2M7LA

Alfa-actinin from parasite entamoeba histolytica
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
144
structure length
144
Chain Sequence
GSSSGVTAEQMQEFKQSFDAFDGNHDGILDKLEFRSCLSSMGLIDIDFTGGEDAQYDAIYNNVTKGENGVSFDNYVQYMKEKNDENPSPEQLNEIFSTIAAGKDSITETDMQKAGMSAEQIEYVKANLPQKGDGYDYAAWVKTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Alfa-actinin from parasite Entamoeba histolytica
rcsb
source organism Entamoeba histolytica
molecule tags Structural protein
molecule keywords Calponin homology domain protein, putative
total genus 48
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2013-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2m7lA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2m7lA02
5TNCA 3RLZA 4PDZA 1BR4B 3NSOA 4MSPA 4P2YB 1SBJA 2LMTA 1YVHA 2NCOA 4YBHB 1DJHA 4MZKA 1DJYA 1YTZC 2K7DA 1V1GA 1DT7B 2KQ6A 3AKBA 2WCFA 1J1DA 3FWCA 3RM1A 3GOFA 1NX3A 3OP0A 1F71A 2CNPA 1TN4A 3LK1A 2M8UA 2BE4A 2HQ8A 2KFGA 4JPZB 1BOCA 5AEQA 1NCXA 5AFPA 5ER5A 2AMIA 3M0WA 1CFFA 3DD4A 2I2RE 1K2HA 2M7LA 1M31A 2LCPA 1KK8B 1JUOA 3EK4A 1TOPA 5IBWA 1BODA 2MLFC 1BLQA 1AHRA 1ODBA 4PE1A 4L9MA 1KQVA 2I7AA 2ZN9A 3BXKA 1DF0A 1FBVA 1S5GZ 1B7TY 1NX0A 4AQIA 2EC6B 1IJ5A 2B1UA 2MRDA 2R2IA 2LVIA 3BYAA 1SNLA 1K9KA 1XA5A 1XO5A 1DJZA 4PHMA 1DGVA 1LKJA 3GK1A 5DKNA 3OB2B 3KO0A 1DJXA 2HETA 2WNDA 2BCXA 2O60A 3C1VA 2K2AA 4I5KA 2FJUB 5KSZA 1PRWA 2FOTA 2OPOA 2LP2A 2JC2A 1JSAA 1SL7A 2F3ZA 1WRZA 1BR1B 1KFXL 1XFUO 1Q80A 2D8NA 2K7BA 3CWGA 3JTDB 2JWWA 1TCFA 5GQQC 1FW4A 5CSIA 1B9AA 2BBNA 1KQMB 5AANA 5HYDA 1YX7A 1DJWA 5HKWA 2ISDA 1QIWA 1YUSA 3SG2A 2PMYA 2KSPA 1AUIB 2IS9A 2KBMA 2FCDA 2KAXA 2GGZA 3IQQA 1BG1A 1TIZA 4YI9A 4N5XA 2NXQA 1K95A 4PE0A 1K9PA 2BECA 4MZLA 1J7PA 2M1KB 1CDPA 3I5IB 2MBXA 3OHMB 2LAPA 2K61A 3A4UB 1ZFSA 5HLVA 1QVIY 1AJ4A 1G4YR 1SPYA 4ORAB 5G08A 3SIBA 3TDUA 3I5FC 1AK8A 1K93D 2LVVA 3NSLA 4PCWA 2LNKA 1M63B 2M0RA 1Y1XA 2FCEA 1F8HA 2I94A 4GFTA 2AAOA 2GGMA 1SCVA 2KI4B 2L51A 4M2OA 1PALA 1OZSA 3ICBA 1F55A 3BOWA 1PULA 4MN0A 4OR9B 1LA3A 3CGAA 1OZOA 4MEWA 1YUUA 2PASA 3D10A 2LVKA 1OOJA 2BL0B 4E68A 2K0JA 1K94A 5HKZA 1UHNA 1N0YA 1MWNA 3HCMA 3CR2A 3NSIA 2KAVA 4GAOA 3DVMA 1OQPA 4ORBB 2L4IA 1FF1A 1DF0B 3E3RA 1K9UA 1RFJA 3FWBA 1QS7A 1E8AA 1GGZA 1QX5B 1SCMB 2HF5A 5I2OA 1QV1A 2CTNA 3QRXA 3PALA 2GV5A 4NDBA 1NX1A 1CLMA 2F33A 2LHIA 1JBAA 2LLSA 3OX6A 4C0JA 4HSZA 1LXFC 3O2PA 1HT9A 4GGFC 1B47A 1RK9A 4PHKA 3I5FB 1B7TZ 1ZOTB 1XFZO 3I5HC 5BPJA 1ZUZA 1TTXA 2WC8A 4NDDA 1PVAA 1SR6C 4M2PA 1IQ3A 4GPLB 4USLA 1Y6WA 1BF5A 1FPWA 1NSHA 2OTGB 2K7OA 4I5JA 4YGBB 1U5IB 2KGBC 3BUOB 1A29A 4A4BA 1H8BA 2KI6D 2Y5IA 2JT8A 1NCYA 3WNXB 1MXEA 1TNXA 2TN4A 3ZWHA 2H61A 3TS5C 1IH0A 2JRFA 1CM4A 1UHKA 3EK8A 3I5HB 2BCAA 1SK6D 3AKAA 5K89A 3TUYB 1KSMA 4I5LB 2PRUA 5B8IB 2KGRA 3KF9A 4WQ2A 4JWQA 4D1EA 2JNFA 1NPQA 1CLLA 2A4JA 2CBLA 2OTGC 1UHJA 1EJ3A 4M2QA 1YUTA 1IJ6A 2NLNA 2L2EA 2BBMA 1UWOA 2VRGA 4N1GA 1SL9A 1V1FA 4CPVA 4UPGA 1TNWA 1NYAA 1S6IA 4CFRA 1KFUS 2M7NA 1CMGA 4GGFA 1FI6A 1F4QA 1S6CA 3PATA 2COLB 1QLKA 4ZCVA 2E30A 4PHNA 1YX8A 2EHBA 3BUWB 2L5XB 1Y1UA 5DKRA 3K21A 2V53A 4GGNA 1MUXA 4N1FA 2JT0A 5CPVA 3VRNA 1L2OB 3EKHA 4MRXA 2KYCA 3D0YB 5JOLA 2LM5A 3EVVA 4CIDA 3PLFB 1ALWA 1AVSA 2JXLA 1XK4A 2BL0C 1B8CA 2EGDA 1JF0A 1QVIZ 3WXAA 1MR8A 2LHLA 5ER4X 4MLWA 1PK0D 1DJGA 3OX5A 1PSRA 3KEVA 1QASA 3AAKA 1SW8A 1A75A 2L4HA 1RJVA 3A8RA 3PFVA 1L2OC 3VRRA 1BT6A 1QTXA 5PALA 2CT9A 2KHNA 3SG6A 3HX4A 1U5IA 5AXIA 4HRGA 4DUQA 1H4BA 2KI6C 1OMVA 3SJSA 1W7JB 3TS5B 1OMRA 1S5GY 1PVBA 1RROA 2JXCA 3LK0A 4HRHA 1BU3A 1ZACA 1JFJA 2PVBA 2KNEA 1M45A 1W7IB 4NQGA 3BQ3A 2Y4QA 1RECA 1QJTA 1QATA 1UHHA 2LANA 4MZJA 3SG7A 3MSEB 3BOWB 1R6PA 3DF0B 1B4CA 4DCKA 1KK7Z 1A03A 1F54A 3AAJA 1J7RA 4HREE 2JNXA 5J3XA 2EC6C 3D0YA 4OV2A 1MHOA 2CCMA 2WCEA 4YGEB 1M39A 3NXAA 2Y1MA 3PSRA 5JJGA 1XFWO 1MF8B 3SG5A 3IQOA 1XFYO 4U8DA 4QJ5B 1J7OA 1R2UA 4I5NB 4P5OE 2G2BA 2L0PA 5KTYA 3JVTB 2M9GA 4XJKA 1NCZA 2M1UA 2ZN8A 4PE4A 1LA0A 2MA2A 1SMGA 1XYDA 2K2FA 1WRLA 4A4CA 3I5GB 2I18A 1WY9A 1G8IA 1NP8A 4C0LA 4YRUA 1CFDA 2MAZA 1OSAA 1G33A 3FIAA 1WDCB 4ZCUA 1S1EA 1D1OA 1TNPA 1NIWA 4XYNA 1K8UA 5D7FA 4YGCB 2F2PA 2KBIA 3BUNB 1AP4A 1BJFA 3WHTB 2BCBA 2JPTA 4WQ3A 2L98A 2K7CA 1SL8A 2RGIA 4YGDB 1CKKA 1F70A 2NCPA 2WOSA 2OS8B 4ETOA 1X02A 2JQ6A 4DS7A 1ALVA 1MXLC 2KYFA 5HLOA 2K8MB 4Q04A 1CB1A 1WLMA 1XFXO 1BMOA 4XJKB 1WDCC 4CFQA 2MJWB 5AERA 1A75B 2BE6A 3NSKA 1OMDA 3LL8B 3BUMB 3SIAA 3PN7B 2P6BB 1SYMA 2PALA 3F45A 2LP3A 2KFHA 1SRAA 1KFXS 3CZTX 3DF0A 1JFKA 2OS8C 2LVJA 3VRQA 1GQMA 1CDMA 5CSNA 4FTGA 2SCPA 2JU0A 1C7VA 1VRKA 4MBEA 3CTNA 1XK4C 5CSFA 1ZMZA 3JVTC 5I8NA 2Y1NA 1RWYA 3LLEA 3EVUA 2F8PA 5KU1A 4GUKA 4NDCA 1DTLA 1WLZA 5CSJA 3VRPA 3WHUB 1B1GA 1IKUA 4MVFA 1PSBA 4DIRA 1UP5A 3I5GC 1XFVO 4BY4A 1CFPA 2F3YA 1CDLA 4PE7A 1QXPA 4FQOA 1K90D 1IRJA 1S26D 4GNKB 1KQMC 3TZ1A 1TCOB 2JTTA 3CR5X 3KHEA 2MHHA 1Y1AA 1NX2A 2PSRA 1QX2A 1EXRA 4IL1A 1EL4A 1AJ5A 4JQ0D 2KDHA 3VGOA 2M29A 1CFCA 1EH2A 1GGWA 2LLTA 1J55A 1DJIA 3IF7A 2KAYA 4ICBA 3TDZA 4DRWA 2F2OA 3BUXB 2ZKMX 3DVKA 2JZIA 2KOTA 2ZNDA 2CXJA 1K96A 1N65A 1IWQA 1B8LA 1JF2A 2E6WA 2G9BA 2M49B 3O78A 4YGAA 4AOMA 3OB1B 1UURA 5DKQA 3SG4A 1UUSA 3KPXA 2M3WA 3TDIA 2NZ0A 3ZNIA 1KWOC 1CTRA 1CNPA 1QLSA 4OCIA 4ORCB 1B8RA 3PN7C 2QPTA 1C7WA 4PHJA 4OVNF 1IQ5A 1DVIA 1KSOA 2JOJA 3O4YA 1A2XA 1GJYA 3CS1A 2DOQA 1M46A 3LCPC 2HPSA 1CLBA 1YRUB 4WRIA 1CDNA 1KCYA 2ZFDA 4F0ZB 1L7ZA 2ZRTA 2H2KA 1KK7Y 1F4OA 5D69A 5I2LA 1YURA 2LUCA 1S36A 1KWOB 2KI4C 4OKHA 1LINA 3EK7A 1JC2A 4MRYA 1Y0VH 2ZRSA 4AQJA 3VROA 2Q4UA 2WCBA 1CM1A 2LC5A 3GK4X 1RTP1 3EKJA 1EG3A 4CLNA 4YI8A 4PALA 2LE9B 1FI5A 4TNCA 2AUCA 5F6TA 1A4PA 1TNQA 3GK2A 1SR6B 2SASA 2JULA 2HQWA 1UHIA 2JTZA 4R1EA 2H61C 2KFFA 1YRTB 1SY9A 2QACA 2M97A 2O5GA 2LMUA 1S3PA 2BKIB 1IG5A 1KFUL 1MQ1A 2LUXA 4QJ3B 1DMOA 4GBAA 1NUBA 3I5IC 1S6JA 2Q91A 4BY5A 1LVCD 3CLNA 1YVLA 1J1EA 1XVJA 1NWDA 1QIVA 2LMVA 2L50A 2ZNEA 1SKTA 1N2DA 1KK8C 2LV7A 1DGUA 1YR5A 3CR4X 3DVEA 5I2QA 3TUYC 2BKHB 1QX7A 3H4SE 5FYXA 1JWDA 1EG4A 3DVJA 3PM8A 2WORA 3FS7A 1QV0A 1TRFA 4QJ4B 1OE9B 1J7QA 1SCMC 1C07A 3JTDC 1CMFA 1IGVA 3O6BA 1WRKA 2LLUA 2JT3A 2KQYA 3SG3A 5HKYA 4C0KA 3EVRA 1HQVA 2MLEC
chains in the Genus database with same CATH superfamily
5TNCA 3RLZA 4PDZA 1BR4B 5I94A 3NSOA 4MSPA 3SS5A 4P2YB 1SBJA 2LMTA 1YVHA 2NCOA 4YBHB 1DJHA 4MZKA 1DJYA 1YTZC 2K7DA 3L4AA 1V1GA 1DT7B 2KQ6A 2WCHA 2WCFA 1J1DA 3AKBA 3FWCA 3RM1A 3GOFA 1NX3A 3OP0A 1F71A 2CNPA 1ORGA 1TN4A 3LK1A 2M8UA 2BE4A 3D78A 2HQ8A 1DEKA 2KFGA 4JPZB 1BOCA 5AEQA 1NCXA 5AFPA 5ER5A 2AMIA 3M0WA 1CFFA 3DD4A 2I2RE 1K2HA 2M7LA 4IJ7A 3S0DA 1M31A 2LCPA 5EL2A 1KK8B 1JUOA 3EK4A 1TOPA 5IBWA 1BODA 2MLFC 1BLQA 1AHRA 1ODBA 4PE1A 4L9MA 1KQVA 2I7AA 2ZN9A 3BXKA 1DF0A 1FBVA 1S5GZ 1B7TY 1NX0A 4AQIA 2EC6B 1IJ5A 1QWVA 2B1UA 2MRDA 2LVIA 2R2IA 3FE9A 3BYAA 1SNLA 1K9KA 1XA5A 1XO5A 1DJZA 4PHMA 1DGVA 3K1EA 1LKJA 3GK1A 5DKNA 3OB2B 3KO0A 1DJXA 2HETA 2WNDA 2BCXA 2O60A 3C1VA 2K2AA 4I5KA 2FJUB 5KSZA 1PRWA 3DY9A 2FOTA 2OPOA 2LP2A 2JC2A 1JSAA 1SL7A 2F3ZA 1WRZA 1BR1B 1KFXL 1XFUO 1Q80A 2D8NA 2K7BA 3CWGA 3JTDB 2JWWA 1TCFA 5GQQC 1FW4A 2QEVA 5CSIA 2BBNA 1B9AA 1KQMB 5AANA 5HYDA 1YX7A 3PM2A 1DJWA 5HKWA 2ISDA 1QIWA 1YUSA 3SG2A 2PMYA 2KSPA 3L4LA 4JKTA 1AUIB 2IS9A 2KBMA 2FCDA 2KAXA 2GGZA 3IQQA 1BG1A 1TIZA 4YI9A 4N5XA 2NXQA 1K95A 4PE0A 2BNXA 1K9PA 2BECA 4MZLA 1OOIX 2JPOA 1J7PA 2M1KB 1TUJA 1CDPA 3I5IB 2MBXA 3OHMB 2LAPA 2K61A 5DICA 3A4UB 1ZFSA 5HLVA 1QVIY 1AJ4A 1G4YR 1SPYA 3D77A 4ORAB 5G08A 3SIBA 3I5FC 3TDUA 1K93D 1AK8A 2LVVA 3NSLA 4PCWA 2LNKA 1M63B 2M0RA 1Y1XA 2FCEA 3DZTA 3RZSA 2I94A 4GFTA 1F8HA 2AAOA 2GGMA 1SCVA 2KI4B 2L51A 4M2OA 1PALA 1OZSA 3ICBA 1F55A 3BOWA 1PULA 4MN0A 4OR9B 1LA3A 3CGAA 1OZOA 4MEWA 1YUUA 2PASA 3D10A 2LVKA 3V2LA 1OOJA 2BL0B 4E68A 2K0JA 1K94A 3R72A 2L5YA 5HKZA 1UHNA 1N0YA 1MWNA 3HCMA 3CR2A 3OBVA 3NSIA 2KAVA 4GAOA 1DC1A 2H8VA 1OQPA 3DVMA 4ORBB 2PQLA 5FI6A 3D76A 2L4IA 2L2CA 1FF1A 1TUZA 1DF0B 3E3RA 1K9UA 1RFJA 1T14A 3FWBA 1QS7A 1E8AA 1GGZA 1QX5B 1SCMB 2HF5A 5I2OA 1DQEA 1QV1A 2ERBA 2CTNA 3QRXA 2FJYA 2GV5A 3PALA 4NDBA 1NX1A 1CLMA 2F33A 2LHIA 1JBAA 2LLSA 3OX6A 4C0JA 4HSZA 1LXFC 3O2PA 1HT9A 4GGFC 1B47A 1RK9A 4PHKA 3I5FB 1B7TZ 1ZOTB 1XFZO 3I5HC 5BPJA 1ZUZA 1TTXA 2WC8A 4NDDA 1PVAA 1SR6C 4M2PA 1IQ3A 4GPLB 4USLA 1Y6WA 1BF5A 1FPWA 1NSHA 2OTGB 4PT1A 2K7OA 4I5JA 4YGBB 1U5IB 2KGBC 3BUOB 1A29A 4A4BA 1H8BA 2KI6D 2Y5IA 2JT8A 1NCYA 3WNXB 1MXEA 1TNXA 2TN4A 3ZWHA 2H61A 3TS5C 1IH0A 2JRFA 1CM4A 1UHKA 3EK8A 3I5HB 3VB1A 2BCAA 1SK6D 3AKAA 5K89A 3TUYB 1KSMA 4I5LB 2PRUA 5B8IB 2KGRA 3KF9A 4WQ2A 4JWQA 4D1EA 2JNFA 1NPQA 1CLLA 5HL1A 3BFBA 2A4JA 2CBLA 2OTGC 1UHJA 1EJ3A 4M2QA 1YUTA 1IJ6A 2NLNA 1GM0A 2L2EA 3NHIA 2BBMA 1UWOA 2VRGA 4N1GA 3UNWA 1SL9A 1V1FA 1C3ZA 4CPVA 4UPGA 1TNWA 3B86A 1NYAA 1S6IA 4CFRA 1OW4A 1KFUS 2M7NA 1CMGA 4GGFA 1FI6A 1F4QA 1LS8A 1S6CA 3Q8IA 3PATA 2COLB 1QLKA 4ZCVA 2E30A 4PHNA 1YX8A 2EHBA 3BUWB 2L5XB 1Y1UA 5DKRA 3K21A 3S0BA 2V53A 4GGNA 1C3YA 1MUXA 4N1FA 2JT0A 5CPVA 3VRNA 1L2OB 3EKHA 4MRXA 2KYCA 3D0YB 5JOLA 2LM5A 3EVVA 4CIDA 3PLFB 3EG5B 1ALWA 1AVSA 2JXLA 4OZDA 1XK4A 2BL0C 1B8CA 2EGDA 1JF0A 1QVIZ 3WXAA 3N7HA 4INWA 1MR8A 2LHLA 1J7OA 3R1OA 4MLWA 5ER4X 1PK0D 1DJGA 3D74A 1PSRA 3KEVA 1QASA 3AAKA 3OX5A 4INXA 1SW8A 1A75A 2L4HA 1RJVA 3A8RA 3PFVA 1L2OC 4FQTA 3VRRA 1BT6A 1QTXA 5PALA 2CT9A 2KHNA 3SG6A 3HX4A 1U5IA 5AXIA 4HRGA 2WCJA 4DUQA 1H4BA 3NGVA 2KI6C 1OMVA 3SJSA 1W7JB 3TS5B 1OMRA 1S5GY 1PVBA 4F7FA 1RROA 2P71A 2QEOA 2JXCA 3LK0A 4HRHA 1BU3A 1ZACA 1JFJA 3B88A 2PVBA 2KNEA 3L47A 1M45A 3S0GA 1W7IB 4NQGA 3BQ3A 2Y4QA 1RECA 1QJTA 3D73A 1QATA 1UHHA 2LANA 4MZJA 3SG7A 2WC6A 3MSEB 3BOWB 1R6PA 3DF0B 1B4CA 4DCKA 1KK7Z 1A03A 1F54A 2BAPA 3B87A 3AAJA 2GTEA 1J7RA 4HREE 2JNXA 5J3XA 2EC6C 3D0YA 4OV2A 1MHOA 2CCMA 2WCEA 4YGEB 1M39A 3NXAA 2Y1MA 3PSRA 5FI7A 1XFWO 1MF8B 3CDNA 5JJGA 3SG5A 3IQOA 1XFYO 3R1VA 4U8DA 4QJ5B 1R2UA 4I5NB 4P5OE 2G2BA 2L0PA 5KTYA 3JVTB 2M9GA 2QEHA 4XJKA 1W9ZA 3CZ2A 1NCZA 2M1UA 2ZN8A 4PE4A 1LA0A 2MA2A 1SMGA 3SS3A 1XYDA 2K2FA 1WRLA 4A4CA 3I5GB 2I18A 1WY9A 1G8IA 1NP8A 4C0LA 4YRUA 1CFDA 2MAZA 1OSAA 1G33A 3FIAA 3CZ1A 1WDCB 4ZCUA 1S1EA 1D1OA 3S0FA 1TNPA 1NIWA 4XYNA 1K8UA 5D7FA 4YGCB 2F2PA 2KBIA 3BFAA 3BUNB 1BJFA 1OOHA 3DXLA 4JD9A 3WHTB 1AP4A 2BCBA 2JPTA 4WQ3A 2L98A 2K7CA 1SL8A 2RGIA 4YGDB 1CKKA 1F70A 1OOGA 2NCPA 2WOSA 2OS8B 4ETOA 1X02A 3CZ0A 3NHTA 2JQ6A 4DS7A 1ALVA 1MXLC 2KYFA 5HLOA 2K8MB 4Q04A 2QEBA 1CB1A 1WLMA 1XFXO 1BMOA 4XJKB 1OOFA 1WDCC 4CFQA 2WCLA 5FI2A 2MJWB 5AERA 1A75B 2BE6A 3NSKA 2WCKA 1OMDA 3LL8B 3BUMB 2WCMA 3SIAA 3B7AA 2P6BB 1SYMA 3PN7B 2PALA 3F45A 2WC5A 2LP3A 2KFHA 1SRAA 1KFXS 3CZTX 3DF0A 1JFKA 2OS8C 2LVJA 3VRQA 1GQMA 1CDMA 5CSNA 3UO9A 4FTGA 1TWOA 2SCPA 2JU0A 1C7VA 1VRKA 4MBEA 3CTNA 1XK4C 5CSFA 1ZMZA 2P70A 3JVTC 5I8NA 2Y1NA 1RWYA 3LLEA 3S0EA 3EVUA 2F8PA 5KU1A 4GUKA 4NDCA 1DTLA 1WLZA 2KLEA 5CSJA 3VRPA 3WHUB 1B1GA 2QDIA 1IKUA 4MVFA 4KYNA 1PSBA 4DIRA 1UP5A 3I5GC 1XFVO 4BY4A 1CFPA 2F3YA 1CDLA 4PE7A 1QXPA 3CABA 4FQOA 1K90D 3DYEA 1IRJA 1S26D 4GNKB 3O4XA 1KQMC 3SS4A 3TZ1A 1TCOB 2JTTA 3CR5X 3KHEA 2MHHA 1Y1AA 1NX2A 2PSRA 1QX2A 1EXRA 4IL1A 1EL4A 1AJ5A 3PJIA 4JQ0D 2KDHA 3VGOA 2M29A 1CFCA 1EH2A 1GGWA 2LLTA 1J55A 1DJIA 3IF7A 2KAYA 4ICBA 3TDZA 4DRWA 2F2OA 3BUXB 2ZKMX 3DVKA 2JZIA 2KOTA 2ZNDA 2CXJA 1K96A 1N65A 1IWQA 1B8LA 1JF2A 2E6WA 2G9BA 2M49B 3O78A 4YGAA 4AOMA 3OB1B 1UURA 1SSEB 5DKQA 3SG4A 1UUSA 3KPXA 2M3WA 3TDIA 2NZ0A 3ZNIA 1KWOC 2KLDA 1CTRA 1CNPA 1QLSA 4OCIA 4ORCB 2KPHA 1B8RA 3OGNA 3PN7C 2QPTA 1C7WA 4PHJA 4OVNF 1IQ5A 1DVIA 1KSOA 2JOJA 3O4YA 1A2XA 1GJYA 3CS1A 3BJHA 2DOQA 1M46A 3LCPC 2HPSA 1CLBA 1YRUB 4WRIA 1CDNA 1KCYA 2ZFDA 4F0ZB 1L7ZA 2ZRTA 2H2KA 1KK7Y 1F4OA 5D69A 1P28A 5I2LA 1YURA 2LUCA 1S36A 1KWOB 2KI4C 4OKHA 1LINA 3EK7A 1JC2A 4MRYA 1Y0VH 2ZRSA 1XFRA 4AQJA 3VROA 2Q4UA 2WCBA 1CM1A 2LC5A 3GK4X 1RTP1 3EKJA 1EG3A 2K60A 4YI8A 4CLNA 3QMEA 4PALA 2LE9B 1FI5A 4TNCA 2AUCA 2YGUA 5F6TA 1A4PA 1TNQA 3GK2A 1SR6B 1Z4HA 2JULA 2SASA 3CYZA 2HQWA 2PYQA 1UHIA 2JTZA 1IIOA 4R1EA 2H61C 2KFFA 1YRTB 1SY9A 2QACA 2M97A 2O5GA 2LMUA 1Z2CB 1S3PA 2BKIB 1IG5A 1KFUL 1MQ1A 2LUXA 3R1PA 4QJ3B 1DMOA 4GBAA 1NUBA 3I5IC 1S6JA 2Q91A 4BY5A 1LVCD 3CLNA 1DELA 1YVLA 1J1EA 1XVJA 1NWDA 1QIVA 2LMVA 2L50A 3FE8A 2ZNEA 1SKTA 1N2DA 1KK8C 2LV7A 1DGUA 1YR5A 3B6XA 3BFHA 3CR4X 3DVEA 5I2QA 2BKHB 3TUYC 1QX7A 3H4SE 5FYXA 3D75A 1JWDA 1EG4A 3DVJA 5D3OA 3PM8A 2WORA 3FS7A 1QV0A 1TRFA 4QJ4B 1OE9B 1J7QA 1SCMC 1C07A 3JTDC 1CMFA 1IGVA 3O6BA 1WRKA 2LLUA 3IVTA 2JT3A 2KQYA 3SG3A 5HKYA 4C0KA 3EVRA 3S0AA 1HQVA 2MLEC 3FE6A
chains in the Genus database with same CATH topology
5TNCA 3RLZA 4PDZA 1BR4B 3NSOA 4MSPA 4P2YB 1SBJA 2LMTA 1YVHA 2NCOA 4YBHB 1DJHA 4MZKA 1DJYA 1YTZC 2K7DA 1V1GA 1DT7B 2KQ6A 3AKBA 2WCFA 1J1DA 3FWCA 3RM1A 3GOFA 1NX3A 3OP0A 1F71A 2CNPA 1TN4A 3LK1A 2M8UA 2BE4A 2HQ8A 2KFGA 4JPZB 1BOCA 5AEQA 1NCXA 5AFPA 5ER5A 2AMIA 3M0WA 1CFFA 3DD4A 2I2RE 1K2HA 2M7LA 1M31A 2LCPA 1KK8B 1JUOA 3EK4A 1TOPA 5IBWA 1BODA 2MLFC 1BLQA 1AHRA 1ODBA 4PE1A 4L9MA 1KQVA 2I7AA 2ZN9A 3BXKA 1DF0A 1FBVA 1S5GZ 1B7TY 1NX0A 4AQIA 2EC6B 1IJ5A 2B1UA 2MRDA 2R2IA 2LVIA 3BYAA 1SNLA 1K9KA 1XA5A 1XO5A 1DJZA 4PHMA 1DGVA 1LKJA 3GK1A 5DKNA 3OB2B 3KO0A 1DJXA 2HETA 2WNDA 2BCXA 2O60A 3C1VA 2K2AA 4I5KA 2FJUB 5KSZA 1PRWA 2FOTA 2OPOA 2LP2A 2JC2A 1JSAA 1SL7A 2F3ZA 1WRZA 1BR1B 1KFXL 1XFUO 1Q80A 2D8NA 2K7BA 3CWGA 3JTDB 2JWWA 1TCFA 5GQQC 1FW4A 5CSIA 1B9AA 2BBNA 1KQMB 5AANA 5HYDA 1YX7A 1DJWA 5HKWA 2ISDA 1QIWA 1YUSA 3SG2A 2PMYA 2KSPA 1AUIB 2IS9A 2KBMA 2FCDA 2KAXA 2GGZA 3IQQA 1BG1A 1TIZA 4YI9A 4N5XA 2NXQA 1K95A 4PE0A 1K9PA 2BECA 4MZLA 1J7PA 2M1KB 1CDPA 3I5IB 2MBXA 3OHMB 2LAPA 2K61A 3A4UB 1ZFSA 5HLVA 1QVIY 1AJ4A 1G4YR 1SPYA 4ORAB 5G08A 3SIBA 3TDUA 3I5FC 1AK8A 1K93D 2LVVA 3NSLA 4PCWA 2LNKA 1M63B 2M0RA 1Y1XA 2FCEA 1F8HA 2I94A 4GFTA 2AAOA 2GGMA 1SCVA 2KI4B 2L51A 4M2OA 1PALA 1OZSA 3ICBA 1F55A 3BOWA 1PULA 4MN0A 4OR9B 1LA3A 3CGAA 1OZOA 4MEWA 1YUUA 2PASA 3D10A 2LVKA 1OOJA 2BL0B 4E68A 2K0JA 1K94A 5HKZA 1UHNA 1N0YA 1MWNA 3HCMA 3CR2A 3NSIA 2KAVA 4GAOA 3DVMA 1OQPA 4ORBB 2L4IA 1FF1A 1DF0B 3E3RA 1K9UA 1RFJA 3FWBA 1QS7A 1E8AA 1GGZA 1QX5B 1SCMB 2HF5A 5I2OA 1QV1A 2CTNA 3QRXA 3PALA 2GV5A 4NDBA 1NX1A 1CLMA 2F33A 2LHIA 1JBAA 2LLSA 3OX6A 4C0JA 4HSZA 1LXFC 3O2PA 1HT9A 4GGFC 1B47A 1RK9A 4PHKA 3I5FB 1B7TZ 1ZOTB 1XFZO 3I5HC 5BPJA 1ZUZA 1TTXA 2WC8A 4NDDA 1PVAA 1SR6C 4M2PA 1IQ3A 4GPLB 4USLA 1Y6WA 1BF5A 1FPWA 1NSHA 2OTGB 2K7OA 4I5JA 4YGBB 1U5IB 2KGBC 3BUOB 1A29A 4A4BA 1H8BA 2KI6D 2Y5IA 2JT8A 1NCYA 3WNXB 1MXEA 1TNXA 2TN4A 3ZWHA 2H61A 3TS5C 1IH0A 2JRFA 1CM4A 1UHKA 3EK8A 3I5HB 2BCAA 1SK6D 3AKAA 5K89A 3TUYB 1KSMA 4I5LB 2PRUA 5B8IB 2KGRA 3KF9A 4WQ2A 4JWQA 4D1EA 2JNFA 1NPQA 1CLLA 2A4JA 2CBLA 2OTGC 1UHJA 1EJ3A 4M2QA 1YUTA 1IJ6A 2NLNA 2L2EA 2BBMA 1UWOA 2VRGA 4N1GA 1SL9A 1V1FA 4CPVA 4UPGA 1TNWA 1NYAA 1S6IA 4CFRA 1KFUS 2M7NA 1CMGA 4GGFA 1FI6A 1F4QA 1S6CA 3PATA 2COLB 1QLKA 4ZCVA 2E30A 4PHNA 1YX8A 2EHBA 3BUWB 2L5XB 1Y1UA 5DKRA 3K21A 2V53A 4GGNA 1MUXA 4N1FA 2JT0A 5CPVA 3VRNA 1L2OB 3EKHA 4MRXA 2KYCA 3D0YB 5JOLA 2LM5A 3EVVA 4CIDA 3PLFB 1ALWA 1AVSA 2JXLA 1XK4A 2BL0C 1B8CA 2EGDA 1JF0A 1QVIZ 3WXAA 1MR8A 2LHLA 5ER4X 4MLWA 1PK0D 1DJGA 3OX5A 1PSRA 3KEVA 1QASA 3AAKA 1SW8A 1A75A 2L4HA 1RJVA 3A8RA 3PFVA 1L2OC 3VRRA 1BT6A 1QTXA 5PALA 2CT9A 2KHNA 3SG6A 3HX4A 1U5IA 5AXIA 4HRGA 4DUQA 1H4BA 2KI6C 1OMVA 3SJSA 1W7JB 3TS5B 1OMRA 1S5GY 1PVBA 1RROA 2JXCA 3LK0A 4HRHA 1BU3A 1ZACA 1JFJA 2PVBA 2KNEA 1M45A 1W7IB 4NQGA 3BQ3A 2Y4QA 1RECA 1QJTA 1QATA 1UHHA 2LANA 4MZJA 3SG7A 3MSEB 3BOWB 1R6PA 3DF0B 1B4CA 4DCKA 1KK7Z 1A03A 1F54A 3AAJA 1J7RA 4HREE 2JNXA 5J3XA 2EC6C 3D0YA 4OV2A 1MHOA 2CCMA 2WCEA 4YGEB 1M39A 3NXAA 2Y1MA 3PSRA 5JJGA 1XFWO 1MF8B 3SG5A 3IQOA 1XFYO 4U8DA 4QJ5B 1J7OA 1R2UA 4I5NB 4P5OE 2G2BA 2L0PA 5KTYA 3JVTB 2M9GA 4XJKA 1NCZA 2M1UA 2ZN8A 4PE4A 1LA0A 2MA2A 1SMGA 1XYDA 2K2FA 1WRLA 4A4CA 3I5GB 2I18A 1WY9A 1G8IA 1NP8A 4C0LA 4YRUA 1CFDA 2MAZA 1OSAA 1G33A 3FIAA 1WDCB 4ZCUA 1S1EA 1D1OA 1TNPA 1NIWA 4XYNA 1K8UA 5D7FA 4YGCB 2F2PA 2KBIA 3BUNB 1AP4A 1BJFA 3WHTB 2BCBA 2JPTA 4WQ3A 2L98A 2K7CA 1SL8A 2RGIA 4YGDB 1CKKA 1F70A 2NCPA 2WOSA 2OS8B 4ETOA 1X02A 2JQ6A 4DS7A 1ALVA 1MXLC 2KYFA 5HLOA 2K8MB 4Q04A 1CB1A 1WLMA 1XFXO 1BMOA 4XJKB 1WDCC 4CFQA 2MJWB 5AERA 1A75B 2BE6A 3NSKA 1OMDA 3LL8B 3BUMB 3SIAA 3PN7B 2P6BB 1SYMA 2PALA 3F45A 2LP3A 2KFHA 1SRAA 1KFXS 3CZTX 3DF0A 1JFKA 2OS8C 2LVJA 3VRQA 1GQMA 1CDMA 5CSNA 4FTGA 2SCPA 2JU0A 1C7VA 1VRKA 4MBEA 3CTNA 1XK4C 5CSFA 1ZMZA 3JVTC 5I8NA 2Y1NA 1RWYA 3LLEA 3EVUA 2F8PA 5KU1A 4GUKA 4NDCA 1DTLA 1WLZA 5CSJA 3VRPA 3WHUB 1B1GA 1IKUA 4MVFA 1PSBA 4DIRA 1UP5A 3I5GC 1XFVO 4BY4A 1CFPA 2F3YA 1CDLA 4PE7A 1QXPA 4FQOA 1K90D 1IRJA 1S26D 4GNKB 1KQMC 3TZ1A 1TCOB 2JTTA 3CR5X 3KHEA 2MHHA 1Y1AA 1NX2A 2PSRA 1QX2A 1EXRA 4IL1A 1EL4A 1AJ5A 4JQ0D 2KDHA 3VGOA 2M29A 1CFCA 1EH2A 1GGWA 2LLTA 1J55A 1DJIA 3IF7A 2KAYA 4ICBA 3TDZA 4DRWA 2F2OA 3BUXB 2ZKMX 3DVKA 2JZIA 2KOTA 2ZNDA 2CXJA 1K96A 1N65A 1IWQA 1B8LA 1JF2A 2E6WA 2G9BA 2M49B 3O78A 4YGAA 4AOMA 3OB1B 1UURA 5DKQA 3SG4A 1UUSA 3KPXA 2M3WA 3TDIA 2NZ0A 3ZNIA 1KWOC 1CTRA 1CNPA 1QLSA 4OCIA 4ORCB 1B8RA 3PN7C 2QPTA 1C7WA 4PHJA 4OVNF 1IQ5A 1DVIA 1KSOA 2JOJA 3O4YA 1A2XA 1GJYA 3CS1A 2DOQA 1M46A 3LCPC 2HPSA 1CLBA 1YRUB 4WRIA 1CDNA 1KCYA 2ZFDA 4F0ZB 1L7ZA 2ZRTA 2H2KA 1KK7Y 1F4OA 5D69A 5I2LA 1YURA 2LUCA 1S36A 1KWOB 2KI4C 4OKHA 1LINA 3EK7A 1JC2A 4MRYA 1Y0VH 2ZRSA 4AQJA 3VROA 2Q4UA 2WCBA 1CM1A 2LC5A 3GK4X 1RTP1 3EKJA 1EG3A 4CLNA 4YI8A 4PALA 2LE9B 1FI5A 4TNCA 2AUCA 5F6TA 1A4PA 1TNQA 3GK2A 1SR6B 2SASA 2JULA 2HQWA 1UHIA 2JTZA 4R1EA 2H61C 2KFFA 1YRTB 1SY9A 2QACA 2M97A 2O5GA 2LMUA 1S3PA 2BKIB 1IG5A 1KFUL 1MQ1A 2LUXA 4QJ3B 1DMOA 4GBAA 1NUBA 3I5IC 1S6JA 2Q91A 4BY5A 1LVCD 3CLNA 1YVLA 1J1EA 1XVJA 1NWDA 1QIVA 2LMVA 2L50A 2ZNEA 1SKTA 1N2DA 1KK8C 2LV7A 1DGUA 1YR5A 3CR4X 3DVEA 5I2QA 3TUYC 2BKHB 1QX7A 3H4SE 5FYXA 1JWDA 1EG4A 3DVJA 3PM8A 2WORA 3FS7A 1QV0A 1TRFA 4QJ4B 1OE9B 1J7QA 1SCMC 1C07A 3JTDC 1CMFA 1IGVA 3O6BA 1WRKA 2LLUA 2JT3A 2KQYA 3SG3A 5HKYA 4C0KA 3EVRA 1HQVA 2MLEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TNC A;  3RLZ A;  4PDZ A;  1BR4 B;  3NSO A;  4MSP A;  4P2Y B;  1SBJ A;  2LMT A;  1YVH A;  2NCO A;  4YBH B;  1DJH A;  4MZK A;  1DJY A;  1YTZ C;  2K7D A;  1V1G A;  1DT7 B;  2KQ6 A;  3AKB A;  2WCF A;  1J1D A;  3FWC A;  3RM1 A;  3GOF A;  1NX3 A;  3OP0 A;  1F71 A;  2CNP A;  1TN4 A;  3LK1 A;  2M8U A;  2BE4 A;  2HQ8 A;  2KFG A;  4JPZ B;  1BOC A;  5AEQ A;  1NCX A;  5AFP A;  5ER5 A;  2AMI A;  3M0W A;  1CFF A;  3DD4 A;  2I2R E;  1K2H A;  2M7L A;  1M31 A;  2LCP A;  1KK8 B;  1JUO A;  3EK4 A;  1TOP A;  5IBW A;  1BOD A;  2MLF C;  1BLQ A;  1AHR A;  1ODB A;  4PE1 A;  4L9M A;  1KQV A;  2I7A A;  2ZN9 A;  3BXK A;  1DF0 A;  1FBV A;  1S5G Z;  1B7T Y;  1NX0 A;  4AQI A;  2EC6 B;  1IJ5 A;  2B1U A;  2MRD A;  2R2I A;  2LVI A;  3BYA A;  1SNL A;  1K9K A;  1XA5 A;  1XO5 A;  1DJZ A;  4PHM A;  1DGV A;  1LKJ A;  3GK1 A;  5DKN A;  3OB2 B;  3KO0 A;  1DJX A;  2HET A;  2WND A;  2BCX A;  2O60 A;  3C1V A;  2K2A A;  4I5K A;  2FJU B;  5KSZ A;  1PRW A;  2FOT A;  2OPO A;  2LP2 A;  2JC2 A;  1JSA A;  1SL7 A;  2F3Z A;  1WRZ A;  1BR1 B;  1KFX L;  1XFU O;  1Q80 A;  2D8N A;  2K7B A;  3CWG A;  3JTD B;  2JWW A;  1TCF A;  5GQQ C;  1FW4 A;  5CSI A;  1B9A A;  2BBN A;  1KQM B;  5AAN A;  5HYD A;  1YX7 A;  1DJW A;  5HKW A;  2ISD A;  1QIW A;  1YUS A;  3SG2 A;  2PMY A;  2KSP A;  1AUI B;  2IS9 A;  2KBM A;  2FCD A;  2KAX A;  2GGZ A;  3IQQ A;  1BG1 A;  1TIZ A;  4YI9 A;  4N5X A;  2NXQ A;  1K95 A;  4PE0 A;  1K9P A;  2BEC A;  4MZL A;  1J7P A;  2M1K B;  1CDP A;  3I5I B;  2MBX A;  3OHM B;  2LAP A;  2K61 A;  3A4U B;  1ZFS A;  5HLV A;  1QVI Y;  1AJ4 A;  1G4Y R;  1SPY A;  4ORA B;  5G08 A;  3SIB A;  3TDU A;  3I5F C;  1AK8 A;  1K93 D;  2LVV A;  3NSL A;  4PCW A;  2LNK A;  1M63 B;  2M0R A;  1Y1X A;  2FCE A;  1F8H A;  2I94 A;  4GFT A;  2AAO A;  2GGM A;  1SCV A;  2KI4 B;  2L51 A;  4M2O A;  1PAL A;  1OZS A;  3ICB A;  1F55 A;  3BOW A;  1PUL A;  4MN0 A;  4OR9 B;  1LA3 A;  3CGA A;  1OZO A;  4MEW A;  1YUU A;  2PAS A;  3D10 A;  2LVK A;  1OOJ A;  2BL0 B;  4E68 A;  2K0J A;  1K94 A;  5HKZ A;  1UHN A;  1N0Y A;  1MWN A;  3HCM A;  3CR2 A;  3NSI A;  2KAV A;  4GAO A;  3DVM A;  1OQP A;  4ORB B;  2L4I A;  1FF1 A;  1DF0 B;  3E3R A;  1K9U A;  1RFJ A;  3FWB A;  1QS7 A;  1E8A A;  1GGZ A;  1QX5 B;  1SCM B;  2HF5 A;  5I2O A;  1QV1 A;  2CTN A;  3QRX A;  3PAL A;  2GV5 A;  4NDB A;  1NX1 A;  1CLM A;  2F33 A;  2LHI A;  1JBA A;  2LLS A;  3OX6 A;  4C0J A;  4HSZ A;  1LXF C;  3O2P A;  1HT9 A;  4GGF C;  1B47 A;  1RK9 A;  4PHK A;  3I5F B;  1B7T Z;  1ZOT B;  1XFZ O;  3I5H C;  5BPJ A;  1ZUZ A;  1TTX A;  2WC8 A;  4NDD A;  1PVA A;  1SR6 C;  4M2P A;  1IQ3 A;  4GPL B;  4USL A;  1Y6W A;  1BF5 A;  1FPW A;  1NSH A;  2OTG B;  2K7O A;  4I5J A;  4YGB B;  1U5I B;  2KGB C;  3BUO B;  1A29 A;  4A4B A;  1H8B A;  2KI6 D;  2Y5I A;  2JT8 A;  1NCY A;  3WNX B;  1MXE A;  1TNX A;  2TN4 A;  3ZWH A;  2H61 A;  3TS5 C;  1IH0 A;  2JRF A;  1CM4 A;  1UHK A;  3EK8 A;  3I5H B;  2BCA A;  1SK6 D;  3AKA A;  5K89 A;  3TUY B;  1KSM A;  4I5L B;  2PRU A;  5B8I B;  2KGR A;  3KF9 A;  4WQ2 A;  4JWQ A;  4D1E A;  2JNF A;  1NPQ A;  1CLL A;  2A4J A;  2CBL A;  2OTG C;  1UHJ A;  1EJ3 A;  4M2Q A;  1YUT A;  1IJ6 A;  2NLN A;  2L2E A;  2BBM A;  1UWO A;  2VRG A;  4N1G A;  1SL9 A;  1V1F A;  4CPV A;  4UPG A;  1TNW A;  1NYA A;  1S6I A;  4CFR A;  1KFU S;  2M7N A;  1CMG A;  4GGF A;  1FI6 A;  1F4Q A;  1S6C A;  3PAT A;  2COL B;  1QLK A;  4ZCV A;  2E30 A;  4PHN A;  1YX8 A;  2EHB A;  3BUW B;  2L5X B;  1Y1U A;  5DKR A;  3K21 A;  2V53 A;  4GGN A;  1MUX A;  4N1F A;  2JT0 A;  5CPV A;  3VRN A;  1L2O B;  3EKH A;  4MRX A;  2KYC A;  3D0Y B;  5JOL A;  2LM5 A;  3EVV A;  4CID A;  3PLF B;  1ALW A;  1AVS A;  2JXL A;  1XK4 A;  2BL0 C;  1B8C A;  2EGD A;  1JF0 A;  1QVI Z;  3WXA A;  1MR8 A;  2LHL A;  5ER4 X;  4MLW A;  1PK0 D;  1DJG A;  3OX5 A;  1PSR A;  3KEV A;  1QAS A;  3AAK A;  1SW8 A;  1A75 A;  2L4H A;  1RJV A;  3A8R A;  3PFV A;  1L2O C;  3VRR A;  1BT6 A;  1QTX A;  5PAL A;  2CT9 A;  2KHN A;  3SG6 A;  3HX4 A;  1U5I A;  5AXI A;  4HRG A;  4DUQ A;  1H4B A;  2KI6 C;  1OMV A;  3SJS A;  1W7J B;  3TS5 B;  1OMR A;  1S5G Y;  1PVB A;  1RRO A;  2JXC A;  3LK0 A;  4HRH A;  1BU3 A;  1ZAC A;  1JFJ A;  2PVB A;  2KNE A;  1M45 A;  1W7I B;  4NQG A;  3BQ3 A;  2Y4Q A;  1REC A;  1QJT A;  1QAT A;  1UHH A;  2LAN A;  4MZJ A;  3SG7 A;  3MSE B;  3BOW B;  1R6P A;  3DF0 B;  1B4C A;  4DCK A;  1KK7 Z;  1A03 A;  1F54 A;  3AAJ A;  1J7R A;  4HRE E;  2JNX A;  5J3X A;  2EC6 C;  3D0Y A;  4OV2 A;  1MHO A;  2CCM A;  2WCE A;  4YGE B;  1M39 A;  3NXA A;  2Y1M A;  3PSR A;  5JJG A;  1XFW O;  1MF8 B;  3SG5 A;  3IQO A;  1XFY O;  4U8D A;  4QJ5 B;  1J7O A;  1R2U A;  4I5N B;  4P5O E;  2G2B A;  2L0P A;  5KTY A;  3JVT B;  2M9G A;  4XJK A;  1NCZ A;  2M1U A;  2ZN8 A;  4PE4 A;  1LA0 A;  2MA2 A;  1SMG A;  1XYD A;  2K2F A;  1WRL A;  4A4C A;  3I5G B;  2I18 A;  1WY9 A;  1G8I A;  1NP8 A;  4C0L A;  4YRU A;  1CFD A;  2MAZ A;  1OSA A;  1G33 A;  3FIA A;  1WDC B;  4ZCU A;  1S1E A;  1D1O A;  1TNP A;  1NIW A;  4XYN A;  1K8U A;  5D7F A;  4YGC B;  2F2P A;  2KBI A;  3BUN B;  1AP4 A;  1BJF A;  3WHT B;  2BCB A;  2JPT A;  4WQ3 A;  2L98 A;  2K7C A;  1SL8 A;  2RGI A;  4YGD B;  1CKK A;  1F70 A;  2NCP A;  2WOS A;  2OS8 B;  4ETO A;  1X02 A;  2JQ6 A;  4DS7 A;  1ALV A;  1MXL C;  2KYF A;  5HLO A;  2K8M B;  4Q04 A;  1CB1 A;  1WLM A;  1XFX O;  1BMO A;  4XJK B;  1WDC C;  4CFQ A;  2MJW B;  5AER A;  1A75 B;  2BE6 A;  3NSK A;  1OMD A;  3LL8 B;  3BUM B;  3SIA A;  3PN7 B;  2P6B B;  1SYM A;  2PAL A;  3F45 A;  2LP3 A;  2KFH A;  1SRA A;  1KFX S;  3CZT X;  3DF0 A;  1JFK A;  2OS8 C;  2LVJ A;  3VRQ A;  1GQM A;  1CDM A;  5CSN A;  4FTG A;  2SCP A;  2JU0 A;  1C7V A;  1VRK A;  4MBE A;  3CTN A;  1XK4 C;  5CSF A;  1ZMZ A;  3JVT C;  5I8N A;  2Y1N A;  1RWY A;  3LLE A;  3EVU A;  2F8P A;  5KU1 A;  4GUK A;  4NDC A;  1DTL A;  1WLZ A;  5CSJ A;  3VRP A;  3WHU B;  1B1G A;  1IKU A;  4MVF A;  1PSB A;  4DIR A;  1UP5 A;  3I5G C;  1XFV O;  4BY4 A;  1CFP A;  2F3Y A;  1CDL A;  4PE7 A;  1QXP A;  4FQO A;  1K90 D;  1IRJ A;  1S26 D;  4GNK B;  1KQM C;  3TZ1 A;  1TCO B;  2JTT A;  3CR5 X;  3KHE A;  2MHH A;  1Y1A A;  1NX2 A;  2PSR A;  1QX2 A;  1EXR A;  4IL1 A;  1EL4 A;  1AJ5 A;  4JQ0 D;  2KDH A;  3VGO A;  2M29 A;  1CFC A;  1EH2 A;  1GGW A;  2LLT A;  1J55 A;  1DJI A;  3IF7 A;  2KAY A;  4ICB A;  3TDZ A;  4DRW A;  2F2O A;  3BUX B;  2ZKM X;  3DVK A;  2JZI A;  2KOT A;  2ZND A;  2CXJ A;  1K96 A;  1N65 A;  1IWQ A;  1B8L A;  1JF2 A;  2E6W A;  2G9B A;  2M49 B;  3O78 A;  4YGA A;  4AOM A;  3OB1 B;  1UUR A;  5DKQ A;  3SG4 A;  1UUS A;  3KPX A;  2M3W A;  3TDI A;  2NZ0 A;  3ZNI A;  1KWO C;  1CTR A;  1CNP A;  1QLS A;  4OCI A;  4ORC B;  1B8R A;  3PN7 C;  2QPT A;  1C7W A;  4PHJ A;  4OVN F;  1IQ5 A;  1DVI A;  1KSO A;  2JOJ A;  3O4Y A;  1A2X A;  1GJY A;  3CS1 A;  2DOQ A;  1M46 A;  3LCP C;  2HPS A;  1CLB A;  1YRU B;  4WRI A;  1CDN A;  1KCY A;  2ZFD A;  4F0Z B;  1L7Z A;  2ZRT A;  2H2K A;  1KK7 Y;  1F4O A;  5D69 A;  5I2L A;  1YUR A;  2LUC A;  1S36 A;  1KWO B;  2KI4 C;  4OKH A;  1LIN A;  3EK7 A;  1JC2 A;  4MRY A;  1Y0V H;  2ZRS A;  4AQJ A;  3VRO A;  2Q4U A;  2WCB A;  1CM1 A;  2LC5 A;  3GK4 X;  1RTP 1;  3EKJ A;  1EG3 A;  4CLN A;  4YI8 A;  4PAL A;  2LE9 B;  1FI5 A;  4TNC A;  2AUC A;  5F6T A;  1A4P A;  1TNQ A;  3GK2 A;  1SR6 B;  2SAS A;  2JUL A;  2HQW A;  1UHI A;  2JTZ A;  4R1E A;  2H61 C;  2KFF A;  1YRT B;  1SY9 A;  2QAC A;  2M97 A;  2O5G A;  2LMU A;  1S3P A;  2BKI B;  1IG5 A;  1KFU L;  1MQ1 A;  2LUX A;  4QJ3 B;  1DMO A;  4GBA A;  1NUB A;  3I5I C;  1S6J A;  2Q91 A;  4BY5 A;  1LVC D;  3CLN A;  1YVL A;  1J1E A;  1XVJ A;  1NWD A;  1QIV A;  2LMV A;  2L50 A;  2ZNE A;  1SKT A;  1N2D A;  1KK8 C;  2LV7 A;  1DGU A;  1YR5 A;  3CR4 X;  3DVE A;  5I2Q A;  3TUY C;  2BKH B;  1QX7 A;  3H4S E;  5FYX A;  1JWD A;  1EG4 A;  3DVJ A;  3PM8 A;  2WOR A;  3FS7 A;  1QV0 A;  1TRF A;  4QJ4 B;  1OE9 B;  1J7Q A;  1SCM C;  1C07 A;  3JTD C;  1CMF A;  1IGV A;  3O6B A;  1WRK A;  2LLU A;  2JT3 A;  2KQY A;  3SG3 A;  5HKY A;  4C0K A;  3EVR A;  1HQV A;  2MLE C; 
#chains in the Genus database with same CATH topology
 5TNC A;  3RLZ A;  4PDZ A;  1BR4 B;  5I94 A;  3NSO A;  4MSP A;  3SS5 A;  4P2Y B;  1SBJ A;  2LMT A;  1YVH A;  2NCO A;  4YBH B;  1DJH A;  4MZK A;  1DJY A;  1YTZ C;  2K7D A;  3L4A A;  1V1G A;  1DT7 B;  2KQ6 A;  2WCH A;  2WCF A;  1J1D A;  3AKB A;  3FWC A;  3RM1 A;  3GOF A;  1NX3 A;  3OP0 A;  1F71 A;  2CNP A;  1ORG A;  1TN4 A;  3LK1 A;  2M8U A;  2BE4 A;  3D78 A;  2HQ8 A;  1DEK A;  2KFG A;  4JPZ B;  1BOC A;  5AEQ A;  1NCX A;  5AFP A;  5ER5 A;  2AMI A;  3M0W A;  1CFF A;  3DD4 A;  2I2R E;  1K2H A;  2M7L A;  4IJ7 A;  3S0D A;  1M31 A;  2LCP A;  5EL2 A;  1KK8 B;  1JUO A;  3EK4 A;  1TOP A;  5IBW A;  1BOD A;  2MLF C;  1BLQ A;  1AHR A;  1ODB A;  4PE1 A;  4L9M A;  1KQV A;  2I7A A;  2ZN9 A;  3BXK A;  1DF0 A;  1FBV A;  1S5G Z;  1B7T Y;  1NX0 A;  4AQI A;  2EC6 B;  1IJ5 A;  1QWV A;  2B1U A;  2MRD A;  2LVI A;  2R2I A;  3FE9 A;  3BYA A;  1SNL A;  1K9K A;  1XA5 A;  1XO5 A;  1DJZ A;  4PHM A;  1DGV A;  3K1E A;  1LKJ A;  3GK1 A;  5DKN A;  3OB2 B;  3KO0 A;  1DJX A;  2HET A;  2WND A;  2BCX A;  2O60 A;  3C1V A;  2K2A A;  4I5K A;  2FJU B;  5KSZ A;  1PRW A;  3DY9 A;  2FOT A;  2OPO A;  2LP2 A;  2JC2 A;  1JSA A;  1SL7 A;  2F3Z A;  1WRZ A;  1BR1 B;  1KFX L;  1XFU O;  1Q80 A;  2D8N A;  2K7B A;  3CWG A;  3JTD B;  2JWW A;  1TCF A;  5GQQ C;  1FW4 A;  2QEV A;  5CSI A;  2BBN A;  1B9A A;  1KQM B;  5AAN A;  5HYD A;  1YX7 A;  3PM2 A;  1DJW A;  5HKW A;  2ISD A;  1QIW A;  1YUS A;  3SG2 A;  2PMY A;  2KSP A;  3L4L A;  4JKT A;  1AUI B;  2IS9 A;  2KBM A;  2FCD A;  2KAX A;  2GGZ A;  3IQQ A;  1BG1 A;  1TIZ A;  4YI9 A;  4N5X A;  2NXQ A;  1K95 A;  4PE0 A;  2BNX A;  1K9P A;  2BEC A;  4MZL A;  1OOI X;  2JPO A;  1J7P A;  2M1K B;  1TUJ A;  1CDP A;  3I5I B;  2MBX A;  3OHM B;  2LAP A;  2K61 A;  5DIC A;  3A4U B;  1ZFS A;  5HLV A;  1QVI Y;  1AJ4 A;  1G4Y R;  1SPY A;  3D77 A;  4ORA B;  5G08 A;  3SIB A;  3I5F C;  3TDU A;  1K93 D;  1AK8 A;  2LVV A;  3NSL A;  4PCW A;  2LNK A;  1M63 B;  2M0R A;  1Y1X A;  2FCE A;  3DZT A;  3RZS A;  2I94 A;  4GFT A;  1F8H A;  2AAO A;  2GGM A;  1SCV A;  2KI4 B;  2L51 A;  4M2O A;  1PAL A;  1OZS A;  3ICB A;  1F55 A;  3BOW A;  1PUL A;  4MN0 A;  4OR9 B;  1LA3 A;  3CGA A;  1OZO A;  4MEW A;  1YUU A;  2PAS A;  3D10 A;  2LVK A;  3V2L A;  1OOJ A;  2BL0 B;  4E68 A;  2K0J A;  1K94 A;  3R72 A;  2L5Y A;  5HKZ A;  1UHN A;  1N0Y A;  1MWN A;  3HCM A;  3CR2 A;  3OBV A;  3NSI A;  2KAV A;  4GAO A;  1DC1 A;  2H8V A;  1OQP A;  3DVM A;  4ORB B;  2PQL A;  5FI6 A;  3D76 A;  2L4I A;  2L2C A;  1FF1 A;  1TUZ A;  1DF0 B;  3E3R A;  1K9U A;  1RFJ A;  1T14 A;  3FWB A;  1QS7 A;  1E8A A;  1GGZ A;  1QX5 B;  1SCM B;  2HF5 A;  5I2O A;  1DQE A;  1QV1 A;  2ERB A;  2CTN A;  3QRX A;  2FJY A;  2GV5 A;  3PAL A;  4NDB A;  1NX1 A;  1CLM A;  2F33 A;  2LHI A;  1JBA A;  2LLS A;  3OX6 A;  4C0J A;  4HSZ A;  1LXF C;  3O2P A;  1HT9 A;  4GGF C;  1B47 A;  1RK9 A;  4PHK A;  3I5F B;  1B7T Z;  1ZOT B;  1XFZ O;  3I5H C;  5BPJ A;  1ZUZ A;  1TTX A;  2WC8 A;  4NDD A;  1PVA A;  1SR6 C;  4M2P A;  1IQ3 A;  4GPL B;  4USL A;  1Y6W A;  1BF5 A;  1FPW A;  1NSH A;  2OTG B;  4PT1 A;  2K7O A;  4I5J A;  4YGB B;  1U5I B;  2KGB C;  3BUO B;  1A29 A;  4A4B A;  1H8B A;  2KI6 D;  2Y5I A;  2JT8 A;  1NCY A;  3WNX B;  1MXE A;  1TNX A;  2TN4 A;  3ZWH A;  2H61 A;  3TS5 C;  1IH0 A;  2JRF A;  1CM4 A;  1UHK A;  3EK8 A;  3I5H B;  3VB1 A;  2BCA A;  1SK6 D;  3AKA A;  5K89 A;  3TUY B;  1KSM A;  4I5L B;  2PRU A;  5B8I B;  2KGR A;  3KF9 A;  4WQ2 A;  4JWQ A;  4D1E A;  2JNF A;  1NPQ A;  1CLL A;  5HL1 A;  3BFB A;  2A4J A;  2CBL A;  2OTG C;  1UHJ A;  1EJ3 A;  4M2Q A;  1YUT A;  1IJ6 A;  2NLN A;  1GM0 A;  2L2E A;  3NHI A;  2BBM A;  1UWO A;  2VRG A;  4N1G A;  3UNW A;  1SL9 A;  1V1F A;  1C3Z A;  4CPV A;  4UPG A;  1TNW A;  3B86 A;  1NYA A;  1S6I A;  4CFR A;  1OW4 A;  1KFU S;  2M7N A;  1CMG A;  4GGF A;  1FI6 A;  1F4Q A;  1LS8 A;  1S6C A;  3Q8I A;  3PAT A;  2COL B;  1QLK A;  4ZCV A;  2E30 A;  4PHN A;  1YX8 A;  2EHB A;  3BUW B;  2L5X B;  1Y1U A;  5DKR A;  3K21 A;  3S0B A;  2V53 A;  4GGN A;  1C3Y A;  1MUX A;  4N1F A;  2JT0 A;  5CPV A;  3VRN A;  1L2O B;  3EKH A;  4MRX A;  2KYC A;  3D0Y B;  5JOL A;  2LM5 A;  3EVV A;  4CID A;  3PLF B;  3EG5 B;  1ALW A;  1AVS A;  2JXL A;  4OZD A;  1XK4 A;  2BL0 C;  1B8C A;  2EGD A;  1JF0 A;  1QVI Z;  3WXA A;  3N7H A;  4INW A;  1MR8 A;  2LHL A;  1J7O A;  3R1O A;  4MLW A;  5ER4 X;  1PK0 D;  1DJG A;  3D74 A;  1PSR A;  3KEV A;  1QAS A;  3AAK A;  3OX5 A;  4INX A;  1SW8 A;  1A75 A;  2L4H A;  1RJV A;  3A8R A;  3PFV A;  1L2O C;  4FQT A;  3VRR A;  1BT6 A;  1QTX A;  5PAL A;  2CT9 A;  2KHN A;  3SG6 A;  3HX4 A;  1U5I A;  5AXI A;  4HRG A;  2WCJ A;  4DUQ A;  1H4B A;  3NGV A;  2KI6 C;  1OMV A;  3SJS A;  1W7J B;  3TS5 B;  1OMR A;  1S5G Y;  1PVB A;  4F7F A;  1RRO A;  2P71 A;  2QEO A;  2JXC A;  3LK0 A;  4HRH A;  1BU3 A;  1ZAC A;  1JFJ A;  3B88 A;  2PVB A;  2KNE A;  3L47 A;  1M45 A;  3S0G A;  1W7I B;  4NQG A;  3BQ3 A;  2Y4Q A;  1REC A;  1QJT A;  3D73 A;  1QAT A;  1UHH A;  2LAN A;  4MZJ A;  3SG7 A;  2WC6 A;  3MSE B;  3BOW B;  1R6P A;  3DF0 B;  1B4C A;  4DCK A;  1KK7 Z;  1A03 A;  1F54 A;  2BAP A;  3B87 A;  3AAJ A;  2GTE A;  1J7R A;  4HRE E;  2JNX A;  5J3X A;  2EC6 C;  3D0Y A;  4OV2 A;  1MHO A;  2CCM A;  2WCE A;  4YGE B;  1M39 A;  3NXA A;  2Y1M A;  3PSR A;  5FI7 A;  1XFW O;  1MF8 B;  3CDN A;  5JJG A;  3SG5 A;  3IQO A;  1XFY O;  3R1V A;  4U8D A;  4QJ5 B;  1R2U A;  4I5N B;  4P5O E;  2G2B A;  2L0P A;  5KTY A;  3JVT B;  2M9G A;  2QEH A;  4XJK A;  1W9Z A;  3CZ2 A;  1NCZ A;  2M1U A;  2ZN8 A;  4PE4 A;  1LA0 A;  2MA2 A;  1SMG A;  3SS3 A;  1XYD A;  2K2F A;  1WRL A;  4A4C A;  3I5G B;  2I18 A;  1WY9 A;  1G8I A;  1NP8 A;  4C0L A;  4YRU A;  1CFD A;  2MAZ A;  1OSA A;  1G33 A;  3FIA A;  3CZ1 A;  1WDC B;  4ZCU A;  1S1E A;  1D1O A;  3S0F A;  1TNP A;  1NIW A;  4XYN A;  1K8U A;  5D7F A;  4YGC B;  2F2P A;  2KBI A;  3BFA A;  3BUN B;  1BJF A;  1OOH A;  3DXL A;  4JD9 A;  3WHT B;  1AP4 A;  2BCB A;  2JPT A;  4WQ3 A;  2L98 A;  2K7C A;  1SL8 A;  2RGI A;  4YGD B;  1CKK A;  1F70 A;  1OOG A;  2NCP A;  2WOS A;  2OS8 B;  4ETO A;  1X02 A;  3CZ0 A;  3NHT A;  2JQ6 A;  4DS7 A;  1ALV A;  1MXL C;  2KYF A;  5HLO A;  2K8M B;  4Q04 A;  2QEB A;  1CB1 A;  1WLM A;  1XFX O;  1BMO A;  4XJK B;  1OOF A;  1WDC C;  4CFQ A;  2WCL A;  5FI2 A;  2MJW B;  5AER A;  1A75 B;  2BE6 A;  3NSK A;  2WCK A;  1OMD A;  3LL8 B;  3BUM B;  2WCM A;  3SIA A;  3B7A A;  2P6B B;  1SYM A;  3PN7 B;  2PAL A;  3F45 A;  2WC5 A;  2LP3 A;  2KFH A;  1SRA A;  1KFX S;  3CZT X;  3DF0 A;  1JFK A;  2OS8 C;  2LVJ A;  3VRQ A;  1GQM A;  1CDM A;  5CSN A;  3UO9 A;  4FTG A;  1TWO A;  2SCP A;  2JU0 A;  1C7V A;  1VRK A;  4MBE A;  3CTN A;  1XK4 C;  5CSF A;  1ZMZ A;  2P70 A;  3JVT C;  5I8N A;  2Y1N A;  1RWY A;  3LLE A;  3S0E A;  3EVU A;  2F8P A;  5KU1 A;  4GUK A;  4NDC A;  1DTL A;  1WLZ A;  2KLE A;  5CSJ A;  3VRP A;  3WHU B;  1B1G A;  2QDI A;  1IKU A;  4MVF A;  4KYN A;  1PSB A;  4DIR A;  1UP5 A;  3I5G C;  1XFV O;  4BY4 A;  1CFP A;  2F3Y A;  1CDL A;  4PE7 A;  1QXP A;  3CAB A;  4FQO A;  1K90 D;  3DYE A;  1IRJ A;  1S26 D;  4GNK B;  3O4X A;  1KQM C;  3SS4 A;  3TZ1 A;  1TCO B;  2JTT A;  3CR5 X;  3KHE A;  2MHH A;  1Y1A A;  1NX2 A;  2PSR A;  1QX2 A;  1EXR A;  4IL1 A;  1EL4 A;  1AJ5 A;  3PJI A;  4JQ0 D;  2KDH A;  3VGO A;  2M29 A;  1CFC A;  1EH2 A;  1GGW A;  2LLT A;  1J55 A;  1DJI A;  3IF7 A;  2KAY A;  4ICB A;  3TDZ A;  4DRW A;  2F2O A;  3BUX B;  2ZKM X;  3DVK A;  2JZI A;  2KOT A;  2ZND A;  2CXJ A;  1K96 A;  1N65 A;  1IWQ A;  1B8L A;  1JF2 A;  2E6W A;  2G9B A;  2M49 B;  3O78 A;  4YGA A;  4AOM A;  3OB1 B;  1UUR A;  1SSE B;  5DKQ A;  3SG4 A;  1UUS A;  3KPX A;  2M3W A;  3TDI A;  2NZ0 A;  3ZNI A;  1KWO C;  2KLD A;  1CTR A;  1CNP A;  1QLS A;  4OCI A;  4ORC B;  2KPH A;  1B8R A;  3OGN A;  3PN7 C;  2QPT A;  1C7W A;  4PHJ A;  4OVN F;  1IQ5 A;  1DVI A;  1KSO A;  2JOJ A;  3O4Y A;  1A2X A;  1GJY A;  3CS1 A;  3BJH A;  2DOQ A;  1M46 A;  3LCP C;  2HPS A;  1CLB A;  1YRU B;  4WRI A;  1CDN A;  1KCY A;  2ZFD A;  4F0Z B;  1L7Z A;  2ZRT A;  2H2K A;  1KK7 Y;  1F4O A;  5D69 A;  1P28 A;  5I2L A;  1YUR A;  2LUC A;  1S36 A;  1KWO B;  2KI4 C;  4OKH A;  1LIN A;  3EK7 A;  1JC2 A;  4MRY A;  1Y0V H;  2ZRS A;  1XFR A;  4AQJ A;  3VRO A;  2Q4U A;  2WCB A;  1CM1 A;  2LC5 A;  3GK4 X;  1RTP 1;  3EKJ A;  1EG3 A;  2K60 A;  4YI8 A;  4CLN A;  3QME A;  4PAL A;  2LE9 B;  1FI5 A;  4TNC A;  2AUC A;  2YGU A;  5F6T A;  1A4P A;  1TNQ A;  3GK2 A;  1SR6 B;  1Z4H A;  2JUL A;  2SAS A;  3CYZ A;  2HQW A;  2PYQ A;  1UHI A;  2JTZ A;  1IIO A;  4R1E A;  2H61 C;  2KFF A;  1YRT B;  1SY9 A;  2QAC A;  2M97 A;  2O5G A;  2LMU A;  1Z2C B;  1S3P A;  2BKI B;  1IG5 A;  1KFU L;  1MQ1 A;  2LUX A;  3R1P A;  4QJ3 B;  1DMO A;  4GBA A;  1NUB A;  3I5I C;  1S6J A;  2Q91 A;  4BY5 A;  1LVC D;  3CLN A;  1DEL A;  1YVL A;  1J1E A;  1XVJ A;  1NWD A;  1QIV A;  2LMV A;  2L50 A;  3FE8 A;  2ZNE A;  1SKT A;  1N2D A;  1KK8 C;  2LV7 A;  1DGU A;  1YR5 A;  3B6X A;  3BFH A;  3CR4 X;  3DVE A;  5I2Q A;  2BKH B;  3TUY C;  1QX7 A;  3H4S E;  5FYX A;  3D75 A;  1JWD A;  1EG4 A;  3DVJ A;  5D3O A;  3PM8 A;  2WOR A;  3FS7 A;  1QV0 A;  1TRF A;  4QJ4 B;  1OE9 B;  1J7Q A;  1SCM C;  1C07 A;  3JTD C;  1CMF A;  1IGV A;  3O6B A;  1WRK A;  2LLU A;  3IVT A;  2JT3 A;  2KQY A;  3SG3 A;  5HKY A;  4C0K A;  3EVR A;  3S0A A;  1HQV A;  2MLE C;  3FE6 A; 
#chains in the Genus database with same CATH homology
 5TNC A;  3RLZ A;  4PDZ A;  1BR4 B;  3NSO A;  4MSP A;  4P2Y B;  1SBJ A;  2LMT A;  1YVH A;  2NCO A;  4YBH B;  1DJH A;  4MZK A;  1DJY A;  1YTZ C;  2K7D A;  1V1G A;  1DT7 B;  2KQ6 A;  3AKB A;  2WCF A;  1J1D A;  3FWC A;  3RM1 A;  3GOF A;  1NX3 A;  3OP0 A;  1F71 A;  2CNP A;  1TN4 A;  3LK1 A;  2M8U A;  2BE4 A;  2HQ8 A;  2KFG A;  4JPZ B;  1BOC A;  5AEQ A;  1NCX A;  5AFP A;  5ER5 A;  2AMI A;  3M0W A;  1CFF A;  3DD4 A;  2I2R E;  1K2H A;  2M7L A;  1M31 A;  2LCP A;  1KK8 B;  1JUO A;  3EK4 A;  1TOP A;  5IBW A;  1BOD A;  2MLF C;  1BLQ A;  1AHR A;  1ODB A;  4PE1 A;  4L9M A;  1KQV A;  2I7A A;  2ZN9 A;  3BXK A;  1DF0 A;  1FBV A;  1S5G Z;  1B7T Y;  1NX0 A;  4AQI A;  2EC6 B;  1IJ5 A;  2B1U A;  2MRD A;  2R2I A;  2LVI A;  3BYA A;  1SNL A;  1K9K A;  1XA5 A;  1XO5 A;  1DJZ A;  4PHM A;  1DGV A;  1LKJ A;  3GK1 A;  5DKN A;  3OB2 B;  3KO0 A;  1DJX A;  2HET A;  2WND A;  2BCX A;  2O60 A;  3C1V A;  2K2A A;  4I5K A;  2FJU B;  5KSZ A;  1PRW A;  2FOT A;  2OPO A;  2LP2 A;  2JC2 A;  1JSA A;  1SL7 A;  2F3Z A;  1WRZ A;  1BR1 B;  1KFX L;  1XFU O;  1Q80 A;  2D8N A;  2K7B A;  3CWG A;  3JTD B;  2JWW A;  1TCF A;  5GQQ C;  1FW4 A;  5CSI A;  1B9A A;  2BBN A;  1KQM B;  5AAN A;  5HYD A;  1YX7 A;  1DJW A;  5HKW A;  2ISD A;  1QIW A;  1YUS A;  3SG2 A;  2PMY A;  2KSP A;  1AUI B;  2IS9 A;  2KBM A;  2FCD A;  2KAX A;  2GGZ A;  3IQQ A;  1BG1 A;  1TIZ A;  4YI9 A;  4N5X A;  2NXQ A;  1K95 A;  4PE0 A;  1K9P A;  2BEC A;  4MZL A;  1J7P A;  2M1K B;  1CDP A;  3I5I B;  2MBX A;  3OHM B;  2LAP A;  2K61 A;  3A4U B;  1ZFS A;  5HLV A;  1QVI Y;  1AJ4 A;  1G4Y R;  1SPY A;  4ORA B;  5G08 A;  3SIB A;  3TDU A;  3I5F C;  1AK8 A;  1K93 D;  2LVV A;  3NSL A;  4PCW A;  2LNK A;  1M63 B;  2M0R A;  1Y1X A;  2FCE A;  1F8H A;  2I94 A;  4GFT A;  2AAO A;  2GGM A;  1SCV A;  2KI4 B;  2L51 A;  4M2O A;  1PAL A;  1OZS A;  3ICB A;  1F55 A;  3BOW A;  1PUL A;  4MN0 A;  4OR9 B;  1LA3 A;  3CGA A;  1OZO A;  4MEW A;  1YUU A;  2PAS A;  3D10 A;  2LVK A;  1OOJ A;  2BL0 B;  4E68 A;  2K0J A;  1K94 A;  5HKZ A;  1UHN A;  1N0Y A;  1MWN A;  3HCM A;  3CR2 A;  3NSI A;  2KAV A;  4GAO A;  3DVM A;  1OQP A;  4ORB B;  2L4I A;  1FF1 A;  1DF0 B;  3E3R A;  1K9U A;  1RFJ A;  3FWB A;  1QS7 A;  1E8A A;  1GGZ A;  1QX5 B;  1SCM B;  2HF5 A;  5I2O A;  1QV1 A;  2CTN A;  3QRX A;  3PAL A;  2GV5 A;  4NDB A;  1NX1 A;  1CLM A;  2F33 A;  2LHI A;  1JBA A;  2LLS A;  3OX6 A;  4C0J A;  4HSZ A;  1LXF C;  3O2P A;  1HT9 A;  4GGF C;  1B47 A;  1RK9 A;  4PHK A;  3I5F B;  1B7T Z;  1ZOT B;  1XFZ O;  3I5H C;  5BPJ A;  1ZUZ A;  1TTX A;  2WC8 A;  4NDD A;  1PVA A;  1SR6 C;  4M2P A;  1IQ3 A;  4GPL B;  4USL A;  1Y6W A;  1BF5 A;  1FPW A;  1NSH A;  2OTG B;  2K7O A;  4I5J A;  4YGB B;  1U5I B;  2KGB C;  3BUO B;  1A29 A;  4A4B A;  1H8B A;  2KI6 D;  2Y5I A;  2JT8 A;  1NCY A;  3WNX B;  1MXE A;  1TNX A;  2TN4 A;  3ZWH A;  2H61 A;  3TS5 C;  1IH0 A;  2JRF A;  1CM4 A;  1UHK A;  3EK8 A;  3I5H B;  2BCA A;  1SK6 D;  3AKA A;  5K89 A;  3TUY B;  1KSM A;  4I5L B;  2PRU A;  5B8I B;  2KGR A;  3KF9 A;  4WQ2 A;  4JWQ A;  4D1E A;  2JNF A;  1NPQ A;  1CLL A;  2A4J A;  2CBL A;  2OTG C;  1UHJ A;  1EJ3 A;  4M2Q A;  1YUT A;  1IJ6 A;  2NLN A;  2L2E A;  2BBM A;  1UWO A;  2VRG A;  4N1G A;  1SL9 A;  1V1F A;  4CPV A;  4UPG A;  1TNW A;  1NYA A;  1S6I A;  4CFR A;  1KFU S;  2M7N A;  1CMG A;  4GGF A;  1FI6 A;  1F4Q A;  1S6C A;  3PAT A;  2COL B;  1QLK A;  4ZCV A;  2E30 A;  4PHN A;  1YX8 A;  2EHB A;  3BUW B;  2L5X B;  1Y1U A;  5DKR A;  3K21 A;  2V53 A;  4GGN A;  1MUX A;  4N1F A;  2JT0 A;  5CPV A;  3VRN A;  1L2O B;  3EKH A;  4MRX A;  2KYC A;  3D0Y B;  5JOL A;  2LM5 A;  3EVV A;  4CID A;  3PLF B;  1ALW A;  1AVS A;  2JXL A;  1XK4 A;  2BL0 C;  1B8C A;  2EGD A;  1JF0 A;  1QVI Z;  3WXA A;  1MR8 A;  2LHL A;  5ER4 X;  4MLW A;  1PK0 D;  1DJG A;  3OX5 A;  1PSR A;  3KEV A;  1QAS A;  3AAK A;  1SW8 A;  1A75 A;  2L4H A;  1RJV A;  3A8R A;  3PFV A;  1L2O C;  3VRR A;  1BT6 A;  1QTX A;  5PAL A;  2CT9 A;  2KHN A;  3SG6 A;  3HX4 A;  1U5I A;  5AXI A;  4HRG A;  4DUQ A;  1H4B A;  2KI6 C;  1OMV A;  3SJS A;  1W7J B;  3TS5 B;  1OMR A;  1S5G Y;  1PVB A;  1RRO A;  2JXC A;  3LK0 A;  4HRH A;  1BU3 A;  1ZAC A;  1JFJ A;  2PVB A;  2KNE A;  1M45 A;  1W7I B;  4NQG A;  3BQ3 A;  2Y4Q A;  1REC A;  1QJT A;  1QAT A;  1UHH A;  2LAN A;  4MZJ A;  3SG7 A;  3MSE B;  3BOW B;  1R6P A;  3DF0 B;  1B4C A;  4DCK A;  1KK7 Z;  1A03 A;  1F54 A;  3AAJ A;  1J7R A;  4HRE E;  2JNX A;  5J3X A;  2EC6 C;  3D0Y A;  4OV2 A;  1MHO A;  2CCM A;  2WCE A;  4YGE B;  1M39 A;  3NXA A;  2Y1M A;  3PSR A;  5JJG A;  1XFW O;  1MF8 B;  3SG5 A;  3IQO A;  1XFY O;  4U8D A;  4QJ5 B;  1J7O A;  1R2U A;  4I5N B;  4P5O E;  2G2B A;  2L0P A;  5KTY A;  3JVT B;  2M9G A;  4XJK A;  1NCZ A;  2M1U A;  2ZN8 A;  4PE4 A;  1LA0 A;  2MA2 A;  1SMG A;  1XYD A;  2K2F A;  1WRL A;  4A4C A;  3I5G B;  2I18 A;  1WY9 A;  1G8I A;  1NP8 A;  4C0L A;  4YRU A;  1CFD A;  2MAZ A;  1OSA A;  1G33 A;  3FIA A;  1WDC B;  4ZCU A;  1S1E A;  1D1O A;  1TNP A;  1NIW A;  4XYN A;  1K8U A;  5D7F A;  4YGC B;  2F2P A;  2KBI A;  3BUN B;  1AP4 A;  1BJF A;  3WHT B;  2BCB A;  2JPT A;  4WQ3 A;  2L98 A;  2K7C A;  1SL8 A;  2RGI A;  4YGD B;  1CKK A;  1F70 A;  2NCP A;  2WOS A;  2OS8 B;  4ETO A;  1X02 A;  2JQ6 A;  4DS7 A;  1ALV A;  1MXL C;  2KYF A;  5HLO A;  2K8M B;  4Q04 A;  1CB1 A;  1WLM A;  1XFX O;  1BMO A;  4XJK B;  1WDC C;  4CFQ A;  2MJW B;  5AER A;  1A75 B;  2BE6 A;  3NSK A;  1OMD A;  3LL8 B;  3BUM B;  3SIA A;  3PN7 B;  2P6B B;  1SYM A;  2PAL A;  3F45 A;  2LP3 A;  2KFH A;  1SRA A;  1KFX S;  3CZT X;  3DF0 A;  1JFK A;  2OS8 C;  2LVJ A;  3VRQ A;  1GQM A;  1CDM A;  5CSN A;  4FTG A;  2SCP A;  2JU0 A;  1C7V A;  1VRK A;  4MBE A;  3CTN A;  1XK4 C;  5CSF A;  1ZMZ A;  3JVT C;  5I8N A;  2Y1N A;  1RWY A;  3LLE A;  3EVU A;  2F8P A;  5KU1 A;  4GUK A;  4NDC A;  1DTL A;  1WLZ A;  5CSJ A;  3VRP A;  3WHU B;  1B1G A;  1IKU A;  4MVF A;  1PSB A;  4DIR A;  1UP5 A;  3I5G C;  1XFV O;  4BY4 A;  1CFP A;  2F3Y A;  1CDL A;  4PE7 A;  1QXP A;  4FQO A;  1K90 D;  1IRJ A;  1S26 D;  4GNK B;  1KQM C;  3TZ1 A;  1TCO B;  2JTT A;  3CR5 X;  3KHE A;  2MHH A;  1Y1A A;  1NX2 A;  2PSR A;  1QX2 A;  1EXR A;  4IL1 A;  1EL4 A;  1AJ5 A;  4JQ0 D;  2KDH A;  3VGO A;  2M29 A;  1CFC A;  1EH2 A;  1GGW A;  2LLT A;  1J55 A;  1DJI A;  3IF7 A;  2KAY A;  4ICB A;  3TDZ A;  4DRW A;  2F2O A;  3BUX B;  2ZKM X;  3DVK A;  2JZI A;  2KOT A;  2ZND A;  2CXJ A;  1K96 A;  1N65 A;  1IWQ A;  1B8L A;  1JF2 A;  2E6W A;  2G9B A;  2M49 B;  3O78 A;  4YGA A;  4AOM A;  3OB1 B;  1UUR A;  5DKQ A;  3SG4 A;  1UUS A;  3KPX A;  2M3W A;  3TDI A;  2NZ0 A;  3ZNI A;  1KWO C;  1CTR A;  1CNP A;  1QLS A;  4OCI A;  4ORC B;  1B8R A;  3PN7 C;  2QPT A;  1C7W A;  4PHJ A;  4OVN F;  1IQ5 A;  1DVI A;  1KSO A;  2JOJ A;  3O4Y A;  1A2X A;  1GJY A;  3CS1 A;  2DOQ A;  1M46 A;  3LCP C;  2HPS A;  1CLB A;  1YRU B;  4WRI A;  1CDN A;  1KCY A;  2ZFD A;  4F0Z B;  1L7Z A;  2ZRT A;  2H2K A;  1KK7 Y;  1F4O A;  5D69 A;  5I2L A;  1YUR A;  2LUC A;  1S36 A;  1KWO B;  2KI4 C;  4OKH A;  1LIN A;  3EK7 A;  1JC2 A;  4MRY A;  1Y0V H;  2ZRS A;  4AQJ A;  3VRO A;  2Q4U A;  2WCB A;  1CM1 A;  2LC5 A;  3GK4 X;  1RTP 1;  3EKJ A;  1EG3 A;  4CLN A;  4YI8 A;  4PAL A;  2LE9 B;  1FI5 A;  4TNC A;  2AUC A;  5F6T A;  1A4P A;  1TNQ A;  3GK2 A;  1SR6 B;  2SAS A;  2JUL A;  2HQW A;  1UHI A;  2JTZ A;  4R1E A;  2H61 C;  2KFF A;  1YRT B;  1SY9 A;  2QAC A;  2M97 A;  2O5G A;  2LMU A;  1S3P A;  2BKI B;  1IG5 A;  1KFU L;  1MQ1 A;  2LUX A;  4QJ3 B;  1DMO A;  4GBA A;  1NUB A;  3I5I C;  1S6J A;  2Q91 A;  4BY5 A;  1LVC D;  3CLN A;  1YVL A;  1J1E A;  1XVJ A;  1NWD A;  1QIV A;  2LMV A;  2L50 A;  2ZNE A;  1SKT A;  1N2D A;  1KK8 C;  2LV7 A;  1DGU A;  1YR5 A;  3CR4 X;  3DVE A;  5I2Q A;  3TUY C;  2BKH B;  1QX7 A;  3H4S E;  5FYX A;  1JWD A;  1EG4 A;  3DVJ A;  3PM8 A;  2WOR A;  3FS7 A;  1QV0 A;  1TRF A;  4QJ4 B;  1OE9 B;  1J7Q A;  1SCM C;  1C07 A;  3JTD C;  1CMF A;  1IGV A;  3O6B A;  1WRK A;  2LLU A;  2JT3 A;  2KQY A;  3SG3 A;  5HKY A;  4C0K A;  3EVR A;  1HQV A;  2MLE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...