2KI4B

Fgf1-s100a13 complex structure: key component in non-classical path way of fgf1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
96
structure length
96
Chain Sequence
MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heparin-binding growth factor 1
publication title The heterohexameric complex structure, a component in the non-classical pathway for fibroblast growth factor 1 (FGF1) secretion.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 35
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2009-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2ki4B00
5F6TA 1PSBA 2I7AA 1M39A 4HRGA 4XJKA 3TDUA 1AHRA 3LK0A 4MVFA 5JOLA 2JT0A 3CLNA 3CWGA 1JUOA 1QTXA 4ORBB 2BE4A 1TN4A 4P5OE 3SIAA 2K7DA 1OMDA 2LP2A 4AQJA 5I8NA 1SNLA 1QVIZ 3OHMB 2JNFA 3HCMA 5I2LA 1CFDA 3PM8A 1IG5A 4MZJA 5D69A 2ZN8A 2QPTA 3MSEB 1F71A 1LA3A 4PE4A 1XFYO 1K94A 2CTNA 1K9KA 1R2UA 3AKAA 3I5GC 1BT6A 1TCOB 3PLFB 3OX6A 1SRAA 2KI6C 5K89A 5CSIA 1IWQA 3CGAA 2ZFDA 1QXPA 1KFXL 1IQ3A 1NWDA 3D10A 1SL9A 1V1FA 2CT9A 3FWCA 3BUMB 1Y1AA 2NCPA 1NCZA 3DD4A 1SYMA 1OMVA 3EK8A 4PALA 2CCMA 3WNXB 4DS7A 4GGFC 1CTRA 3SG4A 5CSJA 5PALA 4I5NB 1Y0VH 1IRJA 3LLEA 1WRLA 4ETOA 2KI4B 2JU0A 4PHJA 2Q4UA 5JJGA 1ZMZA 1RFJA 2MLEC 1DF0A 1NIWA 2KI4C 2K7BA 3PFVA 5J3XA 3AKBA 5I2OA 2KAYA 5CPVA 1A75B 1BMOA 2BKHB 1UHNA 1ZOTB 2JZIA 2MAZA 5HKZA 2BECA 2NZ0A 4OV2A 3SIBA 1WY9A 1DJXA 2BKIB 2GGMA 2JWWA 1BODA 1N0YA 2VRGA 2L4IA 1WDCB 3A4UB 2KI6D 3NSKA 1S1EA 2KAVA 2ISDA 3F45A 3IF7A 5KU1A 2WNDA 1KWOB 1WDCC 4GGNA 3BUNB 1MHOA 1CFCA 3VRPA 1KWOC 3C1VA 1JBAA 1DJZA 4ZCVA 1A4PA 2M7NA 2M8UA 2BCAA 4OVNF 3HX4A 1FI5A 3TS5B 1LKJA 1XO5A 3O78A 3TS5C 2M97A 1BG1A 2EHBA 1GGWA 2PALA 1YR5A 3AAKA 2IS9A 2M49B 4GPLB 5BPJA 4R1EA 3TDIA 3QRXA 2L50A 4Q04A 3WXAA 4NDDA 1XK4A 1SL8A 3GOFA 5TNCA 1EXRA 1UHKA 4MEWA 1ALWA 2FOTA 1K9PA 1JC2A 1K96A 1TRFA 1ZACA 3GK4X 1F70A 1J55A 1WLZA 1GQMA 4YBHB 4U8DA 1EJ3A 3O4YA 2K2AA 3OB2B 1N2DA 3O6BA 1QV0A 1WRKA 1CM4A 2A4JA 2OPOA 3DF0A 2EGDA 1MXEA 2I94A 4BY5A 3LK1A 1B7TZ 3TZ1A 2KNEA 2PSRA 2JT3A 1DT7B 1NYAA 4GNKB 1DJYA 4DUQA 2KGRA 2LMVA 4YRUA 2K7OA 3PN7B 1CNPA 2KFHA 3PN7C 1AP4A 2NLNA 2EC6B 3BUWB 4N1GA 4WQ2A 4MSPA 4NDCA 3RLZA 2EC6C 2KQ6A 2JQ6A 1GJYA 1L2OB 1LINA 4NDBA 1C7VA 4CIDA 3CR5X 3KHEA 1AK8A 1Q80A 4PE0A 2FCDA 2Y5IA 2O5GA 4CFRA 3JVTB 5CSNA 3JVTC 1F55A 3WHTB 1BLQA 4F0ZB 1NCYA 1BJFA 2AAOA 5G08A 3DVKA 3TUYB 2F2OA 1M63B 3TUYC 1IH0A 1B7TY 2NCOA 1RROA 3CR2A 3BXKA 2M29A 2AMIA 3AAJA 2Y1NA 3KEVA 2V53A 2CNPA 1RECA 2LHLA 2KFGA 3EVUA 3VGOA 3VRQA 1SBJA 1UWOA 3JTDB 1A29A 1XFZO 4N1FA 1UHHA 1B4CA 5CSFA 2LVJA 2BBNA 2QACA 2WORA 3JTDC 4GAOA 4BY4A 1HT9A 3I5HB 4YI9A 1S36A 3I5HC 4E68A 1S3PA 1J7QA 1DJHA 1M46A 4A4BA 1SCVA 2I2RE 2KSPA 2KAXA 1BF5A 1JFKA 2P6BB 3VROA 2BCXA 3D0YA 1W7IB 5HKWA 2MHHA 1A03A 1S6CA 2OTGB 1ZUZA 2E6WA 3RM1A 2OTGC 1KFUS 2LM5A 1B47A 1KSMA 3A8RA 5ER4X 1J7PA 2L0PA 1F8HA 2H61A 2WCBA 5FYXA 2LNKA 5DKRA 1B8CA 5B8IB 1QATA 1NX1A 1CKKA 4L9MA 2BCBA 3PALA 4MZKA 1CLMA 2MRDA 1DF0B 1NX3A 1MUXA 1OSAA 4HSZA 4TNCA 1CB1A 1SK6D 1YUTA 1KK8B 2JC2A 2KYCA 3FWBA 1V1GA 1YX7A 1AVSA 1KSOA 2NXQA 4XYNA 4ZCUA 3TDZA 1KK8C 1FF1A 2PMYA 2LHIA 1RWYA 1MWNA 3WHUB 1YVLA 5KTYA 4N5XA 1QV1A 1A75A 5HLOA 1CLBA 2M3WA 2WC8A 4PHKA 1CDPA 1L7ZA 1NP8A 1Y6WA 2G9BA 2JNXA 1CLLA 2KQYA 1A2XA 1NCXA 1DJGA 2LUCA 4MN0A 3BUXB 1DVIA 3ZNIA 4PE1A 1U5IB 2LLUA 3H4SE 4USLA 2LLSA 3BOWB 1S26D 1YRTB 2KOTA 4WQ3A 2M1UA 4YI8A 1PULA 1CFPA 1J1DA 1YURA 3CR4X 1DGVA 1NPQA 1LVCD 2F33A 2M0RA 3VRNA 1F4OA 3EK7A 1J1EA 4P2YB 1D1OA 3IQQA 4YGAA 1SMGA 3EKHA 2LLTA 3SG5A 1XVJA 2WCEA 1OZSA 1LXFC 3KO0A 1JF0A 1FI6A 1MQ1A 2BBMA 2KBIA 1NSHA 5AXIA 4YGDB 4M2PA 1Y1XA 3BQ3A 4DRWA 1JSAA 2LVKA 1XK4C 3GK1A 4QJ3B 5HYDA 1XFUO 2F2PA 1CFFA 2SASA 4PDZA 1WLMA 4MRYA 4C0LA 1TNPA 5AERA 4FQOA 2LANA 4MLWA 1BOCA 2FCEA 4MZLA 2LC5A 2GV5A 2F8PA 2KGBC 2LV7A 3DF0B 2ZRTA 4M2QA 3EK4A 3EKJA 1PVBA 1FBVA 3BYAA 1KFXS 4CPVA 4GFTA 2GGZA 2F3ZA 3KF9A 3FS7A 2L5XB 3SG3A 2RGIA 3ZWHA 1B8RA 1K8UA 4GUKA 1EH2A 3OP0A 2WCFA 1Y1UA 2Y1MA 1JWDA 1TNWA 1S5GY 3K21A 1L2OC 4YGBB 4OCIA 2O60A 4QJ4B 2ZKMX 3O2PA 1RK9A 2LUXA 2FJUB 4OKHA 3SG2A 1S6IA 1NX0A 3I5FB 2WOSA 1W7JB 3I5FC 1KQVA 4XJKB 1KCYA 1C7WA 2K2FA 1SPYA 1J7OA 2Y4QA 4YGCB 3NXAA 4HREE 1TOPA 1DTLA 3OB1B 1C07A 2D8NA 3M0WA 1UP5A 1ZFSA 1H8BA 1OQPA 3LCPC 4JPZB 2JT8A 1QLSA 1TNXA 4AQIA 1IQ5A 2HQWA 3EVRA 1K95A 1TIZA 1XFXO 2M9GA 1CDLA 1CM1A 5HLVA 1NUBA 1BU3A 1WRZA 2KFFA 2KHNA 1PVAA 1UUSA 3SJSA 1KQMB 2JTTA 2PASA 1AJ5A 2SCPA 3BUOB 1KQMC 1FW4A 4ICBA 4AOMA 5HKYA 2LVIA 2ZN9A 1SW8A 4IL1A 5D7FA 2HPSA 5AFPA 3E3RA 4PE7A 3LL8B 4I5JA 3GK2A 1K93D 1S6JA 4QJ5B 4OR9B 1G33A 3I5GB 1DMOA 3SG6A 2JOJA 1OOJA 4C0KA 4ORAB 1EG4A 4GGFA 1MXLC 1CDNA 5AANA 1JFJA 3D0YB 2B1UA 3DVEA 1QIWA 2H2KA 4CFQA 1K9UA 3IQOA 4D1EA 2LVVA 2LP3A 4JWQA 1X02A 4NQGA 1BR1B 2AUCA 2JRFA 4A4CA 2H61C 2JTZA 2CXJA 4JQ0D 5DKNA 2BL0B 1GGZA 2OS8B 1PK0D 1K2HA 2BL0C 2LMUA 1UHJA 1F4QA 2K8MB 3PATA 4PHMA 2OS8C 1B1GA 3ICBA 2LE9B 1DJIA 1F54A 2KBMA 2Q91A 1QVIY 2ZNEA 5AEQA 5KSZA 1QASA 2L2EA 4HRHA 1OZOA 1QX5B 2L51A 5I2QA 1SL7A 3I5IB 3DVMA 1K90D 2HETA 3EVVA 4I5KA 2MBXA 1YUSA 2R2IA 3I5IC 1RTP1 2E30A 1SY9A 1KK7Z 3VRRA 4C0JA 5ER5A 2CBLA 1IJ5A 1QX2A 4MBEA 2I18A 1G4YR 1QLKA 2F3YA 1YVHA 2ZNDA 4DCKA 4WRIA 1NX2A 2M1KB 1U5IA 1S5GZ 2PVBA 3NSLA 3PSRA 1BR4B 3NSOA 2L98A 1TTXA 3BOWA 4FTGA 1B8LA 1DJWA 1PRWA 2JXLA 4YGEB 1B9AA 1QJTA 2ZRSA 2KYFA 5IBWA 3KPXA 2MJWB 4GBAA 2MA2A 1XFWO 1SKTA 2G2BA 3FIAA 1DGUA 1LA0A 1KFUL 1EG3A 2K0JA 1AUIB 1MR8A 1UURA 2K7CA 2TN4A 1J7RA 4MRXA 1M45A 2BE6A 1IGVA 1MF8B 4M2OA 1EL4A 1FPWA 1OMRA 1SR6B 1KK7Y 2JULA 1H4BA 1QS7A 1AJ4A 1SR6C 1G8IA 2M7LA 2LCPA 1CMFA 4PCWA 1QIVA 1IJ6A 1XFVO 1YRUB 1CMGA 1TNQA 2COLB 1CDMA 3OX5A 3CZTX 2PRUA 1YX8A 2MLFC 1QX7A 1PSRA 2LAPA 1IKUA 1E8AA 3SG7A 2KDHA 1UHIA 1YTZC 1HQVA 1M31A 2K61A 2LMTA 2DOQA 2JPTA 2HQ8A 5DKQA 1R6PA 1RJVA 5GQQC 4UPGA 4ORCB 4CLNA 1ALVA 3CTNA 1XYDA 3CS1A 2L4HA 4PHNA 1XA5A 1JF2A 3NSIA 1N65A 1PALA 3DVJA 1ODBA 1SCMB 1YUUA 4I5LB 1VRKA 4DIRA 2HF5A 1OE9B 1TCFA 2JXCA 1SCMC
chains in the Genus database with same CATH superfamily
5F6TA 1PSBA 2I7AA 1M39A 2WCLA 4HRGA 4XJKA 3TDUA 1AHRA 3LK0A 1TUJA 4MVFA 5JOLA 2JT0A 2ERBA 3CLNA 3CWGA 1JUOA 1QTXA 4ORBB 2BE4A 1TN4A 4P5OE 3SIAA 1QWVA 2K7DA 1OMDA 2LP2A 4AQJA 5I8NA 1SNLA 1QVIZ 3OHMB 2JNFA 3HCMA 5I2LA 1CFDA 3PM8A 1IG5A 4MZJA 5D69A 2ZN8A 2QPTA 3MSEB 1F71A 1LA3A 4PE4A 1XFYO 1K94A 2CTNA 1K9KA 1R2UA 2P71A 3AKAA 3I5GC 1BT6A 1TCOB 3PLFB 3OX6A 3L4LA 1SRAA 2KI6C 5K89A 5CSIA 1IWQA 3CGAA 2ZFDA 3CZ0A 1QXPA 1KFXL 1IQ3A 1NWDA 3D10A 1SL9A 1V1FA 2CT9A 3FWCA 4FQTA 3BUMB 1Y1AA 2NCPA 1NCZA 3DD4A 1SYMA 1OMVA 3EK8A 4PALA 2CCMA 3WNXB 4DS7A 4GGFC 1CTRA 3SG4A 5CSJA 5PALA 4I5NB 1Y0VH 1IRJA 3LLEA 3VB1A 3R72A 1WRLA 1OOIX 4ETOA 2KI4B 2JU0A 4PHJA 2Q4UA 5JJGA 1ZMZA 1RFJA 2MLEC 1DF0A 1NIWA 2KI4C 2K7BA 3PFVA 5J3XA 3S0GA 3AKBA 5I2OA 2KAYA 1Z4HA 5CPVA 1A75B 1BMOA 3SS5A 2BKHB 1UHNA 1ZOTB 2JZIA 3D77A 2MAZA 5HKZA 2BECA 2NZ0A 3FE6A 4OV2A 2QEOA 3SIBA 1WY9A 1DJXA 2BKIB 2GGMA 3PJIA 2JWWA 1BODA 1N0YA 2VRGA 5FI6A 2L4IA 1WDCB 3A4UB 2KI6D 3NSKA 1S1EA 2KAVA 2ISDA 3F45A 3IF7A 5KU1A 2WNDA 1KWOB 1WDCC 4GGNA 3BUNB 1MHOA 1CFCA 3VRPA 1KWOC 3C1VA 1JBAA 1DJZA 3S0EA 4ZCVA 1IIOA 1A4PA 2M7NA 2M8UA 2BCAA 4OVNF 3HX4A 3DXLA 1FI5A 1OOFA 3TS5B 1LKJA 1XO5A 3O78A 3TS5C 2M97A 1BG1A 2EHBA 1GGWA 2PALA 1YR5A 3AAKA 3NGVA 2IS9A 2M49B 4GPLB 3CDNA 5BPJA 3CZ2A 4R1EA 3TDIA 3QRXA 2L50A 2QDIA 4Q04A 3WXAA 4NDDA 1XK4A 1SL8A 3OBVA 3GOFA 5TNCA 1EXRA 1UHKA 4MEWA 1ALWA 2FOTA 1K9PA 2WCMA 1K96A 1JC2A 1ZACA 1TRFA 3GK4X 3UO9A 1J55A 1WLZA 1GQMA 1F70A 1LS8A 4YBHB 4U8DA 1EJ3A 3O4YA 2K2AA 3OB2B 1DC1A 1N2DA 3O6BA 3V2LA 1QV0A 1WRKA 1CM4A 2A4JA 2OPOA 3B6XA 2EGDA 3DF0A 1MXEA 2I94A 3Q8IA 4BY5A 3LK1A 1B7TZ 3TZ1A 2KNEA 2PSRA 2JT3A 1DT7B 2WCHA 1NYAA 4GNKB 1DJYA 4DUQA 2KGRA 2LMVA 4YRUA 2K7OA 3PN7B 1CNPA 2GTEA 2KFHA 3PN7C 2P70A 1AP4A 2NLNA 3DZTA 2EC6B 3BUWB 4N1GA 4WQ2A 3DYEA 2BNXA 4MSPA 4NDCA 3RLZA 2EC6C 2KQ6A 2JQ6A 1GM0A 1GJYA 1L2OB 1LINA 4NDBA 1C7VA 4CIDA 3CR5X 3KHEA 1AK8A 1Q80A 4PE0A 3OGNA 2FCDA 2Y5IA 2O5GA 4CFRA 3JVTB 5CSNA 3S0DA 3JVTC 3D76A 1F55A 3WHTB 1BLQA 4F0ZB 1NCYA 1BJFA 2AAOA 5G08A 3DVKA 3TUYB 2F2OA 1M63B 3TUYC 1IH0A 1B7TY 2NCOA 1RROA 3CR2A 3BXKA 2M29A 2AMIA 3AAJA 2Y1NA 3CYZA 3KEVA 2V53A 2CNPA 1RECA 2LHLA 2KFGA 3EVUA 3VGOA 3VRQA 1SBJA 1UWOA 3JTDB 1A29A 1XFZO 4N1FA 1UHHA 1B4CA 3NHTA 5CSFA 2LVJA 2BBNA 2QACA 2WORA 3JTDC 4GAOA 4BY4A 1HT9A 3I5HB 4YI9A 1S36A 3I5HC 3RZSA 4E68A 1S3PA 2KLDA 1J7QA 1DJHA 1M46A 4A4BA 1SCVA 2I2RE 2KSPA 2KAXA 1BF5A 1JFKA 2P6BB 5DICA 3VROA 2BCXA 3D0YA 1W7IB 5HKWA 2MHHA 3SS3A 1A03A 1S6CA 2OTGB 1ZUZA 2E6WA 3S0FA 3RM1A 2OTGC 1KFUS 2LM5A 1B47A 1KSMA 3A8RA 3R1VA 5ER4X 2L0PA 1J7PA 2H61A 2WCBA 5FYXA 1F8HA 2LNKA 5DKRA 1B8CA 2YGUA 1ORGA 5B8IB 1QATA 1NX1A 1CKKA 4L9MA 2BCBA 3BJHA 3PALA 4MZKA 1TUZA 1CLMA 2MRDA 3QMEA 1DF0B 1NX3A 1MUXA 1OSAA 4HSZA 4TNCA 1CB1A 1SK6D 1YUTA 1KK8B 2JC2A 2KYCA 3FWBA 1V1GA 1YX7A 1AVSA 1KSOA 2NXQA 3PM2A 4XYNA 4ZCUA 3TDZA 1KK8C 1FF1A 2PMYA 2LHIA 1RWYA 1MWNA 3WHUB 1YVLA 5KTYA 4N5XA 1QV1A 1A75A 3R1OA 5HLOA 2M3WA 2WC8A 1CLBA 4PHKA 2WC6A 1CDPA 1L7ZA 1NP8A 1DMOA 1Y6WA 2G9BA 2JNXA 2JPOA 1C3ZA 1P28A 1CLLA 2KQYA 1A2XA 1NCXA 1DJGA 2LUCA 1XFRA 4MN0A 3BUXB 3SS4A 1DVIA 3ZNIA 4PE1A 1U5IB 2LLUA 3H4SE 3L4AA 4USLA 4IJ7A 2LLSA 3BOWB 1S26D 1YRTB 2KOTA 4WQ3A 1OOGA 2M1UA 3CZ1A 4YI8A 1PULA 1CFPA 1J1DA 1YURA 3CR4X 3DY9A 1DGVA 1NPQA 1LVCD 2F33A 2M0RA 3VRNA 1F4OA 3EK7A 1J1EA 1W9ZA 3B7AA 4P2YB 1D1OA 3IQQA 4YGAA 1SMGA 2K60A 3EKHA 2LLTA 3SG5A 1XVJA 2WCEA 1OZSA 1LXFC 3KO0A 1JF0A 1FI6A 3B87A 1MQ1A 2BBMA 2KBIA 1NSHA 5AXIA 4YGDB 4M2PA 1Y1XA 3BQ3A 4DRWA 1JSAA 5FI2A 2LVKA 1XK4C 3GK1A 4QJ3B 3S0BA 5HYDA 3CABA 1XFUO 2PQLA 2F2PA 1CFFA 3D73A 2SASA 4PDZA 1WLMA 4MRYA 2WCKA 4C0LA 1TNPA 5AERA 4FQOA 2LANA 4MLWA 1BOCA 2FCEA 4MZLA 2LC5A 2GV5A 2F8PA 2KGBC 2LV7A 3DF0B 2ZRTA 3UNWA 4M2QA 3EK4A 3EKJA 1PVBA 1FBVA 3BYAA 1KFXS 4CPVA 4GFTA 2GGZA 2F3ZA 4INWA 3KF9A 4KYNA 2QEHA 3FE8A 2L5XB 3FS7A 2RGIA 3SG3A 3ZWHA 1B8RA 1K8UA 4GUKA 1EH2A 3OP0A 2WCFA 1Y1UA 2Y1MA 1JWDA 1TNWA 1S5GY 3K21A 1L2OC 4YGBB 4OCIA 2O60A 4QJ4B 2ZKMX 3O2PA 3B86A 1RK9A 2LUXA 2FJUB 4OKHA 3EG5B 3O4XA 3SG2A 1S6IA 1NX0A 3I5FB 2WOSA 1W7JB 1TWOA 4INXA 3I5FC 1KQVA 4XJKB 1KCYA 1C7WA 2K2FA 1SPYA 1J7OA 2Y4QA 4YGCB 3NXAA 4HREE 1TOPA 1DTLA 3OB1B 5D3OA 2D8NA 3M0WA 1C07A 1UP5A 1ZFSA 1H8BA 1OQPA 3LCPC 4JPZB 2JT8A 1QLSA 1TNXA 4AQIA 1IQ5A 2HQWA 2L2CA 3EVRA 1K95A 2WCJA 1TIZA 1XFXO 2M9GA 1SSEB 1CDLA 1CM1A 1NUBA 5HLVA 1BU3A 1WRZA 2KFFA 2KHNA 1PVAA 1UUSA 3SJSA 1KQMB 2JTTA 2PASA 1AJ5A 2SCPA 3BUOB 5EL2A 1KQMC 1FW4A 4ICBA 4AOMA 5FI7A 5HKYA 2LVIA 2ZN9A 1C3YA 1SW8A 4IL1A 5D7FA 1DEKA 2HPSA 5AFPA 3E3RA 4PE7A 3LL8B 4I5JA 3GK2A 1K93D 1S6JA 3NHIA 4OR9B 1G33A 3I5GB 4QJ5B 3SG6A 5HL1A 2JOJA 1OOJA 2KLEA 3K1EA 4C0KA 4ORAB 1EG4A 4GGFA 1MXLC 1CDNA 5AANA 1JFJA 3D0YB 2B1UA 3DVEA 1QIWA 2H2KA 4CFQA 1K9UA 3IQOA 4D1EA 2LVVA 2LP3A 4JWQA 1X02A 4NQGA 1BR1B 2AUCA 2JRFA 4A4CA 2H61C 2JTZA 2CXJA 4JQ0D 5DKNA 2BL0B 3BFBA 1GGZA 3R1PA 2OS8B 1PK0D 1K2HA 2BL0C 2LMUA 1UHJA 1F4QA 2K8MB 3PATA 4PHMA 2OS8C 1B1GA 3ICBA 4F7FA 2LE9B 1DJIA 1F54A 2KBMA 2Q91A 1QVIY 2ZNEA 3B88A 5AEQA 2L5YA 5KSZA 1QASA 2L2EA 4HRHA 1OZOA 4PT1A 5I94A 1QX5B 2L51A 3L47A 5I2QA 1SL7A 2WC5A 3DVMA 1K90D 2HETA 3EVVA 3I5IB 4I5KA 2MBXA 1OW4A 1YUSA 2R2IA 3I5IC 1RTP1 2E30A 1SY9A 2PYQA 1KK7Z 3VRRA 4C0JA 3D78A 5ER5A 2CBLA 1IJ5A 1QX2A 4MBEA 2I18A 1G4YR 1QLKA 3FE9A 2F3YA 1YVHA 2QEBA 2ZNDA 4DCKA 4WRIA 1NX2A 2M1KB 1U5IA 3BFAA 1S5GZ 2PVBA 3NSLA 3PSRA 1BR4B 3NSOA 2L98A 1TTXA 3BOWA 4FTGA 1B8LA 1DJWA 1PRWA 2JXLA 4YGEB 1B9AA 1QJTA 2ZRSA 2KYFA 5IBWA 3KPXA 2MJWB 4GBAA 2MA2A 1XFWO 1SKTA 2G2BA 3FIAA 3D75A 3S0AA 1DGUA 4JD9A 3BFHA 4JKTA 1LA0A 1KFUL 1T14A 1EG3A 2K0JA 1AUIB 1MR8A 1UURA 2K7CA 2TN4A 1J7RA 4MRXA 2KPHA 1M45A 2BE6A 1IGVA 1MF8B 4M2OA 1EL4A 1FPWA 1OMRA 1SR6B 1KK7Y 2JULA 1H4BA 1QS7A 1AJ4A 1SR6C 1G8IA 2M7LA 2LCPA 1DQEA 2QEVA 1CMFA 4PCWA 2BAPA 1QIVA 1IJ6A 1XFVO 1YRUB 3IVTA 1CMGA 1TNQA 2H8VA 2COLB 1CDMA 3OX5A 3CZTX 3N7HA 2PRUA 1YX8A 2MLFC 1OOHA 1QX7A 1PSRA 2LAPA 1IKUA 1E8AA 3SG7A 2FJYA 2KDHA 1UHIA 4OZDA 1DELA 1YTZC 1HQVA 1M31A 2K61A 2LMTA 2DOQA 1Z2CB 2JPTA 2HQ8A 5DKQA 1R6PA 1RJVA 5GQQC 4UPGA 4ORCB 4CLNA 1ALVA 3CTNA 1XYDA 3CS1A 2L4HA 4PHNA 1XA5A 1JF2A 3NSIA 1N65A 1PALA 3DVJA 1ODBA 1SCMB 1YUUA 3D74A 1VRKA 4I5LB 2HF5A 1OE9B 4DIRA 1TCFA 2JXCA 1SCMC
chains in the Genus database with same CATH topology
5F6TA 1PSBA 2I7AA 1M39A 4HRGA 4XJKA 3TDUA 1AHRA 3LK0A 4MVFA 5JOLA 2JT0A 3CLNA 3CWGA 1JUOA 1QTXA 4ORBB 2BE4A 1TN4A 4P5OE 3SIAA 2K7DA 1OMDA 2LP2A 4AQJA 5I8NA 1SNLA 1QVIZ 3OHMB 2JNFA 3HCMA 5I2LA 1CFDA 3PM8A 1IG5A 4MZJA 5D69A 2ZN8A 2QPTA 3MSEB 1F71A 1LA3A 4PE4A 1XFYO 1K94A 2CTNA 1K9KA 1R2UA 3AKAA 3I5GC 1BT6A 1TCOB 3PLFB 3OX6A 1SRAA 2KI6C 5K89A 5CSIA 1IWQA 3CGAA 2ZFDA 1QXPA 1KFXL 1IQ3A 1NWDA 3D10A 1SL9A 1V1FA 2CT9A 3FWCA 3BUMB 1Y1AA 2NCPA 1NCZA 3DD4A 1SYMA 1OMVA 3EK8A 4PALA 2CCMA 3WNXB 4DS7A 4GGFC 1CTRA 3SG4A 5CSJA 5PALA 4I5NB 1Y0VH 1IRJA 3LLEA 1WRLA 4ETOA 2KI4B 2JU0A 4PHJA 2Q4UA 5JJGA 1ZMZA 1RFJA 2MLEC 1DF0A 1NIWA 2KI4C 2K7BA 3PFVA 5J3XA 3AKBA 5I2OA 2KAYA 5CPVA 1A75B 1BMOA 2BKHB 1UHNA 1ZOTB 2JZIA 2MAZA 5HKZA 2BECA 2NZ0A 4OV2A 3SIBA 1WY9A 1DJXA 2BKIB 2GGMA 2JWWA 1BODA 1N0YA 2VRGA 2L4IA 1WDCB 3A4UB 2KI6D 3NSKA 1S1EA 2KAVA 2ISDA 3F45A 3IF7A 5KU1A 2WNDA 1KWOB 1WDCC 4GGNA 3BUNB 1MHOA 1CFCA 3VRPA 1KWOC 3C1VA 1JBAA 1DJZA 4ZCVA 1A4PA 2M7NA 2M8UA 2BCAA 4OVNF 3HX4A 1FI5A 3TS5B 1LKJA 1XO5A 3O78A 3TS5C 2M97A 1BG1A 2EHBA 1GGWA 2PALA 1YR5A 3AAKA 2IS9A 2M49B 4GPLB 5BPJA 4R1EA 3TDIA 3QRXA 2L50A 4Q04A 3WXAA 4NDDA 1XK4A 1SL8A 3GOFA 5TNCA 1EXRA 1UHKA 4MEWA 1ALWA 2FOTA 1K9PA 1JC2A 1K96A 1TRFA 1ZACA 3GK4X 1F70A 1J55A 1WLZA 1GQMA 4YBHB 4U8DA 1EJ3A 3O4YA 2K2AA 3OB2B 1N2DA 3O6BA 1QV0A 1WRKA 1CM4A 2A4JA 2OPOA 3DF0A 2EGDA 1MXEA 2I94A 4BY5A 3LK1A 1B7TZ 3TZ1A 2KNEA 2PSRA 2JT3A 1DT7B 1NYAA 4GNKB 1DJYA 4DUQA 2KGRA 2LMVA 4YRUA 2K7OA 3PN7B 1CNPA 2KFHA 3PN7C 1AP4A 2NLNA 2EC6B 3BUWB 4N1GA 4WQ2A 4MSPA 4NDCA 3RLZA 2EC6C 2KQ6A 2JQ6A 1GJYA 1L2OB 1LINA 4NDBA 1C7VA 4CIDA 3CR5X 3KHEA 1AK8A 1Q80A 4PE0A 2FCDA 2Y5IA 2O5GA 4CFRA 3JVTB 5CSNA 3JVTC 1F55A 3WHTB 1BLQA 4F0ZB 1NCYA 1BJFA 2AAOA 5G08A 3DVKA 3TUYB 2F2OA 1M63B 3TUYC 1IH0A 1B7TY 2NCOA 1RROA 3CR2A 3BXKA 2M29A 2AMIA 3AAJA 2Y1NA 3KEVA 2V53A 2CNPA 1RECA 2LHLA 2KFGA 3EVUA 3VGOA 3VRQA 1SBJA 1UWOA 3JTDB 1A29A 1XFZO 4N1FA 1UHHA 1B4CA 5CSFA 2LVJA 2BBNA 2QACA 2WORA 3JTDC 4GAOA 4BY4A 1HT9A 3I5HB 4YI9A 1S36A 3I5HC 4E68A 1S3PA 1J7QA 1DJHA 1M46A 4A4BA 1SCVA 2I2RE 2KSPA 2KAXA 1BF5A 1JFKA 2P6BB 3VROA 2BCXA 3D0YA 1W7IB 5HKWA 2MHHA 1A03A 1S6CA 2OTGB 1ZUZA 2E6WA 3RM1A 2OTGC 1KFUS 2LM5A 1B47A 1KSMA 3A8RA 5ER4X 1J7PA 2L0PA 1F8HA 2H61A 2WCBA 5FYXA 2LNKA 5DKRA 1B8CA 5B8IB 1QATA 1NX1A 1CKKA 4L9MA 2BCBA 3PALA 4MZKA 1CLMA 2MRDA 1DF0B 1NX3A 1MUXA 1OSAA 4HSZA 4TNCA 1CB1A 1SK6D 1YUTA 1KK8B 2JC2A 2KYCA 3FWBA 1V1GA 1YX7A 1AVSA 1KSOA 2NXQA 4XYNA 4ZCUA 3TDZA 1KK8C 1FF1A 2PMYA 2LHIA 1RWYA 1MWNA 3WHUB 1YVLA 5KTYA 4N5XA 1QV1A 1A75A 5HLOA 1CLBA 2M3WA 2WC8A 4PHKA 1CDPA 1L7ZA 1NP8A 1Y6WA 2G9BA 2JNXA 1CLLA 2KQYA 1A2XA 1NCXA 1DJGA 2LUCA 4MN0A 3BUXB 1DVIA 3ZNIA 4PE1A 1U5IB 2LLUA 3H4SE 4USLA 2LLSA 3BOWB 1S26D 1YRTB 2KOTA 4WQ3A 2M1UA 4YI8A 1PULA 1CFPA 1J1DA 1YURA 3CR4X 1DGVA 1NPQA 1LVCD 2F33A 2M0RA 3VRNA 1F4OA 3EK7A 1J1EA 4P2YB 1D1OA 3IQQA 4YGAA 1SMGA 3EKHA 2LLTA 3SG5A 1XVJA 2WCEA 1OZSA 1LXFC 3KO0A 1JF0A 1FI6A 1MQ1A 2BBMA 2KBIA 1NSHA 5AXIA 4YGDB 4M2PA 1Y1XA 3BQ3A 4DRWA 1JSAA 2LVKA 1XK4C 3GK1A 4QJ3B 5HYDA 1XFUO 2F2PA 1CFFA 2SASA 4PDZA 1WLMA 4MRYA 4C0LA 1TNPA 5AERA 4FQOA 2LANA 4MLWA 1BOCA 2FCEA 4MZLA 2LC5A 2GV5A 2F8PA 2KGBC 2LV7A 3DF0B 2ZRTA 4M2QA 3EK4A 3EKJA 1PVBA 1FBVA 3BYAA 1KFXS 4CPVA 4GFTA 2GGZA 2F3ZA 3KF9A 3FS7A 2L5XB 3SG3A 2RGIA 3ZWHA 1B8RA 1K8UA 4GUKA 1EH2A 3OP0A 2WCFA 1Y1UA 2Y1MA 1JWDA 1TNWA 1S5GY 3K21A 1L2OC 4YGBB 4OCIA 2O60A 4QJ4B 2ZKMX 3O2PA 1RK9A 2LUXA 2FJUB 4OKHA 3SG2A 1S6IA 1NX0A 3I5FB 2WOSA 1W7JB 3I5FC 1KQVA 4XJKB 1KCYA 1C7WA 2K2FA 1SPYA 1J7OA 2Y4QA 4YGCB 3NXAA 4HREE 1TOPA 1DTLA 3OB1B 1C07A 2D8NA 3M0WA 1UP5A 1ZFSA 1H8BA 1OQPA 3LCPC 4JPZB 2JT8A 1QLSA 1TNXA 4AQIA 1IQ5A 2HQWA 3EVRA 1K95A 1TIZA 1XFXO 2M9GA 1CDLA 1CM1A 5HLVA 1NUBA 1BU3A 1WRZA 2KFFA 2KHNA 1PVAA 1UUSA 3SJSA 1KQMB 2JTTA 2PASA 1AJ5A 2SCPA 3BUOB 1KQMC 1FW4A 4ICBA 4AOMA 5HKYA 2LVIA 2ZN9A 1SW8A 4IL1A 5D7FA 2HPSA 5AFPA 3E3RA 4PE7A 3LL8B 4I5JA 3GK2A 1K93D 1S6JA 4QJ5B 4OR9B 1G33A 3I5GB 1DMOA 3SG6A 2JOJA 1OOJA 4C0KA 4ORAB 1EG4A 4GGFA 1MXLC 1CDNA 5AANA 1JFJA 3D0YB 2B1UA 3DVEA 1QIWA 2H2KA 4CFQA 1K9UA 3IQOA 4D1EA 2LVVA 2LP3A 4JWQA 1X02A 4NQGA 1BR1B 2AUCA 2JRFA 4A4CA 2H61C 2JTZA 2CXJA 4JQ0D 5DKNA 2BL0B 1GGZA 2OS8B 1PK0D 1K2HA 2BL0C 2LMUA 1UHJA 1F4QA 2K8MB 3PATA 4PHMA 2OS8C 1B1GA 3ICBA 2LE9B 1DJIA 1F54A 2KBMA 2Q91A 1QVIY 2ZNEA 5AEQA 5KSZA 1QASA 2L2EA 4HRHA 1OZOA 1QX5B 2L51A 5I2QA 1SL7A 3I5IB 3DVMA 1K90D 2HETA 3EVVA 4I5KA 2MBXA 1YUSA 2R2IA 3I5IC 1RTP1 2E30A 1SY9A 1KK7Z 3VRRA 4C0JA 5ER5A 2CBLA 1IJ5A 1QX2A 4MBEA 2I18A 1G4YR 1QLKA 2F3YA 1YVHA 2ZNDA 4DCKA 4WRIA 1NX2A 2M1KB 1U5IA 1S5GZ 2PVBA 3NSLA 3PSRA 1BR4B 3NSOA 2L98A 1TTXA 3BOWA 4FTGA 1B8LA 1DJWA 1PRWA 2JXLA 4YGEB 1B9AA 1QJTA 2ZRSA 2KYFA 5IBWA 3KPXA 2MJWB 4GBAA 2MA2A 1XFWO 1SKTA 2G2BA 3FIAA 1DGUA 1LA0A 1KFUL 1EG3A 2K0JA 1AUIB 1MR8A 1UURA 2K7CA 2TN4A 1J7RA 4MRXA 1M45A 2BE6A 1IGVA 1MF8B 4M2OA 1EL4A 1FPWA 1OMRA 1SR6B 1KK7Y 2JULA 1H4BA 1QS7A 1AJ4A 1SR6C 1G8IA 2M7LA 2LCPA 1CMFA 4PCWA 1QIVA 1IJ6A 1XFVO 1YRUB 1CMGA 1TNQA 2COLB 1CDMA 3OX5A 3CZTX 2PRUA 1YX8A 2MLFC 1QX7A 1PSRA 2LAPA 1IKUA 1E8AA 3SG7A 2KDHA 1UHIA 1YTZC 1HQVA 1M31A 2K61A 2LMTA 2DOQA 2JPTA 2HQ8A 5DKQA 1R6PA 1RJVA 5GQQC 4UPGA 4ORCB 4CLNA 1ALVA 3CTNA 1XYDA 3CS1A 2L4HA 4PHNA 1XA5A 1JF2A 3NSIA 1N65A 1PALA 3DVJA 1ODBA 1SCMB 1YUUA 4I5LB 1VRKA 4DIRA 2HF5A 1OE9B 1TCFA 2JXCA 1SCMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F6T A;  1PSB A;  2I7A A;  1M39 A;  4HRG A;  4XJK A;  3TDU A;  1AHR A;  3LK0 A;  4MVF A;  5JOL A;  2JT0 A;  3CLN A;  3CWG A;  1JUO A;  1QTX A;  4ORB B;  2BE4 A;  1TN4 A;  4P5O E;  3SIA A;  2K7D A;  1OMD A;  2LP2 A;  4AQJ A;  5I8N A;  1SNL A;  1QVI Z;  3OHM B;  2JNF A;  3HCM A;  5I2L A;  1CFD A;  3PM8 A;  1IG5 A;  4MZJ A;  5D69 A;  2ZN8 A;  2QPT A;  3MSE B;  1F71 A;  1LA3 A;  4PE4 A;  1XFY O;  1K94 A;  2CTN A;  1K9K A;  1R2U A;  3AKA A;  3I5G C;  1BT6 A;  1TCO B;  3PLF B;  3OX6 A;  1SRA A;  2KI6 C;  5K89 A;  5CSI A;  1IWQ A;  3CGA A;  2ZFD A;  1QXP A;  1KFX L;  1IQ3 A;  1NWD A;  3D10 A;  1SL9 A;  1V1F A;  2CT9 A;  3FWC A;  3BUM B;  1Y1A A;  2NCP A;  1NCZ A;  3DD4 A;  1SYM A;  1OMV A;  3EK8 A;  4PAL A;  2CCM A;  3WNX B;  4DS7 A;  4GGF C;  1CTR A;  3SG4 A;  5CSJ A;  5PAL A;  4I5N B;  1Y0V H;  1IRJ A;  3LLE A;  1WRL A;  4ETO A;  2KI4 B;  2JU0 A;  4PHJ A;  2Q4U A;  5JJG A;  1ZMZ A;  1RFJ A;  2MLE C;  1DF0 A;  1NIW A;  2KI4 C;  2K7B A;  3PFV A;  5J3X A;  3AKB A;  5I2O A;  2KAY A;  5CPV A;  1A75 B;  1BMO A;  2BKH B;  1UHN A;  1ZOT B;  2JZI A;  2MAZ A;  5HKZ A;  2BEC A;  2NZ0 A;  4OV2 A;  3SIB A;  1WY9 A;  1DJX A;  2BKI B;  2GGM A;  2JWW A;  1BOD A;  1N0Y A;  2VRG A;  2L4I A;  1WDC B;  3A4U B;  2KI6 D;  3NSK A;  1S1E A;  2KAV A;  2ISD A;  3F45 A;  3IF7 A;  5KU1 A;  2WND A;  1KWO B;  1WDC C;  4GGN A;  3BUN B;  1MHO A;  1CFC A;  3VRP A;  1KWO C;  3C1V A;  1JBA A;  1DJZ A;  4ZCV A;  1A4P A;  2M7N A;  2M8U A;  2BCA A;  4OVN F;  3HX4 A;  1FI5 A;  3TS5 B;  1LKJ A;  1XO5 A;  3O78 A;  3TS5 C;  2M97 A;  1BG1 A;  2EHB A;  1GGW A;  2PAL A;  1YR5 A;  3AAK A;  2IS9 A;  2M49 B;  4GPL B;  5BPJ A;  4R1E A;  3TDI A;  3QRX A;  2L50 A;  4Q04 A;  3WXA A;  4NDD A;  1XK4 A;  1SL8 A;  3GOF A;  5TNC A;  1EXR A;  1UHK A;  4MEW A;  1ALW A;  2FOT A;  1K9P A;  1JC2 A;  1K96 A;  1TRF A;  1ZAC A;  3GK4 X;  1F70 A;  1J55 A;  1WLZ A;  1GQM A;  4YBH B;  4U8D A;  1EJ3 A;  3O4Y A;  2K2A A;  3OB2 B;  1N2D A;  3O6B A;  1QV0 A;  1WRK A;  1CM4 A;  2A4J A;  2OPO A;  3DF0 A;  2EGD A;  1MXE A;  2I94 A;  4BY5 A;  3LK1 A;  1B7T Z;  3TZ1 A;  2KNE A;  2PSR A;  2JT3 A;  1DT7 B;  1NYA A;  4GNK B;  1DJY A;  4DUQ A;  2KGR A;  2LMV A;  4YRU A;  2K7O A;  3PN7 B;  1CNP A;  2KFH A;  3PN7 C;  1AP4 A;  2NLN A;  2EC6 B;  3BUW B;  4N1G A;  4WQ2 A;  4MSP A;  4NDC A;  3RLZ A;  2EC6 C;  2KQ6 A;  2JQ6 A;  1GJY A;  1L2O B;  1LIN A;  4NDB A;  1C7V A;  4CID A;  3CR5 X;  3KHE A;  1AK8 A;  1Q80 A;  4PE0 A;  2FCD A;  2Y5I A;  2O5G A;  4CFR A;  3JVT B;  5CSN A;  3JVT C;  1F55 A;  3WHT B;  1BLQ A;  4F0Z B;  1NCY A;  1BJF A;  2AAO A;  5G08 A;  3DVK A;  3TUY B;  2F2O A;  1M63 B;  3TUY C;  1IH0 A;  1B7T Y;  2NCO A;  1RRO A;  3CR2 A;  3BXK A;  2M29 A;  2AMI A;  3AAJ A;  2Y1N A;  3KEV A;  2V53 A;  2CNP A;  1REC A;  2LHL A;  2KFG A;  3EVU A;  3VGO A;  3VRQ A;  1SBJ A;  1UWO A;  3JTD B;  1A29 A;  1XFZ O;  4N1F A;  1UHH A;  1B4C A;  5CSF A;  2LVJ A;  2BBN A;  2QAC A;  2WOR A;  3JTD C;  4GAO A;  4BY4 A;  1HT9 A;  3I5H B;  4YI9 A;  1S36 A;  3I5H C;  4E68 A;  1S3P A;  1J7Q A;  1DJH A;  1M46 A;  4A4B A;  1SCV A;  2I2R E;  2KSP A;  2KAX A;  1BF5 A;  1JFK A;  2P6B B;  3VRO A;  2BCX A;  3D0Y A;  1W7I B;  5HKW A;  2MHH A;  1A03 A;  1S6C A;  2OTG B;  1ZUZ A;  2E6W A;  3RM1 A;  2OTG C;  1KFU S;  2LM5 A;  1B47 A;  1KSM A;  3A8R A;  5ER4 X;  1J7P A;  2L0P A;  1F8H A;  2H61 A;  2WCB A;  5FYX A;  2LNK A;  5DKR A;  1B8C A;  5B8I B;  1QAT A;  1NX1 A;  1CKK A;  4L9M A;  2BCB A;  3PAL A;  4MZK A;  1CLM A;  2MRD A;  1DF0 B;  1NX3 A;  1MUX A;  1OSA A;  4HSZ A;  4TNC A;  1CB1 A;  1SK6 D;  1YUT A;  1KK8 B;  2JC2 A;  2KYC A;  3FWB A;  1V1G A;  1YX7 A;  1AVS A;  1KSO A;  2NXQ A;  4XYN A;  4ZCU A;  3TDZ A;  1KK8 C;  1FF1 A;  2PMY A;  2LHI A;  1RWY A;  1MWN A;  3WHU B;  1YVL A;  5KTY A;  4N5X A;  1QV1 A;  1A75 A;  5HLO A;  1CLB A;  2M3W A;  2WC8 A;  4PHK A;  1CDP A;  1L7Z A;  1NP8 A;  1Y6W A;  2G9B A;  2JNX A;  1CLL A;  2KQY A;  1A2X A;  1NCX A;  1DJG A;  2LUC A;  4MN0 A;  3BUX B;  1DVI A;  3ZNI A;  4PE1 A;  1U5I B;  2LLU A;  3H4S E;  4USL A;  2LLS A;  3BOW B;  1S26 D;  1YRT B;  2KOT A;  4WQ3 A;  2M1U A;  4YI8 A;  1PUL A;  1CFP A;  1J1D A;  1YUR A;  3CR4 X;  1DGV A;  1NPQ A;  1LVC D;  2F33 A;  2M0R A;  3VRN A;  1F4O A;  3EK7 A;  1J1E A;  4P2Y B;  1D1O A;  3IQQ A;  4YGA A;  1SMG A;  3EKH A;  2LLT A;  3SG5 A;  1XVJ A;  2WCE A;  1OZS A;  1LXF C;  3KO0 A;  1JF0 A;  1FI6 A;  1MQ1 A;  2BBM A;  2KBI A;  1NSH A;  5AXI A;  4YGD B;  4M2P A;  1Y1X A;  3BQ3 A;  4DRW A;  1JSA A;  2LVK A;  1XK4 C;  3GK1 A;  4QJ3 B;  5HYD A;  1XFU O;  2F2P A;  1CFF A;  2SAS A;  4PDZ A;  1WLM A;  4MRY A;  4C0L A;  1TNP A;  5AER A;  4FQO A;  2LAN A;  4MLW A;  1BOC A;  2FCE A;  4MZL A;  2LC5 A;  2GV5 A;  2F8P A;  2KGB C;  2LV7 A;  3DF0 B;  2ZRT A;  4M2Q A;  3EK4 A;  3EKJ A;  1PVB A;  1FBV A;  3BYA A;  1KFX S;  4CPV A;  4GFT A;  2GGZ A;  2F3Z A;  3KF9 A;  3FS7 A;  2L5X B;  3SG3 A;  2RGI A;  3ZWH A;  1B8R A;  1K8U A;  4GUK A;  1EH2 A;  3OP0 A;  2WCF A;  1Y1U A;  2Y1M A;  1JWD A;  1TNW A;  1S5G Y;  3K21 A;  1L2O C;  4YGB B;  4OCI A;  2O60 A;  4QJ4 B;  2ZKM X;  3O2P A;  1RK9 A;  2LUX A;  2FJU B;  4OKH A;  3SG2 A;  1S6I A;  1NX0 A;  3I5F B;  2WOS A;  1W7J B;  3I5F C;  1KQV A;  4XJK B;  1KCY A;  1C7W A;  2K2F A;  1SPY A;  1J7O A;  2Y4Q A;  4YGC B;  3NXA A;  4HRE E;  1TOP A;  1DTL A;  3OB1 B;  1C07 A;  2D8N A;  3M0W A;  1UP5 A;  1ZFS A;  1H8B A;  1OQP A;  3LCP C;  4JPZ B;  2JT8 A;  1QLS A;  1TNX A;  4AQI A;  1IQ5 A;  2HQW A;  3EVR A;  1K95 A;  1TIZ A;  1XFX O;  2M9G A;  1CDL A;  1CM1 A;  5HLV A;  1NUB A;  1BU3 A;  1WRZ A;  2KFF A;  2KHN A;  1PVA A;  1UUS A;  3SJS A;  1KQM B;  2JTT A;  2PAS A;  1AJ5 A;  2SCP A;  3BUO B;  1KQM C;  1FW4 A;  4ICB A;  4AOM A;  5HKY A;  2LVI A;  2ZN9 A;  1SW8 A;  4IL1 A;  5D7F A;  2HPS A;  5AFP A;  3E3R A;  4PE7 A;  3LL8 B;  4I5J A;  3GK2 A;  1K93 D;  1S6J A;  4QJ5 B;  4OR9 B;  1G33 A;  3I5G B;  1DMO A;  3SG6 A;  2JOJ A;  1OOJ A;  4C0K A;  4ORA B;  1EG4 A;  4GGF A;  1MXL C;  1CDN A;  5AAN A;  1JFJ A;  3D0Y B;  2B1U A;  3DVE A;  1QIW A;  2H2K A;  4CFQ A;  1K9U A;  3IQO A;  4D1E A;  2LVV A;  2LP3 A;  4JWQ A;  1X02 A;  4NQG A;  1BR1 B;  2AUC A;  2JRF A;  4A4C A;  2H61 C;  2JTZ A;  2CXJ A;  4JQ0 D;  5DKN A;  2BL0 B;  1GGZ A;  2OS8 B;  1PK0 D;  1K2H A;  2BL0 C;  2LMU A;  1UHJ A;  1F4Q A;  2K8M B;  3PAT A;  4PHM A;  2OS8 C;  1B1G A;  3ICB A;  2LE9 B;  1DJI A;  1F54 A;  2KBM A;  2Q91 A;  1QVI Y;  2ZNE A;  5AEQ A;  5KSZ A;  1QAS A;  2L2E A;  4HRH A;  1OZO A;  1QX5 B;  2L51 A;  5I2Q A;  1SL7 A;  3I5I B;  3DVM A;  1K90 D;  2HET A;  3EVV A;  4I5K A;  2MBX A;  1YUS A;  2R2I A;  3I5I C;  1RTP 1;  2E30 A;  1SY9 A;  1KK7 Z;  3VRR A;  4C0J A;  5ER5 A;  2CBL A;  1IJ5 A;  1QX2 A;  4MBE A;  2I18 A;  1G4Y R;  1QLK A;  2F3Y A;  1YVH A;  2ZND A;  4DCK A;  4WRI A;  1NX2 A;  2M1K B;  1U5I A;  1S5G Z;  2PVB A;  3NSL A;  3PSR A;  1BR4 B;  3NSO A;  2L98 A;  1TTX A;  3BOW A;  4FTG A;  1B8L A;  1DJW A;  1PRW A;  2JXL A;  4YGE B;  1B9A A;  1QJT A;  2ZRS A;  2KYF A;  5IBW A;  3KPX A;  2MJW B;  4GBA A;  2MA2 A;  1XFW O;  1SKT A;  2G2B A;  3FIA A;  1DGU A;  1LA0 A;  1KFU L;  1EG3 A;  2K0J A;  1AUI B;  1MR8 A;  1UUR A;  2K7C A;  2TN4 A;  1J7R A;  4MRX A;  1M45 A;  2BE6 A;  1IGV A;  1MF8 B;  4M2O A;  1EL4 A;  1FPW A;  1OMR A;  1SR6 B;  1KK7 Y;  2JUL A;  1H4B A;  1QS7 A;  1AJ4 A;  1SR6 C;  1G8I A;  2M7L A;  2LCP A;  1CMF A;  4PCW A;  1QIV A;  1IJ6 A;  1XFV O;  1YRU B;  1CMG A;  1TNQ A;  2COL B;  1CDM A;  3OX5 A;  3CZT X;  2PRU A;  1YX8 A;  2MLF C;  1QX7 A;  1PSR A;  2LAP A;  1IKU A;  1E8A A;  3SG7 A;  2KDH A;  1UHI A;  1YTZ C;  1HQV A;  1M31 A;  2K61 A;  2LMT A;  2DOQ A;  2JPT A;  2HQ8 A;  5DKQ A;  1R6P A;  1RJV A;  5GQQ C;  4UPG A;  4ORC B;  4CLN A;  1ALV A;  3CTN A;  1XYD A;  3CS1 A;  2L4H A;  4PHN A;  1XA5 A;  1JF2 A;  3NSI A;  1N65 A;  1PAL A;  3DVJ A;  1ODB A;  1SCM B;  1YUU A;  4I5L B;  1VRK A;  4DIR A;  2HF5 A;  1OE9 B;  1TCF A;  2JXC A;  1SCM C; 
#chains in the Genus database with same CATH topology
 5F6T A;  1PSB A;  2I7A A;  1M39 A;  2WCL A;  4HRG A;  4XJK A;  3TDU A;  1AHR A;  3LK0 A;  1TUJ A;  4MVF A;  5JOL A;  2JT0 A;  2ERB A;  3CLN A;  3CWG A;  1JUO A;  1QTX A;  4ORB B;  2BE4 A;  1TN4 A;  4P5O E;  3SIA A;  1QWV A;  2K7D A;  1OMD A;  2LP2 A;  4AQJ A;  5I8N A;  1SNL A;  1QVI Z;  3OHM B;  2JNF A;  3HCM A;  5I2L A;  1CFD A;  3PM8 A;  1IG5 A;  4MZJ A;  5D69 A;  2ZN8 A;  2QPT A;  3MSE B;  1F71 A;  1LA3 A;  4PE4 A;  1XFY O;  1K94 A;  2CTN A;  1K9K A;  1R2U A;  2P71 A;  3AKA A;  3I5G C;  1BT6 A;  1TCO B;  3PLF B;  3OX6 A;  3L4L A;  1SRA A;  2KI6 C;  5K89 A;  5CSI A;  1IWQ A;  3CGA A;  2ZFD A;  3CZ0 A;  1QXP A;  1KFX L;  1IQ3 A;  1NWD A;  3D10 A;  1SL9 A;  1V1F A;  2CT9 A;  3FWC A;  4FQT A;  3BUM B;  1Y1A A;  2NCP A;  1NCZ A;  3DD4 A;  1SYM A;  1OMV A;  3EK8 A;  4PAL A;  2CCM A;  3WNX B;  4DS7 A;  4GGF C;  1CTR A;  3SG4 A;  5CSJ A;  5PAL A;  4I5N B;  1Y0V H;  1IRJ A;  3LLE A;  3VB1 A;  3R72 A;  1WRL A;  1OOI X;  4ETO A;  2KI4 B;  2JU0 A;  4PHJ A;  2Q4U A;  5JJG A;  1ZMZ A;  1RFJ A;  2MLE C;  1DF0 A;  1NIW A;  2KI4 C;  2K7B A;  3PFV A;  5J3X A;  3S0G A;  3AKB A;  5I2O A;  2KAY A;  1Z4H A;  5CPV A;  1A75 B;  1BMO A;  3SS5 A;  2BKH B;  1UHN A;  1ZOT B;  2JZI A;  3D77 A;  2MAZ A;  5HKZ A;  2BEC A;  2NZ0 A;  3FE6 A;  4OV2 A;  2QEO A;  3SIB A;  1WY9 A;  1DJX A;  2BKI B;  2GGM A;  3PJI A;  2JWW A;  1BOD A;  1N0Y A;  2VRG A;  5FI6 A;  2L4I A;  1WDC B;  3A4U B;  2KI6 D;  3NSK A;  1S1E A;  2KAV A;  2ISD A;  3F45 A;  3IF7 A;  5KU1 A;  2WND A;  1KWO B;  1WDC C;  4GGN A;  3BUN B;  1MHO A;  1CFC A;  3VRP A;  1KWO C;  3C1V A;  1JBA A;  1DJZ A;  3S0E A;  4ZCV A;  1IIO A;  1A4P A;  2M7N A;  2M8U A;  2BCA A;  4OVN F;  3HX4 A;  3DXL A;  1FI5 A;  1OOF A;  3TS5 B;  1LKJ A;  1XO5 A;  3O78 A;  3TS5 C;  2M97 A;  1BG1 A;  2EHB A;  1GGW A;  2PAL A;  1YR5 A;  3AAK A;  3NGV A;  2IS9 A;  2M49 B;  4GPL B;  3CDN A;  5BPJ A;  3CZ2 A;  4R1E A;  3TDI A;  3QRX A;  2L50 A;  2QDI A;  4Q04 A;  3WXA A;  4NDD A;  1XK4 A;  1SL8 A;  3OBV A;  3GOF A;  5TNC A;  1EXR A;  1UHK A;  4MEW A;  1ALW A;  2FOT A;  1K9P A;  2WCM A;  1K96 A;  1JC2 A;  1ZAC A;  1TRF A;  3GK4 X;  3UO9 A;  1J55 A;  1WLZ A;  1GQM A;  1F70 A;  1LS8 A;  4YBH B;  4U8D A;  1EJ3 A;  3O4Y A;  2K2A A;  3OB2 B;  1DC1 A;  1N2D A;  3O6B A;  3V2L A;  1QV0 A;  1WRK A;  1CM4 A;  2A4J A;  2OPO A;  3B6X A;  2EGD A;  3DF0 A;  1MXE A;  2I94 A;  3Q8I A;  4BY5 A;  3LK1 A;  1B7T Z;  3TZ1 A;  2KNE A;  2PSR A;  2JT3 A;  1DT7 B;  2WCH A;  1NYA A;  4GNK B;  1DJY A;  4DUQ A;  2KGR A;  2LMV A;  4YRU A;  2K7O A;  3PN7 B;  1CNP A;  2GTE A;  2KFH A;  3PN7 C;  2P70 A;  1AP4 A;  2NLN A;  3DZT A;  2EC6 B;  3BUW B;  4N1G A;  4WQ2 A;  3DYE A;  2BNX A;  4MSP A;  4NDC A;  3RLZ A;  2EC6 C;  2KQ6 A;  2JQ6 A;  1GM0 A;  1GJY A;  1L2O B;  1LIN A;  4NDB A;  1C7V A;  4CID A;  3CR5 X;  3KHE A;  1AK8 A;  1Q80 A;  4PE0 A;  3OGN A;  2FCD A;  2Y5I A;  2O5G A;  4CFR A;  3JVT B;  5CSN A;  3S0D A;  3JVT C;  3D76 A;  1F55 A;  3WHT B;  1BLQ A;  4F0Z B;  1NCY A;  1BJF A;  2AAO A;  5G08 A;  3DVK A;  3TUY B;  2F2O A;  1M63 B;  3TUY C;  1IH0 A;  1B7T Y;  2NCO A;  1RRO A;  3CR2 A;  3BXK A;  2M29 A;  2AMI A;  3AAJ A;  2Y1N A;  3CYZ A;  3KEV A;  2V53 A;  2CNP A;  1REC A;  2LHL A;  2KFG A;  3EVU A;  3VGO A;  3VRQ A;  1SBJ A;  1UWO A;  3JTD B;  1A29 A;  1XFZ O;  4N1F A;  1UHH A;  1B4C A;  3NHT A;  5CSF A;  2LVJ A;  2BBN A;  2QAC A;  2WOR A;  3JTD C;  4GAO A;  4BY4 A;  1HT9 A;  3I5H B;  4YI9 A;  1S36 A;  3I5H C;  3RZS A;  4E68 A;  1S3P A;  2KLD A;  1J7Q A;  1DJH A;  1M46 A;  4A4B A;  1SCV A;  2I2R E;  2KSP A;  2KAX A;  1BF5 A;  1JFK A;  2P6B B;  5DIC A;  3VRO A;  2BCX A;  3D0Y A;  1W7I B;  5HKW A;  2MHH A;  3SS3 A;  1A03 A;  1S6C A;  2OTG B;  1ZUZ A;  2E6W A;  3S0F A;  3RM1 A;  2OTG C;  1KFU S;  2LM5 A;  1B47 A;  1KSM A;  3A8R A;  3R1V A;  5ER4 X;  2L0P A;  1J7P A;  2H61 A;  2WCB A;  5FYX A;  1F8H A;  2LNK A;  5DKR A;  1B8C A;  2YGU A;  1ORG A;  5B8I B;  1QAT A;  1NX1 A;  1CKK A;  4L9M A;  2BCB A;  3BJH A;  3PAL A;  4MZK A;  1TUZ A;  1CLM A;  2MRD A;  3QME A;  1DF0 B;  1NX3 A;  1MUX A;  1OSA A;  4HSZ A;  4TNC A;  1CB1 A;  1SK6 D;  1YUT A;  1KK8 B;  2JC2 A;  2KYC A;  3FWB A;  1V1G A;  1YX7 A;  1AVS A;  1KSO A;  2NXQ A;  3PM2 A;  4XYN A;  4ZCU A;  3TDZ A;  1KK8 C;  1FF1 A;  2PMY A;  2LHI A;  1RWY A;  1MWN A;  3WHU B;  1YVL A;  5KTY A;  4N5X A;  1QV1 A;  1A75 A;  3R1O A;  5HLO A;  2M3W A;  2WC8 A;  1CLB A;  4PHK A;  2WC6 A;  1CDP A;  1L7Z A;  1NP8 A;  1DMO A;  1Y6W A;  2G9B A;  2JNX A;  2JPO A;  1C3Z A;  1P28 A;  1CLL A;  2KQY A;  1A2X A;  1NCX A;  1DJG A;  2LUC A;  1XFR A;  4MN0 A;  3BUX B;  3SS4 A;  1DVI A;  3ZNI A;  4PE1 A;  1U5I B;  2LLU A;  3H4S E;  3L4A A;  4USL A;  4IJ7 A;  2LLS A;  3BOW B;  1S26 D;  1YRT B;  2KOT A;  4WQ3 A;  1OOG A;  2M1U A;  3CZ1 A;  4YI8 A;  1PUL A;  1CFP A;  1J1D A;  1YUR A;  3CR4 X;  3DY9 A;  1DGV A;  1NPQ A;  1LVC D;  2F33 A;  2M0R A;  3VRN A;  1F4O A;  3EK7 A;  1J1E A;  1W9Z A;  3B7A A;  4P2Y B;  1D1O A;  3IQQ A;  4YGA A;  1SMG A;  2K60 A;  3EKH A;  2LLT A;  3SG5 A;  1XVJ A;  2WCE A;  1OZS A;  1LXF C;  3KO0 A;  1JF0 A;  1FI6 A;  3B87 A;  1MQ1 A;  2BBM A;  2KBI A;  1NSH A;  5AXI A;  4YGD B;  4M2P A;  1Y1X A;  3BQ3 A;  4DRW A;  1JSA A;  5FI2 A;  2LVK A;  1XK4 C;  3GK1 A;  4QJ3 B;  3S0B A;  5HYD A;  3CAB A;  1XFU O;  2PQL A;  2F2P A;  1CFF A;  3D73 A;  2SAS A;  4PDZ A;  1WLM A;  4MRY A;  2WCK A;  4C0L A;  1TNP A;  5AER A;  4FQO A;  2LAN A;  4MLW A;  1BOC A;  2FCE A;  4MZL A;  2LC5 A;  2GV5 A;  2F8P A;  2KGB C;  2LV7 A;  3DF0 B;  2ZRT A;  3UNW A;  4M2Q A;  3EK4 A;  3EKJ A;  1PVB A;  1FBV A;  3BYA A;  1KFX S;  4CPV A;  4GFT A;  2GGZ A;  2F3Z A;  4INW A;  3KF9 A;  4KYN A;  2QEH A;  3FE8 A;  2L5X B;  3FS7 A;  2RGI A;  3SG3 A;  3ZWH A;  1B8R A;  1K8U A;  4GUK A;  1EH2 A;  3OP0 A;  2WCF A;  1Y1U A;  2Y1M A;  1JWD A;  1TNW A;  1S5G Y;  3K21 A;  1L2O C;  4YGB B;  4OCI A;  2O60 A;  4QJ4 B;  2ZKM X;  3O2P A;  3B86 A;  1RK9 A;  2LUX A;  2FJU B;  4OKH A;  3EG5 B;  3O4X A;  3SG2 A;  1S6I A;  1NX0 A;  3I5F B;  2WOS A;  1W7J B;  1TWO A;  4INX A;  3I5F C;  1KQV A;  4XJK B;  1KCY A;  1C7W A;  2K2F A;  1SPY A;  1J7O A;  2Y4Q A;  4YGC B;  3NXA A;  4HRE E;  1TOP A;  1DTL A;  3OB1 B;  5D3O A;  2D8N A;  3M0W A;  1C07 A;  1UP5 A;  1ZFS A;  1H8B A;  1OQP A;  3LCP C;  4JPZ B;  2JT8 A;  1QLS A;  1TNX A;  4AQI A;  1IQ5 A;  2HQW A;  2L2C A;  3EVR A;  1K95 A;  2WCJ A;  1TIZ A;  1XFX O;  2M9G A;  1SSE B;  1CDL A;  1CM1 A;  1NUB A;  5HLV A;  1BU3 A;  1WRZ A;  2KFF A;  2KHN A;  1PVA A;  1UUS A;  3SJS A;  1KQM B;  2JTT A;  2PAS A;  1AJ5 A;  2SCP A;  3BUO B;  5EL2 A;  1KQM C;  1FW4 A;  4ICB A;  4AOM A;  5FI7 A;  5HKY A;  2LVI A;  2ZN9 A;  1C3Y A;  1SW8 A;  4IL1 A;  5D7F A;  1DEK A;  2HPS A;  5AFP A;  3E3R A;  4PE7 A;  3LL8 B;  4I5J A;  3GK2 A;  1K93 D;  1S6J A;  3NHI A;  4OR9 B;  1G33 A;  3I5G B;  4QJ5 B;  3SG6 A;  5HL1 A;  2JOJ A;  1OOJ A;  2KLE A;  3K1E A;  4C0K A;  4ORA B;  1EG4 A;  4GGF A;  1MXL C;  1CDN A;  5AAN A;  1JFJ A;  3D0Y B;  2B1U A;  3DVE A;  1QIW A;  2H2K A;  4CFQ A;  1K9U A;  3IQO A;  4D1E A;  2LVV A;  2LP3 A;  4JWQ A;  1X02 A;  4NQG A;  1BR1 B;  2AUC A;  2JRF A;  4A4C A;  2H61 C;  2JTZ A;  2CXJ A;  4JQ0 D;  5DKN A;  2BL0 B;  3BFB A;  1GGZ A;  3R1P A;  2OS8 B;  1PK0 D;  1K2H A;  2BL0 C;  2LMU A;  1UHJ A;  1F4Q A;  2K8M B;  3PAT A;  4PHM A;  2OS8 C;  1B1G A;  3ICB A;  4F7F A;  2LE9 B;  1DJI A;  1F54 A;  2KBM A;  2Q91 A;  1QVI Y;  2ZNE A;  3B88 A;  5AEQ A;  2L5Y A;  5KSZ A;  1QAS A;  2L2E A;  4HRH A;  1OZO A;  4PT1 A;  5I94 A;  1QX5 B;  2L51 A;  3L47 A;  5I2Q A;  1SL7 A;  2WC5 A;  3DVM A;  1K90 D;  2HET A;  3EVV A;  3I5I B;  4I5K A;  2MBX A;  1OW4 A;  1YUS A;  2R2I A;  3I5I C;  1RTP 1;  2E30 A;  1SY9 A;  2PYQ A;  1KK7 Z;  3VRR A;  4C0J A;  3D78 A;  5ER5 A;  2CBL A;  1IJ5 A;  1QX2 A;  4MBE A;  2I18 A;  1G4Y R;  1QLK A;  3FE9 A;  2F3Y A;  1YVH A;  2QEB A;  2ZND A;  4DCK A;  4WRI A;  1NX2 A;  2M1K B;  1U5I A;  3BFA A;  1S5G Z;  2PVB A;  3NSL A;  3PSR A;  1BR4 B;  3NSO A;  2L98 A;  1TTX A;  3BOW A;  4FTG A;  1B8L A;  1DJW A;  1PRW A;  2JXL A;  4YGE B;  1B9A A;  1QJT A;  2ZRS A;  2KYF A;  5IBW A;  3KPX A;  2MJW B;  4GBA A;  2MA2 A;  1XFW O;  1SKT A;  2G2B A;  3FIA A;  3D75 A;  3S0A A;  1DGU A;  4JD9 A;  3BFH A;  4JKT A;  1LA0 A;  1KFU L;  1T14 A;  1EG3 A;  2K0J A;  1AUI B;  1MR8 A;  1UUR A;  2K7C A;  2TN4 A;  1J7R A;  4MRX A;  2KPH A;  1M45 A;  2BE6 A;  1IGV A;  1MF8 B;  4M2O A;  1EL4 A;  1FPW A;  1OMR A;  1SR6 B;  1KK7 Y;  2JUL A;  1H4B A;  1QS7 A;  1AJ4 A;  1SR6 C;  1G8I A;  2M7L A;  2LCP A;  1DQE A;  2QEV A;  1CMF A;  4PCW A;  2BAP A;  1QIV A;  1IJ6 A;  1XFV O;  1YRU B;  3IVT A;  1CMG A;  1TNQ A;  2H8V A;  2COL B;  1CDM A;  3OX5 A;  3CZT X;  3N7H A;  2PRU A;  1YX8 A;  2MLF C;  1OOH A;  1QX7 A;  1PSR A;  2LAP A;  1IKU A;  1E8A A;  3SG7 A;  2FJY A;  2KDH A;  1UHI A;  4OZD A;  1DEL A;  1YTZ C;  1HQV A;  1M31 A;  2K61 A;  2LMT A;  2DOQ A;  1Z2C B;  2JPT A;  2HQ8 A;  5DKQ A;  1R6P A;  1RJV A;  5GQQ C;  4UPG A;  4ORC B;  4CLN A;  1ALV A;  3CTN A;  1XYD A;  3CS1 A;  2L4H A;  4PHN A;  1XA5 A;  1JF2 A;  3NSI A;  1N65 A;  1PAL A;  3DVJ A;  1ODB A;  1SCM B;  1YUU A;  3D74 A;  1VRK A;  4I5L B;  2HF5 A;  1OE9 B;  4DIR A;  1TCF A;  2JXC A;  1SCM C; 
#chains in the Genus database with same CATH homology
 5F6T A;  1PSB A;  2I7A A;  1M39 A;  4HRG A;  4XJK A;  3TDU A;  1AHR A;  3LK0 A;  4MVF A;  5JOL A;  2JT0 A;  3CLN A;  3CWG A;  1JUO A;  1QTX A;  4ORB B;  2BE4 A;  1TN4 A;  4P5O E;  3SIA A;  2K7D A;  1OMD A;  2LP2 A;  4AQJ A;  5I8N A;  1SNL A;  1QVI Z;  3OHM B;  2JNF A;  3HCM A;  5I2L A;  1CFD A;  3PM8 A;  1IG5 A;  4MZJ A;  5D69 A;  2ZN8 A;  2QPT A;  3MSE B;  1F71 A;  1LA3 A;  4PE4 A;  1XFY O;  1K94 A;  2CTN A;  1K9K A;  1R2U A;  3AKA A;  3I5G C;  1BT6 A;  1TCO B;  3PLF B;  3OX6 A;  1SRA A;  2KI6 C;  5K89 A;  5CSI A;  1IWQ A;  3CGA A;  2ZFD A;  1QXP A;  1KFX L;  1IQ3 A;  1NWD A;  3D10 A;  1SL9 A;  1V1F A;  2CT9 A;  3FWC A;  3BUM B;  1Y1A A;  2NCP A;  1NCZ A;  3DD4 A;  1SYM A;  1OMV A;  3EK8 A;  4PAL A;  2CCM A;  3WNX B;  4DS7 A;  4GGF C;  1CTR A;  3SG4 A;  5CSJ A;  5PAL A;  4I5N B;  1Y0V H;  1IRJ A;  3LLE A;  1WRL A;  4ETO A;  2KI4 B;  2JU0 A;  4PHJ A;  2Q4U A;  5JJG A;  1ZMZ A;  1RFJ A;  2MLE C;  1DF0 A;  1NIW A;  2KI4 C;  2K7B A;  3PFV A;  5J3X A;  3AKB A;  5I2O A;  2KAY A;  5CPV A;  1A75 B;  1BMO A;  2BKH B;  1UHN A;  1ZOT B;  2JZI A;  2MAZ A;  5HKZ A;  2BEC A;  2NZ0 A;  4OV2 A;  3SIB A;  1WY9 A;  1DJX A;  2BKI B;  2GGM A;  2JWW A;  1BOD A;  1N0Y A;  2VRG A;  2L4I A;  1WDC B;  3A4U B;  2KI6 D;  3NSK A;  1S1E A;  2KAV A;  2ISD A;  3F45 A;  3IF7 A;  5KU1 A;  2WND A;  1KWO B;  1WDC C;  4GGN A;  3BUN B;  1MHO A;  1CFC A;  3VRP A;  1KWO C;  3C1V A;  1JBA A;  1DJZ A;  4ZCV A;  1A4P A;  2M7N A;  2M8U A;  2BCA A;  4OVN F;  3HX4 A;  1FI5 A;  3TS5 B;  1LKJ A;  1XO5 A;  3O78 A;  3TS5 C;  2M97 A;  1BG1 A;  2EHB A;  1GGW A;  2PAL A;  1YR5 A;  3AAK A;  2IS9 A;  2M49 B;  4GPL B;  5BPJ A;  4R1E A;  3TDI A;  3QRX A;  2L50 A;  4Q04 A;  3WXA A;  4NDD A;  1XK4 A;  1SL8 A;  3GOF A;  5TNC A;  1EXR A;  1UHK A;  4MEW A;  1ALW A;  2FOT A;  1K9P A;  1JC2 A;  1K96 A;  1TRF A;  1ZAC A;  3GK4 X;  1F70 A;  1J55 A;  1WLZ A;  1GQM A;  4YBH B;  4U8D A;  1EJ3 A;  3O4Y A;  2K2A A;  3OB2 B;  1N2D A;  3O6B A;  1QV0 A;  1WRK A;  1CM4 A;  2A4J A;  2OPO A;  3DF0 A;  2EGD A;  1MXE A;  2I94 A;  4BY5 A;  3LK1 A;  1B7T Z;  3TZ1 A;  2KNE A;  2PSR A;  2JT3 A;  1DT7 B;  1NYA A;  4GNK B;  1DJY A;  4DUQ A;  2KGR A;  2LMV A;  4YRU A;  2K7O A;  3PN7 B;  1CNP A;  2KFH A;  3PN7 C;  1AP4 A;  2NLN A;  2EC6 B;  3BUW B;  4N1G A;  4WQ2 A;  4MSP A;  4NDC A;  3RLZ A;  2EC6 C;  2KQ6 A;  2JQ6 A;  1GJY A;  1L2O B;  1LIN A;  4NDB A;  1C7V A;  4CID A;  3CR5 X;  3KHE A;  1AK8 A;  1Q80 A;  4PE0 A;  2FCD A;  2Y5I A;  2O5G A;  4CFR A;  3JVT B;  5CSN A;  3JVT C;  1F55 A;  3WHT B;  1BLQ A;  4F0Z B;  1NCY A;  1BJF A;  2AAO A;  5G08 A;  3DVK A;  3TUY B;  2F2O A;  1M63 B;  3TUY C;  1IH0 A;  1B7T Y;  2NCO A;  1RRO A;  3CR2 A;  3BXK A;  2M29 A;  2AMI A;  3AAJ A;  2Y1N A;  3KEV A;  2V53 A;  2CNP A;  1REC A;  2LHL A;  2KFG A;  3EVU A;  3VGO A;  3VRQ A;  1SBJ A;  1UWO A;  3JTD B;  1A29 A;  1XFZ O;  4N1F A;  1UHH A;  1B4C A;  5CSF A;  2LVJ A;  2BBN A;  2QAC A;  2WOR A;  3JTD C;  4GAO A;  4BY4 A;  1HT9 A;  3I5H B;  4YI9 A;  1S36 A;  3I5H C;  4E68 A;  1S3P A;  1J7Q A;  1DJH A;  1M46 A;  4A4B A;  1SCV A;  2I2R E;  2KSP A;  2KAX A;  1BF5 A;  1JFK A;  2P6B B;  3VRO A;  2BCX A;  3D0Y A;  1W7I B;  5HKW A;  2MHH A;  1A03 A;  1S6C A;  2OTG B;  1ZUZ A;  2E6W A;  3RM1 A;  2OTG C;  1KFU S;  2LM5 A;  1B47 A;  1KSM A;  3A8R A;  5ER4 X;  1J7P A;  2L0P A;  1F8H A;  2H61 A;  2WCB A;  5FYX A;  2LNK A;  5DKR A;  1B8C A;  5B8I B;  1QAT A;  1NX1 A;  1CKK A;  4L9M A;  2BCB A;  3PAL A;  4MZK A;  1CLM A;  2MRD A;  1DF0 B;  1NX3 A;  1MUX A;  1OSA A;  4HSZ A;  4TNC A;  1CB1 A;  1SK6 D;  1YUT A;  1KK8 B;  2JC2 A;  2KYC A;  3FWB A;  1V1G A;  1YX7 A;  1AVS A;  1KSO A;  2NXQ A;  4XYN A;  4ZCU A;  3TDZ A;  1KK8 C;  1FF1 A;  2PMY A;  2LHI A;  1RWY A;  1MWN A;  3WHU B;  1YVL A;  5KTY A;  4N5X A;  1QV1 A;  1A75 A;  5HLO A;  1CLB A;  2M3W A;  2WC8 A;  4PHK A;  1CDP A;  1L7Z A;  1NP8 A;  1Y6W A;  2G9B A;  2JNX A;  1CLL A;  2KQY A;  1A2X A;  1NCX A;  1DJG A;  2LUC A;  4MN0 A;  3BUX B;  1DVI A;  3ZNI A;  4PE1 A;  1U5I B;  2LLU A;  3H4S E;  4USL A;  2LLS A;  3BOW B;  1S26 D;  1YRT B;  2KOT A;  4WQ3 A;  2M1U A;  4YI8 A;  1PUL A;  1CFP A;  1J1D A;  1YUR A;  3CR4 X;  1DGV A;  1NPQ A;  1LVC D;  2F33 A;  2M0R A;  3VRN A;  1F4O A;  3EK7 A;  1J1E A;  4P2Y B;  1D1O A;  3IQQ A;  4YGA A;  1SMG A;  3EKH A;  2LLT A;  3SG5 A;  1XVJ A;  2WCE A;  1OZS A;  1LXF C;  3KO0 A;  1JF0 A;  1FI6 A;  1MQ1 A;  2BBM A;  2KBI A;  1NSH A;  5AXI A;  4YGD B;  4M2P A;  1Y1X A;  3BQ3 A;  4DRW A;  1JSA A;  2LVK A;  1XK4 C;  3GK1 A;  4QJ3 B;  5HYD A;  1XFU O;  2F2P A;  1CFF A;  2SAS A;  4PDZ A;  1WLM A;  4MRY A;  4C0L A;  1TNP A;  5AER A;  4FQO A;  2LAN A;  4MLW A;  1BOC A;  2FCE A;  4MZL A;  2LC5 A;  2GV5 A;  2F8P A;  2KGB C;  2LV7 A;  3DF0 B;  2ZRT A;  4M2Q A;  3EK4 A;  3EKJ A;  1PVB A;  1FBV A;  3BYA A;  1KFX S;  4CPV A;  4GFT A;  2GGZ A;  2F3Z A;  3KF9 A;  3FS7 A;  2L5X B;  3SG3 A;  2RGI A;  3ZWH A;  1B8R A;  1K8U A;  4GUK A;  1EH2 A;  3OP0 A;  2WCF A;  1Y1U A;  2Y1M A;  1JWD A;  1TNW A;  1S5G Y;  3K21 A;  1L2O C;  4YGB B;  4OCI A;  2O60 A;  4QJ4 B;  2ZKM X;  3O2P A;  1RK9 A;  2LUX A;  2FJU B;  4OKH A;  3SG2 A;  1S6I A;  1NX0 A;  3I5F B;  2WOS A;  1W7J B;  3I5F C;  1KQV A;  4XJK B;  1KCY A;  1C7W A;  2K2F A;  1SPY A;  1J7O A;  2Y4Q A;  4YGC B;  3NXA A;  4HRE E;  1TOP A;  1DTL A;  3OB1 B;  1C07 A;  2D8N A;  3M0W A;  1UP5 A;  1ZFS A;  1H8B A;  1OQP A;  3LCP C;  4JPZ B;  2JT8 A;  1QLS A;  1TNX A;  4AQI A;  1IQ5 A;  2HQW A;  3EVR A;  1K95 A;  1TIZ A;  1XFX O;  2M9G A;  1CDL A;  1CM1 A;  5HLV A;  1NUB A;  1BU3 A;  1WRZ A;  2KFF A;  2KHN A;  1PVA A;  1UUS A;  3SJS A;  1KQM B;  2JTT A;  2PAS A;  1AJ5 A;  2SCP A;  3BUO B;  1KQM C;  1FW4 A;  4ICB A;  4AOM A;  5HKY A;  2LVI A;  2ZN9 A;  1SW8 A;  4IL1 A;  5D7F A;  2HPS A;  5AFP A;  3E3R A;  4PE7 A;  3LL8 B;  4I5J A;  3GK2 A;  1K93 D;  1S6J A;  4QJ5 B;  4OR9 B;  1G33 A;  3I5G B;  1DMO A;  3SG6 A;  2JOJ A;  1OOJ A;  4C0K A;  4ORA B;  1EG4 A;  4GGF A;  1MXL C;  1CDN A;  5AAN A;  1JFJ A;  3D0Y B;  2B1U A;  3DVE A;  1QIW A;  2H2K A;  4CFQ A;  1K9U A;  3IQO A;  4D1E A;  2LVV A;  2LP3 A;  4JWQ A;  1X02 A;  4NQG A;  1BR1 B;  2AUC A;  2JRF A;  4A4C A;  2H61 C;  2JTZ A;  2CXJ A;  4JQ0 D;  5DKN A;  2BL0 B;  1GGZ A;  2OS8 B;  1PK0 D;  1K2H A;  2BL0 C;  2LMU A;  1UHJ A;  1F4Q A;  2K8M B;  3PAT A;  4PHM A;  2OS8 C;  1B1G A;  3ICB A;  2LE9 B;  1DJI A;  1F54 A;  2KBM A;  2Q91 A;  1QVI Y;  2ZNE A;  5AEQ A;  5KSZ A;  1QAS A;  2L2E A;  4HRH A;  1OZO A;  1QX5 B;  2L51 A;  5I2Q A;  1SL7 A;  3I5I B;  3DVM A;  1K90 D;  2HET A;  3EVV A;  4I5K A;  2MBX A;  1YUS A;  2R2I A;  3I5I C;  1RTP 1;  2E30 A;  1SY9 A;  1KK7 Z;  3VRR A;  4C0J A;  5ER5 A;  2CBL A;  1IJ5 A;  1QX2 A;  4MBE A;  2I18 A;  1G4Y R;  1QLK A;  2F3Y A;  1YVH A;  2ZND A;  4DCK A;  4WRI A;  1NX2 A;  2M1K B;  1U5I A;  1S5G Z;  2PVB A;  3NSL A;  3PSR A;  1BR4 B;  3NSO A;  2L98 A;  1TTX A;  3BOW A;  4FTG A;  1B8L A;  1DJW A;  1PRW A;  2JXL A;  4YGE B;  1B9A A;  1QJT A;  2ZRS A;  2KYF A;  5IBW A;  3KPX A;  2MJW B;  4GBA A;  2MA2 A;  1XFW O;  1SKT A;  2G2B A;  3FIA A;  1DGU A;  1LA0 A;  1KFU L;  1EG3 A;  2K0J A;  1AUI B;  1MR8 A;  1UUR A;  2K7C A;  2TN4 A;  1J7R A;  4MRX A;  1M45 A;  2BE6 A;  1IGV A;  1MF8 B;  4M2O A;  1EL4 A;  1FPW A;  1OMR A;  1SR6 B;  1KK7 Y;  2JUL A;  1H4B A;  1QS7 A;  1AJ4 A;  1SR6 C;  1G8I A;  2M7L A;  2LCP A;  1CMF A;  4PCW A;  1QIV A;  1IJ6 A;  1XFV O;  1YRU B;  1CMG A;  1TNQ A;  2COL B;  1CDM A;  3OX5 A;  3CZT X;  2PRU A;  1YX8 A;  2MLF C;  1QX7 A;  1PSR A;  2LAP A;  1IKU A;  1E8A A;  3SG7 A;  2KDH A;  1UHI A;  1YTZ C;  1HQV A;  1M31 A;  2K61 A;  2LMT A;  2DOQ A;  2JPT A;  2HQ8 A;  5DKQ A;  1R6P A;  1RJV A;  5GQQ C;  4UPG A;  4ORC B;  4CLN A;  1ALV A;  3CTN A;  1XYD A;  3CS1 A;  2L4H A;  4PHN A;  1XA5 A;  1JF2 A;  3NSI A;  1N65 A;  1PAL A;  3DVJ A;  1ODB A;  1SCM B;  1YUU A;  4I5L B;  1VRK A;  4DIR A;  2HF5 A;  1OE9 B;  1TCF A;  2JXC A;  1SCM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...