2K61A

Solution structure of cam complexed to dapk peptide
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
146
structure length
146
Chain Sequence
QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGDGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Calmodulin
publication title Accurate solution structures of proteins from X-ray data and a minimal set of NMR data: calmodulin-peptide complexes as examples.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2008-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2k61A00
4OR9B 3I5IB 3MSEB 1YRTB 1NWDA 3DVEA 3PALA 1AHRA 2H61A 4OCIA 4YGCB 1XFYO 5HKZA 1F54A 3FWBA 2OTGB 1ZFSA 5AANA 4CFQA 4BY4A 1F8HA 1SL7A 1IQ3A 1KK7Z 1N65A 2JTTA 1JWDA 1J1DA 2IS9A 4PDZA 1EH2A 4GBAA 2WORA 1YTZC 1CKKA 2MHHA 5I2QA 2LAPA 1G33A 4A4BA 1CLLA 1OQPA 2CBLA 2I18A 4I5NB 3OB2B 3VRRA 1A03A 1DJZA 1GQMA 1K9KA 2JXCA 2KBIA 2SCPA 1SYMA 1F71A 2L50A 1KSOA 1LKJA 3RM1A 1U5IA 4PCWA 1KK8B 4GPLB 5AFPA 1DTLA 5G08A 5AXIA 2JOJA 2KNEA 5FYXA 4C0KA 2KAVA 2ZNEA 5I8NA 1FW4A 1A75B 2ZRSA 5DKRA 2QACA 1IG5A 1M31A 2HPSA 2CTNA 5AERA 2CXJA 4A4CA 3M0WA 2K61A 3PLFB 2CT9A 4DCKA 3OP0A 1WY9A 1NIWA 4UPGA 1UWOA 2F3YA 2G2BA 4JWQA 1XFZO 2LC5A 3SG5A 3EVVA 4Q04A 1NPQA 1OZSA 2CNPA 3F45A 5F6TA 4OVNF 1CB1A 2KDHA 4M2OA 3OX5A 1J7RA 1NYAA 1SMGA 4MEWA 3PN7B 1PULA 1TN4A 3I5HC 1N0YA 1QX7A 2WC8A 2TN4A 1B47A 2LE9B 2MAZA 1CDPA 2L2EA 4ICBA 2LVVA 2I7AA 2PMYA 1DF0A 4PHNA 3ICBA 1XFVO 5GQQC 1Y1UA 5D7FA 1BR1B 4JPZB 1CFDA 5ER5A 2F33A 2M9GA 2BKHB 2VRGA 3KEVA 2KFHA 1SRAA 2LUCA 3FWCA 1ZOTB 1U5IB 1VRKA 2JNFA 3GK4X 2G9BA 3KPXA 1NX0A 4FQOA 4GGNA 3PATA 4HRHA 3TS5C 1EL4A 2D8NA 1E8AA 2M97A 1DJWA 4YRUA 1QVIY 3SG2A 2M3WA 1WRKA 4QJ5B 2COLB 2L0PA 3EK4A 1KSMA 4OKHA 2L4IA 1CTRA 2PRUA 1YRUB 1DGUA 5KTYA 2AAOA 1BODA 2ISDA 1CDLA 2HF5A 1DJGA 1ODBA 2KI6C 4GNKB 2LMUA 2M7NA 2MA2A 5D69A 4PHKA 1DT7B 3WXAA 3DVKA 1QS7A 1SL9A 1F55A 4CPVA 1Y1XA 1MXEA 2LHLA 3BUOB 4QJ3B 1S6CA 1M46A 3WHUB 1K9PA 4GUKA 5DKNA 1CFPA 2WCBA 1BLQA 1J7OA 1JFKA 2KI4B 1XYDA 1TOPA 1MF8B 1Y6WA 3CR5X 4P2YB 2L98A 1Y0VH 4MRXA 2LVKA 1QIWA 1DF0B 3TS5B 3A8RA 3EVUA 4BY5A 3IQOA 4PHJA 1F4QA 2JT3A 1FF1A 1JF0A 2FOTA 1S36A 4CLNA 1JFJA 5AEQA 4MZLA 1PSRA 1QATA 3O2PA 2GV5A 2K7DA 2ZN9A 1AP4A 4C0LA 2NCPA 1KQMC 3I5GC 1XO5A 2JWWA 1B7TY 1RWYA 1TNPA 3HCMA 1OSAA 1KWOC 2M8UA 2OPOA 1WRLA 3IF7A 1KFUS 2K8MB 1K94A 2KBMA 3NSIA 1A29A 3OHMB 2K7OA 4MZJA 5IBWA 2LMTA 2LP3A 2BKIB 3DD4A 2AMIA 2KFFA 3D10A 4AQIA 1IKUA 3RLZA 1K96A 1KFXS 4HSZA 4MVFA 1XVJA 3TDZA 4MSPA 2I94A 1UUSA 2KYCA 1IQ5A 2KQYA 2K2AA 2KAYA 1QJTA 1MHOA 5DKQA 1QVIZ 1CLMA 1CFCA 1QXPA 3CR4X 1BF5A 1YVLA 1K8UA 1AJ5A 2BBMA 3CGAA 5KU1A 1B1GA 2MJWB 4GAOA 1OMRA 1IJ5A 1KWOB 3O4YA 3QRXA 4R1EA 1QV0A 2LP2A 1CM1A 3VRPA 3WNXB 4NDBA 2ZFDA 4I5JA 3K21A 2LNKA 1IWQA 4ORBB 2F3ZA 2KYFA 1EG4A 4M2PA 3AAJA 2JTZA 1TIZA 4E68A 3VRNA 1TCOB 5I2LA 1HQVA 4ORAB 1KCYA 1NCZA 4P5OE 2HQWA 2B1UA 1RFJA 1YX8A 1F70A 1W7JB 2LANA 1GGWA 1CDMA 1QV1A 3KO0A 3AKAA 1CMGA 1TNQA 3CTNA 1QLKA 2Q91A 2EHBA 1UHHA 1ALVA 2NCOA 1DJYA 2BBNA 2CCMA 1LA3A 1LVCD 1M63B 2WNDA 3CLNA 4HREE 4WQ2A 4D1EA 1FI6A 1S5GY 1B7TZ 4YI8A 2LV7A 4YI9A 2JT0A 1PRWA 4U8DA 1YVHA 2JRFA 3BUMB 2QPTA 3A4UB 4I5KA 1SNLA 1OE9B 2JXLA 4NQGA 4YGBB 5I2OA 2LCPA 1J1EA 4GFTA 2K0JA 5HKWA 3BOWA 3BYAA 1BMOA 4PE7A 1C07A 3CWGA 1MR8A 1S3PA 3BQ3A 2L51A 2GGMA 2MRDA 1SR6C 1KQVA 1RROA 1L7ZA 3KF9A 1RECA 1OMVA 1TRFA 3C1VA 4PALA 5JOLA 1C7VA 5KSZA 2JU0A 3NSKA 4ETOA 3I5HB 1QX2A 4YGAA 1NP8A 4F0ZB 3ZWHA 1J7PA 2KHNA 3JVTC 1EG3A 1NX2A 4AQJA 1UHNA 1K2HA 3LCPC 3FS7A 1RJVA 1SL8A 3LL8B 2JPTA 3H4SE 2SASA 4GGFA 2NLNA 2ZRTA 4OV2A 4PE0A 1IH0A 2PASA 4PE4A 2MLEC 4DUQA 4M2QA 1B4CA 3TUYC 1IRJA 1B8RA 1K9UA 1KFUL 1YUSA 1S26D 2LLTA 1BU3A 3DF0A 3TDUA 1W7IB 1YURA 2E30A 2HQ8A 1NX3A 1SPYA 1SCMC 3D0YA 4GGFC 2E6WA 4NDCA 1DJHA 3VROA 1SR6B 2KQ6A 2BE4A 1XFXO 1FI5A 1XA5A 4MBEA 1KFXL 1EXRA 1WLZA 2PALA 3AAKA 4L9MA 4TNCA 3BOWB 1S1EA 1OOJA 2LVIA 1NCYA 2OTGC 2LLSA 1S6IA 3ZNIA 2K2FA 1JBAA 1MXLC 1R6PA 3JVTB 1QASA 3PM8A 5HLOA 4YGDB 5PALA 2MBXA 3BUNB 5BPJA 2BECA 1JSAA 1YUUA 3VRQA 1D1OA 3DVJA 3BUXB 1AUIB 1PK0D 3EKHA 1RK9A 1MUXA 2BCAA 4CFRA 2KGBC 1S5GZ 3CS1A 4WQ3A 2FCDA 2WOSA 3I5FC 3TUYB 1ZACA 1A4PA 1WRZA 1DVIA 4PE1A 1QLSA 3GOFA 3AKBA 2JNXA 4USLA 4DIRA 2NZ0A 4AOMA 5HLVA 5HYDA 2M49B 1SCMB 4JQ0D 5JJGA 4MN0A 2LMVA 1KK8C 2KFGA 4ZCUA 2Y4QA 1UURA 2KAXA 2R2IA 4NDDA 1B8LA 3DF0B 1DGVA 2L5XB 3WHTB 3NSOA 1XK4C 3I5GB 1KQMB 2H2KA 4DS7A 4FTGA 2Q4UA 3D0YB 4I5LB 1CDNA 3PFVA 1BOCA 3TDIA 3OB1B 1DMOA 1JC2A 2JC2A 2O60A 2L4HA 1CM4A 5CSIA 1WLMA 1H4BA 1YUTA 1JUOA 2BL0C 1SK6D 2H61C 2LLUA 1TNXA 1UHJA 3SG6A 1GGZA 2MLFC 2KSPA 2M29A 3I5FB 1V1GA 2Y1MA 2JULA 1C7WA 1MQ1A 1HT9A 1LA0A 3PN7C 5K89A 1FPWA 5CSFA 3NXAA 1LXFC 1S6JA 1PVBA 1IGVA 1WDCC 1NX1A 1SBJA 2I2RE 1V1FA 2NXQA 1SW8A 1F4OA 4YGEB 4ORCB 3O6BA 3OX6A 1J55A 3DVMA 2AUCA 2M0RA 1B8CA 2ZKMX 2PSRA 2OS8C 3FIAA 2KI6D 1PVAA 2FJUB 3SG4A 1G8IA 1NCXA 2EC6C 3SIAA 2Y1NA 1BG1A 1CMFA 1B9AA 2Y5IA 2DOQA 1H8BA 2JZIA 1TNWA 1QX5B 2ZNDA 3KHEA 5B8IB 1JF2A 2BL0B 2PVBA 1QIVA 4WRIA 1CNPA 2HETA 3SG7A 2ZN8A 1QTXA 3SIBA 3IQQA 2JQ6A 1AK8A 2EGDA 2WCEA 5HKYA 2GGZA 1X02A 4DRWA 3BXKA 4N1GA 1WDCB 1BR4B 3TZ1A 5TNCA 2F8PA 3LLEA 4ZCVA 1TTXA 2O5GA 1AJ4A 2OS8B 1OMDA 1KK7Y 2JT8A 3EKJA 1A2XA 1N2DA 1AVSA 2KI4C 3JTDC 3PSRA 4XJKA 3VGOA 2EC6B 4HRGA 1MWNA 1SY9A 1UP5A 1XFWO 1NUBA 5CSJA 1YR5A 3EK7A 1SKTA 1XFUO 3LK0A 1Q80A 1ZMZA 1SCVA 1M45A 4N1FA 1PALA 4C0JA 4CIDA 2LM5A 2P6BB 3CR2A 3GK2A 2A4JA 4PHMA 1CFFA 1DJIA 1LINA 2RGIA 3BUWB 2WCFA 3NSLA 2M7LA 2FCEA 3EVRA 4XYNA 1IJ6A 3CZTX 1PSBA 1L2OC 1FBVA 1J7QA 2KGRA 1ZUZA 3I5IC 1EJ3A 1DJXA 1R2UA 2F2PA 2KOTA 1BJFA 1K90D 1M39A 2BE6A 1RTP1 4YBHB 1K95A 1Y1AA 4MRYA 3JTDB 1UHKA 1K93D 1ALWA 3HX4A 3EK8A 4N5XA 5ER4X 2K7BA 3E3RA 3SG3A 2K7CA 2LVJA 5CPVA 4MLWA 1YX7A 2LUXA 1TCFA 3GK1A 5CSNA 2BCBA 4IL1A 1GJYA 3O78A 4XJKB 2V53A 4QJ4B 1G4YR 1A75A 1OZOA 2BCXA 1XK4A 4MZKA 3LK1A 5J3XA 2M1KB 2M1UA 1BT6A 1UHIA 1NSHA 1L2OB 3SJSA 2F2OA 2LHIA 1CLBA
chains in the Genus database with same CATH superfamily
4OR9B 3I5IB 3DYEA 3MSEB 1YRTB 1NWDA 3DVEA 3PALA 3PJIA 1AHRA 2H61A 4OCIA 4YGCB 1XFYO 5HKZA 1F54A 1T14A 3FWBA 2OTGB 1ZFSA 5AANA 4CFQA 4BY4A 1F8HA 1SL7A 1IQ3A 1KK7Z 1N65A 2JTTA 1JWDA 1J1DA 2IS9A 4PDZA 1EH2A 4GBAA 2WORA 1YTZC 1CKKA 2MHHA 5I2QA 2LAPA 3D78A 1G33A 4A4BA 1CLLA 1OQPA 3BFAA 2CBLA 2I18A 4I5NB 3OB2B 3VRRA 3R1VA 1A03A 1DJZA 1GQMA 1K9KA 2JXCA 2KBIA 2SCPA 1SYMA 1F71A 2L50A 1KSOA 1LKJA 3RM1A 1U5IA 4PCWA 1KK8B 4GPLB 5AFPA 1DTLA 5G08A 5AXIA 2JOJA 2KNEA 5FYXA 1Z2CB 1TUJA 2KAVA 2ZNEA 4C0KA 5I8NA 1FW4A 1A75B 2ZRSA 5DKRA 2QACA 4F7FA 1IG5A 1M31A 2HPSA 2CTNA 5AERA 2CXJA 4A4CA 3M0WA 2K61A 3PLFB 2CT9A 4DCKA 3OP0A 5FI2A 1WY9A 1NIWA 4UPGA 1UWOA 2F3YA 2PQLA 2G2BA 4JWQA 1XFZO 2LC5A 3SG5A 3EVVA 4Q04A 1NPQA 1OZSA 2CNPA 3F45A 5F6TA 4OVNF 1CB1A 2KDHA 4M2OA 3OX5A 1J7RA 1NYAA 1SMGA 4MEWA 3PN7B 1PULA 1TN4A 3I5HC 1N0YA 1QX7A 2WC8A 2TN4A 1B47A 2LE9B 2MAZA 1CDPA 3SS4A 2L2EA 4ICBA 2LVVA 2I7AA 2PMYA 1DF0A 3O4XA 4PHNA 3ICBA 1XFVO 5GQQC 1Y1UA 5D7FA 1BR1B 4JPZB 1CFDA 5ER5A 2F33A 2M9GA 2BKHB 2VRGA 3KEVA 2KFHA 1SRAA 2LUCA 3FWCA 1ZOTB 1U5IB 1VRKA 2JNFA 3GK4X 2G9BA 3KPXA 1NX0A 4FQOA 4GGNA 3DY9A 3PATA 3OBVA 4HRHA 3TS5C 2PYQA 1EL4A 2D8NA 1E8AA 2M97A 1DJWA 4YRUA 4KYNA 1QVIY 3SG2A 2M3WA 1WRKA 4QJ5B 2COLB 2L0PA 1IIOA 3EK4A 1KSMA 4OKHA 2L4IA 1CTRA 2PRUA 1YRUB 1DGUA 5KTYA 2AAOA 1BODA 2ISDA 1CDLA 2HF5A 1DJGA 1ODBA 2KI6C 4GNKB 2LMUA 2M7NA 2MA2A 5D69A 2WC6A 3CZ2A 4PHKA 1DT7B 3WXAA 3DVKA 1QS7A 1SL9A 4FQTA 1F55A 4CPVA 1Y1XA 1MXEA 2LHLA 3BUOB 4INWA 1S6CA 4QJ3B 1M46A 2L2CA 3WHUB 1K9PA 4GUKA 5DKNA 1CFPA 2WCBA 3NHTA 1BLQA 1JFKA 2KI4B 1J7OA 1XYDA 1TOPA 1MF8B 2H8VA 1Y6WA 2WCMA 3CR5X 1C3YA 4P2YB 2L98A 1Y0VH 4MRXA 2LVKA 1QIWA 3UNWA 1DF0B 3TS5B 3A8RA 3EVUA 4BY5A 3IQOA 4PHJA 3FE8A 1F4QA 2JT3A 1FF1A 1JF0A 5FI7A 2FOTA 1S36A 4CLNA 1JFJA 5AEQA 3L47A 1PSRA 1QATA 3O2PA 2GV5A 2K7DA 2ZN9A 4JD9A 4MZLA 1AP4A 4C0LA 2NCPA 1KQMC 3I5GC 1XO5A 2JWWA 1B7TY 1RWYA 1TNPA 3D76A 3HCMA 1OSAA 3S0GA 1KWOC 2M8UA 2OPOA 1WRLA 3CDNA 3IF7A 1KFUS 3K1EA 2K8MB 1K94A 2KBMA 3NSIA 1A29A 3OHMB 2K7OA 4MZJA 5IBWA 1W9ZA 2LMTA 5EL2A 2LP3A 2BKIB 3DD4A 2AMIA 2KFFA 3D10A 4AQIA 1IKUA 3RLZA 1K96A 1KFXS 2L5YA 5I94A 1QWVA 4HSZA 4MVFA 1XVJA 3TDZA 4MSPA 2I94A 1UUSA 2KYCA 4INXA 1IQ5A 2KQYA 3S0EA 2K2AA 2KAYA 1QJTA 1MHOA 5DKQA 2BNXA 1QVIZ 1CLMA 1CFCA 1QXPA 3CR4X 1BF5A 1YVLA 1K8UA 1AJ5A 2BBMA 2KLDA 3BJHA 3CGAA 2MJWB 5KU1A 1B1GA 4GAOA 1OMRA 1IJ5A 1KWOB 3O4YA 3QRXA 4R1EA 1QV0A 2LP2A 1CM1A 3VRPA 3WNXB 4NDBA 2ZFDA 4I5JA 3K21A 2LNKA 1IWQA 4ORBB 2F3ZA 2KYFA 1EG4A 4M2PA 3AAJA 2JTZA 1TIZA 4E68A 3VRNA 1TCOB 3R72A 5I2LA 1HQVA 3B7AA 2JPOA 4ORAB 3B6XA 1NCZA 1KCYA 1SSEB 4P5OE 2HQWA 2B1UA 1RFJA 1YX8A 1OOHA 1F70A 1W7JB 1ORGA 2BAPA 1TUZA 2LANA 3IVTA 1GGWA 2QEHA 1CDMA 1QV1A 3KO0A 3AKAA 3SS5A 3NHIA 1TNQA 1CMGA 3CTNA 1QLKA 3S0DA 2Q91A 2EHBA 1UHHA 2WC5A 3DZTA 1ALVA 2NCOA 1DJYA 2BBNA 2CCMA 1LA3A 1LVCD 1M63B 2WNDA 3CLNA 4HREE 4WQ2A 4D1EA 1DELA 1FI6A 1S5GY 3B87A 1B7TZ 4YI8A 2LV7A 4YI9A 2JT0A 1PRWA 3D77A 3FE6A 4U8DA 1LS8A 1YVHA 2JRFA 3BUMB 2QPTA 3A4UB 4I5KA 1SNLA 1OE9B 2JXLA 4NQGA 4YGBB 3B88A 5I2OA 2LCPA 1J1EA 4GFTA 2K0JA 5HKWA 3BOWA 3BYAA 1BMOA 4PE7A 1C07A 3CWGA 1MR8A 3R1PA 1S3PA 3BQ3A 2L51A 2GGMA 2MRDA 1SR6C 1KQVA 1RROA 1DQEA 1L7ZA 3KF9A 1RECA 1OMVA 1TRFA 3C1VA 4PALA 5JOLA 1C7VA 5KSZA 2JU0A 3NSKA 4ETOA 3I5HB 1QX2A 4YGAA 3R1OA 1NP8A 4F0ZB 3ZWHA 1J7PA 2KHNA 3JVTC 1EG3A 1NX2A 4AQJA 1UHNA 1K2HA 3LCPC 2WCKA 3QMEA 3FS7A 1RJVA 1SL8A 3LL8B 2JPTA 3H4SE 2SASA 4GGFA 2NLNA 2ERBA 2KPHA 2ZRTA 4OV2A 4PE0A 1IH0A 2PASA 4PE4A 2MLEC 4DUQA 4M2QA 1B4CA 3TUYC 1IRJA 1B8RA 1K9UA 1KFUL 1YUSA 1GM0A 1S26D 2LLTA 1BU3A 3DF0A 3TDUA 1W7IB 3EG5B 1YURA 3PM2A 2E30A 2HQ8A 1NX3A 1SPYA 1SCMC 3D0YA 4GGFC 5D3OA 3CYZA 2E6WA 3D73A 4NDCA 1DJHA 3VROA 1SR6B 2KQ6A 2BE4A 1XFXO 1FI5A 1XA5A 3D75A 1KFXL 4MBEA 1EXRA 1WLZA 2PALA 3AAKA 4L9MA 4TNCA 3BOWB 1S1EA 3D74A 1OOJA 2LVIA 1NCYA 2OTGC 2LLSA 3CABA 1XFRA 1S6IA 3FE9A 2K2FA 3ZNIA 1JBAA 1MXLC 1R6PA 2GTEA 1QASA 3JVTB 3PM8A 4YGDB 5HLOA 5PALA 3BUNB 2MBXA 5BPJA 2BECA 1JSAA 1YUUA 3VRQA 1D1OA 3DVJA 3BUXB 1AUIB 1PK0D 3EKHA 1RK9A 1MUXA 2BCAA 4CFRA 2KGBC 2QEVA 1S5GZ 3CS1A 4WQ3A 2FCDA 3S0AA 2WOSA 3I5FC 3TUYB 1ZACA 1A4PA 1WRZA 1DVIA 4PE1A 1QLSA 3GOFA 3AKBA 3VB1A 4IJ7A 2JNXA 4USLA 4DIRA 2NZ0A 4AOMA 5HLVA 2QDIA 2M49B 3V2LA 5HYDA 1SCMB 4JQ0D 5JJGA 4MN0A 2LMVA 1KK8C 2KFGA 4ZCUA 3BFHA 2Y4QA 1UURA 2KAXA 2R2IA 4NDDA 5FI6A 1B8LA 3S0BA 3DF0B 1DGVA 2L5XB 3WHTB 3NSOA 1XK4C 3I5GB 1KQMB 2H2KA 4DS7A 4FTGA 2Q4UA 3D0YB 3N7HA 4I5LB 1CDNA 3PFVA 1BOCA 1OOFA 3TDIA 3OB1B 1DMOA 1JC2A 2WCLA 2JC2A 2O60A 2L4HA 1CM4A 5CSIA 1WLMA 1H4BA 1YUTA 1JUOA 2BL0C 1SK6D 2H61C 2LLUA 1TNXA 3B86A 1UHJA 3SG6A 1GGZA 2MLFC 2KSPA 2M29A 3I5FB 1V1GA 2Y1MA 2JULA 3OGNA 1C7WA 1MQ1A 1HT9A 1LA0A 3PN7C 5K89A 1FPWA 5CSFA 3NXAA 1LXFC 1S6JA 1PVBA 1IGVA 1WDCC 1TWOA 1NX1A 1SBJA 2I2RE 2WCJA 2K60A 1V1FA 2NXQA 1SW8A 3RZSA 1F4OA 4YGEB 4ORCB 3O6BA 3OX6A 1J55A 3DVMA 5DICA 2AUCA 2M0RA 1B8CA 2ZKMX 2PSRA 2OS8C 3FIAA 2KI6D 1PVAA 2FJUB 2QEOA 2KLEA 1G8IA 3SG4A 1NCXA 2EC6C 3SIAA 2Y1NA 1BG1A 1CMFA 1B9AA 2Y5IA 2P70A 2DOQA 1H8BA 2JZIA 1TNWA 1QX5B 2ZNDA 3KHEA 5B8IB 1JF2A 2BL0B 2PVBA 1QIVA 4JKTA 4WRIA 2HETA 3SG7A 1CNPA 4OZDA 2ZN8A 1QTXA 3SIBA 3IQQA 2JQ6A 1AK8A 2EGDA 2WCEA 5HKYA 2GGZA 5HL1A 1X02A 4DRWA 3BXKA 4N1GA 1WDCB 1BR4B 3TZ1A 5TNCA 2F8PA 3LLEA 4ZCVA 1OOGA 1TTXA 2O5GA 1AJ4A 2OS8B 3Q8IA 1OMDA 1KK7Y 2JT8A 3EKJA 1A2XA 1N2DA 1AVSA 2KI4C 3JTDC 2WCHA 3PSRA 4XJKA 2EC6B 4HRGA 3VGOA 1MWNA 1SY9A 1UP5A 1XFWO 1NUBA 5CSJA 1YR5A 3EK7A 1Z4HA 1SKTA 1XFUO 3LK0A 1DEKA 1Q80A 1ZMZA 1SCVA 1M45A 4N1FA 1DC1A 1PALA 4C0JA 4CIDA 2LM5A 2P6BB 4PT1A 3CR2A 3GK2A 2A4JA 4PHMA 1CFFA 1C3ZA 1P28A 1DJIA 1LINA 3NGVA 2RGIA 3BUWB 2WCFA 3NSLA 2M7LA 2QEBA 2FCEA 2P71A 3EVRA 3L4AA 4XYNA 1IJ6A 3CZTX 1PSBA 1L2OC 3L4LA 1FBVA 1J7QA 2KGRA 1ZUZA 3I5IC 1EJ3A 1DJXA 1OW4A 1R2UA 2FJYA 2F2PA 2KOTA 3CZ0A 3BFBA 1BJFA 1K90D 1M39A 2BE6A 1RTP1 4YBHB 1K95A 1Y1AA 4MRYA 3JTDB 1OOIX 1K93D 1UHKA 1ALWA 3HX4A 3EK8A 4N5XA 3DXLA 5ER4X 2K7BA 3E3RA 3SG3A 2K7CA 2LVJA 5CPVA 4MLWA 1YX7A 2LUXA 1TCFA 3UO9A 3GK1A 5CSNA 2BCBA 4IL1A 1GJYA 3O78A 4XJKB 2V53A 4QJ4B 1G4YR 1A75A 1OZOA 2BCXA 1XK4A 3S0FA 3CZ1A 4MZKA 3LK1A 5J3XA 2M1KB 2M1UA 1BT6A 3SS3A 1UHIA 2YGUA 1NSHA 1L2OB 3SJSA 2F2OA 2LHIA 1CLBA
chains in the Genus database with same CATH topology
4OR9B 3I5IB 3MSEB 1YRTB 1NWDA 3DVEA 3PALA 1AHRA 2H61A 4OCIA 4YGCB 1XFYO 5HKZA 1F54A 3FWBA 2OTGB 1ZFSA 5AANA 4CFQA 4BY4A 1F8HA 1SL7A 1IQ3A 1KK7Z 1N65A 2JTTA 1JWDA 1J1DA 2IS9A 4PDZA 1EH2A 4GBAA 2WORA 1YTZC 1CKKA 2MHHA 5I2QA 2LAPA 1G33A 4A4BA 1CLLA 1OQPA 2CBLA 2I18A 4I5NB 3OB2B 3VRRA 1A03A 1DJZA 1GQMA 1K9KA 2JXCA 2KBIA 2SCPA 1SYMA 1F71A 2L50A 1KSOA 1LKJA 3RM1A 1U5IA 4PCWA 1KK8B 4GPLB 5AFPA 1DTLA 5G08A 5AXIA 2JOJA 2KNEA 5FYXA 4C0KA 2KAVA 2ZNEA 5I8NA 1FW4A 1A75B 2ZRSA 5DKRA 2QACA 1IG5A 1M31A 2HPSA 2CTNA 5AERA 2CXJA 4A4CA 3M0WA 2K61A 3PLFB 2CT9A 4DCKA 3OP0A 1WY9A 1NIWA 4UPGA 1UWOA 2F3YA 2G2BA 4JWQA 1XFZO 2LC5A 3SG5A 3EVVA 4Q04A 1NPQA 1OZSA 2CNPA 3F45A 5F6TA 4OVNF 1CB1A 2KDHA 4M2OA 3OX5A 1J7RA 1NYAA 1SMGA 4MEWA 3PN7B 1PULA 1TN4A 3I5HC 1N0YA 1QX7A 2WC8A 2TN4A 1B47A 2LE9B 2MAZA 1CDPA 2L2EA 4ICBA 2LVVA 2I7AA 2PMYA 1DF0A 4PHNA 3ICBA 1XFVO 5GQQC 1Y1UA 5D7FA 1BR1B 4JPZB 1CFDA 5ER5A 2F33A 2M9GA 2BKHB 2VRGA 3KEVA 2KFHA 1SRAA 2LUCA 3FWCA 1ZOTB 1U5IB 1VRKA 2JNFA 3GK4X 2G9BA 3KPXA 1NX0A 4FQOA 4GGNA 3PATA 4HRHA 3TS5C 1EL4A 2D8NA 1E8AA 2M97A 1DJWA 4YRUA 1QVIY 3SG2A 2M3WA 1WRKA 4QJ5B 2COLB 2L0PA 3EK4A 1KSMA 4OKHA 2L4IA 1CTRA 2PRUA 1YRUB 1DGUA 5KTYA 2AAOA 1BODA 2ISDA 1CDLA 2HF5A 1DJGA 1ODBA 2KI6C 4GNKB 2LMUA 2M7NA 2MA2A 5D69A 4PHKA 1DT7B 3WXAA 3DVKA 1QS7A 1SL9A 1F55A 4CPVA 1Y1XA 1MXEA 2LHLA 3BUOB 4QJ3B 1S6CA 1M46A 3WHUB 1K9PA 4GUKA 5DKNA 1CFPA 2WCBA 1BLQA 1J7OA 1JFKA 2KI4B 1XYDA 1TOPA 1MF8B 1Y6WA 3CR5X 4P2YB 2L98A 1Y0VH 4MRXA 2LVKA 1QIWA 1DF0B 3TS5B 3A8RA 3EVUA 4BY5A 3IQOA 4PHJA 1F4QA 2JT3A 1FF1A 1JF0A 2FOTA 1S36A 4CLNA 1JFJA 5AEQA 4MZLA 1PSRA 1QATA 3O2PA 2GV5A 2K7DA 2ZN9A 1AP4A 4C0LA 2NCPA 1KQMC 3I5GC 1XO5A 2JWWA 1B7TY 1RWYA 1TNPA 3HCMA 1OSAA 1KWOC 2M8UA 2OPOA 1WRLA 3IF7A 1KFUS 2K8MB 1K94A 2KBMA 3NSIA 1A29A 3OHMB 2K7OA 4MZJA 5IBWA 2LMTA 2LP3A 2BKIB 3DD4A 2AMIA 2KFFA 3D10A 4AQIA 1IKUA 3RLZA 1K96A 1KFXS 4HSZA 4MVFA 1XVJA 3TDZA 4MSPA 2I94A 1UUSA 2KYCA 1IQ5A 2KQYA 2K2AA 2KAYA 1QJTA 1MHOA 5DKQA 1QVIZ 1CLMA 1CFCA 1QXPA 3CR4X 1BF5A 1YVLA 1K8UA 1AJ5A 2BBMA 3CGAA 5KU1A 1B1GA 2MJWB 4GAOA 1OMRA 1IJ5A 1KWOB 3O4YA 3QRXA 4R1EA 1QV0A 2LP2A 1CM1A 3VRPA 3WNXB 4NDBA 2ZFDA 4I5JA 3K21A 2LNKA 1IWQA 4ORBB 2F3ZA 2KYFA 1EG4A 4M2PA 3AAJA 2JTZA 1TIZA 4E68A 3VRNA 1TCOB 5I2LA 1HQVA 4ORAB 1KCYA 1NCZA 4P5OE 2HQWA 2B1UA 1RFJA 1YX8A 1F70A 1W7JB 2LANA 1GGWA 1CDMA 1QV1A 3KO0A 3AKAA 1CMGA 1TNQA 3CTNA 1QLKA 2Q91A 2EHBA 1UHHA 1ALVA 2NCOA 1DJYA 2BBNA 2CCMA 1LA3A 1LVCD 1M63B 2WNDA 3CLNA 4HREE 4WQ2A 4D1EA 1FI6A 1S5GY 1B7TZ 4YI8A 2LV7A 4YI9A 2JT0A 1PRWA 4U8DA 1YVHA 2JRFA 3BUMB 2QPTA 3A4UB 4I5KA 1SNLA 1OE9B 2JXLA 4NQGA 4YGBB 5I2OA 2LCPA 1J1EA 4GFTA 2K0JA 5HKWA 3BOWA 3BYAA 1BMOA 4PE7A 1C07A 3CWGA 1MR8A 1S3PA 3BQ3A 2L51A 2GGMA 2MRDA 1SR6C 1KQVA 1RROA 1L7ZA 3KF9A 1RECA 1OMVA 1TRFA 3C1VA 4PALA 5JOLA 1C7VA 5KSZA 2JU0A 3NSKA 4ETOA 3I5HB 1QX2A 4YGAA 1NP8A 4F0ZB 3ZWHA 1J7PA 2KHNA 3JVTC 1EG3A 1NX2A 4AQJA 1UHNA 1K2HA 3LCPC 3FS7A 1RJVA 1SL8A 3LL8B 2JPTA 3H4SE 2SASA 4GGFA 2NLNA 2ZRTA 4OV2A 4PE0A 1IH0A 2PASA 4PE4A 2MLEC 4DUQA 4M2QA 1B4CA 3TUYC 1IRJA 1B8RA 1K9UA 1KFUL 1YUSA 1S26D 2LLTA 1BU3A 3DF0A 3TDUA 1W7IB 1YURA 2E30A 2HQ8A 1NX3A 1SPYA 1SCMC 3D0YA 4GGFC 2E6WA 4NDCA 1DJHA 3VROA 1SR6B 2KQ6A 2BE4A 1XFXO 1FI5A 1XA5A 4MBEA 1KFXL 1EXRA 1WLZA 2PALA 3AAKA 4L9MA 4TNCA 3BOWB 1S1EA 1OOJA 2LVIA 1NCYA 2OTGC 2LLSA 1S6IA 3ZNIA 2K2FA 1JBAA 1MXLC 1R6PA 3JVTB 1QASA 3PM8A 5HLOA 4YGDB 5PALA 2MBXA 3BUNB 5BPJA 2BECA 1JSAA 1YUUA 3VRQA 1D1OA 3DVJA 3BUXB 1AUIB 1PK0D 3EKHA 1RK9A 1MUXA 2BCAA 4CFRA 2KGBC 1S5GZ 3CS1A 4WQ3A 2FCDA 2WOSA 3I5FC 3TUYB 1ZACA 1A4PA 1WRZA 1DVIA 4PE1A 1QLSA 3GOFA 3AKBA 2JNXA 4USLA 4DIRA 2NZ0A 4AOMA 5HLVA 5HYDA 2M49B 1SCMB 4JQ0D 5JJGA 4MN0A 2LMVA 1KK8C 2KFGA 4ZCUA 2Y4QA 1UURA 2KAXA 2R2IA 4NDDA 1B8LA 3DF0B 1DGVA 2L5XB 3WHTB 3NSOA 1XK4C 3I5GB 1KQMB 2H2KA 4DS7A 4FTGA 2Q4UA 3D0YB 4I5LB 1CDNA 3PFVA 1BOCA 3TDIA 3OB1B 1DMOA 1JC2A 2JC2A 2O60A 2L4HA 1CM4A 5CSIA 1WLMA 1H4BA 1YUTA 1JUOA 2BL0C 1SK6D 2H61C 2LLUA 1TNXA 1UHJA 3SG6A 1GGZA 2MLFC 2KSPA 2M29A 3I5FB 1V1GA 2Y1MA 2JULA 1C7WA 1MQ1A 1HT9A 1LA0A 3PN7C 5K89A 1FPWA 5CSFA 3NXAA 1LXFC 1S6JA 1PVBA 1IGVA 1WDCC 1NX1A 1SBJA 2I2RE 1V1FA 2NXQA 1SW8A 1F4OA 4YGEB 4ORCB 3O6BA 3OX6A 1J55A 3DVMA 2AUCA 2M0RA 1B8CA 2ZKMX 2PSRA 2OS8C 3FIAA 2KI6D 1PVAA 2FJUB 3SG4A 1G8IA 1NCXA 2EC6C 3SIAA 2Y1NA 1BG1A 1CMFA 1B9AA 2Y5IA 2DOQA 1H8BA 2JZIA 1TNWA 1QX5B 2ZNDA 3KHEA 5B8IB 1JF2A 2BL0B 2PVBA 1QIVA 4WRIA 1CNPA 2HETA 3SG7A 2ZN8A 1QTXA 3SIBA 3IQQA 2JQ6A 1AK8A 2EGDA 2WCEA 5HKYA 2GGZA 1X02A 4DRWA 3BXKA 4N1GA 1WDCB 1BR4B 3TZ1A 5TNCA 2F8PA 3LLEA 4ZCVA 1TTXA 2O5GA 1AJ4A 2OS8B 1OMDA 1KK7Y 2JT8A 3EKJA 1A2XA 1N2DA 1AVSA 2KI4C 3JTDC 3PSRA 4XJKA 3VGOA 2EC6B 4HRGA 1MWNA 1SY9A 1UP5A 1XFWO 1NUBA 5CSJA 1YR5A 3EK7A 1SKTA 1XFUO 3LK0A 1Q80A 1ZMZA 1SCVA 1M45A 4N1FA 1PALA 4C0JA 4CIDA 2LM5A 2P6BB 3CR2A 3GK2A 2A4JA 4PHMA 1CFFA 1DJIA 1LINA 2RGIA 3BUWB 2WCFA 3NSLA 2M7LA 2FCEA 3EVRA 4XYNA 1IJ6A 3CZTX 1PSBA 1L2OC 1FBVA 1J7QA 2KGRA 1ZUZA 3I5IC 1EJ3A 1DJXA 1R2UA 2F2PA 2KOTA 1BJFA 1K90D 1M39A 2BE6A 1RTP1 4YBHB 1K95A 1Y1AA 4MRYA 3JTDB 1UHKA 1K93D 1ALWA 3HX4A 3EK8A 4N5XA 5ER4X 2K7BA 3E3RA 3SG3A 2K7CA 2LVJA 5CPVA 4MLWA 1YX7A 2LUXA 1TCFA 3GK1A 5CSNA 2BCBA 4IL1A 1GJYA 3O78A 4XJKB 2V53A 4QJ4B 1G4YR 1A75A 1OZOA 2BCXA 1XK4A 4MZKA 3LK1A 5J3XA 2M1KB 2M1UA 1BT6A 1UHIA 1NSHA 1L2OB 3SJSA 2F2OA 2LHIA 1CLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OR9 B;  3I5I B;  3MSE B;  1YRT B;  1NWD A;  3DVE A;  3PAL A;  1AHR A;  2H61 A;  4OCI A;  4YGC B;  1XFY O;  5HKZ A;  1F54 A;  3FWB A;  2OTG B;  1ZFS A;  5AAN A;  4CFQ A;  4BY4 A;  1F8H A;  1SL7 A;  1IQ3 A;  1KK7 Z;  1N65 A;  2JTT A;  1JWD A;  1J1D A;  2IS9 A;  4PDZ A;  1EH2 A;  4GBA A;  2WOR A;  1YTZ C;  1CKK A;  2MHH A;  5I2Q A;  2LAP A;  1G33 A;  4A4B A;  1CLL A;  1OQP A;  2CBL A;  2I18 A;  4I5N B;  3OB2 B;  3VRR A;  1A03 A;  1DJZ A;  1GQM A;  1K9K A;  2JXC A;  2KBI A;  2SCP A;  1SYM A;  1F71 A;  2L50 A;  1KSO A;  1LKJ A;  3RM1 A;  1U5I A;  4PCW A;  1KK8 B;  4GPL B;  5AFP A;  1DTL A;  5G08 A;  5AXI A;  2JOJ A;  2KNE A;  5FYX A;  4C0K A;  2KAV A;  2ZNE A;  5I8N A;  1FW4 A;  1A75 B;  2ZRS A;  5DKR A;  2QAC A;  1IG5 A;  1M31 A;  2HPS A;  2CTN A;  5AER A;  2CXJ A;  4A4C A;  3M0W A;  2K61 A;  3PLF B;  2CT9 A;  4DCK A;  3OP0 A;  1WY9 A;  1NIW A;  4UPG A;  1UWO A;  2F3Y A;  2G2B A;  4JWQ A;  1XFZ O;  2LC5 A;  3SG5 A;  3EVV A;  4Q04 A;  1NPQ A;  1OZS A;  2CNP A;  3F45 A;  5F6T A;  4OVN F;  1CB1 A;  2KDH A;  4M2O A;  3OX5 A;  1J7R A;  1NYA A;  1SMG A;  4MEW A;  3PN7 B;  1PUL A;  1TN4 A;  3I5H C;  1N0Y A;  1QX7 A;  2WC8 A;  2TN4 A;  1B47 A;  2LE9 B;  2MAZ A;  1CDP A;  2L2E A;  4ICB A;  2LVV A;  2I7A A;  2PMY A;  1DF0 A;  4PHN A;  3ICB A;  1XFV O;  5GQQ C;  1Y1U A;  5D7F A;  1BR1 B;  4JPZ B;  1CFD A;  5ER5 A;  2F33 A;  2M9G A;  2BKH B;  2VRG A;  3KEV A;  2KFH A;  1SRA A;  2LUC A;  3FWC A;  1ZOT B;  1U5I B;  1VRK A;  2JNF A;  3GK4 X;  2G9B A;  3KPX A;  1NX0 A;  4FQO A;  4GGN A;  3PAT A;  4HRH A;  3TS5 C;  1EL4 A;  2D8N A;  1E8A A;  2M97 A;  1DJW A;  4YRU A;  1QVI Y;  3SG2 A;  2M3W A;  1WRK A;  4QJ5 B;  2COL B;  2L0P A;  3EK4 A;  1KSM A;  4OKH A;  2L4I A;  1CTR A;  2PRU A;  1YRU B;  1DGU A;  5KTY A;  2AAO A;  1BOD A;  2ISD A;  1CDL A;  2HF5 A;  1DJG A;  1ODB A;  2KI6 C;  4GNK B;  2LMU A;  2M7N A;  2MA2 A;  5D69 A;  4PHK A;  1DT7 B;  3WXA A;  3DVK A;  1QS7 A;  1SL9 A;  1F55 A;  4CPV A;  1Y1X A;  1MXE A;  2LHL A;  3BUO B;  4QJ3 B;  1S6C A;  1M46 A;  3WHU B;  1K9P A;  4GUK A;  5DKN A;  1CFP A;  2WCB A;  1BLQ A;  1J7O A;  1JFK A;  2KI4 B;  1XYD A;  1TOP A;  1MF8 B;  1Y6W A;  3CR5 X;  4P2Y B;  2L98 A;  1Y0V H;  4MRX A;  2LVK A;  1QIW A;  1DF0 B;  3TS5 B;  3A8R A;  3EVU A;  4BY5 A;  3IQO A;  4PHJ A;  1F4Q A;  2JT3 A;  1FF1 A;  1JF0 A;  2FOT A;  1S36 A;  4CLN A;  1JFJ A;  5AEQ A;  4MZL A;  1PSR A;  1QAT A;  3O2P A;  2GV5 A;  2K7D A;  2ZN9 A;  1AP4 A;  4C0L A;  2NCP A;  1KQM C;  3I5G C;  1XO5 A;  2JWW A;  1B7T Y;  1RWY A;  1TNP A;  3HCM A;  1OSA A;  1KWO C;  2M8U A;  2OPO A;  1WRL A;  3IF7 A;  1KFU S;  2K8M B;  1K94 A;  2KBM A;  3NSI A;  1A29 A;  3OHM B;  2K7O A;  4MZJ A;  5IBW A;  2LMT A;  2LP3 A;  2BKI B;  3DD4 A;  2AMI A;  2KFF A;  3D10 A;  4AQI A;  1IKU A;  3RLZ A;  1K96 A;  1KFX S;  4HSZ A;  4MVF A;  1XVJ A;  3TDZ A;  4MSP A;  2I94 A;  1UUS A;  2KYC A;  1IQ5 A;  2KQY A;  2K2A A;  2KAY A;  1QJT A;  1MHO A;  5DKQ A;  1QVI Z;  1CLM A;  1CFC A;  1QXP A;  3CR4 X;  1BF5 A;  1YVL A;  1K8U A;  1AJ5 A;  2BBM A;  3CGA A;  5KU1 A;  1B1G A;  2MJW B;  4GAO A;  1OMR A;  1IJ5 A;  1KWO B;  3O4Y A;  3QRX A;  4R1E A;  1QV0 A;  2LP2 A;  1CM1 A;  3VRP A;  3WNX B;  4NDB A;  2ZFD A;  4I5J A;  3K21 A;  2LNK A;  1IWQ A;  4ORB B;  2F3Z A;  2KYF A;  1EG4 A;  4M2P A;  3AAJ A;  2JTZ A;  1TIZ A;  4E68 A;  3VRN A;  1TCO B;  5I2L A;  1HQV A;  4ORA B;  1KCY A;  1NCZ A;  4P5O E;  2HQW A;  2B1U A;  1RFJ A;  1YX8 A;  1F70 A;  1W7J B;  2LAN A;  1GGW A;  1CDM A;  1QV1 A;  3KO0 A;  3AKA A;  1CMG A;  1TNQ A;  3CTN A;  1QLK A;  2Q91 A;  2EHB A;  1UHH A;  1ALV A;  2NCO A;  1DJY A;  2BBN A;  2CCM A;  1LA3 A;  1LVC D;  1M63 B;  2WND A;  3CLN A;  4HRE E;  4WQ2 A;  4D1E A;  1FI6 A;  1S5G Y;  1B7T Z;  4YI8 A;  2LV7 A;  4YI9 A;  2JT0 A;  1PRW A;  4U8D A;  1YVH A;  2JRF A;  3BUM B;  2QPT A;  3A4U B;  4I5K A;  1SNL A;  1OE9 B;  2JXL A;  4NQG A;  4YGB B;  5I2O A;  2LCP A;  1J1E A;  4GFT A;  2K0J A;  5HKW A;  3BOW A;  3BYA A;  1BMO A;  4PE7 A;  1C07 A;  3CWG A;  1MR8 A;  1S3P A;  3BQ3 A;  2L51 A;  2GGM A;  2MRD A;  1SR6 C;  1KQV A;  1RRO A;  1L7Z A;  3KF9 A;  1REC A;  1OMV A;  1TRF A;  3C1V A;  4PAL A;  5JOL A;  1C7V A;  5KSZ A;  2JU0 A;  3NSK A;  4ETO A;  3I5H B;  1QX2 A;  4YGA A;  1NP8 A;  4F0Z B;  3ZWH A;  1J7P A;  2KHN A;  3JVT C;  1EG3 A;  1NX2 A;  4AQJ A;  1UHN A;  1K2H A;  3LCP C;  3FS7 A;  1RJV A;  1SL8 A;  3LL8 B;  2JPT A;  3H4S E;  2SAS A;  4GGF A;  2NLN A;  2ZRT A;  4OV2 A;  4PE0 A;  1IH0 A;  2PAS A;  4PE4 A;  2MLE C;  4DUQ A;  4M2Q A;  1B4C A;  3TUY C;  1IRJ A;  1B8R A;  1K9U A;  1KFU L;  1YUS A;  1S26 D;  2LLT A;  1BU3 A;  3DF0 A;  3TDU A;  1W7I B;  1YUR A;  2E30 A;  2HQ8 A;  1NX3 A;  1SPY A;  1SCM C;  3D0Y A;  4GGF C;  2E6W A;  4NDC A;  1DJH A;  3VRO A;  1SR6 B;  2KQ6 A;  2BE4 A;  1XFX O;  1FI5 A;  1XA5 A;  4MBE A;  1KFX L;  1EXR A;  1WLZ A;  2PAL A;  3AAK A;  4L9M A;  4TNC A;  3BOW B;  1S1E A;  1OOJ A;  2LVI A;  1NCY A;  2OTG C;  2LLS A;  1S6I A;  3ZNI A;  2K2F A;  1JBA A;  1MXL C;  1R6P A;  3JVT B;  1QAS A;  3PM8 A;  5HLO A;  4YGD B;  5PAL A;  2MBX A;  3BUN B;  5BPJ A;  2BEC A;  1JSA A;  1YUU A;  3VRQ A;  1D1O A;  3DVJ A;  3BUX B;  1AUI B;  1PK0 D;  3EKH A;  1RK9 A;  1MUX A;  2BCA A;  4CFR A;  2KGB C;  1S5G Z;  3CS1 A;  4WQ3 A;  2FCD A;  2WOS A;  3I5F C;  3TUY B;  1ZAC A;  1A4P A;  1WRZ A;  1DVI A;  4PE1 A;  1QLS A;  3GOF A;  3AKB A;  2JNX A;  4USL A;  4DIR A;  2NZ0 A;  4AOM A;  5HLV A;  5HYD A;  2M49 B;  1SCM B;  4JQ0 D;  5JJG A;  4MN0 A;  2LMV A;  1KK8 C;  2KFG A;  4ZCU A;  2Y4Q A;  1UUR A;  2KAX A;  2R2I A;  4NDD A;  1B8L A;  3DF0 B;  1DGV A;  2L5X B;  3WHT B;  3NSO A;  1XK4 C;  3I5G B;  1KQM B;  2H2K A;  4DS7 A;  4FTG A;  2Q4U A;  3D0Y B;  4I5L B;  1CDN A;  3PFV A;  1BOC A;  3TDI A;  3OB1 B;  1DMO A;  1JC2 A;  2JC2 A;  2O60 A;  2L4H A;  1CM4 A;  5CSI A;  1WLM A;  1H4B A;  1YUT A;  1JUO A;  2BL0 C;  1SK6 D;  2H61 C;  2LLU A;  1TNX A;  1UHJ A;  3SG6 A;  1GGZ A;  2MLF C;  2KSP A;  2M29 A;  3I5F B;  1V1G A;  2Y1M A;  2JUL A;  1C7W A;  1MQ1 A;  1HT9 A;  1LA0 A;  3PN7 C;  5K89 A;  1FPW A;  5CSF A;  3NXA A;  1LXF C;  1S6J A;  1PVB A;  1IGV A;  1WDC C;  1NX1 A;  1SBJ A;  2I2R E;  1V1F A;  2NXQ A;  1SW8 A;  1F4O A;  4YGE B;  4ORC B;  3O6B A;  3OX6 A;  1J55 A;  3DVM A;  2AUC A;  2M0R A;  1B8C A;  2ZKM X;  2PSR A;  2OS8 C;  3FIA A;  2KI6 D;  1PVA A;  2FJU B;  3SG4 A;  1G8I A;  1NCX A;  2EC6 C;  3SIA A;  2Y1N A;  1BG1 A;  1CMF A;  1B9A A;  2Y5I A;  2DOQ A;  1H8B A;  2JZI A;  1TNW A;  1QX5 B;  2ZND A;  3KHE A;  5B8I B;  1JF2 A;  2BL0 B;  2PVB A;  1QIV A;  4WRI A;  1CNP A;  2HET A;  3SG7 A;  2ZN8 A;  1QTX A;  3SIB A;  3IQQ A;  2JQ6 A;  1AK8 A;  2EGD A;  2WCE A;  5HKY A;  2GGZ A;  1X02 A;  4DRW A;  3BXK A;  4N1G A;  1WDC B;  1BR4 B;  3TZ1 A;  5TNC A;  2F8P A;  3LLE A;  4ZCV A;  1TTX A;  2O5G A;  1AJ4 A;  2OS8 B;  1OMD A;  1KK7 Y;  2JT8 A;  3EKJ A;  1A2X A;  1N2D A;  1AVS A;  2KI4 C;  3JTD C;  3PSR A;  4XJK A;  3VGO A;  2EC6 B;  4HRG A;  1MWN A;  1SY9 A;  1UP5 A;  1XFW O;  1NUB A;  5CSJ A;  1YR5 A;  3EK7 A;  1SKT A;  1XFU O;  3LK0 A;  1Q80 A;  1ZMZ A;  1SCV A;  1M45 A;  4N1F A;  1PAL A;  4C0J A;  4CID A;  2LM5 A;  2P6B B;  3CR2 A;  3GK2 A;  2A4J A;  4PHM A;  1CFF A;  1DJI A;  1LIN A;  2RGI A;  3BUW B;  2WCF A;  3NSL A;  2M7L A;  2FCE A;  3EVR A;  4XYN A;  1IJ6 A;  3CZT X;  1PSB A;  1L2O C;  1FBV A;  1J7Q A;  2KGR A;  1ZUZ A;  3I5I C;  1EJ3 A;  1DJX A;  1R2U A;  2F2P A;  2KOT A;  1BJF A;  1K90 D;  1M39 A;  2BE6 A;  1RTP 1;  4YBH B;  1K95 A;  1Y1A A;  4MRY A;  3JTD B;  1UHK A;  1K93 D;  1ALW A;  3HX4 A;  3EK8 A;  4N5X A;  5ER4 X;  2K7B A;  3E3R A;  3SG3 A;  2K7C A;  2LVJ A;  5CPV A;  4MLW A;  1YX7 A;  2LUX A;  1TCF A;  3GK1 A;  5CSN A;  2BCB A;  4IL1 A;  1GJY A;  3O78 A;  4XJK B;  2V53 A;  4QJ4 B;  1G4Y R;  1A75 A;  1OZO A;  2BCX A;  1XK4 A;  4MZK A;  3LK1 A;  5J3X A;  2M1K B;  2M1U A;  1BT6 A;  1UHI A;  1NSH A;  1L2O B;  3SJS A;  2F2O A;  2LHI A;  1CLB A; 
#chains in the Genus database with same CATH topology
 4OR9 B;  3I5I B;  3DYE A;  3MSE B;  1YRT B;  1NWD A;  3DVE A;  3PAL A;  3PJI A;  1AHR A;  2H61 A;  4OCI A;  4YGC B;  1XFY O;  5HKZ A;  1F54 A;  1T14 A;  3FWB A;  2OTG B;  1ZFS A;  5AAN A;  4CFQ A;  4BY4 A;  1F8H A;  1SL7 A;  1IQ3 A;  1KK7 Z;  1N65 A;  2JTT A;  1JWD A;  1J1D A;  2IS9 A;  4PDZ A;  1EH2 A;  4GBA A;  2WOR A;  1YTZ C;  1CKK A;  2MHH A;  5I2Q A;  2LAP A;  3D78 A;  1G33 A;  4A4B A;  1CLL A;  1OQP A;  3BFA A;  2CBL A;  2I18 A;  4I5N B;  3OB2 B;  3VRR A;  3R1V A;  1A03 A;  1DJZ A;  1GQM A;  1K9K A;  2JXC A;  2KBI A;  2SCP A;  1SYM A;  1F71 A;  2L50 A;  1KSO A;  1LKJ A;  3RM1 A;  1U5I A;  4PCW A;  1KK8 B;  4GPL B;  5AFP A;  1DTL A;  5G08 A;  5AXI A;  2JOJ A;  2KNE A;  5FYX A;  1Z2C B;  1TUJ A;  2KAV A;  2ZNE A;  4C0K A;  5I8N A;  1FW4 A;  1A75 B;  2ZRS A;  5DKR A;  2QAC A;  4F7F A;  1IG5 A;  1M31 A;  2HPS A;  2CTN A;  5AER A;  2CXJ A;  4A4C A;  3M0W A;  2K61 A;  3PLF B;  2CT9 A;  4DCK A;  3OP0 A;  5FI2 A;  1WY9 A;  1NIW A;  4UPG A;  1UWO A;  2F3Y A;  2PQL A;  2G2B A;  4JWQ A;  1XFZ O;  2LC5 A;  3SG5 A;  3EVV A;  4Q04 A;  1NPQ A;  1OZS A;  2CNP A;  3F45 A;  5F6T A;  4OVN F;  1CB1 A;  2KDH A;  4M2O A;  3OX5 A;  1J7R A;  1NYA A;  1SMG A;  4MEW A;  3PN7 B;  1PUL A;  1TN4 A;  3I5H C;  1N0Y A;  1QX7 A;  2WC8 A;  2TN4 A;  1B47 A;  2LE9 B;  2MAZ A;  1CDP A;  3SS4 A;  2L2E A;  4ICB A;  2LVV A;  2I7A A;  2PMY A;  1DF0 A;  3O4X A;  4PHN A;  3ICB A;  1XFV O;  5GQQ C;  1Y1U A;  5D7F A;  1BR1 B;  4JPZ B;  1CFD A;  5ER5 A;  2F33 A;  2M9G A;  2BKH B;  2VRG A;  3KEV A;  2KFH A;  1SRA A;  2LUC A;  3FWC A;  1ZOT B;  1U5I B;  1VRK A;  2JNF A;  3GK4 X;  2G9B A;  3KPX A;  1NX0 A;  4FQO A;  4GGN A;  3DY9 A;  3PAT A;  3OBV A;  4HRH A;  3TS5 C;  2PYQ A;  1EL4 A;  2D8N A;  1E8A A;  2M97 A;  1DJW A;  4YRU A;  4KYN A;  1QVI Y;  3SG2 A;  2M3W A;  1WRK A;  4QJ5 B;  2COL B;  2L0P A;  1IIO A;  3EK4 A;  1KSM A;  4OKH A;  2L4I A;  1CTR A;  2PRU A;  1YRU B;  1DGU A;  5KTY A;  2AAO A;  1BOD A;  2ISD A;  1CDL A;  2HF5 A;  1DJG A;  1ODB A;  2KI6 C;  4GNK B;  2LMU A;  2M7N A;  2MA2 A;  5D69 A;  2WC6 A;  3CZ2 A;  4PHK A;  1DT7 B;  3WXA A;  3DVK A;  1QS7 A;  1SL9 A;  4FQT A;  1F55 A;  4CPV A;  1Y1X A;  1MXE A;  2LHL A;  3BUO B;  4INW A;  1S6C A;  4QJ3 B;  1M46 A;  2L2C A;  3WHU B;  1K9P A;  4GUK A;  5DKN A;  1CFP A;  2WCB A;  3NHT A;  1BLQ A;  1JFK A;  2KI4 B;  1J7O A;  1XYD A;  1TOP A;  1MF8 B;  2H8V A;  1Y6W A;  2WCM A;  3CR5 X;  1C3Y A;  4P2Y B;  2L98 A;  1Y0V H;  4MRX A;  2LVK A;  1QIW A;  3UNW A;  1DF0 B;  3TS5 B;  3A8R A;  3EVU A;  4BY5 A;  3IQO A;  4PHJ A;  3FE8 A;  1F4Q A;  2JT3 A;  1FF1 A;  1JF0 A;  5FI7 A;  2FOT A;  1S36 A;  4CLN A;  1JFJ A;  5AEQ A;  3L47 A;  1PSR A;  1QAT A;  3O2P A;  2GV5 A;  2K7D A;  2ZN9 A;  4JD9 A;  4MZL A;  1AP4 A;  4C0L A;  2NCP A;  1KQM C;  3I5G C;  1XO5 A;  2JWW A;  1B7T Y;  1RWY A;  1TNP A;  3D76 A;  3HCM A;  1OSA A;  3S0G A;  1KWO C;  2M8U A;  2OPO A;  1WRL A;  3CDN A;  3IF7 A;  1KFU S;  3K1E A;  2K8M B;  1K94 A;  2KBM A;  3NSI A;  1A29 A;  3OHM B;  2K7O A;  4MZJ A;  5IBW A;  1W9Z A;  2LMT A;  5EL2 A;  2LP3 A;  2BKI B;  3DD4 A;  2AMI A;  2KFF A;  3D10 A;  4AQI A;  1IKU A;  3RLZ A;  1K96 A;  1KFX S;  2L5Y A;  5I94 A;  1QWV A;  4HSZ A;  4MVF A;  1XVJ A;  3TDZ A;  4MSP A;  2I94 A;  1UUS A;  2KYC A;  4INX A;  1IQ5 A;  2KQY A;  3S0E A;  2K2A A;  2KAY A;  1QJT A;  1MHO A;  5DKQ A;  2BNX A;  1QVI Z;  1CLM A;  1CFC A;  1QXP A;  3CR4 X;  1BF5 A;  1YVL A;  1K8U A;  1AJ5 A;  2BBM A;  2KLD A;  3BJH A;  3CGA A;  2MJW B;  5KU1 A;  1B1G A;  4GAO A;  1OMR A;  1IJ5 A;  1KWO B;  3O4Y A;  3QRX A;  4R1E A;  1QV0 A;  2LP2 A;  1CM1 A;  3VRP A;  3WNX B;  4NDB A;  2ZFD A;  4I5J A;  3K21 A;  2LNK A;  1IWQ A;  4ORB B;  2F3Z A;  2KYF A;  1EG4 A;  4M2P A;  3AAJ A;  2JTZ A;  1TIZ A;  4E68 A;  3VRN A;  1TCO B;  3R72 A;  5I2L A;  1HQV A;  3B7A A;  2JPO A;  4ORA B;  3B6X A;  1NCZ A;  1KCY A;  1SSE B;  4P5O E;  2HQW A;  2B1U A;  1RFJ A;  1YX8 A;  1OOH A;  1F70 A;  1W7J B;  1ORG A;  2BAP A;  1TUZ A;  2LAN A;  3IVT A;  1GGW A;  2QEH A;  1CDM A;  1QV1 A;  3KO0 A;  3AKA A;  3SS5 A;  3NHI A;  1TNQ A;  1CMG A;  3CTN A;  1QLK A;  3S0D A;  2Q91 A;  2EHB A;  1UHH A;  2WC5 A;  3DZT A;  1ALV A;  2NCO A;  1DJY A;  2BBN A;  2CCM A;  1LA3 A;  1LVC D;  1M63 B;  2WND A;  3CLN A;  4HRE E;  4WQ2 A;  4D1E A;  1DEL A;  1FI6 A;  1S5G Y;  3B87 A;  1B7T Z;  4YI8 A;  2LV7 A;  4YI9 A;  2JT0 A;  1PRW A;  3D77 A;  3FE6 A;  4U8D A;  1LS8 A;  1YVH A;  2JRF A;  3BUM B;  2QPT A;  3A4U B;  4I5K A;  1SNL A;  1OE9 B;  2JXL A;  4NQG A;  4YGB B;  3B88 A;  5I2O A;  2LCP A;  1J1E A;  4GFT A;  2K0J A;  5HKW A;  3BOW A;  3BYA A;  1BMO A;  4PE7 A;  1C07 A;  3CWG A;  1MR8 A;  3R1P A;  1S3P A;  3BQ3 A;  2L51 A;  2GGM A;  2MRD A;  1SR6 C;  1KQV A;  1RRO A;  1DQE A;  1L7Z A;  3KF9 A;  1REC A;  1OMV A;  1TRF A;  3C1V A;  4PAL A;  5JOL A;  1C7V A;  5KSZ A;  2JU0 A;  3NSK A;  4ETO A;  3I5H B;  1QX2 A;  4YGA A;  3R1O A;  1NP8 A;  4F0Z B;  3ZWH A;  1J7P A;  2KHN A;  3JVT C;  1EG3 A;  1NX2 A;  4AQJ A;  1UHN A;  1K2H A;  3LCP C;  2WCK A;  3QME A;  3FS7 A;  1RJV A;  1SL8 A;  3LL8 B;  2JPT A;  3H4S E;  2SAS A;  4GGF A;  2NLN A;  2ERB A;  2KPH A;  2ZRT A;  4OV2 A;  4PE0 A;  1IH0 A;  2PAS A;  4PE4 A;  2MLE C;  4DUQ A;  4M2Q A;  1B4C A;  3TUY C;  1IRJ A;  1B8R A;  1K9U A;  1KFU L;  1YUS A;  1GM0 A;  1S26 D;  2LLT A;  1BU3 A;  3DF0 A;  3TDU A;  1W7I B;  3EG5 B;  1YUR A;  3PM2 A;  2E30 A;  2HQ8 A;  1NX3 A;  1SPY A;  1SCM C;  3D0Y A;  4GGF C;  5D3O A;  3CYZ A;  2E6W A;  3D73 A;  4NDC A;  1DJH A;  3VRO A;  1SR6 B;  2KQ6 A;  2BE4 A;  1XFX O;  1FI5 A;  1XA5 A;  3D75 A;  1KFX L;  4MBE A;  1EXR A;  1WLZ A;  2PAL A;  3AAK A;  4L9M A;  4TNC A;  3BOW B;  1S1E A;  3D74 A;  1OOJ A;  2LVI A;  1NCY A;  2OTG C;  2LLS A;  3CAB A;  1XFR A;  1S6I A;  3FE9 A;  2K2F A;  3ZNI A;  1JBA A;  1MXL C;  1R6P A;  2GTE A;  1QAS A;  3JVT B;  3PM8 A;  4YGD B;  5HLO A;  5PAL A;  3BUN B;  2MBX A;  5BPJ A;  2BEC A;  1JSA A;  1YUU A;  3VRQ A;  1D1O A;  3DVJ A;  3BUX B;  1AUI B;  1PK0 D;  3EKH A;  1RK9 A;  1MUX A;  2BCA A;  4CFR A;  2KGB C;  2QEV A;  1S5G Z;  3CS1 A;  4WQ3 A;  2FCD A;  3S0A A;  2WOS A;  3I5F C;  3TUY B;  1ZAC A;  1A4P A;  1WRZ A;  1DVI A;  4PE1 A;  1QLS A;  3GOF A;  3AKB A;  3VB1 A;  4IJ7 A;  2JNX A;  4USL A;  4DIR A;  2NZ0 A;  4AOM A;  5HLV A;  2QDI A;  2M49 B;  3V2L A;  5HYD A;  1SCM B;  4JQ0 D;  5JJG A;  4MN0 A;  2LMV A;  1KK8 C;  2KFG A;  4ZCU A;  3BFH A;  2Y4Q A;  1UUR A;  2KAX A;  2R2I A;  4NDD A;  5FI6 A;  1B8L A;  3S0B A;  3DF0 B;  1DGV A;  2L5X B;  3WHT B;  3NSO A;  1XK4 C;  3I5G B;  1KQM B;  2H2K A;  4DS7 A;  4FTG A;  2Q4U A;  3D0Y B;  3N7H A;  4I5L B;  1CDN A;  3PFV A;  1BOC A;  1OOF A;  3TDI A;  3OB1 B;  1DMO A;  1JC2 A;  2WCL A;  2JC2 A;  2O60 A;  2L4H A;  1CM4 A;  5CSI A;  1WLM A;  1H4B A;  1YUT A;  1JUO A;  2BL0 C;  1SK6 D;  2H61 C;  2LLU A;  1TNX A;  3B86 A;  1UHJ A;  3SG6 A;  1GGZ A;  2MLF C;  2KSP A;  2M29 A;  3I5F B;  1V1G A;  2Y1M A;  2JUL A;  3OGN A;  1C7W A;  1MQ1 A;  1HT9 A;  1LA0 A;  3PN7 C;  5K89 A;  1FPW A;  5CSF A;  3NXA A;  1LXF C;  1S6J A;  1PVB A;  1IGV A;  1WDC C;  1TWO A;  1NX1 A;  1SBJ A;  2I2R E;  2WCJ A;  2K60 A;  1V1F A;  2NXQ A;  1SW8 A;  3RZS A;  1F4O A;  4YGE B;  4ORC B;  3O6B A;  3OX6 A;  1J55 A;  3DVM A;  5DIC A;  2AUC A;  2M0R A;  1B8C A;  2ZKM X;  2PSR A;  2OS8 C;  3FIA A;  2KI6 D;  1PVA A;  2FJU B;  2QEO A;  2KLE A;  1G8I A;  3SG4 A;  1NCX A;  2EC6 C;  3SIA A;  2Y1N A;  1BG1 A;  1CMF A;  1B9A A;  2Y5I A;  2P70 A;  2DOQ A;  1H8B A;  2JZI A;  1TNW A;  1QX5 B;  2ZND A;  3KHE A;  5B8I B;  1JF2 A;  2BL0 B;  2PVB A;  1QIV A;  4JKT A;  4WRI A;  2HET A;  3SG7 A;  1CNP A;  4OZD A;  2ZN8 A;  1QTX A;  3SIB A;  3IQQ A;  2JQ6 A;  1AK8 A;  2EGD A;  2WCE A;  5HKY A;  2GGZ A;  5HL1 A;  1X02 A;  4DRW A;  3BXK A;  4N1G A;  1WDC B;  1BR4 B;  3TZ1 A;  5TNC A;  2F8P A;  3LLE A;  4ZCV A;  1OOG A;  1TTX A;  2O5G A;  1AJ4 A;  2OS8 B;  3Q8I A;  1OMD A;  1KK7 Y;  2JT8 A;  3EKJ A;  1A2X A;  1N2D A;  1AVS A;  2KI4 C;  3JTD C;  2WCH A;  3PSR A;  4XJK A;  2EC6 B;  4HRG A;  3VGO A;  1MWN A;  1SY9 A;  1UP5 A;  1XFW O;  1NUB A;  5CSJ A;  1YR5 A;  3EK7 A;  1Z4H A;  1SKT A;  1XFU O;  3LK0 A;  1DEK A;  1Q80 A;  1ZMZ A;  1SCV A;  1M45 A;  4N1F A;  1DC1 A;  1PAL A;  4C0J A;  4CID A;  2LM5 A;  2P6B B;  4PT1 A;  3CR2 A;  3GK2 A;  2A4J A;  4PHM A;  1CFF A;  1C3Z A;  1P28 A;  1DJI A;  1LIN A;  3NGV A;  2RGI A;  3BUW B;  2WCF A;  3NSL A;  2M7L A;  2QEB A;  2FCE A;  2P71 A;  3EVR A;  3L4A A;  4XYN A;  1IJ6 A;  3CZT X;  1PSB A;  1L2O C;  3L4L A;  1FBV A;  1J7Q A;  2KGR A;  1ZUZ A;  3I5I C;  1EJ3 A;  1DJX A;  1OW4 A;  1R2U A;  2FJY A;  2F2P A;  2KOT A;  3CZ0 A;  3BFB A;  1BJF A;  1K90 D;  1M39 A;  2BE6 A;  1RTP 1;  4YBH B;  1K95 A;  1Y1A A;  4MRY A;  3JTD B;  1OOI X;  1K93 D;  1UHK A;  1ALW A;  3HX4 A;  3EK8 A;  4N5X A;  3DXL A;  5ER4 X;  2K7B A;  3E3R A;  3SG3 A;  2K7C A;  2LVJ A;  5CPV A;  4MLW A;  1YX7 A;  2LUX A;  1TCF A;  3UO9 A;  3GK1 A;  5CSN A;  2BCB A;  4IL1 A;  1GJY A;  3O78 A;  4XJK B;  2V53 A;  4QJ4 B;  1G4Y R;  1A75 A;  1OZO A;  2BCX A;  1XK4 A;  3S0F A;  3CZ1 A;  4MZK A;  3LK1 A;  5J3X A;  2M1K B;  2M1U A;  1BT6 A;  3SS3 A;  1UHI A;  2YGU A;  1NSH A;  1L2O B;  3SJS A;  2F2O A;  2LHI A;  1CLB A; 
#chains in the Genus database with same CATH homology
 4OR9 B;  3I5I B;  3MSE B;  1YRT B;  1NWD A;  3DVE A;  3PAL A;  1AHR A;  2H61 A;  4OCI A;  4YGC B;  1XFY O;  5HKZ A;  1F54 A;  3FWB A;  2OTG B;  1ZFS A;  5AAN A;  4CFQ A;  4BY4 A;  1F8H A;  1SL7 A;  1IQ3 A;  1KK7 Z;  1N65 A;  2JTT A;  1JWD A;  1J1D A;  2IS9 A;  4PDZ A;  1EH2 A;  4GBA A;  2WOR A;  1YTZ C;  1CKK A;  2MHH A;  5I2Q A;  2LAP A;  1G33 A;  4A4B A;  1CLL A;  1OQP A;  2CBL A;  2I18 A;  4I5N B;  3OB2 B;  3VRR A;  1A03 A;  1DJZ A;  1GQM A;  1K9K A;  2JXC A;  2KBI A;  2SCP A;  1SYM A;  1F71 A;  2L50 A;  1KSO A;  1LKJ A;  3RM1 A;  1U5I A;  4PCW A;  1KK8 B;  4GPL B;  5AFP A;  1DTL A;  5G08 A;  5AXI A;  2JOJ A;  2KNE A;  5FYX A;  4C0K A;  2KAV A;  2ZNE A;  5I8N A;  1FW4 A;  1A75 B;  2ZRS A;  5DKR A;  2QAC A;  1IG5 A;  1M31 A;  2HPS A;  2CTN A;  5AER A;  2CXJ A;  4A4C A;  3M0W A;  2K61 A;  3PLF B;  2CT9 A;  4DCK A;  3OP0 A;  1WY9 A;  1NIW A;  4UPG A;  1UWO A;  2F3Y A;  2G2B A;  4JWQ A;  1XFZ O;  2LC5 A;  3SG5 A;  3EVV A;  4Q04 A;  1NPQ A;  1OZS A;  2CNP A;  3F45 A;  5F6T A;  4OVN F;  1CB1 A;  2KDH A;  4M2O A;  3OX5 A;  1J7R A;  1NYA A;  1SMG A;  4MEW A;  3PN7 B;  1PUL A;  1TN4 A;  3I5H C;  1N0Y A;  1QX7 A;  2WC8 A;  2TN4 A;  1B47 A;  2LE9 B;  2MAZ A;  1CDP A;  2L2E A;  4ICB A;  2LVV A;  2I7A A;  2PMY A;  1DF0 A;  4PHN A;  3ICB A;  1XFV O;  5GQQ C;  1Y1U A;  5D7F A;  1BR1 B;  4JPZ B;  1CFD A;  5ER5 A;  2F33 A;  2M9G A;  2BKH B;  2VRG A;  3KEV A;  2KFH A;  1SRA A;  2LUC A;  3FWC A;  1ZOT B;  1U5I B;  1VRK A;  2JNF A;  3GK4 X;  2G9B A;  3KPX A;  1NX0 A;  4FQO A;  4GGN A;  3PAT A;  4HRH A;  3TS5 C;  1EL4 A;  2D8N A;  1E8A A;  2M97 A;  1DJW A;  4YRU A;  1QVI Y;  3SG2 A;  2M3W A;  1WRK A;  4QJ5 B;  2COL B;  2L0P A;  3EK4 A;  1KSM A;  4OKH A;  2L4I A;  1CTR A;  2PRU A;  1YRU B;  1DGU A;  5KTY A;  2AAO A;  1BOD A;  2ISD A;  1CDL A;  2HF5 A;  1DJG A;  1ODB A;  2KI6 C;  4GNK B;  2LMU A;  2M7N A;  2MA2 A;  5D69 A;  4PHK A;  1DT7 B;  3WXA A;  3DVK A;  1QS7 A;  1SL9 A;  1F55 A;  4CPV A;  1Y1X A;  1MXE A;  2LHL A;  3BUO B;  4QJ3 B;  1S6C A;  1M46 A;  3WHU B;  1K9P A;  4GUK A;  5DKN A;  1CFP A;  2WCB A;  1BLQ A;  1J7O A;  1JFK A;  2KI4 B;  1XYD A;  1TOP A;  1MF8 B;  1Y6W A;  3CR5 X;  4P2Y B;  2L98 A;  1Y0V H;  4MRX A;  2LVK A;  1QIW A;  1DF0 B;  3TS5 B;  3A8R A;  3EVU A;  4BY5 A;  3IQO A;  4PHJ A;  1F4Q A;  2JT3 A;  1FF1 A;  1JF0 A;  2FOT A;  1S36 A;  4CLN A;  1JFJ A;  5AEQ A;  4MZL A;  1PSR A;  1QAT A;  3O2P A;  2GV5 A;  2K7D A;  2ZN9 A;  1AP4 A;  4C0L A;  2NCP A;  1KQM C;  3I5G C;  1XO5 A;  2JWW A;  1B7T Y;  1RWY A;  1TNP A;  3HCM A;  1OSA A;  1KWO C;  2M8U A;  2OPO A;  1WRL A;  3IF7 A;  1KFU S;  2K8M B;  1K94 A;  2KBM A;  3NSI A;  1A29 A;  3OHM B;  2K7O A;  4MZJ A;  5IBW A;  2LMT A;  2LP3 A;  2BKI B;  3DD4 A;  2AMI A;  2KFF A;  3D10 A;  4AQI A;  1IKU A;  3RLZ A;  1K96 A;  1KFX S;  4HSZ A;  4MVF A;  1XVJ A;  3TDZ A;  4MSP A;  2I94 A;  1UUS A;  2KYC A;  1IQ5 A;  2KQY A;  2K2A A;  2KAY A;  1QJT A;  1MHO A;  5DKQ A;  1QVI Z;  1CLM A;  1CFC A;  1QXP A;  3CR4 X;  1BF5 A;  1YVL A;  1K8U A;  1AJ5 A;  2BBM A;  3CGA A;  5KU1 A;  1B1G A;  2MJW B;  4GAO A;  1OMR A;  1IJ5 A;  1KWO B;  3O4Y A;  3QRX A;  4R1E A;  1QV0 A;  2LP2 A;  1CM1 A;  3VRP A;  3WNX B;  4NDB A;  2ZFD A;  4I5J A;  3K21 A;  2LNK A;  1IWQ A;  4ORB B;  2F3Z A;  2KYF A;  1EG4 A;  4M2P A;  3AAJ A;  2JTZ A;  1TIZ A;  4E68 A;  3VRN A;  1TCO B;  5I2L A;  1HQV A;  4ORA B;  1KCY A;  1NCZ A;  4P5O E;  2HQW A;  2B1U A;  1RFJ A;  1YX8 A;  1F70 A;  1W7J B;  2LAN A;  1GGW A;  1CDM A;  1QV1 A;  3KO0 A;  3AKA A;  1CMG A;  1TNQ A;  3CTN A;  1QLK A;  2Q91 A;  2EHB A;  1UHH A;  1ALV A;  2NCO A;  1DJY A;  2BBN A;  2CCM A;  1LA3 A;  1LVC D;  1M63 B;  2WND A;  3CLN A;  4HRE E;  4WQ2 A;  4D1E A;  1FI6 A;  1S5G Y;  1B7T Z;  4YI8 A;  2LV7 A;  4YI9 A;  2JT0 A;  1PRW A;  4U8D A;  1YVH A;  2JRF A;  3BUM B;  2QPT A;  3A4U B;  4I5K A;  1SNL A;  1OE9 B;  2JXL A;  4NQG A;  4YGB B;  5I2O A;  2LCP A;  1J1E A;  4GFT A;  2K0J A;  5HKW A;  3BOW A;  3BYA A;  1BMO A;  4PE7 A;  1C07 A;  3CWG A;  1MR8 A;  1S3P A;  3BQ3 A;  2L51 A;  2GGM A;  2MRD A;  1SR6 C;  1KQV A;  1RRO A;  1L7Z A;  3KF9 A;  1REC A;  1OMV A;  1TRF A;  3C1V A;  4PAL A;  5JOL A;  1C7V A;  5KSZ A;  2JU0 A;  3NSK A;  4ETO A;  3I5H B;  1QX2 A;  4YGA A;  1NP8 A;  4F0Z B;  3ZWH A;  1J7P A;  2KHN A;  3JVT C;  1EG3 A;  1NX2 A;  4AQJ A;  1UHN A;  1K2H A;  3LCP C;  3FS7 A;  1RJV A;  1SL8 A;  3LL8 B;  2JPT A;  3H4S E;  2SAS A;  4GGF A;  2NLN A;  2ZRT A;  4OV2 A;  4PE0 A;  1IH0 A;  2PAS A;  4PE4 A;  2MLE C;  4DUQ A;  4M2Q A;  1B4C A;  3TUY C;  1IRJ A;  1B8R A;  1K9U A;  1KFU L;  1YUS A;  1S26 D;  2LLT A;  1BU3 A;  3DF0 A;  3TDU A;  1W7I B;  1YUR A;  2E30 A;  2HQ8 A;  1NX3 A;  1SPY A;  1SCM C;  3D0Y A;  4GGF C;  2E6W A;  4NDC A;  1DJH A;  3VRO A;  1SR6 B;  2KQ6 A;  2BE4 A;  1XFX O;  1FI5 A;  1XA5 A;  4MBE A;  1KFX L;  1EXR A;  1WLZ A;  2PAL A;  3AAK A;  4L9M A;  4TNC A;  3BOW B;  1S1E A;  1OOJ A;  2LVI A;  1NCY A;  2OTG C;  2LLS A;  1S6I A;  3ZNI A;  2K2F A;  1JBA A;  1MXL C;  1R6P A;  3JVT B;  1QAS A;  3PM8 A;  5HLO A;  4YGD B;  5PAL A;  2MBX A;  3BUN B;  5BPJ A;  2BEC A;  1JSA A;  1YUU A;  3VRQ A;  1D1O A;  3DVJ A;  3BUX B;  1AUI B;  1PK0 D;  3EKH A;  1RK9 A;  1MUX A;  2BCA A;  4CFR A;  2KGB C;  1S5G Z;  3CS1 A;  4WQ3 A;  2FCD A;  2WOS A;  3I5F C;  3TUY B;  1ZAC A;  1A4P A;  1WRZ A;  1DVI A;  4PE1 A;  1QLS A;  3GOF A;  3AKB A;  2JNX A;  4USL A;  4DIR A;  2NZ0 A;  4AOM A;  5HLV A;  5HYD A;  2M49 B;  1SCM B;  4JQ0 D;  5JJG A;  4MN0 A;  2LMV A;  1KK8 C;  2KFG A;  4ZCU A;  2Y4Q A;  1UUR A;  2KAX A;  2R2I A;  4NDD A;  1B8L A;  3DF0 B;  1DGV A;  2L5X B;  3WHT B;  3NSO A;  1XK4 C;  3I5G B;  1KQM B;  2H2K A;  4DS7 A;  4FTG A;  2Q4U A;  3D0Y B;  4I5L B;  1CDN A;  3PFV A;  1BOC A;  3TDI A;  3OB1 B;  1DMO A;  1JC2 A;  2JC2 A;  2O60 A;  2L4H A;  1CM4 A;  5CSI A;  1WLM A;  1H4B A;  1YUT A;  1JUO A;  2BL0 C;  1SK6 D;  2H61 C;  2LLU A;  1TNX A;  1UHJ A;  3SG6 A;  1GGZ A;  2MLF C;  2KSP A;  2M29 A;  3I5F B;  1V1G A;  2Y1M A;  2JUL A;  1C7W A;  1MQ1 A;  1HT9 A;  1LA0 A;  3PN7 C;  5K89 A;  1FPW A;  5CSF A;  3NXA A;  1LXF C;  1S6J A;  1PVB A;  1IGV A;  1WDC C;  1NX1 A;  1SBJ A;  2I2R E;  1V1F A;  2NXQ A;  1SW8 A;  1F4O A;  4YGE B;  4ORC B;  3O6B A;  3OX6 A;  1J55 A;  3DVM A;  2AUC A;  2M0R A;  1B8C A;  2ZKM X;  2PSR A;  2OS8 C;  3FIA A;  2KI6 D;  1PVA A;  2FJU B;  3SG4 A;  1G8I A;  1NCX A;  2EC6 C;  3SIA A;  2Y1N A;  1BG1 A;  1CMF A;  1B9A A;  2Y5I A;  2DOQ A;  1H8B A;  2JZI A;  1TNW A;  1QX5 B;  2ZND A;  3KHE A;  5B8I B;  1JF2 A;  2BL0 B;  2PVB A;  1QIV A;  4WRI A;  1CNP A;  2HET A;  3SG7 A;  2ZN8 A;  1QTX A;  3SIB A;  3IQQ A;  2JQ6 A;  1AK8 A;  2EGD A;  2WCE A;  5HKY A;  2GGZ A;  1X02 A;  4DRW A;  3BXK A;  4N1G A;  1WDC B;  1BR4 B;  3TZ1 A;  5TNC A;  2F8P A;  3LLE A;  4ZCV A;  1TTX A;  2O5G A;  1AJ4 A;  2OS8 B;  1OMD A;  1KK7 Y;  2JT8 A;  3EKJ A;  1A2X A;  1N2D A;  1AVS A;  2KI4 C;  3JTD C;  3PSR A;  4XJK A;  3VGO A;  2EC6 B;  4HRG A;  1MWN A;  1SY9 A;  1UP5 A;  1XFW O;  1NUB A;  5CSJ A;  1YR5 A;  3EK7 A;  1SKT A;  1XFU O;  3LK0 A;  1Q80 A;  1ZMZ A;  1SCV A;  1M45 A;  4N1F A;  1PAL A;  4C0J A;  4CID A;  2LM5 A;  2P6B B;  3CR2 A;  3GK2 A;  2A4J A;  4PHM A;  1CFF A;  1DJI A;  1LIN A;  2RGI A;  3BUW B;  2WCF A;  3NSL A;  2M7L A;  2FCE A;  3EVR A;  4XYN A;  1IJ6 A;  3CZT X;  1PSB A;  1L2O C;  1FBV A;  1J7Q A;  2KGR A;  1ZUZ A;  3I5I C;  1EJ3 A;  1DJX A;  1R2U A;  2F2P A;  2KOT A;  1BJF A;  1K90 D;  1M39 A;  2BE6 A;  1RTP 1;  4YBH B;  1K95 A;  1Y1A A;  4MRY A;  3JTD B;  1UHK A;  1K93 D;  1ALW A;  3HX4 A;  3EK8 A;  4N5X A;  5ER4 X;  2K7B A;  3E3R A;  3SG3 A;  2K7C A;  2LVJ A;  5CPV A;  4MLW A;  1YX7 A;  2LUX A;  1TCF A;  3GK1 A;  5CSN A;  2BCB A;  4IL1 A;  1GJY A;  3O78 A;  4XJK B;  2V53 A;  4QJ4 B;  1G4Y R;  1A75 A;  1OZO A;  2BCX A;  1XK4 A;  4MZK A;  3LK1 A;  5J3X A;  2M1K B;  2M1U A;  1BT6 A;  1UHI A;  1NSH A;  1L2O B;  3SJS A;  2F2O A;  2LHI A;  1CLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...