2KI4B

Fgf1-s100a13 complex structure: key component in non-classical path way of fgf1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
96
structure length
96
Chain Sequence
MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heparin-binding growth factor 1
publication title The heterohexameric complex structure, a component in the non-classical pathway for fibroblast growth factor 1 (FGF1) secretion.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 35
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2009-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2ki4B00
1NIWA 1EG4A 2JU0A 2KFGA 4MVFA 1CLLA 1YUTA 2LLTA 4ZCUA 1SL9A 1Y6WA 2OS8B 4HSZA 1DJZA 5KTYA 2NCPA 4YI9A 3EK4A 2JZIA 2BL0B 4JQ0D 2CXJA 4USLA 2ZFDA 1K2HA 2K61A 3KO0A 3WXAA 4M2PA 5HLVA 5K89A 4YRUA 1IGVA 4TNCA 3ICBA 4DCKA 3FS7A 2LC5A 2MLEC 1J1EA 4Q04A 1ZACA 1KK8C 5CSJA 3HCMA 1KWOB 2ZNEA 1BJFA 2VRGA 2L4HA 1SKTA 3TZ1A 1WDCC 1X02A 4HRHA 2ZNDA 5BPJA 1M45A 4IL1A 2P6BB 1WY9A 1NYAA 3SIAA 1CLMA 2HETA 4ETOA 1DVIA 1XFZO 1DJXA 1RK9A 1A4PA 5AFPA 2LMVA 2M1KB 3IQQA 4I5KA 4BY5A 1GJYA 2F3YA 2I2RE 2M0RA 2E6WA 3FWCA 4F0ZB 3C1VA 1BODA 2JQ6A 3M0WA 1PALA 3EK8A 2HQ8A 3I5GB 1CNPA 3VRPA 1WLZA 2AAOA 1J7OA 1KSOA 1MXEA 1IJ5A 1WRZA 5JOLA 4I5JA 1IWQA 4GGNA 2L5XB 1B7TY 2O5GA 1YX7A 3BQ3A 2K2AA 3IQOA 2EGDA 2MA2A 1B7TZ 4N1FA 1K94A 1L2OB 1SR6B 1V1GA 2KAXA 4GAOA 3DVKA 5HLOA 4NDBA 5HKYA 5HKZA 1RTP1 1XK4A 1NPQA 1MQ1A 1DJHA 1XO5A 3I5HB 2AMIA 2LV7A 2M7NA 2M8UA 2MAZA 4ICBA 3SG3A 2Q4UA 1QLSA 2GGMA 1ALWA 4M2QA 3JTDC 1OMDA 5DKNA 1H4BA 3DD4A 3BYAA 2PVBA 1CLBA 1PK0D 1IKUA 5D7FA 1CDLA 1BMOA 1H8BA 1R6PA 4MRYA 3O78A 3SG4A 2G9BA 1ALVA 2LP2A 1ODBA 1QX2A 2PRUA 2M7LA 5CSNA 4E68A 3DVJA 3AKBA 1AUIB 1G33A 1C07A 3FWBA 1CKKA 1YX8A 1B8CA 2MRDA 2ISDA 3WNXB 1DMOA 2AUCA 3IF7A 4OCIA 3KHEA 1IQ5A 1F70A 1A03A 4GBAA 1QX7A 1DGVA 3TDUA 4YGDB 2NCOA 2B1UA 2KI4B 2KI6D 1RECA 2OS8C 3TDIA 1AHRA 2EC6B 1PVAA 5TNCA 1MWNA 2BL0C 3SG2A 4C0KA 1M46A 1DTLA 2F2PA 1KQMB 1NSHA 1GGZA 2Y1NA 1SK6D 4QJ3B 5ER4X 4N1GA 5J3XA 3A4UB 3CLNA 3D0YB 1F4OA 2F2OA 1S6JA 2JTTA 2ZRTA 2JOJA 2PSRA 4PHKA 1W7IB 1DGUA 4WQ2A 4C0JA 1UHJA 2LVJA 1KWOC 4DIRA 2K0JA 1G4YR 1M39A 4M2OA 1YUSA 3VRNA 2H61A 4MLWA 3SJSA 1TN4A 2G2BA 1TCFA 2F33A 3GK2A 3OP0A 3CGAA 1QATA 3JVTB 3LCPC 4CLNA 1LVCD 1SMGA 3F45A 3TS5B 2BCXA 1SRAA 3PFVA 1PSRA 1QLKA 4I5NB 1S6IA 1UWOA 2K8MB 3E3RA 4XJKB 2CTNA 1FI6A 1S3PA 3O4YA 4ORAB 1WRKA 1DF0B 1OOJA 1L7ZA 4XJKA 5F6TA 1FW4A 1CMGA 5KSZA 1QXPA 3BUWB 3I5GC 1N65A 3GK4X 4XYNA 2LMUA 2GV5A 2JC2A 4QJ4B 1B1GA 1R2UA 2MBXA 2LAPA 2ZN9A 1OQPA 3CR2A 1MUXA 3PATA 3VROA 5KU1A 3AKAA 2KBMA 3CS1A 1XK4C 1IJ6A 2I7AA 4GGFC 1L2OC 4PE0A 3OB2B 1UHNA 3NXAA 3I5HC 1J7RA 3EVVA 4JPZB 2CBLA 1S26D 2MJWB 2QPTA 4C0LA 1U5IB 1J7QA 1FI5A 2KYCA 2A4JA 5D69A 1XVJA 5I2OA 1BOCA 1U5IA 1YVLA 4NQGA 3EKJA 2M3WA 1Y1AA 2CNPA 3KPXA 3LLEA 2K7OA 2JXLA 1LXFC 4WRIA 2KGBC 4PE4A 3O2PA 1TRFA 4PHMA 1Y0VH 2LVIA 1KCYA 1B8LA 3SG5A 1BR4B 4YGCB 1TOPA 1EG3A 2Y4QA 4GPLB 4PE1A 2ZRSA 5ER5A 3SG6A 5HYDA 2SCPA 5CSFA 1QV0A 3KEVA 2KQ6A 2M1UA 4MZKA 2KQYA 4YI8A 2KFFA 4MEWA 1QV1A 4MZJA 1JWDA 3BUOB 1XYDA 1KSMA 3CZTX 1B47A 1A2XA 2KI4C 2E30A 2EC6C 1B4CA 4ZCVA 1ZOTB 1OZOA 2Y5IA 4ORBB 1F54A 1DT7B 5G08A 1W7JB 1SYMA 1KQMC 2JT3A 2PMYA 2V53A 1NX1A 4P2YB 2M49B 4GGFA 1CDMA 1CMFA 4OR9B 1SCVA 2JTZA 2NXQA 1A75B 1S6CA 1YTZC 2H61C 3TDZA 3GK1A 2K7BA 1EH2A 1EL4A 3MSEB 3I5IB 3VRRA 1A75A 1BLQA 4DS7A 1JFKA 1S36A 2HPSA 3ZNIA 5FYXA 1RWYA 1D1OA 1CM4A 2FCDA 1QJTA 2K7CA 1XFXO 1KK8B 1V1FA 3JVTC 2JT8A 1QIWA 2CT9A 2BKHB 1IRJA 3SG7A 4PE7A 4PHJA 2ZN8A 3TS5C 1BU3A 1UHIA 1MF8B 4DRWA 1CFPA 2M29A 2F8PA 5CPVA 1RROA 1S1EA 1K9PA 4GNKB 1WDCB 3BUXB 3K21A 4WQ3A 5DKQA 4YBHB 5AANA 2JRFA 1RFJA 1PULA 3WHTB 4MZLA 3PALA 4BY4A 1FF1A 5PALA 4CPVA 1DJYA 1HQVA 1JUOA 3DF0B 2NZ0A 4PCWA 3NSIA 3CR4X 4HRGA 1AP4A 5IBWA 1K95A 4ORCB 5CSIA 1K93D 1BR1B 1S5GY 2HQWA 1TNXA 1PRWA 1S5GZ 3D0YA 4NDCA 4YGAA 1LKJA 5JJGA 1CM1A 1QIVA 1OE9B 1K9KA 2BBMA 4GFTA 2WCFA 2BECA 1KK7Y 1UUSA 4L9MA 1M31A 1KK7Z 3BOWB 3OX5A 1JBAA 2LLSA 2BKIB 1PVBA 2BE6A 1YURA 1SL8A 3BUMB 2KDHA 4PALA 1N2DA 4CFQA 4DUQA 1ZUZA 1RJVA 3GOFA 1A29A 2PASA 4U8DA 3PM8A 1TIZA 2WOSA 2LNKA 3O6BA 2LHIA 2L50A 4MBEA 1FBVA 2LMTA 1B9AA 1WRLA 2F3ZA 4JWQA 1E8AA 1DJGA 2EHBA 2NLNA 5I2QA 4AOMA 1UHHA 3TUYB 2WCEA 3NSKA 1DF0A 1UP5A 1CFDA 3PN7B 1NX3A 2FOTA 2OPOA 3D10A 4OKHA 1DJWA 1VRKA 2KAVA 1NWDA 1K96A 1QTXA 1YVHA 1G8IA 1SR6C 2COLB 2Y1MA 2M9GA 1JC2A 1BF5A 1C7VA 2KBIA 4PHNA 5AEQA 3EKHA 3PLFB 1SCMB 1JF0A 2D8NA 1XFYO 1YUUA 2MHHA 1SPYA 2LLUA 2KAYA 1CTRA 3CTNA 4CIDA 1Y1XA 3BXKA 3I5FB 1Y1UA 3LL8B 4FTGA 1MXLC 3I5IC 1QX5B 2JNXA 2LVVA 2GGZA 1UURA 5B8IB 2BCBA 2OTGB 3NSOA 2L4IA 4D1EA 1F4QA 4YGEB 1QS7A 1TTXA 2IS9A 2L51A 3NSLA 3VRQA 1NUBA 2JNFA 4HREE 1JSAA 1KFXS 1AJ5A 1SY9A 1XFVO 1OMRA 4MSPA 1HT9A 4UPGA 3AAKA 3SIBA 1XFUO 3EVUA 5AXIA 4MRXA 1F55A 1CFCA 1CDNA 1IH0A 1AVSA 4QJ5B 5HKWA 1KFXL 1PSBA 3HX4A 1K8UA 4GUKA 5DKRA 3LK0A 1BT6A 2JWWA 2I94A 2O60A 3RM1A 2LCPA 2PALA 3AAJA 1NP8A 2KHNA 2LANA 3A8RA 1AJ4A 1CDPA 5I2LA 3RLZA 1KFUS 2BCAA 1ZMZA 2L98A 2ZKMX 2SASA 5GQQC 3ZWHA 2KOTA 1NX2A 1SW8A 1N0YA 2BBNA 4PDZA 1WLMA 1CFFA 1LA0A 1TNQA 3KF9A 1J7PA 4AQIA 1SBJA 1KFUL 1SL7A 2L2EA 2LHLA 4A4BA 1XA5A 4N5XA 1F71A 1XFWO 2H2KA 3OB1B 1GQMA 5AERA 2Q91A 1LINA 1YR5A 4NDDA 2BE4A 4YGBB 1LA3A 1NCXA 4FQOA 4MN0A 5I8NA 2RGIA 4CFRA 3EVRA 2JPTA 4OVNF 2LVKA 2K2FA 1JFJA 2L0PA 1AK8A 1FPWA 1ZFSA 2CCMA 3TUYC 2MLFC 4OV2A 3PN7C 2LUCA 3CWGA 2HF5A 3QRXA 1TNPA 2WCBA 3DF0A 3PSRA 4A4CA 1OZSA 2KNEA 1NCYA 2LP3A 2M97A 1SCMC 1SNLA 1IG5A 3DVMA 2K7DA 3OX6A 1QVIY 1EJ3A 1NX0A 1GGWA 2KI6C 3BUNB 1QVIZ 1M63B 3FIAA 3I5FC 1F8HA 1K9UA 2KYFA 1C7WA 1MR8A 1UHKA 2OTGC 1EXRA 3WHUB 1OMVA 4AQJA 1NCZA 1JF2A 1BG1A 2JXCA 3BOWA 1IQ3A 2LUXA 1TNWA 2TN4A 2WORA 3OHMB 1QASA 2KSPA 2JT0A 2DOQA 1CB1A 1B8RA 1J1DA 2FCEA 2LE9B 3JTDB 4R1EA 2QACA 3CR5X 2FJUB 1YRTB 2R2IA 1MHOA 2KFHA 1YRUB 2JULA 2LM5A 3DVEA 1K90D 1TCOB 3H4SE 1Q80A 1DJIA 1OSAA 2WNDA 3LK1A 4I5LB 4P5OE 3EK7A 3VGOA 2WC8A 1KQVA 2KGRA 1J55A 2I18A
chains in the Genus database with same CATH superfamily
1NIWA 1EG4A 2JU0A 2KFGA 4MVFA 1CLLA 1YUTA 2LLTA 4ZCUA 1SL9A 1Y6WA 2OS8B 4HSZA 1DJZA 5KTYA 2NCPA 4YI9A 3EK4A 1P28A 2JZIA 2BL0B 4JQ0D 2CXJA 4USLA 2ZFDA 1K2HA 2K61A 3KO0A 3Q8IA 3WXAA 4M2PA 5HLVA 5K89A 4YRUA 1IGVA 4TNCA 1DEKA 3ICBA 4DCKA 3FS7A 2LC5A 2MLEC 1J1EA 4Q04A 1ZACA 1KK8C 1C3ZA 3UO9A 5CSJA 3HCMA 3S0BA 1KWOB 2ZNEA 3VB1A 4PT1A 1BJFA 1C3YA 2VRGA 2L4HA 1SKTA 3TZ1A 1WDCC 1X02A 4HRHA 2ZNDA 5BPJA 1M45A 4IL1A 2P71A 2P6BB 4F7FA 1WY9A 1NYAA 3SIAA 2P70A 1CLMA 1XFRA 2HETA 5D3OA 4ETOA 1DVIA 1XFZO 3BFHA 1DJXA 1RK9A 1A4PA 5AFPA 2LMVA 4JD9A 2M1KB 3IQQA 4I5KA 4BY5A 1GJYA 2F3YA 2KPHA 2I2RE 2M0RA 2E6WA 3FWCA 4F0ZB 3C1VA 1BODA 2JQ6A 3M0WA 1PALA 3EK8A 2HQ8A 3I5GB 1CNPA 3VRPA 1WLZA 2AAOA 1J7OA 1KSOA 1MXEA 1IJ5A 1WRZA 5JOLA 4I5JA 1IWQA 4GGNA 2L5XB 1B7TY 2O5GA 1YX7A 3BQ3A 2K2AA 3IQOA 2EGDA 2MA2A 1B7TZ 4N1FA 1K94A 1L2OB 1SR6B 1V1GA 2KAXA 4GAOA 3DVKA 5HLOA 4NDBA 3DY9A 5HKYA 5HKZA 1RTP1 1XK4A 1NPQA 1MQ1A 1DJHA 1XO5A 3I5HB 2AMIA 2LV7A 2M7NA 2M8UA 2MAZA 4ICBA 3SG3A 2Q4UA 1QLSA 2GGMA 3BFBA 3FE8A 1ALWA 4M2QA 3JTDC 1OMDA 5DKNA 1H4BA 3SS3A 3DD4A 3BYAA 2PVBA 1CLBA 1PK0D 1IKUA 2KLEA 5D7FA 1T14A 1CDLA 1BMOA 1DELA 1R6PA 1H8BA 4MRYA 3O78A 3SG4A 5FI6A 2G9BA 1ALVA 2LP2A 1ODBA 1TUJA 1QX2A 1OOGA 2PRUA 5CSNA 2M7LA 3DVJA 4E68A 3AKBA 1AUIB 1G33A 1C07A 3FWBA 1CKKA 1YX8A 1B8CA 2MRDA 2ISDA 3WNXB 1DMOA 2AUCA 3IF7A 3RZSA 4OCIA 3KHEA 1IQ5A 1F70A 1A03A 3N7HA 4GBAA 1QX7A 5DICA 3S0AA 1DGVA 3OGNA 4YGDB 2NCOA 3TDUA 3UNWA 2B1UA 1DQEA 2KI4B 1RECA 2KI6D 2OS8C 1AHRA 2EC6B 1PVAA 2WC5A 3TDIA 5TNCA 1MWNA 3S0FA 2BL0C 3SG2A 4C0KA 1M46A 1DTLA 1Z4HA 1KQMB 2F2PA 1NSHA 1GGZA 2Y1NA 1SK6D 4QJ3B 5ER4X 4N1GA 5J3XA 3A4UB 3CLNA 3D0YB 1F4OA 2F2OA 1S6JA 2JTTA 2ZRTA 2JOJA 2PSRA 4PHKA 1W7IB 1Z2CB 1DGUA 3SS5A 4WQ2A 4C0JA 1UHJA 2LVJA 1KWOC 3NHTA 3CDNA 2K0JA 4DIRA 1G4YR 1M39A 5EL2A 4M2OA 1YUSA 3BFAA 3VRNA 2H61A 4MLWA 3SJSA 1TN4A 2G2BA 5FI2A 1TCFA 2F33A 3R1VA 3GK2A 3OP0A 3CGAA 1QATA 3R1OA 3JVTB 3LCPC 4CLNA 1LVCD 1SMGA 3F45A 3TS5B 2BCXA 1SRAA 3PFVA 1PSRA 1QLKA 4I5NB 1S6IA 1UWOA 2K8MB 3CZ0A 3E3RA 4XJKB 2CTNA 1FI6A 1S3PA 3O4YA 4ORAB 1WRKA 1DF0B 1OOJA 1L7ZA 4XJKA 5F6TA 1FW4A 1CMGA 3DXLA 5KSZA 1QXPA 3BUWB 3I5GC 1N65A 3GK4X 2QEHA 2LMUA 2WCLA 2GV5A 4XYNA 2JC2A 4QJ4B 1B1GA 1R2UA 2MBXA 2LAPA 2ZN9A 1OQPA 2QDIA 3CR2A 1MUXA 3PATA 3VROA 5KU1A 3AKAA 2KBMA 3B6XA 1XK4C 3CS1A 1IJ6A 2WCJA 2I7AA 4GGFC 1L2OC 4PE0A 3OB2B 1UHNA 1SSEB 3NXAA 2FJYA 3I5HC 1J7RA 3EVVA 4JPZB 2CBLA 1S26D 2MJWB 2QPTA 3R72A 4C0LA 1U5IB 1J7QA 4JKTA 1FI5A 2KYCA 2A4JA 5D69A 1XVJA 5I2OA 1BOCA 1U5IA 1YVLA 4NQGA 3EKJA 2M3WA 1Y1AA 2CNPA 3KPXA 2WCMA 3S0EA 3IVTA 2K7OA 2JXLA 1LXFC 3LLEA 3NGVA 4WRIA 2KGBC 4PE4A 3O2PA 1TRFA 4PHMA 1Y0VH 2LVIA 1KCYA 1B8LA 3SG5A 1BR4B 4YGCB 1TOPA 1EG3A 2Y4QA 3L4AA 4GPLB 2ZRSA 4PE1A 5ER5A 3SG6A 5HYDA 2SCPA 5CSFA 1QV0A 3KEVA 2KQ6A 2M1UA 4MZKA 2KQYA 4YI8A 2KFFA 3S0GA 3CZ1A 4MEWA 3L47A 1QV1A 4MZJA 1JWDA 2JPOA 3BUOB 1QWVA 1XYDA 1KSMA 3CZTX 1B47A 5HL1A 1A2XA 2KI4C 1TWOA 2E30A 2EC6C 1B4CA 4ZCVA 1ZOTB 1OZOA 2Y5IA 3CZ2A 4ORBB 1F54A 3O4XA 1DT7B 5G08A 1W7JB 1SYMA 1KQMC 2JT3A 2PMYA 2V53A 3L4LA 1NX1A 4P2YB 2M49B 5FI7A 4GGFA 1CDMA 2L2CA 1CMFA 4OR9B 1SCVA 2JTZA 2NXQA 1A75B 1S6CA 1YTZC 2H61C 3TDZA 3GK1A 2K7BA 1EH2A 1EL4A 3MSEB 3I5IB 3VRRA 1A75A 1BLQA 4DS7A 1JFKA 1S36A 2HPSA 3ZNIA 5FYXA 1RWYA 5I94A 1D1OA 2L5YA 1CM4A 2FCDA 1QJTA 2K7CA 1XFXO 1KK8B 1V1FA 3JVTC 2JT8A 4FQTA 1QIWA 2CT9A 2BKHB 1IRJA 3SG7A 4PE7A 4PHJA 2ZN8A 3TS5C 1BU3A 1UHIA 1MF8B 4DRWA 1CFPA 2M29A 2F8PA 1IIOA 5CPVA 1RROA 1S1EA 2BNXA 1K9PA 4GNKB 1WDCB 3BUXB 3K21A 4WQ3A 5DKQA 4YBHB 5AANA 3FE9A 3D74A 2JRFA 1RFJA 1PULA 3WHTB 4MZLA 3PALA 4BY4A 1FF1A 1DC1A 5PALA 3D77A 4CPVA 2QEVA 1DJYA 1HQVA 1JUOA 3DF0B 2NZ0A 4PCWA 3NSIA 3CR4X 3CYZA 4HRGA 1AP4A 5IBWA 2WCHA 1K95A 4ORCB 5CSIA 4OZDA 1K93D 1BR1B 1S5GY 2HQWA 1TNXA 1PRWA 1S5GZ 3D0YA 4NDCA 2ERBA 4YGAA 1LKJA 5JJGA 1CM1A 1QIVA 1OE9B 1K9KA 3PJIA 2BBMA 4GFTA 2WCFA 2BECA 1KK7Y 1UUSA 4L9MA 1M31A 1KK7Z 3BOWB 3OX5A 1JBAA 2LLSA 2BKIB 1PVBA 4IJ7A 2BE6A 1YURA 1SL8A 3BUMB 2KDHA 4PALA 1N2DA 4CFQA 4DUQA 1ZUZA 1RJVA 3GOFA 1A29A 2PASA 4U8DA 3PM8A 1TIZA 2WOSA 2LNKA 3O6BA 2LHIA 2L50A 2GTEA 4MBEA 1FBVA 2LMTA 1B9AA 1WRLA 2F3ZA 1W9ZA 4JWQA 1E8AA 1DJGA 2EHBA 2NLNA 5I2QA 4AOMA 1UHHA 4KYNA 3TUYB 2WCEA 3NSKA 1DF0A 1UP5A 1CFDA 3PN7B 1NX3A 2FOTA 2OPOA 3D10A 2WC6A 1ORGA 1DJWA 1VRKA 4OKHA 2KAVA 3D78A 1NWDA 1K96A 1QTXA 1OW4A 1YVHA 1G8IA 1SR6C 2COLB 2Y1MA 2M9GA 1JC2A 1BF5A 3R1PA 1C7VA 2KBIA 4PHNA 5AEQA 3EKHA 3NHIA 1SCMB 1JF0A 2D8NA 3PLFB 1XFYO 1YUUA 2MHHA 1SPYA 2LLUA 2KAYA 1CTRA 3B87A 3CTNA 4CIDA 1Y1XA 3BXKA 3I5FB 1Y1UA 3LL8B 4FTGA 1MXLC 1OOIX 1QX5B 3I5IC 2JNXA 2LVVA 2GGZA 1OOFA 1UURA 5B8IB 2BCBA 4INWA 2OTGB 3NSOA 2L4IA 4D1EA 1F4QA 4YGEB 1QS7A 1TTXA 2IS9A 2L51A 3NSLA 3B88A 1NUBA 2JNFA 3VRQA 4HREE 1JSAA 1KFXS 1AJ5A 1SY9A 1XFVO 1OMRA 3D75A 3D73A 3FE6A 4MSPA 1HT9A 4UPGA 3AAKA 3SIBA 1XFUO 3EVUA 5AXIA 4MRXA 1F55A 1CFCA 1CDNA 3V2LA 3BJHA 3QMEA 1IH0A 1AVSA 4QJ5B 5HKWA 1KFXL 1PSBA 3HX4A 1K8UA 3EG5B 4GUKA 5DKRA 3LK0A 1BT6A 1LS8A 2I94A 2JWWA 2O60A 3RM1A 2WCKA 2LCPA 2PALA 3AAJA 1NP8A 3K1EA 3SS4A 2KHNA 2LANA 3A8RA 1AJ4A 3OBVA 1CDPA 5I2LA 3RLZA 1KFUS 2BCAA 1ZMZA 2L98A 2ZKMX 2SASA 5GQQC 3ZWHA 2KOTA 1NX2A 1SW8A 1N0YA 2BBNA 4PDZA 1WLMA 1CFFA 1LA0A 1TNQA 1TUZA 3KF9A 1J7PA 4AQIA 1SBJA 1KFUL 3DZTA 1SL7A 2L2EA 2LHLA 4A4BA 1XA5A 4N5XA 1F71A 1XFWO 2H2KA 3OB1B 1GQMA 5AERA 2Q91A 1LINA 1YR5A 4NDDA 2BE4A 4YGBB 1LA3A 1NCXA 4FQOA 4MN0A 2PYQA 5I8NA 2RGIA 4CFRA 3EVRA 2JPTA 2K60A 4OVNF 2LVKA 2K2FA 3D76A 1JFJA 2KLDA 3DYEA 2L0PA 1AK8A 1FPWA 1ZFSA 3S0DA 2CCMA 3TUYC 2MLFC 4OV2A 3PN7C 2LUCA 3CWGA 2HF5A 3QRXA 1TNPA 2WCBA 3DF0A 2QEBA 3PM2A 3PSRA 4A4CA 1OZSA 4INXA 2KNEA 1NCYA 2YGUA 2LP3A 2M97A 1SCMC 1SNLA 1IG5A 2PQLA 3DVMA 2K7DA 3OX6A 1QVIY 1EJ3A 1NX0A 1GGWA 3B7AA 2KI6C 3BUNB 1QVIZ 1GM0A 1M63B 3FIAA 3I5FC 2BAPA 1F8HA 1K9UA 2KYFA 1C7WA 1MR8A 1UHKA 2OTGC 1EXRA 3WHUB 1OMVA 4AQJA 1NCZA 1JF2A 1BG1A 2JXCA 2QEOA 3BOWA 1IQ3A 2LUXA 1TNWA 2TN4A 2WORA 3B86A 3OHMB 1QASA 2KSPA 2JT0A 2DOQA 1CB1A 1B8RA 1J1DA 2FCEA 2LE9B 3JTDB 4R1EA 2QACA 3CR5X 2FJUB 1YRTB 2R2IA 1MHOA 2KFHA 1YRUB 2JULA 2LM5A 3DVEA 1K90D 1TCOB 3H4SE 1Q80A 1DJIA 1OSAA 2WNDA 3LK1A 4I5LB 1OOHA 2H8VA 4P5OE 3EK7A 3VGOA 2WC8A 1KQVA 3CABA 2KGRA 1J55A 2I18A
chains in the Genus database with same CATH topology
1NIWA 1EG4A 2JU0A 2KFGA 4MVFA 1CLLA 1YUTA 2LLTA 4ZCUA 1SL9A 1Y6WA 2OS8B 4HSZA 1DJZA 5KTYA 2NCPA 4YI9A 3EK4A 2JZIA 2BL0B 4JQ0D 2CXJA 4USLA 2ZFDA 1K2HA 2K61A 3KO0A 3WXAA 4M2PA 5HLVA 5K89A 4YRUA 1IGVA 4TNCA 3ICBA 4DCKA 3FS7A 2LC5A 2MLEC 1J1EA 4Q04A 1ZACA 1KK8C 5CSJA 3HCMA 1KWOB 2ZNEA 1BJFA 2VRGA 2L4HA 1SKTA 3TZ1A 1WDCC 1X02A 4HRHA 2ZNDA 5BPJA 1M45A 4IL1A 2P6BB 1WY9A 1NYAA 3SIAA 1CLMA 2HETA 4ETOA 1DVIA 1XFZO 1DJXA 1RK9A 1A4PA 5AFPA 2LMVA 2M1KB 3IQQA 4I5KA 4BY5A 1GJYA 2F3YA 2I2RE 2M0RA 2E6WA 3FWCA 4F0ZB 3C1VA 1BODA 2JQ6A 3M0WA 1PALA 3EK8A 2HQ8A 3I5GB 1CNPA 3VRPA 1WLZA 2AAOA 1J7OA 1KSOA 1MXEA 1IJ5A 1WRZA 5JOLA 4I5JA 1IWQA 4GGNA 2L5XB 1B7TY 2O5GA 1YX7A 3BQ3A 2K2AA 3IQOA 2EGDA 2MA2A 1B7TZ 4N1FA 1K94A 1L2OB 1SR6B 1V1GA 2KAXA 4GAOA 3DVKA 5HLOA 4NDBA 5HKYA 5HKZA 1RTP1 1XK4A 1NPQA 1MQ1A 1DJHA 1XO5A 3I5HB 2AMIA 2LV7A 2M7NA 2M8UA 2MAZA 4ICBA 3SG3A 2Q4UA 1QLSA 2GGMA 1ALWA 4M2QA 3JTDC 1OMDA 5DKNA 1H4BA 3DD4A 3BYAA 2PVBA 1CLBA 1PK0D 1IKUA 5D7FA 1CDLA 1BMOA 1H8BA 1R6PA 4MRYA 3O78A 3SG4A 2G9BA 1ALVA 2LP2A 1ODBA 1QX2A 2PRUA 2M7LA 5CSNA 4E68A 3DVJA 3AKBA 1AUIB 1G33A 1C07A 3FWBA 1CKKA 1YX8A 1B8CA 2MRDA 2ISDA 3WNXB 1DMOA 2AUCA 3IF7A 4OCIA 3KHEA 1IQ5A 1F70A 1A03A 4GBAA 1QX7A 1DGVA 3TDUA 4YGDB 2NCOA 2B1UA 2KI4B 2KI6D 1RECA 2OS8C 3TDIA 1AHRA 2EC6B 1PVAA 5TNCA 1MWNA 2BL0C 3SG2A 4C0KA 1M46A 1DTLA 2F2PA 1KQMB 1NSHA 1GGZA 2Y1NA 1SK6D 4QJ3B 5ER4X 4N1GA 5J3XA 3A4UB 3CLNA 3D0YB 1F4OA 2F2OA 1S6JA 2JTTA 2ZRTA 2JOJA 2PSRA 4PHKA 1W7IB 1DGUA 4WQ2A 4C0JA 1UHJA 2LVJA 1KWOC 4DIRA 2K0JA 1G4YR 1M39A 4M2OA 1YUSA 3VRNA 2H61A 4MLWA 3SJSA 1TN4A 2G2BA 1TCFA 2F33A 3GK2A 3OP0A 3CGAA 1QATA 3JVTB 3LCPC 4CLNA 1LVCD 1SMGA 3F45A 3TS5B 2BCXA 1SRAA 3PFVA 1PSRA 1QLKA 4I5NB 1S6IA 1UWOA 2K8MB 3E3RA 4XJKB 2CTNA 1FI6A 1S3PA 3O4YA 4ORAB 1WRKA 1DF0B 1OOJA 1L7ZA 4XJKA 5F6TA 1FW4A 1CMGA 5KSZA 1QXPA 3BUWB 3I5GC 1N65A 3GK4X 4XYNA 2LMUA 2GV5A 2JC2A 4QJ4B 1B1GA 1R2UA 2MBXA 2LAPA 2ZN9A 1OQPA 3CR2A 1MUXA 3PATA 3VROA 5KU1A 3AKAA 2KBMA 3CS1A 1XK4C 1IJ6A 2I7AA 4GGFC 1L2OC 4PE0A 3OB2B 1UHNA 3NXAA 3I5HC 1J7RA 3EVVA 4JPZB 2CBLA 1S26D 2MJWB 2QPTA 4C0LA 1U5IB 1J7QA 1FI5A 2KYCA 2A4JA 5D69A 1XVJA 5I2OA 1BOCA 1U5IA 1YVLA 4NQGA 3EKJA 2M3WA 1Y1AA 2CNPA 3KPXA 3LLEA 2K7OA 2JXLA 1LXFC 4WRIA 2KGBC 4PE4A 3O2PA 1TRFA 4PHMA 1Y0VH 2LVIA 1KCYA 1B8LA 3SG5A 1BR4B 4YGCB 1TOPA 1EG3A 2Y4QA 4GPLB 4PE1A 2ZRSA 5ER5A 3SG6A 5HYDA 2SCPA 5CSFA 1QV0A 3KEVA 2KQ6A 2M1UA 4MZKA 2KQYA 4YI8A 2KFFA 4MEWA 1QV1A 4MZJA 1JWDA 3BUOB 1XYDA 1KSMA 3CZTX 1B47A 1A2XA 2KI4C 2E30A 2EC6C 1B4CA 4ZCVA 1ZOTB 1OZOA 2Y5IA 4ORBB 1F54A 1DT7B 5G08A 1W7JB 1SYMA 1KQMC 2JT3A 2PMYA 2V53A 1NX1A 4P2YB 2M49B 4GGFA 1CDMA 1CMFA 4OR9B 1SCVA 2JTZA 2NXQA 1A75B 1S6CA 1YTZC 2H61C 3TDZA 3GK1A 2K7BA 1EH2A 1EL4A 3MSEB 3I5IB 3VRRA 1A75A 1BLQA 4DS7A 1JFKA 1S36A 2HPSA 3ZNIA 5FYXA 1RWYA 1D1OA 1CM4A 2FCDA 1QJTA 2K7CA 1XFXO 1KK8B 1V1FA 3JVTC 2JT8A 1QIWA 2CT9A 2BKHB 1IRJA 3SG7A 4PE7A 4PHJA 2ZN8A 3TS5C 1BU3A 1UHIA 1MF8B 4DRWA 1CFPA 2M29A 2F8PA 5CPVA 1RROA 1S1EA 1K9PA 4GNKB 1WDCB 3BUXB 3K21A 4WQ3A 5DKQA 4YBHB 5AANA 2JRFA 1RFJA 1PULA 3WHTB 4MZLA 3PALA 4BY4A 1FF1A 5PALA 4CPVA 1DJYA 1HQVA 1JUOA 3DF0B 2NZ0A 4PCWA 3NSIA 3CR4X 4HRGA 1AP4A 5IBWA 1K95A 4ORCB 5CSIA 1K93D 1BR1B 1S5GY 2HQWA 1TNXA 1PRWA 1S5GZ 3D0YA 4NDCA 4YGAA 1LKJA 5JJGA 1CM1A 1QIVA 1OE9B 1K9KA 2BBMA 4GFTA 2WCFA 2BECA 1KK7Y 1UUSA 4L9MA 1M31A 1KK7Z 3BOWB 3OX5A 1JBAA 2LLSA 2BKIB 1PVBA 2BE6A 1YURA 1SL8A 3BUMB 2KDHA 4PALA 1N2DA 4CFQA 4DUQA 1ZUZA 1RJVA 3GOFA 1A29A 2PASA 4U8DA 3PM8A 1TIZA 2WOSA 2LNKA 3O6BA 2LHIA 2L50A 4MBEA 1FBVA 2LMTA 1B9AA 1WRLA 2F3ZA 4JWQA 1E8AA 1DJGA 2EHBA 2NLNA 5I2QA 4AOMA 1UHHA 3TUYB 2WCEA 3NSKA 1DF0A 1UP5A 1CFDA 3PN7B 1NX3A 2FOTA 2OPOA 3D10A 4OKHA 1DJWA 1VRKA 2KAVA 1NWDA 1K96A 1QTXA 1YVHA 1G8IA 1SR6C 2COLB 2Y1MA 2M9GA 1JC2A 1BF5A 1C7VA 2KBIA 4PHNA 5AEQA 3EKHA 3PLFB 1SCMB 1JF0A 2D8NA 1XFYO 1YUUA 2MHHA 1SPYA 2LLUA 2KAYA 1CTRA 3CTNA 4CIDA 1Y1XA 3BXKA 3I5FB 1Y1UA 3LL8B 4FTGA 1MXLC 3I5IC 1QX5B 2JNXA 2LVVA 2GGZA 1UURA 5B8IB 2BCBA 2OTGB 3NSOA 2L4IA 4D1EA 1F4QA 4YGEB 1QS7A 1TTXA 2IS9A 2L51A 3NSLA 3VRQA 1NUBA 2JNFA 4HREE 1JSAA 1KFXS 1AJ5A 1SY9A 1XFVO 1OMRA 4MSPA 1HT9A 4UPGA 3AAKA 3SIBA 1XFUO 3EVUA 5AXIA 4MRXA 1F55A 1CFCA 1CDNA 1IH0A 1AVSA 4QJ5B 5HKWA 1KFXL 1PSBA 3HX4A 1K8UA 4GUKA 5DKRA 3LK0A 1BT6A 2JWWA 2I94A 2O60A 3RM1A 2LCPA 2PALA 3AAJA 1NP8A 2KHNA 2LANA 3A8RA 1AJ4A 1CDPA 5I2LA 3RLZA 1KFUS 2BCAA 1ZMZA 2L98A 2ZKMX 2SASA 5GQQC 3ZWHA 2KOTA 1NX2A 1SW8A 1N0YA 2BBNA 4PDZA 1WLMA 1CFFA 1LA0A 1TNQA 3KF9A 1J7PA 4AQIA 1SBJA 1KFUL 1SL7A 2L2EA 2LHLA 4A4BA 1XA5A 4N5XA 1F71A 1XFWO 2H2KA 3OB1B 1GQMA 5AERA 2Q91A 1LINA 1YR5A 4NDDA 2BE4A 4YGBB 1LA3A 1NCXA 4FQOA 4MN0A 5I8NA 2RGIA 4CFRA 3EVRA 2JPTA 4OVNF 2LVKA 2K2FA 1JFJA 2L0PA 1AK8A 1FPWA 1ZFSA 2CCMA 3TUYC 2MLFC 4OV2A 3PN7C 2LUCA 3CWGA 2HF5A 3QRXA 1TNPA 2WCBA 3DF0A 3PSRA 4A4CA 1OZSA 2KNEA 1NCYA 2LP3A 2M97A 1SCMC 1SNLA 1IG5A 3DVMA 2K7DA 3OX6A 1QVIY 1EJ3A 1NX0A 1GGWA 2KI6C 3BUNB 1QVIZ 1M63B 3FIAA 3I5FC 1F8HA 1K9UA 2KYFA 1C7WA 1MR8A 1UHKA 2OTGC 1EXRA 3WHUB 1OMVA 4AQJA 1NCZA 1JF2A 1BG1A 2JXCA 3BOWA 1IQ3A 2LUXA 1TNWA 2TN4A 2WORA 3OHMB 1QASA 2KSPA 2JT0A 2DOQA 1CB1A 1B8RA 1J1DA 2FCEA 2LE9B 3JTDB 4R1EA 2QACA 3CR5X 2FJUB 1YRTB 2R2IA 1MHOA 2KFHA 1YRUB 2JULA 2LM5A 3DVEA 1K90D 1TCOB 3H4SE 1Q80A 1DJIA 1OSAA 2WNDA 3LK1A 4I5LB 4P5OE 3EK7A 3VGOA 2WC8A 1KQVA 2KGRA 1J55A 2I18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NIW A;  1EG4 A;  2JU0 A;  2KFG A;  4MVF A;  1CLL A;  1YUT A;  2LLT A;  4ZCU A;  1SL9 A;  1Y6W A;  2OS8 B;  4HSZ A;  1DJZ A;  5KTY A;  2NCP A;  4YI9 A;  3EK4 A;  2JZI A;  2BL0 B;  4JQ0 D;  2CXJ A;  4USL A;  2ZFD A;  1K2H A;  2K61 A;  3KO0 A;  3WXA A;  4M2P A;  5HLV A;  5K89 A;  4YRU A;  1IGV A;  4TNC A;  3ICB A;  4DCK A;  3FS7 A;  2LC5 A;  2MLE C;  1J1E A;  4Q04 A;  1ZAC A;  1KK8 C;  5CSJ A;  3HCM A;  1KWO B;  2ZNE A;  1BJF A;  2VRG A;  2L4H A;  1SKT A;  3TZ1 A;  1WDC C;  1X02 A;  4HRH A;  2ZND A;  5BPJ A;  1M45 A;  4IL1 A;  2P6B B;  1WY9 A;  1NYA A;  3SIA A;  1CLM A;  2HET A;  4ETO A;  1DVI A;  1XFZ O;  1DJX A;  1RK9 A;  1A4P A;  5AFP A;  2LMV A;  2M1K B;  3IQQ A;  4I5K A;  4BY5 A;  1GJY A;  2F3Y A;  2I2R E;  2M0R A;  2E6W A;  3FWC A;  4F0Z B;  3C1V A;  1BOD A;  2JQ6 A;  3M0W A;  1PAL A;  3EK8 A;  2HQ8 A;  3I5G B;  1CNP A;  3VRP A;  1WLZ A;  2AAO A;  1J7O A;  1KSO A;  1MXE A;  1IJ5 A;  1WRZ A;  5JOL A;  4I5J A;  1IWQ A;  4GGN A;  2L5X B;  1B7T Y;  2O5G A;  1YX7 A;  3BQ3 A;  2K2A A;  3IQO A;  2EGD A;  2MA2 A;  1B7T Z;  4N1F A;  1K94 A;  1L2O B;  1SR6 B;  1V1G A;  2KAX A;  4GAO A;  3DVK A;  5HLO A;  4NDB A;  5HKY A;  5HKZ A;  1RTP 1;  1XK4 A;  1NPQ A;  1MQ1 A;  1DJH A;  1XO5 A;  3I5H B;  2AMI A;  2LV7 A;  2M7N A;  2M8U A;  2MAZ A;  4ICB A;  3SG3 A;  2Q4U A;  1QLS A;  2GGM A;  1ALW A;  4M2Q A;  3JTD C;  1OMD A;  5DKN A;  1H4B A;  3DD4 A;  3BYA A;  2PVB A;  1CLB A;  1PK0 D;  1IKU A;  5D7F A;  1CDL A;  1BMO A;  1H8B A;  1R6P A;  4MRY A;  3O78 A;  3SG4 A;  2G9B A;  1ALV A;  2LP2 A;  1ODB A;  1QX2 A;  2PRU A;  2M7L A;  5CSN A;  4E68 A;  3DVJ A;  3AKB A;  1AUI B;  1G33 A;  1C07 A;  3FWB A;  1CKK A;  1YX8 A;  1B8C A;  2MRD A;  2ISD A;  3WNX B;  1DMO A;  2AUC A;  3IF7 A;  4OCI A;  3KHE A;  1IQ5 A;  1F70 A;  1A03 A;  4GBA A;  1QX7 A;  1DGV A;  3TDU A;  4YGD B;  2NCO A;  2B1U A;  2KI4 B;  2KI6 D;  1REC A;  2OS8 C;  3TDI A;  1AHR A;  2EC6 B;  1PVA A;  5TNC A;  1MWN A;  2BL0 C;  3SG2 A;  4C0K A;  1M46 A;  1DTL A;  2F2P A;  1KQM B;  1NSH A;  1GGZ A;  2Y1N A;  1SK6 D;  4QJ3 B;  5ER4 X;  4N1G A;  5J3X A;  3A4U B;  3CLN A;  3D0Y B;  1F4O A;  2F2O A;  1S6J A;  2JTT A;  2ZRT A;  2JOJ A;  2PSR A;  4PHK A;  1W7I B;  1DGU A;  4WQ2 A;  4C0J A;  1UHJ A;  2LVJ A;  1KWO C;  4DIR A;  2K0J A;  1G4Y R;  1M39 A;  4M2O A;  1YUS A;  3VRN A;  2H61 A;  4MLW A;  3SJS A;  1TN4 A;  2G2B A;  1TCF A;  2F33 A;  3GK2 A;  3OP0 A;  3CGA A;  1QAT A;  3JVT B;  3LCP C;  4CLN A;  1LVC D;  1SMG A;  3F45 A;  3TS5 B;  2BCX A;  1SRA A;  3PFV A;  1PSR A;  1QLK A;  4I5N B;  1S6I A;  1UWO A;  2K8M B;  3E3R A;  4XJK B;  2CTN A;  1FI6 A;  1S3P A;  3O4Y A;  4ORA B;  1WRK A;  1DF0 B;  1OOJ A;  1L7Z A;  4XJK A;  5F6T A;  1FW4 A;  1CMG A;  5KSZ A;  1QXP A;  3BUW B;  3I5G C;  1N65 A;  3GK4 X;  4XYN A;  2LMU A;  2GV5 A;  2JC2 A;  4QJ4 B;  1B1G A;  1R2U A;  2MBX A;  2LAP A;  2ZN9 A;  1OQP A;  3CR2 A;  1MUX A;  3PAT A;  3VRO A;  5KU1 A;  3AKA A;  2KBM A;  3CS1 A;  1XK4 C;  1IJ6 A;  2I7A A;  4GGF C;  1L2O C;  4PE0 A;  3OB2 B;  1UHN A;  3NXA A;  3I5H C;  1J7R A;  3EVV A;  4JPZ B;  2CBL A;  1S26 D;  2MJW B;  2QPT A;  4C0L A;  1U5I B;  1J7Q A;  1FI5 A;  2KYC A;  2A4J A;  5D69 A;  1XVJ A;  5I2O A;  1BOC A;  1U5I A;  1YVL A;  4NQG A;  3EKJ A;  2M3W A;  1Y1A A;  2CNP A;  3KPX A;  3LLE A;  2K7O A;  2JXL A;  1LXF C;  4WRI A;  2KGB C;  4PE4 A;  3O2P A;  1TRF A;  4PHM A;  1Y0V H;  2LVI A;  1KCY A;  1B8L A;  3SG5 A;  1BR4 B;  4YGC B;  1TOP A;  1EG3 A;  2Y4Q A;  4GPL B;  4PE1 A;  2ZRS A;  5ER5 A;  3SG6 A;  5HYD A;  2SCP A;  5CSF A;  1QV0 A;  3KEV A;  2KQ6 A;  2M1U A;  4MZK A;  2KQY A;  4YI8 A;  2KFF A;  4MEW A;  1QV1 A;  4MZJ A;  1JWD A;  3BUO B;  1XYD A;  1KSM A;  3CZT X;  1B47 A;  1A2X A;  2KI4 C;  2E30 A;  2EC6 C;  1B4C A;  4ZCV A;  1ZOT B;  1OZO A;  2Y5I A;  4ORB B;  1F54 A;  1DT7 B;  5G08 A;  1W7J B;  1SYM A;  1KQM C;  2JT3 A;  2PMY A;  2V53 A;  1NX1 A;  4P2Y B;  2M49 B;  4GGF A;  1CDM A;  1CMF A;  4OR9 B;  1SCV A;  2JTZ A;  2NXQ A;  1A75 B;  1S6C A;  1YTZ C;  2H61 C;  3TDZ A;  3GK1 A;  2K7B A;  1EH2 A;  1EL4 A;  3MSE B;  3I5I B;  3VRR A;  1A75 A;  1BLQ A;  4DS7 A;  1JFK A;  1S36 A;  2HPS A;  3ZNI A;  5FYX A;  1RWY A;  1D1O A;  1CM4 A;  2FCD A;  1QJT A;  2K7C A;  1XFX O;  1KK8 B;  1V1F A;  3JVT C;  2JT8 A;  1QIW A;  2CT9 A;  2BKH B;  1IRJ A;  3SG7 A;  4PE7 A;  4PHJ A;  2ZN8 A;  3TS5 C;  1BU3 A;  1UHI A;  1MF8 B;  4DRW A;  1CFP A;  2M29 A;  2F8P A;  5CPV A;  1RRO A;  1S1E A;  1K9P A;  4GNK B;  1WDC B;  3BUX B;  3K21 A;  4WQ3 A;  5DKQ A;  4YBH B;  5AAN A;  2JRF A;  1RFJ A;  1PUL A;  3WHT B;  4MZL A;  3PAL A;  4BY4 A;  1FF1 A;  5PAL A;  4CPV A;  1DJY A;  1HQV A;  1JUO A;  3DF0 B;  2NZ0 A;  4PCW A;  3NSI A;  3CR4 X;  4HRG A;  1AP4 A;  5IBW A;  1K95 A;  4ORC B;  5CSI A;  1K93 D;  1BR1 B;  1S5G Y;  2HQW A;  1TNX A;  1PRW A;  1S5G Z;  3D0Y A;  4NDC A;  4YGA A;  1LKJ A;  5JJG A;  1CM1 A;  1QIV A;  1OE9 B;  1K9K A;  2BBM A;  4GFT A;  2WCF A;  2BEC A;  1KK7 Y;  1UUS A;  4L9M A;  1M31 A;  1KK7 Z;  3BOW B;  3OX5 A;  1JBA A;  2LLS A;  2BKI B;  1PVB A;  2BE6 A;  1YUR A;  1SL8 A;  3BUM B;  2KDH A;  4PAL A;  1N2D A;  4CFQ A;  4DUQ A;  1ZUZ A;  1RJV A;  3GOF A;  1A29 A;  2PAS A;  4U8D A;  3PM8 A;  1TIZ A;  2WOS A;  2LNK A;  3O6B A;  2LHI A;  2L50 A;  4MBE A;  1FBV A;  2LMT A;  1B9A A;  1WRL A;  2F3Z A;  4JWQ A;  1E8A A;  1DJG A;  2EHB A;  2NLN A;  5I2Q A;  4AOM A;  1UHH A;  3TUY B;  2WCE A;  3NSK A;  1DF0 A;  1UP5 A;  1CFD A;  3PN7 B;  1NX3 A;  2FOT A;  2OPO A;  3D10 A;  4OKH A;  1DJW A;  1VRK A;  2KAV A;  1NWD A;  1K96 A;  1QTX A;  1YVH A;  1G8I A;  1SR6 C;  2COL B;  2Y1M A;  2M9G A;  1JC2 A;  1BF5 A;  1C7V A;  2KBI A;  4PHN A;  5AEQ A;  3EKH A;  3PLF B;  1SCM B;  1JF0 A;  2D8N A;  1XFY O;  1YUU A;  2MHH A;  1SPY A;  2LLU A;  2KAY A;  1CTR A;  3CTN A;  4CID A;  1Y1X A;  3BXK A;  3I5F B;  1Y1U A;  3LL8 B;  4FTG A;  1MXL C;  3I5I C;  1QX5 B;  2JNX A;  2LVV A;  2GGZ A;  1UUR A;  5B8I B;  2BCB A;  2OTG B;  3NSO A;  2L4I A;  4D1E A;  1F4Q A;  4YGE B;  1QS7 A;  1TTX A;  2IS9 A;  2L51 A;  3NSL A;  3VRQ A;  1NUB A;  2JNF A;  4HRE E;  1JSA A;  1KFX S;  1AJ5 A;  1SY9 A;  1XFV O;  1OMR A;  4MSP A;  1HT9 A;  4UPG A;  3AAK A;  3SIB A;  1XFU O;  3EVU A;  5AXI A;  4MRX A;  1F55 A;  1CFC A;  1CDN A;  1IH0 A;  1AVS A;  4QJ5 B;  5HKW A;  1KFX L;  1PSB A;  3HX4 A;  1K8U A;  4GUK A;  5DKR A;  3LK0 A;  1BT6 A;  2JWW A;  2I94 A;  2O60 A;  3RM1 A;  2LCP A;  2PAL A;  3AAJ A;  1NP8 A;  2KHN A;  2LAN A;  3A8R A;  1AJ4 A;  1CDP A;  5I2L A;  3RLZ A;  1KFU S;  2BCA A;  1ZMZ A;  2L98 A;  2ZKM X;  2SAS A;  5GQQ C;  3ZWH A;  2KOT A;  1NX2 A;  1SW8 A;  1N0Y A;  2BBN A;  4PDZ A;  1WLM A;  1CFF A;  1LA0 A;  1TNQ A;  3KF9 A;  1J7P A;  4AQI A;  1SBJ A;  1KFU L;  1SL7 A;  2L2E A;  2LHL A;  4A4B A;  1XA5 A;  4N5X A;  1F71 A;  1XFW O;  2H2K A;  3OB1 B;  1GQM A;  5AER A;  2Q91 A;  1LIN A;  1YR5 A;  4NDD A;  2BE4 A;  4YGB B;  1LA3 A;  1NCX A;  4FQO A;  4MN0 A;  5I8N A;  2RGI A;  4CFR A;  3EVR A;  2JPT A;  4OVN F;  2LVK A;  2K2F A;  1JFJ A;  2L0P A;  1AK8 A;  1FPW A;  1ZFS A;  2CCM A;  3TUY C;  2MLF C;  4OV2 A;  3PN7 C;  2LUC A;  3CWG A;  2HF5 A;  3QRX A;  1TNP A;  2WCB A;  3DF0 A;  3PSR A;  4A4C A;  1OZS A;  2KNE A;  1NCY A;  2LP3 A;  2M97 A;  1SCM C;  1SNL A;  1IG5 A;  3DVM A;  2K7D A;  3OX6 A;  1QVI Y;  1EJ3 A;  1NX0 A;  1GGW A;  2KI6 C;  3BUN B;  1QVI Z;  1M63 B;  3FIA A;  3I5F C;  1F8H A;  1K9U A;  2KYF A;  1C7W A;  1MR8 A;  1UHK A;  2OTG C;  1EXR A;  3WHU B;  1OMV A;  4AQJ A;  1NCZ A;  1JF2 A;  1BG1 A;  2JXC A;  3BOW A;  1IQ3 A;  2LUX A;  1TNW A;  2TN4 A;  2WOR A;  3OHM B;  1QAS A;  2KSP A;  2JT0 A;  2DOQ A;  1CB1 A;  1B8R A;  1J1D A;  2FCE A;  2LE9 B;  3JTD B;  4R1E A;  2QAC A;  3CR5 X;  2FJU B;  1YRT B;  2R2I A;  1MHO A;  2KFH A;  1YRU B;  2JUL A;  2LM5 A;  3DVE A;  1K90 D;  1TCO B;  3H4S E;  1Q80 A;  1DJI A;  1OSA A;  2WND A;  3LK1 A;  4I5L B;  4P5O E;  3EK7 A;  3VGO A;  2WC8 A;  1KQV A;  2KGR A;  1J55 A;  2I18 A; 
#chains in the Genus database with same CATH topology
 1NIW A;  1EG4 A;  2JU0 A;  2KFG A;  4MVF A;  1CLL A;  1YUT A;  2LLT A;  4ZCU A;  1SL9 A;  1Y6W A;  2OS8 B;  4HSZ A;  1DJZ A;  5KTY A;  2NCP A;  4YI9 A;  3EK4 A;  1P28 A;  2JZI A;  2BL0 B;  4JQ0 D;  2CXJ A;  4USL A;  2ZFD A;  1K2H A;  2K61 A;  3KO0 A;  3Q8I A;  3WXA A;  4M2P A;  5HLV A;  5K89 A;  4YRU A;  1IGV A;  4TNC A;  1DEK A;  3ICB A;  4DCK A;  3FS7 A;  2LC5 A;  2MLE C;  1J1E A;  4Q04 A;  1ZAC A;  1KK8 C;  1C3Z A;  3UO9 A;  5CSJ A;  3HCM A;  3S0B A;  1KWO B;  2ZNE A;  3VB1 A;  4PT1 A;  1BJF A;  1C3Y A;  2VRG A;  2L4H A;  1SKT A;  3TZ1 A;  1WDC C;  1X02 A;  4HRH A;  2ZND A;  5BPJ A;  1M45 A;  4IL1 A;  2P71 A;  2P6B B;  4F7F A;  1WY9 A;  1NYA A;  3SIA A;  2P70 A;  1CLM A;  1XFR A;  2HET A;  5D3O A;  4ETO A;  1DVI A;  1XFZ O;  3BFH A;  1DJX A;  1RK9 A;  1A4P A;  5AFP A;  2LMV A;  4JD9 A;  2M1K B;  3IQQ A;  4I5K A;  4BY5 A;  1GJY A;  2F3Y A;  2KPH A;  2I2R E;  2M0R A;  2E6W A;  3FWC A;  4F0Z B;  3C1V A;  1BOD A;  2JQ6 A;  3M0W A;  1PAL A;  3EK8 A;  2HQ8 A;  3I5G B;  1CNP A;  3VRP A;  1WLZ A;  2AAO A;  1J7O A;  1KSO A;  1MXE A;  1IJ5 A;  1WRZ A;  5JOL A;  4I5J A;  1IWQ A;  4GGN A;  2L5X B;  1B7T Y;  2O5G A;  1YX7 A;  3BQ3 A;  2K2A A;  3IQO A;  2EGD A;  2MA2 A;  1B7T Z;  4N1F A;  1K94 A;  1L2O B;  1SR6 B;  1V1G A;  2KAX A;  4GAO A;  3DVK A;  5HLO A;  4NDB A;  3DY9 A;  5HKY A;  5HKZ A;  1RTP 1;  1XK4 A;  1NPQ A;  1MQ1 A;  1DJH A;  1XO5 A;  3I5H B;  2AMI A;  2LV7 A;  2M7N A;  2M8U A;  2MAZ A;  4ICB A;  3SG3 A;  2Q4U A;  1QLS A;  2GGM A;  3BFB A;  3FE8 A;  1ALW A;  4M2Q A;  3JTD C;  1OMD A;  5DKN A;  1H4B A;  3SS3 A;  3DD4 A;  3BYA A;  2PVB A;  1CLB A;  1PK0 D;  1IKU A;  2KLE A;  5D7F A;  1T14 A;  1CDL A;  1BMO A;  1DEL A;  1R6P A;  1H8B A;  4MRY A;  3O78 A;  3SG4 A;  5FI6 A;  2G9B A;  1ALV A;  2LP2 A;  1ODB A;  1TUJ A;  1QX2 A;  1OOG A;  2PRU A;  5CSN A;  2M7L A;  3DVJ A;  4E68 A;  3AKB A;  1AUI B;  1G33 A;  1C07 A;  3FWB A;  1CKK A;  1YX8 A;  1B8C A;  2MRD A;  2ISD A;  3WNX B;  1DMO A;  2AUC A;  3IF7 A;  3RZS A;  4OCI A;  3KHE A;  1IQ5 A;  1F70 A;  1A03 A;  3N7H A;  4GBA A;  1QX7 A;  5DIC A;  3S0A A;  1DGV A;  3OGN A;  4YGD B;  2NCO A;  3TDU A;  3UNW A;  2B1U A;  1DQE A;  2KI4 B;  1REC A;  2KI6 D;  2OS8 C;  1AHR A;  2EC6 B;  1PVA A;  2WC5 A;  3TDI A;  5TNC A;  1MWN A;  3S0F A;  2BL0 C;  3SG2 A;  4C0K A;  1M46 A;  1DTL A;  1Z4H A;  1KQM B;  2F2P A;  1NSH A;  1GGZ A;  2Y1N A;  1SK6 D;  4QJ3 B;  5ER4 X;  4N1G A;  5J3X A;  3A4U B;  3CLN A;  3D0Y B;  1F4O A;  2F2O A;  1S6J A;  2JTT A;  2ZRT A;  2JOJ A;  2PSR A;  4PHK A;  1W7I B;  1Z2C B;  1DGU A;  3SS5 A;  4WQ2 A;  4C0J A;  1UHJ A;  2LVJ A;  1KWO C;  3NHT A;  3CDN A;  2K0J A;  4DIR A;  1G4Y R;  1M39 A;  5EL2 A;  4M2O A;  1YUS A;  3BFA A;  3VRN A;  2H61 A;  4MLW A;  3SJS A;  1TN4 A;  2G2B A;  5FI2 A;  1TCF A;  2F33 A;  3R1V A;  3GK2 A;  3OP0 A;  3CGA A;  1QAT A;  3R1O A;  3JVT B;  3LCP C;  4CLN A;  1LVC D;  1SMG A;  3F45 A;  3TS5 B;  2BCX A;  1SRA A;  3PFV A;  1PSR A;  1QLK A;  4I5N B;  1S6I A;  1UWO A;  2K8M B;  3CZ0 A;  3E3R A;  4XJK B;  2CTN A;  1FI6 A;  1S3P A;  3O4Y A;  4ORA B;  1WRK A;  1DF0 B;  1OOJ A;  1L7Z A;  4XJK A;  5F6T A;  1FW4 A;  1CMG A;  3DXL A;  5KSZ A;  1QXP A;  3BUW B;  3I5G C;  1N65 A;  3GK4 X;  2QEH A;  2LMU A;  2WCL A;  2GV5 A;  4XYN A;  2JC2 A;  4QJ4 B;  1B1G A;  1R2U A;  2MBX A;  2LAP A;  2ZN9 A;  1OQP A;  2QDI A;  3CR2 A;  1MUX A;  3PAT A;  3VRO A;  5KU1 A;  3AKA A;  2KBM A;  3B6X A;  1XK4 C;  3CS1 A;  1IJ6 A;  2WCJ A;  2I7A A;  4GGF C;  1L2O C;  4PE0 A;  3OB2 B;  1UHN A;  1SSE B;  3NXA A;  2FJY A;  3I5H C;  1J7R A;  3EVV A;  4JPZ B;  2CBL A;  1S26 D;  2MJW B;  2QPT A;  3R72 A;  4C0L A;  1U5I B;  1J7Q A;  4JKT A;  1FI5 A;  2KYC A;  2A4J A;  5D69 A;  1XVJ A;  5I2O A;  1BOC A;  1U5I A;  1YVL A;  4NQG A;  3EKJ A;  2M3W A;  1Y1A A;  2CNP A;  3KPX A;  2WCM A;  3S0E A;  3IVT A;  2K7O A;  2JXL A;  1LXF C;  3LLE A;  3NGV A;  4WRI A;  2KGB C;  4PE4 A;  3O2P A;  1TRF A;  4PHM A;  1Y0V H;  2LVI A;  1KCY A;  1B8L A;  3SG5 A;  1BR4 B;  4YGC B;  1TOP A;  1EG3 A;  2Y4Q A;  3L4A A;  4GPL B;  2ZRS A;  4PE1 A;  5ER5 A;  3SG6 A;  5HYD A;  2SCP A;  5CSF A;  1QV0 A;  3KEV A;  2KQ6 A;  2M1U A;  4MZK A;  2KQY A;  4YI8 A;  2KFF A;  3S0G A;  3CZ1 A;  4MEW A;  3L47 A;  1QV1 A;  4MZJ A;  1JWD A;  2JPO A;  3BUO B;  1QWV A;  1XYD A;  1KSM A;  3CZT X;  1B47 A;  5HL1 A;  1A2X A;  2KI4 C;  1TWO A;  2E30 A;  2EC6 C;  1B4C A;  4ZCV A;  1ZOT B;  1OZO A;  2Y5I A;  3CZ2 A;  4ORB B;  1F54 A;  3O4X A;  1DT7 B;  5G08 A;  1W7J B;  1SYM A;  1KQM C;  2JT3 A;  2PMY A;  2V53 A;  3L4L A;  1NX1 A;  4P2Y B;  2M49 B;  5FI7 A;  4GGF A;  1CDM A;  2L2C A;  1CMF A;  4OR9 B;  1SCV A;  2JTZ A;  2NXQ A;  1A75 B;  1S6C A;  1YTZ C;  2H61 C;  3TDZ A;  3GK1 A;  2K7B A;  1EH2 A;  1EL4 A;  3MSE B;  3I5I B;  3VRR A;  1A75 A;  1BLQ A;  4DS7 A;  1JFK A;  1S36 A;  2HPS A;  3ZNI A;  5FYX A;  1RWY A;  5I94 A;  1D1O A;  2L5Y A;  1CM4 A;  2FCD A;  1QJT A;  2K7C A;  1XFX O;  1KK8 B;  1V1F A;  3JVT C;  2JT8 A;  4FQT A;  1QIW A;  2CT9 A;  2BKH B;  1IRJ A;  3SG7 A;  4PE7 A;  4PHJ A;  2ZN8 A;  3TS5 C;  1BU3 A;  1UHI A;  1MF8 B;  4DRW A;  1CFP A;  2M29 A;  2F8P A;  1IIO A;  5CPV A;  1RRO A;  1S1E A;  2BNX A;  1K9P A;  4GNK B;  1WDC B;  3BUX B;  3K21 A;  4WQ3 A;  5DKQ A;  4YBH B;  5AAN A;  3FE9 A;  3D74 A;  2JRF A;  1RFJ A;  1PUL A;  3WHT B;  4MZL A;  3PAL A;  4BY4 A;  1FF1 A;  1DC1 A;  5PAL A;  3D77 A;  4CPV A;  2QEV A;  1DJY A;  1HQV A;  1JUO A;  3DF0 B;  2NZ0 A;  4PCW A;  3NSI A;  3CR4 X;  3CYZ A;  4HRG A;  1AP4 A;  5IBW A;  2WCH A;  1K95 A;  4ORC B;  5CSI A;  4OZD A;  1K93 D;  1BR1 B;  1S5G Y;  2HQW A;  1TNX A;  1PRW A;  1S5G Z;  3D0Y A;  4NDC A;  2ERB A;  4YGA A;  1LKJ A;  5JJG A;  1CM1 A;  1QIV A;  1OE9 B;  1K9K A;  3PJI A;  2BBM A;  4GFT A;  2WCF A;  2BEC A;  1KK7 Y;  1UUS A;  4L9M A;  1M31 A;  1KK7 Z;  3BOW B;  3OX5 A;  1JBA A;  2LLS A;  2BKI B;  1PVB A;  4IJ7 A;  2BE6 A;  1YUR A;  1SL8 A;  3BUM B;  2KDH A;  4PAL A;  1N2D A;  4CFQ A;  4DUQ A;  1ZUZ A;  1RJV A;  3GOF A;  1A29 A;  2PAS A;  4U8D A;  3PM8 A;  1TIZ A;  2WOS A;  2LNK A;  3O6B A;  2LHI A;  2L50 A;  2GTE A;  4MBE A;  1FBV A;  2LMT A;  1B9A A;  1WRL A;  2F3Z A;  1W9Z A;  4JWQ A;  1E8A A;  1DJG A;  2EHB A;  2NLN A;  5I2Q A;  4AOM A;  1UHH A;  4KYN A;  3TUY B;  2WCE A;  3NSK A;  1DF0 A;  1UP5 A;  1CFD A;  3PN7 B;  1NX3 A;  2FOT A;  2OPO A;  3D10 A;  2WC6 A;  1ORG A;  1DJW A;  1VRK A;  4OKH A;  2KAV A;  3D78 A;  1NWD A;  1K96 A;  1QTX A;  1OW4 A;  1YVH A;  1G8I A;  1SR6 C;  2COL B;  2Y1M A;  2M9G A;  1JC2 A;  1BF5 A;  3R1P A;  1C7V A;  2KBI A;  4PHN A;  5AEQ A;  3EKH A;  3NHI A;  1SCM B;  1JF0 A;  2D8N A;  3PLF B;  1XFY O;  1YUU A;  2MHH A;  1SPY A;  2LLU A;  2KAY A;  1CTR A;  3B87 A;  3CTN A;  4CID A;  1Y1X A;  3BXK A;  3I5F B;  1Y1U A;  3LL8 B;  4FTG A;  1MXL C;  1OOI X;  1QX5 B;  3I5I C;  2JNX A;  2LVV A;  2GGZ A;  1OOF A;  1UUR A;  5B8I B;  2BCB A;  4INW A;  2OTG B;  3NSO A;  2L4I A;  4D1E A;  1F4Q A;  4YGE B;  1QS7 A;  1TTX A;  2IS9 A;  2L51 A;  3NSL A;  3B88 A;  1NUB A;  2JNF A;  3VRQ A;  4HRE E;  1JSA A;  1KFX S;  1AJ5 A;  1SY9 A;  1XFV O;  1OMR A;  3D75 A;  3D73 A;  3FE6 A;  4MSP A;  1HT9 A;  4UPG A;  3AAK A;  3SIB A;  1XFU O;  3EVU A;  5AXI A;  4MRX A;  1F55 A;  1CFC A;  1CDN A;  3V2L A;  3BJH A;  3QME A;  1IH0 A;  1AVS A;  4QJ5 B;  5HKW A;  1KFX L;  1PSB A;  3HX4 A;  1K8U A;  3EG5 B;  4GUK A;  5DKR A;  3LK0 A;  1BT6 A;  1LS8 A;  2I94 A;  2JWW A;  2O60 A;  3RM1 A;  2WCK A;  2LCP A;  2PAL A;  3AAJ A;  1NP8 A;  3K1E A;  3SS4 A;  2KHN A;  2LAN A;  3A8R A;  1AJ4 A;  3OBV A;  1CDP A;  5I2L A;  3RLZ A;  1KFU S;  2BCA A;  1ZMZ A;  2L98 A;  2ZKM X;  2SAS A;  5GQQ C;  3ZWH A;  2KOT A;  1NX2 A;  1SW8 A;  1N0Y A;  2BBN A;  4PDZ A;  1WLM A;  1CFF A;  1LA0 A;  1TNQ A;  1TUZ A;  3KF9 A;  1J7P A;  4AQI A;  1SBJ A;  1KFU L;  3DZT A;  1SL7 A;  2L2E A;  2LHL A;  4A4B A;  1XA5 A;  4N5X A;  1F71 A;  1XFW O;  2H2K A;  3OB1 B;  1GQM A;  5AER A;  2Q91 A;  1LIN A;  1YR5 A;  4NDD A;  2BE4 A;  4YGB B;  1LA3 A;  1NCX A;  4FQO A;  4MN0 A;  2PYQ A;  5I8N A;  2RGI A;  4CFR A;  3EVR A;  2JPT A;  2K60 A;  4OVN F;  2LVK A;  2K2F A;  3D76 A;  1JFJ A;  2KLD A;  3DYE A;  2L0P A;  1AK8 A;  1FPW A;  1ZFS A;  3S0D A;  2CCM A;  3TUY C;  2MLF C;  4OV2 A;  3PN7 C;  2LUC A;  3CWG A;  2HF5 A;  3QRX A;  1TNP A;  2WCB A;  3DF0 A;  2QEB A;  3PM2 A;  3PSR A;  4A4C A;  1OZS A;  4INX A;  2KNE A;  1NCY A;  2YGU A;  2LP3 A;  2M97 A;  1SCM C;  1SNL A;  1IG5 A;  2PQL A;  3DVM A;  2K7D A;  3OX6 A;  1QVI Y;  1EJ3 A;  1NX0 A;  1GGW A;  3B7A A;  2KI6 C;  3BUN B;  1QVI Z;  1GM0 A;  1M63 B;  3FIA A;  3I5F C;  2BAP A;  1F8H A;  1K9U A;  2KYF A;  1C7W A;  1MR8 A;  1UHK A;  2OTG C;  1EXR A;  3WHU B;  1OMV A;  4AQJ A;  1NCZ A;  1JF2 A;  1BG1 A;  2JXC A;  2QEO A;  3BOW A;  1IQ3 A;  2LUX A;  1TNW A;  2TN4 A;  2WOR A;  3B86 A;  3OHM B;  1QAS A;  2KSP A;  2JT0 A;  2DOQ A;  1CB1 A;  1B8R A;  1J1D A;  2FCE A;  2LE9 B;  3JTD B;  4R1E A;  2QAC A;  3CR5 X;  2FJU B;  1YRT B;  2R2I A;  1MHO A;  2KFH A;  1YRU B;  2JUL A;  2LM5 A;  3DVE A;  1K90 D;  1TCO B;  3H4S E;  1Q80 A;  1DJI A;  1OSA A;  2WND A;  3LK1 A;  4I5L B;  1OOH A;  2H8V A;  4P5O E;  3EK7 A;  3VGO A;  2WC8 A;  1KQV A;  3CAB A;  2KGR A;  1J55 A;  2I18 A; 
#chains in the Genus database with same CATH homology
 1NIW A;  1EG4 A;  2JU0 A;  2KFG A;  4MVF A;  1CLL A;  1YUT A;  2LLT A;  4ZCU A;  1SL9 A;  1Y6W A;  2OS8 B;  4HSZ A;  1DJZ A;  5KTY A;  2NCP A;  4YI9 A;  3EK4 A;  2JZI A;  2BL0 B;  4JQ0 D;  2CXJ A;  4USL A;  2ZFD A;  1K2H A;  2K61 A;  3KO0 A;  3WXA A;  4M2P A;  5HLV A;  5K89 A;  4YRU A;  1IGV A;  4TNC A;  3ICB A;  4DCK A;  3FS7 A;  2LC5 A;  2MLE C;  1J1E A;  4Q04 A;  1ZAC A;  1KK8 C;  5CSJ A;  3HCM A;  1KWO B;  2ZNE A;  1BJF A;  2VRG A;  2L4H A;  1SKT A;  3TZ1 A;  1WDC C;  1X02 A;  4HRH A;  2ZND A;  5BPJ A;  1M45 A;  4IL1 A;  2P6B B;  1WY9 A;  1NYA A;  3SIA A;  1CLM A;  2HET A;  4ETO A;  1DVI A;  1XFZ O;  1DJX A;  1RK9 A;  1A4P A;  5AFP A;  2LMV A;  2M1K B;  3IQQ A;  4I5K A;  4BY5 A;  1GJY A;  2F3Y A;  2I2R E;  2M0R A;  2E6W A;  3FWC A;  4F0Z B;  3C1V A;  1BOD A;  2JQ6 A;  3M0W A;  1PAL A;  3EK8 A;  2HQ8 A;  3I5G B;  1CNP A;  3VRP A;  1WLZ A;  2AAO A;  1J7O A;  1KSO A;  1MXE A;  1IJ5 A;  1WRZ A;  5JOL A;  4I5J A;  1IWQ A;  4GGN A;  2L5X B;  1B7T Y;  2O5G A;  1YX7 A;  3BQ3 A;  2K2A A;  3IQO A;  2EGD A;  2MA2 A;  1B7T Z;  4N1F A;  1K94 A;  1L2O B;  1SR6 B;  1V1G A;  2KAX A;  4GAO A;  3DVK A;  5HLO A;  4NDB A;  5HKY A;  5HKZ A;  1RTP 1;  1XK4 A;  1NPQ A;  1MQ1 A;  1DJH A;  1XO5 A;  3I5H B;  2AMI A;  2LV7 A;  2M7N A;  2M8U A;  2MAZ A;  4ICB A;  3SG3 A;  2Q4U A;  1QLS A;  2GGM A;  1ALW A;  4M2Q A;  3JTD C;  1OMD A;  5DKN A;  1H4B A;  3DD4 A;  3BYA A;  2PVB A;  1CLB A;  1PK0 D;  1IKU A;  5D7F A;  1CDL A;  1BMO A;  1H8B A;  1R6P A;  4MRY A;  3O78 A;  3SG4 A;  2G9B A;  1ALV A;  2LP2 A;  1ODB A;  1QX2 A;  2PRU A;  2M7L A;  5CSN A;  4E68 A;  3DVJ A;  3AKB A;  1AUI B;  1G33 A;  1C07 A;  3FWB A;  1CKK A;  1YX8 A;  1B8C A;  2MRD A;  2ISD A;  3WNX B;  1DMO A;  2AUC A;  3IF7 A;  4OCI A;  3KHE A;  1IQ5 A;  1F70 A;  1A03 A;  4GBA A;  1QX7 A;  1DGV A;  3TDU A;  4YGD B;  2NCO A;  2B1U A;  2KI4 B;  2KI6 D;  1REC A;  2OS8 C;  3TDI A;  1AHR A;  2EC6 B;  1PVA A;  5TNC A;  1MWN A;  2BL0 C;  3SG2 A;  4C0K A;  1M46 A;  1DTL A;  2F2P A;  1KQM B;  1NSH A;  1GGZ A;  2Y1N A;  1SK6 D;  4QJ3 B;  5ER4 X;  4N1G A;  5J3X A;  3A4U B;  3CLN A;  3D0Y B;  1F4O A;  2F2O A;  1S6J A;  2JTT A;  2ZRT A;  2JOJ A;  2PSR A;  4PHK A;  1W7I B;  1DGU A;  4WQ2 A;  4C0J A;  1UHJ A;  2LVJ A;  1KWO C;  4DIR A;  2K0J A;  1G4Y R;  1M39 A;  4M2O A;  1YUS A;  3VRN A;  2H61 A;  4MLW A;  3SJS A;  1TN4 A;  2G2B A;  1TCF A;  2F33 A;  3GK2 A;  3OP0 A;  3CGA A;  1QAT A;  3JVT B;  3LCP C;  4CLN A;  1LVC D;  1SMG A;  3F45 A;  3TS5 B;  2BCX A;  1SRA A;  3PFV A;  1PSR A;  1QLK A;  4I5N B;  1S6I A;  1UWO A;  2K8M B;  3E3R A;  4XJK B;  2CTN A;  1FI6 A;  1S3P A;  3O4Y A;  4ORA B;  1WRK A;  1DF0 B;  1OOJ A;  1L7Z A;  4XJK A;  5F6T A;  1FW4 A;  1CMG A;  5KSZ A;  1QXP A;  3BUW B;  3I5G C;  1N65 A;  3GK4 X;  4XYN A;  2LMU A;  2GV5 A;  2JC2 A;  4QJ4 B;  1B1G A;  1R2U A;  2MBX A;  2LAP A;  2ZN9 A;  1OQP A;  3CR2 A;  1MUX A;  3PAT A;  3VRO A;  5KU1 A;  3AKA A;  2KBM A;  3CS1 A;  1XK4 C;  1IJ6 A;  2I7A A;  4GGF C;  1L2O C;  4PE0 A;  3OB2 B;  1UHN A;  3NXA A;  3I5H C;  1J7R A;  3EVV A;  4JPZ B;  2CBL A;  1S26 D;  2MJW B;  2QPT A;  4C0L A;  1U5I B;  1J7Q A;  1FI5 A;  2KYC A;  2A4J A;  5D69 A;  1XVJ A;  5I2O A;  1BOC A;  1U5I A;  1YVL A;  4NQG A;  3EKJ A;  2M3W A;  1Y1A A;  2CNP A;  3KPX A;  3LLE A;  2K7O A;  2JXL A;  1LXF C;  4WRI A;  2KGB C;  4PE4 A;  3O2P A;  1TRF A;  4PHM A;  1Y0V H;  2LVI A;  1KCY A;  1B8L A;  3SG5 A;  1BR4 B;  4YGC B;  1TOP A;  1EG3 A;  2Y4Q A;  4GPL B;  4PE1 A;  2ZRS A;  5ER5 A;  3SG6 A;  5HYD A;  2SCP A;  5CSF A;  1QV0 A;  3KEV A;  2KQ6 A;  2M1U A;  4MZK A;  2KQY A;  4YI8 A;  2KFF A;  4MEW A;  1QV1 A;  4MZJ A;  1JWD A;  3BUO B;  1XYD A;  1KSM A;  3CZT X;  1B47 A;  1A2X A;  2KI4 C;  2E30 A;  2EC6 C;  1B4C A;  4ZCV A;  1ZOT B;  1OZO A;  2Y5I A;  4ORB B;  1F54 A;  1DT7 B;  5G08 A;  1W7J B;  1SYM A;  1KQM C;  2JT3 A;  2PMY A;  2V53 A;  1NX1 A;  4P2Y B;  2M49 B;  4GGF A;  1CDM A;  1CMF A;  4OR9 B;  1SCV A;  2JTZ A;  2NXQ A;  1A75 B;  1S6C A;  1YTZ C;  2H61 C;  3TDZ A;  3GK1 A;  2K7B A;  1EH2 A;  1EL4 A;  3MSE B;  3I5I B;  3VRR A;  1A75 A;  1BLQ A;  4DS7 A;  1JFK A;  1S36 A;  2HPS A;  3ZNI A;  5FYX A;  1RWY A;  1D1O A;  1CM4 A;  2FCD A;  1QJT A;  2K7C A;  1XFX O;  1KK8 B;  1V1F A;  3JVT C;  2JT8 A;  1QIW A;  2CT9 A;  2BKH B;  1IRJ A;  3SG7 A;  4PE7 A;  4PHJ A;  2ZN8 A;  3TS5 C;  1BU3 A;  1UHI A;  1MF8 B;  4DRW A;  1CFP A;  2M29 A;  2F8P A;  5CPV A;  1RRO A;  1S1E A;  1K9P A;  4GNK B;  1WDC B;  3BUX B;  3K21 A;  4WQ3 A;  5DKQ A;  4YBH B;  5AAN A;  2JRF A;  1RFJ A;  1PUL A;  3WHT B;  4MZL A;  3PAL A;  4BY4 A;  1FF1 A;  5PAL A;  4CPV A;  1DJY A;  1HQV A;  1JUO A;  3DF0 B;  2NZ0 A;  4PCW A;  3NSI A;  3CR4 X;  4HRG A;  1AP4 A;  5IBW A;  1K95 A;  4ORC B;  5CSI A;  1K93 D;  1BR1 B;  1S5G Y;  2HQW A;  1TNX A;  1PRW A;  1S5G Z;  3D0Y A;  4NDC A;  4YGA A;  1LKJ A;  5JJG A;  1CM1 A;  1QIV A;  1OE9 B;  1K9K A;  2BBM A;  4GFT A;  2WCF A;  2BEC A;  1KK7 Y;  1UUS A;  4L9M A;  1M31 A;  1KK7 Z;  3BOW B;  3OX5 A;  1JBA A;  2LLS A;  2BKI B;  1PVB A;  2BE6 A;  1YUR A;  1SL8 A;  3BUM B;  2KDH A;  4PAL A;  1N2D A;  4CFQ A;  4DUQ A;  1ZUZ A;  1RJV A;  3GOF A;  1A29 A;  2PAS A;  4U8D A;  3PM8 A;  1TIZ A;  2WOS A;  2LNK A;  3O6B A;  2LHI A;  2L50 A;  4MBE A;  1FBV A;  2LMT A;  1B9A A;  1WRL A;  2F3Z A;  4JWQ A;  1E8A A;  1DJG A;  2EHB A;  2NLN A;  5I2Q A;  4AOM A;  1UHH A;  3TUY B;  2WCE A;  3NSK A;  1DF0 A;  1UP5 A;  1CFD A;  3PN7 B;  1NX3 A;  2FOT A;  2OPO A;  3D10 A;  4OKH A;  1DJW A;  1VRK A;  2KAV A;  1NWD A;  1K96 A;  1QTX A;  1YVH A;  1G8I A;  1SR6 C;  2COL B;  2Y1M A;  2M9G A;  1JC2 A;  1BF5 A;  1C7V A;  2KBI A;  4PHN A;  5AEQ A;  3EKH A;  3PLF B;  1SCM B;  1JF0 A;  2D8N A;  1XFY O;  1YUU A;  2MHH A;  1SPY A;  2LLU A;  2KAY A;  1CTR A;  3CTN A;  4CID A;  1Y1X A;  3BXK A;  3I5F B;  1Y1U A;  3LL8 B;  4FTG A;  1MXL C;  3I5I C;  1QX5 B;  2JNX A;  2LVV A;  2GGZ A;  1UUR A;  5B8I B;  2BCB A;  2OTG B;  3NSO A;  2L4I A;  4D1E A;  1F4Q A;  4YGE B;  1QS7 A;  1TTX A;  2IS9 A;  2L51 A;  3NSL A;  3VRQ A;  1NUB A;  2JNF A;  4HRE E;  1JSA A;  1KFX S;  1AJ5 A;  1SY9 A;  1XFV O;  1OMR A;  4MSP A;  1HT9 A;  4UPG A;  3AAK A;  3SIB A;  1XFU O;  3EVU A;  5AXI A;  4MRX A;  1F55 A;  1CFC A;  1CDN A;  1IH0 A;  1AVS A;  4QJ5 B;  5HKW A;  1KFX L;  1PSB A;  3HX4 A;  1K8U A;  4GUK A;  5DKR A;  3LK0 A;  1BT6 A;  2JWW A;  2I94 A;  2O60 A;  3RM1 A;  2LCP A;  2PAL A;  3AAJ A;  1NP8 A;  2KHN A;  2LAN A;  3A8R A;  1AJ4 A;  1CDP A;  5I2L A;  3RLZ A;  1KFU S;  2BCA A;  1ZMZ A;  2L98 A;  2ZKM X;  2SAS A;  5GQQ C;  3ZWH A;  2KOT A;  1NX2 A;  1SW8 A;  1N0Y A;  2BBN A;  4PDZ A;  1WLM A;  1CFF A;  1LA0 A;  1TNQ A;  3KF9 A;  1J7P A;  4AQI A;  1SBJ A;  1KFU L;  1SL7 A;  2L2E A;  2LHL A;  4A4B A;  1XA5 A;  4N5X A;  1F71 A;  1XFW O;  2H2K A;  3OB1 B;  1GQM A;  5AER A;  2Q91 A;  1LIN A;  1YR5 A;  4NDD A;  2BE4 A;  4YGB B;  1LA3 A;  1NCX A;  4FQO A;  4MN0 A;  5I8N A;  2RGI A;  4CFR A;  3EVR A;  2JPT A;  4OVN F;  2LVK A;  2K2F A;  1JFJ A;  2L0P A;  1AK8 A;  1FPW A;  1ZFS A;  2CCM A;  3TUY C;  2MLF C;  4OV2 A;  3PN7 C;  2LUC A;  3CWG A;  2HF5 A;  3QRX A;  1TNP A;  2WCB A;  3DF0 A;  3PSR A;  4A4C A;  1OZS A;  2KNE A;  1NCY A;  2LP3 A;  2M97 A;  1SCM C;  1SNL A;  1IG5 A;  3DVM A;  2K7D A;  3OX6 A;  1QVI Y;  1EJ3 A;  1NX0 A;  1GGW A;  2KI6 C;  3BUN B;  1QVI Z;  1M63 B;  3FIA A;  3I5F C;  1F8H A;  1K9U A;  2KYF A;  1C7W A;  1MR8 A;  1UHK A;  2OTG C;  1EXR A;  3WHU B;  1OMV A;  4AQJ A;  1NCZ A;  1JF2 A;  1BG1 A;  2JXC A;  3BOW A;  1IQ3 A;  2LUX A;  1TNW A;  2TN4 A;  2WOR A;  3OHM B;  1QAS A;  2KSP A;  2JT0 A;  2DOQ A;  1CB1 A;  1B8R A;  1J1D A;  2FCE A;  2LE9 B;  3JTD B;  4R1E A;  2QAC A;  3CR5 X;  2FJU B;  1YRT B;  2R2I A;  1MHO A;  2KFH A;  1YRU B;  2JUL A;  2LM5 A;  3DVE A;  1K90 D;  1TCO B;  3H4S E;  1Q80 A;  1DJI A;  1OSA A;  2WND A;  3LK1 A;  4I5L B;  4P5O E;  3EK7 A;  3VGO A;  2WC8 A;  1KQV A;  2KGR A;  1J55 A;  2I18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...