2WOSA

Structure of human s100a7 in complex with 2,6 ans
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
96
structure length
96
Chain Sequence
SNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium-binding protein
molecule keywords PROTEIN S100-A7
publication title Identification and Characterization of Binding Sites on S100A7, a Participant in Cancer and Inflammation Pathways.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2wosA00
1ZOTB 3NSKA 3RM1A 1AVSA 1F71A 1TOPA 3VGOA 1L2OC 1SRAA 1A29A 3TS5C 1NWDA 1TN4A 1ZUZA 1OE9B 2FJUB 2Y1NA 1NX0A 3SIAA 1S6IA 5ER5A 2MBXA 3VROA 1B9AA 1PULA 1BG1A 1EH2A 1B47A 1CB1A 1XFUO 1Y0VH 1KK8C 5CSFA 2ZKMX 1XFXO 2DOQA 3KPXA 3I5IC 4GPLB 4A4CA 3PALA 4OCIA 2JULA 4PE1A 3I5HB 2ZNDA 5CSIA 5HKZA 1N65A 2MAZA 1K2HA 2KFFA 2BE6A 3EVRA 1JBAA 4UPGA 1BLQA 1NX3A 4MBEA 5J3XA 3FWBA 1B1GA 4MRYA 1LKJA 2LLTA 3EVVA 1BMOA 1MR8A 1CKKA 3DF0A 1JFJA 2BCXA 1DTLA 2H61A 2M49B 4N5XA 1IG5A 1XK4A 2JZIA 3CGAA 1IGVA 2KHNA 2L2EA 3M0WA 4ORCB 3CWGA 5HLVA 1Q80A 1FBVA 1SR6C 1TNQA 1YUTA 1QLSA 1UHHA 4L9MA 3EKJA 3SG6A 1BF5A 3BUWB 1B4CA 3OX6A 1WDCB 3DF0B 2GV5A 4XYNA 2KGRA 1C07A 2R2IA 4PHJA 1ZFSA 4N1FA 3O6BA 4GGNA 5G08A 2BBNA 1CDLA 5I2OA 3KEVA 2MHHA 2LC5A 3JTDB 1K90D 1UWOA 1CM4A 2LVVA 2E6WA 2KI4B 4WQ3A 2JRFA 4CLNA 1CTRA 1PK0D 2JTTA 2ZRSA 4M2OA 3WNXB 2L4IA 3FS7A 3K21A 3BYAA 2JXLA 1Y1UA 2ZN8A 3PM8A 2BKIB 3PLFB 2MLFC 3CZTX 3CTNA 1MQ1A 2BECA 4C0LA 1H4BA 3SG5A 1K94A 2CT9A 4MSPA 1EG3A 3PSRA 2MRDA 1AK8A 1FF1A 4M2PA 4CPVA 5CSJA 2ZFDA 3I5FB 3OP0A 5AANA 3PFVA 4HSZA 2F8PA 3CLNA 1F54A 4PHMA 1QLKA 3A4UB 4MZJA 5DKQA 1TCOB 1JSAA 4NDDA 1B8CA 1L2OB 3ZWHA 3TS5B 2TN4A 1IJ5A 3EKHA 4OVNF 4P5OE 3IF7A 2F2PA 3EK4A 1QIVA 2JWWA 1QXPA 5DKNA 2L5XB 2KOTA 4PE4A 1TCFA 1U5IA 1NPQA 1V1GA 2LMVA 4YI8A 1KK8B 1QX2A 1S36A 1KQVA 1SY9A 3I5IB 4MZLA 1AHRA 4HREE 2KAYA 2WCFA 1F4OA 1J7QA 4Q04A 2I2RE 2NZ0A 1CMFA 1JF2A 1YTZC 2LLSA 3VRPA 1LINA 1GGWA 1U5IB 1YURA 2Y5IA 3AAJA 1S5GY 3BXKA 4PE0A 3CR4X 2JPTA 3O78A 4YGBB 1KWOC 3F45A 4GUKA 4ZCUA 2WNDA 3BUXB 1TNXA 2M1UA 3LCPC 2WCBA 2LP3A 2A4JA 4AQJA 1RWYA 4E68A 1F4QA 1WLZA 1S3PA 1B7TZ 1OOJA 3GOFA 5HKYA 2LMTA 1LA0A 1CMGA 1SR6B 2WCEA 1C7VA 1SCVA 1WRZA 3IQQA 3DVMA 4QJ4B 5JJGA 4IL1A 4YGEB 3ICBA 1QTXA 5IBWA 1MXEA 2HPSA 4I5JA 2M9GA 3CR2A 5F6TA 2CNPA 3BUMB 2LVJA 5FYXA 5KTYA 4YI9A 1YRTB 1J1EA 1RJVA 5B8IB 1N2DA 5BPJA 1NUBA 1CFDA 1NP8A 2CCMA 2M97A 1KFXS 1QV0A 1YUUA 2KGBC 2LCPA 2SASA 1WY9A 3MSEB 3LK0A 1XO5A 1A2XA 2L51A 2AAOA 1SL8A 3NXAA 1J7OA 2GGZA 2I18A 3FIAA 3EK8A 2M1KB 2K2FA 4DUQA 2LAPA 1JWDA 1OQPA 1G8IA 4I5LB 3HX4A 1AJ4A 2WOSA 3OB2B 4GBAA 2O5GA 2LHIA 1SYMA 4PCWA 2O60A 2JU0A 2KAVA 2PASA 1AP4A 3NSIA 4YGAA 1ZACA 3GK1A 2OTGC 3D10A 2FCDA 1SK6D 2JXCA 1MHOA 2KYFA 3KO0A 5I2QA 3EVUA 1M31A 1UHJA 1NX2A 1PSBA 1MXLC 1YRUB 1WRLA 2KYCA 1UUSA 2NCPA 2Q4UA 4GGFC 4C0KA 2JNFA 1IQ3A 2KAXA 1GGZA 2OS8C 3SG4A 1PRWA 2L0PA 1ALWA 3EK7A 3IQOA 3FWCA 4WRIA 1TTXA 1XYDA 1CDMA 1EL4A 4GFTA 4DIRA 1Y1AA 5D69A 4PALA 3TUYC 1CFCA 4BY5A 2LV7A 1SL9A 1QX7A 2ZRTA 1S26D 2L98A 1DJYA 1DVIA 2K7CA 3LLEA 2ISDA 4I5KA 2KI6C 3WHUB 2NLNA 1CNPA 4TNCA 2F3ZA 2GGMA 2BL0C 4BY4A 4CIDA 1SW8A 3SG2A 1WRKA 1BU3A 1KWOB 5AEQA 1NX1A 2JT3A 3A8RA 1LVCD 5TNCA 2PMYA 3TDIA 2E30A 1CDPA 1ALVA 4F0ZB 1NYAA 1RROA 4ORAB 4PHKA 1XA5A 2COLB 1SCMB 1ODBA 1MWNA 1KCYA 3SG3A 1PVBA 2KQYA 4YBHB 3WXAA 3VRQA 1MF8B 5CSNA 1R6PA 4AQIA 4ORBB 2JT0A 1YX8A 3H4SE 3JVTB 1DJZA 3AAKA 1UHIA 1B8RA 4CFQA 1NCZA 5AFPA 3BUNB 4MN0A 1CLLA 2BBMA 1Y1XA 2KQ6A 1CLMA 4OR9B 1A03A 1K9KA 1K9PA 2KNEA 1SKTA 1CM1A 1RK9A 1CFFA 2BCBA 5GQQC 2WC8A 1F55A 1OMDA 4DRWA 1J7RA 2I7AA 3PN7C 3CR5X 1N0YA 1QVIY 2KI6D 1V1FA 4OV2A 3DVKA 2D8NA 4GAOA 1S6CA 1M39A 2F3YA 1SL7A 2HQ8A 4JPZB 4MVFA 5HKWA 1ZMZA 3PATA 3SJSA 1G33A 3GK4X 4M2QA 4GGFA 2BKHB 3D0YA 1DGVA 2OTGB 3SIBA 5AXIA 2LLUA 1SCMC 4FTGA 1DF0A 2LUCA 2JT8A 2VRGA 2ZNEA 2Q91A 1KFUL 1RFJA 4PE7A 1FI5A 1BT6A 2HF5A 2KSPA 1E8AA 2EC6C 1YVLA 2LP2A 3JVTC 1RTP1 4ETOA 2M8UA 2HQWA 4U8DA 2BE4A 3D0YB 3I5GC 1JC2A 2JOJA 2KFGA 2OS8B 5AERA 2LANA 1DF0B 2HETA 1QVIZ 1R2UA 2MJWB 3C1VA 2K8MB 3WHTB 1J55A 2NCOA 2AMIA 1J1DA 3TUYB 1H8BA 4I5NB 1LA3A 3O4YA 1W7JB 1S5GZ 1XVJA 1BODA 2M7LA 4C0JA 1GQMA 4JWQA 2LMUA 3HCMA 2M0RA 1YR5A 4YGCB 4DCKA 4N1GA 1MUXA 2BL0B 1UP5A 1M63B 5D7FA 1IRJA 1KQMC 1QJTA 1C7WA 2BCAA 1KSMA 1SPYA 1NCYA 4NQGA 2K7BA 1K9UA 2B1UA 1DJGA 4AOMA 1RECA 2G9BA 2NXQA 2F33A 4OKHA 1FPWA 1DGUA 1JUOA 1YUSA 3OHMB 4JQ0D 3DVJA 3OB1B 1UURA 4CFRA 2V53A 4ZCVA 2K7OA 1QASA 1L7ZA 5HLOA 2LVKA 4QJ3B 2K2AA 5PALA 3SG7A 4YRUA 1JF0A 2ZN9A 2CBLA 4HRGA 1BR1B 1JFKA 1X02A 1CLBA 1UHNA 2KFHA 1IJ6A 2IS9A 1QX5B 1DJXA 1PSRA 1K95A 1EG4A 3NSLA 3KHEA 5HYDA 2P6BB 1SMGA 2Y4QA 4NDBA 3PN7B 3AKBA 1F70A 1A75A 1K93D 2KBMA 1M45A 3LL8B 4WQ2A 1LXFC 3DVEA 2QPTA 3OX5A 3AKAA 3CS1A 2JTZA 4ICBA 5ER4X 2I94A 1IQ5A 2G2BA 1PVAA 1OMRA 2JQ6A 2L4HA 1WLMA 1EJ3A 1M46A 1NSHA 2LVIA 1FI6A 4MZKA 1A75B 2WORA 4PDZA 4P2YB 4USLA 1UHKA 2PALA 1DJIA 1SNLA 1SBJA 4XJKA 2L50A 5I8NA 1CDNA 1YVHA 1XFVO 1QV1A 2PSRA 1DJWA 3I5HC 1IWQA 1PALA 2EC6B 2LM5A 2H2KA 5I2LA 1G4YR 3GK2A 4MRXA 3I5GB 1GJYA 1K8UA 5CPVA 1XFZO 1HT9A 4FQOA 1QIWA 4PHNA 1AUIB 2JC2A 3E3RA 1A4PA 4XJKB 2PVBA 1BJFA 2PRUA 1XFYO 2MA2A 2F2OA 3KF9A 1DMOA 3LK1A 2AUCA 1OMVA 4D1EA 2FCEA 2JNXA 2M29A 1OZOA 3BOWA 5KSZA 1QATA 2M7NA 3ZNIA 1OZSA 2LUXA 1KK7Y 1AJ5A 2RGIA 1VRKA 1F8HA 3DD4A 3TDUA 1OSAA 1BOCA 3TDZA 1XFWO 5JOLA 1FW4A 1KQMB 1WDCC 4R1EA 2QACA 3VRRA 1QS7A 1DT7B 2H61C 1B7TY 2LE9B 4HRHA 1XK4C 1J7PA 3BOWB 3QRXA 2OPOA 3TZ1A 1IH0A 4YGDB 1S6JA 1TNWA 1YX7A 2LNKA 2SCPA 2K61A 3BUOB 1TIZA 2CTNA 1IKUA 3JTDC 4GNKB 4DS7A 1B8LA 2KI4C 4NDCA 2Y1MA 5KU1A 1HQVA 2CXJA 2M3WA 3NSOA 4MLWA 5K89A 2EGDA 3RLZA 2MLEC 1KSOA 1W7IB 1TRFA 2LHLA 2FOTA 1DJHA 3O2PA 3BQ3A 2K0JA 1K96A 2K7DA 1D1OA 4MEWA 2KDHA 1KK7Z 1BR4B 1S1EA 4QJ5B 2KBIA 1EXRA 1NIWA 4A4BA 2EHBA 1TNPA 1KFUS 1CFPA 3I5FC 1Y6WA 1KFXL 3VRNA 5DKRA 1NCXA
chains in the Genus database with same CATH superfamily
1ZOTB 3NSKA 3RM1A 1AVSA 1F71A 1TOPA 3L47A 3VGOA 3NHTA 2ERBA 1L2OC 1SRAA 1A29A 3TS5C 1NWDA 1TN4A 3FE6A 1ZUZA 1OE9B 2FJUB 2Y1NA 1NX0A 3SIAA 5IBWA 1S6IA 2QEHA 5ER5A 2MBXA 3VROA 1B9AA 1PULA 1BG1A 1EH2A 1B47A 2QDIA 1CB1A 1XFUO 1C3ZA 1Y0VH 1KK8C 5CSFA 2ZKMX 1XFXO 2DOQA 3KPXA 3I5IC 4GPLB 3SS4A 4A4CA 3PALA 4OCIA 2JULA 4PE1A 3I5HB 2ZNDA 3B6XA 5CSIA 5HKZA 3BFBA 1N65A 3CZ0A 3DYEA 2MAZA 1OOFA 1K2HA 2KFFA 5FI7A 2BE6A 3EVRA 1JBAA 4UPGA 1BLQA 1NX3A 4MBEA 5J3XA 3FWBA 1B1GA 4MRYA 1LKJA 2LLTA 3EVVA 1BMOA 1MR8A 1CKKA 3DF0A 1JFJA 3Q8IA 2BCXA 1DTLA 2H61A 2M49B 4N5XA 1IG5A 1XK4A 2JZIA 3CGAA 3O4XA 1IGVA 1DQEA 2KHNA 2L2EA 3M0WA 3CWGA 4ORCB 5HLVA 1Q80A 1FBVA 1SR6C 1TNQA 1Z4HA 1YUTA 1QLSA 1UHHA 2YGUA 4L9MA 2BAPA 3EKJA 3SG6A 1BF5A 3BUWB 1B4CA 3OX6A 1WDCB 3DF0B 2GV5A 4XYNA 2KGRA 1C07A 2R2IA 4PHJA 2PYQA 1ZFSA 3D76A 1OOGA 4N1FA 2FJYA 3O6BA 4GGNA 5G08A 2BBNA 3D75A 1CDLA 5I2OA 3KEVA 3CYZA 2MHHA 2LC5A 3JTDB 1K90D 5I94A 1UWOA 1CM4A 2L5YA 2E6WA 2KI4B 2LVVA 4WQ3A 2JRFA 4CLNA 1CTRA 1PK0D 2JTTA 2ZRSA 4M2OA 3WNXB 2L4IA 3FS7A 3K21A 3BYAA 2JXLA 1Y1UA 2ZN8A 3R1VA 3PM8A 2BKIB 3PLFB 2MLFC 3CZTX 3CTNA 4JKTA 1MQ1A 2BECA 4C0LA 1H4BA 3R1PA 3SG5A 1K94A 2CT9A 4MSPA 1EG3A 3PSRA 2MRDA 1W9ZA 1AK8A 1FF1A 4F7FA 4M2PA 2WC5A 4CPVA 5CSJA 2ZFDA 3I5FB 3OP0A 5AANA 3PFVA 4HSZA 2F8PA 3CLNA 1F54A 4PHMA 1QLKA 3A4UB 2WCHA 4MZJA 1LS8A 5DKQA 1TCOB 1JSAA 4NDDA 1B8CA 1L2OB 3PJIA 3ZWHA 3TS5B 2TN4A 1IJ5A 3EKHA 4OVNF 4P5OE 3SS3A 3IF7A 2F2PA 3EK4A 1QIVA 2JWWA 1QXPA 1QWVA 5DKNA 2L5XB 1ORGA 2KOTA 4PE4A 1TCFA 1U5IA 1NPQA 1V1GA 2LMVA 4YI8A 1KK8B 1QX2A 1S36A 1KQVA 1SY9A 3I5IB 4MZLA 1AHRA 4HREE 3B87A 2KAYA 2WCFA 1F4OA 1J7QA 4Q04A 2I2RE 2NZ0A 1CMFA 1JF2A 1YTZC 2LLSA 3VRPA 1P28A 1LINA 1GGWA 1U5IB 1YURA 2Y5IA 3AAJA 1S5GY 3BXKA 4PE0A 3CR4X 2JPTA 3O78A 4YGBB 1KWOC 3F45A 3FE9A 4GUKA 4ZCUA 3UO9A 2WNDA 3BUXB 1TNXA 3DZTA 2M1UA 3LCPC 2WCBA 2LP3A 3L4AA 2A4JA 4AQJA 1RWYA 4E68A 1F4QA 1WLZA 1S3PA 1B7TZ 1OOJA 3GOFA 5HKYA 2LMTA 1LA0A 1CMGA 1SR6B 2WCEA 1C7VA 1SCVA 1WRZA 3IQQA 3DVMA 4QJ4B 5JJGA 4IL1A 4JD9A 4YGEB 3S0FA 3ICBA 1QTXA 3NGVA 1MXEA 2HPSA 4I5JA 2M9GA 3CR2A 4IJ7A 5F6TA 2CNPA 3BUMB 2LVJA 3RZSA 5FYXA 5KTYA 4YI9A 1YRTB 1J1EA 1RJVA 5B8IB 1N2DA 5BPJA 1NUBA 1CFDA 1NP8A 2CCMA 2M97A 1KFXS 1QV0A 1YUUA 2KGBC 2LCPA 2SASA 1WY9A 5FI6A 3S0AA 3MSEB 3LK0A 1XO5A 1A2XA 2L51A 2AAOA 1SL8A 3NXAA 1J7OA 2GGZA 2I18A 3FIAA 1OOIX 3EK8A 2M1KB 2K2FA 4DUQA 2LAPA 1JWDA 1OQPA 1G8IA 1DELA 4I5LB 3HX4A 1AJ4A 2WOSA 3OB2B 4GBAA 2O5GA 2LHIA 1SYMA 4PCWA 2O60A 2JU0A 2KAVA 2PASA 1AP4A 3NSIA 4YGAA 1ZACA 3GK1A 2QEVA 2OTGC 1Z2CB 3D10A 2FCDA 1SK6D 2JXCA 1MHOA 2KYFA 3KO0A 5I2QA 3EVUA 1M31A 1UHJA 1OW4A 3SS5A 1NX2A 1TUZA 1PSBA 1MXLC 1YRUB 1WRLA 2KYCA 1UUSA 2NCPA 2Q4UA 4GGFC 4C0KA 2JNFA 1IQ3A 2KAXA 1GGZA 2OS8C 3R1OA 3SG4A 1PRWA 2L0PA 1ALWA 3EK7A 3IQOA 3FWCA 4WRIA 1TTXA 1XYDA 1CDMA 1EL4A 4GFTA 4DIRA 1Y1AA 3CZ2A 5D69A 4PALA 3TUYC 1CFCA 2QEBA 4BY5A 2LV7A 1SL9A 1QX7A 2WCLA 3UNWA 2ZRTA 1S26D 2L98A 3D78A 2JPOA 3DXLA 1DJYA 1DVIA 2K7CA 2QEOA 3LLEA 2ISDA 4I5KA 2KI6C 3WHUB 2NLNA 1CNPA 4TNCA 2F3ZA 2GGMA 2BL0C 4BY4A 4CIDA 1SW8A 3SG2A 1WRKA 1BU3A 1KWOB 5AEQA 1NX1A 2JT3A 3A8RA 1LVCD 5TNCA 2PMYA 3TDIA 2E30A 1CDPA 1ALVA 4F0ZB 1NYAA 1RROA 1SSEB 4ORAB 1XA5A 2COLB 4PHKA 1SCMB 1ODBA 1MWNA 1KCYA 3SG3A 1PVBA 1XFRA 2KQYA 4YBHB 3WXAA 3VRQA 1MF8B 5CSNA 1R6PA 3B7AA 1GM0A 4AQIA 4ORBB 2JT0A 1YX8A 3H4SE 3JVTB 1DJZA 3AAKA 1UHIA 1B8RA 4CFQA 3BFHA 1NCZA 3CZ1A 5AFPA 3BUNB 4MN0A 1CLLA 2BBMA 1Y1XA 2KQ6A 3D74A 1CLMA 4OR9B 1A03A 1K9KA 1K9PA 2KNEA 1SKTA 2PQLA 1CM1A 1RK9A 1CFFA 2BCBA 5GQQC 2WC8A 3L4LA 1OMDA 4DRWA 1J7RA 2I7AA 1F55A 3PN7C 3CR5X 1N0YA 1QVIY 2KI6D 1V1FA 1T14A 4OV2A 3NHIA 3DVKA 2D8NA 4GAOA 3DY9A 1S6CA 1M39A 2F3YA 1SL7A 3BJHA 2HQ8A 4JPZB 4MVFA 5HKWA 1ZMZA 2KLDA 3D77A 3PATA 3SJSA 1G33A 3GK4X 4M2QA 4GGFA 2BKHB 3D0YA 1TWOA 1DGVA 2OTGB 3SIBA 5AXIA 3PM2A 1IIOA 2LLUA 1SCMC 2K60A 4FTGA 1DF0A 2L2CA 2LUCA 2JT8A 5DICA 2VRGA 2ZNEA 2Q91A 1KFUL 1RFJA 4PE7A 1FI5A 1BT6A 1OOHA 2HF5A 2KSPA 1E8AA 2EC6C 1YVLA 3IVTA 2LP2A 2H8VA 2WC6A 1RTP1 3JVTC 4ETOA 3B88A 2M8UA 2HQWA 2P71A 2BE4A 3D0YB 3I5GC 4U8DA 2JOJA 1JC2A 2KFGA 2WCKA 2OS8B 5AERA 2LANA 3VB1A 1DF0B 2HETA 1QVIZ 1R2UA 2MJWB 3C1VA 2K8MB 3OGNA 3WHTB 1J55A 2NCOA 2AMIA 4INXA 1J1DA 3TUYB 3EG5B 4I5NB 1LA3A 2WCJA 3O4YA 1H8BA 1W7JB 1S5GZ 1XVJA 1BODA 2M7LA 4C0JA 1GQMA 4JWQA 2LMUA 3HCMA 2M0RA 2WCMA 1YR5A 4YGCB 3S0GA 3CDNA 4DCKA 4N1GA 2BNXA 1MUXA 2BL0B 1UP5A 1M63B 5D7FA 1IRJA 1KQMC 1QJTA 1C7WA 2BCAA 1KSMA 1SPYA 1NCYA 2KLEA 4NQGA 2K7BA 3CABA 1K9UA 2B1UA 1DJGA 4AOMA 1RECA 2G9BA 2NXQA 2F33A 4OKHA 1FPWA 3S0DA 1C3YA 1DGUA 1JUOA 1YUSA 3OHMB 4JQ0D 3DVJA 3OB1B 1UURA 4CFRA 2V53A 4ZCVA 2K7OA 1QASA 1L7ZA 5HLOA 2LVKA 4QJ3B 2K2AA 5PALA 3SG7A 4YRUA 1JF0A 2ZN9A 2CBLA 4HRGA 1DEKA 1BR1B 1JFKA 1TUJA 1X02A 3FE8A 1CLBA 1UHNA 2KFHA 1IJ6A 2IS9A 1QX5B 1DJXA 3OBVA 1PSRA 1K95A 1EG4A 3NSLA 3KHEA 5HYDA 5D3OA 2P6BB 1SMGA 2Y4QA 4NDBA 3PN7B 3AKBA 1F70A 1A75A 1K93D 2KBMA 1M45A 3LL8B 4WQ2A 1LXFC 3DVEA 2QPTA 3OX5A 3AKAA 3CS1A 2JTZA 4ICBA 3N7HA 5ER4X 2I94A 1IQ5A 2G2BA 1PVAA 1OMRA 2JQ6A 2L4HA 1WLMA 1EJ3A 1M46A 1NSHA 2LVIA 4KYNA 1FI6A 4MZKA 1A75B 3QMEA 2WORA 4PDZA 4P2YB 4USLA 1UHKA 2PALA 1DJIA 1SNLA 1SBJA 3K1EA 2L50A 4XJKA 5I8NA 1CDNA 1YVHA 1XFVO 1QV1A 2PSRA 1DJWA 3I5HC 1IWQA 1PALA 2EC6B 2LM5A 2H2KA 3S0EA 5I2LA 1G4YR 3GK2A 2P70A 4PT1A 4MRXA 3I5GB 1GJYA 1K8UA 5CPVA 1XFZO 1HT9A 4FQOA 1QIWA 4PHNA 1AUIB 2JC2A 3E3RA 1A4PA 4XJKB 2PVBA 1BJFA 2PRUA 1XFYO 1DC1A 2MA2A 2F2OA 3KF9A 1DMOA 3LK1A 4OZDA 2AUCA 1OMVA 5EL2A 4D1EA 2FCEA 2JNXA 2M29A 1OZOA 3BOWA 4FQTA 5KSZA 1QATA 2M7NA 3ZNIA 1OZSA 2LUXA 1KK7Y 1AJ5A 2RGIA 1VRKA 4INWA 1F8HA 3DD4A 3TDUA 1OSAA 1BOCA 3TDZA 1XFWO 5JOLA 1FW4A 1KQMB 1WDCC 4R1EA 2QACA 3VRRA 1QS7A 1DT7B 2H61C 1B7TY 2LE9B 4HRHA 1XK4C 1J7PA 3BOWB 3QRXA 2OPOA 3TZ1A 1IH0A 4YGDB 1S6JA 5HL1A 3S0BA 1TNWA 1YX7A 2LNKA 2SCPA 2K61A 3BUOB 1TIZA 2CTNA 1IKUA 3JTDC 4GNKB 3D73A 1B8LA 4DS7A 2KI4C 4NDCA 2Y1MA 3V2LA 5KU1A 1HQVA 2CXJA 2M3WA 3NSOA 4MLWA 5FI2A 5K89A 2EGDA 3RLZA 2MLEC 1KSOA 1W7IB 1TRFA 2LHLA 2FOTA 1DJHA 2GTEA 3O2PA 3R72A 3BQ3A 2K0JA 1K96A 2K7DA 1D1OA 4MEWA 2KDHA 1KK7Z 1BR4B 1S1EA 3B86A 4QJ5B 2KBIA 1EXRA 1NIWA 2KPHA 4A4BA 2EHBA 1TNPA 1KFUS 3BFAA 3I5FC 1Y6WA 1CFPA 1KFXL 3VRNA 5DKRA 1NCXA
chains in the Genus database with same CATH topology
1ZOTB 3NSKA 3RM1A 1AVSA 1F71A 1TOPA 3VGOA 1L2OC 1SRAA 1A29A 3TS5C 1NWDA 1TN4A 1ZUZA 1OE9B 2FJUB 2Y1NA 1NX0A 3SIAA 1S6IA 5ER5A 2MBXA 3VROA 1B9AA 1PULA 1BG1A 1EH2A 1B47A 1CB1A 1XFUO 1Y0VH 1KK8C 5CSFA 2ZKMX 1XFXO 2DOQA 3KPXA 3I5IC 4GPLB 4A4CA 3PALA 4OCIA 2JULA 4PE1A 3I5HB 2ZNDA 5CSIA 5HKZA 1N65A 2MAZA 1K2HA 2KFFA 2BE6A 3EVRA 1JBAA 4UPGA 1BLQA 1NX3A 4MBEA 5J3XA 3FWBA 1B1GA 4MRYA 1LKJA 2LLTA 3EVVA 1BMOA 1MR8A 1CKKA 3DF0A 1JFJA 2BCXA 1DTLA 2H61A 2M49B 4N5XA 1IG5A 1XK4A 2JZIA 3CGAA 1IGVA 2KHNA 2L2EA 3M0WA 4ORCB 3CWGA 5HLVA 1Q80A 1FBVA 1SR6C 1TNQA 1YUTA 1QLSA 1UHHA 4L9MA 3EKJA 3SG6A 1BF5A 3BUWB 1B4CA 3OX6A 1WDCB 3DF0B 2GV5A 4XYNA 2KGRA 1C07A 2R2IA 4PHJA 1ZFSA 4N1FA 3O6BA 4GGNA 5G08A 2BBNA 1CDLA 5I2OA 3KEVA 2MHHA 2LC5A 3JTDB 1K90D 1UWOA 1CM4A 2LVVA 2E6WA 2KI4B 4WQ3A 2JRFA 4CLNA 1CTRA 1PK0D 2JTTA 2ZRSA 4M2OA 3WNXB 2L4IA 3FS7A 3K21A 3BYAA 2JXLA 1Y1UA 2ZN8A 3PM8A 2BKIB 3PLFB 2MLFC 3CZTX 3CTNA 1MQ1A 2BECA 4C0LA 1H4BA 3SG5A 1K94A 2CT9A 4MSPA 1EG3A 3PSRA 2MRDA 1AK8A 1FF1A 4M2PA 4CPVA 5CSJA 2ZFDA 3I5FB 3OP0A 5AANA 3PFVA 4HSZA 2F8PA 3CLNA 1F54A 4PHMA 1QLKA 3A4UB 4MZJA 5DKQA 1TCOB 1JSAA 4NDDA 1B8CA 1L2OB 3ZWHA 3TS5B 2TN4A 1IJ5A 3EKHA 4OVNF 4P5OE 3IF7A 2F2PA 3EK4A 1QIVA 2JWWA 1QXPA 5DKNA 2L5XB 2KOTA 4PE4A 1TCFA 1U5IA 1NPQA 1V1GA 2LMVA 4YI8A 1KK8B 1QX2A 1S36A 1KQVA 1SY9A 3I5IB 4MZLA 1AHRA 4HREE 2KAYA 2WCFA 1F4OA 1J7QA 4Q04A 2I2RE 2NZ0A 1CMFA 1JF2A 1YTZC 2LLSA 3VRPA 1LINA 1GGWA 1U5IB 1YURA 2Y5IA 3AAJA 1S5GY 3BXKA 4PE0A 3CR4X 2JPTA 3O78A 4YGBB 1KWOC 3F45A 4GUKA 4ZCUA 2WNDA 3BUXB 1TNXA 2M1UA 3LCPC 2WCBA 2LP3A 2A4JA 4AQJA 1RWYA 4E68A 1F4QA 1WLZA 1S3PA 1B7TZ 1OOJA 3GOFA 5HKYA 2LMTA 1LA0A 1CMGA 1SR6B 2WCEA 1C7VA 1SCVA 1WRZA 3IQQA 3DVMA 4QJ4B 5JJGA 4IL1A 4YGEB 3ICBA 1QTXA 5IBWA 1MXEA 2HPSA 4I5JA 2M9GA 3CR2A 5F6TA 2CNPA 3BUMB 2LVJA 5FYXA 5KTYA 4YI9A 1YRTB 1J1EA 1RJVA 5B8IB 1N2DA 5BPJA 1NUBA 1CFDA 1NP8A 2CCMA 2M97A 1KFXS 1QV0A 1YUUA 2KGBC 2LCPA 2SASA 1WY9A 3MSEB 3LK0A 1XO5A 1A2XA 2L51A 2AAOA 1SL8A 3NXAA 1J7OA 2GGZA 2I18A 3FIAA 3EK8A 2M1KB 2K2FA 4DUQA 2LAPA 1JWDA 1OQPA 1G8IA 4I5LB 3HX4A 1AJ4A 2WOSA 3OB2B 4GBAA 2O5GA 2LHIA 1SYMA 4PCWA 2O60A 2JU0A 2KAVA 2PASA 1AP4A 3NSIA 4YGAA 1ZACA 3GK1A 2OTGC 3D10A 2FCDA 1SK6D 2JXCA 1MHOA 2KYFA 3KO0A 5I2QA 3EVUA 1M31A 1UHJA 1NX2A 1PSBA 1MXLC 1YRUB 1WRLA 2KYCA 1UUSA 2NCPA 2Q4UA 4GGFC 4C0KA 2JNFA 1IQ3A 2KAXA 1GGZA 2OS8C 3SG4A 1PRWA 2L0PA 1ALWA 3EK7A 3IQOA 3FWCA 4WRIA 1TTXA 1XYDA 1CDMA 1EL4A 4GFTA 4DIRA 1Y1AA 5D69A 4PALA 3TUYC 1CFCA 4BY5A 2LV7A 1SL9A 1QX7A 2ZRTA 1S26D 2L98A 1DJYA 1DVIA 2K7CA 3LLEA 2ISDA 4I5KA 2KI6C 3WHUB 2NLNA 1CNPA 4TNCA 2F3ZA 2GGMA 2BL0C 4BY4A 4CIDA 1SW8A 3SG2A 1WRKA 1BU3A 1KWOB 5AEQA 1NX1A 2JT3A 3A8RA 1LVCD 5TNCA 2PMYA 3TDIA 2E30A 1CDPA 1ALVA 4F0ZB 1NYAA 1RROA 4ORAB 4PHKA 1XA5A 2COLB 1SCMB 1ODBA 1MWNA 1KCYA 3SG3A 1PVBA 2KQYA 4YBHB 3WXAA 3VRQA 1MF8B 5CSNA 1R6PA 4AQIA 4ORBB 2JT0A 1YX8A 3H4SE 3JVTB 1DJZA 3AAKA 1UHIA 1B8RA 4CFQA 1NCZA 5AFPA 3BUNB 4MN0A 1CLLA 2BBMA 1Y1XA 2KQ6A 1CLMA 4OR9B 1A03A 1K9KA 1K9PA 2KNEA 1SKTA 1CM1A 1RK9A 1CFFA 2BCBA 5GQQC 2WC8A 1F55A 1OMDA 4DRWA 1J7RA 2I7AA 3PN7C 3CR5X 1N0YA 1QVIY 2KI6D 1V1FA 4OV2A 3DVKA 2D8NA 4GAOA 1S6CA 1M39A 2F3YA 1SL7A 2HQ8A 4JPZB 4MVFA 5HKWA 1ZMZA 3PATA 3SJSA 1G33A 3GK4X 4M2QA 4GGFA 2BKHB 3D0YA 1DGVA 2OTGB 3SIBA 5AXIA 2LLUA 1SCMC 4FTGA 1DF0A 2LUCA 2JT8A 2VRGA 2ZNEA 2Q91A 1KFUL 1RFJA 4PE7A 1FI5A 1BT6A 2HF5A 2KSPA 1E8AA 2EC6C 1YVLA 2LP2A 3JVTC 1RTP1 4ETOA 2M8UA 2HQWA 4U8DA 2BE4A 3D0YB 3I5GC 1JC2A 2JOJA 2KFGA 2OS8B 5AERA 2LANA 1DF0B 2HETA 1QVIZ 1R2UA 2MJWB 3C1VA 2K8MB 3WHTB 1J55A 2NCOA 2AMIA 1J1DA 3TUYB 1H8BA 4I5NB 1LA3A 3O4YA 1W7JB 1S5GZ 1XVJA 1BODA 2M7LA 4C0JA 1GQMA 4JWQA 2LMUA 3HCMA 2M0RA 1YR5A 4YGCB 4DCKA 4N1GA 1MUXA 2BL0B 1UP5A 1M63B 5D7FA 1IRJA 1KQMC 1QJTA 1C7WA 2BCAA 1KSMA 1SPYA 1NCYA 4NQGA 2K7BA 1K9UA 2B1UA 1DJGA 4AOMA 1RECA 2G9BA 2NXQA 2F33A 4OKHA 1FPWA 1DGUA 1JUOA 1YUSA 3OHMB 4JQ0D 3DVJA 3OB1B 1UURA 4CFRA 2V53A 4ZCVA 2K7OA 1QASA 1L7ZA 5HLOA 2LVKA 4QJ3B 2K2AA 5PALA 3SG7A 4YRUA 1JF0A 2ZN9A 2CBLA 4HRGA 1BR1B 1JFKA 1X02A 1CLBA 1UHNA 2KFHA 1IJ6A 2IS9A 1QX5B 1DJXA 1PSRA 1K95A 1EG4A 3NSLA 3KHEA 5HYDA 2P6BB 1SMGA 2Y4QA 4NDBA 3PN7B 3AKBA 1F70A 1A75A 1K93D 2KBMA 1M45A 3LL8B 4WQ2A 1LXFC 3DVEA 2QPTA 3OX5A 3AKAA 3CS1A 2JTZA 4ICBA 5ER4X 2I94A 1IQ5A 2G2BA 1PVAA 1OMRA 2JQ6A 2L4HA 1WLMA 1EJ3A 1M46A 1NSHA 2LVIA 1FI6A 4MZKA 1A75B 2WORA 4PDZA 4P2YB 4USLA 1UHKA 2PALA 1DJIA 1SNLA 1SBJA 4XJKA 2L50A 5I8NA 1CDNA 1YVHA 1XFVO 1QV1A 2PSRA 1DJWA 3I5HC 1IWQA 1PALA 2EC6B 2LM5A 2H2KA 5I2LA 1G4YR 3GK2A 4MRXA 3I5GB 1GJYA 1K8UA 5CPVA 1XFZO 1HT9A 4FQOA 1QIWA 4PHNA 1AUIB 2JC2A 3E3RA 1A4PA 4XJKB 2PVBA 1BJFA 2PRUA 1XFYO 2MA2A 2F2OA 3KF9A 1DMOA 3LK1A 2AUCA 1OMVA 4D1EA 2FCEA 2JNXA 2M29A 1OZOA 3BOWA 5KSZA 1QATA 2M7NA 3ZNIA 1OZSA 2LUXA 1KK7Y 1AJ5A 2RGIA 1VRKA 1F8HA 3DD4A 3TDUA 1OSAA 1BOCA 3TDZA 1XFWO 5JOLA 1FW4A 1KQMB 1WDCC 4R1EA 2QACA 3VRRA 1QS7A 1DT7B 2H61C 1B7TY 2LE9B 4HRHA 1XK4C 1J7PA 3BOWB 3QRXA 2OPOA 3TZ1A 1IH0A 4YGDB 1S6JA 1TNWA 1YX7A 2LNKA 2SCPA 2K61A 3BUOB 1TIZA 2CTNA 1IKUA 3JTDC 4GNKB 4DS7A 1B8LA 2KI4C 4NDCA 2Y1MA 5KU1A 1HQVA 2CXJA 2M3WA 3NSOA 4MLWA 5K89A 2EGDA 3RLZA 2MLEC 1KSOA 1W7IB 1TRFA 2LHLA 2FOTA 1DJHA 3O2PA 3BQ3A 2K0JA 1K96A 2K7DA 1D1OA 4MEWA 2KDHA 1KK7Z 1BR4B 1S1EA 4QJ5B 2KBIA 1EXRA 1NIWA 4A4BA 2EHBA 1TNPA 1KFUS 1CFPA 3I5FC 1Y6WA 1KFXL 3VRNA 5DKRA 1NCXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZOT B;  3NSK A;  3RM1 A;  1AVS A;  1F71 A;  1TOP A;  3VGO A;  1L2O C;  1SRA A;  1A29 A;  3TS5 C;  1NWD A;  1TN4 A;  1ZUZ A;  1OE9 B;  2FJU B;  2Y1N A;  1NX0 A;  3SIA A;  1S6I A;  5ER5 A;  2MBX A;  3VRO A;  1B9A A;  1PUL A;  1BG1 A;  1EH2 A;  1B47 A;  1CB1 A;  1XFU O;  1Y0V H;  1KK8 C;  5CSF A;  2ZKM X;  1XFX O;  2DOQ A;  3KPX A;  3I5I C;  4GPL B;  4A4C A;  3PAL A;  4OCI A;  2JUL A;  4PE1 A;  3I5H B;  2ZND A;  5CSI A;  5HKZ A;  1N65 A;  2MAZ A;  1K2H A;  2KFF A;  2BE6 A;  3EVR A;  1JBA A;  4UPG A;  1BLQ A;  1NX3 A;  4MBE A;  5J3X A;  3FWB A;  1B1G A;  4MRY A;  1LKJ A;  2LLT A;  3EVV A;  1BMO A;  1MR8 A;  1CKK A;  3DF0 A;  1JFJ A;  2BCX A;  1DTL A;  2H61 A;  2M49 B;  4N5X A;  1IG5 A;  1XK4 A;  2JZI A;  3CGA A;  1IGV A;  2KHN A;  2L2E A;  3M0W A;  4ORC B;  3CWG A;  5HLV A;  1Q80 A;  1FBV A;  1SR6 C;  1TNQ A;  1YUT A;  1QLS A;  1UHH A;  4L9M A;  3EKJ A;  3SG6 A;  1BF5 A;  3BUW B;  1B4C A;  3OX6 A;  1WDC B;  3DF0 B;  2GV5 A;  4XYN A;  2KGR A;  1C07 A;  2R2I A;  4PHJ A;  1ZFS A;  4N1F A;  3O6B A;  4GGN A;  5G08 A;  2BBN A;  1CDL A;  5I2O A;  3KEV A;  2MHH A;  2LC5 A;  3JTD B;  1K90 D;  1UWO A;  1CM4 A;  2LVV A;  2E6W A;  2KI4 B;  4WQ3 A;  2JRF A;  4CLN A;  1CTR A;  1PK0 D;  2JTT A;  2ZRS A;  4M2O A;  3WNX B;  2L4I A;  3FS7 A;  3K21 A;  3BYA A;  2JXL A;  1Y1U A;  2ZN8 A;  3PM8 A;  2BKI B;  3PLF B;  2MLF C;  3CZT X;  3CTN A;  1MQ1 A;  2BEC A;  4C0L A;  1H4B A;  3SG5 A;  1K94 A;  2CT9 A;  4MSP A;  1EG3 A;  3PSR A;  2MRD A;  1AK8 A;  1FF1 A;  4M2P A;  4CPV A;  5CSJ A;  2ZFD A;  3I5F B;  3OP0 A;  5AAN A;  3PFV A;  4HSZ A;  2F8P A;  3CLN A;  1F54 A;  4PHM A;  1QLK A;  3A4U B;  4MZJ A;  5DKQ A;  1TCO B;  1JSA A;  4NDD A;  1B8C A;  1L2O B;  3ZWH A;  3TS5 B;  2TN4 A;  1IJ5 A;  3EKH A;  4OVN F;  4P5O E;  3IF7 A;  2F2P A;  3EK4 A;  1QIV A;  2JWW A;  1QXP A;  5DKN A;  2L5X B;  2KOT A;  4PE4 A;  1TCF A;  1U5I A;  1NPQ A;  1V1G A;  2LMV A;  4YI8 A;  1KK8 B;  1QX2 A;  1S36 A;  1KQV A;  1SY9 A;  3I5I B;  4MZL A;  1AHR A;  4HRE E;  2KAY A;  2WCF A;  1F4O A;  1J7Q A;  4Q04 A;  2I2R E;  2NZ0 A;  1CMF A;  1JF2 A;  1YTZ C;  2LLS A;  3VRP A;  1LIN A;  1GGW A;  1U5I B;  1YUR A;  2Y5I A;  3AAJ A;  1S5G Y;  3BXK A;  4PE0 A;  3CR4 X;  2JPT A;  3O78 A;  4YGB B;  1KWO C;  3F45 A;  4GUK A;  4ZCU A;  2WND A;  3BUX B;  1TNX A;  2M1U A;  3LCP C;  2WCB A;  2LP3 A;  2A4J A;  4AQJ A;  1RWY A;  4E68 A;  1F4Q A;  1WLZ A;  1S3P A;  1B7T Z;  1OOJ A;  3GOF A;  5HKY A;  2LMT A;  1LA0 A;  1CMG A;  1SR6 B;  2WCE A;  1C7V A;  1SCV A;  1WRZ A;  3IQQ A;  3DVM A;  4QJ4 B;  5JJG A;  4IL1 A;  4YGE B;  3ICB A;  1QTX A;  5IBW A;  1MXE A;  2HPS A;  4I5J A;  2M9G A;  3CR2 A;  5F6T A;  2CNP A;  3BUM B;  2LVJ A;  5FYX A;  5KTY A;  4YI9 A;  1YRT B;  1J1E A;  1RJV A;  5B8I B;  1N2D A;  5BPJ A;  1NUB A;  1CFD A;  1NP8 A;  2CCM A;  2M97 A;  1KFX S;  1QV0 A;  1YUU A;  2KGB C;  2LCP A;  2SAS A;  1WY9 A;  3MSE B;  3LK0 A;  1XO5 A;  1A2X A;  2L51 A;  2AAO A;  1SL8 A;  3NXA A;  1J7O A;  2GGZ A;  2I18 A;  3FIA A;  3EK8 A;  2M1K B;  2K2F A;  4DUQ A;  2LAP A;  1JWD A;  1OQP A;  1G8I A;  4I5L B;  3HX4 A;  1AJ4 A;  2WOS A;  3OB2 B;  4GBA A;  2O5G A;  2LHI A;  1SYM A;  4PCW A;  2O60 A;  2JU0 A;  2KAV A;  2PAS A;  1AP4 A;  3NSI A;  4YGA A;  1ZAC A;  3GK1 A;  2OTG C;  3D10 A;  2FCD A;  1SK6 D;  2JXC A;  1MHO A;  2KYF A;  3KO0 A;  5I2Q A;  3EVU A;  1M31 A;  1UHJ A;  1NX2 A;  1PSB A;  1MXL C;  1YRU B;  1WRL A;  2KYC A;  1UUS A;  2NCP A;  2Q4U A;  4GGF C;  4C0K A;  2JNF A;  1IQ3 A;  2KAX A;  1GGZ A;  2OS8 C;  3SG4 A;  1PRW A;  2L0P A;  1ALW A;  3EK7 A;  3IQO A;  3FWC A;  4WRI A;  1TTX A;  1XYD A;  1CDM A;  1EL4 A;  4GFT A;  4DIR A;  1Y1A A;  5D69 A;  4PAL A;  3TUY C;  1CFC A;  4BY5 A;  2LV7 A;  1SL9 A;  1QX7 A;  2ZRT A;  1S26 D;  2L98 A;  1DJY A;  1DVI A;  2K7C A;  3LLE A;  2ISD A;  4I5K A;  2KI6 C;  3WHU B;  2NLN A;  1CNP A;  4TNC A;  2F3Z A;  2GGM A;  2BL0 C;  4BY4 A;  4CID A;  1SW8 A;  3SG2 A;  1WRK A;  1BU3 A;  1KWO B;  5AEQ A;  1NX1 A;  2JT3 A;  3A8R A;  1LVC D;  5TNC A;  2PMY A;  3TDI A;  2E30 A;  1CDP A;  1ALV A;  4F0Z B;  1NYA A;  1RRO A;  4ORA B;  4PHK A;  1XA5 A;  2COL B;  1SCM B;  1ODB A;  1MWN A;  1KCY A;  3SG3 A;  1PVB A;  2KQY A;  4YBH B;  3WXA A;  3VRQ A;  1MF8 B;  5CSN A;  1R6P A;  4AQI A;  4ORB B;  2JT0 A;  1YX8 A;  3H4S E;  3JVT B;  1DJZ A;  3AAK A;  1UHI A;  1B8R A;  4CFQ A;  1NCZ A;  5AFP A;  3BUN B;  4MN0 A;  1CLL A;  2BBM A;  1Y1X A;  2KQ6 A;  1CLM A;  4OR9 B;  1A03 A;  1K9K A;  1K9P A;  2KNE A;  1SKT A;  1CM1 A;  1RK9 A;  1CFF A;  2BCB A;  5GQQ C;  2WC8 A;  1F55 A;  1OMD A;  4DRW A;  1J7R A;  2I7A A;  3PN7 C;  3CR5 X;  1N0Y A;  1QVI Y;  2KI6 D;  1V1F A;  4OV2 A;  3DVK A;  2D8N A;  4GAO A;  1S6C A;  1M39 A;  2F3Y A;  1SL7 A;  2HQ8 A;  4JPZ B;  4MVF A;  5HKW A;  1ZMZ A;  3PAT A;  3SJS A;  1G33 A;  3GK4 X;  4M2Q A;  4GGF A;  2BKH B;  3D0Y A;  1DGV A;  2OTG B;  3SIB A;  5AXI A;  2LLU A;  1SCM C;  4FTG A;  1DF0 A;  2LUC A;  2JT8 A;  2VRG A;  2ZNE A;  2Q91 A;  1KFU L;  1RFJ A;  4PE7 A;  1FI5 A;  1BT6 A;  2HF5 A;  2KSP A;  1E8A A;  2EC6 C;  1YVL A;  2LP2 A;  3JVT C;  1RTP 1;  4ETO A;  2M8U A;  2HQW A;  4U8D A;  2BE4 A;  3D0Y B;  3I5G C;  1JC2 A;  2JOJ A;  2KFG A;  2OS8 B;  5AER A;  2LAN A;  1DF0 B;  2HET A;  1QVI Z;  1R2U A;  2MJW B;  3C1V A;  2K8M B;  3WHT B;  1J55 A;  2NCO A;  2AMI A;  1J1D A;  3TUY B;  1H8B A;  4I5N B;  1LA3 A;  3O4Y A;  1W7J B;  1S5G Z;  1XVJ A;  1BOD A;  2M7L A;  4C0J A;  1GQM A;  4JWQ A;  2LMU A;  3HCM A;  2M0R A;  1YR5 A;  4YGC B;  4DCK A;  4N1G A;  1MUX A;  2BL0 B;  1UP5 A;  1M63 B;  5D7F A;  1IRJ A;  1KQM C;  1QJT A;  1C7W A;  2BCA A;  1KSM A;  1SPY A;  1NCY A;  4NQG A;  2K7B A;  1K9U A;  2B1U A;  1DJG A;  4AOM A;  1REC A;  2G9B A;  2NXQ A;  2F33 A;  4OKH A;  1FPW A;  1DGU A;  1JUO A;  1YUS A;  3OHM B;  4JQ0 D;  3DVJ A;  3OB1 B;  1UUR A;  4CFR A;  2V53 A;  4ZCV A;  2K7O A;  1QAS A;  1L7Z A;  5HLO A;  2LVK A;  4QJ3 B;  2K2A A;  5PAL A;  3SG7 A;  4YRU A;  1JF0 A;  2ZN9 A;  2CBL A;  4HRG A;  1BR1 B;  1JFK A;  1X02 A;  1CLB A;  1UHN A;  2KFH A;  1IJ6 A;  2IS9 A;  1QX5 B;  1DJX A;  1PSR A;  1K95 A;  1EG4 A;  3NSL A;  3KHE A;  5HYD A;  2P6B B;  1SMG A;  2Y4Q A;  4NDB A;  3PN7 B;  3AKB A;  1F70 A;  1A75 A;  1K93 D;  2KBM A;  1M45 A;  3LL8 B;  4WQ2 A;  1LXF C;  3DVE A;  2QPT A;  3OX5 A;  3AKA A;  3CS1 A;  2JTZ A;  4ICB A;  5ER4 X;  2I94 A;  1IQ5 A;  2G2B A;  1PVA A;  1OMR A;  2JQ6 A;  2L4H A;  1WLM A;  1EJ3 A;  1M46 A;  1NSH A;  2LVI A;  1FI6 A;  4MZK A;  1A75 B;  2WOR A;  4PDZ A;  4P2Y B;  4USL A;  1UHK A;  2PAL A;  1DJI A;  1SNL A;  1SBJ A;  4XJK A;  2L50 A;  5I8N A;  1CDN A;  1YVH A;  1XFV O;  1QV1 A;  2PSR A;  1DJW A;  3I5H C;  1IWQ A;  1PAL A;  2EC6 B;  2LM5 A;  2H2K A;  5I2L A;  1G4Y R;  3GK2 A;  4MRX A;  3I5G B;  1GJY A;  1K8U A;  5CPV A;  1XFZ O;  1HT9 A;  4FQO A;  1QIW A;  4PHN A;  1AUI B;  2JC2 A;  3E3R A;  1A4P A;  4XJK B;  2PVB A;  1BJF A;  2PRU A;  1XFY O;  2MA2 A;  2F2O A;  3KF9 A;  1DMO A;  3LK1 A;  2AUC A;  1OMV A;  4D1E A;  2FCE A;  2JNX A;  2M29 A;  1OZO A;  3BOW A;  5KSZ A;  1QAT A;  2M7N A;  3ZNI A;  1OZS A;  2LUX A;  1KK7 Y;  1AJ5 A;  2RGI A;  1VRK A;  1F8H A;  3DD4 A;  3TDU A;  1OSA A;  1BOC A;  3TDZ A;  1XFW O;  5JOL A;  1FW4 A;  1KQM B;  1WDC C;  4R1E A;  2QAC A;  3VRR A;  1QS7 A;  1DT7 B;  2H61 C;  1B7T Y;  2LE9 B;  4HRH A;  1XK4 C;  1J7P A;  3BOW B;  3QRX A;  2OPO A;  3TZ1 A;  1IH0 A;  4YGD B;  1S6J A;  1TNW A;  1YX7 A;  2LNK A;  2SCP A;  2K61 A;  3BUO B;  1TIZ A;  2CTN A;  1IKU A;  3JTD C;  4GNK B;  4DS7 A;  1B8L A;  2KI4 C;  4NDC A;  2Y1M A;  5KU1 A;  1HQV A;  2CXJ A;  2M3W A;  3NSO A;  4MLW A;  5K89 A;  2EGD A;  3RLZ A;  2MLE C;  1KSO A;  1W7I B;  1TRF A;  2LHL A;  2FOT A;  1DJH A;  3O2P A;  3BQ3 A;  2K0J A;  1K96 A;  2K7D A;  1D1O A;  4MEW A;  2KDH A;  1KK7 Z;  1BR4 B;  1S1E A;  4QJ5 B;  2KBI A;  1EXR A;  1NIW A;  4A4B A;  2EHB A;  1TNP A;  1KFU S;  1CFP A;  3I5F C;  1Y6W A;  1KFX L;  3VRN A;  5DKR A;  1NCX A; 
#chains in the Genus database with same CATH topology
 1ZOT B;  3NSK A;  3RM1 A;  1AVS A;  1F71 A;  1TOP A;  3L47 A;  3VGO A;  3NHT A;  2ERB A;  1L2O C;  1SRA A;  1A29 A;  3TS5 C;  1NWD A;  1TN4 A;  3FE6 A;  1ZUZ A;  1OE9 B;  2FJU B;  2Y1N A;  1NX0 A;  3SIA A;  5IBW A;  1S6I A;  2QEH A;  5ER5 A;  2MBX A;  3VRO A;  1B9A A;  1PUL A;  1BG1 A;  1EH2 A;  1B47 A;  2QDI A;  1CB1 A;  1XFU O;  1C3Z A;  1Y0V H;  1KK8 C;  5CSF A;  2ZKM X;  1XFX O;  2DOQ A;  3KPX A;  3I5I C;  4GPL B;  3SS4 A;  4A4C A;  3PAL A;  4OCI A;  2JUL A;  4PE1 A;  3I5H B;  2ZND A;  3B6X A;  5CSI A;  5HKZ A;  3BFB A;  1N65 A;  3CZ0 A;  3DYE A;  2MAZ A;  1OOF A;  1K2H A;  2KFF A;  5FI7 A;  2BE6 A;  3EVR A;  1JBA A;  4UPG A;  1BLQ A;  1NX3 A;  4MBE A;  5J3X A;  3FWB A;  1B1G A;  4MRY A;  1LKJ A;  2LLT A;  3EVV A;  1BMO A;  1MR8 A;  1CKK A;  3DF0 A;  1JFJ A;  3Q8I A;  2BCX A;  1DTL A;  2H61 A;  2M49 B;  4N5X A;  1IG5 A;  1XK4 A;  2JZI A;  3CGA A;  3O4X A;  1IGV A;  1DQE A;  2KHN A;  2L2E A;  3M0W A;  3CWG A;  4ORC B;  5HLV A;  1Q80 A;  1FBV A;  1SR6 C;  1TNQ A;  1Z4H A;  1YUT A;  1QLS A;  1UHH A;  2YGU A;  4L9M A;  2BAP A;  3EKJ A;  3SG6 A;  1BF5 A;  3BUW B;  1B4C A;  3OX6 A;  1WDC B;  3DF0 B;  2GV5 A;  4XYN A;  2KGR A;  1C07 A;  2R2I A;  4PHJ A;  2PYQ A;  1ZFS A;  3D76 A;  1OOG A;  4N1F A;  2FJY A;  3O6B A;  4GGN A;  5G08 A;  2BBN A;  3D75 A;  1CDL A;  5I2O A;  3KEV A;  3CYZ A;  2MHH A;  2LC5 A;  3JTD B;  1K90 D;  5I94 A;  1UWO A;  1CM4 A;  2L5Y A;  2E6W A;  2KI4 B;  2LVV A;  4WQ3 A;  2JRF A;  4CLN A;  1CTR A;  1PK0 D;  2JTT A;  2ZRS A;  4M2O A;  3WNX B;  2L4I A;  3FS7 A;  3K21 A;  3BYA A;  2JXL A;  1Y1U A;  2ZN8 A;  3R1V A;  3PM8 A;  2BKI B;  3PLF B;  2MLF C;  3CZT X;  3CTN A;  4JKT A;  1MQ1 A;  2BEC A;  4C0L A;  1H4B A;  3R1P A;  3SG5 A;  1K94 A;  2CT9 A;  4MSP A;  1EG3 A;  3PSR A;  2MRD A;  1W9Z A;  1AK8 A;  1FF1 A;  4F7F A;  4M2P A;  2WC5 A;  4CPV A;  5CSJ A;  2ZFD A;  3I5F B;  3OP0 A;  5AAN A;  3PFV A;  4HSZ A;  2F8P A;  3CLN A;  1F54 A;  4PHM A;  1QLK A;  3A4U B;  2WCH A;  4MZJ A;  1LS8 A;  5DKQ A;  1TCO B;  1JSA A;  4NDD A;  1B8C A;  1L2O B;  3PJI A;  3ZWH A;  3TS5 B;  2TN4 A;  1IJ5 A;  3EKH A;  4OVN F;  4P5O E;  3SS3 A;  3IF7 A;  2F2P A;  3EK4 A;  1QIV A;  2JWW A;  1QXP A;  1QWV A;  5DKN A;  2L5X B;  1ORG A;  2KOT A;  4PE4 A;  1TCF A;  1U5I A;  1NPQ A;  1V1G A;  2LMV A;  4YI8 A;  1KK8 B;  1QX2 A;  1S36 A;  1KQV A;  1SY9 A;  3I5I B;  4MZL A;  1AHR A;  4HRE E;  3B87 A;  2KAY A;  2WCF A;  1F4O A;  1J7Q A;  4Q04 A;  2I2R E;  2NZ0 A;  1CMF A;  1JF2 A;  1YTZ C;  2LLS A;  3VRP A;  1P28 A;  1LIN A;  1GGW A;  1U5I B;  1YUR A;  2Y5I A;  3AAJ A;  1S5G Y;  3BXK A;  4PE0 A;  3CR4 X;  2JPT A;  3O78 A;  4YGB B;  1KWO C;  3F45 A;  3FE9 A;  4GUK A;  4ZCU A;  3UO9 A;  2WND A;  3BUX B;  1TNX A;  3DZT A;  2M1U A;  3LCP C;  2WCB A;  2LP3 A;  3L4A A;  2A4J A;  4AQJ A;  1RWY A;  4E68 A;  1F4Q A;  1WLZ A;  1S3P A;  1B7T Z;  1OOJ A;  3GOF A;  5HKY A;  2LMT A;  1LA0 A;  1CMG A;  1SR6 B;  2WCE A;  1C7V A;  1SCV A;  1WRZ A;  3IQQ A;  3DVM A;  4QJ4 B;  5JJG A;  4IL1 A;  4JD9 A;  4YGE B;  3S0F A;  3ICB A;  1QTX A;  3NGV A;  1MXE A;  2HPS A;  4I5J A;  2M9G A;  3CR2 A;  4IJ7 A;  5F6T A;  2CNP A;  3BUM B;  2LVJ A;  3RZS A;  5FYX A;  5KTY A;  4YI9 A;  1YRT B;  1J1E A;  1RJV A;  5B8I B;  1N2D A;  5BPJ A;  1NUB A;  1CFD A;  1NP8 A;  2CCM A;  2M97 A;  1KFX S;  1QV0 A;  1YUU A;  2KGB C;  2LCP A;  2SAS A;  1WY9 A;  5FI6 A;  3S0A A;  3MSE B;  3LK0 A;  1XO5 A;  1A2X A;  2L51 A;  2AAO A;  1SL8 A;  3NXA A;  1J7O A;  2GGZ A;  2I18 A;  3FIA A;  1OOI X;  3EK8 A;  2M1K B;  2K2F A;  4DUQ A;  2LAP A;  1JWD A;  1OQP A;  1G8I A;  1DEL A;  4I5L B;  3HX4 A;  1AJ4 A;  2WOS A;  3OB2 B;  4GBA A;  2O5G A;  2LHI A;  1SYM A;  4PCW A;  2O60 A;  2JU0 A;  2KAV A;  2PAS A;  1AP4 A;  3NSI A;  4YGA A;  1ZAC A;  3GK1 A;  2QEV A;  2OTG C;  1Z2C B;  3D10 A;  2FCD A;  1SK6 D;  2JXC A;  1MHO A;  2KYF A;  3KO0 A;  5I2Q A;  3EVU A;  1M31 A;  1UHJ A;  1OW4 A;  3SS5 A;  1NX2 A;  1TUZ A;  1PSB A;  1MXL C;  1YRU B;  1WRL A;  2KYC A;  1UUS A;  2NCP A;  2Q4U A;  4GGF C;  4C0K A;  2JNF A;  1IQ3 A;  2KAX A;  1GGZ A;  2OS8 C;  3R1O A;  3SG4 A;  1PRW A;  2L0P A;  1ALW A;  3EK7 A;  3IQO A;  3FWC A;  4WRI A;  1TTX A;  1XYD A;  1CDM A;  1EL4 A;  4GFT A;  4DIR A;  1Y1A A;  3CZ2 A;  5D69 A;  4PAL A;  3TUY C;  1CFC A;  2QEB A;  4BY5 A;  2LV7 A;  1SL9 A;  1QX7 A;  2WCL A;  3UNW A;  2ZRT A;  1S26 D;  2L98 A;  3D78 A;  2JPO A;  3DXL A;  1DJY A;  1DVI A;  2K7C A;  2QEO A;  3LLE A;  2ISD A;  4I5K A;  2KI6 C;  3WHU B;  2NLN A;  1CNP A;  4TNC A;  2F3Z A;  2GGM A;  2BL0 C;  4BY4 A;  4CID A;  1SW8 A;  3SG2 A;  1WRK A;  1BU3 A;  1KWO B;  5AEQ A;  1NX1 A;  2JT3 A;  3A8R A;  1LVC D;  5TNC A;  2PMY A;  3TDI A;  2E30 A;  1CDP A;  1ALV A;  4F0Z B;  1NYA A;  1RRO A;  1SSE B;  4ORA B;  1XA5 A;  2COL B;  4PHK A;  1SCM B;  1ODB A;  1MWN A;  1KCY A;  3SG3 A;  1PVB A;  1XFR A;  2KQY A;  4YBH B;  3WXA A;  3VRQ A;  1MF8 B;  5CSN A;  1R6P A;  3B7A A;  1GM0 A;  4AQI A;  4ORB B;  2JT0 A;  1YX8 A;  3H4S E;  3JVT B;  1DJZ A;  3AAK A;  1UHI A;  1B8R A;  4CFQ A;  3BFH A;  1NCZ A;  3CZ1 A;  5AFP A;  3BUN B;  4MN0 A;  1CLL A;  2BBM A;  1Y1X A;  2KQ6 A;  3D74 A;  1CLM A;  4OR9 B;  1A03 A;  1K9K A;  1K9P A;  2KNE A;  1SKT A;  2PQL A;  1CM1 A;  1RK9 A;  1CFF A;  2BCB A;  5GQQ C;  2WC8 A;  3L4L A;  1OMD A;  4DRW A;  1J7R A;  2I7A A;  1F55 A;  3PN7 C;  3CR5 X;  1N0Y A;  1QVI Y;  2KI6 D;  1V1F A;  1T14 A;  4OV2 A;  3NHI A;  3DVK A;  2D8N A;  4GAO A;  3DY9 A;  1S6C A;  1M39 A;  2F3Y A;  1SL7 A;  3BJH A;  2HQ8 A;  4JPZ B;  4MVF A;  5HKW A;  1ZMZ A;  2KLD A;  3D77 A;  3PAT A;  3SJS A;  1G33 A;  3GK4 X;  4M2Q A;  4GGF A;  2BKH B;  3D0Y A;  1TWO A;  1DGV A;  2OTG B;  3SIB A;  5AXI A;  3PM2 A;  1IIO A;  2LLU A;  1SCM C;  2K60 A;  4FTG A;  1DF0 A;  2L2C A;  2LUC A;  2JT8 A;  5DIC A;  2VRG A;  2ZNE A;  2Q91 A;  1KFU L;  1RFJ A;  4PE7 A;  1FI5 A;  1BT6 A;  1OOH A;  2HF5 A;  2KSP A;  1E8A A;  2EC6 C;  1YVL A;  3IVT A;  2LP2 A;  2H8V A;  2WC6 A;  1RTP 1;  3JVT C;  4ETO A;  3B88 A;  2M8U A;  2HQW A;  2P71 A;  2BE4 A;  3D0Y B;  3I5G C;  4U8D A;  2JOJ A;  1JC2 A;  2KFG A;  2WCK A;  2OS8 B;  5AER A;  2LAN A;  3VB1 A;  1DF0 B;  2HET A;  1QVI Z;  1R2U A;  2MJW B;  3C1V A;  2K8M B;  3OGN A;  3WHT B;  1J55 A;  2NCO A;  2AMI A;  4INX A;  1J1D A;  3TUY B;  3EG5 B;  4I5N B;  1LA3 A;  2WCJ A;  3O4Y A;  1H8B A;  1W7J B;  1S5G Z;  1XVJ A;  1BOD A;  2M7L A;  4C0J A;  1GQM A;  4JWQ A;  2LMU A;  3HCM A;  2M0R A;  2WCM A;  1YR5 A;  4YGC B;  3S0G A;  3CDN A;  4DCK A;  4N1G A;  2BNX A;  1MUX A;  2BL0 B;  1UP5 A;  1M63 B;  5D7F A;  1IRJ A;  1KQM C;  1QJT A;  1C7W A;  2BCA A;  1KSM A;  1SPY A;  1NCY A;  2KLE A;  4NQG A;  2K7B A;  3CAB A;  1K9U A;  2B1U A;  1DJG A;  4AOM A;  1REC A;  2G9B A;  2NXQ A;  2F33 A;  4OKH A;  1FPW A;  3S0D A;  1C3Y A;  1DGU A;  1JUO A;  1YUS A;  3OHM B;  4JQ0 D;  3DVJ A;  3OB1 B;  1UUR A;  4CFR A;  2V53 A;  4ZCV A;  2K7O A;  1QAS A;  1L7Z A;  5HLO A;  2LVK A;  4QJ3 B;  2K2A A;  5PAL A;  3SG7 A;  4YRU A;  1JF0 A;  2ZN9 A;  2CBL A;  4HRG A;  1DEK A;  1BR1 B;  1JFK A;  1TUJ A;  1X02 A;  3FE8 A;  1CLB A;  1UHN A;  2KFH A;  1IJ6 A;  2IS9 A;  1QX5 B;  1DJX A;  3OBV A;  1PSR A;  1K95 A;  1EG4 A;  3NSL A;  3KHE A;  5HYD A;  5D3O A;  2P6B B;  1SMG A;  2Y4Q A;  4NDB A;  3PN7 B;  3AKB A;  1F70 A;  1A75 A;  1K93 D;  2KBM A;  1M45 A;  3LL8 B;  4WQ2 A;  1LXF C;  3DVE A;  2QPT A;  3OX5 A;  3AKA A;  3CS1 A;  2JTZ A;  4ICB A;  3N7H A;  5ER4 X;  2I94 A;  1IQ5 A;  2G2B A;  1PVA A;  1OMR A;  2JQ6 A;  2L4H A;  1WLM A;  1EJ3 A;  1M46 A;  1NSH A;  2LVI A;  4KYN A;  1FI6 A;  4MZK A;  1A75 B;  3QME A;  2WOR A;  4PDZ A;  4P2Y B;  4USL A;  1UHK A;  2PAL A;  1DJI A;  1SNL A;  1SBJ A;  3K1E A;  2L50 A;  4XJK A;  5I8N A;  1CDN A;  1YVH A;  1XFV O;  1QV1 A;  2PSR A;  1DJW A;  3I5H C;  1IWQ A;  1PAL A;  2EC6 B;  2LM5 A;  2H2K A;  3S0E A;  5I2L A;  1G4Y R;  3GK2 A;  2P70 A;  4PT1 A;  4MRX A;  3I5G B;  1GJY A;  1K8U A;  5CPV A;  1XFZ O;  1HT9 A;  4FQO A;  1QIW A;  4PHN A;  1AUI B;  2JC2 A;  3E3R A;  1A4P A;  4XJK B;  2PVB A;  1BJF A;  2PRU A;  1XFY O;  1DC1 A;  2MA2 A;  2F2O A;  3KF9 A;  1DMO A;  3LK1 A;  4OZD A;  2AUC A;  1OMV A;  5EL2 A;  4D1E A;  2FCE A;  2JNX A;  2M29 A;  1OZO A;  3BOW A;  4FQT A;  5KSZ A;  1QAT A;  2M7N A;  3ZNI A;  1OZS A;  2LUX A;  1KK7 Y;  1AJ5 A;  2RGI A;  1VRK A;  4INW A;  1F8H A;  3DD4 A;  3TDU A;  1OSA A;  1BOC A;  3TDZ A;  1XFW O;  5JOL A;  1FW4 A;  1KQM B;  1WDC C;  4R1E A;  2QAC A;  3VRR A;  1QS7 A;  1DT7 B;  2H61 C;  1B7T Y;  2LE9 B;  4HRH A;  1XK4 C;  1J7P A;  3BOW B;  3QRX A;  2OPO A;  3TZ1 A;  1IH0 A;  4YGD B;  1S6J A;  5HL1 A;  3S0B A;  1TNW A;  1YX7 A;  2LNK A;  2SCP A;  2K61 A;  3BUO B;  1TIZ A;  2CTN A;  1IKU A;  3JTD C;  4GNK B;  3D73 A;  1B8L A;  4DS7 A;  2KI4 C;  4NDC A;  2Y1M A;  3V2L A;  5KU1 A;  1HQV A;  2CXJ A;  2M3W A;  3NSO A;  4MLW A;  5FI2 A;  5K89 A;  2EGD A;  3RLZ A;  2MLE C;  1KSO A;  1W7I B;  1TRF A;  2LHL A;  2FOT A;  1DJH A;  2GTE A;  3O2P A;  3R72 A;  3BQ3 A;  2K0J A;  1K96 A;  2K7D A;  1D1O A;  4MEW A;  2KDH A;  1KK7 Z;  1BR4 B;  1S1E A;  3B86 A;  4QJ5 B;  2KBI A;  1EXR A;  1NIW A;  2KPH A;  4A4B A;  2EHB A;  1TNP A;  1KFU S;  3BFA A;  3I5F C;  1Y6W A;  1CFP A;  1KFX L;  3VRN A;  5DKR A;  1NCX A; 
#chains in the Genus database with same CATH homology
 1ZOT B;  3NSK A;  3RM1 A;  1AVS A;  1F71 A;  1TOP A;  3VGO A;  1L2O C;  1SRA A;  1A29 A;  3TS5 C;  1NWD A;  1TN4 A;  1ZUZ A;  1OE9 B;  2FJU B;  2Y1N A;  1NX0 A;  3SIA A;  1S6I A;  5ER5 A;  2MBX A;  3VRO A;  1B9A A;  1PUL A;  1BG1 A;  1EH2 A;  1B47 A;  1CB1 A;  1XFU O;  1Y0V H;  1KK8 C;  5CSF A;  2ZKM X;  1XFX O;  2DOQ A;  3KPX A;  3I5I C;  4GPL B;  4A4C A;  3PAL A;  4OCI A;  2JUL A;  4PE1 A;  3I5H B;  2ZND A;  5CSI A;  5HKZ A;  1N65 A;  2MAZ A;  1K2H A;  2KFF A;  2BE6 A;  3EVR A;  1JBA A;  4UPG A;  1BLQ A;  1NX3 A;  4MBE A;  5J3X A;  3FWB A;  1B1G A;  4MRY A;  1LKJ A;  2LLT A;  3EVV A;  1BMO A;  1MR8 A;  1CKK A;  3DF0 A;  1JFJ A;  2BCX A;  1DTL A;  2H61 A;  2M49 B;  4N5X A;  1IG5 A;  1XK4 A;  2JZI A;  3CGA A;  1IGV A;  2KHN A;  2L2E A;  3M0W A;  4ORC B;  3CWG A;  5HLV A;  1Q80 A;  1FBV A;  1SR6 C;  1TNQ A;  1YUT A;  1QLS A;  1UHH A;  4L9M A;  3EKJ A;  3SG6 A;  1BF5 A;  3BUW B;  1B4C A;  3OX6 A;  1WDC B;  3DF0 B;  2GV5 A;  4XYN A;  2KGR A;  1C07 A;  2R2I A;  4PHJ A;  1ZFS A;  4N1F A;  3O6B A;  4GGN A;  5G08 A;  2BBN A;  1CDL A;  5I2O A;  3KEV A;  2MHH A;  2LC5 A;  3JTD B;  1K90 D;  1UWO A;  1CM4 A;  2LVV A;  2E6W A;  2KI4 B;  4WQ3 A;  2JRF A;  4CLN A;  1CTR A;  1PK0 D;  2JTT A;  2ZRS A;  4M2O A;  3WNX B;  2L4I A;  3FS7 A;  3K21 A;  3BYA A;  2JXL A;  1Y1U A;  2ZN8 A;  3PM8 A;  2BKI B;  3PLF B;  2MLF C;  3CZT X;  3CTN A;  1MQ1 A;  2BEC A;  4C0L A;  1H4B A;  3SG5 A;  1K94 A;  2CT9 A;  4MSP A;  1EG3 A;  3PSR A;  2MRD A;  1AK8 A;  1FF1 A;  4M2P A;  4CPV A;  5CSJ A;  2ZFD A;  3I5F B;  3OP0 A;  5AAN A;  3PFV A;  4HSZ A;  2F8P A;  3CLN A;  1F54 A;  4PHM A;  1QLK A;  3A4U B;  4MZJ A;  5DKQ A;  1TCO B;  1JSA A;  4NDD A;  1B8C A;  1L2O B;  3ZWH A;  3TS5 B;  2TN4 A;  1IJ5 A;  3EKH A;  4OVN F;  4P5O E;  3IF7 A;  2F2P A;  3EK4 A;  1QIV A;  2JWW A;  1QXP A;  5DKN A;  2L5X B;  2KOT A;  4PE4 A;  1TCF A;  1U5I A;  1NPQ A;  1V1G A;  2LMV A;  4YI8 A;  1KK8 B;  1QX2 A;  1S36 A;  1KQV A;  1SY9 A;  3I5I B;  4MZL A;  1AHR A;  4HRE E;  2KAY A;  2WCF A;  1F4O A;  1J7Q A;  4Q04 A;  2I2R E;  2NZ0 A;  1CMF A;  1JF2 A;  1YTZ C;  2LLS A;  3VRP A;  1LIN A;  1GGW A;  1U5I B;  1YUR A;  2Y5I A;  3AAJ A;  1S5G Y;  3BXK A;  4PE0 A;  3CR4 X;  2JPT A;  3O78 A;  4YGB B;  1KWO C;  3F45 A;  4GUK A;  4ZCU A;  2WND A;  3BUX B;  1TNX A;  2M1U A;  3LCP C;  2WCB A;  2LP3 A;  2A4J A;  4AQJ A;  1RWY A;  4E68 A;  1F4Q A;  1WLZ A;  1S3P A;  1B7T Z;  1OOJ A;  3GOF A;  5HKY A;  2LMT A;  1LA0 A;  1CMG A;  1SR6 B;  2WCE A;  1C7V A;  1SCV A;  1WRZ A;  3IQQ A;  3DVM A;  4QJ4 B;  5JJG A;  4IL1 A;  4YGE B;  3ICB A;  1QTX A;  5IBW A;  1MXE A;  2HPS A;  4I5J A;  2M9G A;  3CR2 A;  5F6T A;  2CNP A;  3BUM B;  2LVJ A;  5FYX A;  5KTY A;  4YI9 A;  1YRT B;  1J1E A;  1RJV A;  5B8I B;  1N2D A;  5BPJ A;  1NUB A;  1CFD A;  1NP8 A;  2CCM A;  2M97 A;  1KFX S;  1QV0 A;  1YUU A;  2KGB C;  2LCP A;  2SAS A;  1WY9 A;  3MSE B;  3LK0 A;  1XO5 A;  1A2X A;  2L51 A;  2AAO A;  1SL8 A;  3NXA A;  1J7O A;  2GGZ A;  2I18 A;  3FIA A;  3EK8 A;  2M1K B;  2K2F A;  4DUQ A;  2LAP A;  1JWD A;  1OQP A;  1G8I A;  4I5L B;  3HX4 A;  1AJ4 A;  2WOS A;  3OB2 B;  4GBA A;  2O5G A;  2LHI A;  1SYM A;  4PCW A;  2O60 A;  2JU0 A;  2KAV A;  2PAS A;  1AP4 A;  3NSI A;  4YGA A;  1ZAC A;  3GK1 A;  2OTG C;  3D10 A;  2FCD A;  1SK6 D;  2JXC A;  1MHO A;  2KYF A;  3KO0 A;  5I2Q A;  3EVU A;  1M31 A;  1UHJ A;  1NX2 A;  1PSB A;  1MXL C;  1YRU B;  1WRL A;  2KYC A;  1UUS A;  2NCP A;  2Q4U A;  4GGF C;  4C0K A;  2JNF A;  1IQ3 A;  2KAX A;  1GGZ A;  2OS8 C;  3SG4 A;  1PRW A;  2L0P A;  1ALW A;  3EK7 A;  3IQO A;  3FWC A;  4WRI A;  1TTX A;  1XYD A;  1CDM A;  1EL4 A;  4GFT A;  4DIR A;  1Y1A A;  5D69 A;  4PAL A;  3TUY C;  1CFC A;  4BY5 A;  2LV7 A;  1SL9 A;  1QX7 A;  2ZRT A;  1S26 D;  2L98 A;  1DJY A;  1DVI A;  2K7C A;  3LLE A;  2ISD A;  4I5K A;  2KI6 C;  3WHU B;  2NLN A;  1CNP A;  4TNC A;  2F3Z A;  2GGM A;  2BL0 C;  4BY4 A;  4CID A;  1SW8 A;  3SG2 A;  1WRK A;  1BU3 A;  1KWO B;  5AEQ A;  1NX1 A;  2JT3 A;  3A8R A;  1LVC D;  5TNC A;  2PMY A;  3TDI A;  2E30 A;  1CDP A;  1ALV A;  4F0Z B;  1NYA A;  1RRO A;  4ORA B;  4PHK A;  1XA5 A;  2COL B;  1SCM B;  1ODB A;  1MWN A;  1KCY A;  3SG3 A;  1PVB A;  2KQY A;  4YBH B;  3WXA A;  3VRQ A;  1MF8 B;  5CSN A;  1R6P A;  4AQI A;  4ORB B;  2JT0 A;  1YX8 A;  3H4S E;  3JVT B;  1DJZ A;  3AAK A;  1UHI A;  1B8R A;  4CFQ A;  1NCZ A;  5AFP A;  3BUN B;  4MN0 A;  1CLL A;  2BBM A;  1Y1X A;  2KQ6 A;  1CLM A;  4OR9 B;  1A03 A;  1K9K A;  1K9P A;  2KNE A;  1SKT A;  1CM1 A;  1RK9 A;  1CFF A;  2BCB A;  5GQQ C;  2WC8 A;  1F55 A;  1OMD A;  4DRW A;  1J7R A;  2I7A A;  3PN7 C;  3CR5 X;  1N0Y A;  1QVI Y;  2KI6 D;  1V1F A;  4OV2 A;  3DVK A;  2D8N A;  4GAO A;  1S6C A;  1M39 A;  2F3Y A;  1SL7 A;  2HQ8 A;  4JPZ B;  4MVF A;  5HKW A;  1ZMZ A;  3PAT A;  3SJS A;  1G33 A;  3GK4 X;  4M2Q A;  4GGF A;  2BKH B;  3D0Y A;  1DGV A;  2OTG B;  3SIB A;  5AXI A;  2LLU A;  1SCM C;  4FTG A;  1DF0 A;  2LUC A;  2JT8 A;  2VRG A;  2ZNE A;  2Q91 A;  1KFU L;  1RFJ A;  4PE7 A;  1FI5 A;  1BT6 A;  2HF5 A;  2KSP A;  1E8A A;  2EC6 C;  1YVL A;  2LP2 A;  3JVT C;  1RTP 1;  4ETO A;  2M8U A;  2HQW A;  4U8D A;  2BE4 A;  3D0Y B;  3I5G C;  1JC2 A;  2JOJ A;  2KFG A;  2OS8 B;  5AER A;  2LAN A;  1DF0 B;  2HET A;  1QVI Z;  1R2U A;  2MJW B;  3C1V A;  2K8M B;  3WHT B;  1J55 A;  2NCO A;  2AMI A;  1J1D A;  3TUY B;  1H8B A;  4I5N B;  1LA3 A;  3O4Y A;  1W7J B;  1S5G Z;  1XVJ A;  1BOD A;  2M7L A;  4C0J A;  1GQM A;  4JWQ A;  2LMU A;  3HCM A;  2M0R A;  1YR5 A;  4YGC B;  4DCK A;  4N1G A;  1MUX A;  2BL0 B;  1UP5 A;  1M63 B;  5D7F A;  1IRJ A;  1KQM C;  1QJT A;  1C7W A;  2BCA A;  1KSM A;  1SPY A;  1NCY A;  4NQG A;  2K7B A;  1K9U A;  2B1U A;  1DJG A;  4AOM A;  1REC A;  2G9B A;  2NXQ A;  2F33 A;  4OKH A;  1FPW A;  1DGU A;  1JUO A;  1YUS A;  3OHM B;  4JQ0 D;  3DVJ A;  3OB1 B;  1UUR A;  4CFR A;  2V53 A;  4ZCV A;  2K7O A;  1QAS A;  1L7Z A;  5HLO A;  2LVK A;  4QJ3 B;  2K2A A;  5PAL A;  3SG7 A;  4YRU A;  1JF0 A;  2ZN9 A;  2CBL A;  4HRG A;  1BR1 B;  1JFK A;  1X02 A;  1CLB A;  1UHN A;  2KFH A;  1IJ6 A;  2IS9 A;  1QX5 B;  1DJX A;  1PSR A;  1K95 A;  1EG4 A;  3NSL A;  3KHE A;  5HYD A;  2P6B B;  1SMG A;  2Y4Q A;  4NDB A;  3PN7 B;  3AKB A;  1F70 A;  1A75 A;  1K93 D;  2KBM A;  1M45 A;  3LL8 B;  4WQ2 A;  1LXF C;  3DVE A;  2QPT A;  3OX5 A;  3AKA A;  3CS1 A;  2JTZ A;  4ICB A;  5ER4 X;  2I94 A;  1IQ5 A;  2G2B A;  1PVA A;  1OMR A;  2JQ6 A;  2L4H A;  1WLM A;  1EJ3 A;  1M46 A;  1NSH A;  2LVI A;  1FI6 A;  4MZK A;  1A75 B;  2WOR A;  4PDZ A;  4P2Y B;  4USL A;  1UHK A;  2PAL A;  1DJI A;  1SNL A;  1SBJ A;  4XJK A;  2L50 A;  5I8N A;  1CDN A;  1YVH A;  1XFV O;  1QV1 A;  2PSR A;  1DJW A;  3I5H C;  1IWQ A;  1PAL A;  2EC6 B;  2LM5 A;  2H2K A;  5I2L A;  1G4Y R;  3GK2 A;  4MRX A;  3I5G B;  1GJY A;  1K8U A;  5CPV A;  1XFZ O;  1HT9 A;  4FQO A;  1QIW A;  4PHN A;  1AUI B;  2JC2 A;  3E3R A;  1A4P A;  4XJK B;  2PVB A;  1BJF A;  2PRU A;  1XFY O;  2MA2 A;  2F2O A;  3KF9 A;  1DMO A;  3LK1 A;  2AUC A;  1OMV A;  4D1E A;  2FCE A;  2JNX A;  2M29 A;  1OZO A;  3BOW A;  5KSZ A;  1QAT A;  2M7N A;  3ZNI A;  1OZS A;  2LUX A;  1KK7 Y;  1AJ5 A;  2RGI A;  1VRK A;  1F8H A;  3DD4 A;  3TDU A;  1OSA A;  1BOC A;  3TDZ A;  1XFW O;  5JOL A;  1FW4 A;  1KQM B;  1WDC C;  4R1E A;  2QAC A;  3VRR A;  1QS7 A;  1DT7 B;  2H61 C;  1B7T Y;  2LE9 B;  4HRH A;  1XK4 C;  1J7P A;  3BOW B;  3QRX A;  2OPO A;  3TZ1 A;  1IH0 A;  4YGD B;  1S6J A;  1TNW A;  1YX7 A;  2LNK A;  2SCP A;  2K61 A;  3BUO B;  1TIZ A;  2CTN A;  1IKU A;  3JTD C;  4GNK B;  4DS7 A;  1B8L A;  2KI4 C;  4NDC A;  2Y1M A;  5KU1 A;  1HQV A;  2CXJ A;  2M3W A;  3NSO A;  4MLW A;  5K89 A;  2EGD A;  3RLZ A;  2MLE C;  1KSO A;  1W7I B;  1TRF A;  2LHL A;  2FOT A;  1DJH A;  3O2P A;  3BQ3 A;  2K0J A;  1K96 A;  2K7D A;  1D1O A;  4MEW A;  2KDH A;  1KK7 Z;  1BR4 B;  1S1E A;  4QJ5 B;  2KBI A;  1EXR A;  1NIW A;  4A4B A;  2EHB A;  1TNP A;  1KFU S;  1CFP A;  3I5F C;  1Y6W A;  1KFX L;  3VRN A;  5DKR A;  1NCX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...