2WOSA

Structure of human s100a7 in complex with 2,6 ans
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
96
structure length
96
Chain Sequence
SNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification and Characterization of Binding Sites on S100A7, a Participant in Cancer and Inflammation Pathways.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Calcium-binding protein
molecule keywords PROTEIN S100-A7
total genus 38
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2wosA00
3FWCA 2Q91A 2BECA 4GGFA 3DVJA 3JVTC 1NSHA 4ZCVA 1QIVA 4ORCB 3QRXA 1OMVA 1G33A 4I5JA 4N1FA 4WRIA 1CM1A 1F71A 1NCZA 3EK8A 4GGNA 4YGAA 2LUXA 3VGOA 3AKBA 3TUYC 3I5GB 4PE0A 1F4QA 1DVIA 1QV1A 3PN7C 1MXEA 2KAYA 1KFUL 4HRHA 1BR4B 3DF0A 2BBMA 1E8AA 1XFZO 4M2QA 1QX7A 1SL7A 2LHIA 4GBAA 5HKYA 3D0YB 3TUYB 2ZN9A 1EG4A 1YRTB 4XJKA 3LK0A 1YVLA 3OX5A 1KK8C 1K2HA 4TNCA 2NCPA 1M46A 2WCEA 3HCMA 4OR9B 2K7BA 1XA5A 2M97A 2K7CA 4HSZA 2JXLA 3A4UB 1UHHA 1SNLA 1CDNA 2PVBA 4D1EA 2JU0A 3OHMB 1JF0A 1H4BA 1EH2A 1LKJA 4AOMA 1A29A 1UWOA 1YUTA 3SG7A 1OE9B 2WC8A 1XFUO 1CM4A 1KQMC 1BT6A 2EGDA 1K94A 2BBNA 4PCWA 1TCFA 4I5KA 4NDDA 1NP8A 2I94A 1DJWA 1WRKA 2JT8A 2LLSA 1N2DA 2ZNDA 1AK8A 2LM5A 5BPJA 2M0RA 2BCXA 1A75A 1DMOA 4C0JA 2JTTA 2JULA 1CDPA 1QASA 2OPOA 3K21A 1SR6B 2KI6D 2ZNEA 3BQ3A 3GK2A 5DKRA 1SMGA 1LVCD 4CFQA 1QVIY 4PHJA 1L2OC 3SG6A 1BMOA 2KI4B 1UURA 1Y0VH 1JFKA 1EJ3A 3BYAA 1BJFA 1B7TY 4YGCB 1B4CA 1QIWA 1S5GZ 5KTYA 2FJUB 4MBEA 1KWOB 5HKWA 1YURA 1AJ4A 1NUBA 1V1FA 2LP2A 1KSMA 3PSRA 1ZMZA 2KAXA 2M8UA 2KBMA 5CSJA 1MF8B 1MUXA 1CB1A 4GNKB 1UHJA 2LMTA 5CSNA 4A4BA 2R2IA 1GQMA 1GGZA 5CSIA 4A4CA 2F33A 4MRXA 4F0ZB 4YI9A 3GOFA 1WLMA 3CS1A 2LMVA 3BUNB 2M3WA 2OS8B 4MZKA 1ALVA 2JT3A 2SASA 3KHEA 3O4YA 1SYMA 2MLFC 1XFWO 1MR8A 3I5IC 4GUKA 2KHNA 4U8DA 1SBJA 2Q4UA 5D7FA 2LLUA 2BKHB 1K95A 4P2YB 1DJZA 1B7TZ 2GGMA 1DJGA 3KF9A 1W7IB 2L5XB 1BODA 1XFVO 4YGEB 2KBIA 2WCBA 3OP0A 5B8IB 2OTGB 2NLNA 1S6IA 1JSAA 1TIZA 3F45A 3EKHA 1M31A 1SL9A 3EK4A 4MLWA 4YGBB 1IKUA 1LA0A 3NSIA 5I8NA 1KFXL 1IWQA 1F55A 1IRJA 1G4YR 5DKQA 1K9PA 2G2BA 3I5HC 5HLOA 3SG2A 4MZLA 4HREE 2L51A 1XK4A 1OOJA 2OS8C 3AAJA 4PHNA 1M45A 4USLA 1PVBA 1IQ5A 5AXIA 4R1EA 2PALA 1KFXS 1WDCC 2CXJA 2KFHA 3O2PA 1YVHA 1QXPA 1YR5A 4PHKA 2KYCA 1PSRA 2FCDA 3NSLA 2COLB 4CFRA 4P5OE 2LVKA 1OQPA 3NSKA 4MEWA 1NYAA 3ZWHA 1S1EA 3DD4A 1HQVA 3BXKA 2JWWA 1J1DA 5AEQA 2LHLA 1BF5A 1FI5A 1XVJA 2JZIA 2K2FA 2L98A 4WQ2A 2LVJA 1LA3A 1M39A 2LVVA 3LCPC 1YX7A 1QX2A 4MZJA 4L9MA 3FWBA 4IL1A 4XYNA 4MN0A 2O60A 1JUOA 4YI8A 1L2OB 1TOPA 5J3XA 1U5IB 2PMYA 4DCKA 1UUSA 1BG1A 1PALA 1FW4A 1J7QA 1CDMA 3VRQA 5CSFA 2AMIA 3TS5B 1Y1XA 2I2RE 3E3RA 2LNKA 1G8IA 3LK1A 4FQOA 1SKTA 1YTZC 2H2KA 1ZFSA 1S5GY 4JQ0D 4PE7A 1K9KA 1K9UA 1XFYO 2E30A 1CKKA 2BE4A 2F3YA 2JRFA 1QS7A 2MRDA 2QPTA 4YBHB 1AUIB 1CFDA 1KFUS 2D8NA 1UP5A 2ZRSA 3VROA 1N0YA 2MAZA 3HX4A 1CNPA 1YUSA 5PALA 1CLLA 1UHIA 1F8HA 3PM8A 1GGWA 2HETA 2NXQA 2NZ0A 1PVAA 2ZRTA 2JT0A 4C0LA 1Y1UA 1TRFA 1LXFC 1NWDA 1NX2A 1TTXA 1SR6C 3LLEA 1B9AA 1IGVA 2K0JA 3DF0B 1DT7B 2K2AA 2PASA 2WOSA 3A8RA 1CDLA 3PLFB 3DVMA 4WQ3A 1AJ5A 1DF0B 3CZTX 4QJ3B 3JVTB 1OSAA 1DJHA 4PALA 2LP3A 4QJ4B 1H8BA 2FOTA 1FF1A 2NCOA 2LMUA 4Q04A 5D69A 2JC2A 3PFVA 1WY9A 1F4OA 1R6PA 1OMDA 3SG5A 2LVIA 2M1KB 1QX5B 1AVSA 3CR2A 3RLZA 2LE9B 2FCEA 5I2OA 4PE4A 1EG3A 2F2PA 3WNXB 2G9BA 1SRAA 1TNXA 2K8MB 2F3ZA 5ER4X 5KU1A 1K8UA 1MQ1A 5ER5A 3CTNA 1FI6A 4GPLB 1CMFA 1KQVA 2OTGC 1S26D 5JOLA 1ODBA 2LLTA 3TZ1A 3SIBA 1AP4A 3NSOA 3KEVA 1J55A 3DVEA 1LINA 1QVIZ 1ZACA 2I7AA 2BL0B 1IH0A 5F6TA 1XFXO 3VRNA 4AQJA 3WXAA 4BY4A 3FS7A 2AAOA 3LL8B 2KGBC 2WCFA 1SCMC 1QV0A 2ISDA 3AAKA 2MBXA 1IQ3A 1NX3A 1QATA 1SCMB 3TDUA 1MWNA 2CTNA 1EL4A 2L4HA 1DGUA 1BU3A 1QJTA 2JNFA 1TNPA 1WDCB 2KDHA 3D10A 1RECA 3TDZA 1S6JA 1RK9A 4DIRA 2P6BB 1B8RA 2M29A 1B47A 1V1GA 4I5NB 1F54A 2CT9A 2CCMA 3VRRA 2JXCA 4DRWA 1BOCA 1DJXA 3TDIA 4C0KA 1CMGA 4N5XA 3FIAA 1FPWA 2L4IA 5K89A 5TNCA 3RM1A 5AERA 1DGVA 3CR5X 4ZCUA 5I2LA 2JQ6A 1FBVA 3I5FB 3BUMB 2AUCA 2O5GA 4NQGA 2H61A 1YUUA 5G08A 4DUQA 1NIWA 2QACA 4UPGA 2KOTA 4CIDA 2MJWB 2M49B 3CWGA 3I5IB 1UHKA 3BOWB 2KNEA 2WORA 2Y4QA 2ZKMX 1CTRA 1BR1B 3O78A 1A4PA 4OV2A 2L0PA 5FYXA 2KQYA 3SJSA 1KQMB 4FTGA 5AFPA 4E68A 4AQIA 1J7OA 2PRUA 1XO5A 3BUOB 3AKAA 4GFTA 1NX1A 1KSOA 4MRYA 3EVVA 1PK0D 2KSPA 2KAVA 1J7RA 3BUXB 1OZSA 1K96A 1YRUB 1NCXA 2DOQA 2GGZA 2Y5IA 1TNWA 2ZFDA 1C7WA 3O6BA 1A03A 1J7PA 1B8CA 1KK8B 3KO0A 3PALA 2BCBA 2B1UA 1KK7Y 2KQ6A 2HF5A 2L2EA 3GK4X 1KWOC 2PSRA 1SPYA 3JTDC 1XK4C 3EKJA 2HQ8A 3IF7A 2JNXA 5JJGA 2HPSA 2A4JA 3PATA 4BY5A 2I18A 4CPVA 1ZOTB 1IJ6A 4OVNF 3GK1A 4ICBA 1C07A 1PSBA 1NPQA 4DS7A 5IBWA 4JWQA 1RROA 3IQQA 3OB1B 3H4SE 3EVRA 3JTDB 5AANA 1DJIA 2RGIA 4PE1A 1JBAA 1EXRA 4PHMA 1WRLA 1NX0A 2IS9A 2MA2A 2Y1MA 5I2QA 1SL8A 4NDBA 1PRWA 1B1GA 4JPZB 1WLZA 2GV5A 1CFCA 1Q80A 1HT9A 1XYDA 1D1OA 1MXLC 4XJKB 1GJYA 1UHNA 1TCOB 3EK7A 1OMRA 2JTZA 4GAOA 1CFPA 1RJVA 1TNQA 3SIAA 2SCPA 2BE6A 3TS5C 1RWYA 2WNDA 4I5LB 1AHRA 1NCYA 2ZN8A 2M7LA 3OB2B 2M9GA 1CLBA 1CLMA 3PN7B 5GQQC 1JF2A 1JWDA 1ZUZA 2CBLA 2K7DA 3BUWB 5KSZA 2L50A 3I5FC 2BCAA 2LC5A 1ALWA 3BOWA 2F8PA 3I5GC 1SK6D 2H61C 1RFJA 2E6WA 1L7ZA 5HLVA 3WHUB 1CFFA 1RTP1 3CGAA 4HRGA 2M1UA 1DF0A 2KI6C 5HYDA 3OX6A 3KPXA 4CLNA 4QJ5B 1QTXA 3M0WA 3ICBA 1DTLA 2TN4A 2F2OA 2LAPA 1MHOA 1R2UA 1TN4A 2VRGA 1OZOA 4PDZA 3WHTB 2JPTA 2LANA 4ORBB 2LUCA 2V53A 1F70A 1PULA 1KCYA 3NXAA 4ETOA 4M2PA 2K61A 1SY9A 1N65A 4OKHA 2MHHA 3I5HB 4M2OA 5CPVA 4YGDB 1WRZA 2M7NA 1JFJA 1IG5A 2HQWA 2KGRA 3MSEB 1K90D 3VRPA 1B8LA 1BLQA 1A75B 2K7OA 3ZNIA 2KFFA 1IJ5A 1X02A 3DVKA 1J1EA 2KYFA 2EC6C 2JOJA 5HKZA 2EC6B 1W7JB 2BL0C 2Y1NA 2BKIB 3IQOA 2KI4C 2LCPA 1DJYA 1YX8A 1KK7Z 2CNPA 4OCIA 3C1VA 4ORAB 1Y6WA 3SG3A 1S36A 1SCVA 3SG4A 4N1GA 4MVFA 3EVUA 1U5IA 1QLKA 1SW8A 3CLNA 2MLEC 2KFGA 1Y1AA 5DKNA 2EHBA 1C7VA 3D0YA 1S3PA 4GGFC 1S6CA 1JC2A 1K93D 2LV7A 4NDCA 4YRUA 3CR4X 1M63B 4MSPA 1QLSA 1VRKA 1A2XA
chains in the Genus database with same CATH superfamily
3FWCA 2Q91A 2BECA 2KLDA 4GGFA 3DVJA 3JVTC 1NSHA 4ZCVA 1QIVA 4ORCB 3QRXA 1OMVA 1G33A 4I5JA 4N1FA 4WRIA 1CM1A 1F71A 4INWA 1NCZA 3EK8A 4GGNA 4YGAA 2LUXA 3VGOA 3AKBA 3TUYC 3I5GB 1DC1A 4PE0A 1F4QA 1DVIA 1QV1A 2GTEA 3PN7C 1MXEA 2KAYA 3BJHA 1KFUL 3R1PA 4HRHA 2P70A 3EG5B 1BR4B 3DF0A 2BBMA 1E8AA 1XFZO 4M2QA 1QX7A 1SL7A 2LHIA 4GBAA 3CDNA 5HKYA 3D0YB 3TUYB 2ZN9A 1EG4A 1YRTB 4XJKA 3LK0A 1YVLA 3OX5A 1KK8C 1K2HA 4TNCA 2NCPA 1M46A 2WCEA 3HCMA 4OR9B 2K7BA 3DZTA 1XA5A 2M97A 2K7CA 4HSZA 2JXLA 3A4UB 1UHHA 1SNLA 1CDNA 2PVBA 4D1EA 3D74A 2JU0A 2QDIA 3CABA 1JF0A 3OHMB 1H4BA 1EH2A 1LKJA 4AOMA 1A29A 1UWOA 1YUTA 3SG7A 1OE9B 2WC8A 1XFUO 1CM4A 1KQMC 1BT6A 2EGDA 1K94A 2BBNA 4PCWA 1TCFA 4I5KA 4NDDA 1NP8A 2I94A 1DJWA 1WRKA 2JT8A 2LLSA 1N2DA 2ZNDA 1AK8A 2LM5A 5BPJA 2M0RA 2BCXA 1A75A 1DMOA 4C0JA 2JTTA 2JULA 1CDPA 3BFBA 1QASA 2OPOA 3K21A 1SR6B 2KI6D 2ZNEA 1T14A 3BQ3A 1TWOA 3GK2A 1SMGA 2YGUA 1LVCD 5DKRA 4CFQA 3FE8A 1QVIY 4JKTA 4F7FA 4PHJA 1L2OC 3SG6A 1BMOA 2KI4B 1UURA 1Y0VH 2WC5A 1JFKA 1EJ3A 3BYAA 5FI6A 1BJFA 1TUJA 1B7TY 4YGCB 1B4CA 1QIWA 1S5GZ 5KTYA 1DEKA 1SSEB 2FJUB 2KLEA 1KWOB 4MBEA 1YURA 5HKWA 1AJ4A 1NUBA 1V1FA 2LP2A 1KSMA 3PSRA 1ZMZA 2KAXA 2M8UA 2KBMA 5CSJA 1MF8B 1MUXA 3K1EA 4GNKB 1UHJA 2LMTA 5CSNA 4A4BA 1CB1A 2R2IA 1GQMA 1GGZA 5CSIA 4A4CA 2F33A 4MRXA 4F0ZB 4YI9A 3GOFA 1WLMA 3CS1A 2LMVA 3BUNB 2M3WA 3SS4A 2OS8B 4MZKA 1ALVA 3R1OA 2JT3A 2SASA 3B88A 3KHEA 2QEHA 3R72A 3O4YA 1SYMA 2MLFC 1XFWO 1MR8A 3I5IC 4GUKA 2KHNA 4U8DA 1ORGA 1SBJA 1Z4HA 2Q4UA 5D7FA 2LLUA 2BKHB 1K95A 4P2YB 1DJZA 1B7TZ 2GGMA 1DJGA 3KF9A 1W7IB 2L5XB 1BODA 1XFVO 4YGEB 2KBIA 2WCBA 3OP0A 5B8IB 3S0FA 2OTGB 3D73A 2NLNA 1S6IA 1JSAA 1TIZA 3F45A 3EKHA 1M31A 1SL9A 3EK4A 4MLWA 4YGBB 3V2LA 1LA0A 3NSIA 1IKUA 5I8NA 1KFXL 1IWQA 1F55A 1IRJA 1G4YR 5DKQA 1K9PA 2G2BA 3I5HC 4PT1A 5HLOA 3SG2A 4MZLA 3SS5A 4HREE 2L51A 1XK4A 1OOJA 2OS8C 3AAJA 4PHNA 3L4LA 1M45A 4USLA 1PVBA 1IQ5A 5AXIA 4R1EA 2PALA 1KFXS 1WDCC 2CXJA 2KFHA 1OOFA 3PALA 3O2PA 1YVHA 1QXPA 1YR5A 4PHKA 3L4AA 2KYCA 1PSRA 2FCDA 3NSLA 2K60A 2COLB 4CFRA 4P5OE 2LVKA 1OQPA 3NSKA 4MEWA 1NYAA 5FI7A 3ZWHA 1S1EA 3DD4A 1HQVA 3BXKA 2JWWA 1J1DA 3IVTA 2LHLA 5AEQA 3S0BA 1FI5A 1XVJA 2JZIA 2K2FA 2L98A 2FJYA 4WQ2A 2LVJA 1LA3A 1M39A 2LVVA 3LCPC 1YX7A 1QX2A 3NHTA 4MZJA 5EL2A 3D77A 4L9MA 3FWBA 4IL1A 4XYNA 4MN0A 2O60A 1JUOA 4YI8A 1C3YA 3UO9A 1L2OB 1TOPA 2BAPA 1U5IB 2PMYA 5J3XA 1UUSA 4DCKA 1PALA 1BG1A 1FW4A 1J7QA 1CDMA 3VRQA 3S0EA 5CSFA 2AMIA 3NHIA 5FI2A 3TS5B 1Y1XA 2I2RE 2QEOA 3E3RA 2LNKA 1G8IA 3DYEA 1OOGA 3LK1A 4FQOA 1SKTA 1YTZC 2H2KA 4OZDA 1ZFSA 3VB1A 1S5GY 4JQ0D 3OGNA 1K9KA 1K9UA 1XFYO 2E30A 4PE7A 1CKKA 2L5YA 2BE4A 5I94A 2L2CA 2F3YA 2JRFA 1QS7A 2MRDA 2QPTA 4YBHB 1AUIB 1CFDA 1KFUS 2D8NA 1OOIX 1UP5A 2ZRSA 3VROA 1N0YA 2MAZA 3HX4A 1CNPA 1YUSA 5PALA 3D76A 1CLLA 1UHIA 1OOHA 1F8HA 3PM8A 1GGWA 2HETA 4FQTA 2NXQA 2NZ0A 1PVAA 2ZRTA 5D3OA 2JT0A 4C0LA 1Y1UA 1TRFA 1LXFC 1NWDA 1NX2A 1IIOA 1TTXA 1SR6C 2WCHA 3LLEA 1B9AA 3Q8IA 1IGVA 2K0JA 3DF0B 1DT7B 2K2AA 2PASA 2WOSA 3A8RA 1CDLA 4KYNA 3PLFB 3DVMA 4WQ3A 1AJ5A 1DF0B 2PQLA 3B7AA 3CZTX 4QJ3B 3JVTB 1OSAA 3B87A 1DJHA 4PALA 2LP3A 4QJ4B 1H8BA 2FOTA 1FF1A 2NCOA 2LMUA 4Q04A 5D69A 1QWVA 2JC2A 3PFVA 1WY9A 1F4OA 1R6PA 1OMDA 3SG5A 2LVIA 2M1KB 1QX5B 1AVSA 3CR2A 3RLZA 2LE9B 2FCEA 5I2OA 4PE4A 3CZ2A 1EG3A 2F2PA 3WNXB 3B6XA 2G9BA 1SRAA 4INXA 1TNXA 2K8MB 2F3ZA 5ER4X 1C3ZA 5KU1A 1K8UA 1MQ1A 5ER5A 3CTNA 1FI6A 4GPLB 1CMFA 1KQVA 2OTGC 1S26D 2BNXA 5JOLA 1ODBA 2LLTA 3TZ1A 3DXLA 3SIBA 1AP4A 3FE6A 3NSOA 3KEVA 1J55A 3D75A 3DVEA 1LINA 1QVIZ 1ZACA 2I7AA 2BL0B 1IH0A 5F6TA 1XFXO 2WCLA 1Z2CB 3VRNA 4AQJA 3WXAA 4BY4A 3FS7A 2AAOA 3LL8B 2KGBC 2WCFA 2JPOA 1SCMC 1QV0A 2ISDA 3AAKA 2MBXA 3N7HA 1IQ3A 1NX3A 1QATA 1SCMB 3TDUA 1MWNA 3S0GA 2CTNA 1EL4A 4IJ7A 2L4HA 1DGUA 1BU3A 1QJTA 2JNFA 1TNPA 1WDCB 2KDHA 3D10A 3OBVA 1RECA 3TDZA 1S6JA 1RK9A 4DIRA 2P6BB 1B8RA 2M29A 1B47A 1V1GA 4I5NB 1F54A 2CT9A 1P28A 2CCMA 3VRRA 2JXCA 3QMEA 4DRWA 3R1VA 1BOCA 1DJXA 3TDIA 4C0KA 1CMGA 4N5XA 3FIAA 1FPWA 2L4IA 5K89A 5TNCA 3RM1A 5AERA 1DGVA 3CR5X 4ZCUA 5I2LA 2JQ6A 1FBVA 3I5FB 3BUMB 2AUCA 2O5GA 4NQGA 2H61A 1YUUA 5G08A 4DUQA 1NIWA 2QACA 4UPGA 2KOTA 4CIDA 2MJWB 2M49B 3CWGA 3I5IB 1UHKA 3BOWB 2KNEA 2WORA 2Y4QA 2ZKMX 1CTRA 1BR1B 3O78A 1A4PA 4OV2A 2L0PA 5FYXA 2KQYA 3SJSA 1KQMB 4FTGA 5AFPA 4E68A 4AQIA 1J7OA 2PRUA 1XO5A 3BUOB 3AKAA 4GFTA 1NX1A 1KSOA 4MRYA 3EVVA 1PK0D 2KSPA 2KAVA 1J7RA 3BUXB 1OZSA 1K96A 1YRUB 1NCXA 2DOQA 2GGZA 2Y5IA 1TNWA 2ZFDA 1C7WA 3O6BA 1A03A 1J7PA 1B8CA 1KK8B 1OW4A 3KO0A 2BCBA 2B1UA 1KK7Y 2KQ6A 2HF5A 2L2EA 3GK4X 1KWOC 2PSRA 2WCKA 1SPYA 3JTDC 1XK4C 3EKJA 2HQ8A 3IF7A 2JNXA 5JJGA 2HPSA 2A4JA 3PATA 4BY5A 2I18A 4CPVA 3BFHA 1ZOTB 1IJ6A 3L47A 3RZSA 4OVNF 3GK1A 4ICBA 1C07A 1PSBA 1NPQA 4DS7A 5IBWA 4JWQA 1RROA 3IQQA 3OB1B 3H4SE 3EVRA 3JTDB 5AANA 1DJIA 2RGIA 4PE1A 2P71A 1JBAA 1EXRA 4PHMA 1WRLA 1NX0A 2IS9A 2MA2A 2Y1MA 3D78A 5I2QA 1SL8A 4NDBA 1PRWA 1BF5A 1B1GA 4JPZB 1WLZA 1W9ZA 2GV5A 1CFCA 1Q80A 1HT9A 1XYDA 1D1OA 1MXLC 4XJKB 1GJYA 1UHNA 1TCOB 3EK7A 1OMRA 2JTZA 4GAOA 1CFPA 1RJVA 1TNQA 3SIAA 2SCPA 1DELA 2BE6A 3TS5C 1RWYA 2WNDA 4I5LB 3S0DA 1AHRA 1NCYA 2ZN8A 2M7LA 3OB2B 2M9GA 1CLBA 1CLMA 2ERBA 3PN7B 5GQQC 3CZ1A 1JF2A 3S0AA 1JWDA 1ZUZA 2CBLA 1GM0A 2K7DA 3BUWB 5KSZA 2L50A 3B86A 2BCAA 2LC5A 3I5FC 1ALWA 3CZ0A 5HL1A 3BOWA 2F8PA 3I5GC 1SK6D 3O4XA 2H61C 1RFJA 2E6WA 2QEVA 1L7ZA 2H8VA 1XFRA 5HLVA 3WHUB 1CFFA 1RTP1 3CGAA 4HRGA 2M1UA 3DY9A 1DF0A 2KI6C 5HYDA 3OX6A 3KPXA 4CLNA 4QJ5B 1QTXA 3M0WA 3ICBA 1DTLA 2TN4A 2F2OA 2LAPA 3NGVA 1MHOA 1R2UA 1TN4A 3PJIA 2VRGA 1OZOA 4PDZA 3WHTB 2JPTA 2LANA 4ORBB 3BFAA 2LUCA 2WCJA 2V53A 2QEBA 1F70A 1PULA 1KCYA 3NXAA 4ETOA 4M2PA 2K61A 1SY9A 1N65A 4OKHA 2MHHA 3I5HB 4M2OA 5CPVA 3SS3A 4YGDB 1WRZA 2M7NA 1JFJA 1IG5A 2HQWA 2KGRA 3MSEB 1K90D 2KPHA 1TUZA 3VRPA 1B8LA 1BLQA 1A75B 2K7OA 2PYQA 3FE9A 1LS8A 3ZNIA 2KFFA 1IJ5A 1X02A 3DVKA 1J1EA 2KYFA 2EC6C 2JOJA 5HKZA 2EC6B 1W7JB 2BL0C 2WC6A 2Y1NA 2BKIB 3IQOA 2KI4C 2LCPA 1DJYA 1YX8A 1KK7Z 2CNPA 4OCIA 5DICA 3C1VA 3PM2A 4ORAB 1Y6WA 3SG3A 1S36A 1SCVA 3SG4A 4N1GA 4MVFA 3EVUA 1U5IA 3UNWA 1QLKA 1SW8A 4JD9A 3CLNA 2MLEC 2WCMA 2KFGA 1Y1AA 5DKNA 2EHBA 1C7VA 3D0YA 1S3PA 4GGFC 1S6CA 1JC2A 1K93D 2LV7A 4NDCA 4YRUA 3CR4X 1DQEA 1M63B 4MSPA 3CYZA 1QLSA 1VRKA 1A2XA
chains in the Genus database with same CATH topology
3FWCA 2Q91A 2BECA 4GGFA 3DVJA 3JVTC 1NSHA 4ZCVA 1QIVA 4ORCB 3QRXA 1OMVA 1G33A 4I5JA 4N1FA 4WRIA 1CM1A 1F71A 1NCZA 3EK8A 4GGNA 4YGAA 2LUXA 3VGOA 3AKBA 3TUYC 3I5GB 4PE0A 1F4QA 1DVIA 1QV1A 3PN7C 1MXEA 2KAYA 1KFUL 4HRHA 1BR4B 3DF0A 2BBMA 1E8AA 1XFZO 4M2QA 1QX7A 1SL7A 2LHIA 4GBAA 5HKYA 3D0YB 3TUYB 2ZN9A 1EG4A 1YRTB 4XJKA 3LK0A 1YVLA 3OX5A 1KK8C 1K2HA 4TNCA 2NCPA 1M46A 2WCEA 3HCMA 4OR9B 2K7BA 1XA5A 2M97A 2K7CA 4HSZA 2JXLA 3A4UB 1UHHA 1SNLA 1CDNA 2PVBA 4D1EA 2JU0A 3OHMB 1JF0A 1H4BA 1EH2A 1LKJA 4AOMA 1A29A 1UWOA 1YUTA 3SG7A 1OE9B 2WC8A 1XFUO 1CM4A 1KQMC 1BT6A 2EGDA 1K94A 2BBNA 4PCWA 1TCFA 4I5KA 4NDDA 1NP8A 2I94A 1DJWA 1WRKA 2JT8A 2LLSA 1N2DA 2ZNDA 1AK8A 2LM5A 5BPJA 2M0RA 2BCXA 1A75A 1DMOA 4C0JA 2JTTA 2JULA 1CDPA 1QASA 2OPOA 3K21A 1SR6B 2KI6D 2ZNEA 3BQ3A 3GK2A 5DKRA 1SMGA 1LVCD 4CFQA 1QVIY 4PHJA 1L2OC 3SG6A 1BMOA 2KI4B 1UURA 1Y0VH 1JFKA 1EJ3A 3BYAA 1BJFA 1B7TY 4YGCB 1B4CA 1QIWA 1S5GZ 5KTYA 2FJUB 4MBEA 1KWOB 5HKWA 1YURA 1AJ4A 1NUBA 1V1FA 2LP2A 1KSMA 3PSRA 1ZMZA 2KAXA 2M8UA 2KBMA 5CSJA 1MF8B 1MUXA 1CB1A 4GNKB 1UHJA 2LMTA 5CSNA 4A4BA 2R2IA 1GQMA 1GGZA 5CSIA 4A4CA 2F33A 4MRXA 4F0ZB 4YI9A 3GOFA 1WLMA 3CS1A 2LMVA 3BUNB 2M3WA 2OS8B 4MZKA 1ALVA 2JT3A 2SASA 3KHEA 3O4YA 1SYMA 2MLFC 1XFWO 1MR8A 3I5IC 4GUKA 2KHNA 4U8DA 1SBJA 2Q4UA 5D7FA 2LLUA 2BKHB 1K95A 4P2YB 1DJZA 1B7TZ 2GGMA 1DJGA 3KF9A 1W7IB 2L5XB 1BODA 1XFVO 4YGEB 2KBIA 2WCBA 3OP0A 5B8IB 2OTGB 2NLNA 1S6IA 1JSAA 1TIZA 3F45A 3EKHA 1M31A 1SL9A 3EK4A 4MLWA 4YGBB 1IKUA 1LA0A 3NSIA 5I8NA 1KFXL 1IWQA 1F55A 1IRJA 1G4YR 5DKQA 1K9PA 2G2BA 3I5HC 5HLOA 3SG2A 4MZLA 4HREE 2L51A 1XK4A 1OOJA 2OS8C 3AAJA 4PHNA 1M45A 4USLA 1PVBA 1IQ5A 5AXIA 4R1EA 2PALA 1KFXS 1WDCC 2CXJA 2KFHA 3O2PA 1YVHA 1QXPA 1YR5A 4PHKA 2KYCA 1PSRA 2FCDA 3NSLA 2COLB 4CFRA 4P5OE 2LVKA 1OQPA 3NSKA 4MEWA 1NYAA 3ZWHA 1S1EA 3DD4A 1HQVA 3BXKA 2JWWA 1J1DA 5AEQA 2LHLA 1BF5A 1FI5A 1XVJA 2JZIA 2K2FA 2L98A 4WQ2A 2LVJA 1LA3A 1M39A 2LVVA 3LCPC 1YX7A 1QX2A 4MZJA 4L9MA 3FWBA 4IL1A 4XYNA 4MN0A 2O60A 1JUOA 4YI8A 1L2OB 1TOPA 5J3XA 1U5IB 2PMYA 4DCKA 1UUSA 1BG1A 1PALA 1FW4A 1J7QA 1CDMA 3VRQA 5CSFA 2AMIA 3TS5B 1Y1XA 2I2RE 3E3RA 2LNKA 1G8IA 3LK1A 4FQOA 1SKTA 1YTZC 2H2KA 1ZFSA 1S5GY 4JQ0D 4PE7A 1K9KA 1K9UA 1XFYO 2E30A 1CKKA 2BE4A 2F3YA 2JRFA 1QS7A 2MRDA 2QPTA 4YBHB 1AUIB 1CFDA 1KFUS 2D8NA 1UP5A 2ZRSA 3VROA 1N0YA 2MAZA 3HX4A 1CNPA 1YUSA 5PALA 1CLLA 1UHIA 1F8HA 3PM8A 1GGWA 2HETA 2NXQA 2NZ0A 1PVAA 2ZRTA 2JT0A 4C0LA 1Y1UA 1TRFA 1LXFC 1NWDA 1NX2A 1TTXA 1SR6C 3LLEA 1B9AA 1IGVA 2K0JA 3DF0B 1DT7B 2K2AA 2PASA 2WOSA 3A8RA 1CDLA 3PLFB 3DVMA 4WQ3A 1AJ5A 1DF0B 3CZTX 4QJ3B 3JVTB 1OSAA 1DJHA 4PALA 2LP3A 4QJ4B 1H8BA 2FOTA 1FF1A 2NCOA 2LMUA 4Q04A 5D69A 2JC2A 3PFVA 1WY9A 1F4OA 1R6PA 1OMDA 3SG5A 2LVIA 2M1KB 1QX5B 1AVSA 3CR2A 3RLZA 2LE9B 2FCEA 5I2OA 4PE4A 1EG3A 2F2PA 3WNXB 2G9BA 1SRAA 1TNXA 2K8MB 2F3ZA 5ER4X 5KU1A 1K8UA 1MQ1A 5ER5A 3CTNA 1FI6A 4GPLB 1CMFA 1KQVA 2OTGC 1S26D 5JOLA 1ODBA 2LLTA 3TZ1A 3SIBA 1AP4A 3NSOA 3KEVA 1J55A 3DVEA 1LINA 1QVIZ 1ZACA 2I7AA 2BL0B 1IH0A 5F6TA 1XFXO 3VRNA 4AQJA 3WXAA 4BY4A 3FS7A 2AAOA 3LL8B 2KGBC 2WCFA 1SCMC 1QV0A 2ISDA 3AAKA 2MBXA 1IQ3A 1NX3A 1QATA 1SCMB 3TDUA 1MWNA 2CTNA 1EL4A 2L4HA 1DGUA 1BU3A 1QJTA 2JNFA 1TNPA 1WDCB 2KDHA 3D10A 1RECA 3TDZA 1S6JA 1RK9A 4DIRA 2P6BB 1B8RA 2M29A 1B47A 1V1GA 4I5NB 1F54A 2CT9A 2CCMA 3VRRA 2JXCA 4DRWA 1BOCA 1DJXA 3TDIA 4C0KA 1CMGA 4N5XA 3FIAA 1FPWA 2L4IA 5K89A 5TNCA 3RM1A 5AERA 1DGVA 3CR5X 4ZCUA 5I2LA 2JQ6A 1FBVA 3I5FB 3BUMB 2AUCA 2O5GA 4NQGA 2H61A 1YUUA 5G08A 4DUQA 1NIWA 2QACA 4UPGA 2KOTA 4CIDA 2MJWB 2M49B 3CWGA 3I5IB 1UHKA 3BOWB 2KNEA 2WORA 2Y4QA 2ZKMX 1CTRA 1BR1B 3O78A 1A4PA 4OV2A 2L0PA 5FYXA 2KQYA 3SJSA 1KQMB 4FTGA 5AFPA 4E68A 4AQIA 1J7OA 2PRUA 1XO5A 3BUOB 3AKAA 4GFTA 1NX1A 1KSOA 4MRYA 3EVVA 1PK0D 2KSPA 2KAVA 1J7RA 3BUXB 1OZSA 1K96A 1YRUB 1NCXA 2DOQA 2GGZA 2Y5IA 1TNWA 2ZFDA 1C7WA 3O6BA 1A03A 1J7PA 1B8CA 1KK8B 3KO0A 3PALA 2BCBA 2B1UA 1KK7Y 2KQ6A 2HF5A 2L2EA 3GK4X 1KWOC 2PSRA 1SPYA 3JTDC 1XK4C 3EKJA 2HQ8A 3IF7A 2JNXA 5JJGA 2HPSA 2A4JA 3PATA 4BY5A 2I18A 4CPVA 1ZOTB 1IJ6A 4OVNF 3GK1A 4ICBA 1C07A 1PSBA 1NPQA 4DS7A 5IBWA 4JWQA 1RROA 3IQQA 3OB1B 3H4SE 3EVRA 3JTDB 5AANA 1DJIA 2RGIA 4PE1A 1JBAA 1EXRA 4PHMA 1WRLA 1NX0A 2IS9A 2MA2A 2Y1MA 5I2QA 1SL8A 4NDBA 1PRWA 1B1GA 4JPZB 1WLZA 2GV5A 1CFCA 1Q80A 1HT9A 1XYDA 1D1OA 1MXLC 4XJKB 1GJYA 1UHNA 1TCOB 3EK7A 1OMRA 2JTZA 4GAOA 1CFPA 1RJVA 1TNQA 3SIAA 2SCPA 2BE6A 3TS5C 1RWYA 2WNDA 4I5LB 1AHRA 1NCYA 2ZN8A 2M7LA 3OB2B 2M9GA 1CLBA 1CLMA 3PN7B 5GQQC 1JF2A 1JWDA 1ZUZA 2CBLA 2K7DA 3BUWB 5KSZA 2L50A 3I5FC 2BCAA 2LC5A 1ALWA 3BOWA 2F8PA 3I5GC 1SK6D 2H61C 1RFJA 2E6WA 1L7ZA 5HLVA 3WHUB 1CFFA 1RTP1 3CGAA 4HRGA 2M1UA 1DF0A 2KI6C 5HYDA 3OX6A 3KPXA 4CLNA 4QJ5B 1QTXA 3M0WA 3ICBA 1DTLA 2TN4A 2F2OA 2LAPA 1MHOA 1R2UA 1TN4A 2VRGA 1OZOA 4PDZA 3WHTB 2JPTA 2LANA 4ORBB 2LUCA 2V53A 1F70A 1PULA 1KCYA 3NXAA 4ETOA 4M2PA 2K61A 1SY9A 1N65A 4OKHA 2MHHA 3I5HB 4M2OA 5CPVA 4YGDB 1WRZA 2M7NA 1JFJA 1IG5A 2HQWA 2KGRA 3MSEB 1K90D 3VRPA 1B8LA 1BLQA 1A75B 2K7OA 3ZNIA 2KFFA 1IJ5A 1X02A 3DVKA 1J1EA 2KYFA 2EC6C 2JOJA 5HKZA 2EC6B 1W7JB 2BL0C 2Y1NA 2BKIB 3IQOA 2KI4C 2LCPA 1DJYA 1YX8A 1KK7Z 2CNPA 4OCIA 3C1VA 4ORAB 1Y6WA 3SG3A 1S36A 1SCVA 3SG4A 4N1GA 4MVFA 3EVUA 1U5IA 1QLKA 1SW8A 3CLNA 2MLEC 2KFGA 1Y1AA 5DKNA 2EHBA 1C7VA 3D0YA 1S3PA 4GGFC 1S6CA 1JC2A 1K93D 2LV7A 4NDCA 4YRUA 3CR4X 1M63B 4MSPA 1QLSA 1VRKA 1A2XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FWC A;  2Q91 A;  2BEC A;  4GGF A;  3DVJ A;  3JVT C;  1NSH A;  4ZCV A;  1QIV A;  4ORC B;  3QRX A;  1OMV A;  1G33 A;  4I5J A;  4N1F A;  4WRI A;  1CM1 A;  1F71 A;  1NCZ A;  3EK8 A;  4GGN A;  4YGA A;  2LUX A;  3VGO A;  3AKB A;  3TUY C;  3I5G B;  4PE0 A;  1F4Q A;  1DVI A;  1QV1 A;  3PN7 C;  1MXE A;  2KAY A;  1KFU L;  4HRH A;  1BR4 B;  3DF0 A;  2BBM A;  1E8A A;  1XFZ O;  4M2Q A;  1QX7 A;  1SL7 A;  2LHI A;  4GBA A;  5HKY A;  3D0Y B;  3TUY B;  2ZN9 A;  1EG4 A;  1YRT B;  4XJK A;  3LK0 A;  1YVL A;  3OX5 A;  1KK8 C;  1K2H A;  4TNC A;  2NCP A;  1M46 A;  2WCE A;  3HCM A;  4OR9 B;  2K7B A;  1XA5 A;  2M97 A;  2K7C A;  4HSZ A;  2JXL A;  3A4U B;  1UHH A;  1SNL A;  1CDN A;  2PVB A;  4D1E A;  2JU0 A;  3OHM B;  1JF0 A;  1H4B A;  1EH2 A;  1LKJ A;  4AOM A;  1A29 A;  1UWO A;  1YUT A;  3SG7 A;  1OE9 B;  2WC8 A;  1XFU O;  1CM4 A;  1KQM C;  1BT6 A;  2EGD A;  1K94 A;  2BBN A;  4PCW A;  1TCF A;  4I5K A;  4NDD A;  1NP8 A;  2I94 A;  1DJW A;  1WRK A;  2JT8 A;  2LLS A;  1N2D A;  2ZND A;  1AK8 A;  2LM5 A;  5BPJ A;  2M0R A;  2BCX A;  1A75 A;  1DMO A;  4C0J A;  2JTT A;  2JUL A;  1CDP A;  1QAS A;  2OPO A;  3K21 A;  1SR6 B;  2KI6 D;  2ZNE A;  3BQ3 A;  3GK2 A;  5DKR A;  1SMG A;  1LVC D;  4CFQ A;  1QVI Y;  4PHJ A;  1L2O C;  3SG6 A;  1BMO A;  2KI4 B;  1UUR A;  1Y0V H;  1JFK A;  1EJ3 A;  3BYA A;  1BJF A;  1B7T Y;  4YGC B;  1B4C A;  1QIW A;  1S5G Z;  5KTY A;  2FJU B;  4MBE A;  1KWO B;  5HKW A;  1YUR A;  1AJ4 A;  1NUB A;  1V1F A;  2LP2 A;  1KSM A;  3PSR A;  1ZMZ A;  2KAX A;  2M8U A;  2KBM A;  5CSJ A;  1MF8 B;  1MUX A;  1CB1 A;  4GNK B;  1UHJ A;  2LMT A;  5CSN A;  4A4B A;  2R2I A;  1GQM A;  1GGZ A;  5CSI A;  4A4C A;  2F33 A;  4MRX A;  4F0Z B;  4YI9 A;  3GOF A;  1WLM A;  3CS1 A;  2LMV A;  3BUN B;  2M3W A;  2OS8 B;  4MZK A;  1ALV A;  2JT3 A;  2SAS A;  3KHE A;  3O4Y A;  1SYM A;  2MLF C;  1XFW O;  1MR8 A;  3I5I C;  4GUK A;  2KHN A;  4U8D A;  1SBJ A;  2Q4U A;  5D7F A;  2LLU A;  2BKH B;  1K95 A;  4P2Y B;  1DJZ A;  1B7T Z;  2GGM A;  1DJG A;  3KF9 A;  1W7I B;  2L5X B;  1BOD A;  1XFV O;  4YGE B;  2KBI A;  2WCB A;  3OP0 A;  5B8I B;  2OTG B;  2NLN A;  1S6I A;  1JSA A;  1TIZ A;  3F45 A;  3EKH A;  1M31 A;  1SL9 A;  3EK4 A;  4MLW A;  4YGB B;  1IKU A;  1LA0 A;  3NSI A;  5I8N A;  1KFX L;  1IWQ A;  1F55 A;  1IRJ A;  1G4Y R;  5DKQ A;  1K9P A;  2G2B A;  3I5H C;  5HLO A;  3SG2 A;  4MZL A;  4HRE E;  2L51 A;  1XK4 A;  1OOJ A;  2OS8 C;  3AAJ A;  4PHN A;  1M45 A;  4USL A;  1PVB A;  1IQ5 A;  5AXI A;  4R1E A;  2PAL A;  1KFX S;  1WDC C;  2CXJ A;  2KFH A;  3O2P A;  1YVH A;  1QXP A;  1YR5 A;  4PHK A;  2KYC A;  1PSR A;  2FCD A;  3NSL A;  2COL B;  4CFR A;  4P5O E;  2LVK A;  1OQP A;  3NSK A;  4MEW A;  1NYA A;  3ZWH A;  1S1E A;  3DD4 A;  1HQV A;  3BXK A;  2JWW A;  1J1D A;  5AEQ A;  2LHL A;  1BF5 A;  1FI5 A;  1XVJ A;  2JZI A;  2K2F A;  2L98 A;  4WQ2 A;  2LVJ A;  1LA3 A;  1M39 A;  2LVV A;  3LCP C;  1YX7 A;  1QX2 A;  4MZJ A;  4L9M A;  3FWB A;  4IL1 A;  4XYN A;  4MN0 A;  2O60 A;  1JUO A;  4YI8 A;  1L2O B;  1TOP A;  5J3X A;  1U5I B;  2PMY A;  4DCK A;  1UUS A;  1BG1 A;  1PAL A;  1FW4 A;  1J7Q A;  1CDM A;  3VRQ A;  5CSF A;  2AMI A;  3TS5 B;  1Y1X A;  2I2R E;  3E3R A;  2LNK A;  1G8I A;  3LK1 A;  4FQO A;  1SKT A;  1YTZ C;  2H2K A;  1ZFS A;  1S5G Y;  4JQ0 D;  4PE7 A;  1K9K A;  1K9U A;  1XFY O;  2E30 A;  1CKK A;  2BE4 A;  2F3Y A;  2JRF A;  1QS7 A;  2MRD A;  2QPT A;  4YBH B;  1AUI B;  1CFD A;  1KFU S;  2D8N A;  1UP5 A;  2ZRS A;  3VRO A;  1N0Y A;  2MAZ A;  3HX4 A;  1CNP A;  1YUS A;  5PAL A;  1CLL A;  1UHI A;  1F8H A;  3PM8 A;  1GGW A;  2HET A;  2NXQ A;  2NZ0 A;  1PVA A;  2ZRT A;  2JT0 A;  4C0L A;  1Y1U A;  1TRF A;  1LXF C;  1NWD A;  1NX2 A;  1TTX A;  1SR6 C;  3LLE A;  1B9A A;  1IGV A;  2K0J A;  3DF0 B;  1DT7 B;  2K2A A;  2PAS A;  2WOS A;  3A8R A;  1CDL A;  3PLF B;  3DVM A;  4WQ3 A;  1AJ5 A;  1DF0 B;  3CZT X;  4QJ3 B;  3JVT B;  1OSA A;  1DJH A;  4PAL A;  2LP3 A;  4QJ4 B;  1H8B A;  2FOT A;  1FF1 A;  2NCO A;  2LMU A;  4Q04 A;  5D69 A;  2JC2 A;  3PFV A;  1WY9 A;  1F4O A;  1R6P A;  1OMD A;  3SG5 A;  2LVI A;  2M1K B;  1QX5 B;  1AVS A;  3CR2 A;  3RLZ A;  2LE9 B;  2FCE A;  5I2O A;  4PE4 A;  1EG3 A;  2F2P A;  3WNX B;  2G9B A;  1SRA A;  1TNX A;  2K8M B;  2F3Z A;  5ER4 X;  5KU1 A;  1K8U A;  1MQ1 A;  5ER5 A;  3CTN A;  1FI6 A;  4GPL B;  1CMF A;  1KQV A;  2OTG C;  1S26 D;  5JOL A;  1ODB A;  2LLT A;  3TZ1 A;  3SIB A;  1AP4 A;  3NSO A;  3KEV A;  1J55 A;  3DVE A;  1LIN A;  1QVI Z;  1ZAC A;  2I7A A;  2BL0 B;  1IH0 A;  5F6T A;  1XFX O;  3VRN A;  4AQJ A;  3WXA A;  4BY4 A;  3FS7 A;  2AAO A;  3LL8 B;  2KGB C;  2WCF A;  1SCM C;  1QV0 A;  2ISD A;  3AAK A;  2MBX A;  1IQ3 A;  1NX3 A;  1QAT A;  1SCM B;  3TDU A;  1MWN A;  2CTN A;  1EL4 A;  2L4H A;  1DGU A;  1BU3 A;  1QJT A;  2JNF A;  1TNP A;  1WDC B;  2KDH A;  3D10 A;  1REC A;  3TDZ A;  1S6J A;  1RK9 A;  4DIR A;  2P6B B;  1B8R A;  2M29 A;  1B47 A;  1V1G A;  4I5N B;  1F54 A;  2CT9 A;  2CCM A;  3VRR A;  2JXC A;  4DRW A;  1BOC A;  1DJX A;  3TDI A;  4C0K A;  1CMG A;  4N5X A;  3FIA A;  1FPW A;  2L4I A;  5K89 A;  5TNC A;  3RM1 A;  5AER A;  1DGV A;  3CR5 X;  4ZCU A;  5I2L A;  2JQ6 A;  1FBV A;  3I5F B;  3BUM B;  2AUC A;  2O5G A;  4NQG A;  2H61 A;  1YUU A;  5G08 A;  4DUQ A;  1NIW A;  2QAC A;  4UPG A;  2KOT A;  4CID A;  2MJW B;  2M49 B;  3CWG A;  3I5I B;  1UHK A;  3BOW B;  2KNE A;  2WOR A;  2Y4Q A;  2ZKM X;  1CTR A;  1BR1 B;  3O78 A;  1A4P A;  4OV2 A;  2L0P A;  5FYX A;  2KQY A;  3SJS A;  1KQM B;  4FTG A;  5AFP A;  4E68 A;  4AQI A;  1J7O A;  2PRU A;  1XO5 A;  3BUO B;  3AKA A;  4GFT A;  1NX1 A;  1KSO A;  4MRY A;  3EVV A;  1PK0 D;  2KSP A;  2KAV A;  1J7R A;  3BUX B;  1OZS A;  1K96 A;  1YRU B;  1NCX A;  2DOQ A;  2GGZ A;  2Y5I A;  1TNW A;  2ZFD A;  1C7W A;  3O6B A;  1A03 A;  1J7P A;  1B8C A;  1KK8 B;  3KO0 A;  3PAL A;  2BCB A;  2B1U A;  1KK7 Y;  2KQ6 A;  2HF5 A;  2L2E A;  3GK4 X;  1KWO C;  2PSR A;  1SPY A;  3JTD C;  1XK4 C;  3EKJ A;  2HQ8 A;  3IF7 A;  2JNX A;  5JJG A;  2HPS A;  2A4J A;  3PAT A;  4BY5 A;  2I18 A;  4CPV A;  1ZOT B;  1IJ6 A;  4OVN F;  3GK1 A;  4ICB A;  1C07 A;  1PSB A;  1NPQ A;  4DS7 A;  5IBW A;  4JWQ A;  1RRO A;  3IQQ A;  3OB1 B;  3H4S E;  3EVR A;  3JTD B;  5AAN A;  1DJI A;  2RGI A;  4PE1 A;  1JBA A;  1EXR A;  4PHM A;  1WRL A;  1NX0 A;  2IS9 A;  2MA2 A;  2Y1M A;  5I2Q A;  1SL8 A;  4NDB A;  1PRW A;  1B1G A;  4JPZ B;  1WLZ A;  2GV5 A;  1CFC A;  1Q80 A;  1HT9 A;  1XYD A;  1D1O A;  1MXL C;  4XJK B;  1GJY A;  1UHN A;  1TCO B;  3EK7 A;  1OMR A;  2JTZ A;  4GAO A;  1CFP A;  1RJV A;  1TNQ A;  3SIA A;  2SCP A;  2BE6 A;  3TS5 C;  1RWY A;  2WND A;  4I5L B;  1AHR A;  1NCY A;  2ZN8 A;  2M7L A;  3OB2 B;  2M9G A;  1CLB A;  1CLM A;  3PN7 B;  5GQQ C;  1JF2 A;  1JWD A;  1ZUZ A;  2CBL A;  2K7D A;  3BUW B;  5KSZ A;  2L50 A;  3I5F C;  2BCA A;  2LC5 A;  1ALW A;  3BOW A;  2F8P A;  3I5G C;  1SK6 D;  2H61 C;  1RFJ A;  2E6W A;  1L7Z A;  5HLV A;  3WHU B;  1CFF A;  1RTP 1;  3CGA A;  4HRG A;  2M1U A;  1DF0 A;  2KI6 C;  5HYD A;  3OX6 A;  3KPX A;  4CLN A;  4QJ5 B;  1QTX A;  3M0W A;  3ICB A;  1DTL A;  2TN4 A;  2F2O A;  2LAP A;  1MHO A;  1R2U A;  1TN4 A;  2VRG A;  1OZO A;  4PDZ A;  3WHT B;  2JPT A;  2LAN A;  4ORB B;  2LUC A;  2V53 A;  1F70 A;  1PUL A;  1KCY A;  3NXA A;  4ETO A;  4M2P A;  2K61 A;  1SY9 A;  1N65 A;  4OKH A;  2MHH A;  3I5H B;  4M2O A;  5CPV A;  4YGD B;  1WRZ A;  2M7N A;  1JFJ A;  1IG5 A;  2HQW A;  2KGR A;  3MSE B;  1K90 D;  3VRP A;  1B8L A;  1BLQ A;  1A75 B;  2K7O A;  3ZNI A;  2KFF A;  1IJ5 A;  1X02 A;  3DVK A;  1J1E A;  2KYF A;  2EC6 C;  2JOJ A;  5HKZ A;  2EC6 B;  1W7J B;  2BL0 C;  2Y1N A;  2BKI B;  3IQO A;  2KI4 C;  2LCP A;  1DJY A;  1YX8 A;  1KK7 Z;  2CNP A;  4OCI A;  3C1V A;  4ORA B;  1Y6W A;  3SG3 A;  1S36 A;  1SCV A;  3SG4 A;  4N1G A;  4MVF A;  3EVU A;  1U5I A;  1QLK A;  1SW8 A;  3CLN A;  2MLE C;  2KFG A;  1Y1A A;  5DKN A;  2EHB A;  1C7V A;  3D0Y A;  1S3P A;  4GGF C;  1S6C A;  1JC2 A;  1K93 D;  2LV7 A;  4NDC A;  4YRU A;  3CR4 X;  1M63 B;  4MSP A;  1QLS A;  1VRK A;  1A2X A; 
#chains in the Genus database with same CATH topology
 3FWC A;  2Q91 A;  2BEC A;  2KLD A;  4GGF A;  3DVJ A;  3JVT C;  1NSH A;  4ZCV A;  1QIV A;  4ORC B;  3QRX A;  1OMV A;  1G33 A;  4I5J A;  4N1F A;  4WRI A;  1CM1 A;  1F71 A;  4INW A;  1NCZ A;  3EK8 A;  4GGN A;  4YGA A;  2LUX A;  3VGO A;  3AKB A;  3TUY C;  3I5G B;  1DC1 A;  4PE0 A;  1F4Q A;  1DVI A;  1QV1 A;  2GTE A;  3PN7 C;  1MXE A;  2KAY A;  3BJH A;  1KFU L;  3R1P A;  4HRH A;  2P70 A;  3EG5 B;  1BR4 B;  3DF0 A;  2BBM A;  1E8A A;  1XFZ O;  4M2Q A;  1QX7 A;  1SL7 A;  2LHI A;  4GBA A;  3CDN A;  5HKY A;  3D0Y B;  3TUY B;  2ZN9 A;  1EG4 A;  1YRT B;  4XJK A;  3LK0 A;  1YVL A;  3OX5 A;  1KK8 C;  1K2H A;  4TNC A;  2NCP A;  1M46 A;  2WCE A;  3HCM A;  4OR9 B;  2K7B A;  3DZT A;  1XA5 A;  2M97 A;  2K7C A;  4HSZ A;  2JXL A;  3A4U B;  1UHH A;  1SNL A;  1CDN A;  2PVB A;  4D1E A;  3D74 A;  2JU0 A;  2QDI A;  3CAB A;  1JF0 A;  3OHM B;  1H4B A;  1EH2 A;  1LKJ A;  4AOM A;  1A29 A;  1UWO A;  1YUT A;  3SG7 A;  1OE9 B;  2WC8 A;  1XFU O;  1CM4 A;  1KQM C;  1BT6 A;  2EGD A;  1K94 A;  2BBN A;  4PCW A;  1TCF A;  4I5K A;  4NDD A;  1NP8 A;  2I94 A;  1DJW A;  1WRK A;  2JT8 A;  2LLS A;  1N2D A;  2ZND A;  1AK8 A;  2LM5 A;  5BPJ A;  2M0R A;  2BCX A;  1A75 A;  1DMO A;  4C0J A;  2JTT A;  2JUL A;  1CDP A;  3BFB A;  1QAS A;  2OPO A;  3K21 A;  1SR6 B;  2KI6 D;  2ZNE A;  1T14 A;  3BQ3 A;  1TWO A;  3GK2 A;  1SMG A;  2YGU A;  1LVC D;  5DKR A;  4CFQ A;  3FE8 A;  1QVI Y;  4JKT A;  4F7F A;  4PHJ A;  1L2O C;  3SG6 A;  1BMO A;  2KI4 B;  1UUR A;  1Y0V H;  2WC5 A;  1JFK A;  1EJ3 A;  3BYA A;  5FI6 A;  1BJF A;  1TUJ A;  1B7T Y;  4YGC B;  1B4C A;  1QIW A;  1S5G Z;  5KTY A;  1DEK A;  1SSE B;  2FJU B;  2KLE A;  1KWO B;  4MBE A;  1YUR A;  5HKW A;  1AJ4 A;  1NUB A;  1V1F A;  2LP2 A;  1KSM A;  3PSR A;  1ZMZ A;  2KAX A;  2M8U A;  2KBM A;  5CSJ A;  1MF8 B;  1MUX A;  3K1E A;  4GNK B;  1UHJ A;  2LMT A;  5CSN A;  4A4B A;  1CB1 A;  2R2I A;  1GQM A;  1GGZ A;  5CSI A;  4A4C A;  2F33 A;  4MRX A;  4F0Z B;  4YI9 A;  3GOF A;  1WLM A;  3CS1 A;  2LMV A;  3BUN B;  2M3W A;  3SS4 A;  2OS8 B;  4MZK A;  1ALV A;  3R1O A;  2JT3 A;  2SAS A;  3B88 A;  3KHE A;  2QEH A;  3R72 A;  3O4Y A;  1SYM A;  2MLF C;  1XFW O;  1MR8 A;  3I5I C;  4GUK A;  2KHN A;  4U8D A;  1ORG A;  1SBJ A;  1Z4H A;  2Q4U A;  5D7F A;  2LLU A;  2BKH B;  1K95 A;  4P2Y B;  1DJZ A;  1B7T Z;  2GGM A;  1DJG A;  3KF9 A;  1W7I B;  2L5X B;  1BOD A;  1XFV O;  4YGE B;  2KBI A;  2WCB A;  3OP0 A;  5B8I B;  3S0F A;  2OTG B;  3D73 A;  2NLN A;  1S6I A;  1JSA A;  1TIZ A;  3F45 A;  3EKH A;  1M31 A;  1SL9 A;  3EK4 A;  4MLW A;  4YGB B;  3V2L A;  1LA0 A;  3NSI A;  1IKU A;  5I8N A;  1KFX L;  1IWQ A;  1F55 A;  1IRJ A;  1G4Y R;  5DKQ A;  1K9P A;  2G2B A;  3I5H C;  4PT1 A;  5HLO A;  3SG2 A;  4MZL A;  3SS5 A;  4HRE E;  2L51 A;  1XK4 A;  1OOJ A;  2OS8 C;  3AAJ A;  4PHN A;  3L4L A;  1M45 A;  4USL A;  1PVB A;  1IQ5 A;  5AXI A;  4R1E A;  2PAL A;  1KFX S;  1WDC C;  2CXJ A;  2KFH A;  1OOF A;  3PAL A;  3O2P A;  1YVH A;  1QXP A;  1YR5 A;  4PHK A;  3L4A A;  2KYC A;  1PSR A;  2FCD A;  3NSL A;  2K60 A;  2COL B;  4CFR A;  4P5O E;  2LVK A;  1OQP A;  3NSK A;  4MEW A;  1NYA A;  5FI7 A;  3ZWH A;  1S1E A;  3DD4 A;  1HQV A;  3BXK A;  2JWW A;  1J1D A;  3IVT A;  2LHL A;  5AEQ A;  3S0B A;  1FI5 A;  1XVJ A;  2JZI A;  2K2F A;  2L98 A;  2FJY A;  4WQ2 A;  2LVJ A;  1LA3 A;  1M39 A;  2LVV A;  3LCP C;  1YX7 A;  1QX2 A;  3NHT A;  4MZJ A;  5EL2 A;  3D77 A;  4L9M A;  3FWB A;  4IL1 A;  4XYN A;  4MN0 A;  2O60 A;  1JUO A;  4YI8 A;  1C3Y A;  3UO9 A;  1L2O B;  1TOP A;  2BAP A;  1U5I B;  2PMY A;  5J3X A;  1UUS A;  4DCK A;  1PAL A;  1BG1 A;  1FW4 A;  1J7Q A;  1CDM A;  3VRQ A;  3S0E A;  5CSF A;  2AMI A;  3NHI A;  5FI2 A;  3TS5 B;  1Y1X A;  2I2R E;  2QEO A;  3E3R A;  2LNK A;  1G8I A;  3DYE A;  1OOG A;  3LK1 A;  4FQO A;  1SKT A;  1YTZ C;  2H2K A;  4OZD A;  1ZFS A;  3VB1 A;  1S5G Y;  4JQ0 D;  3OGN A;  1K9K A;  1K9U A;  1XFY O;  2E30 A;  4PE7 A;  1CKK A;  2L5Y A;  2BE4 A;  5I94 A;  2L2C A;  2F3Y A;  2JRF A;  1QS7 A;  2MRD A;  2QPT A;  4YBH B;  1AUI B;  1CFD A;  1KFU S;  2D8N A;  1OOI X;  1UP5 A;  2ZRS A;  3VRO A;  1N0Y A;  2MAZ A;  3HX4 A;  1CNP A;  1YUS A;  5PAL A;  3D76 A;  1CLL A;  1UHI A;  1OOH A;  1F8H A;  3PM8 A;  1GGW A;  2HET A;  4FQT A;  2NXQ A;  2NZ0 A;  1PVA A;  2ZRT A;  5D3O A;  2JT0 A;  4C0L A;  1Y1U A;  1TRF A;  1LXF C;  1NWD A;  1NX2 A;  1IIO A;  1TTX A;  1SR6 C;  2WCH A;  3LLE A;  1B9A A;  3Q8I A;  1IGV A;  2K0J A;  3DF0 B;  1DT7 B;  2K2A A;  2PAS A;  2WOS A;  3A8R A;  1CDL A;  4KYN A;  3PLF B;  3DVM A;  4WQ3 A;  1AJ5 A;  1DF0 B;  2PQL A;  3B7A A;  3CZT X;  4QJ3 B;  3JVT B;  1OSA A;  3B87 A;  1DJH A;  4PAL A;  2LP3 A;  4QJ4 B;  1H8B A;  2FOT A;  1FF1 A;  2NCO A;  2LMU A;  4Q04 A;  5D69 A;  1QWV A;  2JC2 A;  3PFV A;  1WY9 A;  1F4O A;  1R6P A;  1OMD A;  3SG5 A;  2LVI A;  2M1K B;  1QX5 B;  1AVS A;  3CR2 A;  3RLZ A;  2LE9 B;  2FCE A;  5I2O A;  4PE4 A;  3CZ2 A;  1EG3 A;  2F2P A;  3WNX B;  3B6X A;  2G9B A;  1SRA A;  4INX A;  1TNX A;  2K8M B;  2F3Z A;  5ER4 X;  1C3Z A;  5KU1 A;  1K8U A;  1MQ1 A;  5ER5 A;  3CTN A;  1FI6 A;  4GPL B;  1CMF A;  1KQV A;  2OTG C;  1S26 D;  2BNX A;  5JOL A;  1ODB A;  2LLT A;  3TZ1 A;  3DXL A;  3SIB A;  1AP4 A;  3FE6 A;  3NSO A;  3KEV A;  1J55 A;  3D75 A;  3DVE A;  1LIN A;  1QVI Z;  1ZAC A;  2I7A A;  2BL0 B;  1IH0 A;  5F6T A;  1XFX O;  2WCL A;  1Z2C B;  3VRN A;  4AQJ A;  3WXA A;  4BY4 A;  3FS7 A;  2AAO A;  3LL8 B;  2KGB C;  2WCF A;  2JPO A;  1SCM C;  1QV0 A;  2ISD A;  3AAK A;  2MBX A;  3N7H A;  1IQ3 A;  1NX3 A;  1QAT A;  1SCM B;  3TDU A;  1MWN A;  3S0G A;  2CTN A;  1EL4 A;  4IJ7 A;  2L4H A;  1DGU A;  1BU3 A;  1QJT A;  2JNF A;  1TNP A;  1WDC B;  2KDH A;  3D10 A;  3OBV A;  1REC A;  3TDZ A;  1S6J A;  1RK9 A;  4DIR A;  2P6B B;  1B8R A;  2M29 A;  1B47 A;  1V1G A;  4I5N B;  1F54 A;  2CT9 A;  1P28 A;  2CCM A;  3VRR A;  2JXC A;  3QME A;  4DRW A;  3R1V A;  1BOC A;  1DJX A;  3TDI A;  4C0K A;  1CMG A;  4N5X A;  3FIA A;  1FPW A;  2L4I A;  5K89 A;  5TNC A;  3RM1 A;  5AER A;  1DGV A;  3CR5 X;  4ZCU A;  5I2L A;  2JQ6 A;  1FBV A;  3I5F B;  3BUM B;  2AUC A;  2O5G A;  4NQG A;  2H61 A;  1YUU A;  5G08 A;  4DUQ A;  1NIW A;  2QAC A;  4UPG A;  2KOT A;  4CID A;  2MJW B;  2M49 B;  3CWG A;  3I5I B;  1UHK A;  3BOW B;  2KNE A;  2WOR A;  2Y4Q A;  2ZKM X;  1CTR A;  1BR1 B;  3O78 A;  1A4P A;  4OV2 A;  2L0P A;  5FYX A;  2KQY A;  3SJS A;  1KQM B;  4FTG A;  5AFP A;  4E68 A;  4AQI A;  1J7O A;  2PRU A;  1XO5 A;  3BUO B;  3AKA A;  4GFT A;  1NX1 A;  1KSO A;  4MRY A;  3EVV A;  1PK0 D;  2KSP A;  2KAV A;  1J7R A;  3BUX B;  1OZS A;  1K96 A;  1YRU B;  1NCX A;  2DOQ A;  2GGZ A;  2Y5I A;  1TNW A;  2ZFD A;  1C7W A;  3O6B A;  1A03 A;  1J7P A;  1B8C A;  1KK8 B;  1OW4 A;  3KO0 A;  2BCB A;  2B1U A;  1KK7 Y;  2KQ6 A;  2HF5 A;  2L2E A;  3GK4 X;  1KWO C;  2PSR A;  2WCK A;  1SPY A;  3JTD C;  1XK4 C;  3EKJ A;  2HQ8 A;  3IF7 A;  2JNX A;  5JJG A;  2HPS A;  2A4J A;  3PAT A;  4BY5 A;  2I18 A;  4CPV A;  3BFH A;  1ZOT B;  1IJ6 A;  3L47 A;  3RZS A;  4OVN F;  3GK1 A;  4ICB A;  1C07 A;  1PSB A;  1NPQ A;  4DS7 A;  5IBW A;  4JWQ A;  1RRO A;  3IQQ A;  3OB1 B;  3H4S E;  3EVR A;  3JTD B;  5AAN A;  1DJI A;  2RGI A;  4PE1 A;  2P71 A;  1JBA A;  1EXR A;  4PHM A;  1WRL A;  1NX0 A;  2IS9 A;  2MA2 A;  2Y1M A;  3D78 A;  5I2Q A;  1SL8 A;  4NDB A;  1PRW A;  1BF5 A;  1B1G A;  4JPZ B;  1WLZ A;  1W9Z A;  2GV5 A;  1CFC A;  1Q80 A;  1HT9 A;  1XYD A;  1D1O A;  1MXL C;  4XJK B;  1GJY A;  1UHN A;  1TCO B;  3EK7 A;  1OMR A;  2JTZ A;  4GAO A;  1CFP A;  1RJV A;  1TNQ A;  3SIA A;  2SCP A;  1DEL A;  2BE6 A;  3TS5 C;  1RWY A;  2WND A;  4I5L B;  3S0D A;  1AHR A;  1NCY A;  2ZN8 A;  2M7L A;  3OB2 B;  2M9G A;  1CLB A;  1CLM A;  2ERB A;  3PN7 B;  5GQQ C;  3CZ1 A;  1JF2 A;  3S0A A;  1JWD A;  1ZUZ A;  2CBL A;  1GM0 A;  2K7D A;  3BUW B;  5KSZ A;  2L50 A;  3B86 A;  2BCA A;  2LC5 A;  3I5F C;  1ALW A;  3CZ0 A;  5HL1 A;  3BOW A;  2F8P A;  3I5G C;  1SK6 D;  3O4X A;  2H61 C;  1RFJ A;  2E6W A;  2QEV A;  1L7Z A;  2H8V A;  1XFR A;  5HLV A;  3WHU B;  1CFF A;  1RTP 1;  3CGA A;  4HRG A;  2M1U A;  3DY9 A;  1DF0 A;  2KI6 C;  5HYD A;  3OX6 A;  3KPX A;  4CLN A;  4QJ5 B;  1QTX A;  3M0W A;  3ICB A;  1DTL A;  2TN4 A;  2F2O A;  2LAP A;  3NGV A;  1MHO A;  1R2U A;  1TN4 A;  3PJI A;  2VRG A;  1OZO A;  4PDZ A;  3WHT B;  2JPT A;  2LAN A;  4ORB B;  3BFA A;  2LUC A;  2WCJ A;  2V53 A;  2QEB A;  1F70 A;  1PUL A;  1KCY A;  3NXA A;  4ETO A;  4M2P A;  2K61 A;  1SY9 A;  1N65 A;  4OKH A;  2MHH A;  3I5H B;  4M2O A;  5CPV A;  3SS3 A;  4YGD B;  1WRZ A;  2M7N A;  1JFJ A;  1IG5 A;  2HQW A;  2KGR A;  3MSE B;  1K90 D;  2KPH A;  1TUZ A;  3VRP A;  1B8L A;  1BLQ A;  1A75 B;  2K7O A;  2PYQ A;  3FE9 A;  1LS8 A;  3ZNI A;  2KFF A;  1IJ5 A;  1X02 A;  3DVK A;  1J1E A;  2KYF A;  2EC6 C;  2JOJ A;  5HKZ A;  2EC6 B;  1W7J B;  2BL0 C;  2WC6 A;  2Y1N A;  2BKI B;  3IQO A;  2KI4 C;  2LCP A;  1DJY A;  1YX8 A;  1KK7 Z;  2CNP A;  4OCI A;  5DIC A;  3C1V A;  3PM2 A;  4ORA B;  1Y6W A;  3SG3 A;  1S36 A;  1SCV A;  3SG4 A;  4N1G A;  4MVF A;  3EVU A;  1U5I A;  3UNW A;  1QLK A;  1SW8 A;  4JD9 A;  3CLN A;  2MLE C;  2WCM A;  2KFG A;  1Y1A A;  5DKN A;  2EHB A;  1C7V A;  3D0Y A;  1S3P A;  4GGF C;  1S6C A;  1JC2 A;  1K93 D;  2LV7 A;  4NDC A;  4YRU A;  3CR4 X;  1DQE A;  1M63 B;  4MSP A;  3CYZ A;  1QLS A;  1VRK A;  1A2X A; 
#chains in the Genus database with same CATH homology
 3FWC A;  2Q91 A;  2BEC A;  4GGF A;  3DVJ A;  3JVT C;  1NSH A;  4ZCV A;  1QIV A;  4ORC B;  3QRX A;  1OMV A;  1G33 A;  4I5J A;  4N1F A;  4WRI A;  1CM1 A;  1F71 A;  1NCZ A;  3EK8 A;  4GGN A;  4YGA A;  2LUX A;  3VGO A;  3AKB A;  3TUY C;  3I5G B;  4PE0 A;  1F4Q A;  1DVI A;  1QV1 A;  3PN7 C;  1MXE A;  2KAY A;  1KFU L;  4HRH A;  1BR4 B;  3DF0 A;  2BBM A;  1E8A A;  1XFZ O;  4M2Q A;  1QX7 A;  1SL7 A;  2LHI A;  4GBA A;  5HKY A;  3D0Y B;  3TUY B;  2ZN9 A;  1EG4 A;  1YRT B;  4XJK A;  3LK0 A;  1YVL A;  3OX5 A;  1KK8 C;  1K2H A;  4TNC A;  2NCP A;  1M46 A;  2WCE A;  3HCM A;  4OR9 B;  2K7B A;  1XA5 A;  2M97 A;  2K7C A;  4HSZ A;  2JXL A;  3A4U B;  1UHH A;  1SNL A;  1CDN A;  2PVB A;  4D1E A;  2JU0 A;  3OHM B;  1JF0 A;  1H4B A;  1EH2 A;  1LKJ A;  4AOM A;  1A29 A;  1UWO A;  1YUT A;  3SG7 A;  1OE9 B;  2WC8 A;  1XFU O;  1CM4 A;  1KQM C;  1BT6 A;  2EGD A;  1K94 A;  2BBN A;  4PCW A;  1TCF A;  4I5K A;  4NDD A;  1NP8 A;  2I94 A;  1DJW A;  1WRK A;  2JT8 A;  2LLS A;  1N2D A;  2ZND A;  1AK8 A;  2LM5 A;  5BPJ A;  2M0R A;  2BCX A;  1A75 A;  1DMO A;  4C0J A;  2JTT A;  2JUL A;  1CDP A;  1QAS A;  2OPO A;  3K21 A;  1SR6 B;  2KI6 D;  2ZNE A;  3BQ3 A;  3GK2 A;  5DKR A;  1SMG A;  1LVC D;  4CFQ A;  1QVI Y;  4PHJ A;  1L2O C;  3SG6 A;  1BMO A;  2KI4 B;  1UUR A;  1Y0V H;  1JFK A;  1EJ3 A;  3BYA A;  1BJF A;  1B7T Y;  4YGC B;  1B4C A;  1QIW A;  1S5G Z;  5KTY A;  2FJU B;  4MBE A;  1KWO B;  5HKW A;  1YUR A;  1AJ4 A;  1NUB A;  1V1F A;  2LP2 A;  1KSM A;  3PSR A;  1ZMZ A;  2KAX A;  2M8U A;  2KBM A;  5CSJ A;  1MF8 B;  1MUX A;  1CB1 A;  4GNK B;  1UHJ A;  2LMT A;  5CSN A;  4A4B A;  2R2I A;  1GQM A;  1GGZ A;  5CSI A;  4A4C A;  2F33 A;  4MRX A;  4F0Z B;  4YI9 A;  3GOF A;  1WLM A;  3CS1 A;  2LMV A;  3BUN B;  2M3W A;  2OS8 B;  4MZK A;  1ALV A;  2JT3 A;  2SAS A;  3KHE A;  3O4Y A;  1SYM A;  2MLF C;  1XFW O;  1MR8 A;  3I5I C;  4GUK A;  2KHN A;  4U8D A;  1SBJ A;  2Q4U A;  5D7F A;  2LLU A;  2BKH B;  1K95 A;  4P2Y B;  1DJZ A;  1B7T Z;  2GGM A;  1DJG A;  3KF9 A;  1W7I B;  2L5X B;  1BOD A;  1XFV O;  4YGE B;  2KBI A;  2WCB A;  3OP0 A;  5B8I B;  2OTG B;  2NLN A;  1S6I A;  1JSA A;  1TIZ A;  3F45 A;  3EKH A;  1M31 A;  1SL9 A;  3EK4 A;  4MLW A;  4YGB B;  1IKU A;  1LA0 A;  3NSI A;  5I8N A;  1KFX L;  1IWQ A;  1F55 A;  1IRJ A;  1G4Y R;  5DKQ A;  1K9P A;  2G2B A;  3I5H C;  5HLO A;  3SG2 A;  4MZL A;  4HRE E;  2L51 A;  1XK4 A;  1OOJ A;  2OS8 C;  3AAJ A;  4PHN A;  1M45 A;  4USL A;  1PVB A;  1IQ5 A;  5AXI A;  4R1E A;  2PAL A;  1KFX S;  1WDC C;  2CXJ A;  2KFH A;  3O2P A;  1YVH A;  1QXP A;  1YR5 A;  4PHK A;  2KYC A;  1PSR A;  2FCD A;  3NSL A;  2COL B;  4CFR A;  4P5O E;  2LVK A;  1OQP A;  3NSK A;  4MEW A;  1NYA A;  3ZWH A;  1S1E A;  3DD4 A;  1HQV A;  3BXK A;  2JWW A;  1J1D A;  5AEQ A;  2LHL A;  1BF5 A;  1FI5 A;  1XVJ A;  2JZI A;  2K2F A;  2L98 A;  4WQ2 A;  2LVJ A;  1LA3 A;  1M39 A;  2LVV A;  3LCP C;  1YX7 A;  1QX2 A;  4MZJ A;  4L9M A;  3FWB A;  4IL1 A;  4XYN A;  4MN0 A;  2O60 A;  1JUO A;  4YI8 A;  1L2O B;  1TOP A;  5J3X A;  1U5I B;  2PMY A;  4DCK A;  1UUS A;  1BG1 A;  1PAL A;  1FW4 A;  1J7Q A;  1CDM A;  3VRQ A;  5CSF A;  2AMI A;  3TS5 B;  1Y1X A;  2I2R E;  3E3R A;  2LNK A;  1G8I A;  3LK1 A;  4FQO A;  1SKT A;  1YTZ C;  2H2K A;  1ZFS A;  1S5G Y;  4JQ0 D;  4PE7 A;  1K9K A;  1K9U A;  1XFY O;  2E30 A;  1CKK A;  2BE4 A;  2F3Y A;  2JRF A;  1QS7 A;  2MRD A;  2QPT A;  4YBH B;  1AUI B;  1CFD A;  1KFU S;  2D8N A;  1UP5 A;  2ZRS A;  3VRO A;  1N0Y A;  2MAZ A;  3HX4 A;  1CNP A;  1YUS A;  5PAL A;  1CLL A;  1UHI A;  1F8H A;  3PM8 A;  1GGW A;  2HET A;  2NXQ A;  2NZ0 A;  1PVA A;  2ZRT A;  2JT0 A;  4C0L A;  1Y1U A;  1TRF A;  1LXF C;  1NWD A;  1NX2 A;  1TTX A;  1SR6 C;  3LLE A;  1B9A A;  1IGV A;  2K0J A;  3DF0 B;  1DT7 B;  2K2A A;  2PAS A;  2WOS A;  3A8R A;  1CDL A;  3PLF B;  3DVM A;  4WQ3 A;  1AJ5 A;  1DF0 B;  3CZT X;  4QJ3 B;  3JVT B;  1OSA A;  1DJH A;  4PAL A;  2LP3 A;  4QJ4 B;  1H8B A;  2FOT A;  1FF1 A;  2NCO A;  2LMU A;  4Q04 A;  5D69 A;  2JC2 A;  3PFV A;  1WY9 A;  1F4O A;  1R6P A;  1OMD A;  3SG5 A;  2LVI A;  2M1K B;  1QX5 B;  1AVS A;  3CR2 A;  3RLZ A;  2LE9 B;  2FCE A;  5I2O A;  4PE4 A;  1EG3 A;  2F2P A;  3WNX B;  2G9B A;  1SRA A;  1TNX A;  2K8M B;  2F3Z A;  5ER4 X;  5KU1 A;  1K8U A;  1MQ1 A;  5ER5 A;  3CTN A;  1FI6 A;  4GPL B;  1CMF A;  1KQV A;  2OTG C;  1S26 D;  5JOL A;  1ODB A;  2LLT A;  3TZ1 A;  3SIB A;  1AP4 A;  3NSO A;  3KEV A;  1J55 A;  3DVE A;  1LIN A;  1QVI Z;  1ZAC A;  2I7A A;  2BL0 B;  1IH0 A;  5F6T A;  1XFX O;  3VRN A;  4AQJ A;  3WXA A;  4BY4 A;  3FS7 A;  2AAO A;  3LL8 B;  2KGB C;  2WCF A;  1SCM C;  1QV0 A;  2ISD A;  3AAK A;  2MBX A;  1IQ3 A;  1NX3 A;  1QAT A;  1SCM B;  3TDU A;  1MWN A;  2CTN A;  1EL4 A;  2L4H A;  1DGU A;  1BU3 A;  1QJT A;  2JNF A;  1TNP A;  1WDC B;  2KDH A;  3D10 A;  1REC A;  3TDZ A;  1S6J A;  1RK9 A;  4DIR A;  2P6B B;  1B8R A;  2M29 A;  1B47 A;  1V1G A;  4I5N B;  1F54 A;  2CT9 A;  2CCM A;  3VRR A;  2JXC A;  4DRW A;  1BOC A;  1DJX A;  3TDI A;  4C0K A;  1CMG A;  4N5X A;  3FIA A;  1FPW A;  2L4I A;  5K89 A;  5TNC A;  3RM1 A;  5AER A;  1DGV A;  3CR5 X;  4ZCU A;  5I2L A;  2JQ6 A;  1FBV A;  3I5F B;  3BUM B;  2AUC A;  2O5G A;  4NQG A;  2H61 A;  1YUU A;  5G08 A;  4DUQ A;  1NIW A;  2QAC A;  4UPG A;  2KOT A;  4CID A;  2MJW B;  2M49 B;  3CWG A;  3I5I B;  1UHK A;  3BOW B;  2KNE A;  2WOR A;  2Y4Q A;  2ZKM X;  1CTR A;  1BR1 B;  3O78 A;  1A4P A;  4OV2 A;  2L0P A;  5FYX A;  2KQY A;  3SJS A;  1KQM B;  4FTG A;  5AFP A;  4E68 A;  4AQI A;  1J7O A;  2PRU A;  1XO5 A;  3BUO B;  3AKA A;  4GFT A;  1NX1 A;  1KSO A;  4MRY A;  3EVV A;  1PK0 D;  2KSP A;  2KAV A;  1J7R A;  3BUX B;  1OZS A;  1K96 A;  1YRU B;  1NCX A;  2DOQ A;  2GGZ A;  2Y5I A;  1TNW A;  2ZFD A;  1C7W A;  3O6B A;  1A03 A;  1J7P A;  1B8C A;  1KK8 B;  3KO0 A;  3PAL A;  2BCB A;  2B1U A;  1KK7 Y;  2KQ6 A;  2HF5 A;  2L2E A;  3GK4 X;  1KWO C;  2PSR A;  1SPY A;  3JTD C;  1XK4 C;  3EKJ A;  2HQ8 A;  3IF7 A;  2JNX A;  5JJG A;  2HPS A;  2A4J A;  3PAT A;  4BY5 A;  2I18 A;  4CPV A;  1ZOT B;  1IJ6 A;  4OVN F;  3GK1 A;  4ICB A;  1C07 A;  1PSB A;  1NPQ A;  4DS7 A;  5IBW A;  4JWQ A;  1RRO A;  3IQQ A;  3OB1 B;  3H4S E;  3EVR A;  3JTD B;  5AAN A;  1DJI A;  2RGI A;  4PE1 A;  1JBA A;  1EXR A;  4PHM A;  1WRL A;  1NX0 A;  2IS9 A;  2MA2 A;  2Y1M A;  5I2Q A;  1SL8 A;  4NDB A;  1PRW A;  1B1G A;  4JPZ B;  1WLZ A;  2GV5 A;  1CFC A;  1Q80 A;  1HT9 A;  1XYD A;  1D1O A;  1MXL C;  4XJK B;  1GJY A;  1UHN A;  1TCO B;  3EK7 A;  1OMR A;  2JTZ A;  4GAO A;  1CFP A;  1RJV A;  1TNQ A;  3SIA A;  2SCP A;  2BE6 A;  3TS5 C;  1RWY A;  2WND A;  4I5L B;  1AHR A;  1NCY A;  2ZN8 A;  2M7L A;  3OB2 B;  2M9G A;  1CLB A;  1CLM A;  3PN7 B;  5GQQ C;  1JF2 A;  1JWD A;  1ZUZ A;  2CBL A;  2K7D A;  3BUW B;  5KSZ A;  2L50 A;  3I5F C;  2BCA A;  2LC5 A;  1ALW A;  3BOW A;  2F8P A;  3I5G C;  1SK6 D;  2H61 C;  1RFJ A;  2E6W A;  1L7Z A;  5HLV A;  3WHU B;  1CFF A;  1RTP 1;  3CGA A;  4HRG A;  2M1U A;  1DF0 A;  2KI6 C;  5HYD A;  3OX6 A;  3KPX A;  4CLN A;  4QJ5 B;  1QTX A;  3M0W A;  3ICB A;  1DTL A;  2TN4 A;  2F2O A;  2LAP A;  1MHO A;  1R2U A;  1TN4 A;  2VRG A;  1OZO A;  4PDZ A;  3WHT B;  2JPT A;  2LAN A;  4ORB B;  2LUC A;  2V53 A;  1F70 A;  1PUL A;  1KCY A;  3NXA A;  4ETO A;  4M2P A;  2K61 A;  1SY9 A;  1N65 A;  4OKH A;  2MHH A;  3I5H B;  4M2O A;  5CPV A;  4YGD B;  1WRZ A;  2M7N A;  1JFJ A;  1IG5 A;  2HQW A;  2KGR A;  3MSE B;  1K90 D;  3VRP A;  1B8L A;  1BLQ A;  1A75 B;  2K7O A;  3ZNI A;  2KFF A;  1IJ5 A;  1X02 A;  3DVK A;  1J1E A;  2KYF A;  2EC6 C;  2JOJ A;  5HKZ A;  2EC6 B;  1W7J B;  2BL0 C;  2Y1N A;  2BKI B;  3IQO A;  2KI4 C;  2LCP A;  1DJY A;  1YX8 A;  1KK7 Z;  2CNP A;  4OCI A;  3C1V A;  4ORA B;  1Y6W A;  3SG3 A;  1S36 A;  1SCV A;  3SG4 A;  4N1G A;  4MVF A;  3EVU A;  1U5I A;  1QLK A;  1SW8 A;  3CLN A;  2MLE C;  2KFG A;  1Y1A A;  5DKN A;  2EHB A;  1C7V A;  3D0Y A;  1S3P A;  4GGF C;  1S6C A;  1JC2 A;  1K93 D;  2LV7 A;  4NDC A;  4YRU A;  3CR4 X;  1M63 B;  4MSP A;  1QLS A;  1VRK A;  1A2X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...