2M7LA

Alfa-actinin from parasite entamoeba histolytica
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
144
structure length
144
Chain Sequence
GSSSGVTAEQMQEFKQSFDAFDGNHDGILDKLEFRSCLSSMGLIDIDFTGGEDAQYDAIYNNVTKGENGVSFDNYVQYMKEKNDENPSPEQLNEIFSTIAAGKDSITETDMQKAGMSAEQIEYVKANLPQKGDGYDYAAWVKTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calponin homology domain protein, putative
publication title Alfa-actinin from parasite Entamoeba histolytica
rcsb
source organism Entamoeba histolytica
molecule tags Structural protein
total genus 48
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2013-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2m7lA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2m7lA02
1L2OB 3D0YA 4N1GA 1N65A 1CFCA 4OR9B 1J7PA 2WORA 1F4QA 1XFYO 2LC5A 1AJ4A 3VROA 1RTP1 1H4BA 1XK4A 2KSPA 1UWOA 1AUIB 5TNCA 2KGRA 2KGBC 2E6WA 4GBAA 1K90D 2WOSA 1BG1A 1QIWA 1DTLA 1HT9A 3GK2A 4HRHA 4QJ5B 1FI5A 1IJ5A 5K89A 1TNXA 2BCAA 1BR1B 2NLNA 5KU1A 1J7OA 2KHNA 2PALA 4MVFA 1J55A 5I8NA 2LVKA 3BOWA 2JRFA 1IWQA 5BPJA 1YVHA 1NWDA 1L7ZA 1Y1XA 1LXFC 2Y4QA 3FS7A 1IRJA 3FWBA 1NPQA 3EVRA 1XFUO 3O6BA 1B1GA 2MLEC 2M7LA 3EKJA 2KFGA 4GFTA 3KF9A 1C7WA 4AQJA 1BU3A 4I5JA 3I5HC 1TNQA 5I2OA 1CM1A 1M31A 2KI6C 1K93D 3CTNA 3BYAA 2F8PA 1SL9A 3RM1A 2BL0C 1XK4C 2EHBA 1JC2A 1JF0A 1CFDA 1KQVA 5AXIA 1C07A 1H8BA 3I5GC 2LMVA 5AANA 5GQQC 1KK7Z 1KK7Y 2KYFA 1YTZC 2JT8A 4BY5A 3SG6A 1UUSA 2Q4UA 2FCDA 2VRGA 1LA0A 1NCXA 1M46A 2IS9A 3BUMB 1AK8A 2PMYA 4PDZA 2K2AA 1F71A 1PALA 4MZLA 3TDIA 2M3WA 1XVJA 3D0YB 1DJHA 3I5HB 4TNCA 1KWOC 1Q80A 3BQ3A 1CFPA 1CKKA 1JSAA 1CDMA 2JU0A 3DVKA 2L2EA 1CNPA 1GQMA 1K94A 2H2KA 2LVVA 2CNPA 2KI4C 3CR4X 4YGBB 4PCWA 4YGAA 1D1OA 4MBEA 2LLUA 1GJYA 2M0RA 1CMFA 2CBLA 2B1UA 4MRXA 4HREE 1QX2A 3SIAA 3AAKA 1FW4A 3NSKA 2LLTA 1N2DA 2L50A 2JXCA 1FI6A 3VRQA 4ETOA 1K8UA 3EK8A 2MBXA 3OX5A 1X02A 1UURA 1SBJA 1OMRA 1ZOTB 1DGVA 1TRFA 2I18A 3PN7C 1BT6A 1SYMA 1CFFA 1IG5A 2M7NA 1A03A 1C7VA 1EL4A 2L98A 3A8RA 4CLNA 1CM4A 1KFUL 1NX0A 3ICBA 4GNKB 2ZNDA 1NCYA 4QJ3B 1PRWA 1A4PA 4C0KA 3ZNIA 2LCPA 2NXQA 3PALA 3NSLA 2AMIA 3OHMB 2LMTA 2BBNA 1ZUZA 3BXKA 4F0ZB 1PSBA 1R2UA 1F54A 2DOQA 1S3PA 2EC6C 4YI8A 2KBMA 3OB2B 4Q04A 2A4JA 4MEWA 1TTXA 2F3ZA 4GGNA 5IBWA 4DCKA 1M45A 3I5IC 3I5FB 3DF0B 3LK0A 1BR4B 4PE1A 3PN7B 1DT7B 1RFJA 1XO5A 1JFJA 3SG5A 3OX6A 4NDCA 4ORBB 1R6PA 1QVIZ 1QVIY 3HCMA 2K2FA 2AUCA 1TIZA 1RECA 3TUYB 1LINA 5I2LA 1MXEA 4YGCB 1EH2A 1QIVA 3RLZA 1SPYA 3TS5C 2KFFA 2JTZA 1IJ6A 1B8CA 1S5GZ 1S5GY 2COLB 4R1EA 3CR5X 1E8AA 1OZSA 2KAXA 1NX2A 2G2BA 1YRTB 2M49B 1S6IA 1A29A 1KFXL 1J1EA 1QX7A 4PE7A 3WXAA 2ZKMX 5DKNA 1NYAA 2EC6B 5CSFA 2I2RE 4PHNA 5JJGA 2KAVA 4E68A 4YGEB 5KTYA 2OTGC 1JWDA 4OKHA 2JPTA 3LLEA 5HKYA 1JFKA 1WLZA 4DUQA 1KK8C 1MQ1A 2WCBA 1QXPA 4AQIA 1DF0A 1G33A 2K7BA 3TDZA 4ORCB 1NUBA 2JT0A 1DJWA 4YRUA 4C0LA 1ODBA 5DKQA 1TCFA 2I7AA 2LUXA 3CZTX 1J1DA 1CDPA 1XFVO 3PSRA 1K9KA 5HYDA 1BLQA 1ZMZA 2JXLA 2L4HA 2SASA 1V1GA 2JT3A 1U5IB 1M63B 4OVNF 3BUNB 1GGWA 1KFUS 2LLSA 3AKBA 1SR6C 2LANA 1J7RA 1WY9A 2JZIA 1KK8B 1QATA 2M97A 4ZCUA 3OB1B 2KOTA 1WRLA 1JBAA 3BUXB 4BY4A 2NZ0A 2GGMA 4NQGA 2L0PA 1OZOA 2KAYA 4UPGA 4MN0A 1RJVA 3NSIA 3PFVA 3TDUA 2ISDA 3CS1A 1AHRA 2V53A 2MHHA 4PE0A 4JQ0D 4DIRA 1LKJA 4XJKA 5F6TA 1CMGA 1SL8A 4HRGA 1CTRA 1IQ3A 2L5XB 2WC8A 2ZFDA 4NDDA 1QV0A 1G8IA 1NX1A 1QASA 3IQQA 2BL0B 4A4BA 2LP2A 2Y1NA 2KQYA 3WHTB 1RWYA 1YX8A 2M9GA 3HX4A 2AAOA 1IKUA 5D69A 5HKWA 2BBMA 2LNKA 1JUOA 1OE9B 2LMUA 3GK4X 1BODA 4MZJA 1KFXS 1Y1AA 3I5GB 1DVIA 1G4YR 4MSPA 3VRPA 1AJ5A 3SIBA 4WRIA 3NXAA 4NDBA 3WNXB 1SCMC 1WDCC 1DF0B 1OOJA 3DD4A 3BOWB 3MSEB 3NSOA 1BJFA 2SCPA 1GGZA 1NIWA 1YRUB 3A4UB 2LAPA 2GV5A 1YUSA 3JTDC 2LHLA 5ER4X 2CXJA 1KWOB 2JNFA 1XFZO 1UHJA 4FTGA 1YVLA 1SY9A 2KI4B 2OS8C 5HLVA 1QLKA 1S1EA 4CFRA 1MHOA 1M39A 4CIDA 2MA2A 1NCZA 3DVJA 2JOJA 3F45A 2LVIA 5PALA 1MWNA 4AOMA 1CLLA 1ALWA 5B8IB 2G9BA 3JVTC 3WHUB 1EG3A 1QLSA 1WRZA 1SCMB 2CT9A 2JNXA 1CLBA 1K9PA 1XYDA 1UHIA 4M2PA 1EXRA 3TZ1A 3SG4A 2JC2A 5AFPA 1PVBA 1FBVA 1ALVA 1NX3A 3PM8A 2KQ6A 1KQMC 2PVBA 4MLWA 2LE9B 3EK7A 1BOCA 3KHEA 2ZRTA 3GOFA 4OCIA 1QS7A 1L2OC 3BUWB 1SNLA 1YURA 1QJTA 3QRXA 4CPVA 4USLA 1SW8A 1F8HA 1BMOA 1J7QA 1LA3A 4GAOA 1K96A 2BKHB 2KDHA 2WNDA 3O78A 2BCBA 3E3RA 1DGUA 2NCPA 4ZCVA 5JOLA 3I5IB 2K7DA 2FOTA 2O60A 2PRUA 1FPWA 3GK1A 3VGOA 2K61A 4PHMA 5CSNA 1S6JA 2WCFA 2QPTA 2MLFC 4C0JA 2ZNEA 1IQ5A 2LUCA 1XA5A 1JF2A 3EVUA 2LM5A 4P5OE 5CSJA 3TS5B 1XFXO 2BECA 2PASA 1SKTA 4D1EA 3SG2A 1F70A 2LV7A 1Y6WA 2M1KB 4N1FA 2F3YA 2HPSA 1B9AA 5G08A 2MAZA 3LK1A 4M2OA 1UP5A 1F4OA 1RROA 4GGFA 2OPOA 4ORAB 1SK6D 1IGVA 4L9MA 3ZWHA 2MRDA 1NP8A 2OTGB 1A75A 1MXLC 4IL1A 4JPZB 4WQ2A 1OMVA 2K7CA 3AAJA 4XYNA 1CDNA 2ZN9A 5CSIA 2KI6D 5HLOA 2LVJA 1W7JB 1AVSA 2HETA 4FQOA 1PK0D 4WQ3A 2KNEA 2L4IA 3KEVA 3O2PA 3KPXA 1MF8B 1TOPA 1EJ3A 3DVEA 3EKHA 4HSZA 3KO0A 5KSZA 4GUKA 2EGDA 1Y1UA 1A2XA 2BCXA 1SCVA 3LCPC 2RGIA 4YGDB 3IF7A 1OQPA 3IQOA 1UHKA 2FJUB 1SMGA 2BE4A 2FCEA 3FWCA 4JWQA 2KFHA 2NCOA 3C1VA 3CR2A 1B8RA 1XFWO 2D8NA 2M29A 1OSAA 1ZFSA 2K7OA 1OMDA 5J3XA 2Q91A 2I94A 4M2QA 2ZN8A 2M8UA 1UHNA 1NSHA 1YUTA 1SR6B 2F2PA 1DJYA 2L51A 4GPLB 5AEQA 1KSOA 1DJIA 1SRAA 2WCEA 4DS7A 1TNPA 2KYCA 3LL8B 4GGFC 1S36A 1WLMA 1K95A 2P6BB 1QX5B 2H61A 5DKRA 2Y1MA 3DF0A 4U8DA 3EVVA 1KSMA 1DMOA 1LVCD 1MUXA 1KCYA 2LHIA 1AP4A 2PSRA 2Y5IA 3D10A 3VRNA 2O5GA 4YI9A 2JQ6A 3OP0A 5I2QA 1YX7A 2M1UA 4QJ4B 1B47A 2GGZA 1F55A 2ZRSA 1B4CA 2F2OA 1ZACA 1DJXA 1PVAA 2LP3A 1PSRA 1Y0VH 1DJGA 1EG4A 1WRKA 3K21A 2QACA 4MRYA 1QV1A 4CFQA 3O4YA 3SG3A 1K2HA 1RK9A 4YBHB 1PULA 2HQ8A 1A75B 4PHJA 5HKZA 1YR5A 1TCOB 4I5KA 4I5NB 1UHHA 3DVMA 3CGAA 3H4SE 4ICBA 1DJZA 3AKAA 1B7TZ 1B7TY 1WDCB 2JTTA 1N0YA 2H61C 3I5FC 3FIAA 1HQVA 5CPVA 3JTDB 3SJSA 3TUYC 4N5XA 4I5LB 2JULA 5FYXA 1VRKA 2OS8B 3PATA 3PLFB 2CTNA 2HQWA 1CLMA 5D7FA 2MJWB 4XJKB 1U5IA 1TN4A 1YUUA 2BKIB 1S26D 3M0WA 2KBIA 4PE4A 4A4CA 2BE6A 1SL7A 1CDLA 2HF5A 4PHKA 2F33A 2JWWA 5ER5A 3JVTB 2TN4A 2K8MB 4PALA 1FF1A 3CLNA 3VRRA 2CCMA 1QTXA 3CWGA 4OV2A 1BF5A 1TNWA 1S6CA 1V1FA 3EK4A 4DRWA 5AERA 1MR8A 1B8LA 1K9UA 1IH0A 1KQMB 3BUOB 4P2YB 1CB1A 2E30A 3SG7A 2K0JA 2R2IA 1W7IB 4MZKA
chains in the Genus database with same CATH superfamily
1L2OB 3D0YA 3NHTA 1N65A 4N1GA 1CFCA 4OR9B 1J7PA 2WORA 1F4QA 1XFYO 2LC5A 1AJ4A 3VROA 1RTP1 1H4BA 1XK4A 2KSPA 1UWOA 1AUIB 3OBVA 5TNCA 2KGRA 2KGBC 2E6WA 4GBAA 1K90D 2WOSA 3K1EA 1BG1A 1QIWA 1DTLA 1HT9A 2K60A 3CZ0A 3GK2A 4HRHA 4QJ5B 1FI5A 4PT1A 1IJ5A 5K89A 1TNXA 2BCAA 1BR1B 2NLNA 5KU1A 4INXA 2KHNA 2PALA 1J7OA 4MVFA 1J55A 5I8NA 2LVKA 3FE6A 3BOWA 2L5YA 2JRFA 1IWQA 5BPJA 3IVTA 1YVHA 1NWDA 3CDNA 1L7ZA 1OOHA 1Y1XA 1LXFC 2Y4QA 3B86A 1IRJA 3FS7A 3FWBA 1ORGA 1NPQA 3EVRA 1XFUO 2JPOA 3O6BA 2MLEC 2M7LA 1B1GA 3EKJA 2KFGA 4GFTA 3KF9A 1C7WA 4AQJA 1BU3A 4I5JA 5I94A 3I5HC 1TNQA 5I2OA 1CM1A 1M31A 2KI6C 1K93D 3CTNA 3BYAA 2F8PA 1SL9A 3RM1A 2BL0C 5FI7A 1XK4C 2EHBA 1JC2A 1JF0A 3L47A 1CFDA 1KQVA 3BFAA 5AXIA 1C07A 1H8BA 2P70A 3I5GC 2LMVA 5AANA 5DICA 5GQQC 1KK7Z 1KK7Y 2KYFA 3R72A 1YTZC 2JT8A 2WCLA 4BY5A 3SG6A 2YGUA 1UUSA 2Q4UA 2FCDA 2VRGA 1LA0A 1NCXA 1M46A 2IS9A 3BUMB 1AK8A 2PMYA 4PDZA 2K2AA 1F71A 1PALA 4MZLA 2QEHA 3TDIA 2M3WA 1XVJA 3D0YB 1DJHA 3I5HB 4TNCA 1KWOC 1Q80A 3BQ3A 1CFPA 1CKKA 1JSAA 1CDMA 2JU0A 3DVKA 2L2EA 1CNPA 1GQMA 1K94A 2H2KA 2LVVA 1DC1A 2CNPA 2KI4C 3CR4X 4YGBB 4PCWA 4YGAA 2WCHA 4MBEA 1D1OA 3DYEA 2LLUA 1GJYA 2M0RA 1CMFA 2CBLA 2B1UA 3FE9A 4MRXA 4HREE 1QX2A 3SIAA 3AAKA 1FW4A 2QDIA 1XFRA 3NSKA 2LLTA 1N2DA 2KPHA 2L50A 2JXCA 3D77A 1FI6A 3VRQA 4ETOA 2WCJA 1K8UA 3EK8A 2MBXA 3OX5A 1X02A 1UURA 1SBJA 1OMRA 1ZOTB 1DGVA 1TRFA 2I18A 3PN7C 1BT6A 1SYMA 1CFFA 1IG5A 2M7NA 1A03A 1C7VA 1EL4A 2L98A 3A8RA 4CLNA 1CM4A 1KFUL 1NX0A 3ICBA 4GNKB 2ZNDA 1NCYA 4QJ3B 1PRWA 1A4PA 2L2CA 4C0KA 3ZNIA 2LCPA 2NXQA 3PALA 3NSLA 2AMIA 3OHMB 2LMTA 2BBNA 1ZUZA 3BXKA 4F0ZB 1PSBA 1R2UA 1F54A 2DOQA 1S3PA 3R1PA 2EC6C 4YI8A 2KBMA 3OB2B 4Q04A 2A4JA 3PJIA 4MEWA 1TTXA 2F3ZA 4GGNA 3B6XA 5IBWA 2WCMA 4DCKA 1M45A 3I5IC 3I5FB 3DF0B 3LK0A 1BR4B 4PE1A 3PN7B 1DT7B 1RFJA 1XO5A 1JFJA 3SG5A 3S0AA 3OX6A 4NDCA 4ORBB 1R6PA 1QVIZ 1QVIY 1QWVA 3HCMA 2K2FA 2AUCA 1TIZA 1RECA 3TUYB 1LINA 5I2LA 1MXEA 4YGCB 1EH2A 1QIVA 3RLZA 1SPYA 3TS5C 2KFFA 2JTZA 1IJ6A 1B8CA 1S5GZ 1S5GY 2COLB 4R1EA 3CR5X 1E8AA 1OZSA 2KAXA 1NX2A 2G2BA 1YRTB 2M49B 1S6IA 1A29A 1KFXL 1J1EA 1QX7A 4PE7A 3WXAA 2ZKMX 5DKNA 1NYAA 2EC6B 5CSFA 2I2RE 4KYNA 4PHNA 5JJGA 2KAVA 4E68A 2QEVA 1TUJA 4YGEB 1GM0A 5KTYA 2OTGC 1LS8A 1JWDA 4OKHA 2JPTA 3LLEA 5HKYA 1JFKA 1WLZA 4DUQA 1KK8C 1MQ1A 2WCBA 3S0FA 1QXPA 3D76A 4INWA 4AQIA 1DF0A 1G33A 2K7BA 3TDZA 4ORCB 1NUBA 2JT0A 1DJWA 3SS4A 4YRUA 4C0LA 1ODBA 1DELA 3N7HA 5DKQA 1TCFA 2I7AA 3UO9A 3L4LA 2LUXA 3CZTX 1J1DA 1CDPA 1XFVO 3PSRA 1K9KA 5HYDA 1BLQA 1W9ZA 1ZMZA 2JXLA 2L4HA 2SASA 1V1GA 2JT3A 1U5IB 1M63B 4OVNF 3BUNB 1GGWA 2WC5A 1KFUS 2LLSA 1C3ZA 3AKBA 1SR6C 2LANA 1C3YA 1J7RA 1WY9A 2JZIA 3B7AA 1KK8B 1QATA 1T14A 2M97A 4ZCUA 3OB1B 3B87A 2KOTA 4MZKA 1WRLA 1JBAA 3BUXB 4BY4A 2NZ0A 2GGMA 4NQGA 2L0PA 1OZOA 2KAYA 4UPGA 4MN0A 4OZDA 1RJVA 3NSIA 3PFVA 3TDUA 3NHIA 2ISDA 3CS1A 1AHRA 2V53A 2MHHA 2WCKA 4PE0A 4JQ0D 5D3OA 4DIRA 1DEKA 1LKJA 4XJKA 5F6TA 1CMGA 1SL8A 4HRGA 1CTRA 1IQ3A 2L5XB 2WC6A 2WC8A 2ZFDA 4NDDA 1QV0A 1G8IA 1NX1A 1QASA 3IQQA 2BL0B 1Z4HA 4A4BA 2LP2A 1OOIX 2Y1NA 2KQYA 3WHTB 1RWYA 1YX8A 2BNXA 2M9GA 2AAOA 3HX4A 1IKUA 5D69A 5HKWA 1TUZA 2BBMA 2LNKA 1JUOA 1OE9B 2LMUA 3GK4X 1BODA 4MZJA 1KFXS 1Y1AA 3I5GB 1DVIA 1G4YR 4MSPA 3VRPA 1AJ5A 3SIBA 4F7FA 3R1VA 4WRIA 3NXAA 4NDBA 2H8VA 3PM2A 3D78A 3WNXB 1SCMC 1WDCC 1DF0B 1OOJA 3DD4A 3BOWB 3MSEB 3NSOA 1BJFA 2SCPA 1GGZA 1NIWA 1YRUB 3A4UB 2LAPA 2GV5A 1YUSA 3JTDC 2LHLA 5ER4X 2CXJA 1KWOB 2JNFA 1XFZO 1UHJA 4FTGA 1YVLA 1SY9A 3OGNA 2KI4B 2OS8C 5HLVA 1QLKA 1S1EA 1Z2CB 1MHOA 4CFRA 1M39A 4CIDA 2MA2A 1NCZA 3DY9A 3DVJA 2JOJA 3F45A 2LVIA 5PALA 1MWNA 4AOMA 1CLLA 1ALWA 5B8IB 1OOFA 2G9BA 3JVTC 3WHUB 1EG3A 1QLSA 1WRZA 1SCMB 2CT9A 2JNXA 1CLBA 1K9PA 1XYDA 1UHIA 4M2PA 1EXRA 3DXLA 3TZ1A 3RZSA 3SG4A 2JC2A 5AFPA 1PVBA 1FBVA 1ALVA 1NX3A 3PM8A 2KQ6A 1KQMC 2PVBA 3S0GA 4MLWA 2PYQA 2KLEA 2LE9B 3EK7A 1BOCA 3KHEA 2ZRTA 3GOFA 2QEBA 4OCIA 1QS7A 1L2OC 3BUWB 1SNLA 1YURA 1QJTA 3QRXA 4JD9A 4CPVA 4USLA 1SW8A 1F8HA 1BMOA 4IJ7A 1J7QA 3Q8IA 1LA3A 4GAOA 1K96A 2BKHB 2KDHA 2WNDA 3O78A 2BCBA 3E3RA 1DGUA 2NCPA 4ZCVA 5JOLA 3I5IB 2K7DA 2FOTA 2O60A 2PRUA 1FPWA 3GK1A 3VGOA 2K61A 4PHMA 3CABA 5CSNA 1S6JA 2WCFA 2QPTA 2QEOA 2MLFC 4C0JA 5HL1A 2ZNEA 1IQ5A 2LUCA 1XA5A 1JF2A 3EVUA 2LM5A 4P5OE 5CSJA 3TS5B 1XFXO 1SSEB 2BECA 2PASA 3S0BA 1SKTA 4D1EA 3SG2A 1F70A 2LV7A 1Y6WA 2M1KB 4N1FA 2F3YA 2HPSA 3SS5A 1B9AA 5G08A 2MAZA 3LK1A 4M2OA 1UP5A 1F4OA 1RROA 4GGFA 2OPOA 4ORAB 1SK6D 1IGVA 2BAPA 2KLDA 2MRDA 1NP8A 2OTGB 4L9MA 3ZWHA 1A75A 1MXLC 4IL1A 4JPZB 4WQ2A 1OMVA 2K7CA 3AAJA 4XYNA 1CDNA 2ZN9A 5CSIA 2KI6D 5HLOA 2LVJA 1W7JB 1AVSA 2HETA 3FE8A 3NGVA 4FQOA 1PK0D 4WQ3A 2KNEA 4JKTA 2L4IA 3KEVA 3EG5B 3O2PA 3KPXA 1MF8B 1TOPA 1EJ3A 3DVEA 3EKHA 4HSZA 1OOGA 3KO0A 5KSZA 4GUKA 1P28A 2EGDA 1Y1UA 1A2XA 2BCXA 1SCVA 3CYZA 3LCPC 2RGIA 4YGDB 5FI6A 5EL2A 3IF7A 1OQPA 3IQOA 1UHKA 2ERBA 1SMGA 2BE4A 2FCEA 2FJUB 3FWCA 4JWQA 2KFHA 2NCOA 3C1VA 3CR2A 1B8RA 1XFWO 2D8NA 2M29A 1OSAA 1ZFSA 3S0EA 2K7OA 1OMDA 5J3XA 2Q91A 3D73A 2I94A 4M2QA 2ZN8A 2M8UA 1UHNA 1NSHA 1YUTA 1SR6B 2F2PA 4FQTA 3B88A 1DJYA 2L51A 3QMEA 4GPLB 1KSOA 1DJIA 1SRAA 2WCEA 5AEQA 4DS7A 1TNPA 1IIOA 2KYCA 3LL8B 4GGFC 1S36A 1WLMA 1K95A 2P6BB 1QX5B 2H61A 5DKRA 2Y1MA 3DF0A 2FJYA 4U8DA 3EVVA 1KSMA 1DMOA 1LVCD 1MUXA 1KCYA 2LHIA 1AP4A 1DQEA 2PSRA 2Y5IA 3D10A 3VRNA 2O5GA 4YI9A 2JQ6A 3SS3A 3D75A 3OP0A 5I2QA 1YX7A 2M1UA 4QJ4B 1B47A 2GGZA 1F55A 2ZRSA 1B4CA 2F2OA 1ZACA 1DJXA 1PVAA 2LP3A 2PQLA 3UNWA 1PSRA 1Y0VH 1DJGA 1EG4A 1WRKA 3K21A 2QACA 4MRYA 1QV1A 4CFQA 3O4YA 3BJHA 3CZ1A 3SG3A 1K2HA 1RK9A 4YBHB 1PULA 2HQ8A 1A75B 2GTEA 3VB1A 4PHJA 5HKZA 1YR5A 1TCOB 4I5KA 4I5NB 3R1OA 1UHHA 3BFHA 3DVMA 3CGAA 3H4SE 4ICBA 1DJZA 3AKAA 5FI2A 1B7TZ 1B7TY 1WDCB 2JTTA 1N0YA 2H61C 3I5FC 3CZ2A 3FIAA 1HQVA 5CPVA 1TWOA 3JTDB 3SJSA 3TUYC 4N5XA 4I5LB 2JULA 5FYXA 1VRKA 2OS8B 3PATA 3PLFB 2CTNA 2HQWA 1CLMA 2P71A 5D7FA 2MJWB 4XJKB 1U5IA 1TN4A 1YUUA 2BKIB 1S26D 3M0WA 2KBIA 4PE4A 3V2LA 4A4CA 2BE6A 1SL7A 3O4XA 1CDLA 1OW4A 2HF5A 4PHKA 2F33A 2JWWA 5ER5A 3JVTB 2TN4A 3D74A 2K8MB 4PALA 3BFBA 1FF1A 3CLNA 3VRRA 2CCMA 1QTXA 3CWGA 4OV2A 1BF5A 1TNWA 1S6CA 1V1FA 3S0DA 3EK4A 4DRWA 5AERA 1MR8A 1B8LA 1K9UA 1IH0A 1KQMB 3BUOB 4P2YB 1CB1A 2E30A 3SG7A 2K0JA 3L4AA 2R2IA 1W7IB 3DZTA
chains in the Genus database with same CATH topology
1L2OB 3D0YA 4N1GA 1N65A 1CFCA 4OR9B 1J7PA 2WORA 1F4QA 1XFYO 2LC5A 1AJ4A 3VROA 1RTP1 1H4BA 1XK4A 2KSPA 1UWOA 1AUIB 5TNCA 2KGRA 2KGBC 2E6WA 4GBAA 1K90D 2WOSA 1BG1A 1QIWA 1DTLA 1HT9A 3GK2A 4HRHA 4QJ5B 1FI5A 1IJ5A 5K89A 1TNXA 2BCAA 1BR1B 2NLNA 5KU1A 1J7OA 2KHNA 2PALA 4MVFA 1J55A 5I8NA 2LVKA 3BOWA 2JRFA 1IWQA 5BPJA 1YVHA 1NWDA 1L7ZA 1Y1XA 1LXFC 2Y4QA 3FS7A 1IRJA 3FWBA 1NPQA 3EVRA 1XFUO 3O6BA 1B1GA 2MLEC 2M7LA 3EKJA 2KFGA 4GFTA 3KF9A 1C7WA 4AQJA 1BU3A 4I5JA 3I5HC 1TNQA 5I2OA 1CM1A 1M31A 2KI6C 1K93D 3CTNA 3BYAA 2F8PA 1SL9A 3RM1A 2BL0C 1XK4C 2EHBA 1JC2A 1JF0A 1CFDA 1KQVA 5AXIA 1C07A 1H8BA 3I5GC 2LMVA 5AANA 5GQQC 1KK7Z 1KK7Y 2KYFA 1YTZC 2JT8A 4BY5A 3SG6A 1UUSA 2Q4UA 2FCDA 2VRGA 1LA0A 1NCXA 1M46A 2IS9A 3BUMB 1AK8A 2PMYA 4PDZA 2K2AA 1F71A 1PALA 4MZLA 3TDIA 2M3WA 1XVJA 3D0YB 1DJHA 3I5HB 4TNCA 1KWOC 1Q80A 3BQ3A 1CFPA 1CKKA 1JSAA 1CDMA 2JU0A 3DVKA 2L2EA 1CNPA 1GQMA 1K94A 2H2KA 2LVVA 2CNPA 2KI4C 3CR4X 4YGBB 4PCWA 4YGAA 1D1OA 4MBEA 2LLUA 1GJYA 2M0RA 1CMFA 2CBLA 2B1UA 4MRXA 4HREE 1QX2A 3SIAA 3AAKA 1FW4A 3NSKA 2LLTA 1N2DA 2L50A 2JXCA 1FI6A 3VRQA 4ETOA 1K8UA 3EK8A 2MBXA 3OX5A 1X02A 1UURA 1SBJA 1OMRA 1ZOTB 1DGVA 1TRFA 2I18A 3PN7C 1BT6A 1SYMA 1CFFA 1IG5A 2M7NA 1A03A 1C7VA 1EL4A 2L98A 3A8RA 4CLNA 1CM4A 1KFUL 1NX0A 3ICBA 4GNKB 2ZNDA 1NCYA 4QJ3B 1PRWA 1A4PA 4C0KA 3ZNIA 2LCPA 2NXQA 3PALA 3NSLA 2AMIA 3OHMB 2LMTA 2BBNA 1ZUZA 3BXKA 4F0ZB 1PSBA 1R2UA 1F54A 2DOQA 1S3PA 2EC6C 4YI8A 2KBMA 3OB2B 4Q04A 2A4JA 4MEWA 1TTXA 2F3ZA 4GGNA 5IBWA 4DCKA 1M45A 3I5IC 3I5FB 3DF0B 3LK0A 1BR4B 4PE1A 3PN7B 1DT7B 1RFJA 1XO5A 1JFJA 3SG5A 3OX6A 4NDCA 4ORBB 1R6PA 1QVIZ 1QVIY 3HCMA 2K2FA 2AUCA 1TIZA 1RECA 3TUYB 1LINA 5I2LA 1MXEA 4YGCB 1EH2A 1QIVA 3RLZA 1SPYA 3TS5C 2KFFA 2JTZA 1IJ6A 1B8CA 1S5GZ 1S5GY 2COLB 4R1EA 3CR5X 1E8AA 1OZSA 2KAXA 1NX2A 2G2BA 1YRTB 2M49B 1S6IA 1A29A 1KFXL 1J1EA 1QX7A 4PE7A 3WXAA 2ZKMX 5DKNA 1NYAA 2EC6B 5CSFA 2I2RE 4PHNA 5JJGA 2KAVA 4E68A 4YGEB 5KTYA 2OTGC 1JWDA 4OKHA 2JPTA 3LLEA 5HKYA 1JFKA 1WLZA 4DUQA 1KK8C 1MQ1A 2WCBA 1QXPA 4AQIA 1DF0A 1G33A 2K7BA 3TDZA 4ORCB 1NUBA 2JT0A 1DJWA 4YRUA 4C0LA 1ODBA 5DKQA 1TCFA 2I7AA 2LUXA 3CZTX 1J1DA 1CDPA 1XFVO 3PSRA 1K9KA 5HYDA 1BLQA 1ZMZA 2JXLA 2L4HA 2SASA 1V1GA 2JT3A 1U5IB 1M63B 4OVNF 3BUNB 1GGWA 1KFUS 2LLSA 3AKBA 1SR6C 2LANA 1J7RA 1WY9A 2JZIA 1KK8B 1QATA 2M97A 4ZCUA 3OB1B 2KOTA 1WRLA 1JBAA 3BUXB 4BY4A 2NZ0A 2GGMA 4NQGA 2L0PA 1OZOA 2KAYA 4UPGA 4MN0A 1RJVA 3NSIA 3PFVA 3TDUA 2ISDA 3CS1A 1AHRA 2V53A 2MHHA 4PE0A 4JQ0D 4DIRA 1LKJA 4XJKA 5F6TA 1CMGA 1SL8A 4HRGA 1CTRA 1IQ3A 2L5XB 2WC8A 2ZFDA 4NDDA 1QV0A 1G8IA 1NX1A 1QASA 3IQQA 2BL0B 4A4BA 2LP2A 2Y1NA 2KQYA 3WHTB 1RWYA 1YX8A 2M9GA 3HX4A 2AAOA 1IKUA 5D69A 5HKWA 2BBMA 2LNKA 1JUOA 1OE9B 2LMUA 3GK4X 1BODA 4MZJA 1KFXS 1Y1AA 3I5GB 1DVIA 1G4YR 4MSPA 3VRPA 1AJ5A 3SIBA 4WRIA 3NXAA 4NDBA 3WNXB 1SCMC 1WDCC 1DF0B 1OOJA 3DD4A 3BOWB 3MSEB 3NSOA 1BJFA 2SCPA 1GGZA 1NIWA 1YRUB 3A4UB 2LAPA 2GV5A 1YUSA 3JTDC 2LHLA 5ER4X 2CXJA 1KWOB 2JNFA 1XFZO 1UHJA 4FTGA 1YVLA 1SY9A 2KI4B 2OS8C 5HLVA 1QLKA 1S1EA 4CFRA 1MHOA 1M39A 4CIDA 2MA2A 1NCZA 3DVJA 2JOJA 3F45A 2LVIA 5PALA 1MWNA 4AOMA 1CLLA 1ALWA 5B8IB 2G9BA 3JVTC 3WHUB 1EG3A 1QLSA 1WRZA 1SCMB 2CT9A 2JNXA 1CLBA 1K9PA 1XYDA 1UHIA 4M2PA 1EXRA 3TZ1A 3SG4A 2JC2A 5AFPA 1PVBA 1FBVA 1ALVA 1NX3A 3PM8A 2KQ6A 1KQMC 2PVBA 4MLWA 2LE9B 3EK7A 1BOCA 3KHEA 2ZRTA 3GOFA 4OCIA 1QS7A 1L2OC 3BUWB 1SNLA 1YURA 1QJTA 3QRXA 4CPVA 4USLA 1SW8A 1F8HA 1BMOA 1J7QA 1LA3A 4GAOA 1K96A 2BKHB 2KDHA 2WNDA 3O78A 2BCBA 3E3RA 1DGUA 2NCPA 4ZCVA 5JOLA 3I5IB 2K7DA 2FOTA 2O60A 2PRUA 1FPWA 3GK1A 3VGOA 2K61A 4PHMA 5CSNA 1S6JA 2WCFA 2QPTA 2MLFC 4C0JA 2ZNEA 1IQ5A 2LUCA 1XA5A 1JF2A 3EVUA 2LM5A 4P5OE 5CSJA 3TS5B 1XFXO 2BECA 2PASA 1SKTA 4D1EA 3SG2A 1F70A 2LV7A 1Y6WA 2M1KB 4N1FA 2F3YA 2HPSA 1B9AA 5G08A 2MAZA 3LK1A 4M2OA 1UP5A 1F4OA 1RROA 4GGFA 2OPOA 4ORAB 1SK6D 1IGVA 4L9MA 3ZWHA 2MRDA 1NP8A 2OTGB 1A75A 1MXLC 4IL1A 4JPZB 4WQ2A 1OMVA 2K7CA 3AAJA 4XYNA 1CDNA 2ZN9A 5CSIA 2KI6D 5HLOA 2LVJA 1W7JB 1AVSA 2HETA 4FQOA 1PK0D 4WQ3A 2KNEA 2L4IA 3KEVA 3O2PA 3KPXA 1MF8B 1TOPA 1EJ3A 3DVEA 3EKHA 4HSZA 3KO0A 5KSZA 4GUKA 2EGDA 1Y1UA 1A2XA 2BCXA 1SCVA 3LCPC 2RGIA 4YGDB 3IF7A 1OQPA 3IQOA 1UHKA 2FJUB 1SMGA 2BE4A 2FCEA 3FWCA 4JWQA 2KFHA 2NCOA 3C1VA 3CR2A 1B8RA 1XFWO 2D8NA 2M29A 1OSAA 1ZFSA 2K7OA 1OMDA 5J3XA 2Q91A 2I94A 4M2QA 2ZN8A 2M8UA 1UHNA 1NSHA 1YUTA 1SR6B 2F2PA 1DJYA 2L51A 4GPLB 5AEQA 1KSOA 1DJIA 1SRAA 2WCEA 4DS7A 1TNPA 2KYCA 3LL8B 4GGFC 1S36A 1WLMA 1K95A 2P6BB 1QX5B 2H61A 5DKRA 2Y1MA 3DF0A 4U8DA 3EVVA 1KSMA 1DMOA 1LVCD 1MUXA 1KCYA 2LHIA 1AP4A 2PSRA 2Y5IA 3D10A 3VRNA 2O5GA 4YI9A 2JQ6A 3OP0A 5I2QA 1YX7A 2M1UA 4QJ4B 1B47A 2GGZA 1F55A 2ZRSA 1B4CA 2F2OA 1ZACA 1DJXA 1PVAA 2LP3A 1PSRA 1Y0VH 1DJGA 1EG4A 1WRKA 3K21A 2QACA 4MRYA 1QV1A 4CFQA 3O4YA 3SG3A 1K2HA 1RK9A 4YBHB 1PULA 2HQ8A 1A75B 4PHJA 5HKZA 1YR5A 1TCOB 4I5KA 4I5NB 1UHHA 3DVMA 3CGAA 3H4SE 4ICBA 1DJZA 3AKAA 1B7TZ 1B7TY 1WDCB 2JTTA 1N0YA 2H61C 3I5FC 3FIAA 1HQVA 5CPVA 3JTDB 3SJSA 3TUYC 4N5XA 4I5LB 2JULA 5FYXA 1VRKA 2OS8B 3PATA 3PLFB 2CTNA 2HQWA 1CLMA 5D7FA 2MJWB 4XJKB 1U5IA 1TN4A 1YUUA 2BKIB 1S26D 3M0WA 2KBIA 4PE4A 4A4CA 2BE6A 1SL7A 1CDLA 2HF5A 4PHKA 2F33A 2JWWA 5ER5A 3JVTB 2TN4A 2K8MB 4PALA 1FF1A 3CLNA 3VRRA 2CCMA 1QTXA 3CWGA 4OV2A 1BF5A 1TNWA 1S6CA 1V1FA 3EK4A 4DRWA 5AERA 1MR8A 1B8LA 1K9UA 1IH0A 1KQMB 3BUOB 4P2YB 1CB1A 2E30A 3SG7A 2K0JA 2R2IA 1W7IB 4MZKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L2O B;  3D0Y A;  4N1G A;  1N65 A;  1CFC A;  4OR9 B;  1J7P A;  2WOR A;  1F4Q A;  1XFY O;  2LC5 A;  1AJ4 A;  3VRO A;  1RTP 1;  1H4B A;  1XK4 A;  2KSP A;  1UWO A;  1AUI B;  5TNC A;  2KGR A;  2KGB C;  2E6W A;  4GBA A;  1K90 D;  2WOS A;  1BG1 A;  1QIW A;  1DTL A;  1HT9 A;  3GK2 A;  4HRH A;  4QJ5 B;  1FI5 A;  1IJ5 A;  5K89 A;  1TNX A;  2BCA A;  1BR1 B;  2NLN A;  5KU1 A;  1J7O A;  2KHN A;  2PAL A;  4MVF A;  1J55 A;  5I8N A;  2LVK A;  3BOW A;  2JRF A;  1IWQ A;  5BPJ A;  1YVH A;  1NWD A;  1L7Z A;  1Y1X A;  1LXF C;  2Y4Q A;  3FS7 A;  1IRJ A;  3FWB A;  1NPQ A;  3EVR A;  1XFU O;  3O6B A;  1B1G A;  2MLE C;  2M7L A;  3EKJ A;  2KFG A;  4GFT A;  3KF9 A;  1C7W A;  4AQJ A;  1BU3 A;  4I5J A;  3I5H C;  1TNQ A;  5I2O A;  1CM1 A;  1M31 A;  2KI6 C;  1K93 D;  3CTN A;  3BYA A;  2F8P A;  1SL9 A;  3RM1 A;  2BL0 C;  1XK4 C;  2EHB A;  1JC2 A;  1JF0 A;  1CFD A;  1KQV A;  5AXI A;  1C07 A;  1H8B A;  3I5G C;  2LMV A;  5AAN A;  5GQQ C;  1KK7 Z;  1KK7 Y;  2KYF A;  1YTZ C;  2JT8 A;  4BY5 A;  3SG6 A;  1UUS A;  2Q4U A;  2FCD A;  2VRG A;  1LA0 A;  1NCX A;  1M46 A;  2IS9 A;  3BUM B;  1AK8 A;  2PMY A;  4PDZ A;  2K2A A;  1F71 A;  1PAL A;  4MZL A;  3TDI A;  2M3W A;  1XVJ A;  3D0Y B;  1DJH A;  3I5H B;  4TNC A;  1KWO C;  1Q80 A;  3BQ3 A;  1CFP A;  1CKK A;  1JSA A;  1CDM A;  2JU0 A;  3DVK A;  2L2E A;  1CNP A;  1GQM A;  1K94 A;  2H2K A;  2LVV A;  2CNP A;  2KI4 C;  3CR4 X;  4YGB B;  4PCW A;  4YGA A;  1D1O A;  4MBE A;  2LLU A;  1GJY A;  2M0R A;  1CMF A;  2CBL A;  2B1U A;  4MRX A;  4HRE E;  1QX2 A;  3SIA A;  3AAK A;  1FW4 A;  3NSK A;  2LLT A;  1N2D A;  2L50 A;  2JXC A;  1FI6 A;  3VRQ A;  4ETO A;  1K8U A;  3EK8 A;  2MBX A;  3OX5 A;  1X02 A;  1UUR A;  1SBJ A;  1OMR A;  1ZOT B;  1DGV A;  1TRF A;  2I18 A;  3PN7 C;  1BT6 A;  1SYM A;  1CFF A;  1IG5 A;  2M7N A;  1A03 A;  1C7V A;  1EL4 A;  2L98 A;  3A8R A;  4CLN A;  1CM4 A;  1KFU L;  1NX0 A;  3ICB A;  4GNK B;  2ZND A;  1NCY A;  4QJ3 B;  1PRW A;  1A4P A;  4C0K A;  3ZNI A;  2LCP A;  2NXQ A;  3PAL A;  3NSL A;  2AMI A;  3OHM B;  2LMT A;  2BBN A;  1ZUZ A;  3BXK A;  4F0Z B;  1PSB A;  1R2U A;  1F54 A;  2DOQ A;  1S3P A;  2EC6 C;  4YI8 A;  2KBM A;  3OB2 B;  4Q04 A;  2A4J A;  4MEW A;  1TTX A;  2F3Z A;  4GGN A;  5IBW A;  4DCK A;  1M45 A;  3I5I C;  3I5F B;  3DF0 B;  3LK0 A;  1BR4 B;  4PE1 A;  3PN7 B;  1DT7 B;  1RFJ A;  1XO5 A;  1JFJ A;  3SG5 A;  3OX6 A;  4NDC A;  4ORB B;  1R6P A;  1QVI Z;  1QVI Y;  3HCM A;  2K2F A;  2AUC A;  1TIZ A;  1REC A;  3TUY B;  1LIN A;  5I2L A;  1MXE A;  4YGC B;  1EH2 A;  1QIV A;  3RLZ A;  1SPY A;  3TS5 C;  2KFF A;  2JTZ A;  1IJ6 A;  1B8C A;  1S5G Z;  1S5G Y;  2COL B;  4R1E A;  3CR5 X;  1E8A A;  1OZS A;  2KAX A;  1NX2 A;  2G2B A;  1YRT B;  2M49 B;  1S6I A;  1A29 A;  1KFX L;  1J1E A;  1QX7 A;  4PE7 A;  3WXA A;  2ZKM X;  5DKN A;  1NYA A;  2EC6 B;  5CSF A;  2I2R E;  4PHN A;  5JJG A;  2KAV A;  4E68 A;  4YGE B;  5KTY A;  2OTG C;  1JWD A;  4OKH A;  2JPT A;  3LLE A;  5HKY A;  1JFK A;  1WLZ A;  4DUQ A;  1KK8 C;  1MQ1 A;  2WCB A;  1QXP A;  4AQI A;  1DF0 A;  1G33 A;  2K7B A;  3TDZ A;  4ORC B;  1NUB A;  2JT0 A;  1DJW A;  4YRU A;  4C0L A;  1ODB A;  5DKQ A;  1TCF A;  2I7A A;  2LUX A;  3CZT X;  1J1D A;  1CDP A;  1XFV O;  3PSR A;  1K9K A;  5HYD A;  1BLQ A;  1ZMZ A;  2JXL A;  2L4H A;  2SAS A;  1V1G A;  2JT3 A;  1U5I B;  1M63 B;  4OVN F;  3BUN B;  1GGW A;  1KFU S;  2LLS A;  3AKB A;  1SR6 C;  2LAN A;  1J7R A;  1WY9 A;  2JZI A;  1KK8 B;  1QAT A;  2M97 A;  4ZCU A;  3OB1 B;  2KOT A;  1WRL A;  1JBA A;  3BUX B;  4BY4 A;  2NZ0 A;  2GGM A;  4NQG A;  2L0P A;  1OZO A;  2KAY A;  4UPG A;  4MN0 A;  1RJV A;  3NSI A;  3PFV A;  3TDU A;  2ISD A;  3CS1 A;  1AHR A;  2V53 A;  2MHH A;  4PE0 A;  4JQ0 D;  4DIR A;  1LKJ A;  4XJK A;  5F6T A;  1CMG A;  1SL8 A;  4HRG A;  1CTR A;  1IQ3 A;  2L5X B;  2WC8 A;  2ZFD A;  4NDD A;  1QV0 A;  1G8I A;  1NX1 A;  1QAS A;  3IQQ A;  2BL0 B;  4A4B A;  2LP2 A;  2Y1N A;  2KQY A;  3WHT B;  1RWY A;  1YX8 A;  2M9G A;  3HX4 A;  2AAO A;  1IKU A;  5D69 A;  5HKW A;  2BBM A;  2LNK A;  1JUO A;  1OE9 B;  2LMU A;  3GK4 X;  1BOD A;  4MZJ A;  1KFX S;  1Y1A A;  3I5G B;  1DVI A;  1G4Y R;  4MSP A;  3VRP A;  1AJ5 A;  3SIB A;  4WRI A;  3NXA A;  4NDB A;  3WNX B;  1SCM C;  1WDC C;  1DF0 B;  1OOJ A;  3DD4 A;  3BOW B;  3MSE B;  3NSO A;  1BJF A;  2SCP A;  1GGZ A;  1NIW A;  1YRU B;  3A4U B;  2LAP A;  2GV5 A;  1YUS A;  3JTD C;  2LHL A;  5ER4 X;  2CXJ A;  1KWO B;  2JNF A;  1XFZ O;  1UHJ A;  4FTG A;  1YVL A;  1SY9 A;  2KI4 B;  2OS8 C;  5HLV A;  1QLK A;  1S1E A;  4CFR A;  1MHO A;  1M39 A;  4CID A;  2MA2 A;  1NCZ A;  3DVJ A;  2JOJ A;  3F45 A;  2LVI A;  5PAL A;  1MWN A;  4AOM A;  1CLL A;  1ALW A;  5B8I B;  2G9B A;  3JVT C;  3WHU B;  1EG3 A;  1QLS A;  1WRZ A;  1SCM B;  2CT9 A;  2JNX A;  1CLB A;  1K9P A;  1XYD A;  1UHI A;  4M2P A;  1EXR A;  3TZ1 A;  3SG4 A;  2JC2 A;  5AFP A;  1PVB A;  1FBV A;  1ALV A;  1NX3 A;  3PM8 A;  2KQ6 A;  1KQM C;  2PVB A;  4MLW A;  2LE9 B;  3EK7 A;  1BOC A;  3KHE A;  2ZRT A;  3GOF A;  4OCI A;  1QS7 A;  1L2O C;  3BUW B;  1SNL A;  1YUR A;  1QJT A;  3QRX A;  4CPV A;  4USL A;  1SW8 A;  1F8H A;  1BMO A;  1J7Q A;  1LA3 A;  4GAO A;  1K96 A;  2BKH B;  2KDH A;  2WND A;  3O78 A;  2BCB A;  3E3R A;  1DGU A;  2NCP A;  4ZCV A;  5JOL A;  3I5I B;  2K7D A;  2FOT A;  2O60 A;  2PRU A;  1FPW A;  3GK1 A;  3VGO A;  2K61 A;  4PHM A;  5CSN A;  1S6J A;  2WCF A;  2QPT A;  2MLF C;  4C0J A;  2ZNE A;  1IQ5 A;  2LUC A;  1XA5 A;  1JF2 A;  3EVU A;  2LM5 A;  4P5O E;  5CSJ A;  3TS5 B;  1XFX O;  2BEC A;  2PAS A;  1SKT A;  4D1E A;  3SG2 A;  1F70 A;  2LV7 A;  1Y6W A;  2M1K B;  4N1F A;  2F3Y A;  2HPS A;  1B9A A;  5G08 A;  2MAZ A;  3LK1 A;  4M2O A;  1UP5 A;  1F4O A;  1RRO A;  4GGF A;  2OPO A;  4ORA B;  1SK6 D;  1IGV A;  4L9M A;  3ZWH A;  2MRD A;  1NP8 A;  2OTG B;  1A75 A;  1MXL C;  4IL1 A;  4JPZ B;  4WQ2 A;  1OMV A;  2K7C A;  3AAJ A;  4XYN A;  1CDN A;  2ZN9 A;  5CSI A;  2KI6 D;  5HLO A;  2LVJ A;  1W7J B;  1AVS A;  2HET A;  4FQO A;  1PK0 D;  4WQ3 A;  2KNE A;  2L4I A;  3KEV A;  3O2P A;  3KPX A;  1MF8 B;  1TOP A;  1EJ3 A;  3DVE A;  3EKH A;  4HSZ A;  3KO0 A;  5KSZ A;  4GUK A;  2EGD A;  1Y1U A;  1A2X A;  2BCX A;  1SCV A;  3LCP C;  2RGI A;  4YGD B;  3IF7 A;  1OQP A;  3IQO A;  1UHK A;  2FJU B;  1SMG A;  2BE4 A;  2FCE A;  3FWC A;  4JWQ A;  2KFH A;  2NCO A;  3C1V A;  3CR2 A;  1B8R A;  1XFW O;  2D8N A;  2M29 A;  1OSA A;  1ZFS A;  2K7O A;  1OMD A;  5J3X A;  2Q91 A;  2I94 A;  4M2Q A;  2ZN8 A;  2M8U A;  1UHN A;  1NSH A;  1YUT A;  1SR6 B;  2F2P A;  1DJY A;  2L51 A;  4GPL B;  5AEQ A;  1KSO A;  1DJI A;  1SRA A;  2WCE A;  4DS7 A;  1TNP A;  2KYC A;  3LL8 B;  4GGF C;  1S36 A;  1WLM A;  1K95 A;  2P6B B;  1QX5 B;  2H61 A;  5DKR A;  2Y1M A;  3DF0 A;  4U8D A;  3EVV A;  1KSM A;  1DMO A;  1LVC D;  1MUX A;  1KCY A;  2LHI A;  1AP4 A;  2PSR A;  2Y5I A;  3D10 A;  3VRN A;  2O5G A;  4YI9 A;  2JQ6 A;  3OP0 A;  5I2Q A;  1YX7 A;  2M1U A;  4QJ4 B;  1B47 A;  2GGZ A;  1F55 A;  2ZRS A;  1B4C A;  2F2O A;  1ZAC A;  1DJX A;  1PVA A;  2LP3 A;  1PSR A;  1Y0V H;  1DJG A;  1EG4 A;  1WRK A;  3K21 A;  2QAC A;  4MRY A;  1QV1 A;  4CFQ A;  3O4Y A;  3SG3 A;  1K2H A;  1RK9 A;  4YBH B;  1PUL A;  2HQ8 A;  1A75 B;  4PHJ A;  5HKZ A;  1YR5 A;  1TCO B;  4I5K A;  4I5N B;  1UHH A;  3DVM A;  3CGA A;  3H4S E;  4ICB A;  1DJZ A;  3AKA A;  1B7T Z;  1B7T Y;  1WDC B;  2JTT A;  1N0Y A;  2H61 C;  3I5F C;  3FIA A;  1HQV A;  5CPV A;  3JTD B;  3SJS A;  3TUY C;  4N5X A;  4I5L B;  2JUL A;  5FYX A;  1VRK A;  2OS8 B;  3PAT A;  3PLF B;  2CTN A;  2HQW A;  1CLM A;  5D7F A;  2MJW B;  4XJK B;  1U5I A;  1TN4 A;  1YUU A;  2BKI B;  1S26 D;  3M0W A;  2KBI A;  4PE4 A;  4A4C A;  2BE6 A;  1SL7 A;  1CDL A;  2HF5 A;  4PHK A;  2F33 A;  2JWW A;  5ER5 A;  3JVT B;  2TN4 A;  2K8M B;  4PAL A;  1FF1 A;  3CLN A;  3VRR A;  2CCM A;  1QTX A;  3CWG A;  4OV2 A;  1BF5 A;  1TNW A;  1S6C A;  1V1F A;  3EK4 A;  4DRW A;  5AER A;  1MR8 A;  1B8L A;  1K9U A;  1IH0 A;  1KQM B;  3BUO B;  4P2Y B;  1CB1 A;  2E30 A;  3SG7 A;  2K0J A;  2R2I A;  1W7I B;  4MZK A; 
#chains in the Genus database with same CATH topology
 1L2O B;  3D0Y A;  3NHT A;  1N65 A;  4N1G A;  1CFC A;  4OR9 B;  1J7P A;  2WOR A;  1F4Q A;  1XFY O;  2LC5 A;  1AJ4 A;  3VRO A;  1RTP 1;  1H4B A;  1XK4 A;  2KSP A;  1UWO A;  1AUI B;  3OBV A;  5TNC A;  2KGR A;  2KGB C;  2E6W A;  4GBA A;  1K90 D;  2WOS A;  3K1E A;  1BG1 A;  1QIW A;  1DTL A;  1HT9 A;  2K60 A;  3CZ0 A;  3GK2 A;  4HRH A;  4QJ5 B;  1FI5 A;  4PT1 A;  1IJ5 A;  5K89 A;  1TNX A;  2BCA A;  1BR1 B;  2NLN A;  5KU1 A;  4INX A;  2KHN A;  2PAL A;  1J7O A;  4MVF A;  1J55 A;  5I8N A;  2LVK A;  3FE6 A;  3BOW A;  2L5Y A;  2JRF A;  1IWQ A;  5BPJ A;  3IVT A;  1YVH A;  1NWD A;  3CDN A;  1L7Z A;  1OOH A;  1Y1X A;  1LXF C;  2Y4Q A;  3B86 A;  1IRJ A;  3FS7 A;  3FWB A;  1ORG A;  1NPQ A;  3EVR A;  1XFU O;  2JPO A;  3O6B A;  2MLE C;  2M7L A;  1B1G A;  3EKJ A;  2KFG A;  4GFT A;  3KF9 A;  1C7W A;  4AQJ A;  1BU3 A;  4I5J A;  5I94 A;  3I5H C;  1TNQ A;  5I2O A;  1CM1 A;  1M31 A;  2KI6 C;  1K93 D;  3CTN A;  3BYA A;  2F8P A;  1SL9 A;  3RM1 A;  2BL0 C;  5FI7 A;  1XK4 C;  2EHB A;  1JC2 A;  1JF0 A;  3L47 A;  1CFD A;  1KQV A;  3BFA A;  5AXI A;  1C07 A;  1H8B A;  2P70 A;  3I5G C;  2LMV A;  5AAN A;  5DIC A;  5GQQ C;  1KK7 Z;  1KK7 Y;  2KYF A;  3R72 A;  1YTZ C;  2JT8 A;  2WCL A;  4BY5 A;  3SG6 A;  2YGU A;  1UUS A;  2Q4U A;  2FCD A;  2VRG A;  1LA0 A;  1NCX A;  1M46 A;  2IS9 A;  3BUM B;  1AK8 A;  2PMY A;  4PDZ A;  2K2A A;  1F71 A;  1PAL A;  4MZL A;  2QEH A;  3TDI A;  2M3W A;  1XVJ A;  3D0Y B;  1DJH A;  3I5H B;  4TNC A;  1KWO C;  1Q80 A;  3BQ3 A;  1CFP A;  1CKK A;  1JSA A;  1CDM A;  2JU0 A;  3DVK A;  2L2E A;  1CNP A;  1GQM A;  1K94 A;  2H2K A;  2LVV A;  1DC1 A;  2CNP A;  2KI4 C;  3CR4 X;  4YGB B;  4PCW A;  4YGA A;  2WCH A;  4MBE A;  1D1O A;  3DYE A;  2LLU A;  1GJY A;  2M0R A;  1CMF A;  2CBL A;  2B1U A;  3FE9 A;  4MRX A;  4HRE E;  1QX2 A;  3SIA A;  3AAK A;  1FW4 A;  2QDI A;  1XFR A;  3NSK A;  2LLT A;  1N2D A;  2KPH A;  2L50 A;  2JXC A;  3D77 A;  1FI6 A;  3VRQ A;  4ETO A;  2WCJ A;  1K8U A;  3EK8 A;  2MBX A;  3OX5 A;  1X02 A;  1UUR A;  1SBJ A;  1OMR A;  1ZOT B;  1DGV A;  1TRF A;  2I18 A;  3PN7 C;  1BT6 A;  1SYM A;  1CFF A;  1IG5 A;  2M7N A;  1A03 A;  1C7V A;  1EL4 A;  2L98 A;  3A8R A;  4CLN A;  1CM4 A;  1KFU L;  1NX0 A;  3ICB A;  4GNK B;  2ZND A;  1NCY A;  4QJ3 B;  1PRW A;  1A4P A;  2L2C A;  4C0K A;  3ZNI A;  2LCP A;  2NXQ A;  3PAL A;  3NSL A;  2AMI A;  3OHM B;  2LMT A;  2BBN A;  1ZUZ A;  3BXK A;  4F0Z B;  1PSB A;  1R2U A;  1F54 A;  2DOQ A;  1S3P A;  3R1P A;  2EC6 C;  4YI8 A;  2KBM A;  3OB2 B;  4Q04 A;  2A4J A;  3PJI A;  4MEW A;  1TTX A;  2F3Z A;  4GGN A;  3B6X A;  5IBW A;  2WCM A;  4DCK A;  1M45 A;  3I5I C;  3I5F B;  3DF0 B;  3LK0 A;  1BR4 B;  4PE1 A;  3PN7 B;  1DT7 B;  1RFJ A;  1XO5 A;  1JFJ A;  3SG5 A;  3S0A A;  3OX6 A;  4NDC A;  4ORB B;  1R6P A;  1QVI Z;  1QVI Y;  1QWV A;  3HCM A;  2K2F A;  2AUC A;  1TIZ A;  1REC A;  3TUY B;  1LIN A;  5I2L A;  1MXE A;  4YGC B;  1EH2 A;  1QIV A;  3RLZ A;  1SPY A;  3TS5 C;  2KFF A;  2JTZ A;  1IJ6 A;  1B8C A;  1S5G Z;  1S5G Y;  2COL B;  4R1E A;  3CR5 X;  1E8A A;  1OZS A;  2KAX A;  1NX2 A;  2G2B A;  1YRT B;  2M49 B;  1S6I A;  1A29 A;  1KFX L;  1J1E A;  1QX7 A;  4PE7 A;  3WXA A;  2ZKM X;  5DKN A;  1NYA A;  2EC6 B;  5CSF A;  2I2R E;  4KYN A;  4PHN A;  5JJG A;  2KAV A;  4E68 A;  2QEV A;  1TUJ A;  4YGE B;  1GM0 A;  5KTY A;  2OTG C;  1LS8 A;  1JWD A;  4OKH A;  2JPT A;  3LLE A;  5HKY A;  1JFK A;  1WLZ A;  4DUQ A;  1KK8 C;  1MQ1 A;  2WCB A;  3S0F A;  1QXP A;  3D76 A;  4INW A;  4AQI A;  1DF0 A;  1G33 A;  2K7B A;  3TDZ A;  4ORC B;  1NUB A;  2JT0 A;  1DJW A;  3SS4 A;  4YRU A;  4C0L A;  1ODB A;  1DEL A;  3N7H A;  5DKQ A;  1TCF A;  2I7A A;  3UO9 A;  3L4L A;  2LUX A;  3CZT X;  1J1D A;  1CDP A;  1XFV O;  3PSR A;  1K9K A;  5HYD A;  1BLQ A;  1W9Z A;  1ZMZ A;  2JXL A;  2L4H A;  2SAS A;  1V1G A;  2JT3 A;  1U5I B;  1M63 B;  4OVN F;  3BUN B;  1GGW A;  2WC5 A;  1KFU S;  2LLS A;  1C3Z A;  3AKB A;  1SR6 C;  2LAN A;  1C3Y A;  1J7R A;  1WY9 A;  2JZI A;  3B7A A;  1KK8 B;  1QAT A;  1T14 A;  2M97 A;  4ZCU A;  3OB1 B;  3B87 A;  2KOT A;  4MZK A;  1WRL A;  1JBA A;  3BUX B;  4BY4 A;  2NZ0 A;  2GGM A;  4NQG A;  2L0P A;  1OZO A;  2KAY A;  4UPG A;  4MN0 A;  4OZD A;  1RJV A;  3NSI A;  3PFV A;  3TDU A;  3NHI A;  2ISD A;  3CS1 A;  1AHR A;  2V53 A;  2MHH A;  2WCK A;  4PE0 A;  4JQ0 D;  5D3O A;  4DIR A;  1DEK A;  1LKJ A;  4XJK A;  5F6T A;  1CMG A;  1SL8 A;  4HRG A;  1CTR A;  1IQ3 A;  2L5X B;  2WC6 A;  2WC8 A;  2ZFD A;  4NDD A;  1QV0 A;  1G8I A;  1NX1 A;  1QAS A;  3IQQ A;  2BL0 B;  1Z4H A;  4A4B A;  2LP2 A;  1OOI X;  2Y1N A;  2KQY A;  3WHT B;  1RWY A;  1YX8 A;  2BNX A;  2M9G A;  2AAO A;  3HX4 A;  1IKU A;  5D69 A;  5HKW A;  1TUZ A;  2BBM A;  2LNK A;  1JUO A;  1OE9 B;  2LMU A;  3GK4 X;  1BOD A;  4MZJ A;  1KFX S;  1Y1A A;  3I5G B;  1DVI A;  1G4Y R;  4MSP A;  3VRP A;  1AJ5 A;  3SIB A;  4F7F A;  3R1V A;  4WRI A;  3NXA A;  4NDB A;  2H8V A;  3PM2 A;  3D78 A;  3WNX B;  1SCM C;  1WDC C;  1DF0 B;  1OOJ A;  3DD4 A;  3BOW B;  3MSE B;  3NSO A;  1BJF A;  2SCP A;  1GGZ A;  1NIW A;  1YRU B;  3A4U B;  2LAP A;  2GV5 A;  1YUS A;  3JTD C;  2LHL A;  5ER4 X;  2CXJ A;  1KWO B;  2JNF A;  1XFZ O;  1UHJ A;  4FTG A;  1YVL A;  1SY9 A;  3OGN A;  2KI4 B;  2OS8 C;  5HLV A;  1QLK A;  1S1E A;  1Z2C B;  1MHO A;  4CFR A;  1M39 A;  4CID A;  2MA2 A;  1NCZ A;  3DY9 A;  3DVJ A;  2JOJ A;  3F45 A;  2LVI A;  5PAL A;  1MWN A;  4AOM A;  1CLL A;  1ALW A;  5B8I B;  1OOF A;  2G9B A;  3JVT C;  3WHU B;  1EG3 A;  1QLS A;  1WRZ A;  1SCM B;  2CT9 A;  2JNX A;  1CLB A;  1K9P A;  1XYD A;  1UHI A;  4M2P A;  1EXR A;  3DXL A;  3TZ1 A;  3RZS A;  3SG4 A;  2JC2 A;  5AFP A;  1PVB A;  1FBV A;  1ALV A;  1NX3 A;  3PM8 A;  2KQ6 A;  1KQM C;  2PVB A;  3S0G A;  4MLW A;  2PYQ A;  2KLE A;  2LE9 B;  3EK7 A;  1BOC A;  3KHE A;  2ZRT A;  3GOF A;  2QEB A;  4OCI A;  1QS7 A;  1L2O C;  3BUW B;  1SNL A;  1YUR A;  1QJT A;  3QRX A;  4JD9 A;  4CPV A;  4USL A;  1SW8 A;  1F8H A;  1BMO A;  4IJ7 A;  1J7Q A;  3Q8I A;  1LA3 A;  4GAO A;  1K96 A;  2BKH B;  2KDH A;  2WND A;  3O78 A;  2BCB A;  3E3R A;  1DGU A;  2NCP A;  4ZCV A;  5JOL A;  3I5I B;  2K7D A;  2FOT A;  2O60 A;  2PRU A;  1FPW A;  3GK1 A;  3VGO A;  2K61 A;  4PHM A;  3CAB A;  5CSN A;  1S6J A;  2WCF A;  2QPT A;  2QEO A;  2MLF C;  4C0J A;  5HL1 A;  2ZNE A;  1IQ5 A;  2LUC A;  1XA5 A;  1JF2 A;  3EVU A;  2LM5 A;  4P5O E;  5CSJ A;  3TS5 B;  1XFX O;  1SSE B;  2BEC A;  2PAS A;  3S0B A;  1SKT A;  4D1E A;  3SG2 A;  1F70 A;  2LV7 A;  1Y6W A;  2M1K B;  4N1F A;  2F3Y A;  2HPS A;  3SS5 A;  1B9A A;  5G08 A;  2MAZ A;  3LK1 A;  4M2O A;  1UP5 A;  1F4O A;  1RRO A;  4GGF A;  2OPO A;  4ORA B;  1SK6 D;  1IGV A;  2BAP A;  2KLD A;  2MRD A;  1NP8 A;  2OTG B;  4L9M A;  3ZWH A;  1A75 A;  1MXL C;  4IL1 A;  4JPZ B;  4WQ2 A;  1OMV A;  2K7C A;  3AAJ A;  4XYN A;  1CDN A;  2ZN9 A;  5CSI A;  2KI6 D;  5HLO A;  2LVJ A;  1W7J B;  1AVS A;  2HET A;  3FE8 A;  3NGV A;  4FQO A;  1PK0 D;  4WQ3 A;  2KNE A;  4JKT A;  2L4I A;  3KEV A;  3EG5 B;  3O2P A;  3KPX A;  1MF8 B;  1TOP A;  1EJ3 A;  3DVE A;  3EKH A;  4HSZ A;  1OOG A;  3KO0 A;  5KSZ A;  4GUK A;  1P28 A;  2EGD A;  1Y1U A;  1A2X A;  2BCX A;  1SCV A;  3CYZ A;  3LCP C;  2RGI A;  4YGD B;  5FI6 A;  5EL2 A;  3IF7 A;  1OQP A;  3IQO A;  1UHK A;  2ERB A;  1SMG A;  2BE4 A;  2FCE A;  2FJU B;  3FWC A;  4JWQ A;  2KFH A;  2NCO A;  3C1V A;  3CR2 A;  1B8R A;  1XFW O;  2D8N A;  2M29 A;  1OSA A;  1ZFS A;  3S0E A;  2K7O A;  1OMD A;  5J3X A;  2Q91 A;  3D73 A;  2I94 A;  4M2Q A;  2ZN8 A;  2M8U A;  1UHN A;  1NSH A;  1YUT A;  1SR6 B;  2F2P A;  4FQT A;  3B88 A;  1DJY A;  2L51 A;  3QME A;  4GPL B;  1KSO A;  1DJI A;  1SRA A;  2WCE A;  5AEQ A;  4DS7 A;  1TNP A;  1IIO A;  2KYC A;  3LL8 B;  4GGF C;  1S36 A;  1WLM A;  1K95 A;  2P6B B;  1QX5 B;  2H61 A;  5DKR A;  2Y1M A;  3DF0 A;  2FJY A;  4U8D A;  3EVV A;  1KSM A;  1DMO A;  1LVC D;  1MUX A;  1KCY A;  2LHI A;  1AP4 A;  1DQE A;  2PSR A;  2Y5I A;  3D10 A;  3VRN A;  2O5G A;  4YI9 A;  2JQ6 A;  3SS3 A;  3D75 A;  3OP0 A;  5I2Q A;  1YX7 A;  2M1U A;  4QJ4 B;  1B47 A;  2GGZ A;  1F55 A;  2ZRS A;  1B4C A;  2F2O A;  1ZAC A;  1DJX A;  1PVA A;  2LP3 A;  2PQL A;  3UNW A;  1PSR A;  1Y0V H;  1DJG A;  1EG4 A;  1WRK A;  3K21 A;  2QAC A;  4MRY A;  1QV1 A;  4CFQ A;  3O4Y A;  3BJH A;  3CZ1 A;  3SG3 A;  1K2H A;  1RK9 A;  4YBH B;  1PUL A;  2HQ8 A;  1A75 B;  2GTE A;  3VB1 A;  4PHJ A;  5HKZ A;  1YR5 A;  1TCO B;  4I5K A;  4I5N B;  3R1O A;  1UHH A;  3BFH A;  3DVM A;  3CGA A;  3H4S E;  4ICB A;  1DJZ A;  3AKA A;  5FI2 A;  1B7T Z;  1B7T Y;  1WDC B;  2JTT A;  1N0Y A;  2H61 C;  3I5F C;  3CZ2 A;  3FIA A;  1HQV A;  5CPV A;  1TWO A;  3JTD B;  3SJS A;  3TUY C;  4N5X A;  4I5L B;  2JUL A;  5FYX A;  1VRK A;  2OS8 B;  3PAT A;  3PLF B;  2CTN A;  2HQW A;  1CLM A;  2P71 A;  5D7F A;  2MJW B;  4XJK B;  1U5I A;  1TN4 A;  1YUU A;  2BKI B;  1S26 D;  3M0W A;  2KBI A;  4PE4 A;  3V2L A;  4A4C A;  2BE6 A;  1SL7 A;  3O4X A;  1CDL A;  1OW4 A;  2HF5 A;  4PHK A;  2F33 A;  2JWW A;  5ER5 A;  3JVT B;  2TN4 A;  3D74 A;  2K8M B;  4PAL A;  3BFB A;  1FF1 A;  3CLN A;  3VRR A;  2CCM A;  1QTX A;  3CWG A;  4OV2 A;  1BF5 A;  1TNW A;  1S6C A;  1V1F A;  3S0D A;  3EK4 A;  4DRW A;  5AER A;  1MR8 A;  1B8L A;  1K9U A;  1IH0 A;  1KQM B;  3BUO B;  4P2Y B;  1CB1 A;  2E30 A;  3SG7 A;  2K0J A;  3L4A A;  2R2I A;  1W7I B;  3DZT A; 
#chains in the Genus database with same CATH homology
 1L2O B;  3D0Y A;  4N1G A;  1N65 A;  1CFC A;  4OR9 B;  1J7P A;  2WOR A;  1F4Q A;  1XFY O;  2LC5 A;  1AJ4 A;  3VRO A;  1RTP 1;  1H4B A;  1XK4 A;  2KSP A;  1UWO A;  1AUI B;  5TNC A;  2KGR A;  2KGB C;  2E6W A;  4GBA A;  1K90 D;  2WOS A;  1BG1 A;  1QIW A;  1DTL A;  1HT9 A;  3GK2 A;  4HRH A;  4QJ5 B;  1FI5 A;  1IJ5 A;  5K89 A;  1TNX A;  2BCA A;  1BR1 B;  2NLN A;  5KU1 A;  1J7O A;  2KHN A;  2PAL A;  4MVF A;  1J55 A;  5I8N A;  2LVK A;  3BOW A;  2JRF A;  1IWQ A;  5BPJ A;  1YVH A;  1NWD A;  1L7Z A;  1Y1X A;  1LXF C;  2Y4Q A;  3FS7 A;  1IRJ A;  3FWB A;  1NPQ A;  3EVR A;  1XFU O;  3O6B A;  1B1G A;  2MLE C;  2M7L A;  3EKJ A;  2KFG A;  4GFT A;  3KF9 A;  1C7W A;  4AQJ A;  1BU3 A;  4I5J A;  3I5H C;  1TNQ A;  5I2O A;  1CM1 A;  1M31 A;  2KI6 C;  1K93 D;  3CTN A;  3BYA A;  2F8P A;  1SL9 A;  3RM1 A;  2BL0 C;  1XK4 C;  2EHB A;  1JC2 A;  1JF0 A;  1CFD A;  1KQV A;  5AXI A;  1C07 A;  1H8B A;  3I5G C;  2LMV A;  5AAN A;  5GQQ C;  1KK7 Z;  1KK7 Y;  2KYF A;  1YTZ C;  2JT8 A;  4BY5 A;  3SG6 A;  1UUS A;  2Q4U A;  2FCD A;  2VRG A;  1LA0 A;  1NCX A;  1M46 A;  2IS9 A;  3BUM B;  1AK8 A;  2PMY A;  4PDZ A;  2K2A A;  1F71 A;  1PAL A;  4MZL A;  3TDI A;  2M3W A;  1XVJ A;  3D0Y B;  1DJH A;  3I5H B;  4TNC A;  1KWO C;  1Q80 A;  3BQ3 A;  1CFP A;  1CKK A;  1JSA A;  1CDM A;  2JU0 A;  3DVK A;  2L2E A;  1CNP A;  1GQM A;  1K94 A;  2H2K A;  2LVV A;  2CNP A;  2KI4 C;  3CR4 X;  4YGB B;  4PCW A;  4YGA A;  1D1O A;  4MBE A;  2LLU A;  1GJY A;  2M0R A;  1CMF A;  2CBL A;  2B1U A;  4MRX A;  4HRE E;  1QX2 A;  3SIA A;  3AAK A;  1FW4 A;  3NSK A;  2LLT A;  1N2D A;  2L50 A;  2JXC A;  1FI6 A;  3VRQ A;  4ETO A;  1K8U A;  3EK8 A;  2MBX A;  3OX5 A;  1X02 A;  1UUR A;  1SBJ A;  1OMR A;  1ZOT B;  1DGV A;  1TRF A;  2I18 A;  3PN7 C;  1BT6 A;  1SYM A;  1CFF A;  1IG5 A;  2M7N A;  1A03 A;  1C7V A;  1EL4 A;  2L98 A;  3A8R A;  4CLN A;  1CM4 A;  1KFU L;  1NX0 A;  3ICB A;  4GNK B;  2ZND A;  1NCY A;  4QJ3 B;  1PRW A;  1A4P A;  4C0K A;  3ZNI A;  2LCP A;  2NXQ A;  3PAL A;  3NSL A;  2AMI A;  3OHM B;  2LMT A;  2BBN A;  1ZUZ A;  3BXK A;  4F0Z B;  1PSB A;  1R2U A;  1F54 A;  2DOQ A;  1S3P A;  2EC6 C;  4YI8 A;  2KBM A;  3OB2 B;  4Q04 A;  2A4J A;  4MEW A;  1TTX A;  2F3Z A;  4GGN A;  5IBW A;  4DCK A;  1M45 A;  3I5I C;  3I5F B;  3DF0 B;  3LK0 A;  1BR4 B;  4PE1 A;  3PN7 B;  1DT7 B;  1RFJ A;  1XO5 A;  1JFJ A;  3SG5 A;  3OX6 A;  4NDC A;  4ORB B;  1R6P A;  1QVI Z;  1QVI Y;  3HCM A;  2K2F A;  2AUC A;  1TIZ A;  1REC A;  3TUY B;  1LIN A;  5I2L A;  1MXE A;  4YGC B;  1EH2 A;  1QIV A;  3RLZ A;  1SPY A;  3TS5 C;  2KFF A;  2JTZ A;  1IJ6 A;  1B8C A;  1S5G Z;  1S5G Y;  2COL B;  4R1E A;  3CR5 X;  1E8A A;  1OZS A;  2KAX A;  1NX2 A;  2G2B A;  1YRT B;  2M49 B;  1S6I A;  1A29 A;  1KFX L;  1J1E A;  1QX7 A;  4PE7 A;  3WXA A;  2ZKM X;  5DKN A;  1NYA A;  2EC6 B;  5CSF A;  2I2R E;  4PHN A;  5JJG A;  2KAV A;  4E68 A;  4YGE B;  5KTY A;  2OTG C;  1JWD A;  4OKH A;  2JPT A;  3LLE A;  5HKY A;  1JFK A;  1WLZ A;  4DUQ A;  1KK8 C;  1MQ1 A;  2WCB A;  1QXP A;  4AQI A;  1DF0 A;  1G33 A;  2K7B A;  3TDZ A;  4ORC B;  1NUB A;  2JT0 A;  1DJW A;  4YRU A;  4C0L A;  1ODB A;  5DKQ A;  1TCF A;  2I7A A;  2LUX A;  3CZT X;  1J1D A;  1CDP A;  1XFV O;  3PSR A;  1K9K A;  5HYD A;  1BLQ A;  1ZMZ A;  2JXL A;  2L4H A;  2SAS A;  1V1G A;  2JT3 A;  1U5I B;  1M63 B;  4OVN F;  3BUN B;  1GGW A;  1KFU S;  2LLS A;  3AKB A;  1SR6 C;  2LAN A;  1J7R A;  1WY9 A;  2JZI A;  1KK8 B;  1QAT A;  2M97 A;  4ZCU A;  3OB1 B;  2KOT A;  1WRL A;  1JBA A;  3BUX B;  4BY4 A;  2NZ0 A;  2GGM A;  4NQG A;  2L0P A;  1OZO A;  2KAY A;  4UPG A;  4MN0 A;  1RJV A;  3NSI A;  3PFV A;  3TDU A;  2ISD A;  3CS1 A;  1AHR A;  2V53 A;  2MHH A;  4PE0 A;  4JQ0 D;  4DIR A;  1LKJ A;  4XJK A;  5F6T A;  1CMG A;  1SL8 A;  4HRG A;  1CTR A;  1IQ3 A;  2L5X B;  2WC8 A;  2ZFD A;  4NDD A;  1QV0 A;  1G8I A;  1NX1 A;  1QAS A;  3IQQ A;  2BL0 B;  4A4B A;  2LP2 A;  2Y1N A;  2KQY A;  3WHT B;  1RWY A;  1YX8 A;  2M9G A;  3HX4 A;  2AAO A;  1IKU A;  5D69 A;  5HKW A;  2BBM A;  2LNK A;  1JUO A;  1OE9 B;  2LMU A;  3GK4 X;  1BOD A;  4MZJ A;  1KFX S;  1Y1A A;  3I5G B;  1DVI A;  1G4Y R;  4MSP A;  3VRP A;  1AJ5 A;  3SIB A;  4WRI A;  3NXA A;  4NDB A;  3WNX B;  1SCM C;  1WDC C;  1DF0 B;  1OOJ A;  3DD4 A;  3BOW B;  3MSE B;  3NSO A;  1BJF A;  2SCP A;  1GGZ A;  1NIW A;  1YRU B;  3A4U B;  2LAP A;  2GV5 A;  1YUS A;  3JTD C;  2LHL A;  5ER4 X;  2CXJ A;  1KWO B;  2JNF A;  1XFZ O;  1UHJ A;  4FTG A;  1YVL A;  1SY9 A;  2KI4 B;  2OS8 C;  5HLV A;  1QLK A;  1S1E A;  4CFR A;  1MHO A;  1M39 A;  4CID A;  2MA2 A;  1NCZ A;  3DVJ A;  2JOJ A;  3F45 A;  2LVI A;  5PAL A;  1MWN A;  4AOM A;  1CLL A;  1ALW A;  5B8I B;  2G9B A;  3JVT C;  3WHU B;  1EG3 A;  1QLS A;  1WRZ A;  1SCM B;  2CT9 A;  2JNX A;  1CLB A;  1K9P A;  1XYD A;  1UHI A;  4M2P A;  1EXR A;  3TZ1 A;  3SG4 A;  2JC2 A;  5AFP A;  1PVB A;  1FBV A;  1ALV A;  1NX3 A;  3PM8 A;  2KQ6 A;  1KQM C;  2PVB A;  4MLW A;  2LE9 B;  3EK7 A;  1BOC A;  3KHE A;  2ZRT A;  3GOF A;  4OCI A;  1QS7 A;  1L2O C;  3BUW B;  1SNL A;  1YUR A;  1QJT A;  3QRX A;  4CPV A;  4USL A;  1SW8 A;  1F8H A;  1BMO A;  1J7Q A;  1LA3 A;  4GAO A;  1K96 A;  2BKH B;  2KDH A;  2WND A;  3O78 A;  2BCB A;  3E3R A;  1DGU A;  2NCP A;  4ZCV A;  5JOL A;  3I5I B;  2K7D A;  2FOT A;  2O60 A;  2PRU A;  1FPW A;  3GK1 A;  3VGO A;  2K61 A;  4PHM A;  5CSN A;  1S6J A;  2WCF A;  2QPT A;  2MLF C;  4C0J A;  2ZNE A;  1IQ5 A;  2LUC A;  1XA5 A;  1JF2 A;  3EVU A;  2LM5 A;  4P5O E;  5CSJ A;  3TS5 B;  1XFX O;  2BEC A;  2PAS A;  1SKT A;  4D1E A;  3SG2 A;  1F70 A;  2LV7 A;  1Y6W A;  2M1K B;  4N1F A;  2F3Y A;  2HPS A;  1B9A A;  5G08 A;  2MAZ A;  3LK1 A;  4M2O A;  1UP5 A;  1F4O A;  1RRO A;  4GGF A;  2OPO A;  4ORA B;  1SK6 D;  1IGV A;  4L9M A;  3ZWH A;  2MRD A;  1NP8 A;  2OTG B;  1A75 A;  1MXL C;  4IL1 A;  4JPZ B;  4WQ2 A;  1OMV A;  2K7C A;  3AAJ A;  4XYN A;  1CDN A;  2ZN9 A;  5CSI A;  2KI6 D;  5HLO A;  2LVJ A;  1W7J B;  1AVS A;  2HET A;  4FQO A;  1PK0 D;  4WQ3 A;  2KNE A;  2L4I A;  3KEV A;  3O2P A;  3KPX A;  1MF8 B;  1TOP A;  1EJ3 A;  3DVE A;  3EKH A;  4HSZ A;  3KO0 A;  5KSZ A;  4GUK A;  2EGD A;  1Y1U A;  1A2X A;  2BCX A;  1SCV A;  3LCP C;  2RGI A;  4YGD B;  3IF7 A;  1OQP A;  3IQO A;  1UHK A;  2FJU B;  1SMG A;  2BE4 A;  2FCE A;  3FWC A;  4JWQ A;  2KFH A;  2NCO A;  3C1V A;  3CR2 A;  1B8R A;  1XFW O;  2D8N A;  2M29 A;  1OSA A;  1ZFS A;  2K7O A;  1OMD A;  5J3X A;  2Q91 A;  2I94 A;  4M2Q A;  2ZN8 A;  2M8U A;  1UHN A;  1NSH A;  1YUT A;  1SR6 B;  2F2P A;  1DJY A;  2L51 A;  4GPL B;  5AEQ A;  1KSO A;  1DJI A;  1SRA A;  2WCE A;  4DS7 A;  1TNP A;  2KYC A;  3LL8 B;  4GGF C;  1S36 A;  1WLM A;  1K95 A;  2P6B B;  1QX5 B;  2H61 A;  5DKR A;  2Y1M A;  3DF0 A;  4U8D A;  3EVV A;  1KSM A;  1DMO A;  1LVC D;  1MUX A;  1KCY A;  2LHI A;  1AP4 A;  2PSR A;  2Y5I A;  3D10 A;  3VRN A;  2O5G A;  4YI9 A;  2JQ6 A;  3OP0 A;  5I2Q A;  1YX7 A;  2M1U A;  4QJ4 B;  1B47 A;  2GGZ A;  1F55 A;  2ZRS A;  1B4C A;  2F2O A;  1ZAC A;  1DJX A;  1PVA A;  2LP3 A;  1PSR A;  1Y0V H;  1DJG A;  1EG4 A;  1WRK A;  3K21 A;  2QAC A;  4MRY A;  1QV1 A;  4CFQ A;  3O4Y A;  3SG3 A;  1K2H A;  1RK9 A;  4YBH B;  1PUL A;  2HQ8 A;  1A75 B;  4PHJ A;  5HKZ A;  1YR5 A;  1TCO B;  4I5K A;  4I5N B;  1UHH A;  3DVM A;  3CGA A;  3H4S E;  4ICB A;  1DJZ A;  3AKA A;  1B7T Z;  1B7T Y;  1WDC B;  2JTT A;  1N0Y A;  2H61 C;  3I5F C;  3FIA A;  1HQV A;  5CPV A;  3JTD B;  3SJS A;  3TUY C;  4N5X A;  4I5L B;  2JUL A;  5FYX A;  1VRK A;  2OS8 B;  3PAT A;  3PLF B;  2CTN A;  2HQW A;  1CLM A;  5D7F A;  2MJW B;  4XJK B;  1U5I A;  1TN4 A;  1YUU A;  2BKI B;  1S26 D;  3M0W A;  2KBI A;  4PE4 A;  4A4C A;  2BE6 A;  1SL7 A;  1CDL A;  2HF5 A;  4PHK A;  2F33 A;  2JWW A;  5ER5 A;  3JVT B;  2TN4 A;  2K8M B;  4PAL A;  1FF1 A;  3CLN A;  3VRR A;  2CCM A;  1QTX A;  3CWG A;  4OV2 A;  1BF5 A;  1TNW A;  1S6C A;  1V1F A;  3EK4 A;  4DRW A;  5AER A;  1MR8 A;  1B8L A;  1K9U A;  1IH0 A;  1KQM B;  3BUO B;  4P2Y B;  1CB1 A;  2E30 A;  3SG7 A;  2K0J A;  2R2I A;  1W7I B;  4MZK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...