2M7LA

Alfa-actinin from parasite entamoeba histolytica
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
144
structure length
144
Chain Sequence
GSSSGVTAEQMQEFKQSFDAFDGNHDGILDKLEFRSCLSSMGLIDIDFTGGEDAQYDAIYNNVTKGENGVSFDNYVQYMKEKNDENPSPEQLNEIFSTIAAGKDSITETDMQKAGMSAEQIEYVKANLPQKGDGYDYAAWVKTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calponin homology domain protein, putative
publication title Alfa-actinin from parasite Entamoeba histolytica
rcsb
source organism Entamoeba histolytica
molecule tags Structural protein
total genus 48
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2013-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2m7lA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2m7lA02
1IKUA 1DMOA 2F8PA 5I2OA 1KCYA 2JZIA 4MSPA 1WDCB 3IF7A 1G4YR 2KAVA 1IWQA 1KQMB 3SG6A 4MEWA 4OKHA 3LLEA 2R2IA 4AQJA 4PHKA 2RGIA 2LMUA 1A03A 3TDUA 1FPWA 4Q04A 1SKTA 3WXAA 2ZRSA 1QX2A 3OB2B 5I2QA 1JSAA 1YUUA 2QACA 2KDHA 1DGVA 1U5IB 2KSPA 3KPXA 3C1VA 1GGWA 1FW4A 1H4BA 4YI8A 4CLNA 1CLBA 2KFFA 4BY5A 3CR4X 1S6IA 2KI4B 1XFVO 1CMFA 1L2OB 2JXCA 4M2OA 3TS5B 4DS7A 4YGCB 1AHRA 1QLKA 1MXEA 4NDBA 3BUWB 2LLTA 4YGDB 4M2QA 3PLFB 1JBAA 2K2AA 3VRQA 1XFYO 3PM8A 4YRUA 5F6TA 4AOMA 2V53A 3BYAA 1SR6B 1KFXS 1SW8A 1UHJA 3A8RA 1BT6A 3WHTB 2L51A 3LK1A 5K89A 1A4PA 1K95A 3JTDC 2M49B 2JNXA 1B7TY 5JOLA 2Y4QA 3DVKA 2KFGA 4JPZB 1QVIZ 4NDCA 1UWOA 1KK8B 4L9MA 4JQ0D 1CMGA 1F54A 5HKYA 5I8NA 2WCEA 1YTZC 5PALA 1NX2A 2ZN8A 1DJXA 1QX7A 1TOPA 1CKKA 2L2EA 2PRUA 5ER4X 2B1UA 1J1EA 1QV1A 1X02A 1SYMA 2EC6B 3PALA 1PSBA 4GGNA 1DF0A 1QJTA 1S6CA 1CM4A 1FF1A 5HLOA 1A2XA 2EHBA 5TNCA 1TN4A 2JTTA 3NXAA 4PE1A 2PMYA 1CFCA 3TZ1A 4MZJA 4PDZA 3BUOB 4WQ3A 1A75A 3SJSA 5IBWA 2HPSA 4I5LB 1F8HA 1QXPA 1G8IA 1EG3A 1YX8A 3SG7A 1DJWA 1QATA 2ZRTA 2GV5A 1NSHA 2BE4A 5ER5A 4PALA 3CWGA 2BCAA 1MR8A 1JF2A 2I7AA 1M39A 3IQOA 1IJ5A 4CIDA 2OTGB 3CR2A 5D69A 4GFTA 2K0JA 1ZUZA 3D10A 1QASA 1HQVA 2M1UA 4I5NB 3BUMB 2JU0A 2AUCA 2SASA 4E68A 3SG2A 1SNLA 2LP2A 2Q4UA 2L50A 2L4IA 2AMIA 4YGBB 4YGAA 1B4CA 2ZFDA 3I5IC 4OV2A 2JNFA 3JVTC 1YURA 5JJGA 1PRWA 1SCMC 3CGAA 3O4YA 1F4QA 4U8DA 3ZNIA 1J7RA 1NUBA 1BLQA 1MQ1A 5DKNA 3CZTX 3PN7C 1ZACA 1QTXA 2LAPA 1PSRA 1AK8A 4ORAB 1KWOC 2F3YA 2NLNA 3MSEB 4HREE 2Y1MA 1MWNA 1SL8A 4ORBB 2M7NA 1G33A 1DJGA 1TCFA 2M97A 1BU3A 1SL9A 1YVHA 1KFUS 2LLUA 2WCBA 1YVLA 2LHLA 1XFUO 2ZKMX 3I5FC 1QS7A 2MA2A 4MRXA 1UUSA 1K90D 2QPTA 2DOQA 1H8BA 3GK4X 2JTZA 3TUYB 1M45A 1F70A 3OX6A 2PASA 1K8UA 4C0JA 2AAOA 5AANA 1ZMZA 1LXFC 3O6BA 4P2YB 1DGUA 3TDIA 1S26D 2BL0B 2E30A 4OVNF 1XYDA 2KNEA 5HKZA 2KAYA 2P6BB 3EKJA 1M63B 2FCEA 1S5GZ 2LM5A 4MVFA 2KGBC 1DT7B 1BMOA 1Q80A 2BBMA 2BCBA 4MLWA 2I18A 3VRRA 1S1EA 2JXLA 1LINA 1V1FA 3I5GB 1XA5A 3HCMA 4TNCA 1FI5A 1TTXA 3LK0A 2JOJA 1RJVA 2FOTA 1XK4C 2KAXA 1MXLC 1EG4A 1SRAA 2KI6C 1XK4A 3NSOA 1UHIA 1XVJA 2M3WA 2I2RE 2ZNEA 1NIWA 1KQVA 3OB1B 4C0KA 2NCOA 2EGDA 1CLMA 1RK9A 1RROA 1WY9A 2Y1NA 3O2PA 3NSIA 2LLSA 2LMVA 4MZLA 3WNXB 2F3ZA 2MHHA 4CFQA 3HX4A 1CDLA 1NX1A 1WRKA 2WNDA 1OZSA 3D0YB 1KFUL 4PHNA 3M0WA 1UURA 4GAOA 5CSJA 2M7LA 1J1DA 2WOSA 1AUIB 3K21A 4XJKB 3GK1A 2HF5A 4AQIA 1AJ5A 2LANA 3RM1A 1R6PA 3BOWA 2KI6D 1CLLA 2JC2A 1PALA 2M0RA 1TNWA 3BUXB 3OP0A 5G08A 4P5OE 1TIZA 1K93D 1BJFA 1E8AA 1NCZA 1OOJA 1CTRA 2OS8C 4ZCVA 1Y0VH 4C0LA 1K96A 1W7JB 2CT9A 4XYNA 2LP3A 2H61A 5BPJA 1VRKA 3SG3A 2M29A 3A4UB 1F4OA 2LUXA 4IL1A 4N1GA 4R1EA 2LCPA 1JC2A 1DTLA 1Y1XA 5CSFA 3CLNA 3GOFA 2L98A 2PSRA 2LNKA 3JTDB 1Y6WA 2E6WA 1Y1AA 2KOTA 3PFVA 1SCVA 1IRJA 5AEQA 3GK2A 4OR9B 1LA0A 1M31A 3I5HC 1DVIA 1YRUB 2Q91A 1B8CA 3EK4A 3KHEA 1B8LA 2KQYA 1MF8B 5KU1A 2L4HA 1NYAA 1OE9B 1WDCC 1BOCA 1GJYA 1PVBA 1OSAA 2M1KB 1YUSA 5AXIA 1KQMC 2JT8A 3ZWHA 3BXKA 5KSZA 1CNPA 1J7OA 4FQOA 5HKWA 2KQ6A 3OHMB 1PULA 4NDDA 1Y1UA 1BR4B 3LL8B 1AJ4A 1WRZA 1F71A 1JWDA 2HQWA 1K94A 1C7VA 3DF0B 5DKRA 3EK7A 4MN0A 1EH2A 1EL4A 1NX3A 3NSLA 2KHNA 1CM1A 1TNXA 4YGEB 1TCOB 2F2PA 1NCYA 2JT0A 1DJYA 4MRYA 5D7FA 1SL7A 2ISDA 3FS7A 1U5IA 4DCKA 2GGMA 1SY9A 2H2KA 1ODBA 4USLA 2JQ6A 2KYCA 2MJWB 3SIAA 3VRNA 1B9AA 2I94A 2KI4C 1UP5A 1B7TZ 2LC5A 3FIAA 1L2OC 4PE0A 3TS5C 5CPVA 1B8RA 3KEVA 2LE9B 2LVKA 1TNQA 1DJIA 1K9KA 1QV0A 3AAKA 1TNPA 4QJ5B 2LMTA 1NPQA 4GUKA 2F33A 1M46A 2K7DA 1SR6C 1D1OA 2SCPA 3O78A 2G2BA 1AP4A 2JWWA 3CR5X 2K7BA 2MRDA 2LVIA 2TN4A 2WCFA 1ALVA 1JUOA 2CXJA 1R2UA 1PVAA 4WQ2A 1SPYA 2NZ0A 3QRXA 5CSNA 5HYDA 2LVJA 1CB1A 2WC8A 2M8UA 1NP8A 1KK8C 2FJUB 4ETOA 2BKHB 5GQQC 3WHUB 3I5IB 1OMDA 2LHIA 3JVTB 2K61A 1RWYA 2CNPA 1S36A 1SCMB 2CTNA 1QLSA 2COLB 3EVVA 4PHMA 1BR1B 1LA3A 2KBMA 3D0YA 4HRHA 5B8IB 2KGRA 1IJ6A 3PN7B 2F2OA 2EC6C 4HRGA 1KWOB 1BODA 3CTNA 1CFFA 4MZKA 4XJKA 1JFJA 4MBEA 2KFHA 4WRIA 1NCXA 3EK8A 2K7CA 1WLZA 1WRLA 1NWDA 2K7OA 2PVBA 2ZNDA 1LKJA 1N2DA 1UHKA 1ALWA 1DJZA 4A4BA 4A4CA 4I5JA 4GNKB 4DIRA 1MUXA 2ZN9A 3DVEA 3I5FB 4GPLB 3IQQA 1IQ3A 4N5XA 3EKHA 2BE6A 1JF0A 1OMVA 4PE4A 1SMGA 1FBVA 3AKAA 4FTGA 2IS9A 2OPOA 4ZCUA 2MAZA 3VROA 2OTGC 1AVSA 3NSKA 1KK7Y 1V1GA 2K2FA 1PK0D 4GBAA 1NX0A 4YI9A 3PATA 1CDNA 1J55A 1HT9A 1RFJA 2JT3A 4HSZA 4DRWA 3SIBA 2O60A 3TDZA 1QX5B 3FWCA 2Y5IA 1XFWO 1A29A 3KO0A 1F55A 2A4JA 1XFXO 4CPVA 4DUQA 4M2PA 3DD4A 1C07A 1K9UA 2KYFA 3F45A 5HLVA 2MBXA 2H61C 1S6JA 3FWBA 4N1FA 3LCPC 2G9BA 1XFZO 4QJ4B 2CBLA 3KF9A 1SK6D 4CFRA 3SG4A 1IGVA 1YX7A 1DJHA 2LUCA 3E3RA 3DF0A 2VRGA 1CFDA 1JFKA 3EVRA 1CDMA 2JULA 5CSIA 1FI6A 1S5GY 1TRFA 4ICBA 1IH0A 2M9GA 1YRTB 3VRPA 1C7WA 2K8MB 1W7IB 5AFPA 2BCXA 2O5GA 1L7ZA 1EJ3A 1BG1A 4UPGA 5KTYA 1J7QA 4PCWA 4QJ3B 3ICBA 1GGZA 2BECA 1GQMA 4ORCB 3EVUA 1XO5A 1YUTA 3RLZA 1DF0B 3BQ3A 5AERA 1KSOA 2LVVA 3BOWB 1WLMA 3DVJA 3TUYC 4JWQA 3PSRA 4PHJA 1KFXL 1MHOA 2HETA 1QVIY 1N65A 2KBIA 1J7PA 3AAJA 2GGZA 4GGFC 1K2HA 4YBHB 1OZOA 4GGFA 1IG5A 1B47A 2BL0C 2L0PA 1QIVA 1K9PA 2BKIB 1A75B 2JRFA 3SG5A 1BF5A 4BY4A 2OS8B 1SBJA 2PALA 1IQ5A 2HQ8A 3AKBA 1UHHA 1EXRA 1OMRA 1S3PA 2NCPA 3DVMA 3H4SE 3BUNB 2BBNA 4PE7A 2WORA 2NXQA 3CS1A 4OCIA 1LVCD 3I5GC 1UHNA 1B1GA 2MLFC 4I5KA 1N0YA 5I2LA 3VGOA 2LV7A 1KSMA 2MLEC 5FYXA 1ZOTB 3OX5A 2CCMA 1CDPA 4F0ZB 2FCDA 1QIWA 2D8NA 1OQPA 1RTP1 2L5XB 1YR5A 1ZFSA 2JPTA 3I5HB 1RECA 4D1EA 5DKQA 1CFPA 5J3XA 4NQGA 1KK7Z
chains in the Genus database with same CATH superfamily
3FE8A 1IKUA 1DMOA 2KLEA 2F8PA 5I2OA 1KCYA 2JZIA 4MSPA 1WDCB 3IF7A 1G4YR 2KAVA 1IWQA 1KQMB 3SG6A 4MEWA 4OKHA 3LLEA 3CABA 2R2IA 4AQJA 4PHKA 2RGIA 2LMUA 1A03A 3R1VA 3TDUA 1FPWA 4Q04A 1SKTA 3WXAA 2ZRSA 1QX2A 3OB2B 5I2QA 1JSAA 1YUUA 2QACA 2KDHA 1DGVA 1U5IB 2KSPA 3KPXA 4INWA 2WCLA 3C1VA 3CYZA 1GGWA 1OW4A 1FW4A 1LS8A 1H4BA 3B87A 3EG5B 4YI8A 4CLNA 1CLBA 2KFFA 3BFAA 4BY5A 3CR4X 1S6IA 2KI4B 1XFVO 1Z4HA 1CMFA 1L2OB 1XFRA 2JXCA 4M2OA 3TS5B 4DS7A 4YGCB 1AHRA 1ORGA 1QLKA 2YGUA 1MXEA 4NDBA 3BUWB 1OOFA 2LLTA 4YGDB 4M2QA 3PLFB 1JBAA 1DELA 2K2AA 3VRQA 1XFYO 3PM8A 4YRUA 5F6TA 4AOMA 2V53A 3BYAA 1SR6B 1KFXS 1SW8A 1UHJA 3A8RA 1BT6A 3WHTB 2L51A 3LK1A 5K89A 1A4PA 1K95A 3JTDC 2M49B 2JNXA 1B7TY 5JOLA 3S0DA 2Y4QA 1SSEB 1TWOA 1TUJA 3DVKA 2KFGA 3S0BA 4JPZB 1QVIZ 4NDCA 1UWOA 1KK8B 4L9MA 4JQ0D 1CMGA 5DICA 1F54A 3L47A 5HKYA 5I8NA 2WCEA 2KLDA 1YTZC 5PALA 5EL2A 1NX2A 2ZN8A 1DJXA 1QX7A 1TOPA 1CKKA 2L2EA 2PRUA 5ER4X 2B1UA 1J1EA 1QV1A 1X02A 1SYMA 2EC6B 3PALA 1PSBA 4GGNA 1DF0A 1QJTA 1S6CA 1CM4A 1FF1A 5HLOA 1A2XA 2EHBA 5TNCA 1TN4A 2JTTA 3NXAA 4PE1A 2PMYA 1CFCA 3TZ1A 4MZJA 4INXA 4PDZA 3BUOB 3D75A 4WQ3A 1A75A 3SJSA 5IBWA 2HPSA 1IIOA 4I5LB 1F8HA 1QXPA 2KPHA 1G8IA 1EG3A 1YX8A 3SG7A 1DJWA 1QATA 2ZRTA 2GV5A 1NSHA 3PJIA 2BE4A 5ER5A 4PALA 3CWGA 3UO9A 2BCAA 3OGNA 1MR8A 3B88A 1JF2A 2I7AA 1M39A 3IQOA 1IJ5A 4CIDA 2OTGB 3CR2A 5D69A 4F7FA 4GFTA 2K0JA 5I94A 1ZUZA 3D10A 1QASA 3L4AA 1HQVA 2M1UA 4I5NB 3BUMB 2JU0A 2AUCA 2SASA 3OBVA 4E68A 3SG2A 1OOIX 1SNLA 2LP2A 2Q4UA 2L50A 2L4IA 2AMIA 4YGBB 4YGAA 1B4CA 2ZFDA 1Z2CB 3I5IC 4OV2A 3K1EA 2JNFA 3JVTC 1YURA 5JJGA 1PRWA 1SCMC 3CGAA 3O4YA 1F4QA 4U8DA 3ZNIA 1J7RA 1NUBA 2K60A 3S0FA 1P28A 1BLQA 1MQ1A 5DKNA 3CZTX 3DXLA 3PN7C 1ZACA 1QTXA 2LAPA 1PSRA 1AK8A 4ORAB 1KWOC 2F3YA 2NLNA 3MSEB 3DYEA 4HREE 1C3YA 2Y1MA 1MWNA 1SL8A 4MVFA 3BJHA 2M7NA 4ORBB 3S0EA 1G33A 1DJGA 3B6XA 1TCFA 2M97A 1BU3A 1SL9A 1YVHA 1KFUS 2LLUA 2WCBA 1YVLA 2LHLA 1XFUO 2ZKMX 2QEOA 3I5FC 1QS7A 2MA2A 4MRXA 1UUSA 1K90D 2QPTA 2GTEA 4FQTA 2DOQA 1H8BA 3GK4X 3RZSA 2JTZA 3TUYB 1M45A 1F70A 3OX6A 2PASA 1K8UA 4C0JA 2AAOA 5AANA 1ZMZA 1LXFC 3O6BA 4P2YB 1DGUA 3DZTA 3TDIA 1DC1A 1S26D 2BL0B 2E30A 4OVNF 1XYDA 2KNEA 5HKZA 2KAYA 2P6BB 2QEVA 1M63B 2FCEA 1S5GZ 2LM5A 3EKJA 2KGBC 3IVTA 3R1OA 1BMOA 2JPOA 2BNXA 1Q80A 3SS4A 2BBMA 2BCBA 4MLWA 2I18A 3VRRA 1TUZA 1S1EA 2JXLA 1LINA 2L5YA 1V1FA 3I5GB 3D76A 1XA5A 3HCMA 4TNCA 1FI5A 1TTXA 3SS5A 3LK0A 2JOJA 1RJVA 2FOTA 1XK4C 2KAXA 1MXLC 1EG4A 1SRAA 2KI6C 2WCMA 5FI7A 1XK4A 3BFBA 1UHIA 3NSOA 1XVJA 2M3WA 2I2RE 2ZNEA 1NIWA 1KQVA 5FI2A 3OB1B 4C0KA 2NCOA 2EGDA 1CLMA 1RK9A 1RROA 1WY9A 2Y1NA 3O2PA 3NSIA 2LLSA 2LMVA 4MZLA 5D3OA 3WNXB 3B7AA 2F3ZA 2MHHA 4CFQA 1W9ZA 4OZDA 3HX4A 1CDLA 1NX1A 1WRKA 2WNDA 1DEKA 1OZSA 3D0YB 3Q8IA 1KFUL 4PHNA 3M0WA 1UURA 4GAOA 1DQEA 5CSJA 2M7LA 1J1DA 2WOSA 1AUIB 3K21A 2WCKA 3SS3A 2WC5A 3GK1A 2HF5A 4XJKB 4AQIA 1AJ5A 2LANA 3RM1A 1R6PA 3BOWA 2KI6D 1CLLA 2JC2A 1PALA 2M0RA 1TNWA 3BUXB 2WC6A 3CDNA 3OP0A 2WCJA 5G08A 4P5OE 1TIZA 1K93D 1BJFA 2QEBA 1E8AA 1NCZA 2QEHA 1OOJA 1OOHA 1CTRA 3UNWA 2OS8C 4ZCVA 1Y0VH 4C0LA 1K96A 1W7JB 2CT9A 4XYNA 2LP3A 2H61A 2FJYA 5BPJA 1VRKA 3SG3A 2M29A 3A4UB 1F4OA 2LUXA 4IL1A 4N1GA 4R1EA 2LCPA 1JC2A 1DTLA 4IJ7A 1Y1XA 5CSFA 3VB1A 3CLNA 3GOFA 2L98A 2PSRA 2LNKA 3JTDB 1Y6WA 2E6WA 3R72A 1Y1AA 2KOTA 3PFVA 1SCVA 1IRJA 5AEQA 3GK2A 4OR9B 1LA0A 1M31A 3I5HC 1DVIA 1YRUB 2Q91A 1B8CA 3EK4A 3KHEA 1B8LA 2KQYA 1MF8B 5KU1A 2L4HA 1NYAA 1OE9B 1WDCC 1BOCA 1GJYA 1PVBA 1OSAA 2M1KB 1YUSA 3R1PA 1KQMC 2JT8A 5AXIA 3BXKA 3ZWHA 5KSZA 1CNPA 1J7OA 4FQOA 5HKWA 2KQ6A 3FE6A 1PULA 3OHMB 4NDDA 1Y1UA 1BR4B 3LL8B 1AJ4A 1WRZA 1F71A 1JWDA 2HQWA 1K94A 1C7VA 3DF0B 5DKRA 3EK7A 4MN0A 1EH2A 1EL4A 1NX3A 3NSLA 3S0GA 2KHNA 1CM1A 1TNXA 4YGEB 2QDIA 1TCOB 2F2PA 1NCYA 2JT0A 1DJYA 4MRYA 5D7FA 2L2CA 1SL7A 2ISDA 3FS7A 1U5IA 4DCKA 2GGMA 1SY9A 2H2KA 1ODBA 4USLA 2JQ6A 2KYCA 2MJWB 3SIAA 3VRNA 1B9AA 2I94A 2KI4C 1UP5A 1B7TZ 2LC5A 3FIAA 1L2OC 4PE0A 3TS5C 5CPVA 1B8RA 3KEVA 2LE9B 2LVKA 1TNQA 1DJIA 1K9KA 1QV0A 3AAKA 1TNPA 4QJ5B 2LMTA 1NPQA 4GUKA 4JD9A 3V2LA 2F33A 1M46A 2K7DA 1SR6C 1D1OA 2SCPA 3O78A 2G2BA 1C3ZA 1AP4A 2JWWA 3CR5X 2K7BA 2MRDA 3L4LA 2LVIA 2TN4A 2WCFA 1ALVA 1JUOA 1OOGA 1GM0A 4PT1A 2CXJA 1R2UA 1PVAA 4WQ2A 4JKTA 1SPYA 2NZ0A 5HL1A 3QRXA 5CSNA 5HYDA 2LVJA 1CB1A 2WC8A 2M8UA 1NP8A 1KK8C 2FJUB 4ETOA 2BKHB 5GQQC 3WHUB 3I5IB 1OMDA 2LHIA 3JVTB 2K61A 1RWYA 2CNPA 1S36A 1SCMB 2CTNA 1QLSA 2COLB 3EVVA 1DT7B 4PHMA 1BR1B 1LA3A 2KBMA 3D0YA 4HRHA 5B8IB 2KGRA 1IJ6A 3PN7B 2F2OA 3B86A 2EC6C 4HRGA 1KWOB 1BODA 3CTNA 1CFFA 4MZKA 4XJKA 3N7HA 4MBEA 1JFJA 2KFHA 2WCHA 4WRIA 2H8VA 1NCXA 3EK8A 2K7CA 1WLZA 1WRLA 1NWDA 2K7OA 2PVBA 2ZNDA 1LKJA 1N2DA 1UHKA 3D77A 1ALWA 1DJZA 4A4BA 4A4CA 4I5JA 4GNKB 4DIRA 1MUXA 2ZN9A 3DVEA 3I5FB 4GPLB 3QMEA 3IQQA 1IQ3A 4N5XA 3EKHA 2BE6A 1JF0A 1OMVA 4PE4A 1SMGA 1FBVA 2P70A 3AKAA 2IS9A 4FTGA 2OPOA 4ZCUA 2MAZA 3VROA 2OTGC 1AVSA 3NSKA 1KK7Y 1V1GA 2BAPA 2K2FA 1PK0D 4GBAA 1NX0A 4KYNA 4YI9A 3EVRA 3D73A 3PATA 1CDNA 1J55A 1HT9A 1RFJA 2JT3A 4HSZA 4DRWA 3SIBA 2O60A 3NHIA 3TDZA 2PYQA 1QX5B 3FWCA 2Y5IA 3CZ1A 1XFWO 1A29A 3KO0A 1F55A 2A4JA 1XFXO 2PQLA 4CPVA 4M2PA 4DUQA 3DD4A 1C07A 1K9UA 2KYFA 3F45A 5HLVA 2MBXA 2H61C 1S6JA 3FWBA 4N1FA 3LCPC 2G9BA 3CZ2A 1XFZO 3NHTA 2CBLA 4QJ4B 3KF9A 1SK6D 4CFRA 3SG4A 1IGVA 1YX7A 1DJHA 1T14A 2LUCA 3DF0A 2VRGA 1CFDA 1JFKA 3E3RA 1CDMA 2JULA 5CSIA 1FI6A 1S5GY 3PM2A 1TRFA 4ICBA 1IH0A 2M9GA 1YRTB 3S0AA 3O4XA 3VRPA 1C7WA 2K8MB 1W7IB 5AFPA 2BCXA 2O5GA 1L7ZA 1EJ3A 1BG1A 4UPGA 5KTYA 1J7QA 4PCWA 4QJ3B 3D74A 1QWVA 3ICBA 1GGZA 2BECA 1GQMA 4ORCB 3EVUA 1XO5A 1YUTA 3RLZA 1DF0B 3BQ3A 5AERA 1KSOA 2LVVA 3BOWB 1WLMA 3DVJA 3TUYC 4JWQA 3PSRA 4PHJA 1KFXL 1MHOA 2HETA 3NGVA 1QVIY 1N65A 2KBIA 1J7PA 3AAJA 2GGZA 4GGFC 1K2HA 4YBHB 1OZOA 4GGFA 1IG5A 1B47A 2BL0C 2L0PA 1QIVA 1K9PA 2BKIB 1A75B 2JRFA 3D78A 3SG5A 1BF5A 4BY4A 3BFHA 2OS8B 1SBJA 2PALA 1IQ5A 2HQ8A 3AKBA 5FI6A 1UHHA 1EXRA 1OMRA 1S3PA 2NCPA 3DVMA 3H4SE 3BUNB 2BBNA 4PE7A 2P71A 2NXQA 2WORA 3CS1A 4OCIA 1LVCD 3I5GC 1UHNA 1B1GA 2MLFC 3FE9A 1N0YA 4I5KA 3DY9A 5I2LA 3VGOA 2LV7A 1KSMA 2MLEC 5FYXA 3CZ0A 1ZOTB 2ERBA 3OX5A 2CCMA 1CDPA 4F0ZB 2FCDA 1QIWA 2D8NA 1OQPA 1RTP1 2L5XB 1YR5A 1ZFSA 2JPTA 3I5HB 1RECA 4D1EA 5DKQA 1CFPA 5J3XA 4NQGA 1KK7Z
chains in the Genus database with same CATH topology
1IKUA 1DMOA 2F8PA 5I2OA 1KCYA 2JZIA 4MSPA 1WDCB 3IF7A 1G4YR 2KAVA 1IWQA 1KQMB 3SG6A 4MEWA 4OKHA 3LLEA 2R2IA 4AQJA 4PHKA 2RGIA 2LMUA 1A03A 3TDUA 1FPWA 4Q04A 1SKTA 3WXAA 2ZRSA 1QX2A 3OB2B 5I2QA 1JSAA 1YUUA 2QACA 2KDHA 1DGVA 1U5IB 2KSPA 3KPXA 3C1VA 1GGWA 1FW4A 1H4BA 4YI8A 4CLNA 1CLBA 2KFFA 4BY5A 3CR4X 1S6IA 2KI4B 1XFVO 1CMFA 1L2OB 2JXCA 4M2OA 3TS5B 4DS7A 4YGCB 1AHRA 1QLKA 1MXEA 4NDBA 3BUWB 2LLTA 4YGDB 4M2QA 3PLFB 1JBAA 2K2AA 3VRQA 1XFYO 3PM8A 4YRUA 5F6TA 4AOMA 2V53A 3BYAA 1SR6B 1KFXS 1SW8A 1UHJA 3A8RA 1BT6A 3WHTB 2L51A 3LK1A 5K89A 1A4PA 1K95A 3JTDC 2M49B 2JNXA 1B7TY 5JOLA 2Y4QA 3DVKA 2KFGA 4JPZB 1QVIZ 4NDCA 1UWOA 1KK8B 4L9MA 4JQ0D 1CMGA 1F54A 5HKYA 5I8NA 2WCEA 1YTZC 5PALA 1NX2A 2ZN8A 1DJXA 1QX7A 1TOPA 1CKKA 2L2EA 2PRUA 5ER4X 2B1UA 1J1EA 1QV1A 1X02A 1SYMA 2EC6B 3PALA 1PSBA 4GGNA 1DF0A 1QJTA 1S6CA 1CM4A 1FF1A 5HLOA 1A2XA 2EHBA 5TNCA 1TN4A 2JTTA 3NXAA 4PE1A 2PMYA 1CFCA 3TZ1A 4MZJA 4PDZA 3BUOB 4WQ3A 1A75A 3SJSA 5IBWA 2HPSA 4I5LB 1F8HA 1QXPA 1G8IA 1EG3A 1YX8A 3SG7A 1DJWA 1QATA 2ZRTA 2GV5A 1NSHA 2BE4A 5ER5A 4PALA 3CWGA 2BCAA 1MR8A 1JF2A 2I7AA 1M39A 3IQOA 1IJ5A 4CIDA 2OTGB 3CR2A 5D69A 4GFTA 2K0JA 1ZUZA 3D10A 1QASA 1HQVA 2M1UA 4I5NB 3BUMB 2JU0A 2AUCA 2SASA 4E68A 3SG2A 1SNLA 2LP2A 2Q4UA 2L50A 2L4IA 2AMIA 4YGBB 4YGAA 1B4CA 2ZFDA 3I5IC 4OV2A 2JNFA 3JVTC 1YURA 5JJGA 1PRWA 1SCMC 3CGAA 3O4YA 1F4QA 4U8DA 3ZNIA 1J7RA 1NUBA 1BLQA 1MQ1A 5DKNA 3CZTX 3PN7C 1ZACA 1QTXA 2LAPA 1PSRA 1AK8A 4ORAB 1KWOC 2F3YA 2NLNA 3MSEB 4HREE 2Y1MA 1MWNA 1SL8A 4ORBB 2M7NA 1G33A 1DJGA 1TCFA 2M97A 1BU3A 1SL9A 1YVHA 1KFUS 2LLUA 2WCBA 1YVLA 2LHLA 1XFUO 2ZKMX 3I5FC 1QS7A 2MA2A 4MRXA 1UUSA 1K90D 2QPTA 2DOQA 1H8BA 3GK4X 2JTZA 3TUYB 1M45A 1F70A 3OX6A 2PASA 1K8UA 4C0JA 2AAOA 5AANA 1ZMZA 1LXFC 3O6BA 4P2YB 1DGUA 3TDIA 1S26D 2BL0B 2E30A 4OVNF 1XYDA 2KNEA 5HKZA 2KAYA 2P6BB 3EKJA 1M63B 2FCEA 1S5GZ 2LM5A 4MVFA 2KGBC 1DT7B 1BMOA 1Q80A 2BBMA 2BCBA 4MLWA 2I18A 3VRRA 1S1EA 2JXLA 1LINA 1V1FA 3I5GB 1XA5A 3HCMA 4TNCA 1FI5A 1TTXA 3LK0A 2JOJA 1RJVA 2FOTA 1XK4C 2KAXA 1MXLC 1EG4A 1SRAA 2KI6C 1XK4A 3NSOA 1UHIA 1XVJA 2M3WA 2I2RE 2ZNEA 1NIWA 1KQVA 3OB1B 4C0KA 2NCOA 2EGDA 1CLMA 1RK9A 1RROA 1WY9A 2Y1NA 3O2PA 3NSIA 2LLSA 2LMVA 4MZLA 3WNXB 2F3ZA 2MHHA 4CFQA 3HX4A 1CDLA 1NX1A 1WRKA 2WNDA 1OZSA 3D0YB 1KFUL 4PHNA 3M0WA 1UURA 4GAOA 5CSJA 2M7LA 1J1DA 2WOSA 1AUIB 3K21A 4XJKB 3GK1A 2HF5A 4AQIA 1AJ5A 2LANA 3RM1A 1R6PA 3BOWA 2KI6D 1CLLA 2JC2A 1PALA 2M0RA 1TNWA 3BUXB 3OP0A 5G08A 4P5OE 1TIZA 1K93D 1BJFA 1E8AA 1NCZA 1OOJA 1CTRA 2OS8C 4ZCVA 1Y0VH 4C0LA 1K96A 1W7JB 2CT9A 4XYNA 2LP3A 2H61A 5BPJA 1VRKA 3SG3A 2M29A 3A4UB 1F4OA 2LUXA 4IL1A 4N1GA 4R1EA 2LCPA 1JC2A 1DTLA 1Y1XA 5CSFA 3CLNA 3GOFA 2L98A 2PSRA 2LNKA 3JTDB 1Y6WA 2E6WA 1Y1AA 2KOTA 3PFVA 1SCVA 1IRJA 5AEQA 3GK2A 4OR9B 1LA0A 1M31A 3I5HC 1DVIA 1YRUB 2Q91A 1B8CA 3EK4A 3KHEA 1B8LA 2KQYA 1MF8B 5KU1A 2L4HA 1NYAA 1OE9B 1WDCC 1BOCA 1GJYA 1PVBA 1OSAA 2M1KB 1YUSA 5AXIA 1KQMC 2JT8A 3ZWHA 3BXKA 5KSZA 1CNPA 1J7OA 4FQOA 5HKWA 2KQ6A 3OHMB 1PULA 4NDDA 1Y1UA 1BR4B 3LL8B 1AJ4A 1WRZA 1F71A 1JWDA 2HQWA 1K94A 1C7VA 3DF0B 5DKRA 3EK7A 4MN0A 1EH2A 1EL4A 1NX3A 3NSLA 2KHNA 1CM1A 1TNXA 4YGEB 1TCOB 2F2PA 1NCYA 2JT0A 1DJYA 4MRYA 5D7FA 1SL7A 2ISDA 3FS7A 1U5IA 4DCKA 2GGMA 1SY9A 2H2KA 1ODBA 4USLA 2JQ6A 2KYCA 2MJWB 3SIAA 3VRNA 1B9AA 2I94A 2KI4C 1UP5A 1B7TZ 2LC5A 3FIAA 1L2OC 4PE0A 3TS5C 5CPVA 1B8RA 3KEVA 2LE9B 2LVKA 1TNQA 1DJIA 1K9KA 1QV0A 3AAKA 1TNPA 4QJ5B 2LMTA 1NPQA 4GUKA 2F33A 1M46A 2K7DA 1SR6C 1D1OA 2SCPA 3O78A 2G2BA 1AP4A 2JWWA 3CR5X 2K7BA 2MRDA 2LVIA 2TN4A 2WCFA 1ALVA 1JUOA 2CXJA 1R2UA 1PVAA 4WQ2A 1SPYA 2NZ0A 3QRXA 5CSNA 5HYDA 2LVJA 1CB1A 2WC8A 2M8UA 1NP8A 1KK8C 2FJUB 4ETOA 2BKHB 5GQQC 3WHUB 3I5IB 1OMDA 2LHIA 3JVTB 2K61A 1RWYA 2CNPA 1S36A 1SCMB 2CTNA 1QLSA 2COLB 3EVVA 4PHMA 1BR1B 1LA3A 2KBMA 3D0YA 4HRHA 5B8IB 2KGRA 1IJ6A 3PN7B 2F2OA 2EC6C 4HRGA 1KWOB 1BODA 3CTNA 1CFFA 4MZKA 4XJKA 1JFJA 4MBEA 2KFHA 4WRIA 1NCXA 3EK8A 2K7CA 1WLZA 1WRLA 1NWDA 2K7OA 2PVBA 2ZNDA 1LKJA 1N2DA 1UHKA 1ALWA 1DJZA 4A4BA 4A4CA 4I5JA 4GNKB 4DIRA 1MUXA 2ZN9A 3DVEA 3I5FB 4GPLB 3IQQA 1IQ3A 4N5XA 3EKHA 2BE6A 1JF0A 1OMVA 4PE4A 1SMGA 1FBVA 3AKAA 4FTGA 2IS9A 2OPOA 4ZCUA 2MAZA 3VROA 2OTGC 1AVSA 3NSKA 1KK7Y 1V1GA 2K2FA 1PK0D 4GBAA 1NX0A 4YI9A 3PATA 1CDNA 1J55A 1HT9A 1RFJA 2JT3A 4HSZA 4DRWA 3SIBA 2O60A 3TDZA 1QX5B 3FWCA 2Y5IA 1XFWO 1A29A 3KO0A 1F55A 2A4JA 1XFXO 4CPVA 4DUQA 4M2PA 3DD4A 1C07A 1K9UA 2KYFA 3F45A 5HLVA 2MBXA 2H61C 1S6JA 3FWBA 4N1FA 3LCPC 2G9BA 1XFZO 4QJ4B 2CBLA 3KF9A 1SK6D 4CFRA 3SG4A 1IGVA 1YX7A 1DJHA 2LUCA 3E3RA 3DF0A 2VRGA 1CFDA 1JFKA 3EVRA 1CDMA 2JULA 5CSIA 1FI6A 1S5GY 1TRFA 4ICBA 1IH0A 2M9GA 1YRTB 3VRPA 1C7WA 2K8MB 1W7IB 5AFPA 2BCXA 2O5GA 1L7ZA 1EJ3A 1BG1A 4UPGA 5KTYA 1J7QA 4PCWA 4QJ3B 3ICBA 1GGZA 2BECA 1GQMA 4ORCB 3EVUA 1XO5A 1YUTA 3RLZA 1DF0B 3BQ3A 5AERA 1KSOA 2LVVA 3BOWB 1WLMA 3DVJA 3TUYC 4JWQA 3PSRA 4PHJA 1KFXL 1MHOA 2HETA 1QVIY 1N65A 2KBIA 1J7PA 3AAJA 2GGZA 4GGFC 1K2HA 4YBHB 1OZOA 4GGFA 1IG5A 1B47A 2BL0C 2L0PA 1QIVA 1K9PA 2BKIB 1A75B 2JRFA 3SG5A 1BF5A 4BY4A 2OS8B 1SBJA 2PALA 1IQ5A 2HQ8A 3AKBA 1UHHA 1EXRA 1OMRA 1S3PA 2NCPA 3DVMA 3H4SE 3BUNB 2BBNA 4PE7A 2WORA 2NXQA 3CS1A 4OCIA 1LVCD 3I5GC 1UHNA 1B1GA 2MLFC 4I5KA 1N0YA 5I2LA 3VGOA 2LV7A 1KSMA 2MLEC 5FYXA 1ZOTB 3OX5A 2CCMA 1CDPA 4F0ZB 2FCDA 1QIWA 2D8NA 1OQPA 1RTP1 2L5XB 1YR5A 1ZFSA 2JPTA 3I5HB 1RECA 4D1EA 5DKQA 1CFPA 5J3XA 4NQGA 1KK7Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IKU A;  1DMO A;  2F8P A;  5I2O A;  1KCY A;  2JZI A;  4MSP A;  1WDC B;  3IF7 A;  1G4Y R;  2KAV A;  1IWQ A;  1KQM B;  3SG6 A;  4MEW A;  4OKH A;  3LLE A;  2R2I A;  4AQJ A;  4PHK A;  2RGI A;  2LMU A;  1A03 A;  3TDU A;  1FPW A;  4Q04 A;  1SKT A;  3WXA A;  2ZRS A;  1QX2 A;  3OB2 B;  5I2Q A;  1JSA A;  1YUU A;  2QAC A;  2KDH A;  1DGV A;  1U5I B;  2KSP A;  3KPX A;  3C1V A;  1GGW A;  1FW4 A;  1H4B A;  4YI8 A;  4CLN A;  1CLB A;  2KFF A;  4BY5 A;  3CR4 X;  1S6I A;  2KI4 B;  1XFV O;  1CMF A;  1L2O B;  2JXC A;  4M2O A;  3TS5 B;  4DS7 A;  4YGC B;  1AHR A;  1QLK A;  1MXE A;  4NDB A;  3BUW B;  2LLT A;  4YGD B;  4M2Q A;  3PLF B;  1JBA A;  2K2A A;  3VRQ A;  1XFY O;  3PM8 A;  4YRU A;  5F6T A;  4AOM A;  2V53 A;  3BYA A;  1SR6 B;  1KFX S;  1SW8 A;  1UHJ A;  3A8R A;  1BT6 A;  3WHT B;  2L51 A;  3LK1 A;  5K89 A;  1A4P A;  1K95 A;  3JTD C;  2M49 B;  2JNX A;  1B7T Y;  5JOL A;  2Y4Q A;  3DVK A;  2KFG A;  4JPZ B;  1QVI Z;  4NDC A;  1UWO A;  1KK8 B;  4L9M A;  4JQ0 D;  1CMG A;  1F54 A;  5HKY A;  5I8N A;  2WCE A;  1YTZ C;  5PAL A;  1NX2 A;  2ZN8 A;  1DJX A;  1QX7 A;  1TOP A;  1CKK A;  2L2E A;  2PRU A;  5ER4 X;  2B1U A;  1J1E A;  1QV1 A;  1X02 A;  1SYM A;  2EC6 B;  3PAL A;  1PSB A;  4GGN A;  1DF0 A;  1QJT A;  1S6C A;  1CM4 A;  1FF1 A;  5HLO A;  1A2X A;  2EHB A;  5TNC A;  1TN4 A;  2JTT A;  3NXA A;  4PE1 A;  2PMY A;  1CFC A;  3TZ1 A;  4MZJ A;  4PDZ A;  3BUO B;  4WQ3 A;  1A75 A;  3SJS A;  5IBW A;  2HPS A;  4I5L B;  1F8H A;  1QXP A;  1G8I A;  1EG3 A;  1YX8 A;  3SG7 A;  1DJW A;  1QAT A;  2ZRT A;  2GV5 A;  1NSH A;  2BE4 A;  5ER5 A;  4PAL A;  3CWG A;  2BCA A;  1MR8 A;  1JF2 A;  2I7A A;  1M39 A;  3IQO A;  1IJ5 A;  4CID A;  2OTG B;  3CR2 A;  5D69 A;  4GFT A;  2K0J A;  1ZUZ A;  3D10 A;  1QAS A;  1HQV A;  2M1U A;  4I5N B;  3BUM B;  2JU0 A;  2AUC A;  2SAS A;  4E68 A;  3SG2 A;  1SNL A;  2LP2 A;  2Q4U A;  2L50 A;  2L4I A;  2AMI A;  4YGB B;  4YGA A;  1B4C A;  2ZFD A;  3I5I C;  4OV2 A;  2JNF A;  3JVT C;  1YUR A;  5JJG A;  1PRW A;  1SCM C;  3CGA A;  3O4Y A;  1F4Q A;  4U8D A;  3ZNI A;  1J7R A;  1NUB A;  1BLQ A;  1MQ1 A;  5DKN A;  3CZT X;  3PN7 C;  1ZAC A;  1QTX A;  2LAP A;  1PSR A;  1AK8 A;  4ORA B;  1KWO C;  2F3Y A;  2NLN A;  3MSE B;  4HRE E;  2Y1M A;  1MWN A;  1SL8 A;  4ORB B;  2M7N A;  1G33 A;  1DJG A;  1TCF A;  2M97 A;  1BU3 A;  1SL9 A;  1YVH A;  1KFU S;  2LLU A;  2WCB A;  1YVL A;  2LHL A;  1XFU O;  2ZKM X;  3I5F C;  1QS7 A;  2MA2 A;  4MRX A;  1UUS A;  1K90 D;  2QPT A;  2DOQ A;  1H8B A;  3GK4 X;  2JTZ A;  3TUY B;  1M45 A;  1F70 A;  3OX6 A;  2PAS A;  1K8U A;  4C0J A;  2AAO A;  5AAN A;  1ZMZ A;  1LXF C;  3O6B A;  4P2Y B;  1DGU A;  3TDI A;  1S26 D;  2BL0 B;  2E30 A;  4OVN F;  1XYD A;  2KNE A;  5HKZ A;  2KAY A;  2P6B B;  3EKJ A;  1M63 B;  2FCE A;  1S5G Z;  2LM5 A;  4MVF A;  2KGB C;  1DT7 B;  1BMO A;  1Q80 A;  2BBM A;  2BCB A;  4MLW A;  2I18 A;  3VRR A;  1S1E A;  2JXL A;  1LIN A;  1V1F A;  3I5G B;  1XA5 A;  3HCM A;  4TNC A;  1FI5 A;  1TTX A;  3LK0 A;  2JOJ A;  1RJV A;  2FOT A;  1XK4 C;  2KAX A;  1MXL C;  1EG4 A;  1SRA A;  2KI6 C;  1XK4 A;  3NSO A;  1UHI A;  1XVJ A;  2M3W A;  2I2R E;  2ZNE A;  1NIW A;  1KQV A;  3OB1 B;  4C0K A;  2NCO A;  2EGD A;  1CLM A;  1RK9 A;  1RRO A;  1WY9 A;  2Y1N A;  3O2P A;  3NSI A;  2LLS A;  2LMV A;  4MZL A;  3WNX B;  2F3Z A;  2MHH A;  4CFQ A;  3HX4 A;  1CDL A;  1NX1 A;  1WRK A;  2WND A;  1OZS A;  3D0Y B;  1KFU L;  4PHN A;  3M0W A;  1UUR A;  4GAO A;  5CSJ A;  2M7L A;  1J1D A;  2WOS A;  1AUI B;  3K21 A;  4XJK B;  3GK1 A;  2HF5 A;  4AQI A;  1AJ5 A;  2LAN A;  3RM1 A;  1R6P A;  3BOW A;  2KI6 D;  1CLL A;  2JC2 A;  1PAL A;  2M0R A;  1TNW A;  3BUX B;  3OP0 A;  5G08 A;  4P5O E;  1TIZ A;  1K93 D;  1BJF A;  1E8A A;  1NCZ A;  1OOJ A;  1CTR A;  2OS8 C;  4ZCV A;  1Y0V H;  4C0L A;  1K96 A;  1W7J B;  2CT9 A;  4XYN A;  2LP3 A;  2H61 A;  5BPJ A;  1VRK A;  3SG3 A;  2M29 A;  3A4U B;  1F4O A;  2LUX A;  4IL1 A;  4N1G A;  4R1E A;  2LCP A;  1JC2 A;  1DTL A;  1Y1X A;  5CSF A;  3CLN A;  3GOF A;  2L98 A;  2PSR A;  2LNK A;  3JTD B;  1Y6W A;  2E6W A;  1Y1A A;  2KOT A;  3PFV A;  1SCV A;  1IRJ A;  5AEQ A;  3GK2 A;  4OR9 B;  1LA0 A;  1M31 A;  3I5H C;  1DVI A;  1YRU B;  2Q91 A;  1B8C A;  3EK4 A;  3KHE A;  1B8L A;  2KQY A;  1MF8 B;  5KU1 A;  2L4H A;  1NYA A;  1OE9 B;  1WDC C;  1BOC A;  1GJY A;  1PVB A;  1OSA A;  2M1K B;  1YUS A;  5AXI A;  1KQM C;  2JT8 A;  3ZWH A;  3BXK A;  5KSZ A;  1CNP A;  1J7O A;  4FQO A;  5HKW A;  2KQ6 A;  3OHM B;  1PUL A;  4NDD A;  1Y1U A;  1BR4 B;  3LL8 B;  1AJ4 A;  1WRZ A;  1F71 A;  1JWD A;  2HQW A;  1K94 A;  1C7V A;  3DF0 B;  5DKR A;  3EK7 A;  4MN0 A;  1EH2 A;  1EL4 A;  1NX3 A;  3NSL A;  2KHN A;  1CM1 A;  1TNX A;  4YGE B;  1TCO B;  2F2P A;  1NCY A;  2JT0 A;  1DJY A;  4MRY A;  5D7F A;  1SL7 A;  2ISD A;  3FS7 A;  1U5I A;  4DCK A;  2GGM A;  1SY9 A;  2H2K A;  1ODB A;  4USL A;  2JQ6 A;  2KYC A;  2MJW B;  3SIA A;  3VRN A;  1B9A A;  2I94 A;  2KI4 C;  1UP5 A;  1B7T Z;  2LC5 A;  3FIA A;  1L2O C;  4PE0 A;  3TS5 C;  5CPV A;  1B8R A;  3KEV A;  2LE9 B;  2LVK A;  1TNQ A;  1DJI A;  1K9K A;  1QV0 A;  3AAK A;  1TNP A;  4QJ5 B;  2LMT A;  1NPQ A;  4GUK A;  2F33 A;  1M46 A;  2K7D A;  1SR6 C;  1D1O A;  2SCP A;  3O78 A;  2G2B A;  1AP4 A;  2JWW A;  3CR5 X;  2K7B A;  2MRD A;  2LVI A;  2TN4 A;  2WCF A;  1ALV A;  1JUO A;  2CXJ A;  1R2U A;  1PVA A;  4WQ2 A;  1SPY A;  2NZ0 A;  3QRX A;  5CSN A;  5HYD A;  2LVJ A;  1CB1 A;  2WC8 A;  2M8U A;  1NP8 A;  1KK8 C;  2FJU B;  4ETO A;  2BKH B;  5GQQ C;  3WHU B;  3I5I B;  1OMD A;  2LHI A;  3JVT B;  2K61 A;  1RWY A;  2CNP A;  1S36 A;  1SCM B;  2CTN A;  1QLS A;  2COL B;  3EVV A;  4PHM A;  1BR1 B;  1LA3 A;  2KBM A;  3D0Y A;  4HRH A;  5B8I B;  2KGR A;  1IJ6 A;  3PN7 B;  2F2O A;  2EC6 C;  4HRG A;  1KWO B;  1BOD A;  3CTN A;  1CFF A;  4MZK A;  4XJK A;  1JFJ A;  4MBE A;  2KFH A;  4WRI A;  1NCX A;  3EK8 A;  2K7C A;  1WLZ A;  1WRL A;  1NWD A;  2K7O A;  2PVB A;  2ZND A;  1LKJ A;  1N2D A;  1UHK A;  1ALW A;  1DJZ A;  4A4B A;  4A4C A;  4I5J A;  4GNK B;  4DIR A;  1MUX A;  2ZN9 A;  3DVE A;  3I5F B;  4GPL B;  3IQQ A;  1IQ3 A;  4N5X A;  3EKH A;  2BE6 A;  1JF0 A;  1OMV A;  4PE4 A;  1SMG A;  1FBV A;  3AKA A;  4FTG A;  2IS9 A;  2OPO A;  4ZCU A;  2MAZ A;  3VRO A;  2OTG C;  1AVS A;  3NSK A;  1KK7 Y;  1V1G A;  2K2F A;  1PK0 D;  4GBA A;  1NX0 A;  4YI9 A;  3PAT A;  1CDN A;  1J55 A;  1HT9 A;  1RFJ A;  2JT3 A;  4HSZ A;  4DRW A;  3SIB A;  2O60 A;  3TDZ A;  1QX5 B;  3FWC A;  2Y5I A;  1XFW O;  1A29 A;  3KO0 A;  1F55 A;  2A4J A;  1XFX O;  4CPV A;  4DUQ A;  4M2P A;  3DD4 A;  1C07 A;  1K9U A;  2KYF A;  3F45 A;  5HLV A;  2MBX A;  2H61 C;  1S6J A;  3FWB A;  4N1F A;  3LCP C;  2G9B A;  1XFZ O;  4QJ4 B;  2CBL A;  3KF9 A;  1SK6 D;  4CFR A;  3SG4 A;  1IGV A;  1YX7 A;  1DJH A;  2LUC A;  3E3R A;  3DF0 A;  2VRG A;  1CFD A;  1JFK A;  3EVR A;  1CDM A;  2JUL A;  5CSI A;  1FI6 A;  1S5G Y;  1TRF A;  4ICB A;  1IH0 A;  2M9G A;  1YRT B;  3VRP A;  1C7W A;  2K8M B;  1W7I B;  5AFP A;  2BCX A;  2O5G A;  1L7Z A;  1EJ3 A;  1BG1 A;  4UPG A;  5KTY A;  1J7Q A;  4PCW A;  4QJ3 B;  3ICB A;  1GGZ A;  2BEC A;  1GQM A;  4ORC B;  3EVU A;  1XO5 A;  1YUT A;  3RLZ A;  1DF0 B;  3BQ3 A;  5AER A;  1KSO A;  2LVV A;  3BOW B;  1WLM A;  3DVJ A;  3TUY C;  4JWQ A;  3PSR A;  4PHJ A;  1KFX L;  1MHO A;  2HET A;  1QVI Y;  1N65 A;  2KBI A;  1J7P A;  3AAJ A;  2GGZ A;  4GGF C;  1K2H A;  4YBH B;  1OZO A;  4GGF A;  1IG5 A;  1B47 A;  2BL0 C;  2L0P A;  1QIV A;  1K9P A;  2BKI B;  1A75 B;  2JRF A;  3SG5 A;  1BF5 A;  4BY4 A;  2OS8 B;  1SBJ A;  2PAL A;  1IQ5 A;  2HQ8 A;  3AKB A;  1UHH A;  1EXR A;  1OMR A;  1S3P A;  2NCP A;  3DVM A;  3H4S E;  3BUN B;  2BBN A;  4PE7 A;  2WOR A;  2NXQ A;  3CS1 A;  4OCI A;  1LVC D;  3I5G C;  1UHN A;  1B1G A;  2MLF C;  4I5K A;  1N0Y A;  5I2L A;  3VGO A;  2LV7 A;  1KSM A;  2MLE C;  5FYX A;  1ZOT B;  3OX5 A;  2CCM A;  1CDP A;  4F0Z B;  2FCD A;  1QIW A;  2D8N A;  1OQP A;  1RTP 1;  2L5X B;  1YR5 A;  1ZFS A;  2JPT A;  3I5H B;  1REC A;  4D1E A;  5DKQ A;  1CFP A;  5J3X A;  4NQG A;  1KK7 Z; 
#chains in the Genus database with same CATH topology
 3FE8 A;  1IKU A;  1DMO A;  2KLE A;  2F8P A;  5I2O A;  1KCY A;  2JZI A;  4MSP A;  1WDC B;  3IF7 A;  1G4Y R;  2KAV A;  1IWQ A;  1KQM B;  3SG6 A;  4MEW A;  4OKH A;  3LLE A;  3CAB A;  2R2I A;  4AQJ A;  4PHK A;  2RGI A;  2LMU A;  1A03 A;  3R1V A;  3TDU A;  1FPW A;  4Q04 A;  1SKT A;  3WXA A;  2ZRS A;  1QX2 A;  3OB2 B;  5I2Q A;  1JSA A;  1YUU A;  2QAC A;  2KDH A;  1DGV A;  1U5I B;  2KSP A;  3KPX A;  4INW A;  2WCL A;  3C1V A;  3CYZ A;  1GGW A;  1OW4 A;  1FW4 A;  1LS8 A;  1H4B A;  3B87 A;  3EG5 B;  4YI8 A;  4CLN A;  1CLB A;  2KFF A;  3BFA A;  4BY5 A;  3CR4 X;  1S6I A;  2KI4 B;  1XFV O;  1Z4H A;  1CMF A;  1L2O B;  1XFR A;  2JXC A;  4M2O A;  3TS5 B;  4DS7 A;  4YGC B;  1AHR A;  1ORG A;  1QLK A;  2YGU A;  1MXE A;  4NDB A;  3BUW B;  1OOF A;  2LLT A;  4YGD B;  4M2Q A;  3PLF B;  1JBA A;  1DEL A;  2K2A A;  3VRQ A;  1XFY O;  3PM8 A;  4YRU A;  5F6T A;  4AOM A;  2V53 A;  3BYA A;  1SR6 B;  1KFX S;  1SW8 A;  1UHJ A;  3A8R A;  1BT6 A;  3WHT B;  2L51 A;  3LK1 A;  5K89 A;  1A4P A;  1K95 A;  3JTD C;  2M49 B;  2JNX A;  1B7T Y;  5JOL A;  3S0D A;  2Y4Q A;  1SSE B;  1TWO A;  1TUJ A;  3DVK A;  2KFG A;  3S0B A;  4JPZ B;  1QVI Z;  4NDC A;  1UWO A;  1KK8 B;  4L9M A;  4JQ0 D;  1CMG A;  5DIC A;  1F54 A;  3L47 A;  5HKY A;  5I8N A;  2WCE A;  2KLD A;  1YTZ C;  5PAL A;  5EL2 A;  1NX2 A;  2ZN8 A;  1DJX A;  1QX7 A;  1TOP A;  1CKK A;  2L2E A;  2PRU A;  5ER4 X;  2B1U A;  1J1E A;  1QV1 A;  1X02 A;  1SYM A;  2EC6 B;  3PAL A;  1PSB A;  4GGN A;  1DF0 A;  1QJT A;  1S6C A;  1CM4 A;  1FF1 A;  5HLO A;  1A2X A;  2EHB A;  5TNC A;  1TN4 A;  2JTT A;  3NXA A;  4PE1 A;  2PMY A;  1CFC A;  3TZ1 A;  4MZJ A;  4INX A;  4PDZ A;  3BUO B;  3D75 A;  4WQ3 A;  1A75 A;  3SJS A;  5IBW A;  2HPS A;  1IIO A;  4I5L B;  1F8H A;  1QXP A;  2KPH A;  1G8I A;  1EG3 A;  1YX8 A;  3SG7 A;  1DJW A;  1QAT A;  2ZRT A;  2GV5 A;  1NSH A;  3PJI A;  2BE4 A;  5ER5 A;  4PAL A;  3CWG A;  3UO9 A;  2BCA A;  3OGN A;  1MR8 A;  3B88 A;  1JF2 A;  2I7A A;  1M39 A;  3IQO A;  1IJ5 A;  4CID A;  2OTG B;  3CR2 A;  5D69 A;  4F7F A;  4GFT A;  2K0J A;  5I94 A;  1ZUZ A;  3D10 A;  1QAS A;  3L4A A;  1HQV A;  2M1U A;  4I5N B;  3BUM B;  2JU0 A;  2AUC A;  2SAS A;  3OBV A;  4E68 A;  3SG2 A;  1OOI X;  1SNL A;  2LP2 A;  2Q4U A;  2L50 A;  2L4I A;  2AMI A;  4YGB B;  4YGA A;  1B4C A;  2ZFD A;  1Z2C B;  3I5I C;  4OV2 A;  3K1E A;  2JNF A;  3JVT C;  1YUR A;  5JJG A;  1PRW A;  1SCM C;  3CGA A;  3O4Y A;  1F4Q A;  4U8D A;  3ZNI A;  1J7R A;  1NUB A;  2K60 A;  3S0F A;  1P28 A;  1BLQ A;  1MQ1 A;  5DKN A;  3CZT X;  3DXL A;  3PN7 C;  1ZAC A;  1QTX A;  2LAP A;  1PSR A;  1AK8 A;  4ORA B;  1KWO C;  2F3Y A;  2NLN A;  3MSE B;  3DYE A;  4HRE E;  1C3Y A;  2Y1M A;  1MWN A;  1SL8 A;  4MVF A;  3BJH A;  2M7N A;  4ORB B;  3S0E A;  1G33 A;  1DJG A;  3B6X A;  1TCF A;  2M97 A;  1BU3 A;  1SL9 A;  1YVH A;  1KFU S;  2LLU A;  2WCB A;  1YVL A;  2LHL A;  1XFU O;  2ZKM X;  2QEO A;  3I5F C;  1QS7 A;  2MA2 A;  4MRX A;  1UUS A;  1K90 D;  2QPT A;  2GTE A;  4FQT A;  2DOQ A;  1H8B A;  3GK4 X;  3RZS A;  2JTZ A;  3TUY B;  1M45 A;  1F70 A;  3OX6 A;  2PAS A;  1K8U A;  4C0J A;  2AAO A;  5AAN A;  1ZMZ A;  1LXF C;  3O6B A;  4P2Y B;  1DGU A;  3DZT A;  3TDI A;  1DC1 A;  1S26 D;  2BL0 B;  2E30 A;  4OVN F;  1XYD A;  2KNE A;  5HKZ A;  2KAY A;  2P6B B;  2QEV A;  1M63 B;  2FCE A;  1S5G Z;  2LM5 A;  3EKJ A;  2KGB C;  3IVT A;  3R1O A;  1BMO A;  2JPO A;  2BNX A;  1Q80 A;  3SS4 A;  2BBM A;  2BCB A;  4MLW A;  2I18 A;  3VRR A;  1TUZ A;  1S1E A;  2JXL A;  1LIN A;  2L5Y A;  1V1F A;  3I5G B;  3D76 A;  1XA5 A;  3HCM A;  4TNC A;  1FI5 A;  1TTX A;  3SS5 A;  3LK0 A;  2JOJ A;  1RJV A;  2FOT A;  1XK4 C;  2KAX A;  1MXL C;  1EG4 A;  1SRA A;  2KI6 C;  2WCM A;  5FI7 A;  1XK4 A;  3BFB A;  1UHI A;  3NSO A;  1XVJ A;  2M3W A;  2I2R E;  2ZNE A;  1NIW A;  1KQV A;  5FI2 A;  3OB1 B;  4C0K A;  2NCO A;  2EGD A;  1CLM A;  1RK9 A;  1RRO A;  1WY9 A;  2Y1N A;  3O2P A;  3NSI A;  2LLS A;  2LMV A;  4MZL A;  5D3O A;  3WNX B;  3B7A A;  2F3Z A;  2MHH A;  4CFQ A;  1W9Z A;  4OZD A;  3HX4 A;  1CDL A;  1NX1 A;  1WRK A;  2WND A;  1DEK A;  1OZS A;  3D0Y B;  3Q8I A;  1KFU L;  4PHN A;  3M0W A;  1UUR A;  4GAO A;  1DQE A;  5CSJ A;  2M7L A;  1J1D A;  2WOS A;  1AUI B;  3K21 A;  2WCK A;  3SS3 A;  2WC5 A;  3GK1 A;  2HF5 A;  4XJK B;  4AQI A;  1AJ5 A;  2LAN A;  3RM1 A;  1R6P A;  3BOW A;  2KI6 D;  1CLL A;  2JC2 A;  1PAL A;  2M0R A;  1TNW A;  3BUX B;  2WC6 A;  3CDN A;  3OP0 A;  2WCJ A;  5G08 A;  4P5O E;  1TIZ A;  1K93 D;  1BJF A;  2QEB A;  1E8A A;  1NCZ A;  2QEH A;  1OOJ A;  1OOH A;  1CTR A;  3UNW A;  2OS8 C;  4ZCV A;  1Y0V H;  4C0L A;  1K96 A;  1W7J B;  2CT9 A;  4XYN A;  2LP3 A;  2H61 A;  2FJY A;  5BPJ A;  1VRK A;  3SG3 A;  2M29 A;  3A4U B;  1F4O A;  2LUX A;  4IL1 A;  4N1G A;  4R1E A;  2LCP A;  1JC2 A;  1DTL A;  4IJ7 A;  1Y1X A;  5CSF A;  3VB1 A;  3CLN A;  3GOF A;  2L98 A;  2PSR A;  2LNK A;  3JTD B;  1Y6W A;  2E6W A;  3R72 A;  1Y1A A;  2KOT A;  3PFV A;  1SCV A;  1IRJ A;  5AEQ A;  3GK2 A;  4OR9 B;  1LA0 A;  1M31 A;  3I5H C;  1DVI A;  1YRU B;  2Q91 A;  1B8C A;  3EK4 A;  3KHE A;  1B8L A;  2KQY A;  1MF8 B;  5KU1 A;  2L4H A;  1NYA A;  1OE9 B;  1WDC C;  1BOC A;  1GJY A;  1PVB A;  1OSA A;  2M1K B;  1YUS A;  3R1P A;  1KQM C;  2JT8 A;  5AXI A;  3BXK A;  3ZWH A;  5KSZ A;  1CNP A;  1J7O A;  4FQO A;  5HKW A;  2KQ6 A;  3FE6 A;  1PUL A;  3OHM B;  4NDD A;  1Y1U A;  1BR4 B;  3LL8 B;  1AJ4 A;  1WRZ A;  1F71 A;  1JWD A;  2HQW A;  1K94 A;  1C7V A;  3DF0 B;  5DKR A;  3EK7 A;  4MN0 A;  1EH2 A;  1EL4 A;  1NX3 A;  3NSL A;  3S0G A;  2KHN A;  1CM1 A;  1TNX A;  4YGE B;  2QDI A;  1TCO B;  2F2P A;  1NCY A;  2JT0 A;  1DJY A;  4MRY A;  5D7F A;  2L2C A;  1SL7 A;  2ISD A;  3FS7 A;  1U5I A;  4DCK A;  2GGM A;  1SY9 A;  2H2K A;  1ODB A;  4USL A;  2JQ6 A;  2KYC A;  2MJW B;  3SIA A;  3VRN A;  1B9A A;  2I94 A;  2KI4 C;  1UP5 A;  1B7T Z;  2LC5 A;  3FIA A;  1L2O C;  4PE0 A;  3TS5 C;  5CPV A;  1B8R A;  3KEV A;  2LE9 B;  2LVK A;  1TNQ A;  1DJI A;  1K9K A;  1QV0 A;  3AAK A;  1TNP A;  4QJ5 B;  2LMT A;  1NPQ A;  4GUK A;  4JD9 A;  3V2L A;  2F33 A;  1M46 A;  2K7D A;  1SR6 C;  1D1O A;  2SCP A;  3O78 A;  2G2B A;  1C3Z A;  1AP4 A;  2JWW A;  3CR5 X;  2K7B A;  2MRD A;  3L4L A;  2LVI A;  2TN4 A;  2WCF A;  1ALV A;  1JUO A;  1OOG A;  1GM0 A;  4PT1 A;  2CXJ A;  1R2U A;  1PVA A;  4WQ2 A;  4JKT A;  1SPY A;  2NZ0 A;  5HL1 A;  3QRX A;  5CSN A;  5HYD A;  2LVJ A;  1CB1 A;  2WC8 A;  2M8U A;  1NP8 A;  1KK8 C;  2FJU B;  4ETO A;  2BKH B;  5GQQ C;  3WHU B;  3I5I B;  1OMD A;  2LHI A;  3JVT B;  2K61 A;  1RWY A;  2CNP A;  1S36 A;  1SCM B;  2CTN A;  1QLS A;  2COL B;  3EVV A;  1DT7 B;  4PHM A;  1BR1 B;  1LA3 A;  2KBM A;  3D0Y A;  4HRH A;  5B8I B;  2KGR A;  1IJ6 A;  3PN7 B;  2F2O A;  3B86 A;  2EC6 C;  4HRG A;  1KWO B;  1BOD A;  3CTN A;  1CFF A;  4MZK A;  4XJK A;  3N7H A;  4MBE A;  1JFJ A;  2KFH A;  2WCH A;  4WRI A;  2H8V A;  1NCX A;  3EK8 A;  2K7C A;  1WLZ A;  1WRL A;  1NWD A;  2K7O A;  2PVB A;  2ZND A;  1LKJ A;  1N2D A;  1UHK A;  3D77 A;  1ALW A;  1DJZ A;  4A4B A;  4A4C A;  4I5J A;  4GNK B;  4DIR A;  1MUX A;  2ZN9 A;  3DVE A;  3I5F B;  4GPL B;  3QME A;  3IQQ A;  1IQ3 A;  4N5X A;  3EKH A;  2BE6 A;  1JF0 A;  1OMV A;  4PE4 A;  1SMG A;  1FBV A;  2P70 A;  3AKA A;  2IS9 A;  4FTG A;  2OPO A;  4ZCU A;  2MAZ A;  3VRO A;  2OTG C;  1AVS A;  3NSK A;  1KK7 Y;  1V1G A;  2BAP A;  2K2F A;  1PK0 D;  4GBA A;  1NX0 A;  4KYN A;  4YI9 A;  3EVR A;  3D73 A;  3PAT A;  1CDN A;  1J55 A;  1HT9 A;  1RFJ A;  2JT3 A;  4HSZ A;  4DRW A;  3SIB A;  2O60 A;  3NHI A;  3TDZ A;  2PYQ A;  1QX5 B;  3FWC A;  2Y5I A;  3CZ1 A;  1XFW O;  1A29 A;  3KO0 A;  1F55 A;  2A4J A;  1XFX O;  2PQL A;  4CPV A;  4M2P A;  4DUQ A;  3DD4 A;  1C07 A;  1K9U A;  2KYF A;  3F45 A;  5HLV A;  2MBX A;  2H61 C;  1S6J A;  3FWB A;  4N1F A;  3LCP C;  2G9B A;  3CZ2 A;  1XFZ O;  3NHT A;  2CBL A;  4QJ4 B;  3KF9 A;  1SK6 D;  4CFR A;  3SG4 A;  1IGV A;  1YX7 A;  1DJH A;  1T14 A;  2LUC A;  3DF0 A;  2VRG A;  1CFD A;  1JFK A;  3E3R A;  1CDM A;  2JUL A;  5CSI A;  1FI6 A;  1S5G Y;  3PM2 A;  1TRF A;  4ICB A;  1IH0 A;  2M9G A;  1YRT B;  3S0A A;  3O4X A;  3VRP A;  1C7W A;  2K8M B;  1W7I B;  5AFP A;  2BCX A;  2O5G A;  1L7Z A;  1EJ3 A;  1BG1 A;  4UPG A;  5KTY A;  1J7Q A;  4PCW A;  4QJ3 B;  3D74 A;  1QWV A;  3ICB A;  1GGZ A;  2BEC A;  1GQM A;  4ORC B;  3EVU A;  1XO5 A;  1YUT A;  3RLZ A;  1DF0 B;  3BQ3 A;  5AER A;  1KSO A;  2LVV A;  3BOW B;  1WLM A;  3DVJ A;  3TUY C;  4JWQ A;  3PSR A;  4PHJ A;  1KFX L;  1MHO A;  2HET A;  3NGV A;  1QVI Y;  1N65 A;  2KBI A;  1J7P A;  3AAJ A;  2GGZ A;  4GGF C;  1K2H A;  4YBH B;  1OZO A;  4GGF A;  1IG5 A;  1B47 A;  2BL0 C;  2L0P A;  1QIV A;  1K9P A;  2BKI B;  1A75 B;  2JRF A;  3D78 A;  3SG5 A;  1BF5 A;  4BY4 A;  3BFH A;  2OS8 B;  1SBJ A;  2PAL A;  1IQ5 A;  2HQ8 A;  3AKB A;  5FI6 A;  1UHH A;  1EXR A;  1OMR A;  1S3P A;  2NCP A;  3DVM A;  3H4S E;  3BUN B;  2BBN A;  4PE7 A;  2P71 A;  2NXQ A;  2WOR A;  3CS1 A;  4OCI A;  1LVC D;  3I5G C;  1UHN A;  1B1G A;  2MLF C;  3FE9 A;  1N0Y A;  4I5K A;  3DY9 A;  5I2L A;  3VGO A;  2LV7 A;  1KSM A;  2MLE C;  5FYX A;  3CZ0 A;  1ZOT B;  2ERB A;  3OX5 A;  2CCM A;  1CDP A;  4F0Z B;  2FCD A;  1QIW A;  2D8N A;  1OQP A;  1RTP 1;  2L5X B;  1YR5 A;  1ZFS A;  2JPT A;  3I5H B;  1REC A;  4D1E A;  5DKQ A;  1CFP A;  5J3X A;  4NQG A;  1KK7 Z; 
#chains in the Genus database with same CATH homology
 1IKU A;  1DMO A;  2F8P A;  5I2O A;  1KCY A;  2JZI A;  4MSP A;  1WDC B;  3IF7 A;  1G4Y R;  2KAV A;  1IWQ A;  1KQM B;  3SG6 A;  4MEW A;  4OKH A;  3LLE A;  2R2I A;  4AQJ A;  4PHK A;  2RGI A;  2LMU A;  1A03 A;  3TDU A;  1FPW A;  4Q04 A;  1SKT A;  3WXA A;  2ZRS A;  1QX2 A;  3OB2 B;  5I2Q A;  1JSA A;  1YUU A;  2QAC A;  2KDH A;  1DGV A;  1U5I B;  2KSP A;  3KPX A;  3C1V A;  1GGW A;  1FW4 A;  1H4B A;  4YI8 A;  4CLN A;  1CLB A;  2KFF A;  4BY5 A;  3CR4 X;  1S6I A;  2KI4 B;  1XFV O;  1CMF A;  1L2O B;  2JXC A;  4M2O A;  3TS5 B;  4DS7 A;  4YGC B;  1AHR A;  1QLK A;  1MXE A;  4NDB A;  3BUW B;  2LLT A;  4YGD B;  4M2Q A;  3PLF B;  1JBA A;  2K2A A;  3VRQ A;  1XFY O;  3PM8 A;  4YRU A;  5F6T A;  4AOM A;  2V53 A;  3BYA A;  1SR6 B;  1KFX S;  1SW8 A;  1UHJ A;  3A8R A;  1BT6 A;  3WHT B;  2L51 A;  3LK1 A;  5K89 A;  1A4P A;  1K95 A;  3JTD C;  2M49 B;  2JNX A;  1B7T Y;  5JOL A;  2Y4Q A;  3DVK A;  2KFG A;  4JPZ B;  1QVI Z;  4NDC A;  1UWO A;  1KK8 B;  4L9M A;  4JQ0 D;  1CMG A;  1F54 A;  5HKY A;  5I8N A;  2WCE A;  1YTZ C;  5PAL A;  1NX2 A;  2ZN8 A;  1DJX A;  1QX7 A;  1TOP A;  1CKK A;  2L2E A;  2PRU A;  5ER4 X;  2B1U A;  1J1E A;  1QV1 A;  1X02 A;  1SYM A;  2EC6 B;  3PAL A;  1PSB A;  4GGN A;  1DF0 A;  1QJT A;  1S6C A;  1CM4 A;  1FF1 A;  5HLO A;  1A2X A;  2EHB A;  5TNC A;  1TN4 A;  2JTT A;  3NXA A;  4PE1 A;  2PMY A;  1CFC A;  3TZ1 A;  4MZJ A;  4PDZ A;  3BUO B;  4WQ3 A;  1A75 A;  3SJS A;  5IBW A;  2HPS A;  4I5L B;  1F8H A;  1QXP A;  1G8I A;  1EG3 A;  1YX8 A;  3SG7 A;  1DJW A;  1QAT A;  2ZRT A;  2GV5 A;  1NSH A;  2BE4 A;  5ER5 A;  4PAL A;  3CWG A;  2BCA A;  1MR8 A;  1JF2 A;  2I7A A;  1M39 A;  3IQO A;  1IJ5 A;  4CID A;  2OTG B;  3CR2 A;  5D69 A;  4GFT A;  2K0J A;  1ZUZ A;  3D10 A;  1QAS A;  1HQV A;  2M1U A;  4I5N B;  3BUM B;  2JU0 A;  2AUC A;  2SAS A;  4E68 A;  3SG2 A;  1SNL A;  2LP2 A;  2Q4U A;  2L50 A;  2L4I A;  2AMI A;  4YGB B;  4YGA A;  1B4C A;  2ZFD A;  3I5I C;  4OV2 A;  2JNF A;  3JVT C;  1YUR A;  5JJG A;  1PRW A;  1SCM C;  3CGA A;  3O4Y A;  1F4Q A;  4U8D A;  3ZNI A;  1J7R A;  1NUB A;  1BLQ A;  1MQ1 A;  5DKN A;  3CZT X;  3PN7 C;  1ZAC A;  1QTX A;  2LAP A;  1PSR A;  1AK8 A;  4ORA B;  1KWO C;  2F3Y A;  2NLN A;  3MSE B;  4HRE E;  2Y1M A;  1MWN A;  1SL8 A;  4ORB B;  2M7N A;  1G33 A;  1DJG A;  1TCF A;  2M97 A;  1BU3 A;  1SL9 A;  1YVH A;  1KFU S;  2LLU A;  2WCB A;  1YVL A;  2LHL A;  1XFU O;  2ZKM X;  3I5F C;  1QS7 A;  2MA2 A;  4MRX A;  1UUS A;  1K90 D;  2QPT A;  2DOQ A;  1H8B A;  3GK4 X;  2JTZ A;  3TUY B;  1M45 A;  1F70 A;  3OX6 A;  2PAS A;  1K8U A;  4C0J A;  2AAO A;  5AAN A;  1ZMZ A;  1LXF C;  3O6B A;  4P2Y B;  1DGU A;  3TDI A;  1S26 D;  2BL0 B;  2E30 A;  4OVN F;  1XYD A;  2KNE A;  5HKZ A;  2KAY A;  2P6B B;  3EKJ A;  1M63 B;  2FCE A;  1S5G Z;  2LM5 A;  4MVF A;  2KGB C;  1DT7 B;  1BMO A;  1Q80 A;  2BBM A;  2BCB A;  4MLW A;  2I18 A;  3VRR A;  1S1E A;  2JXL A;  1LIN A;  1V1F A;  3I5G B;  1XA5 A;  3HCM A;  4TNC A;  1FI5 A;  1TTX A;  3LK0 A;  2JOJ A;  1RJV A;  2FOT A;  1XK4 C;  2KAX A;  1MXL C;  1EG4 A;  1SRA A;  2KI6 C;  1XK4 A;  3NSO A;  1UHI A;  1XVJ A;  2M3W A;  2I2R E;  2ZNE A;  1NIW A;  1KQV A;  3OB1 B;  4C0K A;  2NCO A;  2EGD A;  1CLM A;  1RK9 A;  1RRO A;  1WY9 A;  2Y1N A;  3O2P A;  3NSI A;  2LLS A;  2LMV A;  4MZL A;  3WNX B;  2F3Z A;  2MHH A;  4CFQ A;  3HX4 A;  1CDL A;  1NX1 A;  1WRK A;  2WND A;  1OZS A;  3D0Y B;  1KFU L;  4PHN A;  3M0W A;  1UUR A;  4GAO A;  5CSJ A;  2M7L A;  1J1D A;  2WOS A;  1AUI B;  3K21 A;  4XJK B;  3GK1 A;  2HF5 A;  4AQI A;  1AJ5 A;  2LAN A;  3RM1 A;  1R6P A;  3BOW A;  2KI6 D;  1CLL A;  2JC2 A;  1PAL A;  2M0R A;  1TNW A;  3BUX B;  3OP0 A;  5G08 A;  4P5O E;  1TIZ A;  1K93 D;  1BJF A;  1E8A A;  1NCZ A;  1OOJ A;  1CTR A;  2OS8 C;  4ZCV A;  1Y0V H;  4C0L A;  1K96 A;  1W7J B;  2CT9 A;  4XYN A;  2LP3 A;  2H61 A;  5BPJ A;  1VRK A;  3SG3 A;  2M29 A;  3A4U B;  1F4O A;  2LUX A;  4IL1 A;  4N1G A;  4R1E A;  2LCP A;  1JC2 A;  1DTL A;  1Y1X A;  5CSF A;  3CLN A;  3GOF A;  2L98 A;  2PSR A;  2LNK A;  3JTD B;  1Y6W A;  2E6W A;  1Y1A A;  2KOT A;  3PFV A;  1SCV A;  1IRJ A;  5AEQ A;  3GK2 A;  4OR9 B;  1LA0 A;  1M31 A;  3I5H C;  1DVI A;  1YRU B;  2Q91 A;  1B8C A;  3EK4 A;  3KHE A;  1B8L A;  2KQY A;  1MF8 B;  5KU1 A;  2L4H A;  1NYA A;  1OE9 B;  1WDC C;  1BOC A;  1GJY A;  1PVB A;  1OSA A;  2M1K B;  1YUS A;  5AXI A;  1KQM C;  2JT8 A;  3ZWH A;  3BXK A;  5KSZ A;  1CNP A;  1J7O A;  4FQO A;  5HKW A;  2KQ6 A;  3OHM B;  1PUL A;  4NDD A;  1Y1U A;  1BR4 B;  3LL8 B;  1AJ4 A;  1WRZ A;  1F71 A;  1JWD A;  2HQW A;  1K94 A;  1C7V A;  3DF0 B;  5DKR A;  3EK7 A;  4MN0 A;  1EH2 A;  1EL4 A;  1NX3 A;  3NSL A;  2KHN A;  1CM1 A;  1TNX A;  4YGE B;  1TCO B;  2F2P A;  1NCY A;  2JT0 A;  1DJY A;  4MRY A;  5D7F A;  1SL7 A;  2ISD A;  3FS7 A;  1U5I A;  4DCK A;  2GGM A;  1SY9 A;  2H2K A;  1ODB A;  4USL A;  2JQ6 A;  2KYC A;  2MJW B;  3SIA A;  3VRN A;  1B9A A;  2I94 A;  2KI4 C;  1UP5 A;  1B7T Z;  2LC5 A;  3FIA A;  1L2O C;  4PE0 A;  3TS5 C;  5CPV A;  1B8R A;  3KEV A;  2LE9 B;  2LVK A;  1TNQ A;  1DJI A;  1K9K A;  1QV0 A;  3AAK A;  1TNP A;  4QJ5 B;  2LMT A;  1NPQ A;  4GUK A;  2F33 A;  1M46 A;  2K7D A;  1SR6 C;  1D1O A;  2SCP A;  3O78 A;  2G2B A;  1AP4 A;  2JWW A;  3CR5 X;  2K7B A;  2MRD A;  2LVI A;  2TN4 A;  2WCF A;  1ALV A;  1JUO A;  2CXJ A;  1R2U A;  1PVA A;  4WQ2 A;  1SPY A;  2NZ0 A;  3QRX A;  5CSN A;  5HYD A;  2LVJ A;  1CB1 A;  2WC8 A;  2M8U A;  1NP8 A;  1KK8 C;  2FJU B;  4ETO A;  2BKH B;  5GQQ C;  3WHU B;  3I5I B;  1OMD A;  2LHI A;  3JVT B;  2K61 A;  1RWY A;  2CNP A;  1S36 A;  1SCM B;  2CTN A;  1QLS A;  2COL B;  3EVV A;  4PHM A;  1BR1 B;  1LA3 A;  2KBM A;  3D0Y A;  4HRH A;  5B8I B;  2KGR A;  1IJ6 A;  3PN7 B;  2F2O A;  2EC6 C;  4HRG A;  1KWO B;  1BOD A;  3CTN A;  1CFF A;  4MZK A;  4XJK A;  1JFJ A;  4MBE A;  2KFH A;  4WRI A;  1NCX A;  3EK8 A;  2K7C A;  1WLZ A;  1WRL A;  1NWD A;  2K7O A;  2PVB A;  2ZND A;  1LKJ A;  1N2D A;  1UHK A;  1ALW A;  1DJZ A;  4A4B A;  4A4C A;  4I5J A;  4GNK B;  4DIR A;  1MUX A;  2ZN9 A;  3DVE A;  3I5F B;  4GPL B;  3IQQ A;  1IQ3 A;  4N5X A;  3EKH A;  2BE6 A;  1JF0 A;  1OMV A;  4PE4 A;  1SMG A;  1FBV A;  3AKA A;  4FTG A;  2IS9 A;  2OPO A;  4ZCU A;  2MAZ A;  3VRO A;  2OTG C;  1AVS A;  3NSK A;  1KK7 Y;  1V1G A;  2K2F A;  1PK0 D;  4GBA A;  1NX0 A;  4YI9 A;  3PAT A;  1CDN A;  1J55 A;  1HT9 A;  1RFJ A;  2JT3 A;  4HSZ A;  4DRW A;  3SIB A;  2O60 A;  3TDZ A;  1QX5 B;  3FWC A;  2Y5I A;  1XFW O;  1A29 A;  3KO0 A;  1F55 A;  2A4J A;  1XFX O;  4CPV A;  4DUQ A;  4M2P A;  3DD4 A;  1C07 A;  1K9U A;  2KYF A;  3F45 A;  5HLV A;  2MBX A;  2H61 C;  1S6J A;  3FWB A;  4N1F A;  3LCP C;  2G9B A;  1XFZ O;  4QJ4 B;  2CBL A;  3KF9 A;  1SK6 D;  4CFR A;  3SG4 A;  1IGV A;  1YX7 A;  1DJH A;  2LUC A;  3E3R A;  3DF0 A;  2VRG A;  1CFD A;  1JFK A;  3EVR A;  1CDM A;  2JUL A;  5CSI A;  1FI6 A;  1S5G Y;  1TRF A;  4ICB A;  1IH0 A;  2M9G A;  1YRT B;  3VRP A;  1C7W A;  2K8M B;  1W7I B;  5AFP A;  2BCX A;  2O5G A;  1L7Z A;  1EJ3 A;  1BG1 A;  4UPG A;  5KTY A;  1J7Q A;  4PCW A;  4QJ3 B;  3ICB A;  1GGZ A;  2BEC A;  1GQM A;  4ORC B;  3EVU A;  1XO5 A;  1YUT A;  3RLZ A;  1DF0 B;  3BQ3 A;  5AER A;  1KSO A;  2LVV A;  3BOW B;  1WLM A;  3DVJ A;  3TUY C;  4JWQ A;  3PSR A;  4PHJ A;  1KFX L;  1MHO A;  2HET A;  1QVI Y;  1N65 A;  2KBI A;  1J7P A;  3AAJ A;  2GGZ A;  4GGF C;  1K2H A;  4YBH B;  1OZO A;  4GGF A;  1IG5 A;  1B47 A;  2BL0 C;  2L0P A;  1QIV A;  1K9P A;  2BKI B;  1A75 B;  2JRF A;  3SG5 A;  1BF5 A;  4BY4 A;  2OS8 B;  1SBJ A;  2PAL A;  1IQ5 A;  2HQ8 A;  3AKB A;  1UHH A;  1EXR A;  1OMR A;  1S3P A;  2NCP A;  3DVM A;  3H4S E;  3BUN B;  2BBN A;  4PE7 A;  2WOR A;  2NXQ A;  3CS1 A;  4OCI A;  1LVC D;  3I5G C;  1UHN A;  1B1G A;  2MLF C;  4I5K A;  1N0Y A;  5I2L A;  3VGO A;  2LV7 A;  1KSM A;  2MLE C;  5FYX A;  1ZOT B;  3OX5 A;  2CCM A;  1CDP A;  4F0Z B;  2FCD A;  1QIW A;  2D8N A;  1OQP A;  1RTP 1;  2L5X B;  1YR5 A;  1ZFS A;  2JPT A;  3I5H B;  1REC A;  4D1E A;  5DKQ A;  1CFP A;  5J3X A;  4NQG A;  1KK7 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...