1YUUA

Solution structure of calcium-s100a13
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
98
structure length
98
Chain Sequence
MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S100 calcium-binding protein A13
publication title Structural Interplay between Calcium(II) and Copper(II) Binding to S100A13 Protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 34
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1yuuA00
2JU0A 1DJXA 4PE4A 1CKKA 4FTGA 2KFHA 1KQVA 2LCPA 2E6WA 1QTXA 2LP2A 4HRHA 2LMTA 2G2BA 2H61A 4QJ4B 2LAPA 4GUKA 2KYFA 3KO0A 2JQ6A 2I94A 1CDNA 4PE0A 2OTGC 2AMIA 3DF0B 3GK2A 1JF0A 2KYCA 2WOSA 2JXLA 3TDZA 3A4UB 5D7FA 1AP4A 1L2OC 1SRAA 2KBIA 1BLQA 4GGNA 2LE9B 1IG5A 2ZN9A 3FWBA 2BKHB 1OSAA 2MA2A 1SL7A 3CLNA 1TNXA 3CR4X 4A4CA 2LLUA 4P5OE 4PDZA 2KNEA 1PK0D 1ZMZA 1L7ZA 1M45A 5DKQA 2KDHA 1M63B 2KI4B 1MF8B 3TZ1A 1B47A 1YRTB 3DVJA 2Q91A 3HX4A 4GFTA 3BUMB 2K7CA 2CTNA 2M1UA 1MXLC 4PHMA 1S3PA 3D10A 3GK1A 1GQMA 2M7LA 1BOCA 3PALA 4MZJA 4ZCUA 1JWDA 1QATA 1SNLA 1AHRA 3CR5X 1CMGA 2FJUB 1JBAA 4BY4A 1YVHA 3JVTC 1QV0A 1LA3A 1BF5A 2HF5A 1DJYA 2KAYA 2L4HA 2MLFC 1N65A 2PVBA 1B1GA 4N1FA 1CTRA 4CFRA 1YRUB 1TCOB 1TNQA 3D0YA 1KCYA 1IQ5A 1K2HA 4OKHA 2ZFDA 4MRYA 2M9GA 4IL1A 1SR6B 2M3WA 1NCZA 1KSOA 3E3RA 2KAXA 1BODA 2JNXA 5D69A 1KWOC 2AAOA 3I5FB 1ODBA 1UHHA 1SYMA 2LUXA 4MSPA 3PLFB 1B9AA 1H4BA 1F54A 1PULA 1YUUA 1FF1A 1S26D 4AQJA 4DIRA 3I5IB 2JT3A 2TN4A 3BYAA 1KSMA 4M2OA 3WNXB 2BCAA 1UHNA 5GQQC 1BJFA 2L50A 1WLMA 1MWNA 5DKRA 2JTZA 1RTP1 1F4QA 1AJ4A 2ZNEA 2ZRTA 4ICBA 1PALA 2BCBA 1EXRA 1YR5A 3BOWA 3CTNA 4WQ2A 1B8LA 2K7DA 3CS1A 3WXAA 2ZN8A 1U5IA 3ICBA 1YX7A 1QXPA 1BU3A 3HCMA 3ZNIA 1CFDA 3IQQA 4HSZA 1RFJA 2JC2A 2OS8C 2MAZA 2L5XB 4N1GA 2F3YA 4FQOA 1W7IB 1JFKA 1JF2A 1SCMC 2EGDA 2A4JA 2L51A 1XFWO 1BMOA 3DD4A 3SG3A 3OX5A 1XFYO 1DGUA 1H8BA 1UHKA 4YRUA 1J55A 1TNPA 1ALVA 4F0ZB 2K61A 3VRNA 3SG5A 2P6BB 4PHKA 1M46A 4PCWA 4PE7A 2BE4A 4C0KA 1NCXA 1RECA 2LLSA 3TDUA 4PHJA 3SIAA 2QACA 1W7JB 2FCDA 5JOLA 1QLSA 1D1OA 3NXAA 3DF0A 5I8NA 2LC5A 1SBJA 5IBWA 2LLTA 1QLKA 1YVLA 3BUNB 1DF0B 4XJKA 2NZ0A 3EK4A 1NX3A 1AUIB 2JULA 1WDCC 2NLNA 4CLNA 1K9KA 3LCPC 1GGWA 3AAKA 1K93D 2I2RE 1NSHA 4MBEA 3JTDB 2NCOA 1YUSA 5I2OA 3I5HB 2PASA 2M49B 4GPLB 4UPGA 4USLA 2M7NA 3AKBA 1A4PA 1PSRA 2K7OA 1OMDA 2KHNA 1QVIY 1TTXA 3OB1B 4NDCA 2BBNA 5CSIA 1RWYA 1Y1XA 1NIWA 3CZTX 4ORBB 2BL0C 2KFGA 2GGMA 3CR2A 4JPZB 1ZUZA 2K7BA 1UWOA 2MRDA 4PALA 1J1EA 1QS7A 2WCBA 3TS5C 2PMYA 1XFUO 4TNCA 2LHLA 1SY9A 2ISDA 3SG6A 3ZWHA 1AJ5A 3SG7A 1KK7Z 1S6IA 2K2AA 4C0JA 4YBHB 3GK4X 4R1EA 3NSKA 5CSFA 2RGIA 4YI8A 2JOJA 4ZCVA 1BR4B 3O78A 5KTYA 5HKYA 2WCFA 5HLVA 3SIBA 2PALA 1A75A 5I2LA 3OHMB 1XVJA 3CGAA 1DT7B 2B1UA 4GNKB 2LMVA 2O60A 1QX7A 1K94A 4D1EA 4GBAA 1IKUA 1EL4A 1OZOA 2QPTA 2MHHA 3NSLA 1TN4A 3I5GB 1KFXS 5K89A 1J7OA 1TOPA 2Q4UA 2E30A 1XFXO 1Y1UA 2JZIA 4DCKA 3AKAA 1Y6WA 5ER4X 1CDLA 3O6BA 4HRGA 2LHIA 1SL9A 1UURA 3TUYB 1YURA 5CPVA 2GGZA 1SMGA 1GGZA 1WLZA 3OX6A 1F71A 1PVAA 2KI4C 3EVVA 1Y1AA 2KI6D 1PRWA 4YGEB 1TRFA 2I7AA 5AFPA 1IJ6A 3RLZA 1J7PA 1K90D 2K8MB 4M2QA 3WHTB 1BG1A 4MEWA 1EG3A 3EKHA 1NYAA 1K8UA 1YUTA 4NDDA 4I5KA 2K2FA 1FI6A 2LANA 2VRGA 4ORCB 1CM1A 2BCXA 2M97A 1XK4A 5HLOA 1R2UA 4OVNF 1DJWA 3IF7A 1CB1A 1IH0A 4I5LB 3DVMA 4NDBA 1EH2A 1HT9A 4YGDB 5AANA 1IQ3A 3AAJA 2F3ZA 1B8RA 2LNKA 3OB2B 3BUOB 4I5JA 1TNWA 2BE6A 4MVFA 4E68A 2JT0A 1MXEA 1YX8A 1LKJA 1ZFSA 4DUQA 1SR6C 1MR8A 1QX2A 2KAVA 1NX1A 3KHEA 2ZNDA 4GAOA 3LK0A 1KFUS 3I5FC 4Q04A 4AOMA 3BQ3A 1K9UA 3EK8A 1OQPA 2LVKA 2EC6B 2HPSA 2OPOA 2H2KA 1WRKA 4PHNA 3NSOA 1KK8B 1G8IA 3I5IC 3D0YB 1NUBA 3LK1A 3SJSA 4C0LA 1B4CA 1XA5A 1KQMB 1CFFA 1S36A 1XFVO 4MLWA 2Y4QA 4JQ0D 5KU1A 2BBMA 1CM4A 3VRQA 3PN7C 1A29A 2CNPA 2LUCA 2IS9A 1J1DA 1QASA 2KI6C 1DJHA 2EHBA 5I2QA 3CWGA 4OR9B 2Y1MA 1K9PA 1JFJA 1DVIA 2BKIB 1S5GZ 1HQVA 2MLEC 1AVSA 1F4OA 2NXQA 1CLLA 1XK4C 2CCMA 2WNDA 2MBXA 5BPJA 2LVJA 1CMFA 4PE1A 3TDIA 2JXCA 1KFUL 1BR1B 3EKJA 3PATA 4QJ3B 4YGAA 1UP5A 1PVBA 3BOWB 1XFZO 2KFFA 2LM5A 1AK8A 5DKNA 3VGOA 1QIVA 1V1FA 1ALWA 4BY5A 1JC2A 1FBVA 2OTGB 2JTTA 1QIWA 2HETA 5J3XA 4P2YB 1C7VA 2CXJA 4QJ5B 1NX0A 1X02A 1IGVA 1F55A 1L2OB 1DTLA 2JWWA 3NSIA 3LLEA 2F2OA 4OV2A 2WC8A 2F2PA 4GGFC 2HQWA 1M39A 4L9MA 2F8PA 1NX2A 4MZKA 1PSBA 3VROA 4YGBB 1CDMA 1MUXA 1TCFA 4CIDA 1FPWA 3JTDC 3WHUB 3I5HC 1JSAA 1K96A 1SK6D 2L2EA 4AQIA 1UHIA 3DVKA 1CLMA 1GJYA 4XJKB 1WRLA 3KPXA 1A2XA 3H4SE 3JVTB 1J7QA 1N0YA 3SG2A 1N2DA 3O4YA 1KK7Y 1NP8A 1G33A 2D8NA 1NPQA 3EK7A 1LINA 3BUXB 3EVRA 3C1VA 5HKWA 1CFPA 3SG4A 1J7RA 4MN0A 2M1KB 1FW4A 2KQ6A 4OCIA 2L98A 1C7WA 3K21A 1A03A 1ZACA 3FWCA 1KWOB 2SCPA 4WQ3A 2SASA 2L0PA 2JNFA 4CPVA 2AUCA 4I5NB 4ETOA 1F70A 3FIAA 2WCEA 3EVUA 1LA0A 1IRJA 1XYDA 3BXKA 3I5GC 4HREE 4YGCB 1WY9A 2M8UA 5AXIA 1NCYA 2R2IA 2PRUA 2LVVA 2LP3A 1OOJA 1B7TZ 1YTZC 2H61C 1A75B 5AERA 3RM1A 1QJTA 1KFXL 1MHOA 1QV1A 2LMUA 1OMVA 2NCPA 1G4YR 2G9BA 3VRRA 3TUYC 1SL8A 1LVCD 3M0WA 1B8CA 5CSNA 5ER5A 1S6JA 2KBMA 3QRXA 5HYDA 5FYXA 4DS7A 1OZSA 2CT9A 5HKZA 2OS8B 1F8HA 5TNCA 1RJVA 4NQGA 2KSPA 1B7TY 1Q80A 4JWQA 2HQ8A 1CNPA 1SCMB 1SPYA 2I18A 4N5XA 1QX5B 2Y1NA 3GOFA 2M29A 4MRXA 3A8RA 1DJIA 4WRIA 4U8DA 3PN7B 1S1EA 2DOQA 5CSJA 5F6TA 1DF0A 2PSRA 4XYNA 4DRWA 4GGFA 1CLBA 4YI9A 1ZOTB 1BT6A 2KGRA 3VRPA 3O2PA 2JRFA 1CFCA 3PM8A 1DGVA 1SCVA 2WORA 3LL8B 1MQ1A 4M2PA 2GV5A 1WRZA 4MZLA 5AEQA 1OE9B 3KEVA 3PSRA 2CBLA 1SKTA 3PFVA 1SW8A 5KSZA 3FS7A 1DMOA 2KOTA 1VRKA 2EC6C 1JUOA 2JPTA 1C07A 1UHJA 1WDCB 1E8AA 1OMRA 1KK8C 5JJGA 1TIZA 2LV7A 2V53A 1IJ5A 4A4BA 3OP0A 1IWQA 1KQMC 3F45A 1FI5A 2COLB 1U5IB 2JT8A 2ZKMX 1RROA 4CFQA 1S6CA 2Y5IA 2L4IA 1EG4A 1S5GY 1RK9A 1XO5A 1UUSA 3DVEA 2KQYA 2FOTA 2MJWB 2F33A 4ORAB 3MSEB 2BL0B 2BECA 2O5GA 5G08A 1EJ3A 1V1GA 1M31A 1DJGA 1Y0VH 1NWDA 3TS5B 2LVIA 2K0JA 1QVIZ 2M0RA 5B8IB 1R6PA 2FCEA 2KGBC 2ZRSA 3IQOA 1LXFC 1CDPA 3BUWB 1K95A 3KF9A 5PALA 1DJZA
chains in the Genus database with same CATH superfamily
2JU0A 1DJXA 4PE4A 3PJIA 4FTGA 2KFHA 1CKKA 1KQVA 2LCPA 2E6WA 2YGUA 1QTXA 2LP2A 4HRHA 2LMTA 2G2BA 2H61A 4QJ4B 2LAPA 4GUKA 2KYFA 3KO0A 3CDNA 2JQ6A 3R1PA 2I94A 1CDNA 4PE0A 2OTGC 2AMIA 3DF0B 1QWVA 3GK2A 1JF0A 3CZ2A 2KYCA 2WOSA 2JXLA 3TDZA 3A4UB 4INWA 5D7FA 1AP4A 5I94A 1L2OC 1TUJA 1SRAA 2KBIA 1BLQA 2PQLA 4GGNA 2LE9B 1IG5A 2ZN9A 3FWBA 2BKHB 3OGNA 3K1EA 1OSAA 2MA2A 1SL7A 3CLNA 1TNXA 3CR4X 4A4CA 2LLUA 3RZSA 3D75A 4P5OE 4PDZA 2KNEA 1PK0D 1ZMZA 1L7ZA 1M45A 5DKQA 2KDHA 1M63B 2KI4B 3SS3A 1TUZA 1MF8B 3TZ1A 1B47A 1YRTB 3DVJA 2Q91A 3HX4A 4GFTA 3IVTA 1DEKA 3BUMB 2K7CA 2CTNA 2M1UA 1MXLC 4PHMA 1S3PA 3D10A 3GK1A 1GQMA 1Z2CB 2M7LA 3PALA 4MZJA 4ZCUA 1BOCA 1JWDA 1QATA 1SNLA 1AHRA 3CR5X 1CMGA 3L47A 2FJUB 1JBAA 4BY4A 1YVHA 3JVTC 1QV0A 1LA3A 2QEBA 1BF5A 2HF5A 1DJYA 2KAYA 2L4HA 2MLFC 2WCKA 1N65A 2PVBA 1B1GA 2WCLA 2ERBA 3L4AA 1CTRA 4N1FA 4CFRA 1YRUB 4JD9A 1TCOB 1TNQA 3D0YA 1P28A 1KCYA 1IQ5A 1K2HA 4OKHA 2ZFDA 4MRYA 2M9GA 4IL1A 1DC1A 1SR6B 2M3WA 1NCZA 1KSOA 3E3RA 2KAXA 1BODA 2JNXA 5D69A 1KWOC 2AAOA 3I5FB 1ODBA 1UHHA 1SYMA 2LUXA 4MSPA 3DY9A 3PLFB 1B9AA 1H4BA 3OBVA 1F54A 1PULA 1YUUA 1FF1A 1S26D 4AQJA 4DIRA 3I5IB 2JT3A 2TN4A 3BYAA 3EG5B 1KSMA 1DELA 4M2OA 3WNXB 2BCAA 1UHNA 5GQQC 1BJFA 2L50A 1WLMA 3CZ1A 3V2LA 1MWNA 5DKRA 2JTZA 1RTP1 1F4QA 1AJ4A 2ZNEA 2ZRTA 4ICBA 1PALA 2BCBA 1EXRA 1YR5A 3BFHA 3BOWA 3CTNA 4WQ2A 1B8LA 2K7DA 2P70A 1GM0A 3CS1A 3WXAA 2ZN8A 1U5IA 3ICBA 3VB1A 1YX7A 1QXPA 1BU3A 3HCMA 3ZNIA 1CFDA 3IQQA 4HSZA 4PT1A 1RFJA 2JC2A 2OS8C 2MAZA 3B88A 4JKTA 2L5XB 4N1GA 2F3YA 3NHTA 4FQOA 1W7IB 1JFKA 3DYEA 1JF2A 1SCMC 2EGDA 2A4JA 2L51A 1XFWO 1BMOA 3DD4A 4FQTA 3SG3A 3OX5A 1XFYO 1DGUA 2PYQA 1H8BA 1UHKA 4YRUA 1J55A 1TNPA 1ALVA 4F0ZB 3D73A 2K61A 3VRNA 1C3YA 3SG5A 2P6BB 1LS8A 3B6XA 4PHKA 1M46A 4PCWA 4PE7A 2BE4A 4C0KA 1NCXA 1RECA 3S0AA 2LLSA 3TDUA 4PHJA 3SIAA 2QACA 1W7JB 2FCDA 5JOLA 1QLSA 1D1OA 3NXAA 3DF0A 5I8NA 2LC5A 2H8VA 1SBJA 5IBWA 3SS5A 2LLTA 1QLKA 1YVLA 3BUNB 1DF0B 4XJKA 2NZ0A 3EK4A 1DQEA 1AUIB 1NX3A 2JULA 1WDCC 2QEOA 2WC5A 3NHIA 5DICA 2NLNA 4CLNA 1K9KA 3LCPC 1GGWA 3AAKA 1K93D 2WC6A 2I2RE 1NSHA 4MBEA 3JTDB 2NCOA 1YUSA 1TWOA 5I2OA 3I5HB 2PASA 2M49B 3O4XA 4GPLB 4UPGA 4USLA 2M7NA 3FE9A 3AKBA 2JPOA 1A4PA 1PSRA 2K7OA 1OMDA 2KHNA 1QVIY 1TTXA 3B7AA 3OB1B 2BBNA 4NDCA 1RWYA 1Y1XA 1NIWA 3CZTX 4ORBB 5CSIA 2BL0C 3B87A 2KFGA 2GGMA 3CR2A 4JPZB 1ZUZA 2K7BA 1UWOA 2MRDA 4PALA 1J1EA 1QS7A 2WCBA 3TS5C 5HL1A 2PMYA 1XFUO 4TNCA 2LHLA 1C3ZA 1SY9A 2ISDA 3SG6A 3ZWHA 1AJ5A 3SG7A 1KK7Z 1S6IA 2K2AA 4C0JA 4F7FA 4YBHB 3GK4X 4R1EA 3NSKA 5CSFA 2RGIA 4YI8A 2JOJA 4OZDA 1BR4B 3O78A 4ZCVA 5KTYA 5HKYA 1OOHA 2WCFA 1IIOA 5HLVA 3SIBA 2PALA 1A75A 5I2LA 3OHMB 1XVJA 3CGAA 1DT7B 2B1UA 4GNKB 2LMVA 2O60A 1QX7A 1K94A 4D1EA 4GBAA 1IKUA 1EL4A 1OZOA 2QPTA 2MHHA 3NSLA 1TN4A 3I5GB 1KFXS 5K89A 5D3OA 1J7OA 1TOPA 2Q4UA 2E30A 1XFXO 1Y1UA 2JZIA 4DCKA 3AKAA 1Y6WA 5ER4X 1CDLA 3O6BA 4HRGA 2LHIA 1SL9A 1UURA 3TUYB 1YURA 5CPVA 2GGZA 1SMGA 3S0DA 1GGZA 1WLZA 3OX6A 1F71A 1PVAA 2KI4C 3EVVA 1Y1AA 2KI6D 1PRWA 4YGEB 1TRFA 2I7AA 5AFPA 1IJ6A 3RLZA 1J7PA 1K90D 2K8MB 4M2QA 3WHTB 2L5YA 1BG1A 4MEWA 1EG3A 3EKHA 1NYAA 1XFRA 1K8UA 1YUTA 3FE8A 4I5KA 4NDDA 2K2FA 1FI6A 2LANA 2VRGA 4ORCB 1CM1A 2BCXA 2M97A 1XK4A 5HLOA 1R2UA 4OVNF 1DJWA 3IF7A 2K60A 1CB1A 1IH0A 4I5LB 3DVMA 4NDBA 1EH2A 1HT9A 4YGDB 5AANA 1IQ3A 3AAJA 2F3ZA 1B8RA 2LNKA 3OB2B 3BUOB 2BAPA 1TNWA 2BE6A 4I5JA 4MVFA 4E68A 2JT0A 1MXEA 1YX8A 1LKJA 1ZFSA 4DUQA 1SR6C 1MR8A 1QX2A 2KAVA 1NX1A 3KHEA 2ZNDA 4GAOA 3LK0A 1KFUS 3I5FC 4Q04A 4AOMA 3BQ3A 1K9UA 3EK8A 1OQPA 2LVKA 2EC6B 2HPSA 2OPOA 2H2KA 1WRKA 2KLDA 3NSOA 4PHNA 1KK8B 1G8IA 1T14A 3I5IC 3D0YB 1NUBA 3LK1A 3QMEA 3SJSA 4C0LA 2FJYA 1B4CA 1XA5A 2QEHA 1KQMB 1CFFA 1S36A 1XFVO 4MLWA 2Y4QA 4JQ0D 5KU1A 2BBMA 1CM4A 3VRQA 3PN7C 1A29A 2CNPA 2LUCA 2IS9A 1J1DA 1QASA 2KI6C 1DJHA 2EHBA 5I2QA 3CWGA 4OR9B 2Y1MA 1K9PA 4INXA 1JFJA 3BFAA 1DVIA 2BKIB 1S5GZ 3S0EA 3CABA 1HQVA 2MLEC 1AVSA 1F4OA 2NXQA 1CLLA 1XK4C 3SS4A 2CCMA 2WNDA 2MBXA 5BPJA 2LVJA 1CMFA 4PE1A 3TDIA 2JXCA 1KFUL 1BR1B 3EKJA 3PATA 4QJ3B 4YGAA 1UP5A 1PVBA 3BOWB 1XFZO 2KFFA 2LM5A 1AK8A 5DKNA 3VGOA 1QIVA 1V1FA 1ALWA 2KLEA 4BY5A 1JC2A 1FBVA 2OTGB 3DZTA 2JTTA 1QIWA 2HETA 5FI2A 5J3XA 4P2YB 1C7VA 2CXJA 4QJ5B 1NX0A 1X02A 1IGVA 2GTEA 1L2OB 1F55A 1DTLA 2JWWA 3NSIA 3LLEA 1OOIX 2F2OA 4OV2A 3DXLA 2WC8A 2F2PA 4GGFC 1OOFA 2HQWA 1M39A 2WCJA 4L9MA 2F8PA 1NX2A 4MZKA 1PSBA 3VROA 4YGBB 1CDMA 1MUXA 3D76A 2QEVA 1TCFA 4CIDA 1FPWA 3Q8IA 3JTDC 3WHUB 3I5HC 1JSAA 1K96A 1SK6D 3CZ0A 2L2EA 4AQIA 1ORGA 1UHIA 3DVKA 1CLMA 1GJYA 3BFBA 4XJKB 1WRLA 3KPXA 1A2XA 1OOGA 3H4SE 3JVTB 1J7QA 1N0YA 3SG2A 1N2DA 3O4YA 1KK7Y 1NP8A 1G33A 2D8NA 1NPQA 3EK7A 1LINA 3BUXB 3EVRA 3C1VA 3D74A 5HKWA 1CFPA 3SG4A 1J7RA 4MN0A 1Z4HA 5FI7A 2M1KB 1FW4A 2KQ6A 4OCIA 2L98A 1C7WA 3K21A 1A03A 1ZACA 3FWCA 1KWOB 2SCPA 4WQ3A 2SASA 2L0PA 2JNFA 4CPVA 2AUCA 4I5NB 4ETOA 1F70A 3FIAA 2WCEA 3EVUA 1LA0A 1IRJA 1XYDA 3BXKA 3I5GC 4HREE 4YGCB 1WY9A 2M8UA 5AXIA 1NCYA 2R2IA 2PRUA 2LVVA 2LP3A 1OOJA 1B7TZ 1YTZC 2H61C 1A75B 5AERA 3RM1A 1QJTA 2BNXA 1KFXL 5FI6A 3S0GA 1MHOA 1QV1A 2LMUA 1OMVA 2NCPA 1G4YR 2G9BA 3R1OA 3PM2A 1SL8A 3VRRA 3TUYC 1LVCD 3M0WA 1B8CA 5CSNA 5ER5A 1S6JA 2KBMA 3QRXA 5HYDA 5FYXA 4DS7A 1OZSA 3CYZA 2CT9A 5HKZA 2OS8B 1F8HA 5TNCA 1RJVA 4NQGA 3R72A 2KSPA 1B7TY 2WCHA 1Q80A 4JWQA 2HQ8A 1CNPA 1SCMB 1SPYA 2I18A 4N5XA 1QX5B 2Y1NA 3GOFA 2M29A 4MRXA 3A8RA 3S0BA 1DJIA 2WCMA 1W9ZA 4WRIA 4U8DA 3D77A 1S1EA 2DOQA 3PN7B 5CSJA 1DF0A 2PSRA 5EL2A 4XYNA 5F6TA 4GGFA 4DRWA 4YI9A 1CLBA 2L2CA 1ZOTB 1BT6A 2KGRA 3VRPA 3O2PA 2JRFA 3BJHA 1CFCA 3PM8A 1DGVA 1SCVA 2WORA 3LL8B 1MQ1A 4M2PA 2GV5A 1WRZA 4MZLA 5AEQA 3UNWA 1OE9B 3KEVA 3L4LA 2CBLA 3PSRA 1SKTA 3PFVA 1SW8A 5KSZA 3FS7A 3D78A 1DMOA 3FE6A 2KOTA 1VRKA 2EC6C 1JUOA 2JPTA 1C07A 1UHJA 1WDCB 1E8AA 1OMRA 1KK8C 2QDIA 5JJGA 1TIZA 2LV7A 2V53A 1IJ5A 4A4BA 3OP0A 1IWQA 4IJ7A 1KQMC 1SSEB 3F45A 3R1VA 1FI5A 2COLB 1U5IB 2JT8A 2ZKMX 1RROA 4CFQA 1S6CA 2Y5IA 2L4IA 1EG4A 2KPHA 1S5GY 1RK9A 4KYNA 1XO5A 1UUSA 3DVEA 2KQYA 2FOTA 2MJWB 2F33A 3B86A 4ORAB 3S0FA 3MSEB 2BL0B 2BECA 2O5GA 5G08A 1EJ3A 3N7HA 1V1GA 1M31A 1DJGA 1Y0VH 1NWDA 3UO9A 3TS5B 2LVIA 2K0JA 1QVIZ 2M0RA 5B8IB 1R6PA 2FCEA 2KGBC 2ZRSA 3IQOA 1OW4A 2P71A 3NGVA 1LXFC 1CDPA 3BUWB 1K95A 3KF9A 5PALA 1DJZA
chains in the Genus database with same CATH topology
2JU0A 1DJXA 4PE4A 1CKKA 4FTGA 2KFHA 1KQVA 2LCPA 2E6WA 1QTXA 2LP2A 4HRHA 2LMTA 2G2BA 2H61A 4QJ4B 2LAPA 4GUKA 2KYFA 3KO0A 2JQ6A 2I94A 1CDNA 4PE0A 2OTGC 2AMIA 3DF0B 3GK2A 1JF0A 2KYCA 2WOSA 2JXLA 3TDZA 3A4UB 5D7FA 1AP4A 1L2OC 1SRAA 2KBIA 1BLQA 4GGNA 2LE9B 1IG5A 2ZN9A 3FWBA 2BKHB 1OSAA 2MA2A 1SL7A 3CLNA 1TNXA 3CR4X 4A4CA 2LLUA 4P5OE 4PDZA 2KNEA 1PK0D 1ZMZA 1L7ZA 1M45A 5DKQA 2KDHA 1M63B 2KI4B 1MF8B 3TZ1A 1B47A 1YRTB 3DVJA 2Q91A 3HX4A 4GFTA 3BUMB 2K7CA 2CTNA 2M1UA 1MXLC 4PHMA 1S3PA 3D10A 3GK1A 1GQMA 2M7LA 1BOCA 3PALA 4MZJA 4ZCUA 1JWDA 1QATA 1SNLA 1AHRA 3CR5X 1CMGA 2FJUB 1JBAA 4BY4A 1YVHA 3JVTC 1QV0A 1LA3A 1BF5A 2HF5A 1DJYA 2KAYA 2L4HA 2MLFC 1N65A 2PVBA 1B1GA 4N1FA 1CTRA 4CFRA 1YRUB 1TCOB 1TNQA 3D0YA 1KCYA 1IQ5A 1K2HA 4OKHA 2ZFDA 4MRYA 2M9GA 4IL1A 1SR6B 2M3WA 1NCZA 1KSOA 3E3RA 2KAXA 1BODA 2JNXA 5D69A 1KWOC 2AAOA 3I5FB 1ODBA 1UHHA 1SYMA 2LUXA 4MSPA 3PLFB 1B9AA 1H4BA 1F54A 1PULA 1YUUA 1FF1A 1S26D 4AQJA 4DIRA 3I5IB 2JT3A 2TN4A 3BYAA 1KSMA 4M2OA 3WNXB 2BCAA 1UHNA 5GQQC 1BJFA 2L50A 1WLMA 1MWNA 5DKRA 2JTZA 1RTP1 1F4QA 1AJ4A 2ZNEA 2ZRTA 4ICBA 1PALA 2BCBA 1EXRA 1YR5A 3BOWA 3CTNA 4WQ2A 1B8LA 2K7DA 3CS1A 3WXAA 2ZN8A 1U5IA 3ICBA 1YX7A 1QXPA 1BU3A 3HCMA 3ZNIA 1CFDA 3IQQA 4HSZA 1RFJA 2JC2A 2OS8C 2MAZA 2L5XB 4N1GA 2F3YA 4FQOA 1W7IB 1JFKA 1JF2A 1SCMC 2EGDA 2A4JA 2L51A 1XFWO 1BMOA 3DD4A 3SG3A 3OX5A 1XFYO 1DGUA 1H8BA 1UHKA 4YRUA 1J55A 1TNPA 1ALVA 4F0ZB 2K61A 3VRNA 3SG5A 2P6BB 4PHKA 1M46A 4PCWA 4PE7A 2BE4A 4C0KA 1NCXA 1RECA 2LLSA 3TDUA 4PHJA 3SIAA 2QACA 1W7JB 2FCDA 5JOLA 1QLSA 1D1OA 3NXAA 3DF0A 5I8NA 2LC5A 1SBJA 5IBWA 2LLTA 1QLKA 1YVLA 3BUNB 1DF0B 4XJKA 2NZ0A 3EK4A 1NX3A 1AUIB 2JULA 1WDCC 2NLNA 4CLNA 1K9KA 3LCPC 1GGWA 3AAKA 1K93D 2I2RE 1NSHA 4MBEA 3JTDB 2NCOA 1YUSA 5I2OA 3I5HB 2PASA 2M49B 4GPLB 4UPGA 4USLA 2M7NA 3AKBA 1A4PA 1PSRA 2K7OA 1OMDA 2KHNA 1QVIY 1TTXA 3OB1B 4NDCA 2BBNA 5CSIA 1RWYA 1Y1XA 1NIWA 3CZTX 4ORBB 2BL0C 2KFGA 2GGMA 3CR2A 4JPZB 1ZUZA 2K7BA 1UWOA 2MRDA 4PALA 1J1EA 1QS7A 2WCBA 3TS5C 2PMYA 1XFUO 4TNCA 2LHLA 1SY9A 2ISDA 3SG6A 3ZWHA 1AJ5A 3SG7A 1KK7Z 1S6IA 2K2AA 4C0JA 4YBHB 3GK4X 4R1EA 3NSKA 5CSFA 2RGIA 4YI8A 2JOJA 4ZCVA 1BR4B 3O78A 5KTYA 5HKYA 2WCFA 5HLVA 3SIBA 2PALA 1A75A 5I2LA 3OHMB 1XVJA 3CGAA 1DT7B 2B1UA 4GNKB 2LMVA 2O60A 1QX7A 1K94A 4D1EA 4GBAA 1IKUA 1EL4A 1OZOA 2QPTA 2MHHA 3NSLA 1TN4A 3I5GB 1KFXS 5K89A 1J7OA 1TOPA 2Q4UA 2E30A 1XFXO 1Y1UA 2JZIA 4DCKA 3AKAA 1Y6WA 5ER4X 1CDLA 3O6BA 4HRGA 2LHIA 1SL9A 1UURA 3TUYB 1YURA 5CPVA 2GGZA 1SMGA 1GGZA 1WLZA 3OX6A 1F71A 1PVAA 2KI4C 3EVVA 1Y1AA 2KI6D 1PRWA 4YGEB 1TRFA 2I7AA 5AFPA 1IJ6A 3RLZA 1J7PA 1K90D 2K8MB 4M2QA 3WHTB 1BG1A 4MEWA 1EG3A 3EKHA 1NYAA 1K8UA 1YUTA 4NDDA 4I5KA 2K2FA 1FI6A 2LANA 2VRGA 4ORCB 1CM1A 2BCXA 2M97A 1XK4A 5HLOA 1R2UA 4OVNF 1DJWA 3IF7A 1CB1A 1IH0A 4I5LB 3DVMA 4NDBA 1EH2A 1HT9A 4YGDB 5AANA 1IQ3A 3AAJA 2F3ZA 1B8RA 2LNKA 3OB2B 3BUOB 4I5JA 1TNWA 2BE6A 4MVFA 4E68A 2JT0A 1MXEA 1YX8A 1LKJA 1ZFSA 4DUQA 1SR6C 1MR8A 1QX2A 2KAVA 1NX1A 3KHEA 2ZNDA 4GAOA 3LK0A 1KFUS 3I5FC 4Q04A 4AOMA 3BQ3A 1K9UA 3EK8A 1OQPA 2LVKA 2EC6B 2HPSA 2OPOA 2H2KA 1WRKA 4PHNA 3NSOA 1KK8B 1G8IA 3I5IC 3D0YB 1NUBA 3LK1A 3SJSA 4C0LA 1B4CA 1XA5A 1KQMB 1CFFA 1S36A 1XFVO 4MLWA 2Y4QA 4JQ0D 5KU1A 2BBMA 1CM4A 3VRQA 3PN7C 1A29A 2CNPA 2LUCA 2IS9A 1J1DA 1QASA 2KI6C 1DJHA 2EHBA 5I2QA 3CWGA 4OR9B 2Y1MA 1K9PA 1JFJA 1DVIA 2BKIB 1S5GZ 1HQVA 2MLEC 1AVSA 1F4OA 2NXQA 1CLLA 1XK4C 2CCMA 2WNDA 2MBXA 5BPJA 2LVJA 1CMFA 4PE1A 3TDIA 2JXCA 1KFUL 1BR1B 3EKJA 3PATA 4QJ3B 4YGAA 1UP5A 1PVBA 3BOWB 1XFZO 2KFFA 2LM5A 1AK8A 5DKNA 3VGOA 1QIVA 1V1FA 1ALWA 4BY5A 1JC2A 1FBVA 2OTGB 2JTTA 1QIWA 2HETA 5J3XA 4P2YB 1C7VA 2CXJA 4QJ5B 1NX0A 1X02A 1IGVA 1F55A 1L2OB 1DTLA 2JWWA 3NSIA 3LLEA 2F2OA 4OV2A 2WC8A 2F2PA 4GGFC 2HQWA 1M39A 4L9MA 2F8PA 1NX2A 4MZKA 1PSBA 3VROA 4YGBB 1CDMA 1MUXA 1TCFA 4CIDA 1FPWA 3JTDC 3WHUB 3I5HC 1JSAA 1K96A 1SK6D 2L2EA 4AQIA 1UHIA 3DVKA 1CLMA 1GJYA 4XJKB 1WRLA 3KPXA 1A2XA 3H4SE 3JVTB 1J7QA 1N0YA 3SG2A 1N2DA 3O4YA 1KK7Y 1NP8A 1G33A 2D8NA 1NPQA 3EK7A 1LINA 3BUXB 3EVRA 3C1VA 5HKWA 1CFPA 3SG4A 1J7RA 4MN0A 2M1KB 1FW4A 2KQ6A 4OCIA 2L98A 1C7WA 3K21A 1A03A 1ZACA 3FWCA 1KWOB 2SCPA 4WQ3A 2SASA 2L0PA 2JNFA 4CPVA 2AUCA 4I5NB 4ETOA 1F70A 3FIAA 2WCEA 3EVUA 1LA0A 1IRJA 1XYDA 3BXKA 3I5GC 4HREE 4YGCB 1WY9A 2M8UA 5AXIA 1NCYA 2R2IA 2PRUA 2LVVA 2LP3A 1OOJA 1B7TZ 1YTZC 2H61C 1A75B 5AERA 3RM1A 1QJTA 1KFXL 1MHOA 1QV1A 2LMUA 1OMVA 2NCPA 1G4YR 2G9BA 3VRRA 3TUYC 1SL8A 1LVCD 3M0WA 1B8CA 5CSNA 5ER5A 1S6JA 2KBMA 3QRXA 5HYDA 5FYXA 4DS7A 1OZSA 2CT9A 5HKZA 2OS8B 1F8HA 5TNCA 1RJVA 4NQGA 2KSPA 1B7TY 1Q80A 4JWQA 2HQ8A 1CNPA 1SCMB 1SPYA 2I18A 4N5XA 1QX5B 2Y1NA 3GOFA 2M29A 4MRXA 3A8RA 1DJIA 4WRIA 4U8DA 3PN7B 1S1EA 2DOQA 5CSJA 5F6TA 1DF0A 2PSRA 4XYNA 4DRWA 4GGFA 1CLBA 4YI9A 1ZOTB 1BT6A 2KGRA 3VRPA 3O2PA 2JRFA 1CFCA 3PM8A 1DGVA 1SCVA 2WORA 3LL8B 1MQ1A 4M2PA 2GV5A 1WRZA 4MZLA 5AEQA 1OE9B 3KEVA 3PSRA 2CBLA 1SKTA 3PFVA 1SW8A 5KSZA 3FS7A 1DMOA 2KOTA 1VRKA 2EC6C 1JUOA 2JPTA 1C07A 1UHJA 1WDCB 1E8AA 1OMRA 1KK8C 5JJGA 1TIZA 2LV7A 2V53A 1IJ5A 4A4BA 3OP0A 1IWQA 1KQMC 3F45A 1FI5A 2COLB 1U5IB 2JT8A 2ZKMX 1RROA 4CFQA 1S6CA 2Y5IA 2L4IA 1EG4A 1S5GY 1RK9A 1XO5A 1UUSA 3DVEA 2KQYA 2FOTA 2MJWB 2F33A 4ORAB 3MSEB 2BL0B 2BECA 2O5GA 5G08A 1EJ3A 1V1GA 1M31A 1DJGA 1Y0VH 1NWDA 3TS5B 2LVIA 2K0JA 1QVIZ 2M0RA 5B8IB 1R6PA 2FCEA 2KGBC 2ZRSA 3IQOA 1LXFC 1CDPA 3BUWB 1K95A 3KF9A 5PALA 1DJZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JU0 A;  1DJX A;  4PE4 A;  1CKK A;  4FTG A;  2KFH A;  1KQV A;  2LCP A;  2E6W A;  1QTX A;  2LP2 A;  4HRH A;  2LMT A;  2G2B A;  2H61 A;  4QJ4 B;  2LAP A;  4GUK A;  2KYF A;  3KO0 A;  2JQ6 A;  2I94 A;  1CDN A;  4PE0 A;  2OTG C;  2AMI A;  3DF0 B;  3GK2 A;  1JF0 A;  2KYC A;  2WOS A;  2JXL A;  3TDZ A;  3A4U B;  5D7F A;  1AP4 A;  1L2O C;  1SRA A;  2KBI A;  1BLQ A;  4GGN A;  2LE9 B;  1IG5 A;  2ZN9 A;  3FWB A;  2BKH B;  1OSA A;  2MA2 A;  1SL7 A;  3CLN A;  1TNX A;  3CR4 X;  4A4C A;  2LLU A;  4P5O E;  4PDZ A;  2KNE A;  1PK0 D;  1ZMZ A;  1L7Z A;  1M45 A;  5DKQ A;  2KDH A;  1M63 B;  2KI4 B;  1MF8 B;  3TZ1 A;  1B47 A;  1YRT B;  3DVJ A;  2Q91 A;  3HX4 A;  4GFT A;  3BUM B;  2K7C A;  2CTN A;  2M1U A;  1MXL C;  4PHM A;  1S3P A;  3D10 A;  3GK1 A;  1GQM A;  2M7L A;  1BOC A;  3PAL A;  4MZJ A;  4ZCU A;  1JWD A;  1QAT A;  1SNL A;  1AHR A;  3CR5 X;  1CMG A;  2FJU B;  1JBA A;  4BY4 A;  1YVH A;  3JVT C;  1QV0 A;  1LA3 A;  1BF5 A;  2HF5 A;  1DJY A;  2KAY A;  2L4H A;  2MLF C;  1N65 A;  2PVB A;  1B1G A;  4N1F A;  1CTR A;  4CFR A;  1YRU B;  1TCO B;  1TNQ A;  3D0Y A;  1KCY A;  1IQ5 A;  1K2H A;  4OKH A;  2ZFD A;  4MRY A;  2M9G A;  4IL1 A;  1SR6 B;  2M3W A;  1NCZ A;  1KSO A;  3E3R A;  2KAX A;  1BOD A;  2JNX A;  5D69 A;  1KWO C;  2AAO A;  3I5F B;  1ODB A;  1UHH A;  1SYM A;  2LUX A;  4MSP A;  3PLF B;  1B9A A;  1H4B A;  1F54 A;  1PUL A;  1YUU A;  1FF1 A;  1S26 D;  4AQJ A;  4DIR A;  3I5I B;  2JT3 A;  2TN4 A;  3BYA A;  1KSM A;  4M2O A;  3WNX B;  2BCA A;  1UHN A;  5GQQ C;  1BJF A;  2L50 A;  1WLM A;  1MWN A;  5DKR A;  2JTZ A;  1RTP 1;  1F4Q A;  1AJ4 A;  2ZNE A;  2ZRT A;  4ICB A;  1PAL A;  2BCB A;  1EXR A;  1YR5 A;  3BOW A;  3CTN A;  4WQ2 A;  1B8L A;  2K7D A;  3CS1 A;  3WXA A;  2ZN8 A;  1U5I A;  3ICB A;  1YX7 A;  1QXP A;  1BU3 A;  3HCM A;  3ZNI A;  1CFD A;  3IQQ A;  4HSZ A;  1RFJ A;  2JC2 A;  2OS8 C;  2MAZ A;  2L5X B;  4N1G A;  2F3Y A;  4FQO A;  1W7I B;  1JFK A;  1JF2 A;  1SCM C;  2EGD A;  2A4J A;  2L51 A;  1XFW O;  1BMO A;  3DD4 A;  3SG3 A;  3OX5 A;  1XFY O;  1DGU A;  1H8B A;  1UHK A;  4YRU A;  1J55 A;  1TNP A;  1ALV A;  4F0Z B;  2K61 A;  3VRN A;  3SG5 A;  2P6B B;  4PHK A;  1M46 A;  4PCW A;  4PE7 A;  2BE4 A;  4C0K A;  1NCX A;  1REC A;  2LLS A;  3TDU A;  4PHJ A;  3SIA A;  2QAC A;  1W7J B;  2FCD A;  5JOL A;  1QLS A;  1D1O A;  3NXA A;  3DF0 A;  5I8N A;  2LC5 A;  1SBJ A;  5IBW A;  2LLT A;  1QLK A;  1YVL A;  3BUN B;  1DF0 B;  4XJK A;  2NZ0 A;  3EK4 A;  1NX3 A;  1AUI B;  2JUL A;  1WDC C;  2NLN A;  4CLN A;  1K9K A;  3LCP C;  1GGW A;  3AAK A;  1K93 D;  2I2R E;  1NSH A;  4MBE A;  3JTD B;  2NCO A;  1YUS A;  5I2O A;  3I5H B;  2PAS A;  2M49 B;  4GPL B;  4UPG A;  4USL A;  2M7N A;  3AKB A;  1A4P A;  1PSR A;  2K7O A;  1OMD A;  2KHN A;  1QVI Y;  1TTX A;  3OB1 B;  4NDC A;  2BBN A;  5CSI A;  1RWY A;  1Y1X A;  1NIW A;  3CZT X;  4ORB B;  2BL0 C;  2KFG A;  2GGM A;  3CR2 A;  4JPZ B;  1ZUZ A;  2K7B A;  1UWO A;  2MRD A;  4PAL A;  1J1E A;  1QS7 A;  2WCB A;  3TS5 C;  2PMY A;  1XFU O;  4TNC A;  2LHL A;  1SY9 A;  2ISD A;  3SG6 A;  3ZWH A;  1AJ5 A;  3SG7 A;  1KK7 Z;  1S6I A;  2K2A A;  4C0J A;  4YBH B;  3GK4 X;  4R1E A;  3NSK A;  5CSF A;  2RGI A;  4YI8 A;  2JOJ A;  4ZCV A;  1BR4 B;  3O78 A;  5KTY A;  5HKY A;  2WCF A;  5HLV A;  3SIB A;  2PAL A;  1A75 A;  5I2L A;  3OHM B;  1XVJ A;  3CGA A;  1DT7 B;  2B1U A;  4GNK B;  2LMV A;  2O60 A;  1QX7 A;  1K94 A;  4D1E A;  4GBA A;  1IKU A;  1EL4 A;  1OZO A;  2QPT A;  2MHH A;  3NSL A;  1TN4 A;  3I5G B;  1KFX S;  5K89 A;  1J7O A;  1TOP A;  2Q4U A;  2E30 A;  1XFX O;  1Y1U A;  2JZI A;  4DCK A;  3AKA A;  1Y6W A;  5ER4 X;  1CDL A;  3O6B A;  4HRG A;  2LHI A;  1SL9 A;  1UUR A;  3TUY B;  1YUR A;  5CPV A;  2GGZ A;  1SMG A;  1GGZ A;  1WLZ A;  3OX6 A;  1F71 A;  1PVA A;  2KI4 C;  3EVV A;  1Y1A A;  2KI6 D;  1PRW A;  4YGE B;  1TRF A;  2I7A A;  5AFP A;  1IJ6 A;  3RLZ A;  1J7P A;  1K90 D;  2K8M B;  4M2Q A;  3WHT B;  1BG1 A;  4MEW A;  1EG3 A;  3EKH A;  1NYA A;  1K8U A;  1YUT A;  4NDD A;  4I5K A;  2K2F A;  1FI6 A;  2LAN A;  2VRG A;  4ORC B;  1CM1 A;  2BCX A;  2M97 A;  1XK4 A;  5HLO A;  1R2U A;  4OVN F;  1DJW A;  3IF7 A;  1CB1 A;  1IH0 A;  4I5L B;  3DVM A;  4NDB A;  1EH2 A;  1HT9 A;  4YGD B;  5AAN A;  1IQ3 A;  3AAJ A;  2F3Z A;  1B8R A;  2LNK A;  3OB2 B;  3BUO B;  4I5J A;  1TNW A;  2BE6 A;  4MVF A;  4E68 A;  2JT0 A;  1MXE A;  1YX8 A;  1LKJ A;  1ZFS A;  4DUQ A;  1SR6 C;  1MR8 A;  1QX2 A;  2KAV A;  1NX1 A;  3KHE A;  2ZND A;  4GAO A;  3LK0 A;  1KFU S;  3I5F C;  4Q04 A;  4AOM A;  3BQ3 A;  1K9U A;  3EK8 A;  1OQP A;  2LVK A;  2EC6 B;  2HPS A;  2OPO A;  2H2K A;  1WRK A;  4PHN A;  3NSO A;  1KK8 B;  1G8I A;  3I5I C;  3D0Y B;  1NUB A;  3LK1 A;  3SJS A;  4C0L A;  1B4C A;  1XA5 A;  1KQM B;  1CFF A;  1S36 A;  1XFV O;  4MLW A;  2Y4Q A;  4JQ0 D;  5KU1 A;  2BBM A;  1CM4 A;  3VRQ A;  3PN7 C;  1A29 A;  2CNP A;  2LUC A;  2IS9 A;  1J1D A;  1QAS A;  2KI6 C;  1DJH A;  2EHB A;  5I2Q A;  3CWG A;  4OR9 B;  2Y1M A;  1K9P A;  1JFJ A;  1DVI A;  2BKI B;  1S5G Z;  1HQV A;  2MLE C;  1AVS A;  1F4O A;  2NXQ A;  1CLL A;  1XK4 C;  2CCM A;  2WND A;  2MBX A;  5BPJ A;  2LVJ A;  1CMF A;  4PE1 A;  3TDI A;  2JXC A;  1KFU L;  1BR1 B;  3EKJ A;  3PAT A;  4QJ3 B;  4YGA A;  1UP5 A;  1PVB A;  3BOW B;  1XFZ O;  2KFF A;  2LM5 A;  1AK8 A;  5DKN A;  3VGO A;  1QIV A;  1V1F A;  1ALW A;  4BY5 A;  1JC2 A;  1FBV A;  2OTG B;  2JTT A;  1QIW A;  2HET A;  5J3X A;  4P2Y B;  1C7V A;  2CXJ A;  4QJ5 B;  1NX0 A;  1X02 A;  1IGV A;  1F55 A;  1L2O B;  1DTL A;  2JWW A;  3NSI A;  3LLE A;  2F2O A;  4OV2 A;  2WC8 A;  2F2P A;  4GGF C;  2HQW A;  1M39 A;  4L9M A;  2F8P A;  1NX2 A;  4MZK A;  1PSB A;  3VRO A;  4YGB B;  1CDM A;  1MUX A;  1TCF A;  4CID A;  1FPW A;  3JTD C;  3WHU B;  3I5H C;  1JSA A;  1K96 A;  1SK6 D;  2L2E A;  4AQI A;  1UHI A;  3DVK A;  1CLM A;  1GJY A;  4XJK B;  1WRL A;  3KPX A;  1A2X A;  3H4S E;  3JVT B;  1J7Q A;  1N0Y A;  3SG2 A;  1N2D A;  3O4Y A;  1KK7 Y;  1NP8 A;  1G33 A;  2D8N A;  1NPQ A;  3EK7 A;  1LIN A;  3BUX B;  3EVR A;  3C1V A;  5HKW A;  1CFP A;  3SG4 A;  1J7R A;  4MN0 A;  2M1K B;  1FW4 A;  2KQ6 A;  4OCI A;  2L98 A;  1C7W A;  3K21 A;  1A03 A;  1ZAC A;  3FWC A;  1KWO B;  2SCP A;  4WQ3 A;  2SAS A;  2L0P A;  2JNF A;  4CPV A;  2AUC A;  4I5N B;  4ETO A;  1F70 A;  3FIA A;  2WCE A;  3EVU A;  1LA0 A;  1IRJ A;  1XYD A;  3BXK A;  3I5G C;  4HRE E;  4YGC B;  1WY9 A;  2M8U A;  5AXI A;  1NCY A;  2R2I A;  2PRU A;  2LVV A;  2LP3 A;  1OOJ A;  1B7T Z;  1YTZ C;  2H61 C;  1A75 B;  5AER A;  3RM1 A;  1QJT A;  1KFX L;  1MHO A;  1QV1 A;  2LMU A;  1OMV A;  2NCP A;  1G4Y R;  2G9B A;  3VRR A;  3TUY C;  1SL8 A;  1LVC D;  3M0W A;  1B8C A;  5CSN A;  5ER5 A;  1S6J A;  2KBM A;  3QRX A;  5HYD A;  5FYX A;  4DS7 A;  1OZS A;  2CT9 A;  5HKZ A;  2OS8 B;  1F8H A;  5TNC A;  1RJV A;  4NQG A;  2KSP A;  1B7T Y;  1Q80 A;  4JWQ A;  2HQ8 A;  1CNP A;  1SCM B;  1SPY A;  2I18 A;  4N5X A;  1QX5 B;  2Y1N A;  3GOF A;  2M29 A;  4MRX A;  3A8R A;  1DJI A;  4WRI A;  4U8D A;  3PN7 B;  1S1E A;  2DOQ A;  5CSJ A;  5F6T A;  1DF0 A;  2PSR A;  4XYN A;  4DRW A;  4GGF A;  1CLB A;  4YI9 A;  1ZOT B;  1BT6 A;  2KGR A;  3VRP A;  3O2P A;  2JRF A;  1CFC A;  3PM8 A;  1DGV A;  1SCV A;  2WOR A;  3LL8 B;  1MQ1 A;  4M2P A;  2GV5 A;  1WRZ A;  4MZL A;  5AEQ A;  1OE9 B;  3KEV A;  3PSR A;  2CBL A;  1SKT A;  3PFV A;  1SW8 A;  5KSZ A;  3FS7 A;  1DMO A;  2KOT A;  1VRK A;  2EC6 C;  1JUO A;  2JPT A;  1C07 A;  1UHJ A;  1WDC B;  1E8A A;  1OMR A;  1KK8 C;  5JJG A;  1TIZ A;  2LV7 A;  2V53 A;  1IJ5 A;  4A4B A;  3OP0 A;  1IWQ A;  1KQM C;  3F45 A;  1FI5 A;  2COL B;  1U5I B;  2JT8 A;  2ZKM X;  1RRO A;  4CFQ A;  1S6C A;  2Y5I A;  2L4I A;  1EG4 A;  1S5G Y;  1RK9 A;  1XO5 A;  1UUS A;  3DVE A;  2KQY A;  2FOT A;  2MJW B;  2F33 A;  4ORA B;  3MSE B;  2BL0 B;  2BEC A;  2O5G A;  5G08 A;  1EJ3 A;  1V1G A;  1M31 A;  1DJG A;  1Y0V H;  1NWD A;  3TS5 B;  2LVI A;  2K0J A;  1QVI Z;  2M0R A;  5B8I B;  1R6P A;  2FCE A;  2KGB C;  2ZRS A;  3IQO A;  1LXF C;  1CDP A;  3BUW B;  1K95 A;  3KF9 A;  5PAL A;  1DJZ A; 
#chains in the Genus database with same CATH topology
 2JU0 A;  1DJX A;  4PE4 A;  3PJI A;  4FTG A;  2KFH A;  1CKK A;  1KQV A;  2LCP A;  2E6W A;  2YGU A;  1QTX A;  2LP2 A;  4HRH A;  2LMT A;  2G2B A;  2H61 A;  4QJ4 B;  2LAP A;  4GUK A;  2KYF A;  3KO0 A;  3CDN A;  2JQ6 A;  3R1P A;  2I94 A;  1CDN A;  4PE0 A;  2OTG C;  2AMI A;  3DF0 B;  1QWV A;  3GK2 A;  1JF0 A;  3CZ2 A;  2KYC A;  2WOS A;  2JXL A;  3TDZ A;  3A4U B;  4INW A;  5D7F A;  1AP4 A;  5I94 A;  1L2O C;  1TUJ A;  1SRA A;  2KBI A;  1BLQ A;  2PQL A;  4GGN A;  2LE9 B;  1IG5 A;  2ZN9 A;  3FWB A;  2BKH B;  3OGN A;  3K1E A;  1OSA A;  2MA2 A;  1SL7 A;  3CLN A;  1TNX A;  3CR4 X;  4A4C A;  2LLU A;  3RZS A;  3D75 A;  4P5O E;  4PDZ A;  2KNE A;  1PK0 D;  1ZMZ A;  1L7Z A;  1M45 A;  5DKQ A;  2KDH A;  1M63 B;  2KI4 B;  3SS3 A;  1TUZ A;  1MF8 B;  3TZ1 A;  1B47 A;  1YRT B;  3DVJ A;  2Q91 A;  3HX4 A;  4GFT A;  3IVT A;  1DEK A;  3BUM B;  2K7C A;  2CTN A;  2M1U A;  1MXL C;  4PHM A;  1S3P A;  3D10 A;  3GK1 A;  1GQM A;  1Z2C B;  2M7L A;  3PAL A;  4MZJ A;  4ZCU A;  1BOC A;  1JWD A;  1QAT A;  1SNL A;  1AHR A;  3CR5 X;  1CMG A;  3L47 A;  2FJU B;  1JBA A;  4BY4 A;  1YVH A;  3JVT C;  1QV0 A;  1LA3 A;  2QEB A;  1BF5 A;  2HF5 A;  1DJY A;  2KAY A;  2L4H A;  2MLF C;  2WCK A;  1N65 A;  2PVB A;  1B1G A;  2WCL A;  2ERB A;  3L4A A;  1CTR A;  4N1F A;  4CFR A;  1YRU B;  4JD9 A;  1TCO B;  1TNQ A;  3D0Y A;  1P28 A;  1KCY A;  1IQ5 A;  1K2H A;  4OKH A;  2ZFD A;  4MRY A;  2M9G A;  4IL1 A;  1DC1 A;  1SR6 B;  2M3W A;  1NCZ A;  1KSO A;  3E3R A;  2KAX A;  1BOD A;  2JNX A;  5D69 A;  1KWO C;  2AAO A;  3I5F B;  1ODB A;  1UHH A;  1SYM A;  2LUX A;  4MSP A;  3DY9 A;  3PLF B;  1B9A A;  1H4B A;  3OBV A;  1F54 A;  1PUL A;  1YUU A;  1FF1 A;  1S26 D;  4AQJ A;  4DIR A;  3I5I B;  2JT3 A;  2TN4 A;  3BYA A;  3EG5 B;  1KSM A;  1DEL A;  4M2O A;  3WNX B;  2BCA A;  1UHN A;  5GQQ C;  1BJF A;  2L50 A;  1WLM A;  3CZ1 A;  3V2L A;  1MWN A;  5DKR A;  2JTZ A;  1RTP 1;  1F4Q A;  1AJ4 A;  2ZNE A;  2ZRT A;  4ICB A;  1PAL A;  2BCB A;  1EXR A;  1YR5 A;  3BFH A;  3BOW A;  3CTN A;  4WQ2 A;  1B8L A;  2K7D A;  2P70 A;  1GM0 A;  3CS1 A;  3WXA A;  2ZN8 A;  1U5I A;  3ICB A;  3VB1 A;  1YX7 A;  1QXP A;  1BU3 A;  3HCM A;  3ZNI A;  1CFD A;  3IQQ A;  4HSZ A;  4PT1 A;  1RFJ A;  2JC2 A;  2OS8 C;  2MAZ A;  3B88 A;  4JKT A;  2L5X B;  4N1G A;  2F3Y A;  3NHT A;  4FQO A;  1W7I B;  1JFK A;  3DYE A;  1JF2 A;  1SCM C;  2EGD A;  2A4J A;  2L51 A;  1XFW O;  1BMO A;  3DD4 A;  4FQT A;  3SG3 A;  3OX5 A;  1XFY O;  1DGU A;  2PYQ A;  1H8B A;  1UHK A;  4YRU A;  1J55 A;  1TNP A;  1ALV A;  4F0Z B;  3D73 A;  2K61 A;  3VRN A;  1C3Y A;  3SG5 A;  2P6B B;  1LS8 A;  3B6X A;  4PHK A;  1M46 A;  4PCW A;  4PE7 A;  2BE4 A;  4C0K A;  1NCX A;  1REC A;  3S0A A;  2LLS A;  3TDU A;  4PHJ A;  3SIA A;  2QAC A;  1W7J B;  2FCD A;  5JOL A;  1QLS A;  1D1O A;  3NXA A;  3DF0 A;  5I8N A;  2LC5 A;  2H8V A;  1SBJ A;  5IBW A;  3SS5 A;  2LLT A;  1QLK A;  1YVL A;  3BUN B;  1DF0 B;  4XJK A;  2NZ0 A;  3EK4 A;  1DQE A;  1AUI B;  1NX3 A;  2JUL A;  1WDC C;  2QEO A;  2WC5 A;  3NHI A;  5DIC A;  2NLN A;  4CLN A;  1K9K A;  3LCP C;  1GGW A;  3AAK A;  1K93 D;  2WC6 A;  2I2R E;  1NSH A;  4MBE A;  3JTD B;  2NCO A;  1YUS A;  1TWO A;  5I2O A;  3I5H B;  2PAS A;  2M49 B;  3O4X A;  4GPL B;  4UPG A;  4USL A;  2M7N A;  3FE9 A;  3AKB A;  2JPO A;  1A4P A;  1PSR A;  2K7O A;  1OMD A;  2KHN A;  1QVI Y;  1TTX A;  3B7A A;  3OB1 B;  2BBN A;  4NDC A;  1RWY A;  1Y1X A;  1NIW A;  3CZT X;  4ORB B;  5CSI A;  2BL0 C;  3B87 A;  2KFG A;  2GGM A;  3CR2 A;  4JPZ B;  1ZUZ A;  2K7B A;  1UWO A;  2MRD A;  4PAL A;  1J1E A;  1QS7 A;  2WCB A;  3TS5 C;  5HL1 A;  2PMY A;  1XFU O;  4TNC A;  2LHL A;  1C3Z A;  1SY9 A;  2ISD A;  3SG6 A;  3ZWH A;  1AJ5 A;  3SG7 A;  1KK7 Z;  1S6I A;  2K2A A;  4C0J A;  4F7F A;  4YBH B;  3GK4 X;  4R1E A;  3NSK A;  5CSF A;  2RGI A;  4YI8 A;  2JOJ A;  4OZD A;  1BR4 B;  3O78 A;  4ZCV A;  5KTY A;  5HKY A;  1OOH A;  2WCF A;  1IIO A;  5HLV A;  3SIB A;  2PAL A;  1A75 A;  5I2L A;  3OHM B;  1XVJ A;  3CGA A;  1DT7 B;  2B1U A;  4GNK B;  2LMV A;  2O60 A;  1QX7 A;  1K94 A;  4D1E A;  4GBA A;  1IKU A;  1EL4 A;  1OZO A;  2QPT A;  2MHH A;  3NSL A;  1TN4 A;  3I5G B;  1KFX S;  5K89 A;  5D3O A;  1J7O A;  1TOP A;  2Q4U A;  2E30 A;  1XFX O;  1Y1U A;  2JZI A;  4DCK A;  3AKA A;  1Y6W A;  5ER4 X;  1CDL A;  3O6B A;  4HRG A;  2LHI A;  1SL9 A;  1UUR A;  3TUY B;  1YUR A;  5CPV A;  2GGZ A;  1SMG A;  3S0D A;  1GGZ A;  1WLZ A;  3OX6 A;  1F71 A;  1PVA A;  2KI4 C;  3EVV A;  1Y1A A;  2KI6 D;  1PRW A;  4YGE B;  1TRF A;  2I7A A;  5AFP A;  1IJ6 A;  3RLZ A;  1J7P A;  1K90 D;  2K8M B;  4M2Q A;  3WHT B;  2L5Y A;  1BG1 A;  4MEW A;  1EG3 A;  3EKH A;  1NYA A;  1XFR A;  1K8U A;  1YUT A;  3FE8 A;  4I5K A;  4NDD A;  2K2F A;  1FI6 A;  2LAN A;  2VRG A;  4ORC B;  1CM1 A;  2BCX A;  2M97 A;  1XK4 A;  5HLO A;  1R2U A;  4OVN F;  1DJW A;  3IF7 A;  2K60 A;  1CB1 A;  1IH0 A;  4I5L B;  3DVM A;  4NDB A;  1EH2 A;  1HT9 A;  4YGD B;  5AAN A;  1IQ3 A;  3AAJ A;  2F3Z A;  1B8R A;  2LNK A;  3OB2 B;  3BUO B;  2BAP A;  1TNW A;  2BE6 A;  4I5J A;  4MVF A;  4E68 A;  2JT0 A;  1MXE A;  1YX8 A;  1LKJ A;  1ZFS A;  4DUQ A;  1SR6 C;  1MR8 A;  1QX2 A;  2KAV A;  1NX1 A;  3KHE A;  2ZND A;  4GAO A;  3LK0 A;  1KFU S;  3I5F C;  4Q04 A;  4AOM A;  3BQ3 A;  1K9U A;  3EK8 A;  1OQP A;  2LVK A;  2EC6 B;  2HPS A;  2OPO A;  2H2K A;  1WRK A;  2KLD A;  3NSO A;  4PHN A;  1KK8 B;  1G8I A;  1T14 A;  3I5I C;  3D0Y B;  1NUB A;  3LK1 A;  3QME A;  3SJS A;  4C0L A;  2FJY A;  1B4C A;  1XA5 A;  2QEH A;  1KQM B;  1CFF A;  1S36 A;  1XFV O;  4MLW A;  2Y4Q A;  4JQ0 D;  5KU1 A;  2BBM A;  1CM4 A;  3VRQ A;  3PN7 C;  1A29 A;  2CNP A;  2LUC A;  2IS9 A;  1J1D A;  1QAS A;  2KI6 C;  1DJH A;  2EHB A;  5I2Q A;  3CWG A;  4OR9 B;  2Y1M A;  1K9P A;  4INX A;  1JFJ A;  3BFA A;  1DVI A;  2BKI B;  1S5G Z;  3S0E A;  3CAB A;  1HQV A;  2MLE C;  1AVS A;  1F4O A;  2NXQ A;  1CLL A;  1XK4 C;  3SS4 A;  2CCM A;  2WND A;  2MBX A;  5BPJ A;  2LVJ A;  1CMF A;  4PE1 A;  3TDI A;  2JXC A;  1KFU L;  1BR1 B;  3EKJ A;  3PAT A;  4QJ3 B;  4YGA A;  1UP5 A;  1PVB A;  3BOW B;  1XFZ O;  2KFF A;  2LM5 A;  1AK8 A;  5DKN A;  3VGO A;  1QIV A;  1V1F A;  1ALW A;  2KLE A;  4BY5 A;  1JC2 A;  1FBV A;  2OTG B;  3DZT A;  2JTT A;  1QIW A;  2HET A;  5FI2 A;  5J3X A;  4P2Y B;  1C7V A;  2CXJ A;  4QJ5 B;  1NX0 A;  1X02 A;  1IGV A;  2GTE A;  1L2O B;  1F55 A;  1DTL A;  2JWW A;  3NSI A;  3LLE A;  1OOI X;  2F2O A;  4OV2 A;  3DXL A;  2WC8 A;  2F2P A;  4GGF C;  1OOF A;  2HQW A;  1M39 A;  2WCJ A;  4L9M A;  2F8P A;  1NX2 A;  4MZK A;  1PSB A;  3VRO A;  4YGB B;  1CDM A;  1MUX A;  3D76 A;  2QEV A;  1TCF A;  4CID A;  1FPW A;  3Q8I A;  3JTD C;  3WHU B;  3I5H C;  1JSA A;  1K96 A;  1SK6 D;  3CZ0 A;  2L2E A;  4AQI A;  1ORG A;  1UHI A;  3DVK A;  1CLM A;  1GJY A;  3BFB A;  4XJK B;  1WRL A;  3KPX A;  1A2X A;  1OOG A;  3H4S E;  3JVT B;  1J7Q A;  1N0Y A;  3SG2 A;  1N2D A;  3O4Y A;  1KK7 Y;  1NP8 A;  1G33 A;  2D8N A;  1NPQ A;  3EK7 A;  1LIN A;  3BUX B;  3EVR A;  3C1V A;  3D74 A;  5HKW A;  1CFP A;  3SG4 A;  1J7R A;  4MN0 A;  1Z4H A;  5FI7 A;  2M1K B;  1FW4 A;  2KQ6 A;  4OCI A;  2L98 A;  1C7W A;  3K21 A;  1A03 A;  1ZAC A;  3FWC A;  1KWO B;  2SCP A;  4WQ3 A;  2SAS A;  2L0P A;  2JNF A;  4CPV A;  2AUC A;  4I5N B;  4ETO A;  1F70 A;  3FIA A;  2WCE A;  3EVU A;  1LA0 A;  1IRJ A;  1XYD A;  3BXK A;  3I5G C;  4HRE E;  4YGC B;  1WY9 A;  2M8U A;  5AXI A;  1NCY A;  2R2I A;  2PRU A;  2LVV A;  2LP3 A;  1OOJ A;  1B7T Z;  1YTZ C;  2H61 C;  1A75 B;  5AER A;  3RM1 A;  1QJT A;  2BNX A;  1KFX L;  5FI6 A;  3S0G A;  1MHO A;  1QV1 A;  2LMU A;  1OMV A;  2NCP A;  1G4Y R;  2G9B A;  3R1O A;  3PM2 A;  1SL8 A;  3VRR A;  3TUY C;  1LVC D;  3M0W A;  1B8C A;  5CSN A;  5ER5 A;  1S6J A;  2KBM A;  3QRX A;  5HYD A;  5FYX A;  4DS7 A;  1OZS A;  3CYZ A;  2CT9 A;  5HKZ A;  2OS8 B;  1F8H A;  5TNC A;  1RJV A;  4NQG A;  3R72 A;  2KSP A;  1B7T Y;  2WCH A;  1Q80 A;  4JWQ A;  2HQ8 A;  1CNP A;  1SCM B;  1SPY A;  2I18 A;  4N5X A;  1QX5 B;  2Y1N A;  3GOF A;  2M29 A;  4MRX A;  3A8R A;  3S0B A;  1DJI A;  2WCM A;  1W9Z A;  4WRI A;  4U8D A;  3D77 A;  1S1E A;  2DOQ A;  3PN7 B;  5CSJ A;  1DF0 A;  2PSR A;  5EL2 A;  4XYN A;  5F6T A;  4GGF A;  4DRW A;  4YI9 A;  1CLB A;  2L2C A;  1ZOT B;  1BT6 A;  2KGR A;  3VRP A;  3O2P A;  2JRF A;  3BJH A;  1CFC A;  3PM8 A;  1DGV A;  1SCV A;  2WOR A;  3LL8 B;  1MQ1 A;  4M2P A;  2GV5 A;  1WRZ A;  4MZL A;  5AEQ A;  3UNW A;  1OE9 B;  3KEV A;  3L4L A;  2CBL A;  3PSR A;  1SKT A;  3PFV A;  1SW8 A;  5KSZ A;  3FS7 A;  3D78 A;  1DMO A;  3FE6 A;  2KOT A;  1VRK A;  2EC6 C;  1JUO A;  2JPT A;  1C07 A;  1UHJ A;  1WDC B;  1E8A A;  1OMR A;  1KK8 C;  2QDI A;  5JJG A;  1TIZ A;  2LV7 A;  2V53 A;  1IJ5 A;  4A4B A;  3OP0 A;  1IWQ A;  4IJ7 A;  1KQM C;  1SSE B;  3F45 A;  3R1V A;  1FI5 A;  2COL B;  1U5I B;  2JT8 A;  2ZKM X;  1RRO A;  4CFQ A;  1S6C A;  2Y5I A;  2L4I A;  1EG4 A;  2KPH A;  1S5G Y;  1RK9 A;  4KYN A;  1XO5 A;  1UUS A;  3DVE A;  2KQY A;  2FOT A;  2MJW B;  2F33 A;  3B86 A;  4ORA B;  3S0F A;  3MSE B;  2BL0 B;  2BEC A;  2O5G A;  5G08 A;  1EJ3 A;  3N7H A;  1V1G A;  1M31 A;  1DJG A;  1Y0V H;  1NWD A;  3UO9 A;  3TS5 B;  2LVI A;  2K0J A;  1QVI Z;  2M0R A;  5B8I B;  1R6P A;  2FCE A;  2KGB C;  2ZRS A;  3IQO A;  1OW4 A;  2P71 A;  3NGV A;  1LXF C;  1CDP A;  3BUW B;  1K95 A;  3KF9 A;  5PAL A;  1DJZ A; 
#chains in the Genus database with same CATH homology
 2JU0 A;  1DJX A;  4PE4 A;  1CKK A;  4FTG A;  2KFH A;  1KQV A;  2LCP A;  2E6W A;  1QTX A;  2LP2 A;  4HRH A;  2LMT A;  2G2B A;  2H61 A;  4QJ4 B;  2LAP A;  4GUK A;  2KYF A;  3KO0 A;  2JQ6 A;  2I94 A;  1CDN A;  4PE0 A;  2OTG C;  2AMI A;  3DF0 B;  3GK2 A;  1JF0 A;  2KYC A;  2WOS A;  2JXL A;  3TDZ A;  3A4U B;  5D7F A;  1AP4 A;  1L2O C;  1SRA A;  2KBI A;  1BLQ A;  4GGN A;  2LE9 B;  1IG5 A;  2ZN9 A;  3FWB A;  2BKH B;  1OSA A;  2MA2 A;  1SL7 A;  3CLN A;  1TNX A;  3CR4 X;  4A4C A;  2LLU A;  4P5O E;  4PDZ A;  2KNE A;  1PK0 D;  1ZMZ A;  1L7Z A;  1M45 A;  5DKQ A;  2KDH A;  1M63 B;  2KI4 B;  1MF8 B;  3TZ1 A;  1B47 A;  1YRT B;  3DVJ A;  2Q91 A;  3HX4 A;  4GFT A;  3BUM B;  2K7C A;  2CTN A;  2M1U A;  1MXL C;  4PHM A;  1S3P A;  3D10 A;  3GK1 A;  1GQM A;  2M7L A;  1BOC A;  3PAL A;  4MZJ A;  4ZCU A;  1JWD A;  1QAT A;  1SNL A;  1AHR A;  3CR5 X;  1CMG A;  2FJU B;  1JBA A;  4BY4 A;  1YVH A;  3JVT C;  1QV0 A;  1LA3 A;  1BF5 A;  2HF5 A;  1DJY A;  2KAY A;  2L4H A;  2MLF C;  1N65 A;  2PVB A;  1B1G A;  4N1F A;  1CTR A;  4CFR A;  1YRU B;  1TCO B;  1TNQ A;  3D0Y A;  1KCY A;  1IQ5 A;  1K2H A;  4OKH A;  2ZFD A;  4MRY A;  2M9G A;  4IL1 A;  1SR6 B;  2M3W A;  1NCZ A;  1KSO A;  3E3R A;  2KAX A;  1BOD A;  2JNX A;  5D69 A;  1KWO C;  2AAO A;  3I5F B;  1ODB A;  1UHH A;  1SYM A;  2LUX A;  4MSP A;  3PLF B;  1B9A A;  1H4B A;  1F54 A;  1PUL A;  1YUU A;  1FF1 A;  1S26 D;  4AQJ A;  4DIR A;  3I5I B;  2JT3 A;  2TN4 A;  3BYA A;  1KSM A;  4M2O A;  3WNX B;  2BCA A;  1UHN A;  5GQQ C;  1BJF A;  2L50 A;  1WLM A;  1MWN A;  5DKR A;  2JTZ A;  1RTP 1;  1F4Q A;  1AJ4 A;  2ZNE A;  2ZRT A;  4ICB A;  1PAL A;  2BCB A;  1EXR A;  1YR5 A;  3BOW A;  3CTN A;  4WQ2 A;  1B8L A;  2K7D A;  3CS1 A;  3WXA A;  2ZN8 A;  1U5I A;  3ICB A;  1YX7 A;  1QXP A;  1BU3 A;  3HCM A;  3ZNI A;  1CFD A;  3IQQ A;  4HSZ A;  1RFJ A;  2JC2 A;  2OS8 C;  2MAZ A;  2L5X B;  4N1G A;  2F3Y A;  4FQO A;  1W7I B;  1JFK A;  1JF2 A;  1SCM C;  2EGD A;  2A4J A;  2L51 A;  1XFW O;  1BMO A;  3DD4 A;  3SG3 A;  3OX5 A;  1XFY O;  1DGU A;  1H8B A;  1UHK A;  4YRU A;  1J55 A;  1TNP A;  1ALV A;  4F0Z B;  2K61 A;  3VRN A;  3SG5 A;  2P6B B;  4PHK A;  1M46 A;  4PCW A;  4PE7 A;  2BE4 A;  4C0K A;  1NCX A;  1REC A;  2LLS A;  3TDU A;  4PHJ A;  3SIA A;  2QAC A;  1W7J B;  2FCD A;  5JOL A;  1QLS A;  1D1O A;  3NXA A;  3DF0 A;  5I8N A;  2LC5 A;  1SBJ A;  5IBW A;  2LLT A;  1QLK A;  1YVL A;  3BUN B;  1DF0 B;  4XJK A;  2NZ0 A;  3EK4 A;  1NX3 A;  1AUI B;  2JUL A;  1WDC C;  2NLN A;  4CLN A;  1K9K A;  3LCP C;  1GGW A;  3AAK A;  1K93 D;  2I2R E;  1NSH A;  4MBE A;  3JTD B;  2NCO A;  1YUS A;  5I2O A;  3I5H B;  2PAS A;  2M49 B;  4GPL B;  4UPG A;  4USL A;  2M7N A;  3AKB A;  1A4P A;  1PSR A;  2K7O A;  1OMD A;  2KHN A;  1QVI Y;  1TTX A;  3OB1 B;  4NDC A;  2BBN A;  5CSI A;  1RWY A;  1Y1X A;  1NIW A;  3CZT X;  4ORB B;  2BL0 C;  2KFG A;  2GGM A;  3CR2 A;  4JPZ B;  1ZUZ A;  2K7B A;  1UWO A;  2MRD A;  4PAL A;  1J1E A;  1QS7 A;  2WCB A;  3TS5 C;  2PMY A;  1XFU O;  4TNC A;  2LHL A;  1SY9 A;  2ISD A;  3SG6 A;  3ZWH A;  1AJ5 A;  3SG7 A;  1KK7 Z;  1S6I A;  2K2A A;  4C0J A;  4YBH B;  3GK4 X;  4R1E A;  3NSK A;  5CSF A;  2RGI A;  4YI8 A;  2JOJ A;  4ZCV A;  1BR4 B;  3O78 A;  5KTY A;  5HKY A;  2WCF A;  5HLV A;  3SIB A;  2PAL A;  1A75 A;  5I2L A;  3OHM B;  1XVJ A;  3CGA A;  1DT7 B;  2B1U A;  4GNK B;  2LMV A;  2O60 A;  1QX7 A;  1K94 A;  4D1E A;  4GBA A;  1IKU A;  1EL4 A;  1OZO A;  2QPT A;  2MHH A;  3NSL A;  1TN4 A;  3I5G B;  1KFX S;  5K89 A;  1J7O A;  1TOP A;  2Q4U A;  2E30 A;  1XFX O;  1Y1U A;  2JZI A;  4DCK A;  3AKA A;  1Y6W A;  5ER4 X;  1CDL A;  3O6B A;  4HRG A;  2LHI A;  1SL9 A;  1UUR A;  3TUY B;  1YUR A;  5CPV A;  2GGZ A;  1SMG A;  1GGZ A;  1WLZ A;  3OX6 A;  1F71 A;  1PVA A;  2KI4 C;  3EVV A;  1Y1A A;  2KI6 D;  1PRW A;  4YGE B;  1TRF A;  2I7A A;  5AFP A;  1IJ6 A;  3RLZ A;  1J7P A;  1K90 D;  2K8M B;  4M2Q A;  3WHT B;  1BG1 A;  4MEW A;  1EG3 A;  3EKH A;  1NYA A;  1K8U A;  1YUT A;  4NDD A;  4I5K A;  2K2F A;  1FI6 A;  2LAN A;  2VRG A;  4ORC B;  1CM1 A;  2BCX A;  2M97 A;  1XK4 A;  5HLO A;  1R2U A;  4OVN F;  1DJW A;  3IF7 A;  1CB1 A;  1IH0 A;  4I5L B;  3DVM A;  4NDB A;  1EH2 A;  1HT9 A;  4YGD B;  5AAN A;  1IQ3 A;  3AAJ A;  2F3Z A;  1B8R A;  2LNK A;  3OB2 B;  3BUO B;  4I5J A;  1TNW A;  2BE6 A;  4MVF A;  4E68 A;  2JT0 A;  1MXE A;  1YX8 A;  1LKJ A;  1ZFS A;  4DUQ A;  1SR6 C;  1MR8 A;  1QX2 A;  2KAV A;  1NX1 A;  3KHE A;  2ZND A;  4GAO A;  3LK0 A;  1KFU S;  3I5F C;  4Q04 A;  4AOM A;  3BQ3 A;  1K9U A;  3EK8 A;  1OQP A;  2LVK A;  2EC6 B;  2HPS A;  2OPO A;  2H2K A;  1WRK A;  4PHN A;  3NSO A;  1KK8 B;  1G8I A;  3I5I C;  3D0Y B;  1NUB A;  3LK1 A;  3SJS A;  4C0L A;  1B4C A;  1XA5 A;  1KQM B;  1CFF A;  1S36 A;  1XFV O;  4MLW A;  2Y4Q A;  4JQ0 D;  5KU1 A;  2BBM A;  1CM4 A;  3VRQ A;  3PN7 C;  1A29 A;  2CNP A;  2LUC A;  2IS9 A;  1J1D A;  1QAS A;  2KI6 C;  1DJH A;  2EHB A;  5I2Q A;  3CWG A;  4OR9 B;  2Y1M A;  1K9P A;  1JFJ A;  1DVI A;  2BKI B;  1S5G Z;  1HQV A;  2MLE C;  1AVS A;  1F4O A;  2NXQ A;  1CLL A;  1XK4 C;  2CCM A;  2WND A;  2MBX A;  5BPJ A;  2LVJ A;  1CMF A;  4PE1 A;  3TDI A;  2JXC A;  1KFU L;  1BR1 B;  3EKJ A;  3PAT A;  4QJ3 B;  4YGA A;  1UP5 A;  1PVB A;  3BOW B;  1XFZ O;  2KFF A;  2LM5 A;  1AK8 A;  5DKN A;  3VGO A;  1QIV A;  1V1F A;  1ALW A;  4BY5 A;  1JC2 A;  1FBV A;  2OTG B;  2JTT A;  1QIW A;  2HET A;  5J3X A;  4P2Y B;  1C7V A;  2CXJ A;  4QJ5 B;  1NX0 A;  1X02 A;  1IGV A;  1F55 A;  1L2O B;  1DTL A;  2JWW A;  3NSI A;  3LLE A;  2F2O A;  4OV2 A;  2WC8 A;  2F2P A;  4GGF C;  2HQW A;  1M39 A;  4L9M A;  2F8P A;  1NX2 A;  4MZK A;  1PSB A;  3VRO A;  4YGB B;  1CDM A;  1MUX A;  1TCF A;  4CID A;  1FPW A;  3JTD C;  3WHU B;  3I5H C;  1JSA A;  1K96 A;  1SK6 D;  2L2E A;  4AQI A;  1UHI A;  3DVK A;  1CLM A;  1GJY A;  4XJK B;  1WRL A;  3KPX A;  1A2X A;  3H4S E;  3JVT B;  1J7Q A;  1N0Y A;  3SG2 A;  1N2D A;  3O4Y A;  1KK7 Y;  1NP8 A;  1G33 A;  2D8N A;  1NPQ A;  3EK7 A;  1LIN A;  3BUX B;  3EVR A;  3C1V A;  5HKW A;  1CFP A;  3SG4 A;  1J7R A;  4MN0 A;  2M1K B;  1FW4 A;  2KQ6 A;  4OCI A;  2L98 A;  1C7W A;  3K21 A;  1A03 A;  1ZAC A;  3FWC A;  1KWO B;  2SCP A;  4WQ3 A;  2SAS A;  2L0P A;  2JNF A;  4CPV A;  2AUC A;  4I5N B;  4ETO A;  1F70 A;  3FIA A;  2WCE A;  3EVU A;  1LA0 A;  1IRJ A;  1XYD A;  3BXK A;  3I5G C;  4HRE E;  4YGC B;  1WY9 A;  2M8U A;  5AXI A;  1NCY A;  2R2I A;  2PRU A;  2LVV A;  2LP3 A;  1OOJ A;  1B7T Z;  1YTZ C;  2H61 C;  1A75 B;  5AER A;  3RM1 A;  1QJT A;  1KFX L;  1MHO A;  1QV1 A;  2LMU A;  1OMV A;  2NCP A;  1G4Y R;  2G9B A;  3VRR A;  3TUY C;  1SL8 A;  1LVC D;  3M0W A;  1B8C A;  5CSN A;  5ER5 A;  1S6J A;  2KBM A;  3QRX A;  5HYD A;  5FYX A;  4DS7 A;  1OZS A;  2CT9 A;  5HKZ A;  2OS8 B;  1F8H A;  5TNC A;  1RJV A;  4NQG A;  2KSP A;  1B7T Y;  1Q80 A;  4JWQ A;  2HQ8 A;  1CNP A;  1SCM B;  1SPY A;  2I18 A;  4N5X A;  1QX5 B;  2Y1N A;  3GOF A;  2M29 A;  4MRX A;  3A8R A;  1DJI A;  4WRI A;  4U8D A;  3PN7 B;  1S1E A;  2DOQ A;  5CSJ A;  5F6T A;  1DF0 A;  2PSR A;  4XYN A;  4DRW A;  4GGF A;  1CLB A;  4YI9 A;  1ZOT B;  1BT6 A;  2KGR A;  3VRP A;  3O2P A;  2JRF A;  1CFC A;  3PM8 A;  1DGV A;  1SCV A;  2WOR A;  3LL8 B;  1MQ1 A;  4M2P A;  2GV5 A;  1WRZ A;  4MZL A;  5AEQ A;  1OE9 B;  3KEV A;  3PSR A;  2CBL A;  1SKT A;  3PFV A;  1SW8 A;  5KSZ A;  3FS7 A;  1DMO A;  2KOT A;  1VRK A;  2EC6 C;  1JUO A;  2JPT A;  1C07 A;  1UHJ A;  1WDC B;  1E8A A;  1OMR A;  1KK8 C;  5JJG A;  1TIZ A;  2LV7 A;  2V53 A;  1IJ5 A;  4A4B A;  3OP0 A;  1IWQ A;  1KQM C;  3F45 A;  1FI5 A;  2COL B;  1U5I B;  2JT8 A;  2ZKM X;  1RRO A;  4CFQ A;  1S6C A;  2Y5I A;  2L4I A;  1EG4 A;  1S5G Y;  1RK9 A;  1XO5 A;  1UUS A;  3DVE A;  2KQY A;  2FOT A;  2MJW B;  2F33 A;  4ORA B;  3MSE B;  2BL0 B;  2BEC A;  2O5G A;  5G08 A;  1EJ3 A;  1V1G A;  1M31 A;  1DJG A;  1Y0V H;  1NWD A;  3TS5 B;  2LVI A;  2K0J A;  1QVI Z;  2M0R A;  5B8I B;  1R6P A;  2FCE A;  2KGB C;  2ZRS A;  3IQO A;  1LXF C;  1CDP A;  3BUW B;  1K95 A;  3KF9 A;  5PAL A;  1DJZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...