0ZB 3IQOA 1ZMZA 1S5GZ 4MZJA 3BUWB 2JQ6A 4UPGA 2F3ZA 3GK4X 1IKUA 2I18A 4WRIA 3JVTB 5G08A 1R6PA 3PN7B 1KSMA 1CB1A 3BXKA 2G9BA 2O60A 2M29A 2KYCA 2FOTA 2FJUB 3BUXB 3D0YA 1L2OB 2L2CA 2ZRSA 1CDNA 1EG3A 3DZTA 3SG5A 3A4UB 3I5IB 1A4PA 2JNFA 2F2PA 3OP0A 1J1EA 1YRUB 5I8NA 1CFPA 1J55A 1A2XA 3FS7A 4YGBB 4MBEA 1OZOA 1PSBA 3LK1A 1KFXL 5J3XA 1SNLA 1JWDA 1PK0D 1G8IA 1ZUZA 4PT1A 4A4CA 4I5LB 3JTDB 3SS5A 2M49B 2ZNEA 2I2RE 1A03A 2GGZA 2F2OA 2JPTA 2ZN9A 5KU1A 1GQMA 2CBLA 2HQWA 2MA2A 3CZTX 2OS8C 4KYNA 5ER5A 5F6TA 4MSPA 1V1FA 2JNXA 1S1EA 2LVVA 1PSRA 2KI4C 2TN4A 1DGUA 1BF5A 2JWWA 1NCYA 3GOFA 1W7JB 1XFYO 3TS5B 2WCBA 1AK8A 1BMOA 2NXQA 1KFUL 1UHNA 2QDIA 1AVSA 2WC8A 5DKQA 1A29A 1B9AA 3PALA 4D1EA 1S6CA 1SCMC 4DCKA 1NIWA 1A75A 2ZN8A 1IG5A 1IRJA 3FWCA 2KLDA 4OVNF 4I5KA 1XFVO 3SIBA 1S36A 1MF8B 2BBMA 3NSIA 1J7PA 1W9ZA 4MRYA 2KI6C 3PLFB 1QLSA 3SG3A 1Y6WA 5D7FA 1OW4A 1DJWA 1SY9A 2OTGC 1WRKA 3CS1A 4HRGA 4OV2A 1DGVA 1MXEA 3DD4A 5CSIA 5GQQC 3DY9A 2QPTA 2WCMA 1GJYA 3S0BA 1SL8A 3RZSA 1JUOA 2JZIA 2ZFDA 1CMFA 3R1VA 4ORBB 4INWA 3HX4A 4ORCB 2MJWB 4JKTA 1TUZA 3DF0A 3NSKA 3OBVA 1DVIA 3FE8A 1S5GY 3LL8B 4YGEB 2MLEC 5ER4X 3S0AA 2F8PA 1ORGA 1B8CA 1SBJA 2P6BB 4AQJA 1RK9A 3DVMA 1OOGA 1MHOA 1XFRA 2MBXA 1UWOA 4NQGA 2EC6B 1YTZC 1BG1A 2L2EA 2FCEA 2LP2A 2MRDA 1SR6C 2KI6D 3S0GA 1BJFA 1BR4B 1SPYA 2P71A 5D3OA 2KHNA 1OZSA 3BFAA 1DJIA 4GGFA 1NX0A 1OE9B 1V1GA 2WC5A 2KBMA 4NDDA 4OR9B 2Y5IA 4PE4A 4YI8A 4WQ2A 1MXLC 3CGAA 1ALWA 1G4YR 2ERBA 2O5GA 1F4OA 2WCJA 2LVJA 3A8RA 1U5IB 3I5GB 5CSNA 1EG4A 1MR8A 3DXLA 1K8UA 1XA5A 2L4HA 4PALA 1K95A 1KK7Z 4XJKA 4OCIA 3L4LA 1DT7B 1UUSA 2G2BA 1JC2A 1IGVA 1TWOA 1Z4HA 1UHKA 5AXIA 4HRHA 5AFPA 3EVUA 3UNWA 2JT3A 3VRPA 1RROA 2LLTA 4FQTA 4ORAB 1WRLA 1M45A 1QIVA 2GV5A 1CLLA 3EKHA 1ODBA 2KNEA 2LAPA 2LC5A 1AHRA 4P2YB 2LLUA 1B7TZ 1CLMA 1CM1A 2JRFA 2JTZA 1RWYA 2JU0A 3JVTC 1IJ5A 1DJGA 1XFZO 2KOTA 2SCPA 1S3PA 3OGNA 3BQ3A 3PN7C 5DKNA 4QJ4B 1RFJA 1HT9A 1QIWA 3NSOA 1L2OC 3MSEB 2PMYA 2CXJA 1KWOB 2CNPA 3I5IC 4BY4A 5FI6A 1SKTA 2KQYA 1L7ZA 1DJHA 1WDCB 2LV7A 1CKKA 5EL2A 1BODA 2V53A 1SRAA 2H61C 3H4SE 1JF0A 2M9GA 1XYDA 1JSAA 1KCYA 4YGDB 4IL1A 2LMUA 1DQEA 1NX1A 1TRFA 1K96A 3S0EA 2Y1NA 1C7WA 1UURA 2F33A 2I94A 3JTDC 4C0JA 2BE4A 1RJVA 2H2KA 2M3WA 1J7QA 1CLBA 3KHEA 1N65A 2K7OA 2L4IA 5HKWA 2KFHA 4OKHA 5I94A 3CZ0A 1F8HA 1OSAA 1K9PA 1UHJA 4GFTA 2QEOA 1S26D 2KLEA 3EKJA 3D75A 4GGNA 1ZOTB 5CSJA 5I2OA 3SS3A 3K21A 1QVIZ 2JT0A 1WRZA 3TS5C 2PSRA 2Y1MA 1YX7A 4PE1A 1X02A 3VRRA 2AMIA 3KEVA 2BL0B 3KF9A 5I2QA 1KQVA 1TNXA 2WORA 4OZDA 1CDMA 1FI5A 1CFDA 1KK8B 1SL9A 1DF0A 1QTXA 2GGMA 1NSHA 1TUJA 3FE6A 5FI2A 2WOSA 1QX7A 1KQMB 1PALA 1B8LA 1QV0A 5KSZA 3RLZA 4DIRA 4USLA 1AP4A 1C07A 1OMRA 2SASA 3OB1B 3GK2A 3AKBA 2JXCA 3CDNA 1SK6D 1EH2A 1KK7Y 1ZFSA 2KAYA 3RM1A 3SJSA 4GAOA 1BR1B 3BUMB 1IWQA 1PVAA 2I7AA 2KAVA 2P70A 2AUCA 3C1VA 4NDBA 3SG4A 1LA3A 2LLSA 5DICA 1U5IA 1YUUA 1NX3A 1YRTB 2LUXA 3CTNA 2KFGA 4I5NB 4JD9A 4YGAA 3VRQA 3CR2A 1D1OA 3V2LA 1J7OA 2K60A 1TCFA 4FTGA 1PULA 1DJXA 4PHKA 4PHMA 2FCDA 4ETOA 3TUYB 2KSPA 4F7FA 2JPOA 1K93D 1LXFC 1FW4A 1S6IA 3CLNA 4GNKB 1YVLA 3NHIA 1CNPA 2EC6C 1MWNA 5TNCA 4AOMA 5BPJA 3L47A 5JJGA 4M2QA 5AANA 4GUKA 2CTNA 3I5FB 2PVBA 2L98A 3S0FA 1XFXO 3D0YB 3EG5B 2LM5A 1NCXA 2F3YA 4MLWA 3ZWHA 1J7RA 1W7IB 2HF5A 2NCOA 4MZKA 2KDHA 2OPOA 4U8DA 1FI6A 2M7NA 3R1OA 1K9UA 3I5GC 1IIOA 3CZ1A 1KSOA 1TIZA 2M8UA 1YUTA 2E30A 1M46A 2PRUA 1B1GA 1PVBA 2LVKA 3UO9A 2BECA 1QASA 1C3YA 2H8VA 4CFQA 1SW8A 2ZNDA 1SSEB 5HYDA 3SIAA 1F54A 1LVCD 2Y4QA 2K0JA 2BKIB 1E8AA 1J1DA 1WLMA 1LKJA 3CR5X 3I5HB 3BOWB 3VROA 2PALA 1QVIY 2QEBA 2H61A 3BYAA 1Y1AA 1JFJA 3PFVA 2KAXA 2M7LA 3M0WA 3VB1A 1AJ4A 4MN0A 4R1EA 5FI7A 1KWOC 1FF1A 2K61A 1WDCC 2ISDA 3D73A 3QMEA 4A4BA 1F55A 2K8MB 2E6WA 4DUQA 1A75B 2RGIA 1P28A 2YGUA 2JOJA 1SCVA 1BT6A 3D77A 1DEKA 1IH0A 1UHHA 4JPZB 3WXAA 1YVHA 3HCMA 1M39A 1NP8A 4MRXA 1UP5A 4M2PA 2R2IA 3D10A 1BU3A 2L51A 3BJHA 2M97A 2NLNA 3FWBA 2HETA 2L5XB 5IBWA 2BCAA 2QEHA 2JXLA 1QX2A 4PE0A 3B6XA 1DJYA 3OHMB 1M63B 1OMDA 2LE9B 2LMVA 2JT8A 1UHIA 3QRXA 1KFXS 4BY5A 3TZ1A 1N2DA 3LK0A 4INXA 1DMOA 1B8RA 3IVTA 3D74A 1F71A 1MQ1A 2KYFA 3S0DA 1NPQA 2PYQA 2LNKA 1TNPA 4YBHB
chains in the Genus database with same CATH topology
1QATA 3NXAA 4I5JA 4CIDA 2MHHA 2BE6A 1NWDA 2BL0C 1XFWO 4HSZA 1K2HA 2BCBA 1C7VA 1KK8C 1Q80A 3OB2B 4ZCVA 4MZLA 5CPVA 2ZKMX 1K9KA 3SG7A 1N0YA 3TDUA 1CFFA 1XO5A 1KQMC 3CWGA 4GBAA 1HQVA 3KO0A 1EL4A 1R2UA 4N1GA 5HKYA 1WLZA 5D69A 2K2AA 1NYAA 2KFFA 1KFUS 1ZACA 2KBIA 5FYXA 3DVKA 1H8BA 2L50A 2K7BA 2LCPA 3EVVA 2JULA 3AAKA 1LA0A 2QACA 1Y1UA 1CDLA 1TNQA 2WCEA 3PATA 1B47A 1AJ5A 4XJKB 4YRUA 2COLB 2KQ6A 1IQ5A 1RTP1 4WQ3A 1QX5B 1ALVA 3DVJA 3ZNIA 3PSRA 1WY9A 2KGRA 3EK7A 3TUYC 4PE7A 4QJ5B 1Y1XA 2JTTA 1IJ6A 5AEQA 1NCZA 4Q04A 5DKRA 2NCPA 4YI9A 3E3RA 1CTRA 4GPLB 1Y0VH 4TNCA 1JF2A 3BOWA 3I5FC 1QJTA 1IQ3A 2CCMA 4DS7A 3IQQA 1B7TY 2EHBA 4NDCA 1NUBA 2K2FA 1GGZA 4PHNA 1PRWA 3EVRA 2M0RA 4M2OA 4C0KA 2LMTA 3TDZA 1JFKA 2B1UA 3O78A 3LLEA 2WNDA 3GK1A 2OS8B 1OOJA 2BKHB 2LHIA 2LVIA 4C0LA 1H4BA 3CR4X 1K90D 2KI4B 2DOQA 1QLKA 1B4CA 4FQOA 1BLQA 4PHJA 3WHUB 1YUSA 2BCXA 2LUCA 2MLFC 2VRGA 4AQIA 4CPVA 5JOLA 2MAZA 2KGBC 3AAJA 3ICBA 1QS7A 1RECA 5PALA 3I5HC 2Q91A 1SCMB 2K7CA 1QV1A 1TN4A 3PM8A 4N5XA 4MEWA 3O6BA 1S6JA 1TCOB 1OMVA 3SG2A 1F4QA 3KPXA 3WNXB 3O2PA 3BUOB 1SYMA 1VRKA 1SMGA 1YX8A 2LHLA 1DF0B 1FBVA 4ZCUA 4P5OE 2OTGB 3OX6A 3VGOA 3NSLA 1SL7A 4XYNA 4MVFA 3TDIA 1XK4A 1XVJA 2Q4UA 3DVEA 3O4YA 3SG6A 1GGWA 4QJ3B 4YGCB 2A4JA 2LP3A 1F70A 4PDZA 2BBNA 1CDPA 2K7DA 1QXPA 3BUNB 1LINA 1DJZA 1TOPA 4DRWA 4JWQA 5HLOA 1CM4A 1CMGA 1YR5A 5HKZA 2IS9A 5HLVA 4L9MA 4CFRA 2NZ0A 4HREE 1JBAA 2EGDA 1NX2A 1SR6B 1TTXA 1DTLA 4JQ0D 2HQ8A 1FPWA 2WCFA 5B8IB 2AAOA 1EXRA 4CLNA 1BOCA 4E68A 5K89A 2JC2A 2CT9A 2LANA 3LCPC 1XK4C 5AERA 2HPSA 3EK8A 3VRNA 1EJ3A 1AUIB 1OQPA 1TNWA 1K94A 4GGFC 1XFUO 2M1UA 3IF7A 1MUXA 1G33A 2ZRTA 3DF0B 3OX5A 4ICBA 5KTYA 3FIAA 2L0PA 2M1KB 3AKAA 3WHTB 1M31A 3F45A 5I2LA 4N1FA 1YURA 2D8NA 2PASA 1CFCA 4PCWA 3EK4A 5CSFA 4F0ZB 3IQOA 1ZMZA 1S5GZ 4MZJA 3BUWB 2JQ6A 4UPGA 2F3ZA 3GK4X 1IKUA 2I18A 4WRIA 3JVTB 5G08A 1R6PA 3PN7B 1KSMA 1CB1A 3BXKA 2G9BA 2O60A 2M29A 2KYCA 2FOTA 2FJUB 3BUXB 3D0YA 1L2OB 2ZRSA 1CDNA 1EG3A 3SG5A 3A4UB 3I5IB 1A4PA 2JNFA 2F2PA 3OP0A 1J1EA 1YRUB 5I8NA 1CFPA 1J55A 1A2XA 3FS7A 4YGBB 4MBEA 1OZOA 1PSBA 3LK1A 1KFXL 5J3XA 1SNLA 1JWDA 1PK0D 1G8IA 1ZUZA 4A4CA 4I5LB 3JTDB 2M49B 2ZNEA 2I2RE 1A03A 2GGZA 2F2OA 2JPTA 2ZN9A 5KU1A 1GQMA 2CBLA 2HQWA 2MA2A 3CZTX 2OS8C 5ER5A 5F6TA 4MSPA 1V1FA 2JNXA 1S1EA 2LVVA 1PSRA 2KI4C 2TN4A 1DGUA 1BF5A 2JWWA 1NCYA 3GOFA 1W7JB 1XFYO 3TS5B 2WCBA 1AK8A 1BMOA 2NXQA 1KFUL 1UHNA 1AVSA 2WC8A 5DKQA 1A29A 1B9AA 3PALA 4D1EA 1S6CA 1SCMC 4DCKA 1NIWA 1A75A 2ZN8A 1IG5A 1IRJA 3FWCA 4OVNF 4I5KA 1XFVO 3SIBA 1S36A 1MF8B 2BBMA 3NSIA 1J7PA 4MRYA 2KI6C 3PLFB 1QLSA 3SG3A 1Y6WA 5D7FA 1DJWA 1SY9A 2OTGC 1WRKA 3CS1A 4HRGA 4OV2A 1DGVA 1MXEA 3DD4A 5CSIA 5GQQC 2QPTA 1GJYA 1SL8A 1JUOA 2JZIA 2ZFDA 1CMFA 4ORBB 3HX4A 4ORCB 2MJWB 3DF0A 3NSKA 1DVIA 1S5GY 3LL8B 4YGEB 2MLEC 5ER4X 2F8PA 1SBJA 1B8CA 2P6BB 4AQJA 1RK9A 3DVMA 1MHOA 2MBXA 1UWOA 4NQGA 2EC6B 1YTZC 1BG1A 2L2EA 2FCEA 2LP2A 2MRDA 1SR6C 2KI6D 1BJFA 1BR4B 1SPYA 2KHNA 1OZSA 1DJIA 4GGFA 1NX0A 1OE9B 1V1GA 4OR9B 2KBMA 4NDDA 4PE4A 2Y5IA 4YI8A 4WQ2A 1MXLC 3CGAA 1ALWA 1G4YR 2O5GA 1F4OA 2LVJA 3A8RA 1U5IB 3I5GB 5CSNA 1EG4A 1MR8A 1K8UA 1XA5A 2L4HA 4PALA 1K95A 1KK7Z 4XJKA 4OCIA 1DT7B 1UUSA 2G2BA 1JC2A 1IGVA 1UHKA 5AXIA 4HRHA 5AFPA 3EVUA 3VRPA 2JT3A 1RROA 2LLTA 4ORAB 1WRLA 1M45A 1QIVA 2GV5A 1CLLA 3EKHA 1ODBA 2KNEA 2LAPA 2LC5A 1AHRA 4P2YB 2LLUA 1B7TZ 1CLMA 1CM1A 2JRFA 2JTZA 1RWYA 2JU0A 3JVTC 1IJ5A 1DJGA 1XFZO 2KOTA 2SCPA 1S3PA 3PN7C 3BQ3A 5DKNA 4QJ4B 1RFJA 1HT9A 1QIWA 3NSOA 1L2OC 3MSEB 2PMYA 2CXJA 2CNPA 1KWOB 3I5IC 4BY4A 1SKTA 2KQYA 1L7ZA 1DJHA 1WDCB 2LV7A 1CKKA 1BODA 2V53A 1SRAA 2H61C 3H4SE 1JF0A 2M9GA 1XYDA 1JSAA 1KCYA 4YGDB 4IL1A 2LMUA 1NX1A 1TRFA 1K96A 2Y1NA 1C7WA 1UURA 2F33A 2I94A 3JTDC 4C0JA 2BE4A 1RJVA 2H2KA 2M3WA 1J7QA 1CLBA 3KHEA 1N65A 2K7OA 2L4IA 5HKWA 2KFHA 4OKHA 1F8HA 1OSAA 1K9PA 1UHJA 4GFTA 1S26D 4GGNA 3EKJA 1ZOTB 5CSJA 5I2OA 3K21A 1QVIZ 2JT0A 1WRZA 3TS5C 2PSRA 2Y1MA 1YX7A 4PE1A 1X02A 3VRRA 2AMIA 3KEVA 2BL0B 3KF9A 5I2QA 1KQVA 1TNXA 2WORA 1CDMA 1FI5A 1CFDA 1KK8B 1SL9A 1DF0A 1QTXA 2GGMA 1NSHA 2WOSA 1QX7A 1KQMB 1PALA 1B8LA 1QV0A 5KSZA 3RLZA 4DIRA 4USLA 1AP4A 1C07A 1OMRA 2SASA 3OB1B 3GK2A 3AKBA 2JXCA 1SK6D 1EH2A 1KK7Y 1ZFSA 2KAYA 3RM1A 3SJSA 4GAOA 1BR1B 3BUMB 1IWQA 1PVAA 2I7AA 2KAVA 3C1VA 2AUCA 4NDBA 3SG4A 1LA3A 2LLSA 1U5IA 1YUUA 1NX3A 1YRTB 2LUXA 3CTNA 2KFGA 4I5NB 4YGAA 3VRQA 3CR2A 1D1OA 1J7OA 1TCFA 4FTGA 1PULA 1DJXA 4PHKA 4PHMA 2FCDA 4ETOA 3TUYB 2KSPA 1K93D 1LXFC 1FW4A 1S6IA 3CLNA 4GNKB 1YVLA 1CNPA 2EC6C 1MWNA 5TNCA 4AOMA 5BPJA 5JJGA 4M2QA 5AANA 4GUKA 2CTNA 3I5FB 2PVBA 2L98A 1XFXO 3D0YB 2LM5A 1NCXA 2F3YA 4MLWA 3ZWHA 1J7RA 1W7IB 2HF5A 2NCOA 4MZKA 2KDHA 2OPOA 4U8DA 1FI6A 2M7NA 1K9UA 3I5GC 1KSOA 1TIZA 2M8UA 1YUTA 2E30A 1M46A 2PRUA 1B1GA 1PVBA 2LVKA 2BECA 1QASA 4CFQA 1SW8A 2ZNDA 5HYDA 3SIAA 1F54A 1LVCD 2Y4QA 2K0JA 2BKIB 1E8AA 1J1DA 1WLMA 1LKJA 3CR5X 3I5HB 3BOWB 3VROA 2PALA 1QVIY 2H61A 3BYAA 1Y1AA 1JFJA 3PFVA 2KAXA 2M7LA 3M0WA 1AJ4A 4MN0A 4R1EA 1KWOC 1FF1A 2K61A 1WDCC 2ISDA 4A4BA 1F55A 2K8MB 2E6WA 4DUQA 1A75B 2RGIA 2JOJA 1SCVA 1BT6A 1IH0A 1UHHA 4JPZB 3WXAA 1YVHA 3HCMA 1M39A 1NP8A 4MRXA 1UP5A 4M2PA 2R2IA 3D10A 1BU3A 2L51A 3FWBA 2M97A 2NLNA 2HETA 2L5XB 5IBWA 2BCAA 2JXLA 1QX2A 4PE0A 1DJYA 3OHMB 1M63B 1OMDA 2LE9B 2LMVA 2JT8A 1UHIA 3QRXA 1KFXS 4BY5A 3TZ1A 1N2DA 3LK0A 1F71A 1DMOA 1B8RA 1MQ1A 2KYFA 1NPQA 2LNKA 1TNPA 4YBHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QAT A;  3NXA A;  4I5J A;  4CID A;  2MHH A;  2BE6 A;  1NWD A;  2BL0 C;  1XFW O;  4HSZ A;  1K2H A;  2BCB A;  1C7V A;  1KK8 C;  1Q80 A;  3OB2 B;  4ZCV A;  4MZL A;  5CPV A;  2ZKM X;  1K9K A;  3SG7 A;  1N0Y A;  3TDU A;  1CFF A;  1XO5 A;  1KQM C;  3CWG A;  4GBA A;  1HQV A;  3KO0 A;  1EL4 A;  1R2U A;  4N1G A;  5HKY A;  1WLZ A;  5D69 A;  2K2A A;  1NYA A;  2KFF A;  1KFU S;  1ZAC A;  2KBI A;  5FYX A;  3DVK A;  1H8B A;  2L50 A;  2K7B A;  2LCP A;  3EVV A;  2JUL A;  3AAK A;  1LA0 A;  2QAC A;  1Y1U A;  1CDL A;  1TNQ A;  2WCE A;  3PAT A;  1B47 A;  1AJ5 A;  4XJK B;  4YRU A;  2COL B;  2KQ6 A;  1IQ5 A;  1RTP 1;  4WQ3 A;  1QX5 B;  1ALV A;  3DVJ A;  3ZNI A;  3PSR A;  1WY9 A;  2KGR A;  3EK7 A;  3TUY C;  4PE7 A;  4QJ5 B;  1Y1X A;  2JTT A;  1IJ6 A;  5AEQ A;  1NCZ A;  4Q04 A;  5DKR A;  2NCP A;  4YI9 A;  3E3R A;  1CTR A;  4GPL B;  1Y0V H;  4TNC A;  1JF2 A;  3BOW A;  3I5F C;  1QJT A;  1IQ3 A;  2CCM A;  4DS7 A;  3IQQ A;  1B7T Y;  2EHB A;  4NDC A;  1NUB A;  2K2F A;  1GGZ A;  4PHN A;  1PRW A;  3EVR A;  2M0R A;  4M2O A;  4C0K A;  2LMT A;  3TDZ A;  1JFK A;  2B1U A;  3O78 A;  3LLE A;  2WND A;  3GK1 A;  2OS8 B;  1OOJ A;  2BKH B;  2LHI A;  2LVI A;  4C0L A;  1H4B A;  3CR4 X;  1K90 D;  2KI4 B;  2DOQ A;  1QLK A;  1B4C A;  4FQO A;  1BLQ A;  4PHJ A;  3WHU B;  1YUS A;  2BCX A;  2LUC A;  2MLF C;  2VRG A;  4AQI A;  4CPV A;  5JOL A;  2MAZ A;  2KGB C;  3AAJ A;  3ICB A;  1QS7 A;  1REC A;  5PAL A;  3I5H C;  2Q91 A;  1SCM B;  2K7C A;  1QV1 A;  1TN4 A;  3PM8 A;  4N5X A;  4MEW A;  3O6B A;  1S6J A;  1TCO B;  1OMV A;  3SG2 A;  1F4Q A;  3KPX A;  3WNX B;  3O2P A;  3BUO B;  1SYM A;  1VRK A;  1SMG A;  1YX8 A;  2LHL A;  1DF0 B;  1FBV A;  4ZCU A;  4P5O E;  2OTG B;  3OX6 A;  3VGO A;  3NSL A;  1SL7 A;  4XYN A;  4MVF A;  3TDI A;  1XK4 A;  1XVJ A;  2Q4U A;  3DVE A;  3O4Y A;  3SG6 A;  1GGW A;  4QJ3 B;  4YGC B;  2A4J A;  2LP3 A;  1F70 A;  4PDZ A;  2BBN A;  1CDP A;  2K7D A;  1QXP A;  3BUN B;  1LIN A;  1DJZ A;  1TOP A;  4DRW A;  4JWQ A;  5HLO A;  1CM4 A;  1CMG A;  1YR5 A;  5HKZ A;  2IS9 A;  5HLV A;  4L9M A;  4CFR A;  2NZ0 A;  4HRE E;  1JBA A;  2EGD A;  1NX2 A;  1SR6 B;  1TTX A;  1DTL A;  4JQ0 D;  2HQ8 A;  1FPW A;  2WCF A;  5B8I B;  2AAO A;  1EXR A;  4CLN A;  1BOC A;  4E68 A;  5K89 A;  2JC2 A;  2CT9 A;  2LAN A;  3LCP C;  1XK4 C;  5AER A;  2HPS A;  3EK8 A;  3VRN A;  1EJ3 A;  1AUI B;  1OQP A;  1TNW A;  1K94 A;  4GGF C;  1XFU O;  2M1U A;  3IF7 A;  1MUX A;  1G33 A;  2ZRT A;  3DF0 B;  3OX5 A;  4ICB A;  5KTY A;  3FIA A;  2L0P A;  2M1K B;  3AKA A;  3WHT B;  1M31 A;  3F45 A;  5I2L A;  4N1F A;  1YUR A;  2D8N A;  2PAS A;  1CFC A;  4PCW A;  3EK4 A;  5CSF A;  4F0Z B;  3IQO A;  1ZMZ A;  1S5G Z;  4MZJ A;  3BUW B;  2JQ6 A;  4UPG A;  2F3Z A;  3GK4 X;  1IKU A;  2I18 A;  4WRI A;  3JVT B;  5G08 A;  1R6P A;  3PN7 B;  1KSM A;  1CB1 A;  3BXK A;  2G9B A;  2O60 A;  2M29 A;  2KYC A;  2FOT A;  2FJU B;  3BUX B;  3D0Y A;  1L2O B;  2ZRS A;  1CDN A;  1EG3 A;  3SG5 A;  3A4U B;  3I5I B;  1A4P A;  2JNF A;  2F2P A;  3OP0 A;  1J1E A;  1YRU B;  5I8N A;  1CFP A;  1J55 A;  1A2X A;  3FS7 A;  4YGB B;  4MBE A;  1OZO A;  1PSB A;  3LK1 A;  1KFX L;  5J3X A;  1SNL A;  1JWD A;  1PK0 D;  1G8I A;  1ZUZ A;  4A4C A;  4I5L B;  3JTD B;  2M49 B;  2ZNE A;  2I2R E;  1A03 A;  2GGZ A;  2F2O A;  2JPT A;  2ZN9 A;  5KU1 A;  1GQM A;  2CBL A;  2HQW A;  2MA2 A;  3CZT X;  2OS8 C;  5ER5 A;  5F6T A;  4MSP A;  1V1F A;  2JNX A;  1S1E A;  2LVV A;  1PSR A;  2KI4 C;  2TN4 A;  1DGU A;  1BF5 A;  2JWW A;  1NCY A;  3GOF A;  1W7J B;  1XFY O;  3TS5 B;  2WCB A;  1AK8 A;  1BMO A;  2NXQ A;  1KFU L;  1UHN A;  1AVS A;  2WC8 A;  5DKQ A;  1A29 A;  1B9A A;  3PAL A;  4D1E A;  1S6C A;  1SCM C;  4DCK A;  1NIW A;  1A75 A;  2ZN8 A;  1IG5 A;  1IRJ A;  3FWC A;  4OVN F;  4I5K A;  1XFV O;  3SIB A;  1S36 A;  1MF8 B;  2BBM A;  3NSI A;  1J7P A;  4MRY A;  2KI6 C;  3PLF B;  1QLS A;  3SG3 A;  1Y6W A;  5D7F A;  1DJW A;  1SY9 A;  2OTG C;  1WRK A;  3CS1 A;  4HRG A;  4OV2 A;  1DGV A;  1MXE A;  3DD4 A;  5CSI A;  5GQQ C;  2QPT A;  1GJY A;  1SL8 A;  1JUO A;  2JZI A;  2ZFD A;  1CMF A;  4ORB B;  3HX4 A;  4ORC B;  2MJW B;  3DF0 A;  3NSK A;  1DVI A;  1S5G Y;  3LL8 B;  4YGE B;  2MLE C;  5ER4 X;  2F8P A;  1SBJ A;  1B8C A;  2P6B B;  4AQJ A;  1RK9 A;  3DVM A;  1MHO A;  2MBX A;  1UWO A;  4NQG A;  2EC6 B;  1YTZ C;  1BG1 A;  2L2E A;  2FCE A;  2LP2 A;  2MRD A;  1SR6 C;  2KI6 D;  1BJF A;  1BR4 B;  1SPY A;  2KHN A;  1OZS A;  1DJI A;  4GGF A;  1NX0 A;  1OE9 B;  1V1G A;  4OR9 B;  2KBM A;  4NDD A;  4PE4 A;  2Y5I A;  4YI8 A;  4WQ2 A;  1MXL C;  3CGA A;  1ALW A;  1G4Y R;  2O5G A;  1F4O A;  2LVJ A;  3A8R A;  1U5I B;  3I5G B;  5CSN A;  1EG4 A;  1MR8 A;  1K8U A;  1XA5 A;  2L4H A;  4PAL A;  1K95 A;  1KK7 Z;  4XJK A;  4OCI A;  1DT7 B;  1UUS A;  2G2B A;  1JC2 A;  1IGV A;  1UHK A;  5AXI A;  4HRH A;  5AFP A;  3EVU A;  3VRP A;  2JT3 A;  1RRO A;  2LLT A;  4ORA B;  1WRL A;  1M45 A;  1QIV A;  2GV5 A;  1CLL A;  3EKH A;  1ODB A;  2KNE A;  2LAP A;  2LC5 A;  1AHR A;  4P2Y B;  2LLU A;  1B7T Z;  1CLM A;  1CM1 A;  2JRF A;  2JTZ A;  1RWY A;  2JU0 A;  3JVT C;  1IJ5 A;  1DJG A;  1XFZ O;  2KOT A;  2SCP A;  1S3P A;  3PN7 C;  3BQ3 A;  5DKN A;  4QJ4 B;  1RFJ A;  1HT9 A;  1QIW A;  3NSO A;  1L2O C;  3MSE B;  2PMY A;  2CXJ A;  2CNP A;  1KWO B;  3I5I C;  4BY4 A;  1SKT A;  2KQY A;  1L7Z A;  1DJH A;  1WDC B;  2LV7 A;  1CKK A;  1BOD A;  2V53 A;  1SRA A;  2H61 C;  3H4S E;  1JF0 A;  2M9G A;  1XYD A;  1JSA A;  1KCY A;  4YGD B;  4IL1 A;  2LMU A;  1NX1 A;  1TRF A;  1K96 A;  2Y1N A;  1C7W A;  1UUR A;  2F33 A;  2I94 A;  3JTD C;  4C0J A;  2BE4 A;  1RJV A;  2H2K A;  2M3W A;  1J7Q A;  1CLB A;  3KHE A;  1N65 A;  2K7O A;  2L4I A;  5HKW A;  2KFH A;  4OKH A;  1F8H A;  1OSA A;  1K9P A;  1UHJ A;  4GFT A;  1S26 D;  4GGN A;  3EKJ A;  1ZOT B;  5CSJ A;  5I2O A;  3K21 A;  1QVI Z;  2JT0 A;  1WRZ A;  3TS5 C;  2PSR A;  2Y1M A;  1YX7 A;  4PE1 A;  1X02 A;  3VRR A;  2AMI A;  3KEV A;  2BL0 B;  3KF9 A;  5I2Q A;  1KQV A;  1TNX A;  2WOR A;  1CDM A;  1FI5 A;  1CFD A;  1KK8 B;  1SL9 A;  1DF0 A;  1QTX A;  2GGM A;  1NSH A;  2WOS A;  1QX7 A;  1KQM B;  1PAL A;  1B8L A;  1QV0 A;  5KSZ A;  3RLZ A;  4DIR A;  4USL A;  1AP4 A;  1C07 A;  1OMR A;  2SAS A;  3OB1 B;  3GK2 A;  3AKB A;  2JXC A;  1SK6 D;  1EH2 A;  1KK7 Y;  1ZFS A;  2KAY A;  3RM1 A;  3SJS A;  4GAO A;  1BR1 B;  3BUM B;  1IWQ A;  1PVA A;  2I7A A;  2KAV A;  3C1V A;  2AUC A;  4NDB A;  3SG4 A;  1LA3 A;  2LLS A;  1U5I A;  1YUU A;  1NX3 A;  1YRT B;  2LUX A;  3CTN A;  2KFG A;  4I5N B;  4YGA A;  3VRQ A;  3CR2 A;  1D1O A;  1J7O A;  1TCF A;  4FTG A;  1PUL A;  1DJX A;  4PHK A;  4PHM A;  2FCD A;  4ETO A;  3TUY B;  2KSP A;  1K93 D;  1LXF C;  1FW4 A;  1S6I A;  3CLN A;  4GNK B;  1YVL A;  1CNP A;  2EC6 C;  1MWN A;  5TNC A;  4AOM A;  5BPJ A;  5JJG A;  4M2Q A;  5AAN A;  4GUK A;  2CTN A;  3I5F B;  2PVB A;  2L98 A;  1XFX O;  3D0Y B;  2LM5 A;  1NCX A;  2F3Y A;  4MLW A;  3ZWH A;  1J7R A;  1W7I B;  2HF5 A;  2NCO A;  4MZK A;  2KDH A;  2OPO A;  4U8D A;  1FI6 A;  2M7N A;  1K9U A;  3I5G C;  1KSO A;  1TIZ A;  2M8U A;  1YUT A;  2E30 A;  1M46 A;  2PRU A;  1B1G A;  1PVB A;  2LVK A;  2BEC A;  1QAS A;  4CFQ A;  1SW8 A;  2ZND A;  5HYD A;  3SIA A;  1F54 A;  1LVC D;  2Y4Q A;  2K0J A;  2BKI B;  1E8A A;  1J1D A;  1WLM A;  1LKJ A;  3CR5 X;  3I5H B;  3BOW B;  3VRO A;  2PAL A;  1QVI Y;  2H61 A;  3BYA A;  1Y1A A;  1JFJ A;  3PFV A;  2KAX A;  2M7L A;  3M0W A;  1AJ4 A;  4MN0 A;  4R1E A;  1KWO C;  1FF1 A;  2K61 A;  1WDC C;  2ISD A;  4A4B A;  1F55 A;  2K8M B;  2E6W A;  4DUQ A;  1A75 B;  2RGI A;  2JOJ A;  1SCV A;  1BT6 A;  1IH0 A;  1UHH A;  4JPZ B;  3WXA A;  1YVH A;  3HCM A;  1M39 A;  1NP8 A;  4MRX A;  1UP5 A;  4M2P A;  2R2I A;  3D10 A;  1BU3 A;  2L51 A;  3FWB A;  2M97 A;  2NLN A;  2HET A;  2L5X B;  5IBW A;  2BCA A;  2JXL A;  1QX2 A;  4PE0 A;  1DJY A;  3OHM B;  1M63 B;  1OMD A;  2LE9 B;  2LMV A;  2JT8 A;  1UHI A;  3QRX A;  1KFX S;  4BY5 A;  3TZ1 A;  1N2D A;  3LK0 A;  1F71 A;  1DMO A;  1B8R A;  1MQ1 A;  2KYF A;  1NPQ A;  2LNK A;  1TNP A;  4YBH B; 
#chains in the Genus database with same CATH topology
 1QAT A;  3NXA A;  4I5J A;  4CID A;  2MHH A;  2BE6 A;  1NWD A;  2BL0 C;  1XFW O;  4HSZ A;  1K2H A;  2WC6 A;  2L5Y A;  2BCB A;  2GTE A;  1C7V A;  1KK8 C;  1Q80 A;  3OB2 B;  4ZCV A;  3PJI A;  4MZL A;  5CPV A;  2ZKM X;  1K9K A;  3SG7 A;  1N0Y A;  3B7A A;  3TDU A;  1CFF A;  1XO5 A;  1KQM C;  2PQL A;  3CWG A;  3Q8I A;  4GBA A;  1HQV A;  3KO0 A;  3BFH A;  1EL4 A;  1R2U A;  4N1G A;  5HKY A;  1WLZ A;  5D69 A;  2K2A A;  1NYA A;  2KFF A;  1KFU S;  1ZAC A;  2KBI A;  5FYX A;  3DVK A;  1H8B A;  2L50 A;  2K7B A;  2LCP A;  3EVV A;  2JUL A;  3AAK A;  1LA0 A;  2QAC A;  1Y1U A;  1CDL A;  1TNQ A;  2WCE A;  1OOF A;  3PAT A;  1B47 A;  1AJ5 A;  4XJK B;  4YRU A;  2COL B;  2KQ6 A;  1IQ5 A;  1RTP 1;  4WQ3 A;  1QX5 B;  1ALV A;  3CYZ A;  3DVJ A;  3ZNI A;  3PSR A;  1WY9 A;  2KGR A;  3EK7 A;  3TUY C;  1LS8 A;  4PE7 A;  4QJ5 B;  1Y1X A;  2JTT A;  3B86 A;  1IJ6 A;  5AEQ A;  1NCZ A;  4Q04 A;  5DKR A;  2NCP A;  4YI9 A;  3E3R A;  1CTR A;  4GPL B;  3CAB A;  1Y0V H;  1GM0 A;  4TNC A;  1C3Z A;  1JF2 A;  3BOW A;  3I5F C;  1QJT A;  1QWV A;  1IQ3 A;  2CCM A;  4DS7 A;  3IQQ A;  1T14 A;  1B7T Y;  2EHB A;  2BNX A;  1NUB A;  4NDC A;  2K2F A;  3K1E A;  1GGZ A;  4PHN A;  1PRW A;  3EVR A;  2M0R A;  4M2O A;  4C0K A;  2LMT A;  3TDZ A;  1JFK A;  2KPH A;  2B1U A;  3O78 A;  3LLE A;  2WND A;  3GK1 A;  5HL1 A;  2OS8 B;  1OOJ A;  2BKH B;  2LHI A;  2LVI A;  4C0L A;  1H4B A;  3CR4 X;  1K90 D;  2KI4 B;  2DOQ A;  3NGV A;  1QLK A;  1B4C A;  4FQO A;  1BLQ A;  4PHJ A;  3WHU B;  1YUS A;  2BCX A;  2LUC A;  2MLF C;  2VRG A;  2WCH A;  4AQI A;  4CPV A;  5JOL A;  2MAZ A;  2KGB C;  3AAJ A;  4IJ7 A;  3ICB A;  1QS7 A;  1REC A;  5PAL A;  3I5H C;  2Q91 A;  1SCM B;  2K7C A;  1QV1 A;  1TN4 A;  3PM8 A;  4N5X A;  1DC1 A;  4MEW A;  3O6B A;  1S6J A;  3L4A A;  1TCO B;  1OMV A;  3SG2 A;  2BAP A;  3SS4 A;  2WCK A;  1F4Q A;  3N7H A;  3D76 A;  3KPX A;  3WNX B;  3O2P A;  2QEV A;  3BUO B;  1SYM A;  1VRK A;  1SMG A;  1YX8 A;  2LHL A;  3B88 A;  1DF0 B;  1FBV A;  4ZCU A;  4P5O E;  2OTG B;  3OX6 A;  3VGO A;  3NSL A;  1SL7 A;  4XYN A;  3O4X A;  4MVF A;  1XK4 A;  3TDI A;  1XVJ A;  3PM2 A;  2Q4U A;  3DVE A;  3O4Y A;  3SG6 A;  1GGW A;  4QJ3 B;  4YGC B;  2A4J A;  2LP3 A;  1F70 A;  4PDZ A;  2BBN A;  3BFB A;  3CZ2 A;  1CDP A;  3R72 A;  2K7D A;  1QXP A;  3BUN B;  1LIN A;  1DJZ A;  1TOP A;  4DRW A;  4JWQ A;  5HLO A;  1CM4 A;  1CMG A;  1YR5 A;  5HKZ A;  2IS9 A;  5HLV A;  4L9M A;  3FE9 A;  4CFR A;  2NZ0 A;  4HRE E;  2FJY A;  2WCL A;  1JBA A;  1DEL A;  1Z2C B;  2EGD A;  1OOI X;  1NX2 A;  1SR6 B;  1TTX A;  1DTL A;  4JQ0 D;  2HQ8 A;  1FPW A;  2WCF A;  5B8I B;  2AAO A;  1EXR A;  4CLN A;  1BOC A;  4E68 A;  5K89 A;  2JC2 A;  2CT9 A;  2LAN A;  3DYE A;  3LCP C;  1XK4 C;  5AER A;  3NHT A;  1OOH A;  2HPS A;  3EK8 A;  3B87 A;  3VRN A;  1EJ3 A;  3D78 A;  1AUI B;  1OQP A;  1TNW A;  1K94 A;  4GGF C;  1XFU O;  2M1U A;  3IF7 A;  1MUX A;  1G33 A;  2ZRT A;  3DF0 B;  3OX5 A;  4ICB A;  5KTY A;  3R1P A;  3FIA A;  2L0P A;  2M1K B;  3AKA A;  3WHT B;  1M31 A;  3F45 A;  5I2L A;  4N1F A;  1YUR A;  2D8N A;  2PAS A;  1CFC A;  4PCW A;  3EK4 A;  5CSF A;  4F0Z B;  3IQO A;  1ZMZ A;  1S5G Z;  4MZJ A;  3BUW B;  2JQ6 A;  4UPG A;  2F3Z A;  3GK4 X;  1IKU A;  2I18 A;  4WRI A;  3JVT B;  5G08 A;  1R6P A;  3PN7 B;  1KSM A;  1CB1 A;  3BXK A;  2G9B A;  2O60 A;  2M29 A;  2KYC A;  2FOT A;  2FJU B;  3BUX B;  3D0Y A;  1L2O B;  2L2C A;  2ZRS A;  1CDN A;  1EG3 A;  3DZT A;  3SG5 A;  3A4U B;  3I5I B;  1A4P A;  2JNF A;  2F2P A;  3OP0 A;  1J1E A;  1YRU B;  5I8N A;  1CFP A;  1J55 A;  1A2X A;  3FS7 A;  4YGB B;  4MBE A;  1OZO A;  1PSB A;  3LK1 A;  1KFX L;  5J3X A;  1SNL A;  1JWD A;  1PK0 D;  1G8I A;  1ZUZ A;  4PT1 A;  4A4C A;  4I5L B;  3JTD B;  3SS5 A;  2M49 B;  2ZNE A;  2I2R E;  1A03 A;  2GGZ A;  2F2O A;  2JPT A;  2ZN9 A;  5KU1 A;  1GQM A;  2CBL A;  2HQW A;  2MA2 A;  3CZT X;  2OS8 C;  4KYN A;  5ER5 A;  5F6T A;  4MSP A;  1V1F A;  2JNX A;  1S1E A;  2LVV A;  1PSR A;  2KI4 C;  2TN4 A;  1DGU A;  1BF5 A;  2JWW A;  1NCY A;  3GOF A;  1W7J B;  1XFY O;  3TS5 B;  2WCB A;  1AK8 A;  1BMO A;  2NXQ A;  1KFU L;  1UHN A;  2QDI A;  1AVS A;  2WC8 A;  5DKQ A;  1A29 A;  1B9A A;  3PAL A;  4D1E A;  1S6C A;  1SCM C;  4DCK A;  1NIW A;  1A75 A;  2ZN8 A;  1IG5 A;  1IRJ A;  3FWC A;  2KLD A;  4OVN F;  4I5K A;  1XFV O;  3SIB A;  1S36 A;  1MF8 B;  2BBM A;  3NSI A;  1J7P A;  1W9Z A;  4MRY A;  2KI6 C;  3PLF B;  1QLS A;  3SG3 A;  1Y6W A;  5D7F A;  1OW4 A;  1DJW A;  1SY9 A;  2OTG C;  1WRK A;  3CS1 A;  4HRG A;  4OV2 A;  1DGV A;  1MXE A;  3DD4 A;  5CSI A;  5GQQ C;  3DY9 A;  2QPT A;  2WCM A;  1GJY A;  3S0B A;  1SL8 A;  3RZS A;  1JUO A;  2JZI A;  2ZFD A;  1CMF A;  3R1V A;  4ORB B;  4INW A;  3HX4 A;  4ORC B;  2MJW B;  4JKT A;  1TUZ A;  3DF0 A;  3NSK A;  3OBV A;  1DVI A;  3FE8 A;  1S5G Y;  3LL8 B;  4YGE B;  2MLE C;  5ER4 X;  3S0A A;  2F8P A;  1ORG A;  1B8C A;  1SBJ A;  2P6B B;  4AQJ A;  1RK9 A;  3DVM A;  1OOG A;  1MHO A;  1XFR A;  2MBX A;  1UWO A;  4NQG A;  2EC6 B;  1YTZ C;  1BG1 A;  2L2E A;  2FCE A;  2LP2 A;  2MRD A;  1SR6 C;  2KI6 D;  3S0G A;  1BJF A;  1BR4 B;  1SPY A;  2P71 A;  5D3O A;  2KHN A;  1OZS A;  3BFA A;  1DJI A;  4GGF A;  1NX0 A;  1OE9 B;  1V1G A;  2WC5 A;  2KBM A;  4NDD A;  4OR9 B;  2Y5I A;  4PE4 A;  4YI8 A;  4WQ2 A;  1MXL C;  3CGA A;  1ALW A;  1G4Y R;  2ERB A;  2O5G A;  1F4O A;  2WCJ A;  2LVJ A;  3A8R A;  1U5I B;  3I5G B;  5CSN A;  1EG4 A;  1MR8 A;  3DXL A;  1K8U A;  1XA5 A;  2L4H A;  4PAL A;  1K95 A;  1KK7 Z;  4XJK A;  4OCI A;  3L4L A;  1DT7 B;  1UUS A;  2G2B A;  1JC2 A;  1IGV A;  1TWO A;  1Z4H A;  1UHK A;  5AXI A;  4HRH A;  5AFP A;  3EVU A;  3UNW A;  2JT3 A;  3VRP A;  1RRO A;  2LLT A;  4FQT A;  4ORA B;  1WRL A;  1M45 A;  1QIV A;  2GV5 A;  1CLL A;  3EKH A;  1ODB A;  2KNE A;  2LAP A;  2LC5 A;  1AHR A;  4P2Y B;  2LLU A;  1B7T Z;  1CLM A;  1CM1 A;  2JRF A;  2JTZ A;  1RWY A;  2JU0 A;  3JVT C;  1IJ5 A;  1DJG A;  1XFZ O;  2KOT A;  2SCP A;  1S3P A;  3OGN A;  3BQ3 A;  3PN7 C;  5DKN A;  4QJ4 B;  1RFJ A;  1HT9 A;  1QIW A;  3NSO A;  1L2O C;  3MSE B;  2PMY A;  2CXJ A;  1KWO B;  2CNP A;  3I5I C;  4BY4 A;  5FI6 A;  1SKT A;  2KQY A;  1L7Z A;  1DJH A;  1WDC B;  2LV7 A;  1CKK A;  5EL2 A;  1BOD A;  2V53 A;  1SRA A;  2H61 C;  3H4S E;  1JF0 A;  2M9G A;  1XYD A;  1JSA A;  1KCY A;  4YGD B;  4IL1 A;  2LMU A;  1DQE A;  1NX1 A;  1TRF A;  1K96 A;  3S0E A;  2Y1N A;  1C7W A;  1UUR A;  2F33 A;  2I94 A;  3JTD C;  4C0J A;  2BE4 A;  1RJV A;  2H2K A;  2M3W A;  1J7Q A;  1CLB A;  3KHE A;  1N65 A;  2K7O A;  2L4I A;  5HKW A;  2KFH A;  4OKH A;  5I94 A;  3CZ0 A;  1F8H A;  1OSA A;  1K9P A;  1UHJ A;  4GFT A;  2QEO A;  1S26 D;  2KLE A;  3EKJ A;  3D75 A;  4GGN A;  1ZOT B;  5CSJ A;  5I2O A;  3SS3 A;  3K21 A;  1QVI Z;  2JT0 A;  1WRZ A;  3TS5 C;  2PSR A;  2Y1M A;  1YX7 A;  4PE1 A;  1X02 A;  3VRR A;  2AMI A;  3KEV A;  2BL0 B;  3KF9 A;  5I2Q A;  1KQV A;  1TNX A;  2WOR A;  4OZD A;  1CDM A;  1FI5 A;  1CFD A;  1KK8 B;  1SL9 A;  1DF0 A;  1QTX A;  2GGM A;  1NSH A;  1TUJ A;  3FE6 A;  5FI2 A;  2WOS A;  1QX7 A;  1KQM B;  1PAL A;  1B8L A;  1QV0 A;  5KSZ A;  3RLZ A;  4DIR A;  4USL A;  1AP4 A;  1C07 A;  1OMR A;  2SAS A;  3OB1 B;  3GK2 A;  3AKB A;  2JXC A;  3CDN A;  1SK6 D;  1EH2 A;  1KK7 Y;  1ZFS A;  2KAY A;  3RM1 A;  3SJS A;  4GAO A;  1BR1 B;  3BUM B;  1IWQ A;  1PVA A;  2I7A A;  2KAV A;  2P70 A;  2AUC A;  3C1V A;  4NDB A;  3SG4 A;  1LA3 A;  2LLS A;  5DIC A;  1U5I A;  1YUU A;  1NX3 A;  1YRT B;  2LUX A;  3CTN A;  2KFG A;  4I5N B;  4JD9 A;  4YGA A;  3VRQ A;  3CR2 A;  1D1O A;  3V2L A;  1J7O A;  2K60 A;  1TCF A;  4FTG A;  1PUL A;  1DJX A;  4PHK A;  4PHM A;  2FCD A;  4ETO A;  3TUY B;  2KSP A;  4F7F A;  2JPO A;  1K93 D;  1LXF C;  1FW4 A;  1S6I A;  3CLN A;  4GNK B;  1YVL A;  3NHI A;  1CNP A;  2EC6 C;  1MWN A;  5TNC A;  4AOM A;  5BPJ A;  3L47 A;  5JJG A;  4M2Q A;  5AAN A;  4GUK A;  2CTN A;  3I5F B;  2PVB A;  2L98 A;  3S0F A;  1XFX O;  3D0Y B;  3EG5 B;  2LM5 A;  1NCX A;  2F3Y A;  4MLW A;  3ZWH A;  1J7R A;  1W7I B;  2HF5 A;  2NCO A;  4MZK A;  2KDH A;  2OPO A;  4U8D A;  1FI6 A;  2M7N A;  3R1O A;  1K9U A;  3I5G C;  1IIO A;  3CZ1 A;  1KSO A;  1TIZ A;  2M8U A;  1YUT A;  2E30 A;  1M46 A;  2PRU A;  1B1G A;  1PVB A;  2LVK A;  3UO9 A;  2BEC A;  1QAS A;  1C3Y A;  2H8V A;  4CFQ A;  1SW8 A;  2ZND A;  1SSE B;  5HYD A;  3SIA A;  1F54 A;  1LVC D;  2Y4Q A;  2K0J A;  2BKI B;  1E8A A;  1J1D A;  1WLM A;  1LKJ A;  3CR5 X;  3I5H B;  3BOW B;  3VRO A;  2PAL A;  1QVI Y;  2QEB A;  2H61 A;  3BYA A;  1Y1A A;  1JFJ A;  3PFV A;  2KAX A;  2M7L A;  3M0W A;  3VB1 A;  1AJ4 A;  4MN0 A;  4R1E A;  5FI7 A;  1KWO C;  1FF1 A;  2K61 A;  1WDC C;  2ISD A;  3D73 A;  3QME A;  4A4B A;  1F55 A;  2K8M B;  2E6W A;  4DUQ A;  1A75 B;  2RGI A;  1P28 A;  2YGU A;  2JOJ A;  1SCV A;  1BT6 A;  3D77 A;  1DEK A;  1IH0 A;  1UHH A;  4JPZ B;  3WXA A;  1YVH A;  3HCM A;  1M39 A;  1NP8 A;  4MRX A;  1UP5 A;  4M2P A;  2R2I A;  3D10 A;  1BU3 A;  2L51 A;  3BJH A;  2M97 A;  2NLN A;  3FWB A;  2HET A;  2L5X B;  5IBW A;  2BCA A;  2QEH A;  2JXL A;  1QX2 A;  4PE0 A;  3B6X A;  1DJY A;  3OHM B;  1M63 B;  1OMD A;  2LE9 B;  2LMV A;  2JT8 A;  1UHI A;  3QRX A;  1KFX S;  4BY5 A;  3TZ1 A;  1N2D A;  3LK0 A;  4INX A;  1DMO A;  1B8R A;  3IVT A;  3D74 A;  1F71 A;  1MQ1 A;  2KYF A;  3S0D A;  1NPQ A;  2PYQ A;  2LNK A;  1TNP A;  4YBH B; 
#chains in the Genus database with same CATH homology
 1QAT A;  3NXA A;  4I5J A;  4CID A;  2MHH A;  2BE6 A;  1NWD A;  2BL0 C;  1XFW O;  4HSZ A;  1K2H A;  2BCB A;  1C7V A;  1KK8 C;  1Q80 A;  3OB2 B;  4ZCV A;  4MZL A;  5CPV A;  2ZKM X;  1K9K A;  3SG7 A;  1N0Y A;  3TDU A;  1CFF A;  1XO5 A;  1KQM C;  3CWG A;  4GBA A;  1HQV A;  3KO0 A;  1EL4 A;  1R2U A;  4N1G A;  5HKY A;  1WLZ A;  5D69 A;  2K2A A;  1NYA A;  2KFF A;  1KFU S;  1ZAC A;  2KBI A;  5FYX A;  3DVK A;  1H8B A;  2L50 A;  2K7B A;  2LCP A;  3EVV A;  2JUL A;  3AAK A;  1LA0 A;  2QAC A;  1Y1U A;  1CDL A;  1TNQ A;  2WCE A;  3PAT A;  1B47 A;  1AJ5 A;  4XJK B;  4YRU A;  2COL B;  2KQ6 A;  1IQ5 A;  1RTP 1;  4WQ3 A;  1QX5 B;  1ALV A;  3DVJ A;  3ZNI A;  3PSR A;  1WY9 A;  2KGR A;  3EK7 A;  3TUY C;  4PE7 A;  4QJ5 B;  1Y1X A;  2JTT A;  1IJ6 A;  5AEQ A;  1NCZ A;  4Q04 A;  5DKR A;  2NCP A;  4YI9 A;  3E3R A;  1CTR A;  4GPL B;  1Y0V H;  4TNC A;  1JF2 A;  3BOW A;  3I5F C;  1QJT A;  1IQ3 A;  2CCM A;  4DS7 A;  3IQQ A;  1B7T Y;  2EHB A;  4NDC A;  1NUB A;  2K2F A;  1GGZ A;  4PHN A;  1PRW A;  3EVR A;  2M0R A;  4M2O A;  4C0K A;  2LMT A;  3TDZ A;  1JFK A;  2B1U A;  3O78 A;  3LLE A;  2WND A;  3GK1 A;  2OS8 B;  1OOJ A;  2BKH B;  2LHI A;  2LVI A;  4C0L A;  1H4B A;  3CR4 X;  1K90 D;  2KI4 B;  2DOQ A;  1QLK A;  1B4C A;  4FQO A;  1BLQ A;  4PHJ A;  3WHU B;  1YUS A;  2BCX A;  2LUC A;  2MLF C;  2VRG A;  4AQI A;  4CPV A;  5JOL A;  2MAZ A;  2KGB C;  3AAJ A;  3ICB A;  1QS7 A;  1REC A;  5PAL A;  3I5H C;  2Q91 A;  1SCM B;  2K7C A;  1QV1 A;  1TN4 A;  3PM8 A;  4N5X A;  4MEW A;  3O6B A;  1S6J A;  1TCO B;  1OMV A;  3SG2 A;  1F4Q A;  3KPX A;  3WNX B;  3O2P A;  3BUO B;  1SYM A;  1VRK A;  1SMG A;  1YX8 A;  2LHL A;  1DF0 B;  1FBV A;  4ZCU A;  4P5O E;  2OTG B;  3OX6 A;  3VGO A;  3NSL A;  1SL7 A;  4XYN A;  4MVF A;  3TDI A;  1XK4 A;  1XVJ A;  2Q4U A;  3DVE A;  3O4Y A;  3SG6 A;  1GGW A;  4QJ3 B;  4YGC B;  2A4J A;  2LP3 A;  1F70 A;  4PDZ A;  2BBN A;  1CDP A;  2K7D A;  1QXP A;  3BUN B;  1LIN A;  1DJZ A;  1TOP A;  4DRW A;  4JWQ A;  5HLO A;  1CM4 A;  1CMG A;  1YR5 A;  5HKZ A;  2IS9 A;  5HLV A;  4L9M A;  4CFR A;  2NZ0 A;  4HRE E;  1JBA A;  2EGD A;  1NX2 A;  1SR6 B;  1TTX A;  1DTL A;  4JQ0 D;  2HQ8 A;  1FPW A;  2WCF A;  5B8I B;  2AAO A;  1EXR A;  4CLN A;  1BOC A;  4E68 A;  5K89 A;  2JC2 A;  2CT9 A;  2LAN A;  3LCP C;  1XK4 C;  5AER A;  2HPS A;  3EK8 A;  3VRN A;  1EJ3 A;  1AUI B;  1OQP A;  1TNW A;  1K94 A;  4GGF C;  1XFU O;  2M1U A;  3IF7 A;  1MUX A;  1G33 A;  2ZRT A;  3DF0 B;  3OX5 A;  4ICB A;  5KTY A;  3FIA A;  2L0P A;  2M1K B;  3AKA A;  3WHT B;  1M31 A;  3F45 A;  5I2L A;  4N1F A;  1YUR A;  2D8N A;  2PAS A;  1CFC A;  4PCW A;  3EK4 A;  5CSF A;  4F0Z B;  3IQO A;  1ZMZ A;  1S5G Z;  4MZJ A;  3BUW B;  2JQ6 A;  4UPG A;  2F3Z A;  3GK4 X;  1IKU A;  2I18 A;  4WRI A;  3JVT B;  5G08 A;  1R6P A;  3PN7 B;  1KSM A;  1CB1 A;  3BXK A;  2G9B A;  2O60 A;  2M29 A;  2KYC A;  2FOT A;  2FJU B;  3BUX B;  3D0Y A;  1L2O B;  2ZRS A;  1CDN A;  1EG3 A;  3SG5 A;  3A4U B;  3I5I B;  1A4P A;  2JNF A;  2F2P A;  3OP0 A;  1J1E A;  1YRU B;  5I8N A;  1CFP A;  1J55 A;  1A2X A;  3FS7 A;  4YGB B;  4MBE A;  1OZO A;  1PSB A;  3LK1 A;  1KFX L;  5J3X A;  1SNL A;  1JWD A;  1PK0 D;  1G8I A;  1ZUZ A;  4A4C A;  4I5L B;  3JTD B;  2M49 B;  2ZNE A;  2I2R E;  1A03 A;  2GGZ A;  2F2O A;  2JPT A;  2ZN9 A;  5KU1 A;  1GQM A;  2CBL A;  2HQW A;  2MA2 A;  3CZT X;  2OS8 C;  5ER5 A;  5F6T A;  4MSP A;  1V1F A;  2JNX A;  1S1E A;  2LVV A;  1PSR A;  2KI4 C;  2TN4 A;  1DGU A;  1BF5 A;  2JWW A;  1NCY A;  3GOF A;  1W7J B;  1XFY O;  3TS5 B;  2WCB A;  1AK8 A;  1BMO A;  2NXQ A;  1KFU L;  1UHN A;  1AVS A;  2WC8 A;  5DKQ A;  1A29 A;  1B9A A;  3PAL A;  4D1E A;  1S6C A;  1SCM C;  4DCK A;  1NIW A;  1A75 A;  2ZN8 A;  1IG5 A;  1IRJ A;  3FWC A;  4OVN F;  4I5K A;  1XFV O;  3SIB A;  1S36 A;  1MF8 B;  2BBM A;  3NSI A;  1J7P A;  4MRY A;  2KI6 C;  3PLF B;  1QLS A;  3SG3 A;  1Y6W A;  5D7F A;  1DJW A;  1SY9 A;  2OTG C;  1WRK A;  3CS1 A;  4HRG A;  4OV2 A;  1DGV A;  1MXE A;  3DD4 A;  5CSI A;  5GQQ C;  2QPT A;  1GJY A;  1SL8 A;  1JUO A;  2JZI A;  2ZFD A;  1CMF A;  4ORB B;  3HX4 A;  4ORC B;  2MJW B;  3DF0 A;  3NSK A;  1DVI A;  1S5G Y;  3LL8 B;  4YGE B;  2MLE C;  5ER4 X;  2F8P A;  1SBJ A;  1B8C A;  2P6B B;  4AQJ A;  1RK9 A;  3DVM A;  1MHO A;  2MBX A;  1UWO A;  4NQG A;  2EC6 B;  1YTZ C;  1BG1 A;  2L2E A;  2FCE A;  2LP2 A;  2MRD A;  1SR6 C;  2KI6 D;  1BJF A;  1BR4 B;  1SPY A;  2KHN A;  1OZS A;  1DJI A;  4GGF A;  1NX0 A;  1OE9 B;  1V1G A;  4OR9 B;  2KBM A;  4NDD A;  4PE4 A;  2Y5I A;  4YI8 A;  4WQ2 A;  1MXL C;  3CGA A;  1ALW A;  1G4Y R;  2O5G A;  1F4O A;  2LVJ A;  3A8R A;  1U5I B;  3I5G B;  5CSN A;  1EG4 A;  1MR8 A;  1K8U A;  1XA5 A;  2L4H A;  4PAL A;  1K95 A;  1KK7 Z;  4XJK A;  4OCI A;  1DT7 B;  1UUS A;  2G2B A;  1JC2 A;  1IGV A;  1UHK A;  5AXI A;  4HRH A;  5AFP A;  3EVU A;  3VRP A;  2JT3 A;  1RRO A;  2LLT A;  4ORA B;  1WRL A;  1M45 A;  1QIV A;  2GV5 A;  1CLL A;  3EKH A;  1ODB A;  2KNE A;  2LAP A;  2LC5 A;  1AHR A;  4P2Y B;  2LLU A;  1B7T Z;  1CLM A;  1CM1 A;  2JRF A;  2JTZ A;  1RWY A;  2JU0 A;  3JVT C;  1IJ5 A;  1DJG A;  1XFZ O;  2KOT A;  2SCP A;  1S3P A;  3PN7 C;  3BQ3 A;  5DKN A;  4QJ4 B;  1RFJ A;  1HT9 A;  1QIW A;  3NSO A;  1L2O C;  3MSE B;  2PMY A;  2CXJ A;  2CNP A;  1KWO B;  3I5I C;  4BY4 A;  1SKT A;  2KQY A;  1L7Z A;  1DJH A;  1WDC B;  2LV7 A;  1CKK A;  1BOD A;  2V53 A;  1SRA A;  2H61 C;  3H4S E;  1JF0 A;  2M9G A;  1XYD A;  1JSA A;  1KCY A;  4YGD B;  4IL1 A;  2LMU A;  1NX1 A;  1TRF A;  1K96 A;  2Y1N A;  1C7W A;  1UUR A;  2F33 A;  2I94 A;  3JTD C;  4C0J A;  2BE4 A;  1RJV A;  2H2K A;  2M3W A;  1J7Q A;  1CLB A;  3KHE A;  1N65 A;  2K7O A;  2L4I A;  5HKW A;  2KFH A;  4OKH A;  1F8H A;  1OSA A;  1K9P A;  1UHJ A;  4GFT A;  1S26 D;  4GGN A;  3EKJ A;  1ZOT B;  5CSJ A;  5I2O A;  3K21 A;  1QVI Z;  2JT0 A;  1WRZ A;  3TS5 C;  2PSR A;  2Y1M A;  1YX7 A;  4PE1 A;  1X02 A;  3VRR A;  2AMI A;  3KEV A;  2BL0 B;  3KF9 A;  5I2Q A;  1KQV A;  1TNX A;  2WOR A;  1CDM A;  1FI5 A;  1CFD A;  1KK8 B;  1SL9 A;  1DF0 A;  1QTX A;  2GGM A;  1NSH A;  2WOS A;  1QX7 A;  1KQM B;  1PAL A;  1B8L A;  1QV0 A;  5KSZ A;  3RLZ A;  4DIR A;  4USL A;  1AP4 A;  1C07 A;  1OMR A;  2SAS A;  3OB1 B;  3GK2 A;  3AKB A;  2JXC A;  1SK6 D;  1EH2 A;  1KK7 Y;  1ZFS A;  2KAY A;  3RM1 A;  3SJS A;  4GAO A;  1BR1 B;  3BUM B;  1IWQ A;  1PVA A;  2I7A A;  2KAV A;  3C1V A;  2AUC A;  4NDB A;  3SG4 A;  1LA3 A;  2LLS A;  1U5I A;  1YUU A;  1NX3 A;  1YRT B;  2LUX A;  3CTN A;  2KFG A;  4I5N B;  4YGA A;  3VRQ A;  3CR2 A;  1D1O A;  1J7O A;  1TCF A;  4FTG A;  1PUL A;  1DJX A;  4PHK A;  4PHM A;  2FCD A;  4ETO A;  3TUY B;  2KSP A;  1K93 D;  1LXF C;  1FW4 A;  1S6I A;  3CLN A;  4GNK B;  1YVL A;  1CNP A;  2EC6 C;  1MWN A;  5TNC A;  4AOM A;  5BPJ A;  5JJG A;  4M2Q A;  5AAN A;  4GUK A;  2CTN A;  3I5F B;  2PVB A;  2L98 A;  1XFX O;  3D0Y B;  2LM5 A;  1NCX A;  2F3Y A;  4MLW A;  3ZWH A;  1J7R A;  1W7I B;  2HF5 A;  2NCO A;  4MZK A;  2KDH A;  2OPO A;  4U8D A;  1FI6 A;  2M7N A;  1K9U A;  3I5G C;  1KSO A;  1TIZ A;  2M8U A;  1YUT A;  2E30 A;  1M46 A;  2PRU A;  1B1G A;  1PVB A;  2LVK A;  2BEC A;  1QAS A;  4CFQ A;  1SW8 A;  2ZND A;  5HYD A;  3SIA A;  1F54 A;  1LVC D;  2Y4Q A;  2K0J A;  2BKI B;  1E8A A;  1J1D A;  1WLM A;  1LKJ A;  3CR5 X;  3I5H B;  3BOW B;  3VRO A;  2PAL A;  1QVI Y;  2H61 A;  3BYA A;  1Y1A A;  1JFJ A;  3PFV A;  2KAX A;  2M7L A;  3M0W A;  1AJ4 A;  4MN0 A;  4R1E A;  1KWO C;  1FF1 A;  2K61 A;  1WDC C;  2ISD A;  4A4B A;  1F55 A;  2K8M B;  2E6W A;  4DUQ A;  1A75 B;  2RGI A;  2JOJ A;  1SCV A;  1BT6 A;  1IH0 A;  1UHH A;  4JPZ B;  3WXA A;  1YVH A;  3HCM A;  1M39 A;  1NP8 A;  4MRX A;  1UP5 A;  4M2P A;  2R2I A;  3D10 A;  1BU3 A;  2L51 A;  3FWB A;  2M97 A;  2NLN A;  2HET A;  2L5X B;  5IBW A;  2BCA A;  2JXL A;  1QX2 A;  4PE0 A;  1DJY A;  3OHM B;  1M63 B;  1OMD A;  2LE9 B;  2LMV A;  2JT8 A;  1UHI A;  3QRX A;  1KFX S;  4BY5 A;  3TZ1 A;  1N2D A;  3LK0 A;  1F71 A;  1DMO A;  1B8R A;  1MQ1 A;  2KYF A;  1NPQ A;  2LNK A;  1TNP A;  4YBH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...