2M7LA

Alfa-actinin from parasite entamoeba histolytica
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
144
structure length
144
Chain Sequence
GSSSGVTAEQMQEFKQSFDAFDGNHDGILDKLEFRSCLSSMGLIDIDFTGGEDAQYDAIYNNVTKGENGVSFDNYVQYMKEKNDENPSPEQLNEIFSTIAAGKDSITETDMQKAGMSAEQIEYVKANLPQKGDGYDYAAWVKTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Calponin homology domain protein, putative
publication title Alfa-actinin from parasite Entamoeba histolytica
rcsb
source organism Entamoeba histolytica
total genus 48
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2013-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2m7lA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2m7lA02
1WDCC 2TN4A 1RWYA 5AXIA 3BXKA 4OCIA 2Q4UA 4ZCVA 4USLA 2LMUA 1YX7A 1MF8B 2I18A 4CLNA 1WLMA 1IGVA 3DVEA 1K90D 2LLUA 4WRIA 5JJGA 1K94A 1BODA 1AJ4A 4AQIA 3TS5B 4GUKA 2M7LA 2KI4B 1F70A 2BCXA 1K93D 2KYCA 1U5IB 3AAJA 3AKAA 4M2QA 1QS7A 1B9AA 1WRKA 2M1KB 4N5XA 2Y4QA 1TRFA 1KK8B 1YVHA 1OMRA 1A75B 2KI4C 4PHNA 1QV0A 3CWGA 4PCWA 4NQGA 1B7TY 1MUXA 2FCEA 1XK4A 3K21A 4YBHB 2JRFA 3D0YB 1A03A 2WCFA 2BKIB 3RM1A 3WHTB 1XO5A 1EG4A 2JNFA 2B1UA 3KPXA 4JQ0D 4TNCA 4CFRA 4ORAB 1H4BA 2A4JA 1FF1A 1F4QA 3BOWA 2IS9A 1X02A 4MLWA 5DKRA 1NCYA 2PMYA 2LVKA 1AJ5A 2KGBC 1SR6C 1LINA 2H61C 1MXEA 2F8PA 5CPVA 2FJUB 4GPLB 1N0YA 2LUCA 1NX1A 3EVVA 1C07A 3E3RA 2VRGA 1S26D 1DJHA 1JFJA 3PN7C 3DF0B 1K9PA 1LA3A 1KQVA 1S6JA 2K61A 1B4CA 2BE4A 4P2YB 1JBAA 2P6BB 2COLB 4DIRA 2HQWA 3CR2A 3NXAA 2HF5A 3FWBA 3C1VA 4MZJA 1QIWA 3FWCA 1B47A 2F2PA 1GJYA 4XYNA 5ER4X 2KAVA 5BPJA 3GOFA 4NDBA 2KGRA 3MSEB 2K8MB 5I2LA 2M29A 1FBVA 2KSPA 2KFFA 2I2RE 1DJYA 5AERA 2L2EA 1BT6A 1NCZA 2E30A 1IG5A 4JWQA 2PRUA 2KAXA 1LVCD 1Q80A 3H4SE 1AHRA 1G4YR 4F0ZB 1Y1XA 4QJ4B 1N65A 1V1FA 3FS7A 1JF2A 5DKQA 1KFXS 1CLLA 2KFHA 3CTNA 5HKZA 3F45A 1AVSA 2G2BA 1F8HA 1YRTB 1NP8A 2JU0A 2EHBA 1K9KA 1M45A 1LXFC 1BJFA 1SKTA 1JF0A 3NSIA 1OOJA 2PSRA 1F71A 1YUUA 4A4CA 2G9BA 1TCFA 2MAZA 4D1EA 2ZN8A 1SBJA 1J7OA 1SL9A 2MA2A 2KDHA 1DJXA 1CFFA 4QJ5B 1YRUB 3A8RA 5I2QA 1TIZA 1PVBA 1KFXL 3PFVA 4MZLA 4OR9B 2GV5A 1NPQA 1CNPA 1KK7Z 1DT7B 1TNQA 1WRZA 3VROA 5DKNA 2JT8A 2BECA 2KQ6A 2O60A 2LHIA 3JTDB 5AANA 3BQ3A 1UHKA 2JT3A 1YTZC 1HQVA 1SNLA 5GQQC 5FYXA 2MLFC 1XFUO 3HX4A 1ZACA 4A4BA 3LL8B 1OSAA 4YRUA 1IJ6A 2JXCA 4GGNA 1JUOA 1QLSA 3DVMA 1Y0VH 3LK0A 4YI8A 5TNCA 3JTDC 3SG4A 1M39A 1A4PA 2CBLA 4YGEB 2KNEA 2K7BA 1S1EA 1XFXO 1YVLA 3EVUA 3HCMA 1IQ3A 1R2UA 3BUWB 5IBWA 2KI6C 3IQQA 1NCXA 1NYAA 2F3ZA 1A75A 2F2OA 1GQMA 1TCOB 2KFGA 3I5IB 2BCBA 4NDDA 2LANA 4WQ2A 3GK2A 2JT0A 2M3WA 1L2OB 1G8IA 4Q04A 3ICBA 3CZTX 2NZ0A 3D0YA 1DGUA 3FIAA 2LUXA 1SCMB 1CM4A 1Y6WA 2LC5A 2ISDA 3TS5C 1DMOA 1SW8A 3I5IC 1NX0A 4I5LB 2LVIA 4C0LA 3I5HB 1S5GZ 4UPGA 1YX8A 2KI6D 3OP0A 1L2OC 1J7QA 4BY4A 5KTYA 3I5GB 2L4IA 2LVJA 3GK4X 1DJZA 3I5FB 3SG5A 3VRRA 1AUIB 2LP2A 2SCPA 1KK8C 1KFUL 1BF5A 1MWNA 1XA5A 1CDNA 2JNXA 1CLBA 3I5HC 1MR8A 1QXPA 1OE9B 1XFWO 1EL4A 4N1FA 4PE0A 3SG6A 2JULA 1YUSA 2HQ8A 2NCPA 5AEQA 2NCOA 1E8AA 1KK7Y 1A29A 1H8BA 1RK9A 3CGAA 3EK8A 3OX5A 1KQMB 4MZKA 1UHNA 3PLFB 4U8DA 1QVIZ 5ER5A 2HETA 3EK4A 1S3PA 1MHOA 3BYAA 2CTNA 3KHEA 2ZN9A 2JPTA 1DGVA 1DJWA 1FI6A 1K8UA 3VRPA 2FCDA 1OQPA 2M97A 1FI5A 2JTTA 4MSPA 1XVJA 2F33A 1WY9A 1KQMC 1LA0A 1DVIA 4I5JA 3TZ1A 1CB1A 2L5XB 3M0WA 1YURA 3EKHA 1PULA 1S36A 1SCVA 1SY9A 1UHIA 2E6WA 2MLEC 2QACA 2V53A 1DJGA 1PSRA 1IKUA 1CM1A 2I7AA 1UHJA 5PALA 1QTXA 1NIWA 4R1EA 1BU3A 4DRWA 1M31A 4PE4A 3O6BA 1AP4A 2MBXA 3BOWB 1CFDA 4HREE 1B8LA 1XK4C 2AUCA 2GGMA 1DTLA 2K2AA 4JPZB 3SJSA 2KQYA 1J7PA 3LCPC 2LCPA 4FQOA 4WQ3A 2EC6B 1XYDA 2LP3A 2CT9A 1S5GY 5G08A 4C0JA 2KOTA 4MRYA 1KCYA 4CPVA 2ZNDA 2K7OA 2CNPA 2PASA 4OVNF 4YGAA 2D8NA 2CCMA 1NX3A 1AK8A 2CXJA 2LAPA 1CMGA 2K0JA 3KF9A 4I5NB 1R6PA 1SL8A 4HRHA 4AQJA 5JOLA 5B8IB 1S6IA 1NUBA 1BR4B 1IWQA 1QX7A 1QX2A 1RFJA 4YGCB 3VGOA 3ZWHA 1J1EA 1VRKA 2WCBA 2JQ6A 2EGDA 3CR4X 2BL0B 4MBEA 2H2KA 3JVTB 1TNXA 1RROA 3BUNB 4PE1A 2AMIA 1IH0A 3D10A 3NSKA 4GGFC 1UUSA 2LV7A 1UURA 3TDZA 1FPWA 2M7NA 1WRLA 1UWOA 2LLSA 1ZOTB 1HT9A 1M63B 1PRWA 1JSAA 1UHHA 1D1OA 3NSOA 4YGDB 1TNPA 1BMOA 1DF0B 1QASA 4M2PA 2BCAA 2ZKMX 2M8UA 4XJKB 4C0KA 2HPSA 2WOSA 5HLVA 1W7JB 1LKJA 2M49B 1BOCA 1U5IA 2MRDA 2ZRTA 1IRJA 4CFQA 2PALA 3PSRA 1C7VA 3KEVA 1JFKA 5HYDA 4GBAA 1A2XA 3EK7A 1W7IB 1F4OA 1RECA 2WC8A 1PK0D 1C7WA 2L4HA 3TDUA 1B8CA 4GNKB 3VRNA 2K7DA 2KAYA 1KFUS 3BUXB 4CIDA 1OMDA 1N2DA 1RJVA 4DUQA 1J1DA 1ZMZA 1J7RA 2L50A 3SG2A 3QRXA 1BR1B 2O5GA 2ZFDA 1YR5A 2H61A 1ZUZA 1Y1UA 4ORCB 3PM8A 4HSZA 1CTRA 3BUOB 2WCEA 4GFTA 4PHMA 2KHNA 2M1UA 2ZNEA 4ORBB 1UP5A 2KBMA 3NSLA 1PSBA 5HKYA 2NLNA 3CLNA 1SCMC 2I94A 2LLTA 4MVFA 2WORA 3IQOA 2BKHB 3BUMB 3DVJA 4BY5A 5CSFA 3O4YA 4GAOA 1G33A 1EXRA 1TOPA 2LVVA 1JWDA 3I5GC 1QATA 2JWWA 2JOJA 2ZRSA 1CMFA 3DF0A 1F55A 4M2OA 1ALWA 3I5FC 2WNDA 1GGWA 1OZSA 1DJIA 2LE9B 2K2FA 2Y1MA 4YI9A 2JTZA 3ZNIA 4OV2A 4FTGA 4DCKA 1KWOB 4PHJA 5I8NA 5KU1A 2LMVA 2LMTA 1SR6B 2KBIA 1QJTA 2Q91A 1CFCA 3A4UB 1QX5B 4E68A 4PALA 2KYFA 2MHHA 1NWDA 3TDIA 3OB2B 2JZIA 5D7FA 4I5KA 1L7ZA 1KWOC 3PN7B 5F6TA 1TN4A 2OS8B 2AAOA 5D69A 1J55A 4OKHA 1K95A 3EKJA 3O78A 1Y1AA 2F3YA 3GK1A 3SG3A 4MN0A 3LK1A 2LNKA 1NX2A 3VRQA 3WNXB 1SPYA 2Y5IA 4IL1A 5HKWA 3O2PA 2DOQA 1ODBA 2OS8C 5CSJA 2BE6A 1MXLC 3OX6A 1V1GA 3KO0A 1XFZO 2SASA 3AAKA 4GGFA 1BG1A 4QJ3B 4MEWA 1S6CA 1SK6D 5I2OA 2BBMA 3CR5X 1SMGA 2MJWB 1OZOA 5AFPA 1QIVA 1M46A 1WLZA 1FW4A 2JC2A 3OHMB 1JC2A 3SIBA 1CDMA 2EC6C 4P5OE 2M9GA 4PDZA 5CSIA 2OTGB 2R2IA 1XFVO 1EJ3A 1QLKA 1K9UA 4PHKA 2K7CA 1SL7A 3PALA 3WXAA 1XFYO 3RLZA 1K96A 3SIAA 3TUYB 3IF7A 1CLMA 4ZCUA 2LM5A 1B8RA 1QVIY 2JXLA 4MRXA 1QV1A 1DF0A 3LLEA 4L9MA 5KSZA 1OMVA 1YUTA 3CS1A 1SYMA 4XJKA 2OTGC 4N1GA 1CDPA 4HRGA 4YGBB 2L98A 3PATA 3TUYC 2BL0C 4DS7A 1B7TZ 3JVTC 5J3XA 2OPOA 1K2HA 1IQ5A 2M0RA 4AOMA 4ETOA 2L0PA 1F54A 1CFPA 3DVKA 4NDCA 3OB1B 2BBNA 2QPTA 1EH2A 1TNWA 1TTXA 5HLOA 1ALVA 1PVAA 1B1GA 1KSMA 1EG3A 1KSOA 1IJ5A 2GGZA 1CKKA 2LHLA 1CDLA 3DD4A 5CSNA 2PVBA 1BLQA 1WDCB 1MQ1A 3AKBA 2L51A 1RTP1 3SG7A 4PE7A 4ICBA 2RGIA 2NXQA 3EVRA 1GGZA 2FOTA 2Y1NA 1NSHA 1PALA 3WHUB 1ZFSA 1SRAA 5K89A
chains in the Genus database with same CATH superfamily
1WDCC 2TN4A 4INWA 1RWYA 5AXIA 3BXKA 4OCIA 2Q4UA 4ZCVA 4USLA 2LMUA 1YX7A 1MF8B 2I18A 3SS5A 4CLNA 1WLMA 1IGVA 3DVEA 1K90D 2LLUA 4WRIA 5JJGA 1K94A 2WCLA 1BODA 1AJ4A 4AQIA 3TS5B 4GUKA 4F7FA 2M7LA 2KI4B 1F70A 2BCXA 1K93D 3PJIA 2KYCA 1U5IB 3AAJA 3UO9A 3AKAA 4M2QA 1QS7A 1B9AA 1WRKA 2M1KB 4N5XA 2Y4QA 1TRFA 1KK8B 1TWOA 1YVHA 1DEKA 2WC5A 1OMRA 1TUJA 1A75B 2KI4C 4PHNA 1QV0A 3CWGA 4PCWA 4NQGA 1B7TY 1MUXA 2FCEA 1XK4A 3K21A 4YBHB 2JRFA 3D0YB 1A03A 2WCFA 2BKIB 3RM1A 3WHTB 1XO5A 4INXA 1EG4A 2JNFA 2B1UA 3KPXA 4JQ0D 4TNCA 4CFRA 4ORAB 1H4BA 5FI6A 2A4JA 1FF1A 1F4QA 3BOWA 2IS9A 1X02A 1OOIX 4MLWA 5DKRA 1NCYA 2PMYA 2LVKA 1AJ5A 2KGBC 1SR6C 1LINA 2H61C 3B7AA 1MXEA 2F8PA 5CPVA 2FJUB 3CABA 4GPLB 1N0YA 2LUCA 1NX1A 3EVVA 1C07A 3E3RA 2VRGA 1S26D 1DJHA 3NHIA 1JFJA 3PN7C 3O4XA 3DF0B 1K9PA 1LA3A 3OGNA 1KQVA 1S6JA 3S0FA 2K61A 1B4CA 2BE4A 4P2YB 4PT1A 1JBAA 2P6BB 4JKTA 2COLB 4DIRA 2HQWA 3CR2A 3NXAA 2HF5A 3FWBA 3C1VA 4MZJA 1QIWA 3FWCA 1B47A 2F2PA 1GJYA 2WC6A 4XYNA 5ER4X 2KAVA 5BPJA 3GOFA 4NDBA 2KGRA 3MSEB 2K8MB 5I2LA 2M29A 1FBVA 2KSPA 2KFFA 2I2RE 1DJYA 5D3OA 5AERA 2L2EA 1BT6A 1NCZA 2E30A 1IG5A 2L5YA 4JWQA 3S0GA 2PRUA 2KAXA 1LVCD 1Q80A 3H4SE 1AHRA 1G4YR 4F0ZB 1Y1XA 4QJ4B 1DELA 1N65A 1V1FA 1JF2A 1SSEB 3FS7A 5DKQA 1KFXS 3UNWA 1CLLA 2KFHA 3CTNA 5HKZA 3F45A 1AVSA 2G2BA 3FE9A 1F8HA 1YRTB 1NP8A 2JU0A 2EHBA 1K9KA 1M45A 2GTEA 1LXFC 3Q8IA 1BJFA 1SKTA 1JF0A 3NSIA 1OOJA 2PSRA 1F71A 1YUUA 4A4CA 3QMEA 2G9BA 1TCFA 2MAZA 1W9ZA 4D1EA 2ZN8A 1SBJA 1J7OA 1SL9A 2WCKA 2MA2A 2KDHA 1DJXA 1CFFA 3FE6A 4QJ5B 1YRUB 3A8RA 5I2QA 3B86A 1TIZA 3NHTA 1PVBA 1KFXL 3PFVA 4MZLA 4OR9B 2GV5A 1ORGA 1Z2CB 1NPQA 1CNPA 1KK7Z 1DT7B 1TNQA 1WRZA 3VROA 2WCHA 5DKNA 2JT8A 2BECA 2KQ6A 2O60A 2LHIA 3JTDB 5AANA 3BQ3A 5HL1A 1UHKA 2JT3A 1YTZC 1HQVA 1SNLA 5GQQC 5FYXA 2MLFC 1XFUO 2JPOA 3HX4A 1ZACA 4JD9A 3LL8B 4A4BA 1OSAA 4YRUA 5K89A 1IJ6A 2JXCA 4GGNA 1JUOA 1QLSA 3DVMA 3R1VA 1Y0VH 3LK0A 4YI8A 5TNCA 3JTDC 3SG4A 1M39A 1A4PA 2CBLA 4YGEB 2KNEA 2K7BA 1S1EA 1XFRA 3D76A 1XFXO 1YVLA 3EVUA 3HCMA 1IQ3A 1R2UA 3BUWB 5IBWA 2KI6C 3IQQA 1NCXA 1NYAA 4IJ7A 3D74A 2YGUA 2F3ZA 1A75A 3DZTA 2F2OA 1GQMA 1TCOB 2KFGA 3I5IB 3B6XA 2BCBA 4NDDA 2LANA 3R72A 4WQ2A 3GK2A 2JT0A 2M3WA 1L2OB 1G8IA 4Q04A 3ICBA 3CZTX 2NZ0A 3D0YA 1DGUA 3FIAA 2LUXA 2QEBA 3DXLA 1SCMB 1CM4A 1Y6WA 2LC5A 2ISDA 3TS5C 1DMOA 1SW8A 3I5IC 1NX0A 4I5LB 2LVIA 1TUZA 3I5HB 1S5GZ 4C0LA 4UPGA 1YX8A 2KI6D 3OP0A 1L2OC 1J7QA 4BY4A 3SS3A 5KTYA 3I5GB 2L4IA 2LVJA 3GK4X 1DJZA 3I5FB 3SG5A 3VRRA 1AUIB 2LP2A 2SCPA 1KK8C 1KFUL 1BF5A 1MWNA 1XA5A 2QDIA 1CDNA 2JNXA 1CLBA 3I5HC 1MR8A 1QXPA 1OE9B 1XFWO 1EL4A 4N1FA 4PE0A 3SG6A 2JULA 1YUSA 2HQ8A 2NCPA 5AEQA 2NCOA 1E8AA 3BFBA 1KK7Y 1A29A 1H8BA 1RK9A 3CGAA 3EK8A 3OX5A 1KQMB 4MZKA 1UHNA 3PLFB 4U8DA 1QVIZ 5ER5A 2HETA 3EK4A 3CDNA 1S3PA 5FI2A 1MHOA 3BYAA 2CTNA 3KHEA 2ZN9A 2JPTA 1DGVA 1DJWA 3N7HA 1LS8A 1FI6A 1K8UA 3VRPA 2FCDA 1OQPA 2M97A 1FI5A 2JTTA 4MSPA 1XVJA 2F33A 1WY9A 1KQMC 1LA0A 1DVIA 4I5JA 3TZ1A 1CB1A 3B88A 2L5XB 3M0WA 3BFAA 3D78A 1YURA 3BJHA 1PULA 1S36A 1SCVA 1SY9A 1UHIA 2E6WA 2MLEC 2QACA 3EKHA 3FE8A 2V53A 1DJGA 1PSRA 3S0EA 1IKUA 1CM1A 2QEHA 2I7AA 3EG5B 1UHJA 5PALA 1QTXA 1NIWA 3D77A 4R1EA 1BU3A 4DRWA 1M31A 4PE4A 3O6BA 5FI7A 1AP4A 2MBXA 1C3YA 3BOWB 1CFDA 4HREE 1B8LA 1XK4C 2AUCA 2GGMA 1DTLA 2K2AA 3D75A 4JPZB 2KQYA 2P70A 1J7PA 3LCPC 2LCPA 4FQOA 4WQ3A 2EC6B 1XYDA 2LP3A 2CT9A 1S5GY 3CZ2A 5G08A 4C0JA 2KOTA 4MRYA 1KCYA 4CPVA 2ZNDA 2K7OA 2CNPA 2PASA 4OVNF 4YGAA 2D8NA 2CCMA 4KYNA 1NX3A 1AK8A 2CXJA 2LAPA 1OW4A 2KLEA 2K0JA 2PYQA 2QEVA 3KF9A 4I5NB 1CMGA 1R6PA 1SL8A 4HRHA 4AQJA 5JOLA 2BAPA 1S6IA 5B8IB 1NUBA 1BR4B 1IWQA 1QX7A 1QX2A 1RFJA 4YGCB 3VGOA 3ZWHA 1J1EA 1VRKA 2WCBA 2JQ6A 2EGDA 3CR4X 2BL0B 4MBEA 3CYZA 2H2KA 3JVTB 2KLDA 1TNXA 2H8VA 1RROA 3BUNB 4PE1A 2AMIA 1IH0A 3D10A 3NSKA 4GGFC 1UUSA 2LV7A 1UURA 3TDZA 3V2LA 1FPWA 2M7NA 1WRLA 1UWOA 2LLSA 1ZOTB 1HT9A 1M63B 1PRWA 3IVTA 1JSAA 3CZ1A 1UHHA 1D1OA 3NSOA 4YGDB 1TNPA 1BMOA 1DF0B 1QASA 4M2PA 2BCAA 2ZKMX 2M8UA 4XJKB 4C0KA 2HPSA 2WOSA 5HLVA 1W7JB 1LKJA 2M49B 1BOCA 1U5IA 2MRDA 2ZRTA 1IRJA 4CFQA 5I94A 2PALA 2BNXA 3PSRA 3KEVA 1C7VA 1JFKA 5HYDA 4GBAA 1A2XA 3EK7A 1W7IB 1F4OA 1RECA 2WC8A 1PK0D 1C7WA 2L4HA 3TDUA 1DQEA 1B8CA 4GNKB 3VRNA 2K7DA 2KAYA 1KFUS 3BUXB 4CIDA 1QWVA 1OMDA 1N2DA 1RJVA 3PM2A 4DUQA 1J1DA 1ZMZA 1J7RA 2L50A 3RZSA 3SG2A 3QRXA 1BR1B 2O5GA 2ZFDA 1YR5A 2H61A 1ZUZA 1DC1A 1Y1UA 4ORCB 3PM8A 4HSZA 3R1PA 1CTRA 3BUOB 2WCEA 4GFTA 4PHMA 1T14A 2KHNA 2M1UA 2L2CA 2ZNEA 4ORBB 1UP5A 2KBMA 3NSLA 1PSBA 5HKYA 2NLNA 3CLNA 1SCMC 2I94A 4OZDA 1P28A 2LLTA 2WORA 3IQOA 4MVFA 2BKHB 3BUMB 3DVJA 4BY5A 5CSFA 3O4YA 4GAOA 1G33A 1EXRA 1TOPA 2LVVA 1JWDA 3I5GC 1QATA 2JWWA 2JOJA 3S0AA 2ZRSA 1CMFA 3DF0A 1F55A 4M2OA 1ALWA 3I5FC 2ERBA 2WNDA 1GGWA 1OZSA 1DJIA 2LE9B 2K2FA 2Y1MA 4YI9A 1OOHA 2JTZA 2WCJA 3ZNIA 3R1OA 4OV2A 4FTGA 4DCKA 1KWOB 4PHJA 5I8NA 2WCMA 5KU1A 1OOGA 2LMVA 1OOFA 1SR6B 2KBIA 2LMTA 1QJTA 2Q91A 3BFHA 1CFCA 3A4UB 1QX5B 4E68A 4PALA 2KYFA 3S0BA 2MHHA 1NWDA 3TDIA 3OB2B 2JZIA 5D7FA 4I5KA 5EL2A 1L7ZA 1KWOC 3PN7B 5F6TA 1TN4A 2OS8B 2AAOA 5D69A 1IIOA 1J55A 4OKHA 1K95A 3EKJA 3O78A 1Y1AA 2F3YA 3GK1A 3SG3A 4MN0A 3LK1A 2LNKA 1NX2A 3VRQA 3WNXB 1SPYA 2Y5IA 4IL1A 5HKWA 3O2PA 3L4AA 2DOQA 1ODBA 2OS8C 5CSJA 3CZ0A 1GM0A 2BE6A 1MXLC 3D73A 1V1GA 3OX6A 3KO0A 1XFZO 2FJYA 2SASA 3AAKA 4GGFA 1BG1A 4QJ3B 4MEWA 1S6CA 1SK6D 5I2OA 2BBMA 3CR5X 1C3ZA 1SMGA 2MJWB 2P71A 1OZOA 5AFPA 1QIVA 1M46A 1WLZA 2PQLA 1FW4A 2JC2A 3OHMB 1JC2A 3SIBA 1CDMA 2EC6C 4P5OE 2M9GA 4PDZA 5CSIA 2OTGB 2R2IA 1XFVO 1EJ3A 3K1EA 1QLKA 1K9UA 2KPHA 4PHKA 2K7CA 1SL7A 3PALA 3WXAA 1XFYO 3RLZA 1K96A 3SIAA 3TUYB 3IF7A 1CLMA 4ZCUA 2LM5A 3DY9A 1B8RA 1QVIY 2JXLA 4MRXA 1QV1A 1DF0A 3LLEA 4L9MA 5KSZA 1OMVA 1YUTA 3CS1A 1SYMA 4XJKA 2OTGC 4N1GA 1CDPA 4HRGA 4YGBB 3L4LA 2L98A 3PATA 3TUYC 2BL0C 3NGVA 4DS7A 1B7TZ 3JVTC 5J3XA 2OPOA 1K2HA 1IQ5A 2M0RA 4AOMA 3L47A 4ETOA 2K60A 2L0PA 1CFPA 3S0DA 3SS4A 5DICA 1F54A 3DVKA 4NDCA 3OB1B 2BBNA 2QPTA 3VB1A 1EH2A 1TNWA 1TTXA 5HLOA 1ALVA 1PVAA 1B1GA 1KSMA 2QEOA 1EG3A 1KSOA 3SJSA 1IJ5A 2GGZA 1CKKA 2LHLA 1CDLA 3DD4A 3OBVA 5CSNA 3B87A 2PVBA 1BLQA 1WDCB 1MQ1A 3AKBA 2L51A 1RTP1 3SG7A 4PE7A 4ICBA 2RGIA 2NXQA 4FQTA 1Z4HA 3EVRA 1GGZA 2FOTA 2Y1NA 1NSHA 1PALA 3WHUB 1ZFSA 1SRAA 3DYEA
chains in the Genus database with same CATH topology
1WDCC 2TN4A 1RWYA 5AXIA 3BXKA 4OCIA 2Q4UA 4ZCVA 4USLA 2LMUA 1YX7A 1MF8B 2I18A 4CLNA 1WLMA 1IGVA 3DVEA 1K90D 2LLUA 4WRIA 5JJGA 1K94A 1BODA 1AJ4A 4AQIA 3TS5B 4GUKA 2M7LA 2KI4B 1F70A 2BCXA 1K93D 2KYCA 1U5IB 3AAJA 3AKAA 4M2QA 1QS7A 1B9AA 1WRKA 2M1KB 4N5XA 2Y4QA 1TRFA 1KK8B 1YVHA 1OMRA 1A75B 2KI4C 4PHNA 1QV0A 3CWGA 4PCWA 4NQGA 1B7TY 1MUXA 2FCEA 1XK4A 3K21A 4YBHB 2JRFA 3D0YB 1A03A 2WCFA 2BKIB 3RM1A 3WHTB 1XO5A 1EG4A 2JNFA 2B1UA 3KPXA 4JQ0D 4TNCA 4CFRA 4ORAB 1H4BA 2A4JA 1FF1A 1F4QA 3BOWA 2IS9A 1X02A 4MLWA 5DKRA 1NCYA 2PMYA 2LVKA 1AJ5A 2KGBC 1SR6C 1LINA 2H61C 1MXEA 2F8PA 5CPVA 2FJUB 4GPLB 1N0YA 2LUCA 1NX1A 3EVVA 1C07A 3E3RA 2VRGA 1S26D 1DJHA 1JFJA 3PN7C 3DF0B 1K9PA 1LA3A 1KQVA 1S6JA 2K61A 1B4CA 2BE4A 4P2YB 1JBAA 2P6BB 2COLB 4DIRA 2HQWA 3CR2A 3NXAA 2HF5A 3FWBA 3C1VA 4MZJA 1QIWA 3FWCA 1B47A 2F2PA 1GJYA 4XYNA 5ER4X 2KAVA 5BPJA 3GOFA 4NDBA 2KGRA 3MSEB 2K8MB 5I2LA 2M29A 1FBVA 2KSPA 2KFFA 2I2RE 1DJYA 5AERA 2L2EA 1BT6A 1NCZA 2E30A 1IG5A 4JWQA 2PRUA 2KAXA 1LVCD 1Q80A 3H4SE 1AHRA 1G4YR 4F0ZB 1Y1XA 4QJ4B 1N65A 1V1FA 3FS7A 1JF2A 5DKQA 1KFXS 1CLLA 2KFHA 3CTNA 5HKZA 3F45A 1AVSA 2G2BA 1F8HA 1YRTB 1NP8A 2JU0A 2EHBA 1K9KA 1M45A 1LXFC 1BJFA 1SKTA 1JF0A 3NSIA 1OOJA 2PSRA 1F71A 1YUUA 4A4CA 2G9BA 1TCFA 2MAZA 4D1EA 2ZN8A 1SBJA 1J7OA 1SL9A 2MA2A 2KDHA 1DJXA 1CFFA 4QJ5B 1YRUB 3A8RA 5I2QA 1TIZA 1PVBA 1KFXL 3PFVA 4MZLA 4OR9B 2GV5A 1NPQA 1CNPA 1KK7Z 1DT7B 1TNQA 1WRZA 3VROA 5DKNA 2JT8A 2BECA 2KQ6A 2O60A 2LHIA 3JTDB 5AANA 3BQ3A 1UHKA 2JT3A 1YTZC 1HQVA 1SNLA 5GQQC 5FYXA 2MLFC 1XFUO 3HX4A 1ZACA 4A4BA 3LL8B 1OSAA 4YRUA 1IJ6A 2JXCA 4GGNA 1JUOA 1QLSA 3DVMA 1Y0VH 3LK0A 4YI8A 5TNCA 3JTDC 3SG4A 1M39A 1A4PA 2CBLA 4YGEB 2KNEA 2K7BA 1S1EA 1XFXO 1YVLA 3EVUA 3HCMA 1IQ3A 1R2UA 3BUWB 5IBWA 2KI6C 3IQQA 1NCXA 1NYAA 2F3ZA 1A75A 2F2OA 1GQMA 1TCOB 2KFGA 3I5IB 2BCBA 4NDDA 2LANA 4WQ2A 3GK2A 2JT0A 2M3WA 1L2OB 1G8IA 4Q04A 3ICBA 3CZTX 2NZ0A 3D0YA 1DGUA 3FIAA 2LUXA 1SCMB 1CM4A 1Y6WA 2LC5A 2ISDA 3TS5C 1DMOA 1SW8A 3I5IC 1NX0A 4I5LB 2LVIA 4C0LA 3I5HB 1S5GZ 4UPGA 1YX8A 2KI6D 3OP0A 1L2OC 1J7QA 4BY4A 5KTYA 3I5GB 2L4IA 2LVJA 3GK4X 1DJZA 3I5FB 3SG5A 3VRRA 1AUIB 2LP2A 2SCPA 1KK8C 1KFUL 1BF5A 1MWNA 1XA5A 1CDNA 2JNXA 1CLBA 3I5HC 1MR8A 1QXPA 1OE9B 1XFWO 1EL4A 4N1FA 4PE0A 3SG6A 2JULA 1YUSA 2HQ8A 2NCPA 5AEQA 2NCOA 1E8AA 1KK7Y 1A29A 1H8BA 1RK9A 3CGAA 3EK8A 3OX5A 1KQMB 4MZKA 1UHNA 3PLFB 4U8DA 1QVIZ 5ER5A 2HETA 3EK4A 1S3PA 1MHOA 3BYAA 2CTNA 3KHEA 2ZN9A 2JPTA 1DGVA 1DJWA 1FI6A 1K8UA 3VRPA 2FCDA 1OQPA 2M97A 1FI5A 2JTTA 4MSPA 1XVJA 2F33A 1WY9A 1KQMC 1LA0A 1DVIA 4I5JA 3TZ1A 1CB1A 2L5XB 3M0WA 1YURA 3EKHA 1PULA 1S36A 1SCVA 1SY9A 1UHIA 2E6WA 2MLEC 2QACA 2V53A 1DJGA 1PSRA 1IKUA 1CM1A 2I7AA 1UHJA 5PALA 1QTXA 1NIWA 4R1EA 1BU3A 4DRWA 1M31A 4PE4A 3O6BA 1AP4A 2MBXA 3BOWB 1CFDA 4HREE 1B8LA 1XK4C 2AUCA 2GGMA 1DTLA 2K2AA 4JPZB 3SJSA 2KQYA 1J7PA 3LCPC 2LCPA 4FQOA 4WQ3A 2EC6B 1XYDA 2LP3A 2CT9A 1S5GY 5G08A 4C0JA 2KOTA 4MRYA 1KCYA 4CPVA 2ZNDA 2K7OA 2CNPA 2PASA 4OVNF 4YGAA 2D8NA 2CCMA 1NX3A 1AK8A 2CXJA 2LAPA 1CMGA 2K0JA 3KF9A 4I5NB 1R6PA 1SL8A 4HRHA 4AQJA 5JOLA 5B8IB 1S6IA 1NUBA 1BR4B 1IWQA 1QX7A 1QX2A 1RFJA 4YGCB 3VGOA 3ZWHA 1J1EA 1VRKA 2WCBA 2JQ6A 2EGDA 3CR4X 2BL0B 4MBEA 2H2KA 3JVTB 1TNXA 1RROA 3BUNB 4PE1A 2AMIA 1IH0A 3D10A 3NSKA 4GGFC 1UUSA 2LV7A 1UURA 3TDZA 1FPWA 2M7NA 1WRLA 1UWOA 2LLSA 1ZOTB 1HT9A 1M63B 1PRWA 1JSAA 1UHHA 1D1OA 3NSOA 4YGDB 1TNPA 1BMOA 1DF0B 1QASA 4M2PA 2BCAA 2ZKMX 2M8UA 4XJKB 4C0KA 2HPSA 2WOSA 5HLVA 1W7JB 1LKJA 2M49B 1BOCA 1U5IA 2MRDA 2ZRTA 1IRJA 4CFQA 2PALA 3PSRA 1C7VA 3KEVA 1JFKA 5HYDA 4GBAA 1A2XA 3EK7A 1W7IB 1F4OA 1RECA 2WC8A 1PK0D 1C7WA 2L4HA 3TDUA 1B8CA 4GNKB 3VRNA 2K7DA 2KAYA 1KFUS 3BUXB 4CIDA 1OMDA 1N2DA 1RJVA 4DUQA 1J1DA 1ZMZA 1J7RA 2L50A 3SG2A 3QRXA 1BR1B 2O5GA 2ZFDA 1YR5A 2H61A 1ZUZA 1Y1UA 4ORCB 3PM8A 4HSZA 1CTRA 3BUOB 2WCEA 4GFTA 4PHMA 2KHNA 2M1UA 2ZNEA 4ORBB 1UP5A 2KBMA 3NSLA 1PSBA 5HKYA 2NLNA 3CLNA 1SCMC 2I94A 2LLTA 4MVFA 2WORA 3IQOA 2BKHB 3BUMB 3DVJA 4BY5A 5CSFA 3O4YA 4GAOA 1G33A 1EXRA 1TOPA 2LVVA 1JWDA 3I5GC 1QATA 2JWWA 2JOJA 2ZRSA 1CMFA 3DF0A 1F55A 4M2OA 1ALWA 3I5FC 2WNDA 1GGWA 1OZSA 1DJIA 2LE9B 2K2FA 2Y1MA 4YI9A 2JTZA 3ZNIA 4OV2A 4FTGA 4DCKA 1KWOB 4PHJA 5I8NA 5KU1A 2LMVA 2LMTA 1SR6B 2KBIA 1QJTA 2Q91A 1CFCA 3A4UB 1QX5B 4E68A 4PALA 2KYFA 2MHHA 1NWDA 3TDIA 3OB2B 2JZIA 5D7FA 4I5KA 1L7ZA 1KWOC 3PN7B 5F6TA 1TN4A 2OS8B 2AAOA 5D69A 1J55A 4OKHA 1K95A 3EKJA 3O78A 1Y1AA 2F3YA 3GK1A 3SG3A 4MN0A 3LK1A 2LNKA 1NX2A 3VRQA 3WNXB 1SPYA 2Y5IA 4IL1A 5HKWA 3O2PA 2DOQA 1ODBA 2OS8C 5CSJA 2BE6A 1MXLC 3OX6A 1V1GA 3KO0A 1XFZO 2SASA 3AAKA 4GGFA 1BG1A 4QJ3B 4MEWA 1S6CA 1SK6D 5I2OA 2BBMA 3CR5X 1SMGA 2MJWB 1OZOA 5AFPA 1QIVA 1M46A 1WLZA 1FW4A 2JC2A 3OHMB 1JC2A 3SIBA 1CDMA 2EC6C 4P5OE 2M9GA 4PDZA 5CSIA 2OTGB 2R2IA 1XFVO 1EJ3A 1QLKA 1K9UA 4PHKA 2K7CA 1SL7A 3PALA 3WXAA 1XFYO 3RLZA 1K96A 3SIAA 3TUYB 3IF7A 1CLMA 4ZCUA 2LM5A 1B8RA 1QVIY 2JXLA 4MRXA 1QV1A 1DF0A 3LLEA 4L9MA 5KSZA 1OMVA 1YUTA 3CS1A 1SYMA 4XJKA 2OTGC 4N1GA 1CDPA 4HRGA 4YGBB 2L98A 3PATA 3TUYC 2BL0C 4DS7A 1B7TZ 3JVTC 5J3XA 2OPOA 1K2HA 1IQ5A 2M0RA 4AOMA 4ETOA 2L0PA 1F54A 1CFPA 3DVKA 4NDCA 3OB1B 2BBNA 2QPTA 1EH2A 1TNWA 1TTXA 5HLOA 1ALVA 1PVAA 1B1GA 1KSMA 1EG3A 1KSOA 1IJ5A 2GGZA 1CKKA 2LHLA 1CDLA 3DD4A 5CSNA 2PVBA 1BLQA 1WDCB 1MQ1A 3AKBA 2L51A 1RTP1 3SG7A 4PE7A 4ICBA 2RGIA 2NXQA 3EVRA 1GGZA 2FOTA 2Y1NA 1NSHA 1PALA 3WHUB 1ZFSA 1SRAA 5K89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WDC C;  2TN4 A;  1RWY A;  5AXI A;  3BXK A;  4OCI A;  2Q4U A;  4ZCV A;  4USL A;  2LMU A;  1YX7 A;  1MF8 B;  2I18 A;  4CLN A;  1WLM A;  1IGV A;  3DVE A;  1K90 D;  2LLU A;  4WRI A;  5JJG A;  1K94 A;  1BOD A;  1AJ4 A;  4AQI A;  3TS5 B;  4GUK A;  2M7L A;  2KI4 B;  1F70 A;  2BCX A;  1K93 D;  2KYC A;  1U5I B;  3AAJ A;  3AKA A;  4M2Q A;  1QS7 A;  1B9A A;  1WRK A;  2M1K B;  4N5X A;  2Y4Q A;  1TRF A;  1KK8 B;  1YVH A;  1OMR A;  1A75 B;  2KI4 C;  4PHN A;  1QV0 A;  3CWG A;  4PCW A;  4NQG A;  1B7T Y;  1MUX A;  2FCE A;  1XK4 A;  3K21 A;  4YBH B;  2JRF A;  3D0Y B;  1A03 A;  2WCF A;  2BKI B;  3RM1 A;  3WHT B;  1XO5 A;  1EG4 A;  2JNF A;  2B1U A;  3KPX A;  4JQ0 D;  4TNC A;  4CFR A;  4ORA B;  1H4B A;  2A4J A;  1FF1 A;  1F4Q A;  3BOW A;  2IS9 A;  1X02 A;  4MLW A;  5DKR A;  1NCY A;  2PMY A;  2LVK A;  1AJ5 A;  2KGB C;  1SR6 C;  1LIN A;  2H61 C;  1MXE A;  2F8P A;  5CPV A;  2FJU B;  4GPL B;  1N0Y A;  2LUC A;  1NX1 A;  3EVV A;  1C07 A;  3E3R A;  2VRG A;  1S26 D;  1DJH A;  1JFJ A;  3PN7 C;  3DF0 B;  1K9P A;  1LA3 A;  1KQV A;  1S6J A;  2K61 A;  1B4C A;  2BE4 A;  4P2Y B;  1JBA A;  2P6B B;  2COL B;  4DIR A;  2HQW A;  3CR2 A;  3NXA A;  2HF5 A;  3FWB A;  3C1V A;  4MZJ A;  1QIW A;  3FWC A;  1B47 A;  2F2P A;  1GJY A;  4XYN A;  5ER4 X;  2KAV A;  5BPJ A;  3GOF A;  4NDB A;  2KGR A;  3MSE B;  2K8M B;  5I2L A;  2M29 A;  1FBV A;  2KSP A;  2KFF A;  2I2R E;  1DJY A;  5AER A;  2L2E A;  1BT6 A;  1NCZ A;  2E30 A;  1IG5 A;  4JWQ A;  2PRU A;  2KAX A;  1LVC D;  1Q80 A;  3H4S E;  1AHR A;  1G4Y R;  4F0Z B;  1Y1X A;  4QJ4 B;  1N65 A;  1V1F A;  3FS7 A;  1JF2 A;  5DKQ A;  1KFX S;  1CLL A;  2KFH A;  3CTN A;  5HKZ A;  3F45 A;  1AVS A;  2G2B A;  1F8H A;  1YRT B;  1NP8 A;  2JU0 A;  2EHB A;  1K9K A;  1M45 A;  1LXF C;  1BJF A;  1SKT A;  1JF0 A;  3NSI A;  1OOJ A;  2PSR A;  1F71 A;  1YUU A;  4A4C A;  2G9B A;  1TCF A;  2MAZ A;  4D1E A;  2ZN8 A;  1SBJ A;  1J7O A;  1SL9 A;  2MA2 A;  2KDH A;  1DJX A;  1CFF A;  4QJ5 B;  1YRU B;  3A8R A;  5I2Q A;  1TIZ A;  1PVB A;  1KFX L;  3PFV A;  4MZL A;  4OR9 B;  2GV5 A;  1NPQ A;  1CNP A;  1KK7 Z;  1DT7 B;  1TNQ A;  1WRZ A;  3VRO A;  5DKN A;  2JT8 A;  2BEC A;  2KQ6 A;  2O60 A;  2LHI A;  3JTD B;  5AAN A;  3BQ3 A;  1UHK A;  2JT3 A;  1YTZ C;  1HQV A;  1SNL A;  5GQQ C;  5FYX A;  2MLF C;  1XFU O;  3HX4 A;  1ZAC A;  4A4B A;  3LL8 B;  1OSA A;  4YRU A;  1IJ6 A;  2JXC A;  4GGN A;  1JUO A;  1QLS A;  3DVM A;  1Y0V H;  3LK0 A;  4YI8 A;  5TNC A;  3JTD C;  3SG4 A;  1M39 A;  1A4P A;  2CBL A;  4YGE B;  2KNE A;  2K7B A;  1S1E A;  1XFX O;  1YVL A;  3EVU A;  3HCM A;  1IQ3 A;  1R2U A;  3BUW B;  5IBW A;  2KI6 C;  3IQQ A;  1NCX A;  1NYA A;  2F3Z A;  1A75 A;  2F2O A;  1GQM A;  1TCO B;  2KFG A;  3I5I B;  2BCB A;  4NDD A;  2LAN A;  4WQ2 A;  3GK2 A;  2JT0 A;  2M3W A;  1L2O B;  1G8I A;  4Q04 A;  3ICB A;  3CZT X;  2NZ0 A;  3D0Y A;  1DGU A;  3FIA A;  2LUX A;  1SCM B;  1CM4 A;  1Y6W A;  2LC5 A;  2ISD A;  3TS5 C;  1DMO A;  1SW8 A;  3I5I C;  1NX0 A;  4I5L B;  2LVI A;  4C0L A;  3I5H B;  1S5G Z;  4UPG A;  1YX8 A;  2KI6 D;  3OP0 A;  1L2O C;  1J7Q A;  4BY4 A;  5KTY A;  3I5G B;  2L4I A;  2LVJ A;  3GK4 X;  1DJZ A;  3I5F B;  3SG5 A;  3VRR A;  1AUI B;  2LP2 A;  2SCP A;  1KK8 C;  1KFU L;  1BF5 A;  1MWN A;  1XA5 A;  1CDN A;  2JNX A;  1CLB A;  3I5H C;  1MR8 A;  1QXP A;  1OE9 B;  1XFW O;  1EL4 A;  4N1F A;  4PE0 A;  3SG6 A;  2JUL A;  1YUS A;  2HQ8 A;  2NCP A;  5AEQ A;  2NCO A;  1E8A A;  1KK7 Y;  1A29 A;  1H8B A;  1RK9 A;  3CGA A;  3EK8 A;  3OX5 A;  1KQM B;  4MZK A;  1UHN A;  3PLF B;  4U8D A;  1QVI Z;  5ER5 A;  2HET A;  3EK4 A;  1S3P A;  1MHO A;  3BYA A;  2CTN A;  3KHE A;  2ZN9 A;  2JPT A;  1DGV A;  1DJW A;  1FI6 A;  1K8U A;  3VRP A;  2FCD A;  1OQP A;  2M97 A;  1FI5 A;  2JTT A;  4MSP A;  1XVJ A;  2F33 A;  1WY9 A;  1KQM C;  1LA0 A;  1DVI A;  4I5J A;  3TZ1 A;  1CB1 A;  2L5X B;  3M0W A;  1YUR A;  3EKH A;  1PUL A;  1S36 A;  1SCV A;  1SY9 A;  1UHI A;  2E6W A;  2MLE C;  2QAC A;  2V53 A;  1DJG A;  1PSR A;  1IKU A;  1CM1 A;  2I7A A;  1UHJ A;  5PAL A;  1QTX A;  1NIW A;  4R1E A;  1BU3 A;  4DRW A;  1M31 A;  4PE4 A;  3O6B A;  1AP4 A;  2MBX A;  3BOW B;  1CFD A;  4HRE E;  1B8L A;  1XK4 C;  2AUC A;  2GGM A;  1DTL A;  2K2A A;  4JPZ B;  3SJS A;  2KQY A;  1J7P A;  3LCP C;  2LCP A;  4FQO A;  4WQ3 A;  2EC6 B;  1XYD A;  2LP3 A;  2CT9 A;  1S5G Y;  5G08 A;  4C0J A;  2KOT A;  4MRY A;  1KCY A;  4CPV A;  2ZND A;  2K7O A;  2CNP A;  2PAS A;  4OVN F;  4YGA A;  2D8N A;  2CCM A;  1NX3 A;  1AK8 A;  2CXJ A;  2LAP A;  1CMG A;  2K0J A;  3KF9 A;  4I5N B;  1R6P A;  1SL8 A;  4HRH A;  4AQJ A;  5JOL A;  5B8I B;  1S6I A;  1NUB A;  1BR4 B;  1IWQ A;  1QX7 A;  1QX2 A;  1RFJ A;  4YGC B;  3VGO A;  3ZWH A;  1J1E A;  1VRK A;  2WCB A;  2JQ6 A;  2EGD A;  3CR4 X;  2BL0 B;  4MBE A;  2H2K A;  3JVT B;  1TNX A;  1RRO A;  3BUN B;  4PE1 A;  2AMI A;  1IH0 A;  3D10 A;  3NSK A;  4GGF C;  1UUS A;  2LV7 A;  1UUR A;  3TDZ A;  1FPW A;  2M7N A;  1WRL A;  1UWO A;  2LLS A;  1ZOT B;  1HT9 A;  1M63 B;  1PRW A;  1JSA A;  1UHH A;  1D1O A;  3NSO A;  4YGD B;  1TNP A;  1BMO A;  1DF0 B;  1QAS A;  4M2P A;  2BCA A;  2ZKM X;  2M8U A;  4XJK B;  4C0K A;  2HPS A;  2WOS A;  5HLV A;  1W7J B;  1LKJ A;  2M49 B;  1BOC A;  1U5I A;  2MRD A;  2ZRT A;  1IRJ A;  4CFQ A;  2PAL A;  3PSR A;  1C7V A;  3KEV A;  1JFK A;  5HYD A;  4GBA A;  1A2X A;  3EK7 A;  1W7I B;  1F4O A;  1REC A;  2WC8 A;  1PK0 D;  1C7W A;  2L4H A;  3TDU A;  1B8C A;  4GNK B;  3VRN A;  2K7D A;  2KAY A;  1KFU S;  3BUX B;  4CID A;  1OMD A;  1N2D A;  1RJV A;  4DUQ A;  1J1D A;  1ZMZ A;  1J7R A;  2L50 A;  3SG2 A;  3QRX A;  1BR1 B;  2O5G A;  2ZFD A;  1YR5 A;  2H61 A;  1ZUZ A;  1Y1U A;  4ORC B;  3PM8 A;  4HSZ A;  1CTR A;  3BUO B;  2WCE A;  4GFT A;  4PHM A;  2KHN A;  2M1U A;  2ZNE A;  4ORB B;  1UP5 A;  2KBM A;  3NSL A;  1PSB A;  5HKY A;  2NLN A;  3CLN A;  1SCM C;  2I94 A;  2LLT A;  4MVF A;  2WOR A;  3IQO A;  2BKH B;  3BUM B;  3DVJ A;  4BY5 A;  5CSF A;  3O4Y A;  4GAO A;  1G33 A;  1EXR A;  1TOP A;  2LVV A;  1JWD A;  3I5G C;  1QAT A;  2JWW A;  2JOJ A;  2ZRS A;  1CMF A;  3DF0 A;  1F55 A;  4M2O A;  1ALW A;  3I5F C;  2WND A;  1GGW A;  1OZS A;  1DJI A;  2LE9 B;  2K2F A;  2Y1M A;  4YI9 A;  2JTZ A;  3ZNI A;  4OV2 A;  4FTG A;  4DCK A;  1KWO B;  4PHJ A;  5I8N A;  5KU1 A;  2LMV A;  2LMT A;  1SR6 B;  2KBI A;  1QJT A;  2Q91 A;  1CFC A;  3A4U B;  1QX5 B;  4E68 A;  4PAL A;  2KYF A;  2MHH A;  1NWD A;  3TDI A;  3OB2 B;  2JZI A;  5D7F A;  4I5K A;  1L7Z A;  1KWO C;  3PN7 B;  5F6T A;  1TN4 A;  2OS8 B;  2AAO A;  5D69 A;  1J55 A;  4OKH A;  1K95 A;  3EKJ A;  3O78 A;  1Y1A A;  2F3Y A;  3GK1 A;  3SG3 A;  4MN0 A;  3LK1 A;  2LNK A;  1NX2 A;  3VRQ A;  3WNX B;  1SPY A;  2Y5I A;  4IL1 A;  5HKW A;  3O2P A;  2DOQ A;  1ODB A;  2OS8 C;  5CSJ A;  2BE6 A;  1MXL C;  3OX6 A;  1V1G A;  3KO0 A;  1XFZ O;  2SAS A;  3AAK A;  4GGF A;  1BG1 A;  4QJ3 B;  4MEW A;  1S6C A;  1SK6 D;  5I2O A;  2BBM A;  3CR5 X;  1SMG A;  2MJW B;  1OZO A;  5AFP A;  1QIV A;  1M46 A;  1WLZ A;  1FW4 A;  2JC2 A;  3OHM B;  1JC2 A;  3SIB A;  1CDM A;  2EC6 C;  4P5O E;  2M9G A;  4PDZ A;  5CSI A;  2OTG B;  2R2I A;  1XFV O;  1EJ3 A;  1QLK A;  1K9U A;  4PHK A;  2K7C A;  1SL7 A;  3PAL A;  3WXA A;  1XFY O;  3RLZ A;  1K96 A;  3SIA A;  3TUY B;  3IF7 A;  1CLM A;  4ZCU A;  2LM5 A;  1B8R A;  1QVI Y;  2JXL A;  4MRX A;  1QV1 A;  1DF0 A;  3LLE A;  4L9M A;  5KSZ A;  1OMV A;  1YUT A;  3CS1 A;  1SYM A;  4XJK A;  2OTG C;  4N1G A;  1CDP A;  4HRG A;  4YGB B;  2L98 A;  3PAT A;  3TUY C;  2BL0 C;  4DS7 A;  1B7T Z;  3JVT C;  5J3X A;  2OPO A;  1K2H A;  1IQ5 A;  2M0R A;  4AOM A;  4ETO A;  2L0P A;  1F54 A;  1CFP A;  3DVK A;  4NDC A;  3OB1 B;  2BBN A;  2QPT A;  1EH2 A;  1TNW A;  1TTX A;  5HLO A;  1ALV A;  1PVA A;  1B1G A;  1KSM A;  1EG3 A;  1KSO A;  1IJ5 A;  2GGZ A;  1CKK A;  2LHL A;  1CDL A;  3DD4 A;  5CSN A;  2PVB A;  1BLQ A;  1WDC B;  1MQ1 A;  3AKB A;  2L51 A;  1RTP 1;  3SG7 A;  4PE7 A;  4ICB A;  2RGI A;  2NXQ A;  3EVR A;  1GGZ A;  2FOT A;  2Y1N A;  1NSH A;  1PAL A;  3WHU B;  1ZFS A;  1SRA A;  5K89 A; 
#chains in the Genus database with same CATH topology
 1WDC C;  2TN4 A;  4INW A;  1RWY A;  5AXI A;  3BXK A;  4OCI A;  2Q4U A;  4ZCV A;  4USL A;  2LMU A;  1YX7 A;  1MF8 B;  2I18 A;  3SS5 A;  4CLN A;  1WLM A;  1IGV A;  3DVE A;  1K90 D;  2LLU A;  4WRI A;  5JJG A;  1K94 A;  2WCL A;  1BOD A;  1AJ4 A;  4AQI A;  3TS5 B;  4GUK A;  4F7F A;  2M7L A;  2KI4 B;  1F70 A;  2BCX A;  1K93 D;  3PJI A;  2KYC A;  1U5I B;  3AAJ A;  3UO9 A;  3AKA A;  4M2Q A;  1QS7 A;  1B9A A;  1WRK A;  2M1K B;  4N5X A;  2Y4Q A;  1TRF A;  1KK8 B;  1TWO A;  1YVH A;  1DEK A;  2WC5 A;  1OMR A;  1TUJ A;  1A75 B;  2KI4 C;  4PHN A;  1QV0 A;  3CWG A;  4PCW A;  4NQG A;  1B7T Y;  1MUX A;  2FCE A;  1XK4 A;  3K21 A;  4YBH B;  2JRF A;  3D0Y B;  1A03 A;  2WCF A;  2BKI B;  3RM1 A;  3WHT B;  1XO5 A;  4INX A;  1EG4 A;  2JNF A;  2B1U A;  3KPX A;  4JQ0 D;  4TNC A;  4CFR A;  4ORA B;  1H4B A;  5FI6 A;  2A4J A;  1FF1 A;  1F4Q A;  3BOW A;  2IS9 A;  1X02 A;  1OOI X;  4MLW A;  5DKR A;  1NCY A;  2PMY A;  2LVK A;  1AJ5 A;  2KGB C;  1SR6 C;  1LIN A;  2H61 C;  3B7A A;  1MXE A;  2F8P A;  5CPV A;  2FJU B;  3CAB A;  4GPL B;  1N0Y A;  2LUC A;  1NX1 A;  3EVV A;  1C07 A;  3E3R A;  2VRG A;  1S26 D;  1DJH A;  3NHI A;  1JFJ A;  3PN7 C;  3O4X A;  3DF0 B;  1K9P A;  1LA3 A;  3OGN A;  1KQV A;  1S6J A;  3S0F A;  2K61 A;  1B4C A;  2BE4 A;  4P2Y B;  4PT1 A;  1JBA A;  2P6B B;  4JKT A;  2COL B;  4DIR A;  2HQW A;  3CR2 A;  3NXA A;  2HF5 A;  3FWB A;  3C1V A;  4MZJ A;  1QIW A;  3FWC A;  1B47 A;  2F2P A;  1GJY A;  2WC6 A;  4XYN A;  5ER4 X;  2KAV A;  5BPJ A;  3GOF A;  4NDB A;  2KGR A;  3MSE B;  2K8M B;  5I2L A;  2M29 A;  1FBV A;  2KSP A;  2KFF A;  2I2R E;  1DJY A;  5D3O A;  5AER A;  2L2E A;  1BT6 A;  1NCZ A;  2E30 A;  1IG5 A;  2L5Y A;  4JWQ A;  3S0G A;  2PRU A;  2KAX A;  1LVC D;  1Q80 A;  3H4S E;  1AHR A;  1G4Y R;  4F0Z B;  1Y1X A;  4QJ4 B;  1DEL A;  1N65 A;  1V1F A;  1JF2 A;  1SSE B;  3FS7 A;  5DKQ A;  1KFX S;  3UNW A;  1CLL A;  2KFH A;  3CTN A;  5HKZ A;  3F45 A;  1AVS A;  2G2B A;  3FE9 A;  1F8H A;  1YRT B;  1NP8 A;  2JU0 A;  2EHB A;  1K9K A;  1M45 A;  2GTE A;  1LXF C;  3Q8I A;  1BJF A;  1SKT A;  1JF0 A;  3NSI A;  1OOJ A;  2PSR A;  1F71 A;  1YUU A;  4A4C A;  3QME A;  2G9B A;  1TCF A;  2MAZ A;  1W9Z A;  4D1E A;  2ZN8 A;  1SBJ A;  1J7O A;  1SL9 A;  2WCK A;  2MA2 A;  2KDH A;  1DJX A;  1CFF A;  3FE6 A;  4QJ5 B;  1YRU B;  3A8R A;  5I2Q A;  3B86 A;  1TIZ A;  3NHT A;  1PVB A;  1KFX L;  3PFV A;  4MZL A;  4OR9 B;  2GV5 A;  1ORG A;  1Z2C B;  1NPQ A;  1CNP A;  1KK7 Z;  1DT7 B;  1TNQ A;  1WRZ A;  3VRO A;  2WCH A;  5DKN A;  2JT8 A;  2BEC A;  2KQ6 A;  2O60 A;  2LHI A;  3JTD B;  5AAN A;  3BQ3 A;  5HL1 A;  1UHK A;  2JT3 A;  1YTZ C;  1HQV A;  1SNL A;  5GQQ C;  5FYX A;  2MLF C;  1XFU O;  2JPO A;  3HX4 A;  1ZAC A;  4JD9 A;  3LL8 B;  4A4B A;  1OSA A;  4YRU A;  5K89 A;  1IJ6 A;  2JXC A;  4GGN A;  1JUO A;  1QLS A;  3DVM A;  3R1V A;  1Y0V H;  3LK0 A;  4YI8 A;  5TNC A;  3JTD C;  3SG4 A;  1M39 A;  1A4P A;  2CBL A;  4YGE B;  2KNE A;  2K7B A;  1S1E A;  1XFR A;  3D76 A;  1XFX O;  1YVL A;  3EVU A;  3HCM A;  1IQ3 A;  1R2U A;  3BUW B;  5IBW A;  2KI6 C;  3IQQ A;  1NCX A;  1NYA A;  4IJ7 A;  3D74 A;  2YGU A;  2F3Z A;  1A75 A;  3DZT A;  2F2O A;  1GQM A;  1TCO B;  2KFG A;  3I5I B;  3B6X A;  2BCB A;  4NDD A;  2LAN A;  3R72 A;  4WQ2 A;  3GK2 A;  2JT0 A;  2M3W A;  1L2O B;  1G8I A;  4Q04 A;  3ICB A;  3CZT X;  2NZ0 A;  3D0Y A;  1DGU A;  3FIA A;  2LUX A;  2QEB A;  3DXL A;  1SCM B;  1CM4 A;  1Y6W A;  2LC5 A;  2ISD A;  3TS5 C;  1DMO A;  1SW8 A;  3I5I C;  1NX0 A;  4I5L B;  2LVI A;  1TUZ A;  3I5H B;  1S5G Z;  4C0L A;  4UPG A;  1YX8 A;  2KI6 D;  3OP0 A;  1L2O C;  1J7Q A;  4BY4 A;  3SS3 A;  5KTY A;  3I5G B;  2L4I A;  2LVJ A;  3GK4 X;  1DJZ A;  3I5F B;  3SG5 A;  3VRR A;  1AUI B;  2LP2 A;  2SCP A;  1KK8 C;  1KFU L;  1BF5 A;  1MWN A;  1XA5 A;  2QDI A;  1CDN A;  2JNX A;  1CLB A;  3I5H C;  1MR8 A;  1QXP A;  1OE9 B;  1XFW O;  1EL4 A;  4N1F A;  4PE0 A;  3SG6 A;  2JUL A;  1YUS A;  2HQ8 A;  2NCP A;  5AEQ A;  2NCO A;  1E8A A;  3BFB A;  1KK7 Y;  1A29 A;  1H8B A;  1RK9 A;  3CGA A;  3EK8 A;  3OX5 A;  1KQM B;  4MZK A;  1UHN A;  3PLF B;  4U8D A;  1QVI Z;  5ER5 A;  2HET A;  3EK4 A;  3CDN A;  1S3P A;  5FI2 A;  1MHO A;  3BYA A;  2CTN A;  3KHE A;  2ZN9 A;  2JPT A;  1DGV A;  1DJW A;  3N7H A;  1LS8 A;  1FI6 A;  1K8U A;  3VRP A;  2FCD A;  1OQP A;  2M97 A;  1FI5 A;  2JTT A;  4MSP A;  1XVJ A;  2F33 A;  1WY9 A;  1KQM C;  1LA0 A;  1DVI A;  4I5J A;  3TZ1 A;  1CB1 A;  3B88 A;  2L5X B;  3M0W A;  3BFA A;  3D78 A;  1YUR A;  3BJH A;  1PUL A;  1S36 A;  1SCV A;  1SY9 A;  1UHI A;  2E6W A;  2MLE C;  2QAC A;  3EKH A;  3FE8 A;  2V53 A;  1DJG A;  1PSR A;  3S0E A;  1IKU A;  1CM1 A;  2QEH A;  2I7A A;  3EG5 B;  1UHJ A;  5PAL A;  1QTX A;  1NIW A;  3D77 A;  4R1E A;  1BU3 A;  4DRW A;  1M31 A;  4PE4 A;  3O6B A;  5FI7 A;  1AP4 A;  2MBX A;  1C3Y A;  3BOW B;  1CFD A;  4HRE E;  1B8L A;  1XK4 C;  2AUC A;  2GGM A;  1DTL A;  2K2A A;  3D75 A;  4JPZ B;  2KQY A;  2P70 A;  1J7P A;  3LCP C;  2LCP A;  4FQO A;  4WQ3 A;  2EC6 B;  1XYD A;  2LP3 A;  2CT9 A;  1S5G Y;  3CZ2 A;  5G08 A;  4C0J A;  2KOT A;  4MRY A;  1KCY A;  4CPV A;  2ZND A;  2K7O A;  2CNP A;  2PAS A;  4OVN F;  4YGA A;  2D8N A;  2CCM A;  4KYN A;  1NX3 A;  1AK8 A;  2CXJ A;  2LAP A;  1OW4 A;  2KLE A;  2K0J A;  2PYQ A;  2QEV A;  3KF9 A;  4I5N B;  1CMG A;  1R6P A;  1SL8 A;  4HRH A;  4AQJ A;  5JOL A;  2BAP A;  1S6I A;  5B8I B;  1NUB A;  1BR4 B;  1IWQ A;  1QX7 A;  1QX2 A;  1RFJ A;  4YGC B;  3VGO A;  3ZWH A;  1J1E A;  1VRK A;  2WCB A;  2JQ6 A;  2EGD A;  3CR4 X;  2BL0 B;  4MBE A;  3CYZ A;  2H2K A;  3JVT B;  2KLD A;  1TNX A;  2H8V A;  1RRO A;  3BUN B;  4PE1 A;  2AMI A;  1IH0 A;  3D10 A;  3NSK A;  4GGF C;  1UUS A;  2LV7 A;  1UUR A;  3TDZ A;  3V2L A;  1FPW A;  2M7N A;  1WRL A;  1UWO A;  2LLS A;  1ZOT B;  1HT9 A;  1M63 B;  1PRW A;  3IVT A;  1JSA A;  3CZ1 A;  1UHH A;  1D1O A;  3NSO A;  4YGD B;  1TNP A;  1BMO A;  1DF0 B;  1QAS A;  4M2P A;  2BCA A;  2ZKM X;  2M8U A;  4XJK B;  4C0K A;  2HPS A;  2WOS A;  5HLV A;  1W7J B;  1LKJ A;  2M49 B;  1BOC A;  1U5I A;  2MRD A;  2ZRT A;  1IRJ A;  4CFQ A;  5I94 A;  2PAL A;  2BNX A;  3PSR A;  3KEV A;  1C7V A;  1JFK A;  5HYD A;  4GBA A;  1A2X A;  3EK7 A;  1W7I B;  1F4O A;  1REC A;  2WC8 A;  1PK0 D;  1C7W A;  2L4H A;  3TDU A;  1DQE A;  1B8C A;  4GNK B;  3VRN A;  2K7D A;  2KAY A;  1KFU S;  3BUX B;  4CID A;  1QWV A;  1OMD A;  1N2D A;  1RJV A;  3PM2 A;  4DUQ A;  1J1D A;  1ZMZ A;  1J7R A;  2L50 A;  3RZS A;  3SG2 A;  3QRX A;  1BR1 B;  2O5G A;  2ZFD A;  1YR5 A;  2H61 A;  1ZUZ A;  1DC1 A;  1Y1U A;  4ORC B;  3PM8 A;  4HSZ A;  3R1P A;  1CTR A;  3BUO B;  2WCE A;  4GFT A;  4PHM A;  1T14 A;  2KHN A;  2M1U A;  2L2C A;  2ZNE A;  4ORB B;  1UP5 A;  2KBM A;  3NSL A;  1PSB A;  5HKY A;  2NLN A;  3CLN A;  1SCM C;  2I94 A;  4OZD A;  1P28 A;  2LLT A;  2WOR A;  3IQO A;  4MVF A;  2BKH B;  3BUM B;  3DVJ A;  4BY5 A;  5CSF A;  3O4Y A;  4GAO A;  1G33 A;  1EXR A;  1TOP A;  2LVV A;  1JWD A;  3I5G C;  1QAT A;  2JWW A;  2JOJ A;  3S0A A;  2ZRS A;  1CMF A;  3DF0 A;  1F55 A;  4M2O A;  1ALW A;  3I5F C;  2ERB A;  2WND A;  1GGW A;  1OZS A;  1DJI A;  2LE9 B;  2K2F A;  2Y1M A;  4YI9 A;  1OOH A;  2JTZ A;  2WCJ A;  3ZNI A;  3R1O A;  4OV2 A;  4FTG A;  4DCK A;  1KWO B;  4PHJ A;  5I8N A;  2WCM A;  5KU1 A;  1OOG A;  2LMV A;  1OOF A;  1SR6 B;  2KBI A;  2LMT A;  1QJT A;  2Q91 A;  3BFH A;  1CFC A;  3A4U B;  1QX5 B;  4E68 A;  4PAL A;  2KYF A;  3S0B A;  2MHH A;  1NWD A;  3TDI A;  3OB2 B;  2JZI A;  5D7F A;  4I5K A;  5EL2 A;  1L7Z A;  1KWO C;  3PN7 B;  5F6T A;  1TN4 A;  2OS8 B;  2AAO A;  5D69 A;  1IIO A;  1J55 A;  4OKH A;  1K95 A;  3EKJ A;  3O78 A;  1Y1A A;  2F3Y A;  3GK1 A;  3SG3 A;  4MN0 A;  3LK1 A;  2LNK A;  1NX2 A;  3VRQ A;  3WNX B;  1SPY A;  2Y5I A;  4IL1 A;  5HKW A;  3O2P A;  3L4A A;  2DOQ A;  1ODB A;  2OS8 C;  5CSJ A;  3CZ0 A;  1GM0 A;  2BE6 A;  1MXL C;  3D73 A;  1V1G A;  3OX6 A;  3KO0 A;  1XFZ O;  2FJY A;  2SAS A;  3AAK A;  4GGF A;  1BG1 A;  4QJ3 B;  4MEW A;  1S6C A;  1SK6 D;  5I2O A;  2BBM A;  3CR5 X;  1C3Z A;  1SMG A;  2MJW B;  2P71 A;  1OZO A;  5AFP A;  1QIV A;  1M46 A;  1WLZ A;  2PQL A;  1FW4 A;  2JC2 A;  3OHM B;  1JC2 A;  3SIB A;  1CDM A;  2EC6 C;  4P5O E;  2M9G A;  4PDZ A;  5CSI A;  2OTG B;  2R2I A;  1XFV O;  1EJ3 A;  3K1E A;  1QLK A;  1K9U A;  2KPH A;  4PHK A;  2K7C A;  1SL7 A;  3PAL A;  3WXA A;  1XFY O;  3RLZ A;  1K96 A;  3SIA A;  3TUY B;  3IF7 A;  1CLM A;  4ZCU A;  2LM5 A;  3DY9 A;  1B8R A;  1QVI Y;  2JXL A;  4MRX A;  1QV1 A;  1DF0 A;  3LLE A;  4L9M A;  5KSZ A;  1OMV A;  1YUT A;  3CS1 A;  1SYM A;  4XJK A;  2OTG C;  4N1G A;  1CDP A;  4HRG A;  4YGB B;  3L4L A;  2L98 A;  3PAT A;  3TUY C;  2BL0 C;  3NGV A;  4DS7 A;  1B7T Z;  3JVT C;  5J3X A;  2OPO A;  1K2H A;  1IQ5 A;  2M0R A;  4AOM A;  3L47 A;  4ETO A;  2K60 A;  2L0P A;  1CFP A;  3S0D A;  3SS4 A;  5DIC A;  1F54 A;  3DVK A;  4NDC A;  3OB1 B;  2BBN A;  2QPT A;  3VB1 A;  1EH2 A;  1TNW A;  1TTX A;  5HLO A;  1ALV A;  1PVA A;  1B1G A;  1KSM A;  2QEO A;  1EG3 A;  1KSO A;  3SJS A;  1IJ5 A;  2GGZ A;  1CKK A;  2LHL A;  1CDL A;  3DD4 A;  3OBV A;  5CSN A;  3B87 A;  2PVB A;  1BLQ A;  1WDC B;  1MQ1 A;  3AKB A;  2L51 A;  1RTP 1;  3SG7 A;  4PE7 A;  4ICB A;  2RGI A;  2NXQ A;  4FQT A;  1Z4H A;  3EVR A;  1GGZ A;  2FOT A;  2Y1N A;  1NSH A;  1PAL A;  3WHU B;  1ZFS A;  1SRA A;  3DYE A; 
#chains in the Genus database with same CATH homology
 1WDC C;  2TN4 A;  1RWY A;  5AXI A;  3BXK A;  4OCI A;  2Q4U A;  4ZCV A;  4USL A;  2LMU A;  1YX7 A;  1MF8 B;  2I18 A;  4CLN A;  1WLM A;  1IGV A;  3DVE A;  1K90 D;  2LLU A;  4WRI A;  5JJG A;  1K94 A;  1BOD A;  1AJ4 A;  4AQI A;  3TS5 B;  4GUK A;  2M7L A;  2KI4 B;  1F70 A;  2BCX A;  1K93 D;  2KYC A;  1U5I B;  3AAJ A;  3AKA A;  4M2Q A;  1QS7 A;  1B9A A;  1WRK A;  2M1K B;  4N5X A;  2Y4Q A;  1TRF A;  1KK8 B;  1YVH A;  1OMR A;  1A75 B;  2KI4 C;  4PHN A;  1QV0 A;  3CWG A;  4PCW A;  4NQG A;  1B7T Y;  1MUX A;  2FCE A;  1XK4 A;  3K21 A;  4YBH B;  2JRF A;  3D0Y B;  1A03 A;  2WCF A;  2BKI B;  3RM1 A;  3WHT B;  1XO5 A;  1EG4 A;  2JNF A;  2B1U A;  3KPX A;  4JQ0 D;  4TNC A;  4CFR A;  4ORA B;  1H4B A;  2A4J A;  1FF1 A;  1F4Q A;  3BOW A;  2IS9 A;  1X02 A;  4MLW A;  5DKR A;  1NCY A;  2PMY A;  2LVK A;  1AJ5 A;  2KGB C;  1SR6 C;  1LIN A;  2H61 C;  1MXE A;  2F8P A;  5CPV A;  2FJU B;  4GPL B;  1N0Y A;  2LUC A;  1NX1 A;  3EVV A;  1C07 A;  3E3R A;  2VRG A;  1S26 D;  1DJH A;  1JFJ A;  3PN7 C;  3DF0 B;  1K9P A;  1LA3 A;  1KQV A;  1S6J A;  2K61 A;  1B4C A;  2BE4 A;  4P2Y B;  1JBA A;  2P6B B;  2COL B;  4DIR A;  2HQW A;  3CR2 A;  3NXA A;  2HF5 A;  3FWB A;  3C1V A;  4MZJ A;  1QIW A;  3FWC A;  1B47 A;  2F2P A;  1GJY A;  4XYN A;  5ER4 X;  2KAV A;  5BPJ A;  3GOF A;  4NDB A;  2KGR A;  3MSE B;  2K8M B;  5I2L A;  2M29 A;  1FBV A;  2KSP A;  2KFF A;  2I2R E;  1DJY A;  5AER A;  2L2E A;  1BT6 A;  1NCZ A;  2E30 A;  1IG5 A;  4JWQ A;  2PRU A;  2KAX A;  1LVC D;  1Q80 A;  3H4S E;  1AHR A;  1G4Y R;  4F0Z B;  1Y1X A;  4QJ4 B;  1N65 A;  1V1F A;  3FS7 A;  1JF2 A;  5DKQ A;  1KFX S;  1CLL A;  2KFH A;  3CTN A;  5HKZ A;  3F45 A;  1AVS A;  2G2B A;  1F8H A;  1YRT B;  1NP8 A;  2JU0 A;  2EHB A;  1K9K A;  1M45 A;  1LXF C;  1BJF A;  1SKT A;  1JF0 A;  3NSI A;  1OOJ A;  2PSR A;  1F71 A;  1YUU A;  4A4C A;  2G9B A;  1TCF A;  2MAZ A;  4D1E A;  2ZN8 A;  1SBJ A;  1J7O A;  1SL9 A;  2MA2 A;  2KDH A;  1DJX A;  1CFF A;  4QJ5 B;  1YRU B;  3A8R A;  5I2Q A;  1TIZ A;  1PVB A;  1KFX L;  3PFV A;  4MZL A;  4OR9 B;  2GV5 A;  1NPQ A;  1CNP A;  1KK7 Z;  1DT7 B;  1TNQ A;  1WRZ A;  3VRO A;  5DKN A;  2JT8 A;  2BEC A;  2KQ6 A;  2O60 A;  2LHI A;  3JTD B;  5AAN A;  3BQ3 A;  1UHK A;  2JT3 A;  1YTZ C;  1HQV A;  1SNL A;  5GQQ C;  5FYX A;  2MLF C;  1XFU O;  3HX4 A;  1ZAC A;  4A4B A;  3LL8 B;  1OSA A;  4YRU A;  1IJ6 A;  2JXC A;  4GGN A;  1JUO A;  1QLS A;  3DVM A;  1Y0V H;  3LK0 A;  4YI8 A;  5TNC A;  3JTD C;  3SG4 A;  1M39 A;  1A4P A;  2CBL A;  4YGE B;  2KNE A;  2K7B A;  1S1E A;  1XFX O;  1YVL A;  3EVU A;  3HCM A;  1IQ3 A;  1R2U A;  3BUW B;  5IBW A;  2KI6 C;  3IQQ A;  1NCX A;  1NYA A;  2F3Z A;  1A75 A;  2F2O A;  1GQM A;  1TCO B;  2KFG A;  3I5I B;  2BCB A;  4NDD A;  2LAN A;  4WQ2 A;  3GK2 A;  2JT0 A;  2M3W A;  1L2O B;  1G8I A;  4Q04 A;  3ICB A;  3CZT X;  2NZ0 A;  3D0Y A;  1DGU A;  3FIA A;  2LUX A;  1SCM B;  1CM4 A;  1Y6W A;  2LC5 A;  2ISD A;  3TS5 C;  1DMO A;  1SW8 A;  3I5I C;  1NX0 A;  4I5L B;  2LVI A;  4C0L A;  3I5H B;  1S5G Z;  4UPG A;  1YX8 A;  2KI6 D;  3OP0 A;  1L2O C;  1J7Q A;  4BY4 A;  5KTY A;  3I5G B;  2L4I A;  2LVJ A;  3GK4 X;  1DJZ A;  3I5F B;  3SG5 A;  3VRR A;  1AUI B;  2LP2 A;  2SCP A;  1KK8 C;  1KFU L;  1BF5 A;  1MWN A;  1XA5 A;  1CDN A;  2JNX A;  1CLB A;  3I5H C;  1MR8 A;  1QXP A;  1OE9 B;  1XFW O;  1EL4 A;  4N1F A;  4PE0 A;  3SG6 A;  2JUL A;  1YUS A;  2HQ8 A;  2NCP A;  5AEQ A;  2NCO A;  1E8A A;  1KK7 Y;  1A29 A;  1H8B A;  1RK9 A;  3CGA A;  3EK8 A;  3OX5 A;  1KQM B;  4MZK A;  1UHN A;  3PLF B;  4U8D A;  1QVI Z;  5ER5 A;  2HET A;  3EK4 A;  1S3P A;  1MHO A;  3BYA A;  2CTN A;  3KHE A;  2ZN9 A;  2JPT A;  1DGV A;  1DJW A;  1FI6 A;  1K8U A;  3VRP A;  2FCD A;  1OQP A;  2M97 A;  1FI5 A;  2JTT A;  4MSP A;  1XVJ A;  2F33 A;  1WY9 A;  1KQM C;  1LA0 A;  1DVI A;  4I5J A;  3TZ1 A;  1CB1 A;  2L5X B;  3M0W A;  1YUR A;  3EKH A;  1PUL A;  1S36 A;  1SCV A;  1SY9 A;  1UHI A;  2E6W A;  2MLE C;  2QAC A;  2V53 A;  1DJG A;  1PSR A;  1IKU A;  1CM1 A;  2I7A A;  1UHJ A;  5PAL A;  1QTX A;  1NIW A;  4R1E A;  1BU3 A;  4DRW A;  1M31 A;  4PE4 A;  3O6B A;  1AP4 A;  2MBX A;  3BOW B;  1CFD A;  4HRE E;  1B8L A;  1XK4 C;  2AUC A;  2GGM A;  1DTL A;  2K2A A;  4JPZ B;  3SJS A;  2KQY A;  1J7P A;  3LCP C;  2LCP A;  4FQO A;  4WQ3 A;  2EC6 B;  1XYD A;  2LP3 A;  2CT9 A;  1S5G Y;  5G08 A;  4C0J A;  2KOT A;  4MRY A;  1KCY A;  4CPV A;  2ZND A;  2K7O A;  2CNP A;  2PAS A;  4OVN F;  4YGA A;  2D8N A;  2CCM A;  1NX3 A;  1AK8 A;  2CXJ A;  2LAP A;  1CMG A;  2K0J A;  3KF9 A;  4I5N B;  1R6P A;  1SL8 A;  4HRH A;  4AQJ A;  5JOL A;  5B8I B;  1S6I A;  1NUB A;  1BR4 B;  1IWQ A;  1QX7 A;  1QX2 A;  1RFJ A;  4YGC B;  3VGO A;  3ZWH A;  1J1E A;  1VRK A;  2WCB A;  2JQ6 A;  2EGD A;  3CR4 X;  2BL0 B;  4MBE A;  2H2K A;  3JVT B;  1TNX A;  1RRO A;  3BUN B;  4PE1 A;  2AMI A;  1IH0 A;  3D10 A;  3NSK A;  4GGF C;  1UUS A;  2LV7 A;  1UUR A;  3TDZ A;  1FPW A;  2M7N A;  1WRL A;  1UWO A;  2LLS A;  1ZOT B;  1HT9 A;  1M63 B;  1PRW A;  1JSA A;  1UHH A;  1D1O A;  3NSO A;  4YGD B;  1TNP A;  1BMO A;  1DF0 B;  1QAS A;  4M2P A;  2BCA A;  2ZKM X;  2M8U A;  4XJK B;  4C0K A;  2HPS A;  2WOS A;  5HLV A;  1W7J B;  1LKJ A;  2M49 B;  1BOC A;  1U5I A;  2MRD A;  2ZRT A;  1IRJ A;  4CFQ A;  2PAL A;  3PSR A;  1C7V A;  3KEV A;  1JFK A;  5HYD A;  4GBA A;  1A2X A;  3EK7 A;  1W7I B;  1F4O A;  1REC A;  2WC8 A;  1PK0 D;  1C7W A;  2L4H A;  3TDU A;  1B8C A;  4GNK B;  3VRN A;  2K7D A;  2KAY A;  1KFU S;  3BUX B;  4CID A;  1OMD A;  1N2D A;  1RJV A;  4DUQ A;  1J1D A;  1ZMZ A;  1J7R A;  2L50 A;  3SG2 A;  3QRX A;  1BR1 B;  2O5G A;  2ZFD A;  1YR5 A;  2H61 A;  1ZUZ A;  1Y1U A;  4ORC B;  3PM8 A;  4HSZ A;  1CTR A;  3BUO B;  2WCE A;  4GFT A;  4PHM A;  2KHN A;  2M1U A;  2ZNE A;  4ORB B;  1UP5 A;  2KBM A;  3NSL A;  1PSB A;  5HKY A;  2NLN A;  3CLN A;  1SCM C;  2I94 A;  2LLT A;  4MVF A;  2WOR A;  3IQO A;  2BKH B;  3BUM B;  3DVJ A;  4BY5 A;  5CSF A;  3O4Y A;  4GAO A;  1G33 A;  1EXR A;  1TOP A;  2LVV A;  1JWD A;  3I5G C;  1QAT A;  2JWW A;  2JOJ A;  2ZRS A;  1CMF A;  3DF0 A;  1F55 A;  4M2O A;  1ALW A;  3I5F C;  2WND A;  1GGW A;  1OZS A;  1DJI A;  2LE9 B;  2K2F A;  2Y1M A;  4YI9 A;  2JTZ A;  3ZNI A;  4OV2 A;  4FTG A;  4DCK A;  1KWO B;  4PHJ A;  5I8N A;  5KU1 A;  2LMV A;  2LMT A;  1SR6 B;  2KBI A;  1QJT A;  2Q91 A;  1CFC A;  3A4U B;  1QX5 B;  4E68 A;  4PAL A;  2KYF A;  2MHH A;  1NWD A;  3TDI A;  3OB2 B;  2JZI A;  5D7F A;  4I5K A;  1L7Z A;  1KWO C;  3PN7 B;  5F6T A;  1TN4 A;  2OS8 B;  2AAO A;  5D69 A;  1J55 A;  4OKH A;  1K95 A;  3EKJ A;  3O78 A;  1Y1A A;  2F3Y A;  3GK1 A;  3SG3 A;  4MN0 A;  3LK1 A;  2LNK A;  1NX2 A;  3VRQ A;  3WNX B;  1SPY A;  2Y5I A;  4IL1 A;  5HKW A;  3O2P A;  2DOQ A;  1ODB A;  2OS8 C;  5CSJ A;  2BE6 A;  1MXL C;  3OX6 A;  1V1G A;  3KO0 A;  1XFZ O;  2SAS A;  3AAK A;  4GGF A;  1BG1 A;  4QJ3 B;  4MEW A;  1S6C A;  1SK6 D;  5I2O A;  2BBM A;  3CR5 X;  1SMG A;  2MJW B;  1OZO A;  5AFP A;  1QIV A;  1M46 A;  1WLZ A;  1FW4 A;  2JC2 A;  3OHM B;  1JC2 A;  3SIB A;  1CDM A;  2EC6 C;  4P5O E;  2M9G A;  4PDZ A;  5CSI A;  2OTG B;  2R2I A;  1XFV O;  1EJ3 A;  1QLK A;  1K9U A;  4PHK A;  2K7C A;  1SL7 A;  3PAL A;  3WXA A;  1XFY O;  3RLZ A;  1K96 A;  3SIA A;  3TUY B;  3IF7 A;  1CLM A;  4ZCU A;  2LM5 A;  1B8R A;  1QVI Y;  2JXL A;  4MRX A;  1QV1 A;  1DF0 A;  3LLE A;  4L9M A;  5KSZ A;  1OMV A;  1YUT A;  3CS1 A;  1SYM A;  4XJK A;  2OTG C;  4N1G A;  1CDP A;  4HRG A;  4YGB B;  2L98 A;  3PAT A;  3TUY C;  2BL0 C;  4DS7 A;  1B7T Z;  3JVT C;  5J3X A;  2OPO A;  1K2H A;  1IQ5 A;  2M0R A;  4AOM A;  4ETO A;  2L0P A;  1F54 A;  1CFP A;  3DVK A;  4NDC A;  3OB1 B;  2BBN A;  2QPT A;  1EH2 A;  1TNW A;  1TTX A;  5HLO A;  1ALV A;  1PVA A;  1B1G A;  1KSM A;  1EG3 A;  1KSO A;  1IJ5 A;  2GGZ A;  1CKK A;  2LHL A;  1CDL A;  3DD4 A;  5CSN A;  2PVB A;  1BLQ A;  1WDC B;  1MQ1 A;  3AKB A;  2L51 A;  1RTP 1;  3SG7 A;  4PE7 A;  4ICB A;  2RGI A;  2NXQ A;  3EVR A;  1GGZ A;  2FOT A;  2Y1N A;  1NSH A;  1PAL A;  3WHU B;  1ZFS A;  1SRA A;  5K89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...