2KI4B

Fgf1-s100a13 complex structure: key component in non-classical path way of fgf1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
96
structure length
96
Chain Sequence
MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Heparin-binding growth factor 1
publication title The heterohexameric complex structure, a component in the non-classical pathway for fibroblast growth factor 1 (FGF1) secretion.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2009-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2ki4B00
1IKUA 4A4BA 5F6TA 5AEQA 2CT9A 1GQMA 1JUOA 2LMVA 1Y0VH 1LA0A 1CDPA 1SRAA 2JRFA 1LXFC 2BKIB 2LP3A 5HKZA 5HKWA 2L5XB 2A4JA 1MF8B 3TZ1A 1CFFA 1AJ5A 3D10A 2ZN8A 2FCEA 4MRYA 4P2YB 2DOQA 4U8DA 5FYXA 1SW8A 3SG6A 2M97A 3OHMB 3VRPA 1J1DA 1YRTB 1CDMA 1CTRA 4JPZB 4XJKA 2CNPA 1WDCC 1JBAA 2ZNEA 1UHHA 1XYDA 1BU3A 2H61A 4XJKB 3WHTB 1SNLA 1Y1UA 1S6JA 2M0RA 1DF0B 1BG1A 2NXQA 2LUXA 1DJXA 2JT3A 1J1EA 1L7ZA 1XFVO 1IJ6A 1WDCB 4NQGA 1XFXO 2K61A 2PMYA 1TTXA 1CLLA 1ODBA 1QLSA 4CPVA 3O2PA 2ZN9A 2PASA 4PE0A 1TNWA 1XFZO 1FI5A 4ORAB 1RTP1 2JNXA 1QLKA 1GGZA 2LUCA 1FW4A 4MSPA 1ALVA 2KI6D 1K90D 1B1GA 4MRXA 1BR4B 1QXPA 1UP5A 5DKRA 5CSJA 1C7VA 1A4PA 5JJGA 1J7PA 1J7RA 1QV1A 1DF0A 1KFUL 2LVJA 3KF9A 1EJ3A 1N0YA 1UHKA 2I94A 2JT0A 1B7TZ 1Q80A 1QTXA 2I2RE 2JQ6A 2JXCA 2ISDA 5DKQA 1NIWA 3I5GC 2LVKA 5CSIA 4ORCB 2KGBC 1QVIY 1SCMC 1LKJA 1S5GY 5B8IB 1IJ5A 3RM1A 1U5IB 2AMIA 4P5OE 1SBJA 2JXLA 1ZUZA 5AANA 1CM4A 2G2BA 3HX4A 3BXKA 1N2DA 3MSEB 3NSLA 3I5GB 1YUUA 2KDHA 1SY9A 1WRKA 2L4IA 1M39A 2O5GA 3FS7A 1CM1A 3O4YA 4BY4A 4M2QA 1KFUS 3O6BA 3CR5X 5K89A 4UPGA 2HPSA 1SL7A 2KAXA 1SL9A 3PALA 2BL0C 4PE1A 3TUYC 3M0WA 2L98A 1XVJA 1U5IA 4WQ2A 4ETOA 1M45A 2L51A 1PK0D 4MVFA 1BODA 4NDBA 1TNPA 1TOPA 3SG2A 2F2PA 1KFXL 1XA5A 2BL0B 1JSAA 2OS8C 1KSOA 3CLNA 4MZJA 3VGOA 4MN0A 1KQMC 5HKYA 1G33A 1NCZA 2FJUB 5KSZA 3I5IC 2M29A 4Q04A 2E6WA 3LLEA 1YR5A 2L50A 4F0ZB 1JF2A 1EH2A 3SIBA 1UHJA 1WY9A 2OS8B 1DJIA 1KQMB 3FWBA 1QVIZ 2PSRA 2HQ8A 2CXJA 1PSRA 2K7OA 3EVUA 1K9KA 1PSBA 1YX7A 1H4BA 1DJGA 1MUXA 1QASA 3NSKA 1DJYA 5AFPA 4JWQA 2TN4A 4GGNA 1KK8B 3VRNA 1AP4A 2FOTA 1KFXS 1ALWA 1BF5A 1DGVA 1OZOA 2KBIA 1EXRA 5KU1A 1UURA 4A4CA 4AOMA 1WRZA 2SCPA 3OP0A 5J3XA 1K8UA 1MHOA 1BT6A 2LANA 4DCKA 4HSZA 1HQVA 1NX3A 1IRJA 2KHNA 3I5HB 1KQVA 1UHNA 5CSFA 2F2OA 2HETA 1PVAA 3GK2A 2F33A 2KI4C 1IQ3A 1Y6WA 2HQWA 2P6BB 2ZKMX 1W7JB 3NSIA 1B9AA 3DVKA 4MLWA 1R6PA 2JC2A 1CDNA 4NDDA 2BBMA 2KI4B 1S3PA 3AKAA 1RFJA 1WLZA 2BCAA 2CCMA 4IL1A 1YUSA 1YUTA 1HT9A 4D1EA 1XFUO 4MZKA 5I2LA 1KSMA 4PHNA 3EK4A 1XFWO 3SG4A 4GBAA 2LNKA 3EK7A 3I5FB 1NWDA 1J7QA 2GV5A 4PHJA 5TNCA 1SMGA 1CMFA 3CTNA 4GAOA 5D69A 1VRKA 1CFCA 2V53A 1H8BA 3CWGA 2BE4A 1RWYA 1RJVA 2OTGB 1YRUB 1K96A 1CKKA 4HREE 1CFPA 3ZNIA 1M46A 4MBEA 1OE9B 1W7IB 2F3YA 1F71A 3DVEA 1B8RA 2MLEC 1AVSA 3SG3A 2NCPA 3H4SE 1CNPA 1B8LA 1NYAA 2BECA 3GK1A 3PM8A 5D7FA 1SR6C 1MWNA 3BUXB 1K95A 2BE6A 1F4QA 1DJZA 1PALA 3PFVA 1NUBA 1UUSA 1YX8A 4C0JA 1OOJA 3O78A 3DVJA 3PLFB 4PDZA 2PALA 4WRIA 4YBHB 2LCPA 2KFFA 2MHHA 3BUOB 1SR6B 1EG3A 1OZSA 3CR4X 3SG5A 2JULA 1TN4A 1A03A 2B1UA 2KQYA 5ER5A 3WNXB 4PHKA 2LVIA 3DF0B 4CLNA 1CLBA 1NX2A 2KYFA 2BKHB 1YVLA 1K9UA 1F55A 4YRUA 2M7LA 3OB1B 1LINA 5DKNA 4YGBB 5CPVA 3IQOA 2L4HA 4I5JA 5G08A 2WCBA 1J7OA 2LLTA 1SCVA 2OPOA 1E8AA 4L9MA 5I2OA 4M2OA 3AAJA 3BUNB 1IWQA 4ORBB 3RLZA 1YTZC 1TNQA 3LL8B 5ER4X 1WRLA 2L0PA 3DVMA 1BJFA 2LP2A 4N5XA 4YI8A 3PN7B 1BR1B 1CB1A 3FIAA 2BBNA 2K2FA 3DF0A 2JWWA 2KFHA 2JU0A 2LC5A 2CTNA 1BMOA 1DVIA 1KK7Y 1RK9A 2D8NA 3EK8A 3EVVA 3BUMB 2KYCA 2IS9A 1KK8C 1G4YR 2BCXA 1AUIB 1XO5A 1OMVA 1TIZA 1ZMZA 1S5GZ 3BUWB 1EG4A 1NCYA 3HCMA 4GUKA 2Q4UA 4PE7A 1DJWA 2HF5A 3VRQA 1NCXA 2COLB 2O60A 1IQ5A 1G8IA 3ICBA 1S6IA 2JZIA 3A4UB 1D1OA 1V1FA 2L2EA 2KAYA 3OX5A 2MAZA 3I5HC 2GGMA 1QJTA 2WNDA 3K21A 4OKHA 3CS1A 1B4CA 1JC2A 1F70A 1NPQA 3NXAA 4USLA 4CIDA 1Y1XA 1JWDA 1IH0A 1PVBA 5IBWA 1OQPA 2Y5IA 1A2XA 4YGAA 1WLMA 4DRWA 2LMUA 2PVBA 3CGAA 2EC6C 5JOLA 5GQQC 1RECA 2K2AA 1DMOA 2JT8A 1BLQA 3ZWHA 3TDIA 3EVRA 2M3WA 3LK0A 1MR8A 4PCWA 2KBMA 4I5LB 4JQ0D 4R1EA 2WCEA 3BOWB 2EC6B 3JTDC 4OCIA 1ZFSA 3IQQA 4ZCUA 2ZRTA 3TDUA 5I2QA 3D0YB 4GGFA 3I5FC 4DIRA 4QJ5B 2K7CA 1ZOTB 2JNFA 4HRHA 3JTDB 1PULA 1JF0A 2ZRSA 1NSHA 1XFYO 1B8CA 1QIVA 2JOJA 1RROA 4TNCA 1QV0A 2K0JA 1SKTA 1B7TY 2BCBA 1A75B 2OTGC 2WOSA 2KSPA 3JVTC 4YGEB 3AKBA 5KTYA 1BOCA 1TCFA 3GOFA 3BOWA 1MXEA 3KPXA 1S36A 3IF7A 4DUQA 1JFKA 1TNXA 3D0YA 4FTGA 3TS5C 1MXLC 2PRUA 1EL4A 2QACA 1K93D 3JVTB 3KHEA 1B47A 2F8PA 2G9BA 3BYAA 2LE9B 1KCYA 3F45A 1ZACA 2LHIA 5PALA 3TS5B 1IG5A 2Y1NA 1A75A 4AQJA 3GK4X 1S1EA 2SASA 1JFJA 4YI9A 3KO0A 5AXIA 4OV2A 1R2UA 2M8UA 4GNKB 1C07A 4C0KA 1M31A 4XYNA 3WXAA 1SYMA 3PSRA 3CR2A 3AAKA 3C1VA 4ZCVA 2AUCA 2K7DA 1K9PA 1GJYA 2WORA 2NLNA 3KEVA 1PRWA 4BY5A 2M1KB 4N1GA 3PATA 2MJWB 1K2HA 1C7WA 4WQ3A 1FBVA 4MZLA 1LVCD 1YURA 2M9GA 4GFTA 2MA2A 2H2KA 1SK6D 1CDLA 2JPTA 2RGIA 1F54A 2JTZA 2LLSA 2LVVA 2MRDA 1SPYA 1XK4C 2M49B 2E30A 3DD4A 4NDCA 1YVHA 1KWOC 1QS7A 1OMRA 2ZNDA 1QX2A 1DGUA 3EKJA 4I5NB 3PN7C 2M7NA 1AK8A 2EHBA 3QRXA 1GGWA 1L2OC 3NSOA 1J55A 1KWOB 1SCMB 3SG7A 3LCPC 1NP8A 4PE4A 2CBLA 2LAPA 2KQ6A 2LV7A 4QJ3B 1LA3A 1L2OB 2KI6C 1DJHA 3SJSA 2K8MB 3OB2B 4HRGA 2JTTA 4N1FA 1V1GA 3VROA 1NX0A 2NZ0A 2MBXA 4C0LA 4FQOA 4YGCB 4GPLB 4QJ4B 1TRFA 4OR9B 2LHLA 2KGRA 4OVNF 1XK4A 2I18A 3WHUB 5HLVA 4CFRA 1S26D 2KAVA 3EKHA 3TUYB 4DS7A 1AJ4A 1MQ1A 1X02A 2LMTA 4YGDB 2LM5A 1A29A 4GGFC 5I8NA 3BQ3A 5HLOA 1DTLA 2GGZA 4I5KA 1FF1A 1FPWA 4E68A 2MLFC 5HYDA 1M63B 1UWOA 1FI6A 3VRRA 1F8HA 1UHIA 2KOTA 4MEWA 2LLUA 4AQIA 3CZTX 4M2PA 5BPJA 1CMGA 1SL8A 2Y4QA 1IGVA 2R2IA 1CFDA 2AAOA 4PALA 1QX5B 1OSAA 3SIAA 1N65A 1QX7A 2VRGA 3I5IB 3FWCA 2M1UA 1CLMA 2EGDA 1DT7B 2Y1MA 3TDZA 2Q91A 2NCOA 1QATA 4PHMA 5AERA 3LK1A 2QPTA 1F4OA 3A8RA 1QIWA 3E3RA 1K94A 1S6CA 1AHRA 2K7BA 1TCOB 4ICBA 2H61C 1KK7Z 5CSNA 2KFGA 3OX6A 2ZFDA 1OMDA 4CFQA 2FCDA 1NX1A 2F3ZA 2I7AA 2KNEA 2WCFA 1Y1AA 2WC8A
chains in the Genus database with same CATH superfamily
1IKUA 4A4BA 5F6TA 5AEQA 2CT9A 1GQMA 1JUOA 2LMVA 1Y0VH 1LA0A 1CDPA 1SRAA 2JRFA 3S0GA 1LXFC 3CYZA 2BKIB 2LP3A 5HKZA 5HKWA 2L5XB 2A4JA 1MF8B 3TZ1A 1CFFA 2WC6A 1AJ5A 3D10A 2ZN8A 2FCEA 4MRYA 4P2YB 2DOQA 4U8DA 5FYXA 3D77A 1SW8A 3SG6A 2M97A 3OHMB 3DZTA 3IVTA 3VRPA 1J1DA 1YRTB 1CDMA 1CTRA 4JPZB 4XJKA 2CNPA 1WDCC 1JBAA 2ZNEA 1UHHA 1XYDA 2K60A 1BU3A 2H61A 4XJKB 3WHTB 1SNLA 1Y1UA 1S6JA 2M0RA 1DF0B 1BG1A 2NXQA 2LUXA 1DJXA 2JT3A 1J1EA 1L7ZA 1XFVO 1IJ6A 1WDCB 4NQGA 1XFXO 2K61A 2PMYA 1TTXA 1CLLA 1ODBA 1QLSA 4CPVA 3O2PA 2ZN9A 2PASA 4PE0A 1TNWA 1XFZO 1FI5A 4ORAB 1RTP1 2JNXA 1QLKA 1GGZA 1DQEA 1FW4A 2LUCA 4MSPA 1ALVA 2KI6D 3QMEA 1K90D 1B1GA 5FI7A 3FE8A 4MRXA 2L2CA 1BR4B 1QXPA 1UP5A 5DKRA 5CSJA 1C7VA 1A4PA 5JJGA 1J7PA 1J7RA 1QV1A 1DF0A 1KFUL 1P28A 2LVJA 2L5YA 1EJ3A 3KF9A 1N0YA 1UHKA 2I94A 2JT0A 1B7TZ 1Q80A 1QTXA 3CDNA 2I2RE 2JQ6A 2JXCA 2ISDA 5DKQA 5HL1A 1NIWA 3I5GC 2LVKA 5CSIA 4ORCB 2KGBC 1QVIY 1SCMC 1LKJA 2P71A 1S5GY 5B8IB 3PJIA 1IJ5A 3RM1A 3CZ1A 1U5IB 2AMIA 3L47A 4P5OE 1SBJA 2JXLA 1ZUZA 5AANA 1CM4A 2G2BA 3HX4A 3BXKA 1N2DA 3MSEB 3NSLA 3I5GB 1YUUA 2KDHA 3SS4A 1SY9A 1WRKA 2L4IA 1M39A 1OOIX 2O5GA 3FS7A 1CM1A 3O4YA 4BY4A 4M2QA 1KFUS 3O6BA 3CR5X 1DELA 5K89A 4UPGA 2BAPA 2HPSA 3SS5A 1SL7A 2KAXA 1SL9A 3PALA 2BL0C 4PE1A 3TUYC 3M0WA 2L98A 1XVJA 1U5IA 4WQ2A 4ETOA 1M45A 2L51A 1ORGA 1PK0D 4MVFA 1BODA 4NDBA 1TNPA 2GTEA 1TOPA 3SG2A 3S0FA 2F2PA 1KFXL 1XA5A 2BL0B 1OOGA 1JSAA 2OS8C 1KSOA 2WCKA 3CLNA 4MZJA 3VGOA 4MN0A 1KQMC 1Z2CB 5HKYA 1G33A 5I94A 1NCZA 2WC5A 3L4LA 2FJUB 5KSZA 3I5IC 2M29A 4Q04A 2E6WA 3LLEA 1YR5A 2L50A 4F0ZB 1JF2A 1EH2A 3SIBA 1UHJA 1WY9A 2OS8B 3S0EA 1DJIA 1KQMB 3FWBA 1QVIZ 2PSRA 3BFAA 2HQ8A 3CZ2A 2CXJA 1PSRA 2K7OA 3EVUA 3L4AA 1K9KA 1PSBA 1YX7A 1H4BA 1DJGA 1MUXA 1QASA 3NSKA 1DJYA 5AFPA 4JWQA 2TN4A 4GGNA 1KK8B 3VRNA 1AP4A 2FOTA 1KFXS 1ALWA 1BF5A 1DGVA 1OZOA 2KBIA 1EXRA 5KU1A 1UURA 3R1OA 4A4CA 4AOMA 1WRZA 1TUJA 2QDIA 2SCPA 3OP0A 5J3XA 1K8UA 1MHOA 1BT6A 2LANA 4DCKA 3K1EA 4HSZA 1HQVA 1NX3A 1XFRA 1IRJA 2KHNA 3I5HB 1KQVA 1UHNA 5CSFA 5FI6A 4INWA 2F2OA 2HETA 1PVAA 3B87A 2F33A 2KI4C 3GK2A 1Y6WA 1IQ3A 2HQWA 2P6BB 2ZKMX 1W7JB 3NSIA 1B9AA 3DVKA 4MLWA 1R6PA 2JC2A 1CDNA 4NDDA 2BBMA 2KI4B 1SSEB 1S3PA 3AKAA 1RFJA 1WLZA 2BCAA 2CCMA 4JKTA 4IL1A 3R1VA 1YUSA 1YUTA 1HT9A 4D1EA 2QEVA 1XFUO 2KLEA 4MZKA 5I2LA 1KSMA 4PHNA 3EK4A 1XFWO 3SG4A 4GBAA 2LNKA 3EK7A 3I5FB 2YGUA 1NWDA 2BNXA 1J7QA 2GV5A 3DYEA 4PHJA 5TNCA 3S0DA 1SMGA 1CMFA 3CTNA 4GAOA 1T14A 5D69A 1VRKA 1CFCA 2V53A 1H8BA 3D75A 1TWOA 2BE4A 3CWGA 1RWYA 1RJVA 2OTGB 1YRUB 1K96A 1CKKA 4HREE 4PT1A 1CFPA 3ZNIA 1M46A 4MBEA 1OE9B 1W7IB 2F3YA 1IIOA 1F71A 3DVEA 3CABA 1B8RA 2MLEC 1AVSA 3SG3A 2NCPA 3H4SE 1CNPA 1B8LA 1NYAA 2BECA 1C3YA 3GK1A 3PM8A 5D7FA 1SR6C 1MWNA 3BUXB 1DC1A 1K95A 2BE6A 3NHIA 1F4QA 1DJZA 2PYQA 1PALA 2ERBA 3PFVA 1NUBA 1UUSA 1YX8A 4C0JA 1OOJA 3O78A 3DVJA 3PLFB 4PDZA 3S0AA 2PALA 4WRIA 4YBHB 2LCPA 2KFFA 2MHHA 3BUOB 1SR6B 1EG3A 1OZSA 2QEBA 3CR4X 3SG5A 2JULA 4JD9A 1TN4A 1A03A 2B1UA 2KQYA 5ER5A 3WNXB 4PHKA 2LVIA 3DF0B 4CLNA 1CLBA 1NX2A 2KYFA 2BKHB 1YVLA 4IJ7A 1K9UA 1F55A 4YRUA 2M7LA 3OB1B 1LINA 5DKNA 4YGBB 1Z4HA 5CPVA 1C3ZA 3IQOA 2L4HA 4I5JA 5G08A 2WCBA 1J7OA 2LLTA 1SCVA 2OPOA 1E8AA 4FQTA 4L9MA 4M2OA 5I2OA 1W9ZA 3AAJA 1GM0A 3BUNB 1IWQA 4ORBB 3RLZA 1YTZC 1TNQA 3B88A 3LL8B 5ER4X 1WRLA 2L0PA 3DVMA 1BJFA 2LP2A 4N5XA 4YI8A 3PN7B 1BR1B 1CB1A 3FE6A 2BBNA 2K2FA 3FIAA 3SS3A 4INXA 3DF0A 2JWWA 2WCLA 2KFHA 2JU0A 2LC5A 2CTNA 1BMOA 1DVIA 1KK7Y 1RK9A 2D8NA 3EK8A 3EVVA 3BUMB 3DXLA 2KYCA 2IS9A 3O4XA 1KK8C 1G4YR 2BCXA 1AUIB 1XO5A 1OMVA 1TIZA 1ZMZA 1S5GZ 3BUWB 3NGVA 1EG4A 1NCYA 1OW4A 3HCMA 4GUKA 2Q4UA 4OZDA 4PE7A 1DJWA 2HF5A 3VRQA 1NCXA 2COLB 2O60A 1IQ5A 1G8IA 2KLDA 3ICBA 1S6IA 2JZIA 3A4UB 1D1OA 1V1FA 2L2EA 2KAYA 3OX5A 2MAZA 3I5HC 2GGMA 1QJTA 2WNDA 3K21A 4OKHA 3CS1A 1B4CA 1JC2A 1F70A 3D73A 1NPQA 3NXAA 4USLA 4CIDA 1Y1XA 3D76A 1JWDA 1IH0A 1PVBA 5EL2A 5IBWA 1OQPA 2Y5IA 1A2XA 4YGAA 1WLMA 2KPHA 4DRWA 2LMUA 2PVBA 3CGAA 2EC6C 5JOLA 5GQQC 1RECA 2K2AA 2WCHA 3BJHA 1DMOA 2JT8A 1BLQA 3ZWHA 3TDIA 3EG5B 3EVRA 2P70A 2M3WA 3LK0A 1MR8A 4PCWA 2KBMA 4I5LB 4JQ0D 4R1EA 2WCEA 3BOWB 2EC6B 3JTDC 4OCIA 1DEKA 1ZFSA 3IQQA 4ZCUA 1LS8A 2ZRTA 3TDUA 5I2QA 3D0YB 4GGFA 3I5FC 4DIRA 4QJ5B 2K7CA 1ZOTB 2JNFA 4F7FA 4HRHA 3JTDB 1PULA 1JF0A 2ZRSA 1NSHA 1XFYO 3R72A 1B8CA 1QIVA 2JOJA 1RROA 4TNCA 1QV0A 2K0JA 1SKTA 1B7TY 2BCBA 1A75B 2OTGC 2WOSA 2KSPA 3JVTC 2PQLA 3AKBA 4YGEB 5KTYA 1BOCA 1TCFA 2WCJA 3GOFA 3BOWA 1MXEA 3KPXA 1S36A 2QEOA 3IF7A 4DUQA 1OOHA 1JFKA 1QWVA 1TNXA 3D0YA 4FTGA 3TS5C 1MXLC 2PRUA 1EL4A 2QACA 1K93D 3JVTB 3KHEA 1B47A 2F8PA 2G9BA 3BYAA 2LE9B 3S0BA 1KCYA 3F45A 1ZACA 2LHIA 5PALA 3TS5B 1IG5A 2Y1NA 4KYNA 3UNWA 1A75A 4AQJA 3GK4X 1S1EA 2SASA 1JFJA 4YI9A 3KO0A 3D74A 4OV2A 5AXIA 3BFHA 1R2UA 2M8UA 4GNKB 1C07A 4C0KA 1M31A 4XYNA 3WXAA 1SYMA 3PSRA 3CR2A 3AAKA 3C1VA 4ZCVA 2AUCA 2K7DA 1K9PA 3OGNA 1GJYA 2QEHA 2WORA 2NLNA 3KEVA 1PRWA 4BY5A 2M1KB 4N1GA 3PATA 2MJWB 1K2HA 1C7WA 4WQ3A 1FBVA 4MZLA 1LVCD 1YURA 2M9GA 4GFTA 2MA2A 3PM2A 3R1PA 2H2KA 1SK6D 1CDLA 2JPTA 2RGIA 3DY9A 1F54A 2JTZA 2LLSA 2LVVA 2MRDA 2H8VA 1SPYA 1XK4C 2M49B 2E30A 3DD4A 4NDCA 1YVHA 1KWOC 1QS7A 1OMRA 2ZNDA 1QX2A 1DGUA 3EKJA 4I5NB 3PN7C 2M7NA 1AK8A 2JPOA 2EHBA 3QRXA 1GGWA 1L2OC 3NSOA 1J55A 1KWOB 1SCMB 5D3OA 3LCPC 3SG7A 1NP8A 1OOFA 4PE4A 2CBLA 2LAPA 2KQ6A 2LV7A 4QJ3B 1LA3A 1L2OB 2KI6C 1DJHA 3SJSA 2K8MB 3OB2B 4HRGA 2JTTA 4N1FA 1V1GA 3VROA 1NX0A 2NZ0A 2MBXA 4C0LA 4FQOA 4YGCB 4GPLB 4QJ4B 1TRFA 3B6XA 4OR9B 2LHLA 2KGRA 4OVNF 1XK4A 2I18A 3WHUB 5HLVA 4CFRA 2FJYA 1S26D 2KAVA 3EKHA 3N7HA 3D78A 3TUYB 4DS7A 3BFBA 1AJ4A 1MQ1A 1X02A 2LMTA 4YGDB 2LM5A 1A29A 4GGFC 5I8NA 3BQ3A 5HLOA 1DTLA 2GGZA 4I5KA 1FF1A 1FPWA 4E68A 2MLFC 5HYDA 1M63B 3OBVA 2WCMA 1UWOA 1FI6A 3VRRA 1F8HA 1UHIA 2KOTA 3B86A 4MEWA 2LLUA 4AQIA 1TUZA 3CZTX 4M2PA 5BPJA 1CMGA 1SL8A 2Y4QA 1IGVA 2R2IA 1CFDA 3VB1A 2AAOA 4PALA 1QX5B 1OSAA 3SIAA 1N65A 1QX7A 2VRGA 3I5IB 3FWCA 2M1UA 3RZSA 1CLMA 2EGDA 3FE9A 1DT7B 2Y1MA 3TDZA 2Q91A 2NCOA 1QATA 4PHMA 5AERA 3LK1A 2QPTA 1F4OA 3A8RA 1QIWA 3Q8IA 5FI2A 3E3RA 3UO9A 3V2LA 3CZ0A 1K94A 1S6CA 1AHRA 2K7BA 1TCOB 4ICBA 2H61C 3NHTA 1KK7Z 5CSNA 3B7AA 2KFGA 3OX6A 2ZFDA 1OMDA 4CFQA 5DICA 2FCDA 1NX1A 2F3ZA 2I7AA 2KNEA 2WCFA 1Y1AA 2WC8A
chains in the Genus database with same CATH topology
1IKUA 4A4BA 5F6TA 5AEQA 2CT9A 1GQMA 1JUOA 2LMVA 1Y0VH 1LA0A 1CDPA 1SRAA 2JRFA 1LXFC 2BKIB 2LP3A 5HKZA 5HKWA 2L5XB 2A4JA 1MF8B 3TZ1A 1CFFA 1AJ5A 3D10A 2ZN8A 2FCEA 4MRYA 4P2YB 2DOQA 4U8DA 5FYXA 1SW8A 3SG6A 2M97A 3OHMB 3VRPA 1J1DA 1YRTB 1CDMA 1CTRA 4JPZB 4XJKA 2CNPA 1WDCC 1JBAA 2ZNEA 1UHHA 1XYDA 1BU3A 2H61A 4XJKB 3WHTB 1SNLA 1Y1UA 1S6JA 2M0RA 1DF0B 1BG1A 2NXQA 2LUXA 1DJXA 2JT3A 1J1EA 1L7ZA 1XFVO 1IJ6A 1WDCB 4NQGA 1XFXO 2K61A 2PMYA 1TTXA 1CLLA 1ODBA 1QLSA 4CPVA 3O2PA 2ZN9A 2PASA 4PE0A 1TNWA 1XFZO 1FI5A 4ORAB 1RTP1 2JNXA 1QLKA 1GGZA 2LUCA 1FW4A 4MSPA 1ALVA 2KI6D 1K90D 1B1GA 4MRXA 1BR4B 1QXPA 1UP5A 5DKRA 5CSJA 1C7VA 1A4PA 5JJGA 1J7PA 1J7RA 1QV1A 1DF0A 1KFUL 2LVJA 3KF9A 1EJ3A 1N0YA 1UHKA 2I94A 2JT0A 1B7TZ 1Q80A 1QTXA 2I2RE 2JQ6A 2JXCA 2ISDA 5DKQA 1NIWA 3I5GC 2LVKA 5CSIA 4ORCB 2KGBC 1QVIY 1SCMC 1LKJA 1S5GY 5B8IB 1IJ5A 3RM1A 1U5IB 2AMIA 4P5OE 1SBJA 2JXLA 1ZUZA 5AANA 1CM4A 2G2BA 3HX4A 3BXKA 1N2DA 3MSEB 3NSLA 3I5GB 1YUUA 2KDHA 1SY9A 1WRKA 2L4IA 1M39A 2O5GA 3FS7A 1CM1A 3O4YA 4BY4A 4M2QA 1KFUS 3O6BA 3CR5X 5K89A 4UPGA 2HPSA 1SL7A 2KAXA 1SL9A 3PALA 2BL0C 4PE1A 3TUYC 3M0WA 2L98A 1XVJA 1U5IA 4WQ2A 4ETOA 1M45A 2L51A 1PK0D 4MVFA 1BODA 4NDBA 1TNPA 1TOPA 3SG2A 2F2PA 1KFXL 1XA5A 2BL0B 1JSAA 2OS8C 1KSOA 3CLNA 4MZJA 3VGOA 4MN0A 1KQMC 5HKYA 1G33A 1NCZA 2FJUB 5KSZA 3I5IC 2M29A 4Q04A 2E6WA 3LLEA 1YR5A 2L50A 4F0ZB 1JF2A 1EH2A 3SIBA 1UHJA 1WY9A 2OS8B 1DJIA 1KQMB 3FWBA 1QVIZ 2PSRA 2HQ8A 2CXJA 1PSRA 2K7OA 3EVUA 1K9KA 1PSBA 1YX7A 1H4BA 1DJGA 1MUXA 1QASA 3NSKA 1DJYA 5AFPA 4JWQA 2TN4A 4GGNA 1KK8B 3VRNA 1AP4A 2FOTA 1KFXS 1ALWA 1BF5A 1DGVA 1OZOA 2KBIA 1EXRA 5KU1A 1UURA 4A4CA 4AOMA 1WRZA 2SCPA 3OP0A 5J3XA 1K8UA 1MHOA 1BT6A 2LANA 4DCKA 4HSZA 1HQVA 1NX3A 1IRJA 2KHNA 3I5HB 1KQVA 1UHNA 5CSFA 2F2OA 2HETA 1PVAA 3GK2A 2F33A 2KI4C 1IQ3A 1Y6WA 2HQWA 2P6BB 2ZKMX 1W7JB 3NSIA 1B9AA 3DVKA 4MLWA 1R6PA 2JC2A 1CDNA 4NDDA 2BBMA 2KI4B 1S3PA 3AKAA 1RFJA 1WLZA 2BCAA 2CCMA 4IL1A 1YUSA 1YUTA 1HT9A 4D1EA 1XFUO 4MZKA 5I2LA 1KSMA 4PHNA 3EK4A 1XFWO 3SG4A 4GBAA 2LNKA 3EK7A 3I5FB 1NWDA 1J7QA 2GV5A 4PHJA 5TNCA 1SMGA 1CMFA 3CTNA 4GAOA 5D69A 1VRKA 1CFCA 2V53A 1H8BA 3CWGA 2BE4A 1RWYA 1RJVA 2OTGB 1YRUB 1K96A 1CKKA 4HREE 1CFPA 3ZNIA 1M46A 4MBEA 1OE9B 1W7IB 2F3YA 1F71A 3DVEA 1B8RA 2MLEC 1AVSA 3SG3A 2NCPA 3H4SE 1CNPA 1B8LA 1NYAA 2BECA 3GK1A 3PM8A 5D7FA 1SR6C 1MWNA 3BUXB 1K95A 2BE6A 1F4QA 1DJZA 1PALA 3PFVA 1NUBA 1UUSA 1YX8A 4C0JA 1OOJA 3O78A 3DVJA 3PLFB 4PDZA 2PALA 4WRIA 4YBHB 2LCPA 2KFFA 2MHHA 3BUOB 1SR6B 1EG3A 1OZSA 3CR4X 3SG5A 2JULA 1TN4A 1A03A 2B1UA 2KQYA 5ER5A 3WNXB 4PHKA 2LVIA 3DF0B 4CLNA 1CLBA 1NX2A 2KYFA 2BKHB 1YVLA 1K9UA 1F55A 4YRUA 2M7LA 3OB1B 1LINA 5DKNA 4YGBB 5CPVA 3IQOA 2L4HA 4I5JA 5G08A 2WCBA 1J7OA 2LLTA 1SCVA 2OPOA 1E8AA 4L9MA 5I2OA 4M2OA 3AAJA 3BUNB 1IWQA 4ORBB 3RLZA 1YTZC 1TNQA 3LL8B 5ER4X 1WRLA 2L0PA 3DVMA 1BJFA 2LP2A 4N5XA 4YI8A 3PN7B 1BR1B 1CB1A 3FIAA 2BBNA 2K2FA 3DF0A 2JWWA 2KFHA 2JU0A 2LC5A 2CTNA 1BMOA 1DVIA 1KK7Y 1RK9A 2D8NA 3EK8A 3EVVA 3BUMB 2KYCA 2IS9A 1KK8C 1G4YR 2BCXA 1AUIB 1XO5A 1OMVA 1TIZA 1ZMZA 1S5GZ 3BUWB 1EG4A 1NCYA 3HCMA 4GUKA 2Q4UA 4PE7A 1DJWA 2HF5A 3VRQA 1NCXA 2COLB 2O60A 1IQ5A 1G8IA 3ICBA 1S6IA 2JZIA 3A4UB 1D1OA 1V1FA 2L2EA 2KAYA 3OX5A 2MAZA 3I5HC 2GGMA 1QJTA 2WNDA 3K21A 4OKHA 3CS1A 1B4CA 1JC2A 1F70A 1NPQA 3NXAA 4USLA 4CIDA 1Y1XA 1JWDA 1IH0A 1PVBA 5IBWA 1OQPA 2Y5IA 1A2XA 4YGAA 1WLMA 4DRWA 2LMUA 2PVBA 3CGAA 2EC6C 5JOLA 5GQQC 1RECA 2K2AA 1DMOA 2JT8A 1BLQA 3ZWHA 3TDIA 3EVRA 2M3WA 3LK0A 1MR8A 4PCWA 2KBMA 4I5LB 4JQ0D 4R1EA 2WCEA 3BOWB 2EC6B 3JTDC 4OCIA 1ZFSA 3IQQA 4ZCUA 2ZRTA 3TDUA 5I2QA 3D0YB 4GGFA 3I5FC 4DIRA 4QJ5B 2K7CA 1ZOTB 2JNFA 4HRHA 3JTDB 1PULA 1JF0A 2ZRSA 1NSHA 1XFYO 1B8CA 1QIVA 2JOJA 1RROA 4TNCA 1QV0A 2K0JA 1SKTA 1B7TY 2BCBA 1A75B 2OTGC 2WOSA 2KSPA 3JVTC 4YGEB 3AKBA 5KTYA 1BOCA 1TCFA 3GOFA 3BOWA 1MXEA 3KPXA 1S36A 3IF7A 4DUQA 1JFKA 1TNXA 3D0YA 4FTGA 3TS5C 1MXLC 2PRUA 1EL4A 2QACA 1K93D 3JVTB 3KHEA 1B47A 2F8PA 2G9BA 3BYAA 2LE9B 1KCYA 3F45A 1ZACA 2LHIA 5PALA 3TS5B 1IG5A 2Y1NA 1A75A 4AQJA 3GK4X 1S1EA 2SASA 1JFJA 4YI9A 3KO0A 5AXIA 4OV2A 1R2UA 2M8UA 4GNKB 1C07A 4C0KA 1M31A 4XYNA 3WXAA 1SYMA 3PSRA 3CR2A 3AAKA 3C1VA 4ZCVA 2AUCA 2K7DA 1K9PA 1GJYA 2WORA 2NLNA 3KEVA 1PRWA 4BY5A 2M1KB 4N1GA 3PATA 2MJWB 1K2HA 1C7WA 4WQ3A 1FBVA 4MZLA 1LVCD 1YURA 2M9GA 4GFTA 2MA2A 2H2KA 1SK6D 1CDLA 2JPTA 2RGIA 1F54A 2JTZA 2LLSA 2LVVA 2MRDA 1SPYA 1XK4C 2M49B 2E30A 3DD4A 4NDCA 1YVHA 1KWOC 1QS7A 1OMRA 2ZNDA 1QX2A 1DGUA 3EKJA 4I5NB 3PN7C 2M7NA 1AK8A 2EHBA 3QRXA 1GGWA 1L2OC 3NSOA 1J55A 1KWOB 1SCMB 3SG7A 3LCPC 1NP8A 4PE4A 2CBLA 2LAPA 2KQ6A 2LV7A 4QJ3B 1LA3A 1L2OB 2KI6C 1DJHA 3SJSA 2K8MB 3OB2B 4HRGA 2JTTA 4N1FA 1V1GA 3VROA 1NX0A 2NZ0A 2MBXA 4C0LA 4FQOA 4YGCB 4GPLB 4QJ4B 1TRFA 4OR9B 2LHLA 2KGRA 4OVNF 1XK4A 2I18A 3WHUB 5HLVA 4CFRA 1S26D 2KAVA 3EKHA 3TUYB 4DS7A 1AJ4A 1MQ1A 1X02A 2LMTA 4YGDB 2LM5A 1A29A 4GGFC 5I8NA 3BQ3A 5HLOA 1DTLA 2GGZA 4I5KA 1FF1A 1FPWA 4E68A 2MLFC 5HYDA 1M63B 1UWOA 1FI6A 3VRRA 1F8HA 1UHIA 2KOTA 4MEWA 2LLUA 4AQIA 3CZTX 4M2PA 5BPJA 1CMGA 1SL8A 2Y4QA 1IGVA 2R2IA 1CFDA 2AAOA 4PALA 1QX5B 1OSAA 3SIAA 1N65A 1QX7A 2VRGA 3I5IB 3FWCA 2M1UA 1CLMA 2EGDA 1DT7B 2Y1MA 3TDZA 2Q91A 2NCOA 1QATA 4PHMA 5AERA 3LK1A 2QPTA 1F4OA 3A8RA 1QIWA 3E3RA 1K94A 1S6CA 1AHRA 2K7BA 1TCOB 4ICBA 2H61C 1KK7Z 5CSNA 2KFGA 3OX6A 2ZFDA 1OMDA 4CFQA 2FCDA 1NX1A 2F3ZA 2I7AA 2KNEA 2WCFA 1Y1AA 2WC8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IKU A;  4A4B A;  5F6T A;  5AEQ A;  2CT9 A;  1GQM A;  1JUO A;  2LMV A;  1Y0V H;  1LA0 A;  1CDP A;  1SRA A;  2JRF A;  1LXF C;  2BKI B;  2LP3 A;  5HKZ A;  5HKW A;  2L5X B;  2A4J A;  1MF8 B;  3TZ1 A;  1CFF A;  1AJ5 A;  3D10 A;  2ZN8 A;  2FCE A;  4MRY A;  4P2Y B;  2DOQ A;  4U8D A;  5FYX A;  1SW8 A;  3SG6 A;  2M97 A;  3OHM B;  3VRP A;  1J1D A;  1YRT B;  1CDM A;  1CTR A;  4JPZ B;  4XJK A;  2CNP A;  1WDC C;  1JBA A;  2ZNE A;  1UHH A;  1XYD A;  1BU3 A;  2H61 A;  4XJK B;  3WHT B;  1SNL A;  1Y1U A;  1S6J A;  2M0R A;  1DF0 B;  1BG1 A;  2NXQ A;  2LUX A;  1DJX A;  2JT3 A;  1J1E A;  1L7Z A;  1XFV O;  1IJ6 A;  1WDC B;  4NQG A;  1XFX O;  2K61 A;  2PMY A;  1TTX A;  1CLL A;  1ODB A;  1QLS A;  4CPV A;  3O2P A;  2ZN9 A;  2PAS A;  4PE0 A;  1TNW A;  1XFZ O;  1FI5 A;  4ORA B;  1RTP 1;  2JNX A;  1QLK A;  1GGZ A;  2LUC A;  1FW4 A;  4MSP A;  1ALV A;  2KI6 D;  1K90 D;  1B1G A;  4MRX A;  1BR4 B;  1QXP A;  1UP5 A;  5DKR A;  5CSJ A;  1C7V A;  1A4P A;  5JJG A;  1J7P A;  1J7R A;  1QV1 A;  1DF0 A;  1KFU L;  2LVJ A;  3KF9 A;  1EJ3 A;  1N0Y A;  1UHK A;  2I94 A;  2JT0 A;  1B7T Z;  1Q80 A;  1QTX A;  2I2R E;  2JQ6 A;  2JXC A;  2ISD A;  5DKQ A;  1NIW A;  3I5G C;  2LVK A;  5CSI A;  4ORC B;  2KGB C;  1QVI Y;  1SCM C;  1LKJ A;  1S5G Y;  5B8I B;  1IJ5 A;  3RM1 A;  1U5I B;  2AMI A;  4P5O E;  1SBJ A;  2JXL A;  1ZUZ A;  5AAN A;  1CM4 A;  2G2B A;  3HX4 A;  3BXK A;  1N2D A;  3MSE B;  3NSL A;  3I5G B;  1YUU A;  2KDH A;  1SY9 A;  1WRK A;  2L4I A;  1M39 A;  2O5G A;  3FS7 A;  1CM1 A;  3O4Y A;  4BY4 A;  4M2Q A;  1KFU S;  3O6B A;  3CR5 X;  5K89 A;  4UPG A;  2HPS A;  1SL7 A;  2KAX A;  1SL9 A;  3PAL A;  2BL0 C;  4PE1 A;  3TUY C;  3M0W A;  2L98 A;  1XVJ A;  1U5I A;  4WQ2 A;  4ETO A;  1M45 A;  2L51 A;  1PK0 D;  4MVF A;  1BOD A;  4NDB A;  1TNP A;  1TOP A;  3SG2 A;  2F2P A;  1KFX L;  1XA5 A;  2BL0 B;  1JSA A;  2OS8 C;  1KSO A;  3CLN A;  4MZJ A;  3VGO A;  4MN0 A;  1KQM C;  5HKY A;  1G33 A;  1NCZ A;  2FJU B;  5KSZ A;  3I5I C;  2M29 A;  4Q04 A;  2E6W A;  3LLE A;  1YR5 A;  2L50 A;  4F0Z B;  1JF2 A;  1EH2 A;  3SIB A;  1UHJ A;  1WY9 A;  2OS8 B;  1DJI A;  1KQM B;  3FWB A;  1QVI Z;  2PSR A;  2HQ8 A;  2CXJ A;  1PSR A;  2K7O A;  3EVU A;  1K9K A;  1PSB A;  1YX7 A;  1H4B A;  1DJG A;  1MUX A;  1QAS A;  3NSK A;  1DJY A;  5AFP A;  4JWQ A;  2TN4 A;  4GGN A;  1KK8 B;  3VRN A;  1AP4 A;  2FOT A;  1KFX S;  1ALW A;  1BF5 A;  1DGV A;  1OZO A;  2KBI A;  1EXR A;  5KU1 A;  1UUR A;  4A4C A;  4AOM A;  1WRZ A;  2SCP A;  3OP0 A;  5J3X A;  1K8U A;  1MHO A;  1BT6 A;  2LAN A;  4DCK A;  4HSZ A;  1HQV A;  1NX3 A;  1IRJ A;  2KHN A;  3I5H B;  1KQV A;  1UHN A;  5CSF A;  2F2O A;  2HET A;  1PVA A;  3GK2 A;  2F33 A;  2KI4 C;  1IQ3 A;  1Y6W A;  2HQW A;  2P6B B;  2ZKM X;  1W7J B;  3NSI A;  1B9A A;  3DVK A;  4MLW A;  1R6P A;  2JC2 A;  1CDN A;  4NDD A;  2BBM A;  2KI4 B;  1S3P A;  3AKA A;  1RFJ A;  1WLZ A;  2BCA A;  2CCM A;  4IL1 A;  1YUS A;  1YUT A;  1HT9 A;  4D1E A;  1XFU O;  4MZK A;  5I2L A;  1KSM A;  4PHN A;  3EK4 A;  1XFW O;  3SG4 A;  4GBA A;  2LNK A;  3EK7 A;  3I5F B;  1NWD A;  1J7Q A;  2GV5 A;  4PHJ A;  5TNC A;  1SMG A;  1CMF A;  3CTN A;  4GAO A;  5D69 A;  1VRK A;  1CFC A;  2V53 A;  1H8B A;  3CWG A;  2BE4 A;  1RWY A;  1RJV A;  2OTG B;  1YRU B;  1K96 A;  1CKK A;  4HRE E;  1CFP A;  3ZNI A;  1M46 A;  4MBE A;  1OE9 B;  1W7I B;  2F3Y A;  1F71 A;  3DVE A;  1B8R A;  2MLE C;  1AVS A;  3SG3 A;  2NCP A;  3H4S E;  1CNP A;  1B8L A;  1NYA A;  2BEC A;  3GK1 A;  3PM8 A;  5D7F A;  1SR6 C;  1MWN A;  3BUX B;  1K95 A;  2BE6 A;  1F4Q A;  1DJZ A;  1PAL A;  3PFV A;  1NUB A;  1UUS A;  1YX8 A;  4C0J A;  1OOJ A;  3O78 A;  3DVJ A;  3PLF B;  4PDZ A;  2PAL A;  4WRI A;  4YBH B;  2LCP A;  2KFF A;  2MHH A;  3BUO B;  1SR6 B;  1EG3 A;  1OZS A;  3CR4 X;  3SG5 A;  2JUL A;  1TN4 A;  1A03 A;  2B1U A;  2KQY A;  5ER5 A;  3WNX B;  4PHK A;  2LVI A;  3DF0 B;  4CLN A;  1CLB A;  1NX2 A;  2KYF A;  2BKH B;  1YVL A;  1K9U A;  1F55 A;  4YRU A;  2M7L A;  3OB1 B;  1LIN A;  5DKN A;  4YGB B;  5CPV A;  3IQO A;  2L4H A;  4I5J A;  5G08 A;  2WCB A;  1J7O A;  2LLT A;  1SCV A;  2OPO A;  1E8A A;  4L9M A;  5I2O A;  4M2O A;  3AAJ A;  3BUN B;  1IWQ A;  4ORB B;  3RLZ A;  1YTZ C;  1TNQ A;  3LL8 B;  5ER4 X;  1WRL A;  2L0P A;  3DVM A;  1BJF A;  2LP2 A;  4N5X A;  4YI8 A;  3PN7 B;  1BR1 B;  1CB1 A;  3FIA A;  2BBN A;  2K2F A;  3DF0 A;  2JWW A;  2KFH A;  2JU0 A;  2LC5 A;  2CTN A;  1BMO A;  1DVI A;  1KK7 Y;  1RK9 A;  2D8N A;  3EK8 A;  3EVV A;  3BUM B;  2KYC A;  2IS9 A;  1KK8 C;  1G4Y R;  2BCX A;  1AUI B;  1XO5 A;  1OMV A;  1TIZ A;  1ZMZ A;  1S5G Z;  3BUW B;  1EG4 A;  1NCY A;  3HCM A;  4GUK A;  2Q4U A;  4PE7 A;  1DJW A;  2HF5 A;  3VRQ A;  1NCX A;  2COL B;  2O60 A;  1IQ5 A;  1G8I A;  3ICB A;  1S6I A;  2JZI A;  3A4U B;  1D1O A;  1V1F A;  2L2E A;  2KAY A;  3OX5 A;  2MAZ A;  3I5H C;  2GGM A;  1QJT A;  2WND A;  3K21 A;  4OKH A;  3CS1 A;  1B4C A;  1JC2 A;  1F70 A;  1NPQ A;  3NXA A;  4USL A;  4CID A;  1Y1X A;  1JWD A;  1IH0 A;  1PVB A;  5IBW A;  1OQP A;  2Y5I A;  1A2X A;  4YGA A;  1WLM A;  4DRW A;  2LMU A;  2PVB A;  3CGA A;  2EC6 C;  5JOL A;  5GQQ C;  1REC A;  2K2A A;  1DMO A;  2JT8 A;  1BLQ A;  3ZWH A;  3TDI A;  3EVR A;  2M3W A;  3LK0 A;  1MR8 A;  4PCW A;  2KBM A;  4I5L B;  4JQ0 D;  4R1E A;  2WCE A;  3BOW B;  2EC6 B;  3JTD C;  4OCI A;  1ZFS A;  3IQQ A;  4ZCU A;  2ZRT A;  3TDU A;  5I2Q A;  3D0Y B;  4GGF A;  3I5F C;  4DIR A;  4QJ5 B;  2K7C A;  1ZOT B;  2JNF A;  4HRH A;  3JTD B;  1PUL A;  1JF0 A;  2ZRS A;  1NSH A;  1XFY O;  1B8C A;  1QIV A;  2JOJ A;  1RRO A;  4TNC A;  1QV0 A;  2K0J A;  1SKT A;  1B7T Y;  2BCB A;  1A75 B;  2OTG C;  2WOS A;  2KSP A;  3JVT C;  4YGE B;  3AKB A;  5KTY A;  1BOC A;  1TCF A;  3GOF A;  3BOW A;  1MXE A;  3KPX A;  1S36 A;  3IF7 A;  4DUQ A;  1JFK A;  1TNX A;  3D0Y A;  4FTG A;  3TS5 C;  1MXL C;  2PRU A;  1EL4 A;  2QAC A;  1K93 D;  3JVT B;  3KHE A;  1B47 A;  2F8P A;  2G9B A;  3BYA A;  2LE9 B;  1KCY A;  3F45 A;  1ZAC A;  2LHI A;  5PAL A;  3TS5 B;  1IG5 A;  2Y1N A;  1A75 A;  4AQJ A;  3GK4 X;  1S1E A;  2SAS A;  1JFJ A;  4YI9 A;  3KO0 A;  5AXI A;  4OV2 A;  1R2U A;  2M8U A;  4GNK B;  1C07 A;  4C0K A;  1M31 A;  4XYN A;  3WXA A;  1SYM A;  3PSR A;  3CR2 A;  3AAK A;  3C1V A;  4ZCV A;  2AUC A;  2K7D A;  1K9P A;  1GJY A;  2WOR A;  2NLN A;  3KEV A;  1PRW A;  4BY5 A;  2M1K B;  4N1G A;  3PAT A;  2MJW B;  1K2H A;  1C7W A;  4WQ3 A;  1FBV A;  4MZL A;  1LVC D;  1YUR A;  2M9G A;  4GFT A;  2MA2 A;  2H2K A;  1SK6 D;  1CDL A;  2JPT A;  2RGI A;  1F54 A;  2JTZ A;  2LLS A;  2LVV A;  2MRD A;  1SPY A;  1XK4 C;  2M49 B;  2E30 A;  3DD4 A;  4NDC A;  1YVH A;  1KWO C;  1QS7 A;  1OMR A;  2ZND A;  1QX2 A;  1DGU A;  3EKJ A;  4I5N B;  3PN7 C;  2M7N A;  1AK8 A;  2EHB A;  3QRX A;  1GGW A;  1L2O C;  3NSO A;  1J55 A;  1KWO B;  1SCM B;  3SG7 A;  3LCP C;  1NP8 A;  4PE4 A;  2CBL A;  2LAP A;  2KQ6 A;  2LV7 A;  4QJ3 B;  1LA3 A;  1L2O B;  2KI6 C;  1DJH A;  3SJS A;  2K8M B;  3OB2 B;  4HRG A;  2JTT A;  4N1F A;  1V1G A;  3VRO A;  1NX0 A;  2NZ0 A;  2MBX A;  4C0L A;  4FQO A;  4YGC B;  4GPL B;  4QJ4 B;  1TRF A;  4OR9 B;  2LHL A;  2KGR A;  4OVN F;  1XK4 A;  2I18 A;  3WHU B;  5HLV A;  4CFR A;  1S26 D;  2KAV A;  3EKH A;  3TUY B;  4DS7 A;  1AJ4 A;  1MQ1 A;  1X02 A;  2LMT A;  4YGD B;  2LM5 A;  1A29 A;  4GGF C;  5I8N A;  3BQ3 A;  5HLO A;  1DTL A;  2GGZ A;  4I5K A;  1FF1 A;  1FPW A;  4E68 A;  2MLF C;  5HYD A;  1M63 B;  1UWO A;  1FI6 A;  3VRR A;  1F8H A;  1UHI A;  2KOT A;  4MEW A;  2LLU A;  4AQI A;  3CZT X;  4M2P A;  5BPJ A;  1CMG A;  1SL8 A;  2Y4Q A;  1IGV A;  2R2I A;  1CFD A;  2AAO A;  4PAL A;  1QX5 B;  1OSA A;  3SIA A;  1N65 A;  1QX7 A;  2VRG A;  3I5I B;  3FWC A;  2M1U A;  1CLM A;  2EGD A;  1DT7 B;  2Y1M A;  3TDZ A;  2Q91 A;  2NCO A;  1QAT A;  4PHM A;  5AER A;  3LK1 A;  2QPT A;  1F4O A;  3A8R A;  1QIW A;  3E3R A;  1K94 A;  1S6C A;  1AHR A;  2K7B A;  1TCO B;  4ICB A;  2H61 C;  1KK7 Z;  5CSN A;  2KFG A;  3OX6 A;  2ZFD A;  1OMD A;  4CFQ A;  2FCD A;  1NX1 A;  2F3Z A;  2I7A A;  2KNE A;  2WCF A;  1Y1A A;  2WC8 A; 
#chains in the Genus database with same CATH topology
 1IKU A;  4A4B A;  5F6T A;  5AEQ A;  2CT9 A;  1GQM A;  1JUO A;  2LMV A;  1Y0V H;  1LA0 A;  1CDP A;  1SRA A;  2JRF A;  3S0G A;  1LXF C;  3CYZ A;  2BKI B;  2LP3 A;  5HKZ A;  5HKW A;  2L5X B;  2A4J A;  1MF8 B;  3TZ1 A;  1CFF A;  2WC6 A;  1AJ5 A;  3D10 A;  2ZN8 A;  2FCE A;  4MRY A;  4P2Y B;  2DOQ A;  4U8D A;  5FYX A;  3D77 A;  1SW8 A;  3SG6 A;  2M97 A;  3OHM B;  3DZT A;  3IVT A;  3VRP A;  1J1D A;  1YRT B;  1CDM A;  1CTR A;  4JPZ B;  4XJK A;  2CNP A;  1WDC C;  1JBA A;  2ZNE A;  1UHH A;  1XYD A;  2K60 A;  1BU3 A;  2H61 A;  4XJK B;  3WHT B;  1SNL A;  1Y1U A;  1S6J A;  2M0R A;  1DF0 B;  1BG1 A;  2NXQ A;  2LUX A;  1DJX A;  2JT3 A;  1J1E A;  1L7Z A;  1XFV O;  1IJ6 A;  1WDC B;  4NQG A;  1XFX O;  2K61 A;  2PMY A;  1TTX A;  1CLL A;  1ODB A;  1QLS A;  4CPV A;  3O2P A;  2ZN9 A;  2PAS A;  4PE0 A;  1TNW A;  1XFZ O;  1FI5 A;  4ORA B;  1RTP 1;  2JNX A;  1QLK A;  1GGZ A;  1DQE A;  1FW4 A;  2LUC A;  4MSP A;  1ALV A;  2KI6 D;  3QME A;  1K90 D;  1B1G A;  5FI7 A;  3FE8 A;  4MRX A;  2L2C A;  1BR4 B;  1QXP A;  1UP5 A;  5DKR A;  5CSJ A;  1C7V A;  1A4P A;  5JJG A;  1J7P A;  1J7R A;  1QV1 A;  1DF0 A;  1KFU L;  1P28 A;  2LVJ A;  2L5Y A;  1EJ3 A;  3KF9 A;  1N0Y A;  1UHK A;  2I94 A;  2JT0 A;  1B7T Z;  1Q80 A;  1QTX A;  3CDN A;  2I2R E;  2JQ6 A;  2JXC A;  2ISD A;  5DKQ A;  5HL1 A;  1NIW A;  3I5G C;  2LVK A;  5CSI A;  4ORC B;  2KGB C;  1QVI Y;  1SCM C;  1LKJ A;  2P71 A;  1S5G Y;  5B8I B;  3PJI A;  1IJ5 A;  3RM1 A;  3CZ1 A;  1U5I B;  2AMI A;  3L47 A;  4P5O E;  1SBJ A;  2JXL A;  1ZUZ A;  5AAN A;  1CM4 A;  2G2B A;  3HX4 A;  3BXK A;  1N2D A;  3MSE B;  3NSL A;  3I5G B;  1YUU A;  2KDH A;  3SS4 A;  1SY9 A;  1WRK A;  2L4I A;  1M39 A;  1OOI X;  2O5G A;  3FS7 A;  1CM1 A;  3O4Y A;  4BY4 A;  4M2Q A;  1KFU S;  3O6B A;  3CR5 X;  1DEL A;  5K89 A;  4UPG A;  2BAP A;  2HPS A;  3SS5 A;  1SL7 A;  2KAX A;  1SL9 A;  3PAL A;  2BL0 C;  4PE1 A;  3TUY C;  3M0W A;  2L98 A;  1XVJ A;  1U5I A;  4WQ2 A;  4ETO A;  1M45 A;  2L51 A;  1ORG A;  1PK0 D;  4MVF A;  1BOD A;  4NDB A;  1TNP A;  2GTE A;  1TOP A;  3SG2 A;  3S0F A;  2F2P A;  1KFX L;  1XA5 A;  2BL0 B;  1OOG A;  1JSA A;  2OS8 C;  1KSO A;  2WCK A;  3CLN A;  4MZJ A;  3VGO A;  4MN0 A;  1KQM C;  1Z2C B;  5HKY A;  1G33 A;  5I94 A;  1NCZ A;  2WC5 A;  3L4L A;  2FJU B;  5KSZ A;  3I5I C;  2M29 A;  4Q04 A;  2E6W A;  3LLE A;  1YR5 A;  2L50 A;  4F0Z B;  1JF2 A;  1EH2 A;  3SIB A;  1UHJ A;  1WY9 A;  2OS8 B;  3S0E A;  1DJI A;  1KQM B;  3FWB A;  1QVI Z;  2PSR A;  3BFA A;  2HQ8 A;  3CZ2 A;  2CXJ A;  1PSR A;  2K7O A;  3EVU A;  3L4A A;  1K9K A;  1PSB A;  1YX7 A;  1H4B A;  1DJG A;  1MUX A;  1QAS A;  3NSK A;  1DJY A;  5AFP A;  4JWQ A;  2TN4 A;  4GGN A;  1KK8 B;  3VRN A;  1AP4 A;  2FOT A;  1KFX S;  1ALW A;  1BF5 A;  1DGV A;  1OZO A;  2KBI A;  1EXR A;  5KU1 A;  1UUR A;  3R1O A;  4A4C A;  4AOM A;  1WRZ A;  1TUJ A;  2QDI A;  2SCP A;  3OP0 A;  5J3X A;  1K8U A;  1MHO A;  1BT6 A;  2LAN A;  4DCK A;  3K1E A;  4HSZ A;  1HQV A;  1NX3 A;  1XFR A;  1IRJ A;  2KHN A;  3I5H B;  1KQV A;  1UHN A;  5CSF A;  5FI6 A;  4INW A;  2F2O A;  2HET A;  1PVA A;  3B87 A;  2F33 A;  2KI4 C;  3GK2 A;  1Y6W A;  1IQ3 A;  2HQW A;  2P6B B;  2ZKM X;  1W7J B;  3NSI A;  1B9A A;  3DVK A;  4MLW A;  1R6P A;  2JC2 A;  1CDN A;  4NDD A;  2BBM A;  2KI4 B;  1SSE B;  1S3P A;  3AKA A;  1RFJ A;  1WLZ A;  2BCA A;  2CCM A;  4JKT A;  4IL1 A;  3R1V A;  1YUS A;  1YUT A;  1HT9 A;  4D1E A;  2QEV A;  1XFU O;  2KLE A;  4MZK A;  5I2L A;  1KSM A;  4PHN A;  3EK4 A;  1XFW O;  3SG4 A;  4GBA A;  2LNK A;  3EK7 A;  3I5F B;  2YGU A;  1NWD A;  2BNX A;  1J7Q A;  2GV5 A;  3DYE A;  4PHJ A;  5TNC A;  3S0D A;  1SMG A;  1CMF A;  3CTN A;  4GAO A;  1T14 A;  5D69 A;  1VRK A;  1CFC A;  2V53 A;  1H8B A;  3D75 A;  1TWO A;  2BE4 A;  3CWG A;  1RWY A;  1RJV A;  2OTG B;  1YRU B;  1K96 A;  1CKK A;  4HRE E;  4PT1 A;  1CFP A;  3ZNI A;  1M46 A;  4MBE A;  1OE9 B;  1W7I B;  2F3Y A;  1IIO A;  1F71 A;  3DVE A;  3CAB A;  1B8R A;  2MLE C;  1AVS A;  3SG3 A;  2NCP A;  3H4S E;  1CNP A;  1B8L A;  1NYA A;  2BEC A;  1C3Y A;  3GK1 A;  3PM8 A;  5D7F A;  1SR6 C;  1MWN A;  3BUX B;  1DC1 A;  1K95 A;  2BE6 A;  3NHI A;  1F4Q A;  1DJZ A;  2PYQ A;  1PAL A;  2ERB A;  3PFV A;  1NUB A;  1UUS A;  1YX8 A;  4C0J A;  1OOJ A;  3O78 A;  3DVJ A;  3PLF B;  4PDZ A;  3S0A A;  2PAL A;  4WRI A;  4YBH B;  2LCP A;  2KFF A;  2MHH A;  3BUO B;  1SR6 B;  1EG3 A;  1OZS A;  2QEB A;  3CR4 X;  3SG5 A;  2JUL A;  4JD9 A;  1TN4 A;  1A03 A;  2B1U A;  2KQY A;  5ER5 A;  3WNX B;  4PHK A;  2LVI A;  3DF0 B;  4CLN A;  1CLB A;  1NX2 A;  2KYF A;  2BKH B;  1YVL A;  4IJ7 A;  1K9U A;  1F55 A;  4YRU A;  2M7L A;  3OB1 B;  1LIN A;  5DKN A;  4YGB B;  1Z4H A;  5CPV A;  1C3Z A;  3IQO A;  2L4H A;  4I5J A;  5G08 A;  2WCB A;  1J7O A;  2LLT A;  1SCV A;  2OPO A;  1E8A A;  4FQT A;  4L9M A;  4M2O A;  5I2O A;  1W9Z A;  3AAJ A;  1GM0 A;  3BUN B;  1IWQ A;  4ORB B;  3RLZ A;  1YTZ C;  1TNQ A;  3B88 A;  3LL8 B;  5ER4 X;  1WRL A;  2L0P A;  3DVM A;  1BJF A;  2LP2 A;  4N5X A;  4YI8 A;  3PN7 B;  1BR1 B;  1CB1 A;  3FE6 A;  2BBN A;  2K2F A;  3FIA A;  3SS3 A;  4INX A;  3DF0 A;  2JWW A;  2WCL A;  2KFH A;  2JU0 A;  2LC5 A;  2CTN A;  1BMO A;  1DVI A;  1KK7 Y;  1RK9 A;  2D8N A;  3EK8 A;  3EVV A;  3BUM B;  3DXL A;  2KYC A;  2IS9 A;  3O4X A;  1KK8 C;  1G4Y R;  2BCX A;  1AUI B;  1XO5 A;  1OMV A;  1TIZ A;  1ZMZ A;  1S5G Z;  3BUW B;  3NGV A;  1EG4 A;  1NCY A;  1OW4 A;  3HCM A;  4GUK A;  2Q4U A;  4OZD A;  4PE7 A;  1DJW A;  2HF5 A;  3VRQ A;  1NCX A;  2COL B;  2O60 A;  1IQ5 A;  1G8I A;  2KLD A;  3ICB A;  1S6I A;  2JZI A;  3A4U B;  1D1O A;  1V1F A;  2L2E A;  2KAY A;  3OX5 A;  2MAZ A;  3I5H C;  2GGM A;  1QJT A;  2WND A;  3K21 A;  4OKH A;  3CS1 A;  1B4C A;  1JC2 A;  1F70 A;  3D73 A;  1NPQ A;  3NXA A;  4USL A;  4CID A;  1Y1X A;  3D76 A;  1JWD A;  1IH0 A;  1PVB A;  5EL2 A;  5IBW A;  1OQP A;  2Y5I A;  1A2X A;  4YGA A;  1WLM A;  2KPH A;  4DRW A;  2LMU A;  2PVB A;  3CGA A;  2EC6 C;  5JOL A;  5GQQ C;  1REC A;  2K2A A;  2WCH A;  3BJH A;  1DMO A;  2JT8 A;  1BLQ A;  3ZWH A;  3TDI A;  3EG5 B;  3EVR A;  2P70 A;  2M3W A;  3LK0 A;  1MR8 A;  4PCW A;  2KBM A;  4I5L B;  4JQ0 D;  4R1E A;  2WCE A;  3BOW B;  2EC6 B;  3JTD C;  4OCI A;  1DEK A;  1ZFS A;  3IQQ A;  4ZCU A;  1LS8 A;  2ZRT A;  3TDU A;  5I2Q A;  3D0Y B;  4GGF A;  3I5F C;  4DIR A;  4QJ5 B;  2K7C A;  1ZOT B;  2JNF A;  4F7F A;  4HRH A;  3JTD B;  1PUL A;  1JF0 A;  2ZRS A;  1NSH A;  1XFY O;  3R72 A;  1B8C A;  1QIV A;  2JOJ A;  1RRO A;  4TNC A;  1QV0 A;  2K0J A;  1SKT A;  1B7T Y;  2BCB A;  1A75 B;  2OTG C;  2WOS A;  2KSP A;  3JVT C;  2PQL A;  3AKB A;  4YGE B;  5KTY A;  1BOC A;  1TCF A;  2WCJ A;  3GOF A;  3BOW A;  1MXE A;  3KPX A;  1S36 A;  2QEO A;  3IF7 A;  4DUQ A;  1OOH A;  1JFK A;  1QWV A;  1TNX A;  3D0Y A;  4FTG A;  3TS5 C;  1MXL C;  2PRU A;  1EL4 A;  2QAC A;  1K93 D;  3JVT B;  3KHE A;  1B47 A;  2F8P A;  2G9B A;  3BYA A;  2LE9 B;  3S0B A;  1KCY A;  3F45 A;  1ZAC A;  2LHI A;  5PAL A;  3TS5 B;  1IG5 A;  2Y1N A;  4KYN A;  3UNW A;  1A75 A;  4AQJ A;  3GK4 X;  1S1E A;  2SAS A;  1JFJ A;  4YI9 A;  3KO0 A;  3D74 A;  4OV2 A;  5AXI A;  3BFH A;  1R2U A;  2M8U A;  4GNK B;  1C07 A;  4C0K A;  1M31 A;  4XYN A;  3WXA A;  1SYM A;  3PSR A;  3CR2 A;  3AAK A;  3C1V A;  4ZCV A;  2AUC A;  2K7D A;  1K9P A;  3OGN A;  1GJY A;  2QEH A;  2WOR A;  2NLN A;  3KEV A;  1PRW A;  4BY5 A;  2M1K B;  4N1G A;  3PAT A;  2MJW B;  1K2H A;  1C7W A;  4WQ3 A;  1FBV A;  4MZL A;  1LVC D;  1YUR A;  2M9G A;  4GFT A;  2MA2 A;  3PM2 A;  3R1P A;  2H2K A;  1SK6 D;  1CDL A;  2JPT A;  2RGI A;  3DY9 A;  1F54 A;  2JTZ A;  2LLS A;  2LVV A;  2MRD A;  2H8V A;  1SPY A;  1XK4 C;  2M49 B;  2E30 A;  3DD4 A;  4NDC A;  1YVH A;  1KWO C;  1QS7 A;  1OMR A;  2ZND A;  1QX2 A;  1DGU A;  3EKJ A;  4I5N B;  3PN7 C;  2M7N A;  1AK8 A;  2JPO A;  2EHB A;  3QRX A;  1GGW A;  1L2O C;  3NSO A;  1J55 A;  1KWO B;  1SCM B;  5D3O A;  3LCP C;  3SG7 A;  1NP8 A;  1OOF A;  4PE4 A;  2CBL A;  2LAP A;  2KQ6 A;  2LV7 A;  4QJ3 B;  1LA3 A;  1L2O B;  2KI6 C;  1DJH A;  3SJS A;  2K8M B;  3OB2 B;  4HRG A;  2JTT A;  4N1F A;  1V1G A;  3VRO A;  1NX0 A;  2NZ0 A;  2MBX A;  4C0L A;  4FQO A;  4YGC B;  4GPL B;  4QJ4 B;  1TRF A;  3B6X A;  4OR9 B;  2LHL A;  2KGR A;  4OVN F;  1XK4 A;  2I18 A;  3WHU B;  5HLV A;  4CFR A;  2FJY A;  1S26 D;  2KAV A;  3EKH A;  3N7H A;  3D78 A;  3TUY B;  4DS7 A;  3BFB A;  1AJ4 A;  1MQ1 A;  1X02 A;  2LMT A;  4YGD B;  2LM5 A;  1A29 A;  4GGF C;  5I8N A;  3BQ3 A;  5HLO A;  1DTL A;  2GGZ A;  4I5K A;  1FF1 A;  1FPW A;  4E68 A;  2MLF C;  5HYD A;  1M63 B;  3OBV A;  2WCM A;  1UWO A;  1FI6 A;  3VRR A;  1F8H A;  1UHI A;  2KOT A;  3B86 A;  4MEW A;  2LLU A;  4AQI A;  1TUZ A;  3CZT X;  4M2P A;  5BPJ A;  1CMG A;  1SL8 A;  2Y4Q A;  1IGV A;  2R2I A;  1CFD A;  3VB1 A;  2AAO A;  4PAL A;  1QX5 B;  1OSA A;  3SIA A;  1N65 A;  1QX7 A;  2VRG A;  3I5I B;  3FWC A;  2M1U A;  3RZS A;  1CLM A;  2EGD A;  3FE9 A;  1DT7 B;  2Y1M A;  3TDZ A;  2Q91 A;  2NCO A;  1QAT A;  4PHM A;  5AER A;  3LK1 A;  2QPT A;  1F4O A;  3A8R A;  1QIW A;  3Q8I A;  5FI2 A;  3E3R A;  3UO9 A;  3V2L A;  3CZ0 A;  1K94 A;  1S6C A;  1AHR A;  2K7B A;  1TCO B;  4ICB A;  2H61 C;  3NHT A;  1KK7 Z;  5CSN A;  3B7A A;  2KFG A;  3OX6 A;  2ZFD A;  1OMD A;  4CFQ A;  5DIC A;  2FCD A;  1NX1 A;  2F3Z A;  2I7A A;  2KNE A;  2WCF A;  1Y1A A;  2WC8 A; 
#chains in the Genus database with same CATH homology
 1IKU A;  4A4B A;  5F6T A;  5AEQ A;  2CT9 A;  1GQM A;  1JUO A;  2LMV A;  1Y0V H;  1LA0 A;  1CDP A;  1SRA A;  2JRF A;  1LXF C;  2BKI B;  2LP3 A;  5HKZ A;  5HKW A;  2L5X B;  2A4J A;  1MF8 B;  3TZ1 A;  1CFF A;  1AJ5 A;  3D10 A;  2ZN8 A;  2FCE A;  4MRY A;  4P2Y B;  2DOQ A;  4U8D A;  5FYX A;  1SW8 A;  3SG6 A;  2M97 A;  3OHM B;  3VRP A;  1J1D A;  1YRT B;  1CDM A;  1CTR A;  4JPZ B;  4XJK A;  2CNP A;  1WDC C;  1JBA A;  2ZNE A;  1UHH A;  1XYD A;  1BU3 A;  2H61 A;  4XJK B;  3WHT B;  1SNL A;  1Y1U A;  1S6J A;  2M0R A;  1DF0 B;  1BG1 A;  2NXQ A;  2LUX A;  1DJX A;  2JT3 A;  1J1E A;  1L7Z A;  1XFV O;  1IJ6 A;  1WDC B;  4NQG A;  1XFX O;  2K61 A;  2PMY A;  1TTX A;  1CLL A;  1ODB A;  1QLS A;  4CPV A;  3O2P A;  2ZN9 A;  2PAS A;  4PE0 A;  1TNW A;  1XFZ O;  1FI5 A;  4ORA B;  1RTP 1;  2JNX A;  1QLK A;  1GGZ A;  2LUC A;  1FW4 A;  4MSP A;  1ALV A;  2KI6 D;  1K90 D;  1B1G A;  4MRX A;  1BR4 B;  1QXP A;  1UP5 A;  5DKR A;  5CSJ A;  1C7V A;  1A4P A;  5JJG A;  1J7P A;  1J7R A;  1QV1 A;  1DF0 A;  1KFU L;  2LVJ A;  3KF9 A;  1EJ3 A;  1N0Y A;  1UHK A;  2I94 A;  2JT0 A;  1B7T Z;  1Q80 A;  1QTX A;  2I2R E;  2JQ6 A;  2JXC A;  2ISD A;  5DKQ A;  1NIW A;  3I5G C;  2LVK A;  5CSI A;  4ORC B;  2KGB C;  1QVI Y;  1SCM C;  1LKJ A;  1S5G Y;  5B8I B;  1IJ5 A;  3RM1 A;  1U5I B;  2AMI A;  4P5O E;  1SBJ A;  2JXL A;  1ZUZ A;  5AAN A;  1CM4 A;  2G2B A;  3HX4 A;  3BXK A;  1N2D A;  3MSE B;  3NSL A;  3I5G B;  1YUU A;  2KDH A;  1SY9 A;  1WRK A;  2L4I A;  1M39 A;  2O5G A;  3FS7 A;  1CM1 A;  3O4Y A;  4BY4 A;  4M2Q A;  1KFU S;  3O6B A;  3CR5 X;  5K89 A;  4UPG A;  2HPS A;  1SL7 A;  2KAX A;  1SL9 A;  3PAL A;  2BL0 C;  4PE1 A;  3TUY C;  3M0W A;  2L98 A;  1XVJ A;  1U5I A;  4WQ2 A;  4ETO A;  1M45 A;  2L51 A;  1PK0 D;  4MVF A;  1BOD A;  4NDB A;  1TNP A;  1TOP A;  3SG2 A;  2F2P A;  1KFX L;  1XA5 A;  2BL0 B;  1JSA A;  2OS8 C;  1KSO A;  3CLN A;  4MZJ A;  3VGO A;  4MN0 A;  1KQM C;  5HKY A;  1G33 A;  1NCZ A;  2FJU B;  5KSZ A;  3I5I C;  2M29 A;  4Q04 A;  2E6W A;  3LLE A;  1YR5 A;  2L50 A;  4F0Z B;  1JF2 A;  1EH2 A;  3SIB A;  1UHJ A;  1WY9 A;  2OS8 B;  1DJI A;  1KQM B;  3FWB A;  1QVI Z;  2PSR A;  2HQ8 A;  2CXJ A;  1PSR A;  2K7O A;  3EVU A;  1K9K A;  1PSB A;  1YX7 A;  1H4B A;  1DJG A;  1MUX A;  1QAS A;  3NSK A;  1DJY A;  5AFP A;  4JWQ A;  2TN4 A;  4GGN A;  1KK8 B;  3VRN A;  1AP4 A;  2FOT A;  1KFX S;  1ALW A;  1BF5 A;  1DGV A;  1OZO A;  2KBI A;  1EXR A;  5KU1 A;  1UUR A;  4A4C A;  4AOM A;  1WRZ A;  2SCP A;  3OP0 A;  5J3X A;  1K8U A;  1MHO A;  1BT6 A;  2LAN A;  4DCK A;  4HSZ A;  1HQV A;  1NX3 A;  1IRJ A;  2KHN A;  3I5H B;  1KQV A;  1UHN A;  5CSF A;  2F2O A;  2HET A;  1PVA A;  3GK2 A;  2F33 A;  2KI4 C;  1IQ3 A;  1Y6W A;  2HQW A;  2P6B B;  2ZKM X;  1W7J B;  3NSI A;  1B9A A;  3DVK A;  4MLW A;  1R6P A;  2JC2 A;  1CDN A;  4NDD A;  2BBM A;  2KI4 B;  1S3P A;  3AKA A;  1RFJ A;  1WLZ A;  2BCA A;  2CCM A;  4IL1 A;  1YUS A;  1YUT A;  1HT9 A;  4D1E A;  1XFU O;  4MZK A;  5I2L A;  1KSM A;  4PHN A;  3EK4 A;  1XFW O;  3SG4 A;  4GBA A;  2LNK A;  3EK7 A;  3I5F B;  1NWD A;  1J7Q A;  2GV5 A;  4PHJ A;  5TNC A;  1SMG A;  1CMF A;  3CTN A;  4GAO A;  5D69 A;  1VRK A;  1CFC A;  2V53 A;  1H8B A;  3CWG A;  2BE4 A;  1RWY A;  1RJV A;  2OTG B;  1YRU B;  1K96 A;  1CKK A;  4HRE E;  1CFP A;  3ZNI A;  1M46 A;  4MBE A;  1OE9 B;  1W7I B;  2F3Y A;  1F71 A;  3DVE A;  1B8R A;  2MLE C;  1AVS A;  3SG3 A;  2NCP A;  3H4S E;  1CNP A;  1B8L A;  1NYA A;  2BEC A;  3GK1 A;  3PM8 A;  5D7F A;  1SR6 C;  1MWN A;  3BUX B;  1K95 A;  2BE6 A;  1F4Q A;  1DJZ A;  1PAL A;  3PFV A;  1NUB A;  1UUS A;  1YX8 A;  4C0J A;  1OOJ A;  3O78 A;  3DVJ A;  3PLF B;  4PDZ A;  2PAL A;  4WRI A;  4YBH B;  2LCP A;  2KFF A;  2MHH A;  3BUO B;  1SR6 B;  1EG3 A;  1OZS A;  3CR4 X;  3SG5 A;  2JUL A;  1TN4 A;  1A03 A;  2B1U A;  2KQY A;  5ER5 A;  3WNX B;  4PHK A;  2LVI A;  3DF0 B;  4CLN A;  1CLB A;  1NX2 A;  2KYF A;  2BKH B;  1YVL A;  1K9U A;  1F55 A;  4YRU A;  2M7L A;  3OB1 B;  1LIN A;  5DKN A;  4YGB B;  5CPV A;  3IQO A;  2L4H A;  4I5J A;  5G08 A;  2WCB A;  1J7O A;  2LLT A;  1SCV A;  2OPO A;  1E8A A;  4L9M A;  5I2O A;  4M2O A;  3AAJ A;  3BUN B;  1IWQ A;  4ORB B;  3RLZ A;  1YTZ C;  1TNQ A;  3LL8 B;  5ER4 X;  1WRL A;  2L0P A;  3DVM A;  1BJF A;  2LP2 A;  4N5X A;  4YI8 A;  3PN7 B;  1BR1 B;  1CB1 A;  3FIA A;  2BBN A;  2K2F A;  3DF0 A;  2JWW A;  2KFH A;  2JU0 A;  2LC5 A;  2CTN A;  1BMO A;  1DVI A;  1KK7 Y;  1RK9 A;  2D8N A;  3EK8 A;  3EVV A;  3BUM B;  2KYC A;  2IS9 A;  1KK8 C;  1G4Y R;  2BCX A;  1AUI B;  1XO5 A;  1OMV A;  1TIZ A;  1ZMZ A;  1S5G Z;  3BUW B;  1EG4 A;  1NCY A;  3HCM A;  4GUK A;  2Q4U A;  4PE7 A;  1DJW A;  2HF5 A;  3VRQ A;  1NCX A;  2COL B;  2O60 A;  1IQ5 A;  1G8I A;  3ICB A;  1S6I A;  2JZI A;  3A4U B;  1D1O A;  1V1F A;  2L2E A;  2KAY A;  3OX5 A;  2MAZ A;  3I5H C;  2GGM A;  1QJT A;  2WND A;  3K21 A;  4OKH A;  3CS1 A;  1B4C A;  1JC2 A;  1F70 A;  1NPQ A;  3NXA A;  4USL A;  4CID A;  1Y1X A;  1JWD A;  1IH0 A;  1PVB A;  5IBW A;  1OQP A;  2Y5I A;  1A2X A;  4YGA A;  1WLM A;  4DRW A;  2LMU A;  2PVB A;  3CGA A;  2EC6 C;  5JOL A;  5GQQ C;  1REC A;  2K2A A;  1DMO A;  2JT8 A;  1BLQ A;  3ZWH A;  3TDI A;  3EVR A;  2M3W A;  3LK0 A;  1MR8 A;  4PCW A;  2KBM A;  4I5L B;  4JQ0 D;  4R1E A;  2WCE A;  3BOW B;  2EC6 B;  3JTD C;  4OCI A;  1ZFS A;  3IQQ A;  4ZCU A;  2ZRT A;  3TDU A;  5I2Q A;  3D0Y B;  4GGF A;  3I5F C;  4DIR A;  4QJ5 B;  2K7C A;  1ZOT B;  2JNF A;  4HRH A;  3JTD B;  1PUL A;  1JF0 A;  2ZRS A;  1NSH A;  1XFY O;  1B8C A;  1QIV A;  2JOJ A;  1RRO A;  4TNC A;  1QV0 A;  2K0J A;  1SKT A;  1B7T Y;  2BCB A;  1A75 B;  2OTG C;  2WOS A;  2KSP A;  3JVT C;  4YGE B;  3AKB A;  5KTY A;  1BOC A;  1TCF A;  3GOF A;  3BOW A;  1MXE A;  3KPX A;  1S36 A;  3IF7 A;  4DUQ A;  1JFK A;  1TNX A;  3D0Y A;  4FTG A;  3TS5 C;  1MXL C;  2PRU A;  1EL4 A;  2QAC A;  1K93 D;  3JVT B;  3KHE A;  1B47 A;  2F8P A;  2G9B A;  3BYA A;  2LE9 B;  1KCY A;  3F45 A;  1ZAC A;  2LHI A;  5PAL A;  3TS5 B;  1IG5 A;  2Y1N A;  1A75 A;  4AQJ A;  3GK4 X;  1S1E A;  2SAS A;  1JFJ A;  4YI9 A;  3KO0 A;  5AXI A;  4OV2 A;  1R2U A;  2M8U A;  4GNK B;  1C07 A;  4C0K A;  1M31 A;  4XYN A;  3WXA A;  1SYM A;  3PSR A;  3CR2 A;  3AAK A;  3C1V A;  4ZCV A;  2AUC A;  2K7D A;  1K9P A;  1GJY A;  2WOR A;  2NLN A;  3KEV A;  1PRW A;  4BY5 A;  2M1K B;  4N1G A;  3PAT A;  2MJW B;  1K2H A;  1C7W A;  4WQ3 A;  1FBV A;  4MZL A;  1LVC D;  1YUR A;  2M9G A;  4GFT A;  2MA2 A;  2H2K A;  1SK6 D;  1CDL A;  2JPT A;  2RGI A;  1F54 A;  2JTZ A;  2LLS A;  2LVV A;  2MRD A;  1SPY A;  1XK4 C;  2M49 B;  2E30 A;  3DD4 A;  4NDC A;  1YVH A;  1KWO C;  1QS7 A;  1OMR A;  2ZND A;  1QX2 A;  1DGU A;  3EKJ A;  4I5N B;  3PN7 C;  2M7N A;  1AK8 A;  2EHB A;  3QRX A;  1GGW A;  1L2O C;  3NSO A;  1J55 A;  1KWO B;  1SCM B;  3SG7 A;  3LCP C;  1NP8 A;  4PE4 A;  2CBL A;  2LAP A;  2KQ6 A;  2LV7 A;  4QJ3 B;  1LA3 A;  1L2O B;  2KI6 C;  1DJH A;  3SJS A;  2K8M B;  3OB2 B;  4HRG A;  2JTT A;  4N1F A;  1V1G A;  3VRO A;  1NX0 A;  2NZ0 A;  2MBX A;  4C0L A;  4FQO A;  4YGC B;  4GPL B;  4QJ4 B;  1TRF A;  4OR9 B;  2LHL A;  2KGR A;  4OVN F;  1XK4 A;  2I18 A;  3WHU B;  5HLV A;  4CFR A;  1S26 D;  2KAV A;  3EKH A;  3TUY B;  4DS7 A;  1AJ4 A;  1MQ1 A;  1X02 A;  2LMT A;  4YGD B;  2LM5 A;  1A29 A;  4GGF C;  5I8N A;  3BQ3 A;  5HLO A;  1DTL A;  2GGZ A;  4I5K A;  1FF1 A;  1FPW A;  4E68 A;  2MLF C;  5HYD A;  1M63 B;  1UWO A;  1FI6 A;  3VRR A;  1F8H A;  1UHI A;  2KOT A;  4MEW A;  2LLU A;  4AQI A;  3CZT X;  4M2P A;  5BPJ A;  1CMG A;  1SL8 A;  2Y4Q A;  1IGV A;  2R2I A;  1CFD A;  2AAO A;  4PAL A;  1QX5 B;  1OSA A;  3SIA A;  1N65 A;  1QX7 A;  2VRG A;  3I5I B;  3FWC A;  2M1U A;  1CLM A;  2EGD A;  1DT7 B;  2Y1M A;  3TDZ A;  2Q91 A;  2NCO A;  1QAT A;  4PHM A;  5AER A;  3LK1 A;  2QPT A;  1F4O A;  3A8R A;  1QIW A;  3E3R A;  1K94 A;  1S6C A;  1AHR A;  2K7B A;  1TCO B;  4ICB A;  2H61 C;  1KK7 Z;  5CSN A;  2KFG A;  3OX6 A;  2ZFD A;  1OMD A;  4CFQ A;  2FCD A;  1NX1 A;  2F3Z A;  2I7A A;  2KNE A;  2WCF A;  1Y1A A;  2WC8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...