1YUUA

Solution structure of calcium-s100a13
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
98
structure length
98
Chain Sequence
b'MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S100 calcium-binding protein A13
publication title Structural Interplay between Calcium(II) and Copper(II) Binding to S100A13 Protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 34
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1yuuA00
2MA2A 1C7VA 2LM5A 4M2OA 3MSEB 1SK6D 5BPJA 1QTXA 1IH0A 1KK7Y 1ZOTB 2KDHA 1NIWA 4GUKA 1X02A 3VROA 3BUWB 1S26D 1S5GZ 4MVFA 2OPOA 2DOQA 1J1DA 1Y0VH 1K94A 3I5HB 3OP0A 1UHNA 1KQMB 1CLBA 1DVIA 4DCKA 2MRDA 1JUOA 1YUSA 4NDDA 2KBMA 1DF0B 3AKBA 5AFPA 1SW8A 2KAYA 4ORBB 2VRGA 1SCVA 2LLTA 1KK8B 3IQOA 1HQVA 1NX0A 2BE6A 2JNXA 3NSLA 1SRAA 1B1GA 2COLB 3FS7A 1A4PA 2RGIA 1M63B 1TCFA 1KSMA 1DJYA 1KWOB 1SY9A 4XJKA 1CFPA 2O60A 1FW4A 1BF5A 1DGUA 1CDMA 3KF9A 4NDBA 2WORA 1LVCD 2K7OA 2KI4C 3E3RA 2KI6D 4N5XA 1SYMA 2KAXA 1S6JA 1V1GA 1QV1A 1WRLA 1XFXO 1IG5A 5CPVA 1OMDA 2LHLA 1BG1A 1MR8A 4USLA 2H61A 2AMIA 1A03A 1SCMC 3EVRA 1GGWA 3LLEA 3OX5A 3LK0A 1XFZO 3EKHA 2IS9A 2OTGB 1S3PA 4A4BA 1IRJA 1FI5A 2CT9A 1KFXL 2LAPA 2K0JA 2KFFA 2JTZA 3FWCA 4N1FA 2WCBA 2ISDA 4E68A 2LVIA 1JF2A 1QX2A 3KPXA 3WXAA 1BMOA 2ZN8A 1CMFA 3I5HC 1L7ZA 1MXEA 2LUXA 2PVBA 2CTNA 3TZ1A 3VRPA 4AOMA 1KQMC 1SNLA 4ORCB 3VRRA 4YRUA 1AJ4A 4XYNA 1JBAA 1QVIY 2G2BA 3O2PA 4OV2A 2LC5A 1QX5B 2GGMA 4MRXA 2KSPA 2JU0A 1L2OC 4GAOA 4PALA 1KSOA 1JFKA 2JXCA 2WOSA 2MBXA 1XVJA 1N2DA 2TN4A 3PALA 1S1EA 1KK8C 1SL7A 1V1FA 2I18A 1AP4A 4OCIA 1B9AA 2G9BA 1TNQA 1C07A 2Y1NA 1IWQA 1JSAA 1TN4A 1S5GY 2F3YA 2LNKA 2OS8B 4YGCB 3CZTX 3AKAA 1XK4C 1IKUA 3KHEA 1FPWA 2L4HA 4TNCA 2LCPA 1RK9A 2LP3A 1DGVA 5GQQC 1PVBA 5AEQA 3PN7B 2JULA 3BOWB 4CFQA 2LVKA 2FOTA 3BQ3A 3K21A 1WLMA 4FQOA 1OZSA 2LLUA 1SL8A 1J7OA 2JXLA 3O4YA 2A4JA 1XO5A 2FCDA 1DJWA 3ICBA 2B1UA 2JZIA 3CGAA 3D0YB 2L98A 1J7PA 1NPQA 3CTNA 5CSIA 5B8IB 1A75A 1QV0A 4N1GA 5KU1A 1CDNA 3AAJA 4MRYA 2Y5IA 1EXRA 2OTGC 2PSRA 3SG5A 1TRFA 5HKWA 1BR1B 1KFUL 1RFJA 2MJWB 2LE9B 1G33A 1XFUO 4U8DA 1XFVO 2CXJA 4GGFC 1BT6A 4GNKB 1Q80A 1IJ6A 1YVLA 3CWGA 5D7FA 2E30A 2L50A 4MSPA 3I5IC 1KQVA 1KFXS 1AHRA 2JPTA 3VRNA 2EC6B 1NYAA 4GBAA 1J7RA 1NSHA 3TDUA 1PALA 1DF0A 2HQWA 2LMVA 3ZWHA 4MN0A 2D8NA 4PE7A 1OQPA 3SG6A 2BECA 2JT0A 1H4BA 1F55A 1G8IA 1OSAA 4QJ5B 1J1EA 2LLSA 1DJHA 1NCXA 1NX1A 2KGRA 3O6BA 2OS8C 4GGNA 1QS7A 5TNCA 2KHNA 2BL0C 1IQ3A 1BLQA 1XK4A 1B47A 3EVVA 4GPLB 5ER4X 1B8RA 2JNFA 1LA3A 1NCYA 2KFGA 3SJSA 3I5GC 1OE9B 3PN7C 2K2FA 4WRIA 5I2QA 1VRKA 2BBMA 3CR4X 4MLWA 1L2OB 1ALVA 4BY5A 2LVJA 2MHHA 1D1OA 2CCMA 1UHIA 1F4QA 2M29A 1CTRA 1K9UA 4A4CA 3EKJA 4NQGA 3NSKA 3ZNIA 2KQYA 1XA5A 2EHBA 3PLFB 2KOTA 4D1EA 3BUNB 1ZMZA 2BKHB 1WLZA 3FWBA 2LP2A 3VGOA 1YUTA 4AQJA 2MLEC 1UURA 2MLFC 1GQMA 1U5IB 4GGFA 3QRXA 4M2PA 1Y1AA 2NZ0A 1CDPA 3FIAA 4YI9A 5PALA 2WCFA 2K7DA 4MZJA 2JT8A 1BJFA 3CS1A 1CKKA 4HREE 1G4YR 2PALA 2HF5A 3BUOB 2EC6C 3WNXB 1TIZA 2WC8A 1IJ5A 2CBLA 4F0ZB 4CIDA 5JOLA 5AXIA 1A29A 1OZOA 1Y6WA 2LMUA 1PULA 1B7TZ 3CR2A 1TNPA 4AQIA 1F4OA 3DVKA 3NXAA 2LHIA 4HRHA 3PFVA 2L0PA 2FCEA 1S6CA 1S36A 5G08A 4MBEA 1UWOA 1ZUZA 2F33A 1XFWO 4ZCVA 3OX6A 4OVNF 5F6TA 1MUXA 5HLOA 5I2OA 3I5IB 5AANA 2BKIB 1RWYA 4WQ3A 3BOWA 5HLVA 2L51A 1TNWA 1OMVA 4PHJA 2F3ZA 1CM1A 2Y4QA 1QLKA 2I7AA 1YRTB 2FJUB 4YBHB 1ZACA 1RJVA 5AERA 1UHJA 1NX3A 4I5JA 3SIAA 4L9MA 1YVHA 4NDCA 1RROA 2M0RA 3D0YA 1PRWA 1NUBA 1NWDA 4FTGA 4YGEB 1WRZA 2CNPA 1QASA 3PSRA 1NX2A 4PCWA 2Y1MA 1QIWA 2BL0B 2PRUA 3EVUA 4MZLA 3H4SE 1CB1A 3A8RA 3CLNA 1YRUB 3DF0B 3I5GB 4JPZB 3SG7A 1YR5A 2M97A 1CM4A 1C7WA 5HKYA 1MXLC 2K7BA 1TCOB 4BY4A 4YI8A 1XFYO 1AJ5A 3TS5C 1LA0A 4HRGA 1ZFSA 3KO0A 5KTYA 5CSJA 1F8HA 1OOJA 3DVJA 1CLLA 4DS7A 1DJZA 5DKQA 3D10A 2M3WA 1B8LA 1A2XA 2NLNA 2L2EA 2M49B 4GFTA 3CR5X 5IBWA 3LCPC 1SL9A 1YUUA 2M1KB 4I5LB 4C0JA 2JTTA 3EK4A 1KCYA 1RECA 1SMGA 2HPSA 1UP5A 1MWNA 3I5FC 2BBNA 3DD4A 4R1EA 4ETOA 5K89A 2LV7A 3BXKA 1PK0D 1B7TY 1LXFC 2M1UA 3LL8B 4PDZA 1M45A 4ICBA 3PM8A 2M7LA 2M8UA 2F8PA 1DT7B 2NCOA 1UUSA 3LK1A 4PHKA 1FBVA 5JJGA 1R6PA 4OKHA 4YGAA 1WDCC 2LANA 1EG4A 4P5OE 1BODA 1QJTA 1J55A 1ODBA 1JF0A 1EH2A 3GK2A 2JC2A 5DKRA 1U5IA 4WQ2A 5I2LA 1K90D 1PVAA 1CFCA 2L5XB 1DJIA 4QJ3B 4C0LA 1BR4B 4QJ4B 1K9PA 1K96A 2R2IA 1IQ5A 1Y1UA 2PMYA 3KEVA 4P2YB 3TUYB 1R2UA 1PSRA 1AVSA 3TDIA 2SASA 1CFDA 2LUCA 2K2AA 1NP8A 2KI6C 3JTDC 1F54A 1CLMA 2NCPA 3NSOA 5I8NA 1AK8A 1MQ1A 1SR6C 2QPTA 3GOFA 3F45A 3OB1B 1TNXA 1JC2A 3HCMA 1GGZA 2H2KA 2NXQA 1AUIB 3TS5B 1OMRA 4PHMA 2ZNEA 1QATA 2KGBC 1K93D 1KFUS 2SCPA 1K9KA 3AAKA 2HQ8A 1TTXA 2JRFA 5J3XA 5CSFA 4IL1A 2JOJA 1B8CA 4YGDB 2AUCA 2ZRTA 3JVTC 2WNDA 2ZNDA 3RLZA 2BE4A 3EK7A 4ORAB 1LINA 4DUQA 1DTLA 1BU3A 3PATA 1F71A 1K95A 1K8UA 5CSNA 3WHUB 5FYXA 1S6IA 3DF0A 2ZKMX 3I5FB 2HETA 1ALWA 2LVVA 4CLNA 1JFJA 1LKJA 2KQ6A 5D69A 3M0WA 1M39A 1M46A 4XJKB 3OB2B 2KYFA 4I5KA 4ZCUA 2K8MB 3TDZA 1RTP1 2JT3A 1CDLA 1QXPA 4OR9B 3VRQA 4UPGA 3GK1A 3TUYC 1WRKA 1IGVA 1KK7Z 2KFHA 3SG4A 4MEWA 5DKNA 1CMGA 1K2HA 2JQ6A 4HSZA 1UHKA 1EL4A 1WDCB 1YX8A 2KNEA 2F2PA 4I5NB 4CPVA 3IF7A 3HX4A 4Q04A 4DIRA 2JWWA 1DJXA 1TOPA 2GV5A 3O78A 1PSBA 1QLSA 4JWQA 2P6BB 4M2QA 1QX7A 2WCEA 2I94A 4PE4A 1YURA 1JWDA 1CFFA 2QACA 3SG3A 3GK4X 2BCBA 3EK8A 1SPYA 1KWOC 4PHNA 1H8BA 2L4IA 1DMOA 5ER5A 2K7CA 3A4UB 1N65A 2KYCA 3BYAA 5KSZA 3JTDB 2PASA 3BUXB 1SR6B 2I2RE 3OHMB 1F70A 4C0KA 2V53A 2ZN9A 2KAVA 3SIBA 2AAOA 2BCXA 2ZFDA 3NSIA 1MF8B 1SBJA 5HKZA 1CNPA 2MAZA 3BUMB 5HYDA 4MZKA 1B4CA 4YGBB 2GGZA 4DRWA 1EG3A 2BCAA 1W7IB 1Y1XA 3IQQA 1SKTA 2K61A 3DVMA 3JVTB 2KI4B 2LMTA 2M7NA 1HT9A 1NCZA 1WY9A 4PE0A 2Q91A 3SG2A 1N0YA 1YX7A 1MHOA 4JQ0D 1J7QA 1XYDA 2ZRSA 1E8AA 4CFRA 2EGDA 1DJGA 1M31A 2H61C 1EJ3A 1YTZC 1W7JB 2E6WA 1GJYA 1QVIZ 1A75B 3RM1A 3WHTB 3DVEA 1SCMB 2O5GA 4PE1A 1FF1A 1FI6A 1BOCA 1UHHA 2Q4UA 2F2OA 1QIVA 2KBIA 3C1VA 2M9GA
chains in the Genus database with same CATH superfamily
2MA2A 1C7VA 2LM5A 4M2OA 3MSEB 2QEVA 1SK6D 5BPJA 1QTXA 3S0AA 1KK7Y 1ZOTB 1IH0A 2KDHA 1NIWA 4GUKA 1X02A 3VROA 3BUWB 1S26D 1S5GZ 4MVFA 2OPOA 2DOQA 1J1DA 1Y0VH 1K94A 3I5HB 3OP0A 1UHNA 1KQMB 1CLBA 1DVIA 2QEHA 4DCKA 2MRDA 1JUOA 1YUSA 4NDDA 3QMEA 2KBMA 1DF0B 3AKBA 5AFPA 1SW8A 2KAYA 4ORBB 2VRGA 1SCVA 2LLTA 1KK8B 3IQOA 1HQVA 1NX0A 2BE6A 2JNXA 3NSLA 1SRAA 1B1GA 2COLB 3FS7A 2KLEA 1A4PA 2RGIA 1M63B 1TCFA 1KSMA 3DYEA 1DJYA 1KWOB 1OOIX 1SY9A 3B86A 4XJKA 1CFPA 2O60A 1FW4A 4KYNA 1DGUA 2GTEA 1CDMA 3KF9A 4NDBA 1BF5A 2WORA 3R1PA 1LVCD 2K7OA 2KI4C 3E3RA 2KI6D 4N5XA 1T14A 1SYMA 3UO9A 2KAXA 1S6JA 1V1GA 1OOGA 2H8VA 1QV1A 1WRLA 1XFXO 1IG5A 3Q8IA 1OMDA 5CPVA 2LHLA 3SS5A 1BG1A 1MR8A 4USLA 2H61A 2AMIA 3PJIA 1A03A 1SCMC 3EVRA 1GGWA 3LLEA 3OX5A 3LK0A 1XFZO 1ORGA 3EKHA 2IS9A 2OTGB 1S3PA 4A4BA 1IRJA 1FI5A 2CT9A 1KFXL 2LAPA 2K0JA 2KFFA 2JTZA 3FWCA 4N1FA 2WCBA 2ISDA 4E68A 2LVIA 1JF2A 1QX2A 2WC6A 2JPOA 3KPXA 3WXAA 1SSEB 1BMOA 2PYQA 2ZN8A 1CMFA 3I5HC 1L7ZA 1MXEA 2LUXA 2PVBA 1W9ZA 2CTNA 3TZ1A 3FE6A 1KQMC 1SNLA 3DZTA 4ORCB 3VRPA 3VRRA 4YRUA 1AJ4A 4XYNA 1JBAA 1QVIY 2G2BA 2KLDA 3O2PA 4OV2A 2QDIA 2LC5A 1QX5B 2GGMA 4MRXA 3S0EA 2KSPA 2JU0A 1L2OC 4GAOA 4PALA 1KSOA 5FI7A 1Z4HA 3SS4A 1JFKA 2JXCA 2WOSA 2MBXA 1XVJA 1N2DA 2TN4A 3PALA 3UNWA 1S1EA 1KK8C 1SL7A 1V1FA 2I18A 3FE8A 3IVTA 4OCIA 1AP4A 1B9AA 2G9BA 1TNQA 1C07A 2Y1NA 1IWQA 1JSAA 1TN4A 1S5GY 2F3YA 2LNKA 2OS8B 3FE9A 4YGCB 3CZTX 3AKAA 1XK4C 1TUZA 3KHEA 1IKUA 1FPWA 2L4HA 4TNCA 2LCPA 1RK9A 2LP3A 1DGVA 5GQQC 1PVBA 5AEQA 3PN7B 2JULA 3BOWB 4CFQA 2LVKA 4IJ7A 2FOTA 3BQ3A 3K21A 1WLMA 4FQOA 1OZSA 2LLUA 1SL8A 1J7OA 2JXLA 3O4YA 2A4JA 1XO5A 2FCDA 2QEOA 1DJWA 3ICBA 2B1UA 2JZIA 3CGAA 3D0YB 2L98A 1J7PA 1NPQA 3CTNA 5CSIA 5B8IB 1A75A 1QV0A 4N1GA 5KU1A 1CDNA 3AAJA 4MRYA 2Y5IA 1EXRA 2OTGC 2PSRA 3SG5A 1TRFA 5HKWA 1OOFA 1BR1B 1KFUL 1RFJA 2MJWB 2LE9B 1G33A 1XFUO 3BFHA 4U8DA 1XFVO 2CXJA 4GGFC 1BT6A 4GNKB 1Q80A 1XFRA 1IJ6A 1YVLA 2P71A 3CWGA 5D7FA 2E30A 2L50A 4MSPA 3I5IC 1KQVA 1KFXS 1AHRA 2JPTA 3VRNA 2EC6B 1NYAA 4GBAA 1J7RA 1NSHA 3TDUA 1PALA 1DF0A 2HQWA 1P28A 2LMVA 3ZWHA 3R1OA 4MN0A 2D8NA 4PE7A 1OQPA 3SG6A 1DEKA 2BECA 2JT0A 1H4BA 3NHIA 1F55A 1G8IA 1OSAA 4QJ5B 1J1EA 2LLSA 1DJHA 1NCXA 1NX1A 2KGRA 3O6BA 2OS8C 4GGNA 4F7FA 1QS7A 1Z2CB 5TNCA 2KHNA 2BL0C 1IQ3A 1BLQA 1XK4A 1B47A 3EVVA 4GPLB 5ER4X 3S0GA 1B8RA 2JNFA 1LA3A 1NCYA 2KFGA 3SJSA 1GM0A 3I5GC 1OE9B 3PN7C 2K2FA 3CABA 4PT1A 4WRIA 5I2QA 1VRKA 2BBMA 3CR4X 4MLWA 1L2OB 1ALVA 4BY5A 2LVJA 1QWVA 2MHHA 1D1OA 2CCMA 4INWA 1UHIA 1F4QA 2M29A 1CTRA 1K9UA 4A4CA 3EKJA 4NQGA 3NSKA 3S0DA 3B88A 3ZNIA 2KQYA 1XA5A 3BFAA 2WCKA 2EHBA 3PLFB 2KOTA 3N7HA 4D1EA 3BUNB 1ZMZA 2BKHB 1WLZA 3DY9A 2LP2A 3FWBA 3VGOA 1YUTA 3L4AA 2MLEC 1UURA 4AQJA 2MLFC 1GQMA 1U5IB 2BAPA 1TUJA 4GGFA 3QRXA 4M2PA 1Y1AA 2NZ0A 1CDPA 3FIAA 4YI9A 5PALA 2WCFA 2K7DA 4MZJA 2JT8A 1BJFA 3CS1A 1CKKA 4HREE 3D78A 3D74A 1G4YR 2PALA 2HF5A 3BUOB 2EC6C 3WNXB 1TIZA 2WC8A 1IJ5A 2CBLA 4F0ZB 4CIDA 5JOLA 5EL2A 5AXIA 1A29A 1OZOA 1Y6WA 2LMUA 1PULA 1B7TZ 3CR2A 1TNPA 4AQIA 1F4OA 3DVKA 3NXAA 2LHIA 4HRHA 3PFVA 2L0PA 2FCEA 1S6CA 5FI6A 1S36A 5G08A 3D77A 4MBEA 2YGUA 1UWOA 1ZUZA 2F33A 2P70A 1XFWO 4ZCVA 3OX6A 4OVNF 2L5YA 5F6TA 1MUXA 5HLOA 5I2OA 3I5IB 5AANA 2BKIB 5I94A 1RWYA 4WQ3A 3BOWA 5HLVA 2L51A 1TNWA 1OMVA 4PHJA 2F3ZA 1CM1A 2Y4QA 1QLKA 2I7AA 1YRTB 2FJUB 4YBHB 1ZACA 1RJVA 4AOMA 5AERA 1UHJA 1NX3A 4I5JA 3SIAA 4L9MA 1YVHA 4NDCA 1RROA 2M0RA 3D0YA 1PRWA 1NUBA 1NWDA 3PM2A 4FTGA 4YGEB 1WRZA 2CNPA 1QASA 3PSRA 1NX2A 4PCWA 2Y1MA 1QIWA 2BL0B 2PRUA 3EVUA 4MZLA 3H4SE 1CB1A 3A8RA 3CLNA 1YRUB 3DF0B 3I5GB 4JPZB 3SG7A 1YR5A 2M97A 1CM4A 1C7WA 5HKYA 1MXLC 2K7BA 1TCOB 4BY4A 4YI8A 1XFYO 1AJ5A 3TS5C 1LA0A 3D76A 3BFBA 4HRGA 1ZFSA 3KO0A 5KTYA 5CSJA 1F8HA 1OOJA 2WCMA 3RZSA 3DVJA 1CLLA 4DS7A 3S0FA 1DJZA 4INXA 5DKQA 3D10A 2M3WA 1B8LA 1A2XA 2NLNA 3L4LA 1IIOA 2L2EA 2ERBA 2M49B 4GFTA 3CR5X 5IBWA 3LCPC 1SL9A 1YUUA 2M1KB 4I5LB 4C0JA 2JTTA 3EK4A 4FQTA 1KCYA 1RECA 1SMGA 2HPSA 1UP5A 1MWNA 3I5FC 2BBNA 3DD4A 4R1EA 4ETOA 5K89A 2LV7A 3BXKA 1PK0D 1B7TY 1LXFC 2M1UA 3LL8B 4PDZA 1DC1A 1M45A 3CZ1A 4ICBA 4OZDA 3PM8A 2M7LA 2M8UA 2F8PA 1DT7B 3OGNA 2NCOA 1UUSA 3LK1A 4PHKA 1FBVA 3DXLA 5JJGA 1R6PA 1DELA 4OKHA 4YGAA 2FJYA 1WDCC 2LANA 1EG4A 4P5OE 1BODA 1QJTA 1J55A 1ODBA 1JF0A 1EH2A 3GK2A 2JC2A 5DKRA 1U5IA 1OOHA 4WQ2A 5I2LA 1K90D 1PVAA 1CFCA 3SS3A 2L5XB 1DJIA 4QJ3B 4C0LA 1BR4B 4QJ4B 1K9PA 1K96A 2R2IA 1IQ5A 1Y1UA 2PMYA 3KEVA 4P2YB 3TUYB 1R2UA 1PSRA 1AVSA 3TDIA 2SASA 1CFDA 3B7AA 2LUCA 2K60A 2K2AA 1NP8A 2KI6C 3JTDC 1F54A 1CLMA 2NCPA 3NSOA 5I8NA 1AK8A 1MQ1A 1SR6C 2QPTA 3GOFA 3F45A 3OB1B 1TNXA 1JC2A 3HCMA 1GGZA 2H2KA 2NXQA 1AUIB 3TS5B 1OMRA 2BNXA 4PHMA 3CZ0A 2ZNEA 1QATA 2KGBC 1K93D 1KFUS 2SCPA 5FI2A 1K9KA 4JKTA 3AAKA 2HQ8A 1TTXA 2JRFA 5J3XA 5CSFA 4IL1A 2JOJA 1B8CA 4YGDB 1OW4A 2AUCA 2ZRTA 3JVTC 2WNDA 2ZNDA 4JD9A 3RLZA 2BE4A 3S0BA 3EK7A 4ORAB 1LINA 4DUQA 1DTLA 1BU3A 3PATA 1F71A 1K95A 3CZ2A 1K8UA 5CSNA 3WHUB 3V2LA 5FYXA 1S6IA 3CDNA 3DF0A 2ZKMX 3I5FB 2HETA 1ALWA 2LVVA 4CLNA 1JFJA 1LKJA 2KQ6A 5D69A 3M0WA 1M39A 1M46A 4XJKB 3OB2B 2KYFA 3B87A 4I5KA 4ZCUA 2K8MB 3TDZA 1DQEA 1RTP1 2JT3A 1CDLA 1QXPA 4OR9B 3VRQA 4UPGA 3GK1A 3TUYC 1WRKA 5D3OA 1IGVA 1KK7Z 2KFHA 3SG4A 4MEWA 5DKNA 1CMGA 3OBVA 1K2HA 2JQ6A 4HSZA 1UHKA 1EL4A 1WDCB 1YX8A 2KNEA 3K1EA 2F2PA 4I5NB 2WC5A 3VB1A 4CPVA 3IF7A 3HX4A 4Q04A 1C3YA 4DIRA 2JWWA 1DJXA 1TOPA 2GV5A 3O78A 1PSBA 1QLSA 4JWQA 2P6BB 4M2QA 1QX7A 2WCEA 2WCHA 3NHTA 2I94A 4PE4A 1YURA 1JWDA 1CFFA 2QACA 2L2CA 3SG3A 2PQLA 3GK4X 3B6XA 2BCBA 3EK8A 1SPYA 1KWOC 4PHNA 1H8BA 2WCJA 2L4IA 2QEBA 1DMOA 5ER5A 2K7CA 3A4UB 1N65A 2KYCA 3BYAA 5KSZA 3JTDB 2WCLA 1TWOA 2PASA 3BUXB 1SR6B 2I2RE 3CYZA 3OHMB 1F70A 2KPHA 4C0KA 2V53A 2ZN9A 3NGVA 2KAVA 3SIBA 2AAOA 2BCXA 2ZFDA 3NSIA 3O4XA 3D75A 1MF8B 1SBJA 5HKZA 1CNPA 2MAZA 3BUMB 5HYDA 4MZKA 1B4CA 4YGBB 2GGZA 4DRWA 1EG3A 2BCAA 1W7IB 1Y1XA 3IQQA 1SKTA 2K61A 3DVMA 3JVTB 2KI4B 2LMTA 3R72A 2M7NA 1HT9A 1NCZA 1WY9A 4PE0A 2Q91A 1LS8A 3D73A 1N0YA 5DICA 1YX7A 1MHOA 4JQ0D 3SG2A 1J7QA 3EG5B 1XYDA 1C3ZA 1E8AA 2ZRSA 2EGDA 4CFRA 1DJGA 1M31A 3R1VA 2H61C 1EJ3A 1YTZC 1W7JB 3BJHA 2E6WA 1GJYA 1QVIZ 1A75B 3RM1A 3WHTB 3DVEA 1SCMB 2O5GA 4PE1A 1FF1A 1FI6A 1BOCA 1UHHA 2Q4UA 2F2OA 3L47A 1QIVA 2KBIA 3C1VA 2M9GA 5HL1A
chains in the Genus database with same CATH topology
2MA2A 1C7VA 2LM5A 4M2OA 3MSEB 1SK6D 5BPJA 1QTXA 1IH0A 1KK7Y 1ZOTB 2KDHA 1NIWA 4GUKA 1X02A 3VROA 3BUWB 1S26D 1S5GZ 4MVFA 2OPOA 2DOQA 1J1DA 1Y0VH 1K94A 3I5HB 3OP0A 1UHNA 1KQMB 1CLBA 1DVIA 4DCKA 2MRDA 1JUOA 1YUSA 4NDDA 2KBMA 1DF0B 3AKBA 5AFPA 1SW8A 2KAYA 4ORBB 2VRGA 1SCVA 2LLTA 1KK8B 3IQOA 1HQVA 1NX0A 2BE6A 2JNXA 3NSLA 1SRAA 1B1GA 2COLB 3FS7A 1A4PA 2RGIA 1M63B 1TCFA 1KSMA 1DJYA 1KWOB 1SY9A 4XJKA 1CFPA 2O60A 1FW4A 1BF5A 1DGUA 1CDMA 3KF9A 4NDBA 2WORA 1LVCD 2K7OA 2KI4C 3E3RA 2KI6D 4N5XA 1SYMA 2KAXA 1S6JA 1V1GA 1QV1A 1WRLA 1XFXO 1IG5A 5CPVA 1OMDA 2LHLA 1BG1A 1MR8A 4USLA 2H61A 2AMIA 1A03A 1SCMC 3EVRA 1GGWA 3LLEA 3OX5A 3LK0A 1XFZO 3EKHA 2IS9A 2OTGB 1S3PA 4A4BA 1IRJA 1FI5A 2CT9A 1KFXL 2LAPA 2K0JA 2KFFA 2JTZA 3FWCA 4N1FA 2WCBA 2ISDA 4E68A 2LVIA 1JF2A 1QX2A 3KPXA 3WXAA 1BMOA 2ZN8A 1CMFA 3I5HC 1L7ZA 1MXEA 2LUXA 2PVBA 2CTNA 3TZ1A 3VRPA 4AOMA 1KQMC 1SNLA 4ORCB 3VRRA 4YRUA 1AJ4A 4XYNA 1JBAA 1QVIY 2G2BA 3O2PA 4OV2A 2LC5A 1QX5B 2GGMA 4MRXA 2KSPA 2JU0A 1L2OC 4GAOA 4PALA 1KSOA 1JFKA 2JXCA 2WOSA 2MBXA 1XVJA 1N2DA 2TN4A 3PALA 1S1EA 1KK8C 1SL7A 1V1FA 2I18A 1AP4A 4OCIA 1B9AA 2G9BA 1TNQA 1C07A 2Y1NA 1IWQA 1JSAA 1TN4A 1S5GY 2F3YA 2LNKA 2OS8B 4YGCB 3CZTX 3AKAA 1XK4C 1IKUA 3KHEA 1FPWA 2L4HA 4TNCA 2LCPA 1RK9A 2LP3A 1DGVA 5GQQC 1PVBA 5AEQA 3PN7B 2JULA 3BOWB 4CFQA 2LVKA 2FOTA 3BQ3A 3K21A 1WLMA 4FQOA 1OZSA 2LLUA 1SL8A 1J7OA 2JXLA 3O4YA 2A4JA 1XO5A 2FCDA 1DJWA 3ICBA 2B1UA 2JZIA 3CGAA 3D0YB 2L98A 1J7PA 1NPQA 3CTNA 5CSIA 5B8IB 1A75A 1QV0A 4N1GA 5KU1A 1CDNA 3AAJA 4MRYA 2Y5IA 1EXRA 2OTGC 2PSRA 3SG5A 1TRFA 5HKWA 1BR1B 1KFUL 1RFJA 2MJWB 2LE9B 1G33A 1XFUO 4U8DA 1XFVO 2CXJA 4GGFC 1BT6A 4GNKB 1Q80A 1IJ6A 1YVLA 3CWGA 5D7FA 2E30A 2L50A 4MSPA 3I5IC 1KQVA 1KFXS 1AHRA 2JPTA 3VRNA 2EC6B 1NYAA 4GBAA 1J7RA 1NSHA 3TDUA 1PALA 1DF0A 2HQWA 2LMVA 3ZWHA 4MN0A 2D8NA 4PE7A 1OQPA 3SG6A 2BECA 2JT0A 1H4BA 1F55A 1G8IA 1OSAA 4QJ5B 1J1EA 2LLSA 1DJHA 1NCXA 1NX1A 2KGRA 3O6BA 2OS8C 4GGNA 1QS7A 5TNCA 2KHNA 2BL0C 1IQ3A 1BLQA 1XK4A 1B47A 3EVVA 4GPLB 5ER4X 1B8RA 2JNFA 1LA3A 1NCYA 2KFGA 3SJSA 3I5GC 1OE9B 3PN7C 2K2FA 4WRIA 5I2QA 1VRKA 2BBMA 3CR4X 4MLWA 1L2OB 1ALVA 4BY5A 2LVJA 2MHHA 1D1OA 2CCMA 1UHIA 1F4QA 2M29A 1CTRA 1K9UA 4A4CA 3EKJA 4NQGA 3NSKA 3ZNIA 2KQYA 1XA5A 2EHBA 3PLFB 2KOTA 4D1EA 3BUNB 1ZMZA 2BKHB 1WLZA 3FWBA 2LP2A 3VGOA 1YUTA 4AQJA 2MLEC 1UURA 2MLFC 1GQMA 1U5IB 4GGFA 3QRXA 4M2PA 1Y1AA 2NZ0A 1CDPA 3FIAA 4YI9A 5PALA 2WCFA 2K7DA 4MZJA 2JT8A 1BJFA 3CS1A 1CKKA 4HREE 1G4YR 2PALA 2HF5A 3BUOB 2EC6C 3WNXB 1TIZA 2WC8A 1IJ5A 2CBLA 4F0ZB 4CIDA 5JOLA 5AXIA 1A29A 1OZOA 1Y6WA 2LMUA 1PULA 1B7TZ 3CR2A 1TNPA 4AQIA 1F4OA 3DVKA 3NXAA 2LHIA 4HRHA 3PFVA 2L0PA 2FCEA 1S6CA 1S36A 5G08A 4MBEA 1UWOA 1ZUZA 2F33A 1XFWO 4ZCVA 3OX6A 4OVNF 5F6TA 1MUXA 5HLOA 5I2OA 3I5IB 5AANA 2BKIB 1RWYA 4WQ3A 3BOWA 5HLVA 2L51A 1TNWA 1OMVA 4PHJA 2F3ZA 1CM1A 2Y4QA 1QLKA 2I7AA 1YRTB 2FJUB 4YBHB 1ZACA 1RJVA 5AERA 1UHJA 1NX3A 4I5JA 3SIAA 4L9MA 1YVHA 4NDCA 1RROA 2M0RA 3D0YA 1PRWA 1NUBA 1NWDA 4FTGA 4YGEB 1WRZA 2CNPA 1QASA 3PSRA 1NX2A 4PCWA 2Y1MA 1QIWA 2BL0B 2PRUA 3EVUA 4MZLA 3H4SE 1CB1A 3A8RA 3CLNA 1YRUB 3DF0B 3I5GB 4JPZB 3SG7A 1YR5A 2M97A 1CM4A 1C7WA 5HKYA 1MXLC 2K7BA 1TCOB 4BY4A 4YI8A 1XFYO 1AJ5A 3TS5C 1LA0A 4HRGA 1ZFSA 3KO0A 5KTYA 5CSJA 1F8HA 1OOJA 3DVJA 1CLLA 4DS7A 1DJZA 5DKQA 3D10A 2M3WA 1B8LA 1A2XA 2NLNA 2L2EA 2M49B 4GFTA 3CR5X 5IBWA 3LCPC 1SL9A 1YUUA 2M1KB 4I5LB 4C0JA 2JTTA 3EK4A 1KCYA 1RECA 1SMGA 2HPSA 1UP5A 1MWNA 3I5FC 2BBNA 3DD4A 4R1EA 4ETOA 5K89A 2LV7A 3BXKA 1PK0D 1B7TY 1LXFC 2M1UA 3LL8B 4PDZA 1M45A 4ICBA 3PM8A 2M7LA 2M8UA 2F8PA 1DT7B 2NCOA 1UUSA 3LK1A 4PHKA 1FBVA 5JJGA 1R6PA 4OKHA 4YGAA 1WDCC 2LANA 1EG4A 4P5OE 1BODA 1QJTA 1J55A 1ODBA 1JF0A 1EH2A 3GK2A 2JC2A 5DKRA 1U5IA 4WQ2A 5I2LA 1K90D 1PVAA 1CFCA 2L5XB 1DJIA 4QJ3B 4C0LA 1BR4B 4QJ4B 1K9PA 1K96A 2R2IA 1IQ5A 1Y1UA 2PMYA 3KEVA 4P2YB 3TUYB 1R2UA 1PSRA 1AVSA 3TDIA 2SASA 1CFDA 2LUCA 2K2AA 1NP8A 2KI6C 3JTDC 1F54A 1CLMA 2NCPA 3NSOA 5I8NA 1AK8A 1MQ1A 1SR6C 2QPTA 3GOFA 3F45A 3OB1B 1TNXA 1JC2A 3HCMA 1GGZA 2H2KA 2NXQA 1AUIB 3TS5B 1OMRA 4PHMA 2ZNEA 1QATA 2KGBC 1K93D 1KFUS 2SCPA 1K9KA 3AAKA 2HQ8A 1TTXA 2JRFA 5J3XA 5CSFA 4IL1A 2JOJA 1B8CA 4YGDB 2AUCA 2ZRTA 3JVTC 2WNDA 2ZNDA 3RLZA 2BE4A 3EK7A 4ORAB 1LINA 4DUQA 1DTLA 1BU3A 3PATA 1F71A 1K95A 1K8UA 5CSNA 3WHUB 5FYXA 1S6IA 3DF0A 2ZKMX 3I5FB 2HETA 1ALWA 2LVVA 4CLNA 1JFJA 1LKJA 2KQ6A 5D69A 3M0WA 1M39A 1M46A 4XJKB 3OB2B 2KYFA 4I5KA 4ZCUA 2K8MB 3TDZA 1RTP1 2JT3A 1CDLA 1QXPA 4OR9B 3VRQA 4UPGA 3GK1A 3TUYC 1WRKA 1IGVA 1KK7Z 2KFHA 3SG4A 4MEWA 5DKNA 1CMGA 1K2HA 2JQ6A 4HSZA 1UHKA 1EL4A 1WDCB 1YX8A 2KNEA 2F2PA 4I5NB 4CPVA 3IF7A 3HX4A 4Q04A 4DIRA 2JWWA 1DJXA 1TOPA 2GV5A 3O78A 1PSBA 1QLSA 4JWQA 2P6BB 4M2QA 1QX7A 2WCEA 2I94A 4PE4A 1YURA 1JWDA 1CFFA 2QACA 3SG3A 3GK4X 2BCBA 3EK8A 1SPYA 1KWOC 4PHNA 1H8BA 2L4IA 1DMOA 5ER5A 2K7CA 3A4UB 1N65A 2KYCA 3BYAA 5KSZA 3JTDB 2PASA 3BUXB 1SR6B 2I2RE 3OHMB 1F70A 4C0KA 2V53A 2ZN9A 2KAVA 3SIBA 2AAOA 2BCXA 2ZFDA 3NSIA 1MF8B 1SBJA 5HKZA 1CNPA 2MAZA 3BUMB 5HYDA 4MZKA 1B4CA 4YGBB 2GGZA 4DRWA 1EG3A 2BCAA 1W7IB 1Y1XA 3IQQA 1SKTA 2K61A 3DVMA 3JVTB 2KI4B 2LMTA 2M7NA 1HT9A 1NCZA 1WY9A 4PE0A 2Q91A 3SG2A 1N0YA 1YX7A 1MHOA 4JQ0D 1J7QA 1XYDA 2ZRSA 1E8AA 4CFRA 2EGDA 1DJGA 1M31A 2H61C 1EJ3A 1YTZC 1W7JB 2E6WA 1GJYA 1QVIZ 1A75B 3RM1A 3WHTB 3DVEA 1SCMB 2O5GA 4PE1A 1FF1A 1FI6A 1BOCA 1UHHA 2Q4UA 2F2OA 1QIVA 2KBIA 3C1VA 2M9GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MA2 A;  1C7V A;  2LM5 A;  4M2O A;  3MSE B;  1SK6 D;  5BPJ A;  1QTX A;  1IH0 A;  1KK7 Y;  1ZOT B;  2KDH A;  1NIW A;  4GUK A;  1X02 A;  3VRO A;  3BUW B;  1S26 D;  1S5G Z;  4MVF A;  2OPO A;  2DOQ A;  1J1D A;  1Y0V H;  1K94 A;  3I5H B;  3OP0 A;  1UHN A;  1KQM B;  1CLB A;  1DVI A;  4DCK A;  2MRD A;  1JUO A;  1YUS A;  4NDD A;  2KBM A;  1DF0 B;  3AKB A;  5AFP A;  1SW8 A;  2KAY A;  4ORB B;  2VRG A;  1SCV A;  2LLT A;  1KK8 B;  3IQO A;  1HQV A;  1NX0 A;  2BE6 A;  2JNX A;  3NSL A;  1SRA A;  1B1G A;  2COL B;  3FS7 A;  1A4P A;  2RGI A;  1M63 B;  1TCF A;  1KSM A;  1DJY A;  1KWO B;  1SY9 A;  4XJK A;  1CFP A;  2O60 A;  1FW4 A;  1BF5 A;  1DGU A;  1CDM A;  3KF9 A;  4NDB A;  2WOR A;  1LVC D;  2K7O A;  2KI4 C;  3E3R A;  2KI6 D;  4N5X A;  1SYM A;  2KAX A;  1S6J A;  1V1G A;  1QV1 A;  1WRL A;  1XFX O;  1IG5 A;  5CPV A;  1OMD A;  2LHL A;  1BG1 A;  1MR8 A;  4USL A;  2H61 A;  2AMI A;  1A03 A;  1SCM C;  3EVR A;  1GGW A;  3LLE A;  3OX5 A;  3LK0 A;  1XFZ O;  3EKH A;  2IS9 A;  2OTG B;  1S3P A;  4A4B A;  1IRJ A;  1FI5 A;  2CT9 A;  1KFX L;  2LAP A;  2K0J A;  2KFF A;  2JTZ A;  3FWC A;  4N1F A;  2WCB A;  2ISD A;  4E68 A;  2LVI A;  1JF2 A;  1QX2 A;  3KPX A;  3WXA A;  1BMO A;  2ZN8 A;  1CMF A;  3I5H C;  1L7Z A;  1MXE A;  2LUX A;  2PVB A;  2CTN A;  3TZ1 A;  3VRP A;  4AOM A;  1KQM C;  1SNL A;  4ORC B;  3VRR A;  4YRU A;  1AJ4 A;  4XYN A;  1JBA A;  1QVI Y;  2G2B A;  3O2P A;  4OV2 A;  2LC5 A;  1QX5 B;  2GGM A;  4MRX A;  2KSP A;  2JU0 A;  1L2O C;  4GAO A;  4PAL A;  1KSO A;  1JFK A;  2JXC A;  2WOS A;  2MBX A;  1XVJ A;  1N2D A;  2TN4 A;  3PAL A;  1S1E A;  1KK8 C;  1SL7 A;  1V1F A;  2I18 A;  1AP4 A;  4OCI A;  1B9A A;  2G9B A;  1TNQ A;  1C07 A;  2Y1N A;  1IWQ A;  1JSA A;  1TN4 A;  1S5G Y;  2F3Y A;  2LNK A;  2OS8 B;  4YGC B;  3CZT X;  3AKA A;  1XK4 C;  1IKU A;  3KHE A;  1FPW A;  2L4H A;  4TNC A;  2LCP A;  1RK9 A;  2LP3 A;  1DGV A;  5GQQ C;  1PVB A;  5AEQ A;  3PN7 B;  2JUL A;  3BOW B;  4CFQ A;  2LVK A;  2FOT A;  3BQ3 A;  3K21 A;  1WLM A;  4FQO A;  1OZS A;  2LLU A;  1SL8 A;  1J7O A;  2JXL A;  3O4Y A;  2A4J A;  1XO5 A;  2FCD A;  1DJW A;  3ICB A;  2B1U A;  2JZI A;  3CGA A;  3D0Y B;  2L98 A;  1J7P A;  1NPQ A;  3CTN A;  5CSI A;  5B8I B;  1A75 A;  1QV0 A;  4N1G A;  5KU1 A;  1CDN A;  3AAJ A;  4MRY A;  2Y5I A;  1EXR A;  2OTG C;  2PSR A;  3SG5 A;  1TRF A;  5HKW A;  1BR1 B;  1KFU L;  1RFJ A;  2MJW B;  2LE9 B;  1G33 A;  1XFU O;  4U8D A;  1XFV O;  2CXJ A;  4GGF C;  1BT6 A;  4GNK B;  1Q80 A;  1IJ6 A;  1YVL A;  3CWG A;  5D7F A;  2E30 A;  2L50 A;  4MSP A;  3I5I C;  1KQV A;  1KFX S;  1AHR A;  2JPT A;  3VRN A;  2EC6 B;  1NYA A;  4GBA A;  1J7R A;  1NSH A;  3TDU A;  1PAL A;  1DF0 A;  2HQW A;  2LMV A;  3ZWH A;  4MN0 A;  2D8N A;  4PE7 A;  1OQP A;  3SG6 A;  2BEC A;  2JT0 A;  1H4B A;  1F55 A;  1G8I A;  1OSA A;  4QJ5 B;  1J1E A;  2LLS A;  1DJH A;  1NCX A;  1NX1 A;  2KGR A;  3O6B A;  2OS8 C;  4GGN A;  1QS7 A;  5TNC A;  2KHN A;  2BL0 C;  1IQ3 A;  1BLQ A;  1XK4 A;  1B47 A;  3EVV A;  4GPL B;  5ER4 X;  1B8R A;  2JNF A;  1LA3 A;  1NCY A;  2KFG A;  3SJS A;  3I5G C;  1OE9 B;  3PN7 C;  2K2F A;  4WRI A;  5I2Q A;  1VRK A;  2BBM A;  3CR4 X;  4MLW A;  1L2O B;  1ALV A;  4BY5 A;  2LVJ A;  2MHH A;  1D1O A;  2CCM A;  1UHI A;  1F4Q A;  2M29 A;  1CTR A;  1K9U A;  4A4C A;  3EKJ A;  4NQG A;  3NSK A;  3ZNI A;  2KQY A;  1XA5 A;  2EHB A;  3PLF B;  2KOT A;  4D1E A;  3BUN B;  1ZMZ A;  2BKH B;  1WLZ A;  3FWB A;  2LP2 A;  3VGO A;  1YUT A;  4AQJ A;  2MLE C;  1UUR A;  2MLF C;  1GQM A;  1U5I B;  4GGF A;  3QRX A;  4M2P A;  1Y1A A;  2NZ0 A;  1CDP A;  3FIA A;  4YI9 A;  5PAL A;  2WCF A;  2K7D A;  4MZJ A;  2JT8 A;  1BJF A;  3CS1 A;  1CKK A;  4HRE E;  1G4Y R;  2PAL A;  2HF5 A;  3BUO B;  2EC6 C;  3WNX B;  1TIZ A;  2WC8 A;  1IJ5 A;  2CBL A;  4F0Z B;  4CID A;  5JOL A;  5AXI A;  1A29 A;  1OZO A;  1Y6W A;  2LMU A;  1PUL A;  1B7T Z;  3CR2 A;  1TNP A;  4AQI A;  1F4O A;  3DVK A;  3NXA A;  2LHI A;  4HRH A;  3PFV A;  2L0P A;  2FCE A;  1S6C A;  1S36 A;  5G08 A;  4MBE A;  1UWO A;  1ZUZ A;  2F33 A;  1XFW O;  4ZCV A;  3OX6 A;  4OVN F;  5F6T A;  1MUX A;  5HLO A;  5I2O A;  3I5I B;  5AAN A;  2BKI B;  1RWY A;  4WQ3 A;  3BOW A;  5HLV A;  2L51 A;  1TNW A;  1OMV A;  4PHJ A;  2F3Z A;  1CM1 A;  2Y4Q A;  1QLK A;  2I7A A;  1YRT B;  2FJU B;  4YBH B;  1ZAC A;  1RJV A;  5AER A;  1UHJ A;  1NX3 A;  4I5J A;  3SIA A;  4L9M A;  1YVH A;  4NDC A;  1RRO A;  2M0R A;  3D0Y A;  1PRW A;  1NUB A;  1NWD A;  4FTG A;  4YGE B;  1WRZ A;  2CNP A;  1QAS A;  3PSR A;  1NX2 A;  4PCW A;  2Y1M A;  1QIW A;  2BL0 B;  2PRU A;  3EVU A;  4MZL A;  3H4S E;  1CB1 A;  3A8R A;  3CLN A;  1YRU B;  3DF0 B;  3I5G B;  4JPZ B;  3SG7 A;  1YR5 A;  2M97 A;  1CM4 A;  1C7W A;  5HKY A;  1MXL C;  2K7B A;  1TCO B;  4BY4 A;  4YI8 A;  1XFY O;  1AJ5 A;  3TS5 C;  1LA0 A;  4HRG A;  1ZFS A;  3KO0 A;  5KTY A;  5CSJ A;  1F8H A;  1OOJ A;  3DVJ A;  1CLL A;  4DS7 A;  1DJZ A;  5DKQ A;  3D10 A;  2M3W A;  1B8L A;  1A2X A;  2NLN A;  2L2E A;  2M49 B;  4GFT A;  3CR5 X;  5IBW A;  3LCP C;  1SL9 A;  1YUU A;  2M1K B;  4I5L B;  4C0J A;  2JTT A;  3EK4 A;  1KCY A;  1REC A;  1SMG A;  2HPS A;  1UP5 A;  1MWN A;  3I5F C;  2BBN A;  3DD4 A;  4R1E A;  4ETO A;  5K89 A;  2LV7 A;  3BXK A;  1PK0 D;  1B7T Y;  1LXF C;  2M1U A;  3LL8 B;  4PDZ A;  1M45 A;  4ICB A;  3PM8 A;  2M7L A;  2M8U A;  2F8P A;  1DT7 B;  2NCO A;  1UUS A;  3LK1 A;  4PHK A;  1FBV A;  5JJG A;  1R6P A;  4OKH A;  4YGA A;  1WDC C;  2LAN A;  1EG4 A;  4P5O E;  1BOD A;  1QJT A;  1J55 A;  1ODB A;  1JF0 A;  1EH2 A;  3GK2 A;  2JC2 A;  5DKR A;  1U5I A;  4WQ2 A;  5I2L A;  1K90 D;  1PVA A;  1CFC A;  2L5X B;  1DJI A;  4QJ3 B;  4C0L A;  1BR4 B;  4QJ4 B;  1K9P A;  1K96 A;  2R2I A;  1IQ5 A;  1Y1U A;  2PMY A;  3KEV A;  4P2Y B;  3TUY B;  1R2U A;  1PSR A;  1AVS A;  3TDI A;  2SAS A;  1CFD A;  2LUC A;  2K2A A;  1NP8 A;  2KI6 C;  3JTD C;  1F54 A;  1CLM A;  2NCP A;  3NSO A;  5I8N A;  1AK8 A;  1MQ1 A;  1SR6 C;  2QPT A;  3GOF A;  3F45 A;  3OB1 B;  1TNX A;  1JC2 A;  3HCM A;  1GGZ A;  2H2K A;  2NXQ A;  1AUI B;  3TS5 B;  1OMR A;  4PHM A;  2ZNE A;  1QAT A;  2KGB C;  1K93 D;  1KFU S;  2SCP A;  1K9K A;  3AAK A;  2HQ8 A;  1TTX A;  2JRF A;  5J3X A;  5CSF A;  4IL1 A;  2JOJ A;  1B8C A;  4YGD B;  2AUC A;  2ZRT A;  3JVT C;  2WND A;  2ZND A;  3RLZ A;  2BE4 A;  3EK7 A;  4ORA B;  1LIN A;  4DUQ A;  1DTL A;  1BU3 A;  3PAT A;  1F71 A;  1K95 A;  1K8U A;  5CSN A;  3WHU B;  5FYX A;  1S6I A;  3DF0 A;  2ZKM X;  3I5F B;  2HET A;  1ALW A;  2LVV A;  4CLN A;  1JFJ A;  1LKJ A;  2KQ6 A;  5D69 A;  3M0W A;  1M39 A;  1M46 A;  4XJK B;  3OB2 B;  2KYF A;  4I5K A;  4ZCU A;  2K8M B;  3TDZ A;  1RTP 1;  2JT3 A;  1CDL A;  1QXP A;  4OR9 B;  3VRQ A;  4UPG A;  3GK1 A;  3TUY C;  1WRK A;  1IGV A;  1KK7 Z;  2KFH A;  3SG4 A;  4MEW A;  5DKN A;  1CMG A;  1K2H A;  2JQ6 A;  4HSZ A;  1UHK A;  1EL4 A;  1WDC B;  1YX8 A;  2KNE A;  2F2P A;  4I5N B;  4CPV A;  3IF7 A;  3HX4 A;  4Q04 A;  4DIR A;  2JWW A;  1DJX A;  1TOP A;  2GV5 A;  3O78 A;  1PSB A;  1QLS A;  4JWQ A;  2P6B B;  4M2Q A;  1QX7 A;  2WCE A;  2I94 A;  4PE4 A;  1YUR A;  1JWD A;  1CFF A;  2QAC A;  3SG3 A;  3GK4 X;  2BCB A;  3EK8 A;  1SPY A;  1KWO C;  4PHN A;  1H8B A;  2L4I A;  1DMO A;  5ER5 A;  2K7C A;  3A4U B;  1N65 A;  2KYC A;  3BYA A;  5KSZ A;  3JTD B;  2PAS A;  3BUX B;  1SR6 B;  2I2R E;  3OHM B;  1F70 A;  4C0K A;  2V53 A;  2ZN9 A;  2KAV A;  3SIB A;  2AAO A;  2BCX A;  2ZFD A;  3NSI A;  1MF8 B;  1SBJ A;  5HKZ A;  1CNP A;  2MAZ A;  3BUM B;  5HYD A;  4MZK A;  1B4C A;  4YGB B;  2GGZ A;  4DRW A;  1EG3 A;  2BCA A;  1W7I B;  1Y1X A;  3IQQ A;  1SKT A;  2K61 A;  3DVM A;  3JVT B;  2KI4 B;  2LMT A;  2M7N A;  1HT9 A;  1NCZ A;  1WY9 A;  4PE0 A;  2Q91 A;  3SG2 A;  1N0Y A;  1YX7 A;  1MHO A;  4JQ0 D;  1J7Q A;  1XYD A;  2ZRS A;  1E8A A;  4CFR A;  2EGD A;  1DJG A;  1M31 A;  2H61 C;  1EJ3 A;  1YTZ C;  1W7J B;  2E6W A;  1GJY A;  1QVI Z;  1A75 B;  3RM1 A;  3WHT B;  3DVE A;  1SCM B;  2O5G A;  4PE1 A;  1FF1 A;  1FI6 A;  1BOC A;  1UHH A;  2Q4U A;  2F2O A;  1QIV A;  2KBI A;  3C1V A;  2M9G A; 
#chains in the Genus database with same CATH topology
 2MA2 A;  1C7V A;  2LM5 A;  4M2O A;  3MSE B;  2QEV A;  1SK6 D;  5BPJ A;  1QTX A;  3S0A A;  1KK7 Y;  1ZOT B;  1IH0 A;  2KDH A;  1NIW A;  4GUK A;  1X02 A;  3VRO A;  3BUW B;  1S26 D;  1S5G Z;  4MVF A;  2OPO A;  2DOQ A;  1J1D A;  1Y0V H;  1K94 A;  3I5H B;  3OP0 A;  1UHN A;  1KQM B;  1CLB A;  1DVI A;  2QEH A;  4DCK A;  2MRD A;  1JUO A;  1YUS A;  4NDD A;  3QME A;  2KBM A;  1DF0 B;  3AKB A;  5AFP A;  1SW8 A;  2KAY A;  4ORB B;  2VRG A;  1SCV A;  2LLT A;  1KK8 B;  3IQO A;  1HQV A;  1NX0 A;  2BE6 A;  2JNX A;  3NSL A;  1SRA A;  1B1G A;  2COL B;  3FS7 A;  2KLE A;  1A4P A;  2RGI A;  1M63 B;  1TCF A;  1KSM A;  3DYE A;  1DJY A;  1KWO B;  1OOI X;  1SY9 A;  3B86 A;  4XJK A;  1CFP A;  2O60 A;  1FW4 A;  4KYN A;  1DGU A;  2GTE A;  1CDM A;  3KF9 A;  4NDB A;  1BF5 A;  2WOR A;  3R1P A;  1LVC D;  2K7O A;  2KI4 C;  3E3R A;  2KI6 D;  4N5X A;  1T14 A;  1SYM A;  3UO9 A;  2KAX A;  1S6J A;  1V1G A;  1OOG A;  2H8V A;  1QV1 A;  1WRL A;  1XFX O;  1IG5 A;  3Q8I A;  1OMD A;  5CPV A;  2LHL A;  3SS5 A;  1BG1 A;  1MR8 A;  4USL A;  2H61 A;  2AMI A;  3PJI A;  1A03 A;  1SCM C;  3EVR A;  1GGW A;  3LLE A;  3OX5 A;  3LK0 A;  1XFZ O;  1ORG A;  3EKH A;  2IS9 A;  2OTG B;  1S3P A;  4A4B A;  1IRJ A;  1FI5 A;  2CT9 A;  1KFX L;  2LAP A;  2K0J A;  2KFF A;  2JTZ A;  3FWC A;  4N1F A;  2WCB A;  2ISD A;  4E68 A;  2LVI A;  1JF2 A;  1QX2 A;  2WC6 A;  2JPO A;  3KPX A;  3WXA A;  1SSE B;  1BMO A;  2PYQ A;  2ZN8 A;  1CMF A;  3I5H C;  1L7Z A;  1MXE A;  2LUX A;  2PVB A;  1W9Z A;  2CTN A;  3TZ1 A;  3FE6 A;  1KQM C;  1SNL A;  3DZT A;  4ORC B;  3VRP A;  3VRR A;  4YRU A;  1AJ4 A;  4XYN A;  1JBA A;  1QVI Y;  2G2B A;  2KLD A;  3O2P A;  4OV2 A;  2QDI A;  2LC5 A;  1QX5 B;  2GGM A;  4MRX A;  3S0E A;  2KSP A;  2JU0 A;  1L2O C;  4GAO A;  4PAL A;  1KSO A;  5FI7 A;  1Z4H A;  3SS4 A;  1JFK A;  2JXC A;  2WOS A;  2MBX A;  1XVJ A;  1N2D A;  2TN4 A;  3PAL A;  3UNW A;  1S1E A;  1KK8 C;  1SL7 A;  1V1F A;  2I18 A;  3FE8 A;  3IVT A;  4OCI A;  1AP4 A;  1B9A A;  2G9B A;  1TNQ A;  1C07 A;  2Y1N A;  1IWQ A;  1JSA A;  1TN4 A;  1S5G Y;  2F3Y A;  2LNK A;  2OS8 B;  3FE9 A;  4YGC B;  3CZT X;  3AKA A;  1XK4 C;  1TUZ A;  3KHE A;  1IKU A;  1FPW A;  2L4H A;  4TNC A;  2LCP A;  1RK9 A;  2LP3 A;  1DGV A;  5GQQ C;  1PVB A;  5AEQ A;  3PN7 B;  2JUL A;  3BOW B;  4CFQ A;  2LVK A;  4IJ7 A;  2FOT A;  3BQ3 A;  3K21 A;  1WLM A;  4FQO A;  1OZS A;  2LLU A;  1SL8 A;  1J7O A;  2JXL A;  3O4Y A;  2A4J A;  1XO5 A;  2FCD A;  2QEO A;  1DJW A;  3ICB A;  2B1U A;  2JZI A;  3CGA A;  3D0Y B;  2L98 A;  1J7P A;  1NPQ A;  3CTN A;  5CSI A;  5B8I B;  1A75 A;  1QV0 A;  4N1G A;  5KU1 A;  1CDN A;  3AAJ A;  4MRY A;  2Y5I A;  1EXR A;  2OTG C;  2PSR A;  3SG5 A;  1TRF A;  5HKW A;  1OOF A;  1BR1 B;  1KFU L;  1RFJ A;  2MJW B;  2LE9 B;  1G33 A;  1XFU O;  3BFH A;  4U8D A;  1XFV O;  2CXJ A;  4GGF C;  1BT6 A;  4GNK B;  1Q80 A;  1XFR A;  1IJ6 A;  1YVL A;  2P71 A;  3CWG A;  5D7F A;  2E30 A;  2L50 A;  4MSP A;  3I5I C;  1KQV A;  1KFX S;  1AHR A;  2JPT A;  3VRN A;  2EC6 B;  1NYA A;  4GBA A;  1J7R A;  1NSH A;  3TDU A;  1PAL A;  1DF0 A;  2HQW A;  1P28 A;  2LMV A;  3ZWH A;  3R1O A;  4MN0 A;  2D8N A;  4PE7 A;  1OQP A;  3SG6 A;  1DEK A;  2BEC A;  2JT0 A;  1H4B A;  3NHI A;  1F55 A;  1G8I A;  1OSA A;  4QJ5 B;  1J1E A;  2LLS A;  1DJH A;  1NCX A;  1NX1 A;  2KGR A;  3O6B A;  2OS8 C;  4GGN A;  4F7F A;  1QS7 A;  1Z2C B;  5TNC A;  2KHN A;  2BL0 C;  1IQ3 A;  1BLQ A;  1XK4 A;  1B47 A;  3EVV A;  4GPL B;  5ER4 X;  3S0G A;  1B8R A;  2JNF A;  1LA3 A;  1NCY A;  2KFG A;  3SJS A;  1GM0 A;  3I5G C;  1OE9 B;  3PN7 C;  2K2F A;  3CAB A;  4PT1 A;  4WRI A;  5I2Q A;  1VRK A;  2BBM A;  3CR4 X;  4MLW A;  1L2O B;  1ALV A;  4BY5 A;  2LVJ A;  1QWV A;  2MHH A;  1D1O A;  2CCM A;  4INW A;  1UHI A;  1F4Q A;  2M29 A;  1CTR A;  1K9U A;  4A4C A;  3EKJ A;  4NQG A;  3NSK A;  3S0D A;  3B88 A;  3ZNI A;  2KQY A;  1XA5 A;  3BFA A;  2WCK A;  2EHB A;  3PLF B;  2KOT A;  3N7H A;  4D1E A;  3BUN B;  1ZMZ A;  2BKH B;  1WLZ A;  3DY9 A;  2LP2 A;  3FWB A;  3VGO A;  1YUT A;  3L4A A;  2MLE C;  1UUR A;  4AQJ A;  2MLF C;  1GQM A;  1U5I B;  2BAP A;  1TUJ A;  4GGF A;  3QRX A;  4M2P A;  1Y1A A;  2NZ0 A;  1CDP A;  3FIA A;  4YI9 A;  5PAL A;  2WCF A;  2K7D A;  4MZJ A;  2JT8 A;  1BJF A;  3CS1 A;  1CKK A;  4HRE E;  3D78 A;  3D74 A;  1G4Y R;  2PAL A;  2HF5 A;  3BUO B;  2EC6 C;  3WNX B;  1TIZ A;  2WC8 A;  1IJ5 A;  2CBL A;  4F0Z B;  4CID A;  5JOL A;  5EL2 A;  5AXI A;  1A29 A;  1OZO A;  1Y6W A;  2LMU A;  1PUL A;  1B7T Z;  3CR2 A;  1TNP A;  4AQI A;  1F4O A;  3DVK A;  3NXA A;  2LHI A;  4HRH A;  3PFV A;  2L0P A;  2FCE A;  1S6C A;  5FI6 A;  1S36 A;  5G08 A;  3D77 A;  4MBE A;  2YGU A;  1UWO A;  1ZUZ A;  2F33 A;  2P70 A;  1XFW O;  4ZCV A;  3OX6 A;  4OVN F;  2L5Y A;  5F6T A;  1MUX A;  5HLO A;  5I2O A;  3I5I B;  5AAN A;  2BKI B;  5I94 A;  1RWY A;  4WQ3 A;  3BOW A;  5HLV A;  2L51 A;  1TNW A;  1OMV A;  4PHJ A;  2F3Z A;  1CM1 A;  2Y4Q A;  1QLK A;  2I7A A;  1YRT B;  2FJU B;  4YBH B;  1ZAC A;  1RJV A;  4AOM A;  5AER A;  1UHJ A;  1NX3 A;  4I5J A;  3SIA A;  4L9M A;  1YVH A;  4NDC A;  1RRO A;  2M0R A;  3D0Y A;  1PRW A;  1NUB A;  1NWD A;  3PM2 A;  4FTG A;  4YGE B;  1WRZ A;  2CNP A;  1QAS A;  3PSR A;  1NX2 A;  4PCW A;  2Y1M A;  1QIW A;  2BL0 B;  2PRU A;  3EVU A;  4MZL A;  3H4S E;  1CB1 A;  3A8R A;  3CLN A;  1YRU B;  3DF0 B;  3I5G B;  4JPZ B;  3SG7 A;  1YR5 A;  2M97 A;  1CM4 A;  1C7W A;  5HKY A;  1MXL C;  2K7B A;  1TCO B;  4BY4 A;  4YI8 A;  1XFY O;  1AJ5 A;  3TS5 C;  1LA0 A;  3D76 A;  3BFB A;  4HRG A;  1ZFS A;  3KO0 A;  5KTY A;  5CSJ A;  1F8H A;  1OOJ A;  2WCM A;  3RZS A;  3DVJ A;  1CLL A;  4DS7 A;  3S0F A;  1DJZ A;  4INX A;  5DKQ A;  3D10 A;  2M3W A;  1B8L A;  1A2X A;  2NLN A;  3L4L A;  1IIO A;  2L2E A;  2ERB A;  2M49 B;  4GFT A;  3CR5 X;  5IBW A;  3LCP C;  1SL9 A;  1YUU A;  2M1K B;  4I5L B;  4C0J A;  2JTT A;  3EK4 A;  4FQT A;  1KCY A;  1REC A;  1SMG A;  2HPS A;  1UP5 A;  1MWN A;  3I5F C;  2BBN A;  3DD4 A;  4R1E A;  4ETO A;  5K89 A;  2LV7 A;  3BXK A;  1PK0 D;  1B7T Y;  1LXF C;  2M1U A;  3LL8 B;  4PDZ A;  1DC1 A;  1M45 A;  3CZ1 A;  4ICB A;  4OZD A;  3PM8 A;  2M7L A;  2M8U A;  2F8P A;  1DT7 B;  3OGN A;  2NCO A;  1UUS A;  3LK1 A;  4PHK A;  1FBV A;  3DXL A;  5JJG A;  1R6P A;  1DEL A;  4OKH A;  4YGA A;  2FJY A;  1WDC C;  2LAN A;  1EG4 A;  4P5O E;  1BOD A;  1QJT A;  1J55 A;  1ODB A;  1JF0 A;  1EH2 A;  3GK2 A;  2JC2 A;  5DKR A;  1U5I A;  1OOH A;  4WQ2 A;  5I2L A;  1K90 D;  1PVA A;  1CFC A;  3SS3 A;  2L5X B;  1DJI A;  4QJ3 B;  4C0L A;  1BR4 B;  4QJ4 B;  1K9P A;  1K96 A;  2R2I A;  1IQ5 A;  1Y1U A;  2PMY A;  3KEV A;  4P2Y B;  3TUY B;  1R2U A;  1PSR A;  1AVS A;  3TDI A;  2SAS A;  1CFD A;  3B7A A;  2LUC A;  2K60 A;  2K2A A;  1NP8 A;  2KI6 C;  3JTD C;  1F54 A;  1CLM A;  2NCP A;  3NSO A;  5I8N A;  1AK8 A;  1MQ1 A;  1SR6 C;  2QPT A;  3GOF A;  3F45 A;  3OB1 B;  1TNX A;  1JC2 A;  3HCM A;  1GGZ A;  2H2K A;  2NXQ A;  1AUI B;  3TS5 B;  1OMR A;  2BNX A;  4PHM A;  3CZ0 A;  2ZNE A;  1QAT A;  2KGB C;  1K93 D;  1KFU S;  2SCP A;  5FI2 A;  1K9K A;  4JKT A;  3AAK A;  2HQ8 A;  1TTX A;  2JRF A;  5J3X A;  5CSF A;  4IL1 A;  2JOJ A;  1B8C A;  4YGD B;  1OW4 A;  2AUC A;  2ZRT A;  3JVT C;  2WND A;  2ZND A;  4JD9 A;  3RLZ A;  2BE4 A;  3S0B A;  3EK7 A;  4ORA B;  1LIN A;  4DUQ A;  1DTL A;  1BU3 A;  3PAT A;  1F71 A;  1K95 A;  3CZ2 A;  1K8U A;  5CSN A;  3WHU B;  3V2L A;  5FYX A;  1S6I A;  3CDN A;  3DF0 A;  2ZKM X;  3I5F B;  2HET A;  1ALW A;  2LVV A;  4CLN A;  1JFJ A;  1LKJ A;  2KQ6 A;  5D69 A;  3M0W A;  1M39 A;  1M46 A;  4XJK B;  3OB2 B;  2KYF A;  3B87 A;  4I5K A;  4ZCU A;  2K8M B;  3TDZ A;  1DQE A;  1RTP 1;  2JT3 A;  1CDL A;  1QXP A;  4OR9 B;  3VRQ A;  4UPG A;  3GK1 A;  3TUY C;  1WRK A;  5D3O A;  1IGV A;  1KK7 Z;  2KFH A;  3SG4 A;  4MEW A;  5DKN A;  1CMG A;  3OBV A;  1K2H A;  2JQ6 A;  4HSZ A;  1UHK A;  1EL4 A;  1WDC B;  1YX8 A;  2KNE A;  3K1E A;  2F2P A;  4I5N B;  2WC5 A;  3VB1 A;  4CPV A;  3IF7 A;  3HX4 A;  4Q04 A;  1C3Y A;  4DIR A;  2JWW A;  1DJX A;  1TOP A;  2GV5 A;  3O78 A;  1PSB A;  1QLS A;  4JWQ A;  2P6B B;  4M2Q A;  1QX7 A;  2WCE A;  2WCH A;  3NHT A;  2I94 A;  4PE4 A;  1YUR A;  1JWD A;  1CFF A;  2QAC A;  2L2C A;  3SG3 A;  2PQL A;  3GK4 X;  3B6X A;  2BCB A;  3EK8 A;  1SPY A;  1KWO C;  4PHN A;  1H8B A;  2WCJ A;  2L4I A;  2QEB A;  1DMO A;  5ER5 A;  2K7C A;  3A4U B;  1N65 A;  2KYC A;  3BYA A;  5KSZ A;  3JTD B;  2WCL A;  1TWO A;  2PAS A;  3BUX B;  1SR6 B;  2I2R E;  3CYZ A;  3OHM B;  1F70 A;  2KPH A;  4C0K A;  2V53 A;  2ZN9 A;  3NGV A;  2KAV A;  3SIB A;  2AAO A;  2BCX A;  2ZFD A;  3NSI A;  3O4X A;  3D75 A;  1MF8 B;  1SBJ A;  5HKZ A;  1CNP A;  2MAZ A;  3BUM B;  5HYD A;  4MZK A;  1B4C A;  4YGB B;  2GGZ A;  4DRW A;  1EG3 A;  2BCA A;  1W7I B;  1Y1X A;  3IQQ A;  1SKT A;  2K61 A;  3DVM A;  3JVT B;  2KI4 B;  2LMT A;  3R72 A;  2M7N A;  1HT9 A;  1NCZ A;  1WY9 A;  4PE0 A;  2Q91 A;  1LS8 A;  3D73 A;  1N0Y A;  5DIC A;  1YX7 A;  1MHO A;  4JQ0 D;  3SG2 A;  1J7Q A;  3EG5 B;  1XYD A;  1C3Z A;  1E8A A;  2ZRS A;  2EGD A;  4CFR A;  1DJG A;  1M31 A;  3R1V A;  2H61 C;  1EJ3 A;  1YTZ C;  1W7J B;  3BJH A;  2E6W A;  1GJY A;  1QVI Z;  1A75 B;  3RM1 A;  3WHT B;  3DVE A;  1SCM B;  2O5G A;  4PE1 A;  1FF1 A;  1FI6 A;  1BOC A;  1UHH A;  2Q4U A;  2F2O A;  3L47 A;  1QIV A;  2KBI A;  3C1V A;  2M9G A;  5HL1 A; 
#chains in the Genus database with same CATH homology
 2MA2 A;  1C7V A;  2LM5 A;  4M2O A;  3MSE B;  1SK6 D;  5BPJ A;  1QTX A;  1IH0 A;  1KK7 Y;  1ZOT B;  2KDH A;  1NIW A;  4GUK A;  1X02 A;  3VRO A;  3BUW B;  1S26 D;  1S5G Z;  4MVF A;  2OPO A;  2DOQ A;  1J1D A;  1Y0V H;  1K94 A;  3I5H B;  3OP0 A;  1UHN A;  1KQM B;  1CLB A;  1DVI A;  4DCK A;  2MRD A;  1JUO A;  1YUS A;  4NDD A;  2KBM A;  1DF0 B;  3AKB A;  5AFP A;  1SW8 A;  2KAY A;  4ORB B;  2VRG A;  1SCV A;  2LLT A;  1KK8 B;  3IQO A;  1HQV A;  1NX0 A;  2BE6 A;  2JNX A;  3NSL A;  1SRA A;  1B1G A;  2COL B;  3FS7 A;  1A4P A;  2RGI A;  1M63 B;  1TCF A;  1KSM A;  1DJY A;  1KWO B;  1SY9 A;  4XJK A;  1CFP A;  2O60 A;  1FW4 A;  1BF5 A;  1DGU A;  1CDM A;  3KF9 A;  4NDB A;  2WOR A;  1LVC D;  2K7O A;  2KI4 C;  3E3R A;  2KI6 D;  4N5X A;  1SYM A;  2KAX A;  1S6J A;  1V1G A;  1QV1 A;  1WRL A;  1XFX O;  1IG5 A;  5CPV A;  1OMD A;  2LHL A;  1BG1 A;  1MR8 A;  4USL A;  2H61 A;  2AMI A;  1A03 A;  1SCM C;  3EVR A;  1GGW A;  3LLE A;  3OX5 A;  3LK0 A;  1XFZ O;  3EKH A;  2IS9 A;  2OTG B;  1S3P A;  4A4B A;  1IRJ A;  1FI5 A;  2CT9 A;  1KFX L;  2LAP A;  2K0J A;  2KFF A;  2JTZ A;  3FWC A;  4N1F A;  2WCB A;  2ISD A;  4E68 A;  2LVI A;  1JF2 A;  1QX2 A;  3KPX A;  3WXA A;  1BMO A;  2ZN8 A;  1CMF A;  3I5H C;  1L7Z A;  1MXE A;  2LUX A;  2PVB A;  2CTN A;  3TZ1 A;  3VRP A;  4AOM A;  1KQM C;  1SNL A;  4ORC B;  3VRR A;  4YRU A;  1AJ4 A;  4XYN A;  1JBA A;  1QVI Y;  2G2B A;  3O2P A;  4OV2 A;  2LC5 A;  1QX5 B;  2GGM A;  4MRX A;  2KSP A;  2JU0 A;  1L2O C;  4GAO A;  4PAL A;  1KSO A;  1JFK A;  2JXC A;  2WOS A;  2MBX A;  1XVJ A;  1N2D A;  2TN4 A;  3PAL A;  1S1E A;  1KK8 C;  1SL7 A;  1V1F A;  2I18 A;  1AP4 A;  4OCI A;  1B9A A;  2G9B A;  1TNQ A;  1C07 A;  2Y1N A;  1IWQ A;  1JSA A;  1TN4 A;  1S5G Y;  2F3Y A;  2LNK A;  2OS8 B;  4YGC B;  3CZT X;  3AKA A;  1XK4 C;  1IKU A;  3KHE A;  1FPW A;  2L4H A;  4TNC A;  2LCP A;  1RK9 A;  2LP3 A;  1DGV A;  5GQQ C;  1PVB A;  5AEQ A;  3PN7 B;  2JUL A;  3BOW B;  4CFQ A;  2LVK A;  2FOT A;  3BQ3 A;  3K21 A;  1WLM A;  4FQO A;  1OZS A;  2LLU A;  1SL8 A;  1J7O A;  2JXL A;  3O4Y A;  2A4J A;  1XO5 A;  2FCD A;  1DJW A;  3ICB A;  2B1U A;  2JZI A;  3CGA A;  3D0Y B;  2L98 A;  1J7P A;  1NPQ A;  3CTN A;  5CSI A;  5B8I B;  1A75 A;  1QV0 A;  4N1G A;  5KU1 A;  1CDN A;  3AAJ A;  4MRY A;  2Y5I A;  1EXR A;  2OTG C;  2PSR A;  3SG5 A;  1TRF A;  5HKW A;  1BR1 B;  1KFU L;  1RFJ A;  2MJW B;  2LE9 B;  1G33 A;  1XFU O;  4U8D A;  1XFV O;  2CXJ A;  4GGF C;  1BT6 A;  4GNK B;  1Q80 A;  1IJ6 A;  1YVL A;  3CWG A;  5D7F A;  2E30 A;  2L50 A;  4MSP A;  3I5I C;  1KQV A;  1KFX S;  1AHR A;  2JPT A;  3VRN A;  2EC6 B;  1NYA A;  4GBA A;  1J7R A;  1NSH A;  3TDU A;  1PAL A;  1DF0 A;  2HQW A;  2LMV A;  3ZWH A;  4MN0 A;  2D8N A;  4PE7 A;  1OQP A;  3SG6 A;  2BEC A;  2JT0 A;  1H4B A;  1F55 A;  1G8I A;  1OSA A;  4QJ5 B;  1J1E A;  2LLS A;  1DJH A;  1NCX A;  1NX1 A;  2KGR A;  3O6B A;  2OS8 C;  4GGN A;  1QS7 A;  5TNC A;  2KHN A;  2BL0 C;  1IQ3 A;  1BLQ A;  1XK4 A;  1B47 A;  3EVV A;  4GPL B;  5ER4 X;  1B8R A;  2JNF A;  1LA3 A;  1NCY A;  2KFG A;  3SJS A;  3I5G C;  1OE9 B;  3PN7 C;  2K2F A;  4WRI A;  5I2Q A;  1VRK A;  2BBM A;  3CR4 X;  4MLW A;  1L2O B;  1ALV A;  4BY5 A;  2LVJ A;  2MHH A;  1D1O A;  2CCM A;  1UHI A;  1F4Q A;  2M29 A;  1CTR A;  1K9U A;  4A4C A;  3EKJ A;  4NQG A;  3NSK A;  3ZNI A;  2KQY A;  1XA5 A;  2EHB A;  3PLF B;  2KOT A;  4D1E A;  3BUN B;  1ZMZ A;  2BKH B;  1WLZ A;  3FWB A;  2LP2 A;  3VGO A;  1YUT A;  4AQJ A;  2MLE C;  1UUR A;  2MLF C;  1GQM A;  1U5I B;  4GGF A;  3QRX A;  4M2P A;  1Y1A A;  2NZ0 A;  1CDP A;  3FIA A;  4YI9 A;  5PAL A;  2WCF A;  2K7D A;  4MZJ A;  2JT8 A;  1BJF A;  3CS1 A;  1CKK A;  4HRE E;  1G4Y R;  2PAL A;  2HF5 A;  3BUO B;  2EC6 C;  3WNX B;  1TIZ A;  2WC8 A;  1IJ5 A;  2CBL A;  4F0Z B;  4CID A;  5JOL A;  5AXI A;  1A29 A;  1OZO A;  1Y6W A;  2LMU A;  1PUL A;  1B7T Z;  3CR2 A;  1TNP A;  4AQI A;  1F4O A;  3DVK A;  3NXA A;  2LHI A;  4HRH A;  3PFV A;  2L0P A;  2FCE A;  1S6C A;  1S36 A;  5G08 A;  4MBE A;  1UWO A;  1ZUZ A;  2F33 A;  1XFW O;  4ZCV A;  3OX6 A;  4OVN F;  5F6T A;  1MUX A;  5HLO A;  5I2O A;  3I5I B;  5AAN A;  2BKI B;  1RWY A;  4WQ3 A;  3BOW A;  5HLV A;  2L51 A;  1TNW A;  1OMV A;  4PHJ A;  2F3Z A;  1CM1 A;  2Y4Q A;  1QLK A;  2I7A A;  1YRT B;  2FJU B;  4YBH B;  1ZAC A;  1RJV A;  5AER A;  1UHJ A;  1NX3 A;  4I5J A;  3SIA A;  4L9M A;  1YVH A;  4NDC A;  1RRO A;  2M0R A;  3D0Y A;  1PRW A;  1NUB A;  1NWD A;  4FTG A;  4YGE B;  1WRZ A;  2CNP A;  1QAS A;  3PSR A;  1NX2 A;  4PCW A;  2Y1M A;  1QIW A;  2BL0 B;  2PRU A;  3EVU A;  4MZL A;  3H4S E;  1CB1 A;  3A8R A;  3CLN A;  1YRU B;  3DF0 B;  3I5G B;  4JPZ B;  3SG7 A;  1YR5 A;  2M97 A;  1CM4 A;  1C7W A;  5HKY A;  1MXL C;  2K7B A;  1TCO B;  4BY4 A;  4YI8 A;  1XFY O;  1AJ5 A;  3TS5 C;  1LA0 A;  4HRG A;  1ZFS A;  3KO0 A;  5KTY A;  5CSJ A;  1F8H A;  1OOJ A;  3DVJ A;  1CLL A;  4DS7 A;  1DJZ A;  5DKQ A;  3D10 A;  2M3W A;  1B8L A;  1A2X A;  2NLN A;  2L2E A;  2M49 B;  4GFT A;  3CR5 X;  5IBW A;  3LCP C;  1SL9 A;  1YUU A;  2M1K B;  4I5L B;  4C0J A;  2JTT A;  3EK4 A;  1KCY A;  1REC A;  1SMG A;  2HPS A;  1UP5 A;  1MWN A;  3I5F C;  2BBN A;  3DD4 A;  4R1E A;  4ETO A;  5K89 A;  2LV7 A;  3BXK A;  1PK0 D;  1B7T Y;  1LXF C;  2M1U A;  3LL8 B;  4PDZ A;  1M45 A;  4ICB A;  3PM8 A;  2M7L A;  2M8U A;  2F8P A;  1DT7 B;  2NCO A;  1UUS A;  3LK1 A;  4PHK A;  1FBV A;  5JJG A;  1R6P A;  4OKH A;  4YGA A;  1WDC C;  2LAN A;  1EG4 A;  4P5O E;  1BOD A;  1QJT A;  1J55 A;  1ODB A;  1JF0 A;  1EH2 A;  3GK2 A;  2JC2 A;  5DKR A;  1U5I A;  4WQ2 A;  5I2L A;  1K90 D;  1PVA A;  1CFC A;  2L5X B;  1DJI A;  4QJ3 B;  4C0L A;  1BR4 B;  4QJ4 B;  1K9P A;  1K96 A;  2R2I A;  1IQ5 A;  1Y1U A;  2PMY A;  3KEV A;  4P2Y B;  3TUY B;  1R2U A;  1PSR A;  1AVS A;  3TDI A;  2SAS A;  1CFD A;  2LUC A;  2K2A A;  1NP8 A;  2KI6 C;  3JTD C;  1F54 A;  1CLM A;  2NCP A;  3NSO A;  5I8N A;  1AK8 A;  1MQ1 A;  1SR6 C;  2QPT A;  3GOF A;  3F45 A;  3OB1 B;  1TNX A;  1JC2 A;  3HCM A;  1GGZ A;  2H2K A;  2NXQ A;  1AUI B;  3TS5 B;  1OMR A;  4PHM A;  2ZNE A;  1QAT A;  2KGB C;  1K93 D;  1KFU S;  2SCP A;  1K9K A;  3AAK A;  2HQ8 A;  1TTX A;  2JRF A;  5J3X A;  5CSF A;  4IL1 A;  2JOJ A;  1B8C A;  4YGD B;  2AUC A;  2ZRT A;  3JVT C;  2WND A;  2ZND A;  3RLZ A;  2BE4 A;  3EK7 A;  4ORA B;  1LIN A;  4DUQ A;  1DTL A;  1BU3 A;  3PAT A;  1F71 A;  1K95 A;  1K8U A;  5CSN A;  3WHU B;  5FYX A;  1S6I A;  3DF0 A;  2ZKM X;  3I5F B;  2HET A;  1ALW A;  2LVV A;  4CLN A;  1JFJ A;  1LKJ A;  2KQ6 A;  5D69 A;  3M0W A;  1M39 A;  1M46 A;  4XJK B;  3OB2 B;  2KYF A;  4I5K A;  4ZCU A;  2K8M B;  3TDZ A;  1RTP 1;  2JT3 A;  1CDL A;  1QXP A;  4OR9 B;  3VRQ A;  4UPG A;  3GK1 A;  3TUY C;  1WRK A;  1IGV A;  1KK7 Z;  2KFH A;  3SG4 A;  4MEW A;  5DKN A;  1CMG A;  1K2H A;  2JQ6 A;  4HSZ A;  1UHK A;  1EL4 A;  1WDC B;  1YX8 A;  2KNE A;  2F2P A;  4I5N B;  4CPV A;  3IF7 A;  3HX4 A;  4Q04 A;  4DIR A;  2JWW A;  1DJX A;  1TOP A;  2GV5 A;  3O78 A;  1PSB A;  1QLS A;  4JWQ A;  2P6B B;  4M2Q A;  1QX7 A;  2WCE A;  2I94 A;  4PE4 A;  1YUR A;  1JWD A;  1CFF A;  2QAC A;  3SG3 A;  3GK4 X;  2BCB A;  3EK8 A;  1SPY A;  1KWO C;  4PHN A;  1H8B A;  2L4I A;  1DMO A;  5ER5 A;  2K7C A;  3A4U B;  1N65 A;  2KYC A;  3BYA A;  5KSZ A;  3JTD B;  2PAS A;  3BUX B;  1SR6 B;  2I2R E;  3OHM B;  1F70 A;  4C0K A;  2V53 A;  2ZN9 A;  2KAV A;  3SIB A;  2AAO A;  2BCX A;  2ZFD A;  3NSI A;  1MF8 B;  1SBJ A;  5HKZ A;  1CNP A;  2MAZ A;  3BUM B;  5HYD A;  4MZK A;  1B4C A;  4YGB B;  2GGZ A;  4DRW A;  1EG3 A;  2BCA A;  1W7I B;  1Y1X A;  3IQQ A;  1SKT A;  2K61 A;  3DVM A;  3JVT B;  2KI4 B;  2LMT A;  2M7N A;  1HT9 A;  1NCZ A;  1WY9 A;  4PE0 A;  2Q91 A;  3SG2 A;  1N0Y A;  1YX7 A;  1MHO A;  4JQ0 D;  1J7Q A;  1XYD A;  2ZRS A;  1E8A A;  4CFR A;  2EGD A;  1DJG A;  1M31 A;  2H61 C;  1EJ3 A;  1YTZ C;  1W7J B;  2E6W A;  1GJY A;  1QVI Z;  1A75 B;  3RM1 A;  3WHT B;  3DVE A;  1SCM B;  2O5G A;  4PE1 A;  1FF1 A;  1FI6 A;  1BOC A;  1UHH A;  2Q4U A;  2F2O A;  1QIV A;  2KBI A;  3C1V A;  2M9G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...