2KI4B

Fgf1-s100a13 complex structure: key component in non-classical path way of fgf1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
96
structure length
96
Chain Sequence
b'MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heparin-binding growth factor 1
publication title The heterohexameric complex structure, a component in the non-classical pathway for fibroblast growth factor 1 (FGF1) secretion.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 35
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2009-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2ki4B00
1BU3A 3DVJA 5JOLA 1NP8A 3SIAA 4C0JA 5PALA 3RM1A 1J7RA 1KFUS 3TUYC 1Y0VH 3BQ3A 1NYAA 4YGDB 4A4BA 5HKWA 5G08A 1CFCA 1FI5A 4N1FA 4D1EA 5KTYA 1MR8A 1AJ4A 2BCAA 4FQOA 4GFTA 1QIWA 2PALA 3AAJA 1BR4B 2M0RA 1OMVA 1SYMA 3OHMB 1B4CA 4OV2A 1KFXL 2BECA 2OTGC 1TNPA 1YRUB 2F3YA 3FWCA 5AEQA 4OVNF 2BKIB 2WORA 2EGDA 1WRKA 1K9PA 1UHIA 3EVRA 4ETOA 2KAVA 3GOFA 3LCPC 2NCOA 4CPVA 1UP5A 1MF8B 1F8HA 4MEWA 1MXLC 2HQWA 2JT0A 2KSPA 1K96A 2I7AA 1FW4A 2JZIA 4M2QA 4NQGA 2SCPA 1MUXA 1PALA 4PHNA 4YBHB 1MXEA 1TN4A 2PASA 5AERA 3ZNIA 2NZ0A 3BOWA 2F2OA 5DKNA 3WNXB 2L0PA 4DS7A 4YI9A 1B47A 5ER4X 5D69A 3CR5X 2L98A 2CBLA 1IGVA 1M45A 1SW8A 1G4YR 1YR5A 2MLFC 2NXQA 1QIVA 4HRHA 2KQYA 2KGRA 3NXAA 3QRXA 2QPTA 3OX5A 2KBMA 1NX1A 3BUMB 2OS8C 1SL7A 4M2OA 1QV1A 1JUOA 2I94A 2LMUA 1MQ1A 1K2HA 1QJTA 1VRKA 2F8PA 2ISDA 3TDUA 1WRLA 1RJVA 2HPSA 3DF0B 1CM4A 4NDDA 1G33A 1B7TZ 1WLMA 2EHBA 2LANA 4MN0A 3EK7A 1ZFSA 2KOTA 2JXLA 2L4IA 1YUSA 1JFKA 2NCPA 1KWOB 1PSBA 1BT6A 1N0YA 1D1OA 3EKHA 4XYNA 1ZOTB 1CNPA 3KHEA 1KWOC 3HCMA 2I2RE 1DGUA 1V1GA 2DOQA 5I2LA 1B8CA 1TRFA 1FPWA 1M46A 1OQPA 1F54A 1SRAA 1NCXA 2BBMA 2M1UA 1KQMC 1K95A 1DF0A 2M1KB 1KK7Z 1A03A 3DD4A 1XO5A 1N65A 4I5LB 2OPOA 1AUIB 4ORCB 4XJKB 1BLQA 4MRXA 2K7OA 1WLZA 3PN7B 3C1VA 2F3ZA 2K7CA 3F45A 2KYFA 3I5IB 2KI4B 2K0JA 3CTNA 2JQ6A 4ORAB 2KNEA 3I5IC 1JFJA 1CKKA 1CLLA 2JNFA 4JWQA 2KFFA 2H61A 3EVUA 4FTGA 1A29A 5KSZA 5DKQA 3D0YB 2MLEC 4F0ZB 1F70A 5HKZA 3CR2A 2MAZA 1SCMB 1QLKA 3BUOB 1J7PA 1S5GZ 3KEVA 4CIDA 1Y1XA 1RTP1 3JVTB 2KI6D 3NSLA 4GNKB 1SCMC 3PM8A 2JULA 2BL0B 2K8MB 4YRUA 1YX8A 1G8IA 2JWWA 1BOCA 4HSZA 2JT8A 3GK4X 4OKHA 2PRUA 1ZUZA 4U8DA 1W7IB 2V53A 4PHKA 2WCEA 4E68A 1HT9A 2AUCA 1DMOA 1S6CA 1M31A 1R2UA 5CSIA 1DJGA 2M3WA 1NPQA 1YVHA 4GUKA 1NCZA 1YTZC 1QX2A 1SR6C 2LVKA 1IRJA 3LLEA 2LAPA 4OCIA 4ZCUA 1KCYA 2MHHA 4PE7A 2BE4A 1PVBA 3JTDB 4DCKA 4I5KA 2E30A 3CR4X 3SG3A 3PALA 1DJHA 3JTDC 4QJ3B 1X02A 5J3XA 4DIRA 1CDMA 1ODBA 4MRYA 1QLSA 1B9AA 4PALA 2LCPA 2K7DA 1TOPA 2K7BA 4HRGA 1CDNA 3IF7A 1H8BA 2BCBA 1QX7A 1LKJA 1OMDA 1Y1UA 4M2PA 4WRIA 1KK8B 2JT3A 2LUXA 2NLNA 1DGVA 3TZ1A 2CNPA 2BCXA 2VRGA 1CMGA 1XFWO 4MLWA 3GK1A 5KU1A 1RFJA 1K8UA 3VRPA 1Q80A 1IQ3A 2LM5A 1OSAA 1EXRA 1UUSA 1RECA 1RWYA 1KFXS 2WC8A 4BY4A 1SPYA 3D10A 1UHKA 4UPGA 2LMVA 1ALWA 1BJFA 1SKTA 4Q04A 1QVIZ 2IS9A 1KSMA 3SG5A 3A8RA 2LLUA 3H4SE 4ORBB 4P5OE 3VROA 1SL9A 1DT7B 4AQIA 3SG2A 4PE4A 5CSNA 1LXFC 2ZRSA 3ICBA 2WCFA 1KSOA 3BUXB 5JJGA 3LK0A 1XFVO 2O60A 1PRWA 2ZNDA 2LV7A 4PE1A 2EC6B 1DJYA 1NIWA 1JSAA 3FWBA 1M63B 2EC6C 4YI8A 5K89A 2F33A 3NSKA 2TN4A 1OMRA 3GK2A 3KO0A 1K90D 1IJ6A 3K21A 2G9BA 3I5GB 1QTXA 1HQVA 2I18A 5BPJA 1GQMA 1SY9A 2K2FA 4N1GA 3PSRA 1UURA 1ZMZA 2O5GA 3AAKA 4A4CA 1TTXA 4DRWA 4N5XA 2KFHA 4I5NB 1J1EA 2RGIA 3SG6A 2LUCA 1EJ3A 2L5XB 4ZCVA 3E3RA 4JQ0D 1SBJA 1DJXA 1R6PA 1B7TY 4IL1A 3M0WA 1WY9A 1NWDA 5FYXA 1CMFA 1TNWA 5HLVA 1ALVA 2JPTA 1CM1A 1QX5B 1IG5A 1S36A 2E6WA 3PN7C 2JRFA 1CDPA 1S1EA 1OZOA 3SG4A 5CSJA 1A75A 2KI4C 3I5FB 2M49B 5D7FA 2GV5A 1DJIA 2Y5IA 2HETA 3DVMA 3I5FC 4MBEA 4DUQA 1XFYO 4OR9B 1U5IA 2JTZA 2Q91A 2KDHA 3BOWB 3DVEA 1KK7Y 3DVKA 1L7ZA 2F2PA 4WQ3A 1OZSA 1AP4A 1NX3A 3CWGA 1YVLA 4MSPA 5ER5A 1A4PA 1PSRA 1XYDA 3JVTC 3CS1A 3VRRA 1F4OA 1WRZA 3TS5B 5AFPA 1RROA 2D8NA 5I2OA 2FOTA 1CFFA 1JF0A 2BL0C 4HREE 4GAOA 1TNQA 3A4UB 1FI6A 2PSRA 1S3PA 2LVIA 2LP2A 3BXKA 3IQQA 3O78A 2LHLA 2CTNA 4MZLA 4PCWA 3MSEB 3O4YA 1H4BA 4YGEB 1BF5A 1LA0A 1DJZA 1LVCD 1FF1A 4CFRA 2LC5A 2BE6A 1KFUL 1S5GY 2G2BA 4GGFC 2L2EA 1B8LA 2M8UA 2HQ8A 2WCBA 3LK1A 5HYDA 1F71A 2AMIA 5F6TA 1QXPA 1CLMA 2Q4UA 1J7QA 4AQJA 4MZJA 1XVJA 1WDCB 3TUYB 1JC2A 2KQ6A 2MRDA 1BR1B 1YUUA 2PMYA 1WDCC 3EK4A 1GJYA 3BUWB 1BG1A 3DF0A 2ZFDA 1BMOA 4GBAA 1OOJA 1L2OB 1C7VA 2L50A 1DF0B 3KF9A 5GQQC 2CXJA 1L2OC 1CLBA 1ZACA 1NX2A 1KK8C 1XK4C 1PULA 2H2KA 2MA2A 1XFUO 4C0KA 2LVJA 1QS7A 2KFGA 3SIBA 2MBXA 4AOMA 1IQ5A 5I2QA 1FBVA 3IQOA 1A75B 2OTGB 5HLOA 4YGAA 2B1UA 1EG4A 3O6BA 4WQ2A 2ZN8A 3O2PA 1C7WA 1DTLA 1AHRA 1YRTB 2KYCA 3WHTB 1U5IB 1TCFA 4YGBB 2A4JA 4PDZA 2H61C 2ZNEA 2CT9A 2FCEA 2Y1NA 4XJKA 4JPZB 1CB1A 1NSHA 5AXIA 1B8RA 1UHHA 5I8NA 3NSIA 1EL4A 1GGZA 3EVVA 2KBIA 1JF2A 2M7NA 4R1EA 4USLA 3OB1B 1S6IA 5TNCA 1SK6D 1SNLA 4L9MA 2JXCA 1IKUA 1XA5A 2M9GA 1JWDA 1MHOA 1QASA 3D0YA 2LP3A 2KI6C 4PHMA 1K9UA 3WXAA 1QVIY 2BKHB 2M7LA 1C07A 4NDBA 1KQVA 3BUNB 2JTTA 2AAOA 3BYAA 4TNCA 3KPXA 2CCMA 1DJWA 2K2AA 5DKRA 3TDIA 1Y1AA 1A2XA 3OB2B 4QJ5B 3OP0A 3NSOA 2JU0A 2OS8B 3I5GC 1IJ5A 1NCYA 1NUBA 2JC2A 3WHUB 1DVIA 4GGFA 5B8IB 3ZWHA 1F4QA 1AK8A 2JOJA 1UHNA 4PHJA 2COLB 2ZN9A 1UHJA 3EK8A 1EH2A 1AJ5A 3TDZA 1SCVA 1XFZO 1S6JA 4MVFA 1B1GA 1JBAA 1YURA 1LINA 2MJWB 3SJSA 4QJ4B 1W7JB 1E8AA 1F55A 1IWQA 1NX0A 1TCOB 1TIZA 2L4HA 2LNKA 3AKBA 5IBWA 1S26D 2M97A 1CFDA 2LLTA 2ZKMX 5CSFA 3PLFB 3CLNA 4I5JA 1J55A 2R2IA 2LHIA 1KQMB 1V1FA 1UWOA 5HKYA 1QV0A 1GGWA 3CZTX 3RLZA 2WOSA 2GGZA 1K93D 3HX4A 4PE0A 3SG7A 4YGCB 4C0LA 2HF5A 1TNXA 3EKJA 1XK4A 3PATA 1CTRA 1K94A 2LE9B 3FIAA 1MWNA 4NDCA 2LVVA 1BODA 3VRNA 3AKAA 2PVBA 2ZRTA 4CFQA 3I5HB 3CGAA 1CDLA 4ICBA 3I5HC 1YX7A 3TS5C 1J7OA 2LLSA 2QACA 4GPLB 1RK9A 2WNDA 4GGNA 5AANA 3FS7A 2Y4QA 2Y1MA 4CLNA 2FCDA 3VRQA 2LMTA 2KAYA 2K61A 2SASA 1Y6WA 1M39A 2KGBC 1YUTA 2FJUB 1K9KA 1PVAA 3PFVA 4MZKA 1SL8A 1N2DA 2KAXA 1J1DA 2L51A 3VGOA 2M29A 1IH0A 1EG3A 2BBNA 1XFXO 2GGMA 1CFPA 2JNXA 1QATA 1OE9B 3LL8B 3OX6A 4BY5A 1LA3A 1AVSA 2KHNA 5CPVA 1SMGA 1PK0D 4P2YB 2P6BB 1SR6B
chains in the Genus database with same CATH superfamily
1BU3A 3DVJA 5JOLA 1NP8A 3SIAA 4C0JA 5PALA 3RM1A 1J7RA 1KFUS 3TUYC 2WC5A 1Y0VH 3BQ3A 1NYAA 5D3OA 4YGDB 4A4BA 3FE9A 5HKWA 5G08A 1CFCA 1FI5A 3S0DA 4N1FA 4D1EA 5KTYA 1MR8A 1AJ4A 2BCAA 5I94A 4FQOA 4GFTA 1LS8A 1QIWA 2PALA 3AAJA 1IIOA 4F7FA 1BR4B 2M0RA 1OMVA 4OZDA 1SYMA 3OHMB 1B4CA 4OV2A 1KFXL 2BECA 2OTGC 1TNPA 1YRUB 2P71A 2F3YA 3FWCA 5AEQA 4OVNF 2BKIB 2WORA 2EGDA 1WRKA 1K9PA 1UHIA 3EVRA 4ETOA 2KAVA 3GOFA 3K1EA 5FI7A 3LCPC 2NCOA 4CPVA 1UP5A 1MF8B 1C3YA 1F8HA 3D74A 4MEWA 1MXLC 2HQWA 2JT0A 2KSPA 1K96A 2I7AA 1FW4A 2JZIA 4M2QA 4NQGA 2SCPA 1DELA 1MUXA 1PALA 3B86A 4PHNA 2QEHA 4YBHB 1MXEA 1TN4A 2PASA 5AERA 3ZNIA 3D77A 1Z4HA 2NZ0A 3BOWA 2F2OA 5DKNA 3WNXB 2L0PA 4DS7A 4YI9A 4INWA 1B47A 1XFRA 5ER4X 1OOHA 3PJIA 5D69A 3CR5X 1W9ZA 2PQLA 2L98A 2CBLA 3D78A 1IGVA 1M45A 1SW8A 1G4YR 1YR5A 2MLFC 2NXQA 1QIVA 4HRHA 2KQYA 1TWOA 2KGRA 3NXAA 3QRXA 2QPTA 2QEOA 3UNWA 3OX5A 2KBMA 1NX1A 3BUMB 2OS8C 1SL7A 4M2OA 1QV1A 1JUOA 2I94A 2LMUA 1MQ1A 1K2HA 1QJTA 1VRKA 2F8PA 2JPOA 2ISDA 3TDUA 1WRLA 1RJVA 2HPSA 3DF0B 3B88A 1CM4A 4NDDA 1G33A 1B7TZ 1WLMA 2EHBA 2LANA 1ORGA 4MN0A 3EK7A 1ZFSA 2KOTA 2JXLA 5HL1A 3S0FA 2L4IA 1YUSA 1JFKA 2NCPA 1KWOB 1PSBA 3B6XA 1BT6A 1N0YA 1D1OA 3EKHA 4XYNA 1ZOTB 1CNPA 3KHEA 1KWOC 3HCMA 2I2RE 1DGUA 3CZ1A 1V1GA 2DOQA 5I2LA 1FI6A 1B8CA 1TRFA 1FPWA 1M46A 1OQPA 1F54A 1SRAA 1NCXA 2BBMA 2M1UA 3S0BA 1KQMC 1K95A 2GTEA 1DF0A 2M1KB 1KK7Z 1A03A 3DD4A 1XO5A 2K60A 1N65A 4I5LB 2OPOA 1AUIB 4ORCB 4XJKB 1BLQA 4MRXA 2K7OA 1WLZA 3PN7B 3C1VA 2F3ZA 2K7CA 3F45A 2KYFA 3I5IB 2KI4B 2K0JA 2QEBA 3CTNA 2JQ6A 4ORAB 2KNEA 3I5IC 3R1VA 1Z2CB 1JFJA 1CKKA 1CLLA 2JNFA 4JWQA 2KFFA 2H61A 3EVUA 4FTGA 1A29A 5KSZA 3SS4A 5DKQA 3D0YB 2MLEC 4F0ZB 3BFHA 1F70A 5HKZA 3CR2A 3NHTA 2MAZA 1SCMB 1QLKA 3BUOB 1J7PA 1S5GZ 3KEVA 4CIDA 4PCWA 1Y1XA 1RTP1 3CYZA 3JVTB 2KI6D 3NSLA 4GNKB 1SCMC 3PM8A 2JULA 2L2CA 2BL0B 2K8MB 3BFAA 4YRUA 1YX8A 1G8IA 2JWWA 1BOCA 4HSZA 2JT8A 3GK4X 4OKHA 2PRUA 1ZUZA 2BAPA 4U8DA 2QDIA 1W7IB 2V53A 4PHKA 2WCEA 4E68A 1HT9A 2AUCA 1DMOA 1S6CA 1M31A 1R2UA 5CSIA 1DJGA 2M3WA 3D76A 1NPQA 1YVHA 4GUKA 1NCZA 1YTZC 1QX2A 1SR6C 2LVKA 1IRJA 3LLEA 2LAPA 4OCIA 4ZCUA 1KCYA 2MHHA 3FE8A 4PE7A 2BE4A 3FE6A 1PVBA 3JTDB 4DCKA 4I5KA 1DEKA 2E30A 3CR4X 3SG3A 3BFBA 3PALA 1DJHA 3JTDC 2KLEA 4QJ3B 1X02A 5J3XA 4DIRA 1CDMA 1ODBA 2WCMA 4MRYA 1QLSA 1B9AA 4PALA 1OOGA 2LCPA 2K7DA 1TOPA 2K7BA 4HRGA 3L4LA 1CDNA 3IF7A 1H8BA 3RZSA 2BCBA 1QX7A 1LKJA 1OMDA 1Y1UA 4M2PA 4WRIA 1KK8B 2JT3A 3CDNA 2LUXA 2NLNA 1DGVA 3TZ1A 3OGNA 2CNPA 2BCXA 2VRGA 1CMGA 1XFWO 4MLWA 3GK1A 1QWVA 5KU1A 1RFJA 3OBVA 3Q8IA 1K8UA 3S0EA 3VRPA 1Q80A 1IQ3A 2LM5A 1OSAA 1EXRA 3R1OA 1UUSA 1RECA 1RWYA 1KFXS 2WC8A 4BY4A 1SPYA 3D10A 1UHKA 4UPGA 2LMVA 1ALWA 1BJFA 1SKTA 4Q04A 5DICA 1QVIZ 3VB1A 2IS9A 3O4XA 1KSMA 3SG5A 3A8RA 2LLUA 3H4SE 4ORBB 4P5OE 3VROA 1SL9A 1DT7B 4AQIA 3SG2A 4PE4A 5CSNA 1LXFC 2ZRSA 3ICBA 2WCFA 1KSOA 3BUXB 2KPHA 5JJGA 3LK0A 1XFVO 2O60A 1PRWA 2ZNDA 2LV7A 4PE1A 2EC6B 1DJYA 1NIWA 1JSAA 3FWBA 1M63B 2EC6C 4YI8A 5K89A 3CZ2A 2F33A 3NSKA 2TN4A 1OMRA 3GK2A 3KO0A 1K90D 1IJ6A 3K21A 2G9BA 3I5GB 1QTXA 1HQVA 2I18A 5BPJA 1GQMA 1SY9A 2K2FA 2WCKA 4N1GA 3L4AA 3PSRA 1UURA 1ZMZA 2O5GA 2WCJA 3AAKA 4A4CA 1TTXA 4DRWA 3R72A 2KFHA 4I5NB 4N5XA 1OW4A 1J1EA 3DZTA 2RGIA 3SG6A 2LUCA 1EJ3A 3NHIA 2L5XB 4ZCVA 3E3RA 4JQ0D 1SBJA 1DJXA 1R6PA 1B7TY 4IL1A 3M0WA 1WY9A 1NWDA 5FYXA 1CMFA 1TNWA 5HLVA 1ALVA 2JPTA 1CM1A 1QX5B 2ERBA 1IG5A 1S36A 2E6WA 3PN7C 2JRFA 3DXLA 1CDPA 1S1EA 1OZOA 3SG4A 5CSJA 1A75A 2QEVA 2KI4C 3I5FB 2M49B 5D7FA 2GV5A 1DJIA 3QMEA 1P28A 2Y5IA 2HETA 3DVMA 3I5FC 4MBEA 4DUQA 1XFYO 4OR9B 1U5IA 2JTZA 2Q91A 2KDHA 2WC6A 3BOWB 1KK7Y 3CZ0A 3DVEA 1L7ZA 2F2PA 3DVKA 4WQ3A 5FI2A 1OZSA 1AP4A 1NX3A 3CWGA 1YVLA 4MSPA 5ER5A 2YGUA 1A4PA 1PSRA 1XYDA 3JVTC 2P70A 3CS1A 1F4OA 1WRZA 3TS5B 3VRRA 5AFPA 1RROA 2D8NA 5I2OA 2FOTA 1CFFA 1JF0A 2BL0C 4HREE 4GAOA 5EL2A 1TNQA 3A4UB 3D73A 2PSRA 1S3PA 2LVIA 2LP2A 3BXKA 3DYEA 3IQQA 2LHLA 2CTNA 3O78A 4IJ7A 3MSEB 3O4YA 1H4BA 3D75A 4YGEB 1BF5A 1LA0A 1DJZA 1LVCD 1FF1A 4CFRA 2LC5A 2BE6A 1KFUL 1S5GY 2G2BA 4GGFC 3SS5A 2L2EA 3R1PA 1B8LA 2M8UA 2HQ8A 4INXA 2WCBA 3LK1A 5HYDA 1F71A 4PT1A 1TUZA 2AMIA 5F6TA 3B87A 1QXPA 1CLMA 2Q4UA 1J7QA 3L47A 4MZJA 1XVJA 1WDCB 3TUYB 4AQJA 1JC2A 2KQ6A 2MRDA 1BR1B 1YUUA 2PMYA 1WDCC 3EK4A 1C3ZA 3SS3A 1GJYA 3BUWB 1BG1A 3DF0A 2ZFDA 1BMOA 4GBAA 1OOJA 1L2OB 1C7VA 2L50A 4JKTA 1DF0B 3KF9A 5GQQC 2CXJA 1L2OC 1CLBA 1ZACA 1NX2A 1GM0A 1KK8C 1XK4C 1PULA 2H2KA 2MA2A 2PYQA 1XFUO 4C0KA 2LVJA 1QS7A 2KFGA 3SIBA 2MBXA 4AOMA 1IQ5A 3IVTA 5I2QA 1FBVA 3IQOA 2BNXA 1A75B 2OTGB 5HLOA 2FJYA 3N7HA 4YGAA 2B1UA 1EG4A 3O6BA 4WQ2A 2ZN8A 3O2PA 1C7WA 1DTLA 1AHRA 1OOIX 1YRTB 2KYCA 1U5IB 1TCFA 4YGBB 3WHTB 2A4JA 1T14A 4PDZA 2H61C 2ZNEA 2CT9A 2FCEA 2Y1NA 4XJKA 4JPZB 1CB1A 1NSHA 5AXIA 1B8RA 3B7AA 1UHHA 5I8NA 3NSIA 1EL4A 1DQEA 1GGZA 3EVVA 2KBIA 1JF2A 2M7NA 1TUJA 4R1EA 4USLA 3OB1B 1S6IA 2WCLA 5TNCA 1SK6D 1SNLA 4L9MA 2JXCA 1IKUA 1XA5A 2M9GA 1JWDA 1MHOA 1QASA 3D0YA 2LP3A 2KI6C 4JD9A 1K9UA 4PHMA 3WXAA 1QVIY 2BKHB 2M7LA 1C07A 4NDBA 1KQVA 3BUNB 2JTTA 2AAOA 2H8VA 3BYAA 3DY9A 3KPXA 4TNCA 2CCMA 1DJWA 2K2AA 5DKRA 3TDIA 1Y1AA 1A2XA 3OB2B 4QJ5B 3OP0A 3NSOA 3UO9A 1OOFA 2JU0A 2OS8B 3CABA 3I5GC 1IJ5A 1NCYA 1NUBA 2JC2A 3WHUB 1DVIA 4GGFA 5B8IB 3ZWHA 1F4QA 3V2LA 1AK8A 2JOJA 1UHNA 4PHJA 2COLB 2ZN9A 1UHJA 3EK8A 1EH2A 1DC1A 1AJ5A 3TDZA 1SCVA 1XFZO 1S6JA 4MVFA 1B1GA 1JBAA 1YURA 1LINA 2MJWB 3SJSA 4QJ4B 4MZLA 1W7JB 1E8AA 1F55A 1IWQA 1NX0A 1TCOB 1TIZA 2L4HA 2LNKA 3AKBA 5IBWA 1S26D 2M97A 1CFDA 2LLTA 2ZKMX 5CSFA 3PLFB 3CLNA 4I5JA 1J55A 2R2IA 2LHIA 1KQMB 1V1FA 1UWOA 5HKYA 1QV0A 1GGWA 3CZTX 3RLZA 2WOSA 3BJHA 2GGZA 1K93D 3HX4A 4PE0A 3SG7A 4YGCB 4C0LA 2HF5A 3S0GA 1TNXA 3EKJA 1XK4A 3EG5B 3PATA 1CTRA 1K94A 2LE9B 3FIAA 1MWNA 1SSEB 2LVVA 4NDCA 2L5YA 1BODA 3VRNA 3AKAA 2PVBA 3PM2A 2ZRTA 4CFQA 3I5HB 3CGAA 1CDLA 5FI6A 2WCHA 4ICBA 3I5HC 1YX7A 4FQTA 3TS5C 1J7OA 2LLSA 2QACA 4GPLB 1RK9A 3S0AA 2WNDA 4GGNA 5AANA 3FS7A 2Y4QA 2Y1MA 4CLNA 2FCDA 3VRQA 2LMTA 2KAYA 2K61A 2SASA 1Y6WA 1M39A 2KGBC 1YUTA 2FJUB 1K9KA 1PVAA 3PFVA 4MZKA 1SL8A 1N2DA 2KLDA 2KAXA 4KYNA 1J1DA 2L51A 3NGVA 3VGOA 2M29A 1IH0A 1EG3A 2BBNA 1XFXO 2GGMA 1CFPA 2JNXA 1QATA 1OE9B 3LL8B 3OX6A 4BY5A 1LA3A 1AVSA 2KHNA 5CPVA 1SMGA 1PK0D 4P2YB 2P6BB 1SR6B
chains in the Genus database with same CATH topology
1BU3A 3DVJA 5JOLA 1NP8A 3SIAA 4C0JA 5PALA 3RM1A 1J7RA 1KFUS 3TUYC 1Y0VH 3BQ3A 1NYAA 4YGDB 4A4BA 5HKWA 5G08A 1CFCA 1FI5A 4N1FA 4D1EA 5KTYA 1MR8A 1AJ4A 2BCAA 4FQOA 4GFTA 1QIWA 2PALA 3AAJA 1BR4B 2M0RA 1OMVA 1SYMA 3OHMB 1B4CA 4OV2A 1KFXL 2BECA 2OTGC 1TNPA 1YRUB 2F3YA 3FWCA 5AEQA 4OVNF 2BKIB 2WORA 2EGDA 1WRKA 1K9PA 1UHIA 3EVRA 4ETOA 2KAVA 3GOFA 3LCPC 2NCOA 4CPVA 1UP5A 1MF8B 1F8HA 4MEWA 1MXLC 2HQWA 2JT0A 2KSPA 1K96A 2I7AA 1FW4A 2JZIA 4M2QA 4NQGA 2SCPA 1MUXA 1PALA 4PHNA 4YBHB 1MXEA 1TN4A 2PASA 5AERA 3ZNIA 2NZ0A 3BOWA 2F2OA 5DKNA 3WNXB 2L0PA 4DS7A 4YI9A 1B47A 5ER4X 5D69A 3CR5X 2L98A 2CBLA 1IGVA 1M45A 1SW8A 1G4YR 1YR5A 2MLFC 2NXQA 1QIVA 4HRHA 2KQYA 2KGRA 3NXAA 3QRXA 2QPTA 3OX5A 2KBMA 1NX1A 3BUMB 2OS8C 1SL7A 4M2OA 1QV1A 1JUOA 2I94A 2LMUA 1MQ1A 1K2HA 1QJTA 1VRKA 2F8PA 2ISDA 3TDUA 1WRLA 1RJVA 2HPSA 3DF0B 1CM4A 4NDDA 1G33A 1B7TZ 1WLMA 2EHBA 2LANA 4MN0A 3EK7A 1ZFSA 2KOTA 2JXLA 2L4IA 1YUSA 1JFKA 2NCPA 1KWOB 1PSBA 1BT6A 1N0YA 1D1OA 3EKHA 4XYNA 1ZOTB 1CNPA 3KHEA 1KWOC 3HCMA 2I2RE 1DGUA 1V1GA 2DOQA 5I2LA 1B8CA 1TRFA 1FPWA 1M46A 1OQPA 1F54A 1SRAA 1NCXA 2BBMA 2M1UA 1KQMC 1K95A 1DF0A 2M1KB 1KK7Z 1A03A 3DD4A 1XO5A 1N65A 4I5LB 2OPOA 1AUIB 4ORCB 4XJKB 1BLQA 4MRXA 2K7OA 1WLZA 3PN7B 3C1VA 2F3ZA 2K7CA 3F45A 2KYFA 3I5IB 2KI4B 2K0JA 3CTNA 2JQ6A 4ORAB 2KNEA 3I5IC 1JFJA 1CKKA 1CLLA 2JNFA 4JWQA 2KFFA 2H61A 3EVUA 4FTGA 1A29A 5KSZA 5DKQA 3D0YB 2MLEC 4F0ZB 1F70A 5HKZA 3CR2A 2MAZA 1SCMB 1QLKA 3BUOB 1J7PA 1S5GZ 3KEVA 4CIDA 1Y1XA 1RTP1 3JVTB 2KI6D 3NSLA 4GNKB 1SCMC 3PM8A 2JULA 2BL0B 2K8MB 4YRUA 1YX8A 1G8IA 2JWWA 1BOCA 4HSZA 2JT8A 3GK4X 4OKHA 2PRUA 1ZUZA 4U8DA 1W7IB 2V53A 4PHKA 2WCEA 4E68A 1HT9A 2AUCA 1DMOA 1S6CA 1M31A 1R2UA 5CSIA 1DJGA 2M3WA 1NPQA 1YVHA 4GUKA 1NCZA 1YTZC 1QX2A 1SR6C 2LVKA 1IRJA 3LLEA 2LAPA 4OCIA 4ZCUA 1KCYA 2MHHA 4PE7A 2BE4A 1PVBA 3JTDB 4DCKA 4I5KA 2E30A 3CR4X 3SG3A 3PALA 1DJHA 3JTDC 4QJ3B 1X02A 5J3XA 4DIRA 1CDMA 1ODBA 4MRYA 1QLSA 1B9AA 4PALA 2LCPA 2K7DA 1TOPA 2K7BA 4HRGA 1CDNA 3IF7A 1H8BA 2BCBA 1QX7A 1LKJA 1OMDA 1Y1UA 4M2PA 4WRIA 1KK8B 2JT3A 2LUXA 2NLNA 1DGVA 3TZ1A 2CNPA 2BCXA 2VRGA 1CMGA 1XFWO 4MLWA 3GK1A 5KU1A 1RFJA 1K8UA 3VRPA 1Q80A 1IQ3A 2LM5A 1OSAA 1EXRA 1UUSA 1RECA 1RWYA 1KFXS 2WC8A 4BY4A 1SPYA 3D10A 1UHKA 4UPGA 2LMVA 1ALWA 1BJFA 1SKTA 4Q04A 1QVIZ 2IS9A 1KSMA 3SG5A 3A8RA 2LLUA 3H4SE 4ORBB 4P5OE 3VROA 1SL9A 1DT7B 4AQIA 3SG2A 4PE4A 5CSNA 1LXFC 2ZRSA 3ICBA 2WCFA 1KSOA 3BUXB 5JJGA 3LK0A 1XFVO 2O60A 1PRWA 2ZNDA 2LV7A 4PE1A 2EC6B 1DJYA 1NIWA 1JSAA 3FWBA 1M63B 2EC6C 4YI8A 5K89A 2F33A 3NSKA 2TN4A 1OMRA 3GK2A 3KO0A 1K90D 1IJ6A 3K21A 2G9BA 3I5GB 1QTXA 1HQVA 2I18A 5BPJA 1GQMA 1SY9A 2K2FA 4N1GA 3PSRA 1UURA 1ZMZA 2O5GA 3AAKA 4A4CA 1TTXA 4DRWA 4N5XA 2KFHA 4I5NB 1J1EA 2RGIA 3SG6A 2LUCA 1EJ3A 2L5XB 4ZCVA 3E3RA 4JQ0D 1SBJA 1DJXA 1R6PA 1B7TY 4IL1A 3M0WA 1WY9A 1NWDA 5FYXA 1CMFA 1TNWA 5HLVA 1ALVA 2JPTA 1CM1A 1QX5B 1IG5A 1S36A 2E6WA 3PN7C 2JRFA 1CDPA 1S1EA 1OZOA 3SG4A 5CSJA 1A75A 2KI4C 3I5FB 2M49B 5D7FA 2GV5A 1DJIA 2Y5IA 2HETA 3DVMA 3I5FC 4MBEA 4DUQA 1XFYO 4OR9B 1U5IA 2JTZA 2Q91A 2KDHA 3BOWB 3DVEA 1KK7Y 3DVKA 1L7ZA 2F2PA 4WQ3A 1OZSA 1AP4A 1NX3A 3CWGA 1YVLA 4MSPA 5ER5A 1A4PA 1PSRA 1XYDA 3JVTC 3CS1A 3VRRA 1F4OA 1WRZA 3TS5B 5AFPA 1RROA 2D8NA 5I2OA 2FOTA 1CFFA 1JF0A 2BL0C 4HREE 4GAOA 1TNQA 3A4UB 1FI6A 2PSRA 1S3PA 2LVIA 2LP2A 3BXKA 3IQQA 3O78A 2LHLA 2CTNA 4MZLA 4PCWA 3MSEB 3O4YA 1H4BA 4YGEB 1BF5A 1LA0A 1DJZA 1LVCD 1FF1A 4CFRA 2LC5A 2BE6A 1KFUL 1S5GY 2G2BA 4GGFC 2L2EA 1B8LA 2M8UA 2HQ8A 2WCBA 3LK1A 5HYDA 1F71A 2AMIA 5F6TA 1QXPA 1CLMA 2Q4UA 1J7QA 4AQJA 4MZJA 1XVJA 1WDCB 3TUYB 1JC2A 2KQ6A 2MRDA 1BR1B 1YUUA 2PMYA 1WDCC 3EK4A 1GJYA 3BUWB 1BG1A 3DF0A 2ZFDA 1BMOA 4GBAA 1OOJA 1L2OB 1C7VA 2L50A 1DF0B 3KF9A 5GQQC 2CXJA 1L2OC 1CLBA 1ZACA 1NX2A 1KK8C 1XK4C 1PULA 2H2KA 2MA2A 1XFUO 4C0KA 2LVJA 1QS7A 2KFGA 3SIBA 2MBXA 4AOMA 1IQ5A 5I2QA 1FBVA 3IQOA 1A75B 2OTGB 5HLOA 4YGAA 2B1UA 1EG4A 3O6BA 4WQ2A 2ZN8A 3O2PA 1C7WA 1DTLA 1AHRA 1YRTB 2KYCA 3WHTB 1U5IB 1TCFA 4YGBB 2A4JA 4PDZA 2H61C 2ZNEA 2CT9A 2FCEA 2Y1NA 4XJKA 4JPZB 1CB1A 1NSHA 5AXIA 1B8RA 1UHHA 5I8NA 3NSIA 1EL4A 1GGZA 3EVVA 2KBIA 1JF2A 2M7NA 4R1EA 4USLA 3OB1B 1S6IA 5TNCA 1SK6D 1SNLA 4L9MA 2JXCA 1IKUA 1XA5A 2M9GA 1JWDA 1MHOA 1QASA 3D0YA 2LP3A 2KI6C 4PHMA 1K9UA 3WXAA 1QVIY 2BKHB 2M7LA 1C07A 4NDBA 1KQVA 3BUNB 2JTTA 2AAOA 3BYAA 4TNCA 3KPXA 2CCMA 1DJWA 2K2AA 5DKRA 3TDIA 1Y1AA 1A2XA 3OB2B 4QJ5B 3OP0A 3NSOA 2JU0A 2OS8B 3I5GC 1IJ5A 1NCYA 1NUBA 2JC2A 3WHUB 1DVIA 4GGFA 5B8IB 3ZWHA 1F4QA 1AK8A 2JOJA 1UHNA 4PHJA 2COLB 2ZN9A 1UHJA 3EK8A 1EH2A 1AJ5A 3TDZA 1SCVA 1XFZO 1S6JA 4MVFA 1B1GA 1JBAA 1YURA 1LINA 2MJWB 3SJSA 4QJ4B 1W7JB 1E8AA 1F55A 1IWQA 1NX0A 1TCOB 1TIZA 2L4HA 2LNKA 3AKBA 5IBWA 1S26D 2M97A 1CFDA 2LLTA 2ZKMX 5CSFA 3PLFB 3CLNA 4I5JA 1J55A 2R2IA 2LHIA 1KQMB 1V1FA 1UWOA 5HKYA 1QV0A 1GGWA 3CZTX 3RLZA 2WOSA 2GGZA 1K93D 3HX4A 4PE0A 3SG7A 4YGCB 4C0LA 2HF5A 1TNXA 3EKJA 1XK4A 3PATA 1CTRA 1K94A 2LE9B 3FIAA 1MWNA 4NDCA 2LVVA 1BODA 3VRNA 3AKAA 2PVBA 2ZRTA 4CFQA 3I5HB 3CGAA 1CDLA 4ICBA 3I5HC 1YX7A 3TS5C 1J7OA 2LLSA 2QACA 4GPLB 1RK9A 2WNDA 4GGNA 5AANA 3FS7A 2Y4QA 2Y1MA 4CLNA 2FCDA 3VRQA 2LMTA 2KAYA 2K61A 2SASA 1Y6WA 1M39A 2KGBC 1YUTA 2FJUB 1K9KA 1PVAA 3PFVA 4MZKA 1SL8A 1N2DA 2KAXA 1J1DA 2L51A 3VGOA 2M29A 1IH0A 1EG3A 2BBNA 1XFXO 2GGMA 1CFPA 2JNXA 1QATA 1OE9B 3LL8B 3OX6A 4BY5A 1LA3A 1AVSA 2KHNA 5CPVA 1SMGA 1PK0D 4P2YB 2P6BB 1SR6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BU3 A;  3DVJ A;  5JOL A;  1NP8 A;  3SIA A;  4C0J A;  5PAL A;  3RM1 A;  1J7R A;  1KFU S;  3TUY C;  1Y0V H;  3BQ3 A;  1NYA A;  4YGD B;  4A4B A;  5HKW A;  5G08 A;  1CFC A;  1FI5 A;  4N1F A;  4D1E A;  5KTY A;  1MR8 A;  1AJ4 A;  2BCA A;  4FQO A;  4GFT A;  1QIW A;  2PAL A;  3AAJ A;  1BR4 B;  2M0R A;  1OMV A;  1SYM A;  3OHM B;  1B4C A;  4OV2 A;  1KFX L;  2BEC A;  2OTG C;  1TNP A;  1YRU B;  2F3Y A;  3FWC A;  5AEQ A;  4OVN F;  2BKI B;  2WOR A;  2EGD A;  1WRK A;  1K9P A;  1UHI A;  3EVR A;  4ETO A;  2KAV A;  3GOF A;  3LCP C;  2NCO A;  4CPV A;  1UP5 A;  1MF8 B;  1F8H A;  4MEW A;  1MXL C;  2HQW A;  2JT0 A;  2KSP A;  1K96 A;  2I7A A;  1FW4 A;  2JZI A;  4M2Q A;  4NQG A;  2SCP A;  1MUX A;  1PAL A;  4PHN A;  4YBH B;  1MXE A;  1TN4 A;  2PAS A;  5AER A;  3ZNI A;  2NZ0 A;  3BOW A;  2F2O A;  5DKN A;  3WNX B;  2L0P A;  4DS7 A;  4YI9 A;  1B47 A;  5ER4 X;  5D69 A;  3CR5 X;  2L98 A;  2CBL A;  1IGV A;  1M45 A;  1SW8 A;  1G4Y R;  1YR5 A;  2MLF C;  2NXQ A;  1QIV A;  4HRH A;  2KQY A;  2KGR A;  3NXA A;  3QRX A;  2QPT A;  3OX5 A;  2KBM A;  1NX1 A;  3BUM B;  2OS8 C;  1SL7 A;  4M2O A;  1QV1 A;  1JUO A;  2I94 A;  2LMU A;  1MQ1 A;  1K2H A;  1QJT A;  1VRK A;  2F8P A;  2ISD A;  3TDU A;  1WRL A;  1RJV A;  2HPS A;  3DF0 B;  1CM4 A;  4NDD A;  1G33 A;  1B7T Z;  1WLM A;  2EHB A;  2LAN A;  4MN0 A;  3EK7 A;  1ZFS A;  2KOT A;  2JXL A;  2L4I A;  1YUS A;  1JFK A;  2NCP A;  1KWO B;  1PSB A;  1BT6 A;  1N0Y A;  1D1O A;  3EKH A;  4XYN A;  1ZOT B;  1CNP A;  3KHE A;  1KWO C;  3HCM A;  2I2R E;  1DGU A;  1V1G A;  2DOQ A;  5I2L A;  1B8C A;  1TRF A;  1FPW A;  1M46 A;  1OQP A;  1F54 A;  1SRA A;  1NCX A;  2BBM A;  2M1U A;  1KQM C;  1K95 A;  1DF0 A;  2M1K B;  1KK7 Z;  1A03 A;  3DD4 A;  1XO5 A;  1N65 A;  4I5L B;  2OPO A;  1AUI B;  4ORC B;  4XJK B;  1BLQ A;  4MRX A;  2K7O A;  1WLZ A;  3PN7 B;  3C1V A;  2F3Z A;  2K7C A;  3F45 A;  2KYF A;  3I5I B;  2KI4 B;  2K0J A;  3CTN A;  2JQ6 A;  4ORA B;  2KNE A;  3I5I C;  1JFJ A;  1CKK A;  1CLL A;  2JNF A;  4JWQ A;  2KFF A;  2H61 A;  3EVU A;  4FTG A;  1A29 A;  5KSZ A;  5DKQ A;  3D0Y B;  2MLE C;  4F0Z B;  1F70 A;  5HKZ A;  3CR2 A;  2MAZ A;  1SCM B;  1QLK A;  3BUO B;  1J7P A;  1S5G Z;  3KEV A;  4CID A;  1Y1X A;  1RTP 1;  3JVT B;  2KI6 D;  3NSL A;  4GNK B;  1SCM C;  3PM8 A;  2JUL A;  2BL0 B;  2K8M B;  4YRU A;  1YX8 A;  1G8I A;  2JWW A;  1BOC A;  4HSZ A;  2JT8 A;  3GK4 X;  4OKH A;  2PRU A;  1ZUZ A;  4U8D A;  1W7I B;  2V53 A;  4PHK A;  2WCE A;  4E68 A;  1HT9 A;  2AUC A;  1DMO A;  1S6C A;  1M31 A;  1R2U A;  5CSI A;  1DJG A;  2M3W A;  1NPQ A;  1YVH A;  4GUK A;  1NCZ A;  1YTZ C;  1QX2 A;  1SR6 C;  2LVK A;  1IRJ A;  3LLE A;  2LAP A;  4OCI A;  4ZCU A;  1KCY A;  2MHH A;  4PE7 A;  2BE4 A;  1PVB A;  3JTD B;  4DCK A;  4I5K A;  2E30 A;  3CR4 X;  3SG3 A;  3PAL A;  1DJH A;  3JTD C;  4QJ3 B;  1X02 A;  5J3X A;  4DIR A;  1CDM A;  1ODB A;  4MRY A;  1QLS A;  1B9A A;  4PAL A;  2LCP A;  2K7D A;  1TOP A;  2K7B A;  4HRG A;  1CDN A;  3IF7 A;  1H8B A;  2BCB A;  1QX7 A;  1LKJ A;  1OMD A;  1Y1U A;  4M2P A;  4WRI A;  1KK8 B;  2JT3 A;  2LUX A;  2NLN A;  1DGV A;  3TZ1 A;  2CNP A;  2BCX A;  2VRG A;  1CMG A;  1XFW O;  4MLW A;  3GK1 A;  5KU1 A;  1RFJ A;  1K8U A;  3VRP A;  1Q80 A;  1IQ3 A;  2LM5 A;  1OSA A;  1EXR A;  1UUS A;  1REC A;  1RWY A;  1KFX S;  2WC8 A;  4BY4 A;  1SPY A;  3D10 A;  1UHK A;  4UPG A;  2LMV A;  1ALW A;  1BJF A;  1SKT A;  4Q04 A;  1QVI Z;  2IS9 A;  1KSM A;  3SG5 A;  3A8R A;  2LLU A;  3H4S E;  4ORB B;  4P5O E;  3VRO A;  1SL9 A;  1DT7 B;  4AQI A;  3SG2 A;  4PE4 A;  5CSN A;  1LXF C;  2ZRS A;  3ICB A;  2WCF A;  1KSO A;  3BUX B;  5JJG A;  3LK0 A;  1XFV O;  2O60 A;  1PRW A;  2ZND A;  2LV7 A;  4PE1 A;  2EC6 B;  1DJY A;  1NIW A;  1JSA A;  3FWB A;  1M63 B;  2EC6 C;  4YI8 A;  5K89 A;  2F33 A;  3NSK A;  2TN4 A;  1OMR A;  3GK2 A;  3KO0 A;  1K90 D;  1IJ6 A;  3K21 A;  2G9B A;  3I5G B;  1QTX A;  1HQV A;  2I18 A;  5BPJ A;  1GQM A;  1SY9 A;  2K2F A;  4N1G A;  3PSR A;  1UUR A;  1ZMZ A;  2O5G A;  3AAK A;  4A4C A;  1TTX A;  4DRW A;  4N5X A;  2KFH A;  4I5N B;  1J1E A;  2RGI A;  3SG6 A;  2LUC A;  1EJ3 A;  2L5X B;  4ZCV A;  3E3R A;  4JQ0 D;  1SBJ A;  1DJX A;  1R6P A;  1B7T Y;  4IL1 A;  3M0W A;  1WY9 A;  1NWD A;  5FYX A;  1CMF A;  1TNW A;  5HLV A;  1ALV A;  2JPT A;  1CM1 A;  1QX5 B;  1IG5 A;  1S36 A;  2E6W A;  3PN7 C;  2JRF A;  1CDP A;  1S1E A;  1OZO A;  3SG4 A;  5CSJ A;  1A75 A;  2KI4 C;  3I5F B;  2M49 B;  5D7F A;  2GV5 A;  1DJI A;  2Y5I A;  2HET A;  3DVM A;  3I5F C;  4MBE A;  4DUQ A;  1XFY O;  4OR9 B;  1U5I A;  2JTZ A;  2Q91 A;  2KDH A;  3BOW B;  3DVE A;  1KK7 Y;  3DVK A;  1L7Z A;  2F2P A;  4WQ3 A;  1OZS A;  1AP4 A;  1NX3 A;  3CWG A;  1YVL A;  4MSP A;  5ER5 A;  1A4P A;  1PSR A;  1XYD A;  3JVT C;  3CS1 A;  3VRR A;  1F4O A;  1WRZ A;  3TS5 B;  5AFP A;  1RRO A;  2D8N A;  5I2O A;  2FOT A;  1CFF A;  1JF0 A;  2BL0 C;  4HRE E;  4GAO A;  1TNQ A;  3A4U B;  1FI6 A;  2PSR A;  1S3P A;  2LVI A;  2LP2 A;  3BXK A;  3IQQ A;  3O78 A;  2LHL A;  2CTN A;  4MZL A;  4PCW A;  3MSE B;  3O4Y A;  1H4B A;  4YGE B;  1BF5 A;  1LA0 A;  1DJZ A;  1LVC D;  1FF1 A;  4CFR A;  2LC5 A;  2BE6 A;  1KFU L;  1S5G Y;  2G2B A;  4GGF C;  2L2E A;  1B8L A;  2M8U A;  2HQ8 A;  2WCB A;  3LK1 A;  5HYD A;  1F71 A;  2AMI A;  5F6T A;  1QXP A;  1CLM A;  2Q4U A;  1J7Q A;  4AQJ A;  4MZJ A;  1XVJ A;  1WDC B;  3TUY B;  1JC2 A;  2KQ6 A;  2MRD A;  1BR1 B;  1YUU A;  2PMY A;  1WDC C;  3EK4 A;  1GJY A;  3BUW B;  1BG1 A;  3DF0 A;  2ZFD A;  1BMO A;  4GBA A;  1OOJ A;  1L2O B;  1C7V A;  2L50 A;  1DF0 B;  3KF9 A;  5GQQ C;  2CXJ A;  1L2O C;  1CLB A;  1ZAC A;  1NX2 A;  1KK8 C;  1XK4 C;  1PUL A;  2H2K A;  2MA2 A;  1XFU O;  4C0K A;  2LVJ A;  1QS7 A;  2KFG A;  3SIB A;  2MBX A;  4AOM A;  1IQ5 A;  5I2Q A;  1FBV A;  3IQO A;  1A75 B;  2OTG B;  5HLO A;  4YGA A;  2B1U A;  1EG4 A;  3O6B A;  4WQ2 A;  2ZN8 A;  3O2P A;  1C7W A;  1DTL A;  1AHR A;  1YRT B;  2KYC A;  3WHT B;  1U5I B;  1TCF A;  4YGB B;  2A4J A;  4PDZ A;  2H61 C;  2ZNE A;  2CT9 A;  2FCE A;  2Y1N A;  4XJK A;  4JPZ B;  1CB1 A;  1NSH A;  5AXI A;  1B8R A;  1UHH A;  5I8N A;  3NSI A;  1EL4 A;  1GGZ A;  3EVV A;  2KBI A;  1JF2 A;  2M7N A;  4R1E A;  4USL A;  3OB1 B;  1S6I A;  5TNC A;  1SK6 D;  1SNL A;  4L9M A;  2JXC A;  1IKU A;  1XA5 A;  2M9G A;  1JWD A;  1MHO A;  1QAS A;  3D0Y A;  2LP3 A;  2KI6 C;  4PHM A;  1K9U A;  3WXA A;  1QVI Y;  2BKH B;  2M7L A;  1C07 A;  4NDB A;  1KQV A;  3BUN B;  2JTT A;  2AAO A;  3BYA A;  4TNC A;  3KPX A;  2CCM A;  1DJW A;  2K2A A;  5DKR A;  3TDI A;  1Y1A A;  1A2X A;  3OB2 B;  4QJ5 B;  3OP0 A;  3NSO A;  2JU0 A;  2OS8 B;  3I5G C;  1IJ5 A;  1NCY A;  1NUB A;  2JC2 A;  3WHU B;  1DVI A;  4GGF A;  5B8I B;  3ZWH A;  1F4Q A;  1AK8 A;  2JOJ A;  1UHN A;  4PHJ A;  2COL B;  2ZN9 A;  1UHJ A;  3EK8 A;  1EH2 A;  1AJ5 A;  3TDZ A;  1SCV A;  1XFZ O;  1S6J A;  4MVF A;  1B1G A;  1JBA A;  1YUR A;  1LIN A;  2MJW B;  3SJS A;  4QJ4 B;  1W7J B;  1E8A A;  1F55 A;  1IWQ A;  1NX0 A;  1TCO B;  1TIZ A;  2L4H A;  2LNK A;  3AKB A;  5IBW A;  1S26 D;  2M97 A;  1CFD A;  2LLT A;  2ZKM X;  5CSF A;  3PLF B;  3CLN A;  4I5J A;  1J55 A;  2R2I A;  2LHI A;  1KQM B;  1V1F A;  1UWO A;  5HKY A;  1QV0 A;  1GGW A;  3CZT X;  3RLZ A;  2WOS A;  2GGZ A;  1K93 D;  3HX4 A;  4PE0 A;  3SG7 A;  4YGC B;  4C0L A;  2HF5 A;  1TNX A;  3EKJ A;  1XK4 A;  3PAT A;  1CTR A;  1K94 A;  2LE9 B;  3FIA A;  1MWN A;  4NDC A;  2LVV A;  1BOD A;  3VRN A;  3AKA A;  2PVB A;  2ZRT A;  4CFQ A;  3I5H B;  3CGA A;  1CDL A;  4ICB A;  3I5H C;  1YX7 A;  3TS5 C;  1J7O A;  2LLS A;  2QAC A;  4GPL B;  1RK9 A;  2WND A;  4GGN A;  5AAN A;  3FS7 A;  2Y4Q A;  2Y1M A;  4CLN A;  2FCD A;  3VRQ A;  2LMT A;  2KAY A;  2K61 A;  2SAS A;  1Y6W A;  1M39 A;  2KGB C;  1YUT A;  2FJU B;  1K9K A;  1PVA A;  3PFV A;  4MZK A;  1SL8 A;  1N2D A;  2KAX A;  1J1D A;  2L51 A;  3VGO A;  2M29 A;  1IH0 A;  1EG3 A;  2BBN A;  1XFX O;  2GGM A;  1CFP A;  2JNX A;  1QAT A;  1OE9 B;  3LL8 B;  3OX6 A;  4BY5 A;  1LA3 A;  1AVS A;  2KHN A;  5CPV A;  1SMG A;  1PK0 D;  4P2Y B;  2P6B B;  1SR6 B; 
#chains in the Genus database with same CATH topology
 1BU3 A;  3DVJ A;  5JOL A;  1NP8 A;  3SIA A;  4C0J A;  5PAL A;  3RM1 A;  1J7R A;  1KFU S;  3TUY C;  2WC5 A;  1Y0V H;  3BQ3 A;  1NYA A;  5D3O A;  4YGD B;  4A4B A;  3FE9 A;  5HKW A;  5G08 A;  1CFC A;  1FI5 A;  3S0D A;  4N1F A;  4D1E A;  5KTY A;  1MR8 A;  1AJ4 A;  2BCA A;  5I94 A;  4FQO A;  4GFT A;  1LS8 A;  1QIW A;  2PAL A;  3AAJ A;  1IIO A;  4F7F A;  1BR4 B;  2M0R A;  1OMV A;  4OZD A;  1SYM A;  3OHM B;  1B4C A;  4OV2 A;  1KFX L;  2BEC A;  2OTG C;  1TNP A;  1YRU B;  2P71 A;  2F3Y A;  3FWC A;  5AEQ A;  4OVN F;  2BKI B;  2WOR A;  2EGD A;  1WRK A;  1K9P A;  1UHI A;  3EVR A;  4ETO A;  2KAV A;  3GOF A;  3K1E A;  5FI7 A;  3LCP C;  2NCO A;  4CPV A;  1UP5 A;  1MF8 B;  1C3Y A;  1F8H A;  3D74 A;  4MEW A;  1MXL C;  2HQW A;  2JT0 A;  2KSP A;  1K96 A;  2I7A A;  1FW4 A;  2JZI A;  4M2Q A;  4NQG A;  2SCP A;  1DEL A;  1MUX A;  1PAL A;  3B86 A;  4PHN A;  2QEH A;  4YBH B;  1MXE A;  1TN4 A;  2PAS A;  5AER A;  3ZNI A;  3D77 A;  1Z4H A;  2NZ0 A;  3BOW A;  2F2O A;  5DKN A;  3WNX B;  2L0P A;  4DS7 A;  4YI9 A;  4INW A;  1B47 A;  1XFR A;  5ER4 X;  1OOH A;  3PJI A;  5D69 A;  3CR5 X;  1W9Z A;  2PQL A;  2L98 A;  2CBL A;  3D78 A;  1IGV A;  1M45 A;  1SW8 A;  1G4Y R;  1YR5 A;  2MLF C;  2NXQ A;  1QIV A;  4HRH A;  2KQY A;  1TWO A;  2KGR A;  3NXA A;  3QRX A;  2QPT A;  2QEO A;  3UNW A;  3OX5 A;  2KBM A;  1NX1 A;  3BUM B;  2OS8 C;  1SL7 A;  4M2O A;  1QV1 A;  1JUO A;  2I94 A;  2LMU A;  1MQ1 A;  1K2H A;  1QJT A;  1VRK A;  2F8P A;  2JPO A;  2ISD A;  3TDU A;  1WRL A;  1RJV A;  2HPS A;  3DF0 B;  3B88 A;  1CM4 A;  4NDD A;  1G33 A;  1B7T Z;  1WLM A;  2EHB A;  2LAN A;  1ORG A;  4MN0 A;  3EK7 A;  1ZFS A;  2KOT A;  2JXL A;  5HL1 A;  3S0F A;  2L4I A;  1YUS A;  1JFK A;  2NCP A;  1KWO B;  1PSB A;  3B6X A;  1BT6 A;  1N0Y A;  1D1O A;  3EKH A;  4XYN A;  1ZOT B;  1CNP A;  3KHE A;  1KWO C;  3HCM A;  2I2R E;  1DGU A;  3CZ1 A;  1V1G A;  2DOQ A;  5I2L A;  1FI6 A;  1B8C A;  1TRF A;  1FPW A;  1M46 A;  1OQP A;  1F54 A;  1SRA A;  1NCX A;  2BBM A;  2M1U A;  3S0B A;  1KQM C;  1K95 A;  2GTE A;  1DF0 A;  2M1K B;  1KK7 Z;  1A03 A;  3DD4 A;  1XO5 A;  2K60 A;  1N65 A;  4I5L B;  2OPO A;  1AUI B;  4ORC B;  4XJK B;  1BLQ A;  4MRX A;  2K7O A;  1WLZ A;  3PN7 B;  3C1V A;  2F3Z A;  2K7C A;  3F45 A;  2KYF A;  3I5I B;  2KI4 B;  2K0J A;  2QEB A;  3CTN A;  2JQ6 A;  4ORA B;  2KNE A;  3I5I C;  3R1V A;  1Z2C B;  1JFJ A;  1CKK A;  1CLL A;  2JNF A;  4JWQ A;  2KFF A;  2H61 A;  3EVU A;  4FTG A;  1A29 A;  5KSZ A;  3SS4 A;  5DKQ A;  3D0Y B;  2MLE C;  4F0Z B;  3BFH A;  1F70 A;  5HKZ A;  3CR2 A;  3NHT A;  2MAZ A;  1SCM B;  1QLK A;  3BUO B;  1J7P A;  1S5G Z;  3KEV A;  4CID A;  4PCW A;  1Y1X A;  1RTP 1;  3CYZ A;  3JVT B;  2KI6 D;  3NSL A;  4GNK B;  1SCM C;  3PM8 A;  2JUL A;  2L2C A;  2BL0 B;  2K8M B;  3BFA A;  4YRU A;  1YX8 A;  1G8I A;  2JWW A;  1BOC A;  4HSZ A;  2JT8 A;  3GK4 X;  4OKH A;  2PRU A;  1ZUZ A;  2BAP A;  4U8D A;  2QDI A;  1W7I B;  2V53 A;  4PHK A;  2WCE A;  4E68 A;  1HT9 A;  2AUC A;  1DMO A;  1S6C A;  1M31 A;  1R2U A;  5CSI A;  1DJG A;  2M3W A;  3D76 A;  1NPQ A;  1YVH A;  4GUK A;  1NCZ A;  1YTZ C;  1QX2 A;  1SR6 C;  2LVK A;  1IRJ A;  3LLE A;  2LAP A;  4OCI A;  4ZCU A;  1KCY A;  2MHH A;  3FE8 A;  4PE7 A;  2BE4 A;  3FE6 A;  1PVB A;  3JTD B;  4DCK A;  4I5K A;  1DEK A;  2E30 A;  3CR4 X;  3SG3 A;  3BFB A;  3PAL A;  1DJH A;  3JTD C;  2KLE A;  4QJ3 B;  1X02 A;  5J3X A;  4DIR A;  1CDM A;  1ODB A;  2WCM A;  4MRY A;  1QLS A;  1B9A A;  4PAL A;  1OOG A;  2LCP A;  2K7D A;  1TOP A;  2K7B A;  4HRG A;  3L4L A;  1CDN A;  3IF7 A;  1H8B A;  3RZS A;  2BCB A;  1QX7 A;  1LKJ A;  1OMD A;  1Y1U A;  4M2P A;  4WRI A;  1KK8 B;  2JT3 A;  3CDN A;  2LUX A;  2NLN A;  1DGV A;  3TZ1 A;  3OGN A;  2CNP A;  2BCX A;  2VRG A;  1CMG A;  1XFW O;  4MLW A;  3GK1 A;  1QWV A;  5KU1 A;  1RFJ A;  3OBV A;  3Q8I A;  1K8U A;  3S0E A;  3VRP A;  1Q80 A;  1IQ3 A;  2LM5 A;  1OSA A;  1EXR A;  3R1O A;  1UUS A;  1REC A;  1RWY A;  1KFX S;  2WC8 A;  4BY4 A;  1SPY A;  3D10 A;  1UHK A;  4UPG A;  2LMV A;  1ALW A;  1BJF A;  1SKT A;  4Q04 A;  5DIC A;  1QVI Z;  3VB1 A;  2IS9 A;  3O4X A;  1KSM A;  3SG5 A;  3A8R A;  2LLU A;  3H4S E;  4ORB B;  4P5O E;  3VRO A;  1SL9 A;  1DT7 B;  4AQI A;  3SG2 A;  4PE4 A;  5CSN A;  1LXF C;  2ZRS A;  3ICB A;  2WCF A;  1KSO A;  3BUX B;  2KPH A;  5JJG A;  3LK0 A;  1XFV O;  2O60 A;  1PRW A;  2ZND A;  2LV7 A;  4PE1 A;  2EC6 B;  1DJY A;  1NIW A;  1JSA A;  3FWB A;  1M63 B;  2EC6 C;  4YI8 A;  5K89 A;  3CZ2 A;  2F33 A;  3NSK A;  2TN4 A;  1OMR A;  3GK2 A;  3KO0 A;  1K90 D;  1IJ6 A;  3K21 A;  2G9B A;  3I5G B;  1QTX A;  1HQV A;  2I18 A;  5BPJ A;  1GQM A;  1SY9 A;  2K2F A;  2WCK A;  4N1G A;  3L4A A;  3PSR A;  1UUR A;  1ZMZ A;  2O5G A;  2WCJ A;  3AAK A;  4A4C A;  1TTX A;  4DRW A;  3R72 A;  2KFH A;  4I5N B;  4N5X A;  1OW4 A;  1J1E A;  3DZT A;  2RGI A;  3SG6 A;  2LUC A;  1EJ3 A;  3NHI A;  2L5X B;  4ZCV A;  3E3R A;  4JQ0 D;  1SBJ A;  1DJX A;  1R6P A;  1B7T Y;  4IL1 A;  3M0W A;  1WY9 A;  1NWD A;  5FYX A;  1CMF A;  1TNW A;  5HLV A;  1ALV A;  2JPT A;  1CM1 A;  1QX5 B;  2ERB A;  1IG5 A;  1S36 A;  2E6W A;  3PN7 C;  2JRF A;  3DXL A;  1CDP A;  1S1E A;  1OZO A;  3SG4 A;  5CSJ A;  1A75 A;  2QEV A;  2KI4 C;  3I5F B;  2M49 B;  5D7F A;  2GV5 A;  1DJI A;  3QME A;  1P28 A;  2Y5I A;  2HET A;  3DVM A;  3I5F C;  4MBE A;  4DUQ A;  1XFY O;  4OR9 B;  1U5I A;  2JTZ A;  2Q91 A;  2KDH A;  2WC6 A;  3BOW B;  1KK7 Y;  3CZ0 A;  3DVE A;  1L7Z A;  2F2P A;  3DVK A;  4WQ3 A;  5FI2 A;  1OZS A;  1AP4 A;  1NX3 A;  3CWG A;  1YVL A;  4MSP A;  5ER5 A;  2YGU A;  1A4P A;  1PSR A;  1XYD A;  3JVT C;  2P70 A;  3CS1 A;  1F4O A;  1WRZ A;  3TS5 B;  3VRR A;  5AFP A;  1RRO A;  2D8N A;  5I2O A;  2FOT A;  1CFF A;  1JF0 A;  2BL0 C;  4HRE E;  4GAO A;  5EL2 A;  1TNQ A;  3A4U B;  3D73 A;  2PSR A;  1S3P A;  2LVI A;  2LP2 A;  3BXK A;  3DYE A;  3IQQ A;  2LHL A;  2CTN A;  3O78 A;  4IJ7 A;  3MSE B;  3O4Y A;  1H4B A;  3D75 A;  4YGE B;  1BF5 A;  1LA0 A;  1DJZ A;  1LVC D;  1FF1 A;  4CFR A;  2LC5 A;  2BE6 A;  1KFU L;  1S5G Y;  2G2B A;  4GGF C;  3SS5 A;  2L2E A;  3R1P A;  1B8L A;  2M8U A;  2HQ8 A;  4INX A;  2WCB A;  3LK1 A;  5HYD A;  1F71 A;  4PT1 A;  1TUZ A;  2AMI A;  5F6T A;  3B87 A;  1QXP A;  1CLM A;  2Q4U A;  1J7Q A;  3L47 A;  4MZJ A;  1XVJ A;  1WDC B;  3TUY B;  4AQJ A;  1JC2 A;  2KQ6 A;  2MRD A;  1BR1 B;  1YUU A;  2PMY A;  1WDC C;  3EK4 A;  1C3Z A;  3SS3 A;  1GJY A;  3BUW B;  1BG1 A;  3DF0 A;  2ZFD A;  1BMO A;  4GBA A;  1OOJ A;  1L2O B;  1C7V A;  2L50 A;  4JKT A;  1DF0 B;  3KF9 A;  5GQQ C;  2CXJ A;  1L2O C;  1CLB A;  1ZAC A;  1NX2 A;  1GM0 A;  1KK8 C;  1XK4 C;  1PUL A;  2H2K A;  2MA2 A;  2PYQ A;  1XFU O;  4C0K A;  2LVJ A;  1QS7 A;  2KFG A;  3SIB A;  2MBX A;  4AOM A;  1IQ5 A;  3IVT A;  5I2Q A;  1FBV A;  3IQO A;  2BNX A;  1A75 B;  2OTG B;  5HLO A;  2FJY A;  3N7H A;  4YGA A;  2B1U A;  1EG4 A;  3O6B A;  4WQ2 A;  2ZN8 A;  3O2P A;  1C7W A;  1DTL A;  1AHR A;  1OOI X;  1YRT B;  2KYC A;  1U5I B;  1TCF A;  4YGB B;  3WHT B;  2A4J A;  1T14 A;  4PDZ A;  2H61 C;  2ZNE A;  2CT9 A;  2FCE A;  2Y1N A;  4XJK A;  4JPZ B;  1CB1 A;  1NSH A;  5AXI A;  1B8R A;  3B7A A;  1UHH A;  5I8N A;  3NSI A;  1EL4 A;  1DQE A;  1GGZ A;  3EVV A;  2KBI A;  1JF2 A;  2M7N A;  1TUJ A;  4R1E A;  4USL A;  3OB1 B;  1S6I A;  2WCL A;  5TNC A;  1SK6 D;  1SNL A;  4L9M A;  2JXC A;  1IKU A;  1XA5 A;  2M9G A;  1JWD A;  1MHO A;  1QAS A;  3D0Y A;  2LP3 A;  2KI6 C;  4JD9 A;  1K9U A;  4PHM A;  3WXA A;  1QVI Y;  2BKH B;  2M7L A;  1C07 A;  4NDB A;  1KQV A;  3BUN B;  2JTT A;  2AAO A;  2H8V A;  3BYA A;  3DY9 A;  3KPX A;  4TNC A;  2CCM A;  1DJW A;  2K2A A;  5DKR A;  3TDI A;  1Y1A A;  1A2X A;  3OB2 B;  4QJ5 B;  3OP0 A;  3NSO A;  3UO9 A;  1OOF A;  2JU0 A;  2OS8 B;  3CAB A;  3I5G C;  1IJ5 A;  1NCY A;  1NUB A;  2JC2 A;  3WHU B;  1DVI A;  4GGF A;  5B8I B;  3ZWH A;  1F4Q A;  3V2L A;  1AK8 A;  2JOJ A;  1UHN A;  4PHJ A;  2COL B;  2ZN9 A;  1UHJ A;  3EK8 A;  1EH2 A;  1DC1 A;  1AJ5 A;  3TDZ A;  1SCV A;  1XFZ O;  1S6J A;  4MVF A;  1B1G A;  1JBA A;  1YUR A;  1LIN A;  2MJW B;  3SJS A;  4QJ4 B;  4MZL A;  1W7J B;  1E8A A;  1F55 A;  1IWQ A;  1NX0 A;  1TCO B;  1TIZ A;  2L4H A;  2LNK A;  3AKB A;  5IBW A;  1S26 D;  2M97 A;  1CFD A;  2LLT A;  2ZKM X;  5CSF A;  3PLF B;  3CLN A;  4I5J A;  1J55 A;  2R2I A;  2LHI A;  1KQM B;  1V1F A;  1UWO A;  5HKY A;  1QV0 A;  1GGW A;  3CZT X;  3RLZ A;  2WOS A;  3BJH A;  2GGZ A;  1K93 D;  3HX4 A;  4PE0 A;  3SG7 A;  4YGC B;  4C0L A;  2HF5 A;  3S0G A;  1TNX A;  3EKJ A;  1XK4 A;  3EG5 B;  3PAT A;  1CTR A;  1K94 A;  2LE9 B;  3FIA A;  1MWN A;  1SSE B;  2LVV A;  4NDC A;  2L5Y A;  1BOD A;  3VRN A;  3AKA A;  2PVB A;  3PM2 A;  2ZRT A;  4CFQ A;  3I5H B;  3CGA A;  1CDL A;  5FI6 A;  2WCH A;  4ICB A;  3I5H C;  1YX7 A;  4FQT A;  3TS5 C;  1J7O A;  2LLS A;  2QAC A;  4GPL B;  1RK9 A;  3S0A A;  2WND A;  4GGN A;  5AAN A;  3FS7 A;  2Y4Q A;  2Y1M A;  4CLN A;  2FCD A;  3VRQ A;  2LMT A;  2KAY A;  2K61 A;  2SAS A;  1Y6W A;  1M39 A;  2KGB C;  1YUT A;  2FJU B;  1K9K A;  1PVA A;  3PFV A;  4MZK A;  1SL8 A;  1N2D A;  2KLD A;  2KAX A;  4KYN A;  1J1D A;  2L51 A;  3NGV A;  3VGO A;  2M29 A;  1IH0 A;  1EG3 A;  2BBN A;  1XFX O;  2GGM A;  1CFP A;  2JNX A;  1QAT A;  1OE9 B;  3LL8 B;  3OX6 A;  4BY5 A;  1LA3 A;  1AVS A;  2KHN A;  5CPV A;  1SMG A;  1PK0 D;  4P2Y B;  2P6B B;  1SR6 B; 
#chains in the Genus database with same CATH homology
 1BU3 A;  3DVJ A;  5JOL A;  1NP8 A;  3SIA A;  4C0J A;  5PAL A;  3RM1 A;  1J7R A;  1KFU S;  3TUY C;  1Y0V H;  3BQ3 A;  1NYA A;  4YGD B;  4A4B A;  5HKW A;  5G08 A;  1CFC A;  1FI5 A;  4N1F A;  4D1E A;  5KTY A;  1MR8 A;  1AJ4 A;  2BCA A;  4FQO A;  4GFT A;  1QIW A;  2PAL A;  3AAJ A;  1BR4 B;  2M0R A;  1OMV A;  1SYM A;  3OHM B;  1B4C A;  4OV2 A;  1KFX L;  2BEC A;  2OTG C;  1TNP A;  1YRU B;  2F3Y A;  3FWC A;  5AEQ A;  4OVN F;  2BKI B;  2WOR A;  2EGD A;  1WRK A;  1K9P A;  1UHI A;  3EVR A;  4ETO A;  2KAV A;  3GOF A;  3LCP C;  2NCO A;  4CPV A;  1UP5 A;  1MF8 B;  1F8H A;  4MEW A;  1MXL C;  2HQW A;  2JT0 A;  2KSP A;  1K96 A;  2I7A A;  1FW4 A;  2JZI A;  4M2Q A;  4NQG A;  2SCP A;  1MUX A;  1PAL A;  4PHN A;  4YBH B;  1MXE A;  1TN4 A;  2PAS A;  5AER A;  3ZNI A;  2NZ0 A;  3BOW A;  2F2O A;  5DKN A;  3WNX B;  2L0P A;  4DS7 A;  4YI9 A;  1B47 A;  5ER4 X;  5D69 A;  3CR5 X;  2L98 A;  2CBL A;  1IGV A;  1M45 A;  1SW8 A;  1G4Y R;  1YR5 A;  2MLF C;  2NXQ A;  1QIV A;  4HRH A;  2KQY A;  2KGR A;  3NXA A;  3QRX A;  2QPT A;  3OX5 A;  2KBM A;  1NX1 A;  3BUM B;  2OS8 C;  1SL7 A;  4M2O A;  1QV1 A;  1JUO A;  2I94 A;  2LMU A;  1MQ1 A;  1K2H A;  1QJT A;  1VRK A;  2F8P A;  2ISD A;  3TDU A;  1WRL A;  1RJV A;  2HPS A;  3DF0 B;  1CM4 A;  4NDD A;  1G33 A;  1B7T Z;  1WLM A;  2EHB A;  2LAN A;  4MN0 A;  3EK7 A;  1ZFS A;  2KOT A;  2JXL A;  2L4I A;  1YUS A;  1JFK A;  2NCP A;  1KWO B;  1PSB A;  1BT6 A;  1N0Y A;  1D1O A;  3EKH A;  4XYN A;  1ZOT B;  1CNP A;  3KHE A;  1KWO C;  3HCM A;  2I2R E;  1DGU A;  1V1G A;  2DOQ A;  5I2L A;  1B8C A;  1TRF A;  1FPW A;  1M46 A;  1OQP A;  1F54 A;  1SRA A;  1NCX A;  2BBM A;  2M1U A;  1KQM C;  1K95 A;  1DF0 A;  2M1K B;  1KK7 Z;  1A03 A;  3DD4 A;  1XO5 A;  1N65 A;  4I5L B;  2OPO A;  1AUI B;  4ORC B;  4XJK B;  1BLQ A;  4MRX A;  2K7O A;  1WLZ A;  3PN7 B;  3C1V A;  2F3Z A;  2K7C A;  3F45 A;  2KYF A;  3I5I B;  2KI4 B;  2K0J A;  3CTN A;  2JQ6 A;  4ORA B;  2KNE A;  3I5I C;  1JFJ A;  1CKK A;  1CLL A;  2JNF A;  4JWQ A;  2KFF A;  2H61 A;  3EVU A;  4FTG A;  1A29 A;  5KSZ A;  5DKQ A;  3D0Y B;  2MLE C;  4F0Z B;  1F70 A;  5HKZ A;  3CR2 A;  2MAZ A;  1SCM B;  1QLK A;  3BUO B;  1J7P A;  1S5G Z;  3KEV A;  4CID A;  1Y1X A;  1RTP 1;  3JVT B;  2KI6 D;  3NSL A;  4GNK B;  1SCM C;  3PM8 A;  2JUL A;  2BL0 B;  2K8M B;  4YRU A;  1YX8 A;  1G8I A;  2JWW A;  1BOC A;  4HSZ A;  2JT8 A;  3GK4 X;  4OKH A;  2PRU A;  1ZUZ A;  4U8D A;  1W7I B;  2V53 A;  4PHK A;  2WCE A;  4E68 A;  1HT9 A;  2AUC A;  1DMO A;  1S6C A;  1M31 A;  1R2U A;  5CSI A;  1DJG A;  2M3W A;  1NPQ A;  1YVH A;  4GUK A;  1NCZ A;  1YTZ C;  1QX2 A;  1SR6 C;  2LVK A;  1IRJ A;  3LLE A;  2LAP A;  4OCI A;  4ZCU A;  1KCY A;  2MHH A;  4PE7 A;  2BE4 A;  1PVB A;  3JTD B;  4DCK A;  4I5K A;  2E30 A;  3CR4 X;  3SG3 A;  3PAL A;  1DJH A;  3JTD C;  4QJ3 B;  1X02 A;  5J3X A;  4DIR A;  1CDM A;  1ODB A;  4MRY A;  1QLS A;  1B9A A;  4PAL A;  2LCP A;  2K7D A;  1TOP A;  2K7B A;  4HRG A;  1CDN A;  3IF7 A;  1H8B A;  2BCB A;  1QX7 A;  1LKJ A;  1OMD A;  1Y1U A;  4M2P A;  4WRI A;  1KK8 B;  2JT3 A;  2LUX A;  2NLN A;  1DGV A;  3TZ1 A;  2CNP A;  2BCX A;  2VRG A;  1CMG A;  1XFW O;  4MLW A;  3GK1 A;  5KU1 A;  1RFJ A;  1K8U A;  3VRP A;  1Q80 A;  1IQ3 A;  2LM5 A;  1OSA A;  1EXR A;  1UUS A;  1REC A;  1RWY A;  1KFX S;  2WC8 A;  4BY4 A;  1SPY A;  3D10 A;  1UHK A;  4UPG A;  2LMV A;  1ALW A;  1BJF A;  1SKT A;  4Q04 A;  1QVI Z;  2IS9 A;  1KSM A;  3SG5 A;  3A8R A;  2LLU A;  3H4S E;  4ORB B;  4P5O E;  3VRO A;  1SL9 A;  1DT7 B;  4AQI A;  3SG2 A;  4PE4 A;  5CSN A;  1LXF C;  2ZRS A;  3ICB A;  2WCF A;  1KSO A;  3BUX B;  5JJG A;  3LK0 A;  1XFV O;  2O60 A;  1PRW A;  2ZND A;  2LV7 A;  4PE1 A;  2EC6 B;  1DJY A;  1NIW A;  1JSA A;  3FWB A;  1M63 B;  2EC6 C;  4YI8 A;  5K89 A;  2F33 A;  3NSK A;  2TN4 A;  1OMR A;  3GK2 A;  3KO0 A;  1K90 D;  1IJ6 A;  3K21 A;  2G9B A;  3I5G B;  1QTX A;  1HQV A;  2I18 A;  5BPJ A;  1GQM A;  1SY9 A;  2K2F A;  4N1G A;  3PSR A;  1UUR A;  1ZMZ A;  2O5G A;  3AAK A;  4A4C A;  1TTX A;  4DRW A;  4N5X A;  2KFH A;  4I5N B;  1J1E A;  2RGI A;  3SG6 A;  2LUC A;  1EJ3 A;  2L5X B;  4ZCV A;  3E3R A;  4JQ0 D;  1SBJ A;  1DJX A;  1R6P A;  1B7T Y;  4IL1 A;  3M0W A;  1WY9 A;  1NWD A;  5FYX A;  1CMF A;  1TNW A;  5HLV A;  1ALV A;  2JPT A;  1CM1 A;  1QX5 B;  1IG5 A;  1S36 A;  2E6W A;  3PN7 C;  2JRF A;  1CDP A;  1S1E A;  1OZO A;  3SG4 A;  5CSJ A;  1A75 A;  2KI4 C;  3I5F B;  2M49 B;  5D7F A;  2GV5 A;  1DJI A;  2Y5I A;  2HET A;  3DVM A;  3I5F C;  4MBE A;  4DUQ A;  1XFY O;  4OR9 B;  1U5I A;  2JTZ A;  2Q91 A;  2KDH A;  3BOW B;  3DVE A;  1KK7 Y;  3DVK A;  1L7Z A;  2F2P A;  4WQ3 A;  1OZS A;  1AP4 A;  1NX3 A;  3CWG A;  1YVL A;  4MSP A;  5ER5 A;  1A4P A;  1PSR A;  1XYD A;  3JVT C;  3CS1 A;  3VRR A;  1F4O A;  1WRZ A;  3TS5 B;  5AFP A;  1RRO A;  2D8N A;  5I2O A;  2FOT A;  1CFF A;  1JF0 A;  2BL0 C;  4HRE E;  4GAO A;  1TNQ A;  3A4U B;  1FI6 A;  2PSR A;  1S3P A;  2LVI A;  2LP2 A;  3BXK A;  3IQQ A;  3O78 A;  2LHL A;  2CTN A;  4MZL A;  4PCW A;  3MSE B;  3O4Y A;  1H4B A;  4YGE B;  1BF5 A;  1LA0 A;  1DJZ A;  1LVC D;  1FF1 A;  4CFR A;  2LC5 A;  2BE6 A;  1KFU L;  1S5G Y;  2G2B A;  4GGF C;  2L2E A;  1B8L A;  2M8U A;  2HQ8 A;  2WCB A;  3LK1 A;  5HYD A;  1F71 A;  2AMI A;  5F6T A;  1QXP A;  1CLM A;  2Q4U A;  1J7Q A;  4AQJ A;  4MZJ A;  1XVJ A;  1WDC B;  3TUY B;  1JC2 A;  2KQ6 A;  2MRD A;  1BR1 B;  1YUU A;  2PMY A;  1WDC C;  3EK4 A;  1GJY A;  3BUW B;  1BG1 A;  3DF0 A;  2ZFD A;  1BMO A;  4GBA A;  1OOJ A;  1L2O B;  1C7V A;  2L50 A;  1DF0 B;  3KF9 A;  5GQQ C;  2CXJ A;  1L2O C;  1CLB A;  1ZAC A;  1NX2 A;  1KK8 C;  1XK4 C;  1PUL A;  2H2K A;  2MA2 A;  1XFU O;  4C0K A;  2LVJ A;  1QS7 A;  2KFG A;  3SIB A;  2MBX A;  4AOM A;  1IQ5 A;  5I2Q A;  1FBV A;  3IQO A;  1A75 B;  2OTG B;  5HLO A;  4YGA A;  2B1U A;  1EG4 A;  3O6B A;  4WQ2 A;  2ZN8 A;  3O2P A;  1C7W A;  1DTL A;  1AHR A;  1YRT B;  2KYC A;  3WHT B;  1U5I B;  1TCF A;  4YGB B;  2A4J A;  4PDZ A;  2H61 C;  2ZNE A;  2CT9 A;  2FCE A;  2Y1N A;  4XJK A;  4JPZ B;  1CB1 A;  1NSH A;  5AXI A;  1B8R A;  1UHH A;  5I8N A;  3NSI A;  1EL4 A;  1GGZ A;  3EVV A;  2KBI A;  1JF2 A;  2M7N A;  4R1E A;  4USL A;  3OB1 B;  1S6I A;  5TNC A;  1SK6 D;  1SNL A;  4L9M A;  2JXC A;  1IKU A;  1XA5 A;  2M9G A;  1JWD A;  1MHO A;  1QAS A;  3D0Y A;  2LP3 A;  2KI6 C;  4PHM A;  1K9U A;  3WXA A;  1QVI Y;  2BKH B;  2M7L A;  1C07 A;  4NDB A;  1KQV A;  3BUN B;  2JTT A;  2AAO A;  3BYA A;  4TNC A;  3KPX A;  2CCM A;  1DJW A;  2K2A A;  5DKR A;  3TDI A;  1Y1A A;  1A2X A;  3OB2 B;  4QJ5 B;  3OP0 A;  3NSO A;  2JU0 A;  2OS8 B;  3I5G C;  1IJ5 A;  1NCY A;  1NUB A;  2JC2 A;  3WHU B;  1DVI A;  4GGF A;  5B8I B;  3ZWH A;  1F4Q A;  1AK8 A;  2JOJ A;  1UHN A;  4PHJ A;  2COL B;  2ZN9 A;  1UHJ A;  3EK8 A;  1EH2 A;  1AJ5 A;  3TDZ A;  1SCV A;  1XFZ O;  1S6J A;  4MVF A;  1B1G A;  1JBA A;  1YUR A;  1LIN A;  2MJW B;  3SJS A;  4QJ4 B;  1W7J B;  1E8A A;  1F55 A;  1IWQ A;  1NX0 A;  1TCO B;  1TIZ A;  2L4H A;  2LNK A;  3AKB A;  5IBW A;  1S26 D;  2M97 A;  1CFD A;  2LLT A;  2ZKM X;  5CSF A;  3PLF B;  3CLN A;  4I5J A;  1J55 A;  2R2I A;  2LHI A;  1KQM B;  1V1F A;  1UWO A;  5HKY A;  1QV0 A;  1GGW A;  3CZT X;  3RLZ A;  2WOS A;  2GGZ A;  1K93 D;  3HX4 A;  4PE0 A;  3SG7 A;  4YGC B;  4C0L A;  2HF5 A;  1TNX A;  3EKJ A;  1XK4 A;  3PAT A;  1CTR A;  1K94 A;  2LE9 B;  3FIA A;  1MWN A;  4NDC A;  2LVV A;  1BOD A;  3VRN A;  3AKA A;  2PVB A;  2ZRT A;  4CFQ A;  3I5H B;  3CGA A;  1CDL A;  4ICB A;  3I5H C;  1YX7 A;  3TS5 C;  1J7O A;  2LLS A;  2QAC A;  4GPL B;  1RK9 A;  2WND A;  4GGN A;  5AAN A;  3FS7 A;  2Y4Q A;  2Y1M A;  4CLN A;  2FCD A;  3VRQ A;  2LMT A;  2KAY A;  2K61 A;  2SAS A;  1Y6W A;  1M39 A;  2KGB C;  1YUT A;  2FJU B;  1K9K A;  1PVA A;  3PFV A;  4MZK A;  1SL8 A;  1N2D A;  2KAX A;  1J1D A;  2L51 A;  3VGO A;  2M29 A;  1IH0 A;  1EG3 A;  2BBN A;  1XFX O;  2GGM A;  1CFP A;  2JNX A;  1QAT A;  1OE9 B;  3LL8 B;  3OX6 A;  4BY5 A;  1LA3 A;  1AVS A;  2KHN A;  5CPV A;  1SMG A;  1PK0 D;  4P2Y B;  2P6B B;  1SR6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...