1YUUA

Solution structure of calcium-s100a13
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
98
structure length
98
Chain Sequence
MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords S100 calcium-binding protein A13
publication title Structural Interplay between Calcium(II) and Copper(II) Binding to S100A13 Protein
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1yuuA00
4DRWA 1J7PA 5G08A 1IRJA 1SNLA 1ZOTB 4ZCUA 1WDCC 4UPGA 4E68A 2BBMA 3VROA 4CPVA 1DF0B 3SG5A 3OX6A 1RFJA 3QRXA 3VRNA 2M3WA 3RLZA 4ORBB 5AERA 5HKZA 1QVIY 4HRGA 4PHMA 2F8PA 2JT8A 1YRTB 2B1UA 5KTYA 5PALA 4QJ5B 1A29A 2E6WA 3SG4A 1KK7Y 1SPYA 5KSZA 1M39A 3DVJA 5CSFA 1CM1A 2JT3A 2KBMA 2NLNA 4JQ0D 2GGZA 3SG3A 1DGUA 1QV0A 1AJ4A 3OHMB 4DIRA 1NWDA 2EGDA 1SL7A 1IJ5A 1Y6WA 3BYAA 3I5IC 4N1FA 1CNPA 1YVLA 1TRFA 3I5GB 2L4IA 3PALA 5DKQA 1S36A 1XVJA 1OOJA 1QX2A 1C07A 2BKHB 4AQJA 1CLLA 1XK4A 4DCKA 1KFUL 4MSPA 2LNKA 3VRQA 3DF0B 1MUXA 3TUYC 2K7BA 1K8UA 2LMUA 5IBWA 1DJHA 3NSLA 2PMYA 4MBEA 1YURA 1SR6B 2LVJA 1DMOA 1NCXA 2L4HA 2BKIB 2L50A 1LINA 1MQ1A 2BCXA 1NP8A 2JT0A 2G9BA 2JXLA 5CSIA 1A03A 1DJWA 1XFYO 2OS8C 2WCBA 4PHNA 3VRPA 1AVSA 4XJKA 4MZLA 1DF0A 4U8DA 4ETOA 1MXEA 3I5IB 2PASA 1FF1A 2MJWB 2PALA 1NUBA 1A75B 1OQPA 1SY9A 1K95A 2VRGA 4I5NB 4MVFA 1K2HA 2K61A 4C0JA 1NCZA 2KAVA 3OB2B 2I94A 2JTZA 4YBHB 1YUUA 2L5XB 1PVAA 1X02A 3TUYB 1QV1A 1QIWA 1AHRA 1ZMZA 3VGOA 2KAYA 1QX5B 2M0RA 5AXIA 4CFRA 1YX7A 1QVIZ 3EKJA 1RROA 3ICBA 3OP0A 5AFPA 1B7TY 2L2EA 2F3YA 1AJ5A 2L51A 2OS8B 2QPTA 2HF5A 3PM8A 1KK7Z 1SCMB 1IG5A 3IF7A 2L98A 4I5KA 1CLBA 1C7WA 5CSJA 1FBVA 3TDIA 1UHIA 2CT9A 1QIVA 2KI4C 1V1GA 1N2DA 1F4OA 3BUMB 4GGNA 1K96A 2SASA 3DF0A 1XFVO 1NIWA 5J3XA 3LLEA 5I8NA 3TS5C 1QTXA 1KSOA 3FIAA 3AKAA 3NXAA 1K9PA 1G8IA 3O4YA 1TTXA 4YGEB 3TDUA 4BY5A 2KGRA 4OVNF 1DT7B 3WHUB 2LLUA 1RECA 2KFFA 3FWBA 1KWOC 2Y4QA 4R1EA 1SKTA 1XA5A 4MEWA 2LHLA 2Y1NA 1QATA 3O78A 4GPLB 2KNEA 2LC5A 3SJSA 3D10A 1K9UA 1HT9A 1A75A 1DGVA 2KHNA 2LUXA 3BUNB 1YX8A 3WNXB 2KI4B 1Y0VH 1B8LA 1QLKA 1NSHA 3PFVA 3I5HB 2HQWA 1KFXL 1RTP1 1GJYA 2PSRA 4WRIA 1R6PA 3EK8A 5JJGA 4D1EA 2KI6D 1ZUZA 1S6IA 2HETA 2HQ8A 1WLZA 2ZKMX 3DVKA 3JVTC 4MRYA 2SCPA 1IWQA 4XJKB 2KFHA 1YR5A 2LVKA 3FWCA 1XO5A 2LMTA 3BUWB 5I2LA 3EVRA 4GGFA 1CM4A 3ZWHA 3O6BA 1F8HA 5I2OA 5ER5A 3EVUA 1UHJA 3LK0A 1TCOB 3BXKA 4ORAB 1YUSA 5F6TA 3PATA 3O2PA 1QS7A 1EG4A 2Q4UA 5HYDA 3SIAA 1A2XA 1YRUB 3FS7A 2OTGB 1F70A 2H2KA 1B7TZ 2L0PA 2CBLA 4OR9B 5TNCA 1FW4A 2CTNA 1S3PA 4F0ZB 1PK0D 1S6JA 1J7QA 1WLMA 4MZJA 1EJ3A 2AUCA 1FI6A 3IQOA 1NX2A 1L2OC 1NCYA 1WRLA 3CGAA 3WXAA 3JVTB 3CTNA 2JRFA 1SRAA 2K7DA 1WDCB 2LE9B 4M2QA 1JSAA 1B8CA 3KHEA 1Y1XA 4PCWA 2A4JA 1JC2A 2BL0C 1TCFA 2I2RE 1QX7A 3SIBA 2KSPA 4CLNA 4BY4A 1TOPA 4I5LB 3M0WA 1JFKA 2EC6C 2IS9A 5B8IB 3CWGA 2KFGA 2KQ6A 1MF8B 2WNDA 1U5IA 2BECA 2KAXA 1XFWO 3LK1A 1G4YR 1Y1AA 3WHTB 1B8RA 3DVMA 1TNXA 1ZACA 3SG7A 1KQMC 1IQ5A 1F55A 4MRXA 4JPZB 2BCBA 1BT6A 1NX1A 2LVIA 2JULA 1YTZC 2GV5A 4MZKA 1BU3A 1CDPA 1WRKA 1ALWA 3NSIA 5FYXA 2KBIA 1BODA 2Y1MA 2WORA 1J7RA 2LHIA 1M31A 2ZN9A 5AANA 1S6CA 2BCAA 1BR1B 1CFDA 4Q04A 1K9KA 1N65A 1B1GA 1HQVA 3GK2A 2E30A 1SL8A 4AQIA 4OCIA 3SG2A 1CLMA 1TNQA 1DVIA 2ZRTA 3TDZA 1ZFSA 1J1EA 1AUIB 4DS7A 1SCVA 4A4BA 3EKHA 1LXFC 1DJIA 1TNWA 2KYFA 4L9MA 4PHJA 4USLA 1KQVA 1UHNA 4GAOA 1IJ6A 1NX0A 1BOCA 1KK8C 2ISDA 1OMVA 1M45A 3KPXA 5HKWA 1IQ3A 4TNCA 2CCMA 1UUSA 4PALA 1W7IB 4N1GA 3AAJA 3E3RA 1R2UA 1LKJA 4YGCB 1M63B 3CR5X 1C7VA 1CKKA 1DJXA 4OKHA 2KGBC 2Y5IA 1CDNA 5I2QA 1AP4A 1EG3A 2FCDA 2LLSA 4P5OE 1SL9A 2PRUA 3HX4A 1QXPA 4CIDA 2AAOA 2AMIA 1GGWA 1IH0A 3BOWB 1LA3A 1N0YA 2M1UA 3PLFB 4NDDA 1RWYA 4YGAA 4AOMA 2H61C 1J7OA 3CR2A 3I5FC 4ICBA 1XFUO 2WOSA 4MLWA 2MLEC 3A4UB 1XYDA 3PN7C 3K21A 2JOJA 2M49B 1JWDA 1CB1A 1XFXO 1QLSA 2O5GA 2R2IA 1JBAA 4GBAA 1RJVA 1OMDA 2OPOA 3CR4X 2NXQA 1OZSA 2ZRSA 1CMFA 2LCPA 2F3ZA 1U5IB 3TS5B 2JNFA 1IKUA 4PE0A 2M97A 1FI5A 5BPJA 4PDZA 2LVVA 4WQ2A 4M2PA 2M7NA 1E8AA 1KSMA 1CTRA 3KO0A 4HRHA 1PRWA 3JTDC 1S1EA 1YVHA 5HLVA 1EXRA 1KWOB 4I5JA 2K8MB 1WRZA 1JFJA 2CXJA 1IGVA 1TNPA 2MAZA 1F71A 3KF9A 1B4CA 2F2OA 2MA2A 1KFXS 4JWQA 4N5XA 2F33A 4WQ3A 2PVBA 2JQ6A 2FCEA 2NCOA 2V53A 3PN7B 1S26D 4QJ4B 2K0JA 2KOTA 2MBXA 5HKYA 1BF5A 1H8BA 2CNPA 4YGBB 3SG6A 2EHBA 1Q80A 1UWOA 2NCPA 2LM5A 4YGDB 3AAKA 4PHKA 1M46A 1B47A 3BOWA 4CFQA 4ORCB 1GGZA 5CPVA 2K2AA 3KEVA 1BR4B 3EK4A 2I7AA 5DKNA 1SW8A 2LANA 3I5GC 1CFPA 3CS1A 4NQGA 5AEQA 3JTDB 1OE9B 3H4SE 1JUOA 2JZIA 3PSRA 2KQYA 1W7JB 1CFFA 4NDBA 4PE4A 3DD4A 1SYMA 2G2BA 3GOFA 2JU0A 3OB1B 1SR6C 1XFZO 3LL8B 3D0YB 3CZTX 4ZCVA 2COLB 4NDCA 1FPWA 1A4PA 5D7FA 1LVCD 2JC2A 4C0LA 1TIZA 1ALVA 1UHHA 2M1KB 3A8RA 2ZNEA 3OX5A 1QASA 4GNKB 1SMGA 1K93D 1UP5A 2H61A 1L2OB 2ZN8A 1KFUS 1K94A 4C0KA 1S5GY 2BE6A 2LLTA 3ZNIA 2MHHA 2BL0B 1D1OA 3VRRA 5CSNA 2M7LA 3BUXB 1SBJA 1BLQA 1CMGA 4YI9A 1DJZA 1K90D 4QJ3B 2EC6B 2RGIA 4PE1A 1G33A 2TN4A 3MSEB 1J1DA 4FTGA 1NYAA 4HSZA 1MHOA 2HPSA 2LP2A 1F54A 1DJGA 3AKBA 1SCMC 4GGFC 1BG1A 2WC8A 1CDMA 1DJYA 1KQMB 1MWNA 2F2PA 3C1VA 2GGMA 1OSAA 5D69A 3IQQA 1PSRA 1PVBA 2D8NA 1DTLA 3F45A 1CFCA 1PSBA 2LV7A 4YI8A 4FQOA 4PE7A 3D0YA 1KCYA 2JNXA 4M2OA 1B9AA 3EVVA 3LCPC 4YRUA 1AK8A 1WY9A 1TN4A 2JXCA 1MXLC 1JF0A 1PALA 3BQ3A 2KI6C 1SK6D 1Y1UA 2O60A 2MRDA 2QACA 3GK4X 4GFTA 3TZ1A 3DVEA 4GUKA 2K7CA 3GK1A 3NSOA 4IL1A 1LA0A 1V1FA 1KK8B 2JPTA 5JOLA 1L7ZA 2LMVA 1XK4C 4MN0A 1RK9A 2JWWA 2BBNA 1UURA 2JTTA 2MLFC 3I5HC 2ZNDA 1F4QA 1BJFA 2WCFA 1NPQA 2K7OA 2BE4A 1H4BA 4XYNA 2I18A 2ZFDA 1JF2A 1J55A 2LAPA 2DOQA 2NZ0A 1S5GZ 2M9GA 3BUOB 2P6BB 2KYCA 1PULA 1NX3A 2K2FA 4P2YB 5HLOA 3HCMA 1CDLA 4OV2A 1ODBA 1QJTA 2LUCA 1OMRA 1YUTA 1MR8A 5GQQC 3RM1A 3I5FB 2FJUB 3NSKA 2Q91A 5DKRA 2M29A 1BMOA 2FOTA 5ER4X 2OTGC 4A4CA 1GQMA 3CLNA 1VRKA 5KU1A 1EH2A 2M8UA 2WCEA 1OZOA 4HREE 4DUQA 3EK7A 1EL4A 1UHKA 5K89A 2KDHA 2LP3A
chains in the Genus database with same CATH superfamily
4DRWA 1J7PA 5G08A 1IRJA 1SNLA 1ZOTB 4ZCUA 1WDCC 4UPGA 4E68A 2BBMA 3VROA 4CPVA 1DF0B 2QEBA 2KPHA 3SG5A 3OX6A 1RFJA 3QRXA 1ORGA 3VRNA 2M3WA 3RLZA 4ORBB 3UO9A 5AERA 5HKZA 1QVIY 4HRGA 3BFBA 4PHMA 2F8PA 2JT8A 1YRTB 2B1UA 3CZ1A 5PALA 4QJ5B 1A29A 5KTYA 2E6WA 1QWVA 3SG4A 5D3OA 3D73A 1KK7Y 3BFAA 1SPYA 5KSZA 1M39A 3DVJA 5CSFA 1CM1A 2JT3A 2KBMA 2NLNA 3BJHA 2L5YA 5FI7A 4JQ0D 2GGZA 3SG3A 1DGUA 1QV0A 1XFRA 1DEKA 1AJ4A 3OHMB 4DIRA 1NWDA 2EGDA 3L4LA 1SL7A 1IJ5A 1Y6WA 3BYAA 3I5IC 4N1FA 1CNPA 1YVLA 3DYEA 1Z2CB 1TRFA 3I5GB 2L4IA 3PALA 5DKQA 1S36A 1XVJA 1OOJA 1QX2A 2P70A 4F7FA 1C07A 2BKHB 3S0EA 1CLLA 1XK4A 4AQJA 1KFUL 4DCKA 4MSPA 2LNKA 3VRQA 3DF0B 3PM2A 1MUXA 3TUYC 2K7BA 1K8UA 2LMUA 5IBWA 1DJHA 3NSLA 2PMYA 3R1OA 1YURA 4MBEA 1SR6B 2LVJA 3SS4A 1DMOA 1NCXA 2L4HA 2BKIB 2L50A 1LINA 1MQ1A 2BCXA 1NP8A 2JT0A 2G9BA 2JXLA 5CSIA 1A03A 1DJWA 1XFYO 2OS8C 2WCBA 4PHNA 3VRPA 1AVSA 3NGVA 4MZLA 4XJKA 5FI2A 1DF0A 3B6XA 4U8DA 4ETOA 1MXEA 3I5IB 2PASA 1FF1A 2MJWB 3Q8IA 1P28A 2WC5A 3S0DA 2PALA 1NUBA 1A75B 1OQPA 1SY9A 1K95A 2VRGA 4I5NB 4MVFA 1K2HA 2K61A 4C0JA 4JKTA 1NCZA 2KAVA 3OB2B 2I94A 2JTZA 4YBHB 1YUUA 2L5XB 2WC6A 1PVAA 1X02A 3TUYB 1QV1A 1QIWA 1AHRA 1ZMZA 3VGOA 2KAYA 1QX5B 2M0RA 5AXIA 4CFRA 5HL1A 1YX7A 3FE9A 3BFHA 1OOIX 1QVIZ 3EKJA 1RROA 2K60A 3ICBA 3OP0A 1IIOA 5AFPA 1B7TY 2L2EA 2F3YA 1AJ5A 1OW4A 2L51A 2OS8B 2HF5A 2QPTA 3FE6A 3PM8A 1KK7Z 1SCMB 1IG5A 3IF7A 2L98A 4I5KA 1CLBA 1C7WA 3D75A 5CSJA 1FBVA 3TDIA 1UHIA 2CT9A 1QIVA 2KI4C 1V1GA 1N2DA 1F4OA 3BUMB 4GGNA 1K96A 1Z4HA 2SASA 3DF0A 1XFVO 1NIWA 5J3XA 2GTEA 3LLEA 5I8NA 3TS5C 1QTXA 3S0GA 1KSOA 3FIAA 3AKAA 3NXAA 1K9PA 1G8IA 3O4YA 1TTXA 4YGEB 1DELA 3TDUA 4BY5A 2KGRA 4OVNF 1TUZA 3WHUB 2LLUA 1RECA 1DT7B 2KFFA 3FWBA 1KWOC 2Y4QA 4R1EA 1SKTA 2ERBA 1XA5A 4MEWA 2LHLA 2Y1NA 1QATA 3O78A 4GPLB 2KNEA 2LC5A 3SJSA 3D10A 1K9UA 1HT9A 1DC1A 1A75A 1DGVA 2KHNA 2LUXA 3BUNB 4KYNA 1YX8A 3WNXB 2KI4B 1Y0VH 1B8LA 1QLKA 1NSHA 3PFVA 3I5HB 2HQWA 1KFXL 3SS3A 1RTP1 1GJYA 2WCLA 2PSRA 4WRIA 1R6PA 3EK8A 5JJGA 4D1EA 2KI6D 1ZUZA 1S6IA 2HETA 2HQ8A 3B87A 1WLZA 2ZKMX 3DVKA 3JVTC 4MRYA 3DZTA 2SCPA 1IWQA 4XJKB 2KFHA 1YR5A 2LVKA 3FWCA 1XO5A 2LMTA 3BUWB 5I2LA 3EVRA 4GGFA 1CM4A 3N7HA 3O6BA 3ZWHA 5I2OA 1F8HA 5ER5A 3EVUA 3PJIA 1UHJA 3LK0A 1W9ZA 1TCOB 3BXKA 4ORAB 1YUSA 5F6TA 3PATA 3O2PA 1QS7A 1EG4A 2Q4UA 5HYDA 3SIAA 1A2XA 1YRUB 3FS7A 3R1VA 2OTGB 1F70A 2H2KA 1B7TZ 2L0PA 2CBLA 4OR9B 5TNCA 1FW4A 2CTNA 1S3PA 4F0ZB 1PK0D 1S6JA 1J7QA 1WLMA 4MZJA 3D76A 3NHTA 1C3YA 1EJ3A 2AUCA 1FI6A 3IQOA 1NX2A 1L2OC 1NCYA 1WRLA 3CGAA 2L2CA 3JVTB 3WXAA 3CTNA 2JRFA 1SRAA 2K7DA 1WDCB 2LE9B 4M2QA 1JSAA 3CDNA 1B8CA 3KHEA 1Y1XA 4PCWA 2A4JA 1JC2A 1TCFA 2BL0C 2I2RE 1QX7A 3SIBA 2KSPA 4CLNA 4OZDA 4BY4A 3R1PA 1TOPA 4INWA 3SS5A 4I5LB 3M0WA 1JFKA 2H8VA 2EC6C 2IS9A 5B8IB 3CWGA 2KFGA 2KQ6A 4INXA 1MF8B 2WNDA 1U5IA 2BECA 2KAXA 1XFWO 3LK1A 1G4YR 1Y1AA 1OOGA 3VB1A 3WHTB 1B8RA 2YGUA 3DVMA 1TNXA 1ZACA 3SG7A 1KQMC 1IQ5A 1F55A 4MRXA 4JPZB 2BCBA 1BT6A 1NX1A 2KLEA 2LVIA 2JULA 1YTZC 2GV5A 3CYZA 4MZKA 1BU3A 1CDPA 1WRKA 1ALWA 3NSIA 5FYXA 2KBIA 1BODA 2Y1MA 2WORA 1J7RA 2LHIA 1M31A 2ZN9A 5AANA 1S6CA 2BCAA 1BR1B 1CFDA 4Q04A 1K9KA 1TWOA 1N65A 1B1GA 1HQVA 3GK2A 2E30A 2PQLA 1SL8A 4AQIA 4OCIA 3SG2A 1CLMA 1TNQA 1DVIA 2ZRTA 3TDZA 1ZFSA 1J1EA 1AUIB 3OGNA 4DS7A 1SCVA 4A4BA 3EKHA 1LXFC 1DJIA 1TNWA 2KYFA 2PYQA 4L9MA 4PHJA 4USLA 1UHNA 4GAOA 1IJ6A 3DY9A 1KQVA 1NX0A 1BOCA 1KK8C 2ISDA 1SSEB 1C3ZA 1OMVA 1M45A 3KPXA 5HKWA 1IQ3A 4TNCA 2CCMA 3FE8A 1UUSA 4PALA 1W7IB 4N1GA 3AAJA 3E3RA 1R2UA 1LKJA 4YGCB 1M63B 3CR5X 1C7VA 1CKKA 1DJXA 4OKHA 2KGBC 2Y5IA 5FI6A 1CDNA 5I2QA 1TUJA 1EG3A 2FCDA 2LLSA 4P5OE 3L47A 1AP4A 3CZ0A 3NHIA 1SL9A 2PRUA 3HX4A 1QXPA 4CIDA 2AAOA 2AMIA 1GGWA 1IH0A 3BOWB 1LA3A 1N0YA 2M1UA 3PLFB 4NDDA 1RWYA 4YGAA 4AOMA 2H61C 1J7OA 3CR2A 3I5FC 4ICBA 1XFUO 2WOSA 4MLWA 4JD9A 2MLEC 3A4UB 1XYDA 3PN7C 3K21A 2JOJA 2M49B 1JWDA 1CB1A 1XFXO 1QLSA 2O5GA 2FJYA 2R2IA 4GBAA 1JBAA 1RJVA 2QEHA 1OMDA 2OPOA 3CR4X 2NXQA 1OZSA 3RZSA 2ZRSA 1CMFA 2LCPA 2F3ZA 1U5IB 3TS5B 2JNFA 3D74A 3K1EA 4PE0A 2M97A 1IKUA 3R72A 1FI5A 5BPJA 4PDZA 2LVVA 4WQ2A 4M2PA 2M7NA 1E8AA 1KSMA 3B88A 1CTRA 3KO0A 4HRHA 1PRWA 3JTDC 3OBVA 1S1EA 3D78A 1YVHA 5HLVA 1EXRA 1KWOB 4I5JA 1GM0A 2K8MB 1OOFA 1WRZA 1JFJA 2CXJA 1IGVA 1TNPA 2MAZA 1F71A 3KF9A 1B4CA 2F2OA 2MA2A 1KFXS 4JWQA 4N5XA 2F33A 4WQ3A 2PVBA 2JQ6A 2FCEA 2NCOA 2V53A 3PN7B 1S26D 4QJ4B 2K0JA 2KOTA 2MBXA 5HKYA 1BF5A 1H8BA 2CNPA 3DXLA 4YGBB 3SG6A 2EHBA 1Q80A 1UWOA 2NCPA 2LM5A 4YGDB 3AAKA 4PHKA 1M46A 1B47A 3BOWA 4CFQA 4ORCB 1GGZA 5CPVA 2K2AA 3KEVA 1BR4B 3QMEA 3B86A 3EK4A 2I7AA 5DKNA 1SW8A 2LANA 3I5GC 5EL2A 1CFPA 3CS1A 4NQGA 5AEQA 2QEVA 2WCJA 3JTDB 1OE9B 3H4SE 1JUOA 2JZIA 3PSRA 2KQYA 2WCMA 3L4AA 1W7JB 1CFFA 3UNWA 3EG5B 4NDBA 4PE4A 3DD4A 1SYMA 2G2BA 2BNXA 3GOFA 2JU0A 3OB1B 1SR6C 1XFZO 3LL8B 3D0YB 3CZTX 4ZCVA 2COLB 4NDCA 2WCKA 1DQEA 1A4PA 1FPWA 3B7AA 5D7FA 1LVCD 2JC2A 4C0LA 1TIZA 1ALVA 1UHHA 2M1KB 3A8RA 2ZNEA 3OX5A 4IJ7A 1QASA 4GNKB 1SMGA 1K93D 1UP5A 2H61A 1L2OB 2QEOA 2ZN8A 2P71A 1KFUS 1K94A 4C0KA 1S5GY 2BE6A 2LLTA 3V2LA 2MHHA 2BL0B 3ZNIA 3VRRA 1D1OA 5CSNA 2M7LA 3BUXB 1SBJA 1BLQA 1OOHA 1CMGA 4YI9A 1DJZA 1K90D 1T14A 2EC6B 4QJ3B 2RGIA 4PE1A 1G33A 2TN4A 3MSEB 1LS8A 1J1DA 4FTGA 1NYAA 4HSZA 1MHOA 2HPSA 2LP2A 1F54A 1DJGA 3AKBA 1SCMC 4GGFC 2KLDA 1BG1A 2WC8A 1CDMA 1DJYA 1KQMB 1MWNA 2BAPA 2F2PA 4FQTA 3C1VA 3S0BA 2GGMA 1OSAA 5D69A 3IQQA 1PSRA 1PVBA 2D8NA 1DTLA 2QDIA 3F45A 1CFCA 1PSBA 2LV7A 4YI8A 4FQOA 4PE7A 3D0YA 1KCYA 2JNXA 4M2OA 1B9AA 3EVVA 3LCPC 4YRUA 1AK8A 1WY9A 1TN4A 2JXCA 1MXLC 1JF0A 1PALA 3BQ3A 2JPOA 2KI6C 1SK6D 1Y1UA 2O60A 2MRDA 2QACA 3GK4X 4GFTA 3TZ1A 3DVEA 4GUKA 2K7CA 3GK1A 3NSOA 4IL1A 1LA0A 1V1FA 1KK8B 2JPTA 3O4XA 5JOLA 1L7ZA 2LMVA 1XK4C 4MN0A 3S0FA 1RK9A 5DICA 3CABA 2JWWA 2BBNA 1UURA 2JTTA 2MLFC 3I5HC 2ZNDA 1F4QA 1BJFA 2WCFA 1NPQA 2K7OA 2BE4A 1H4BA 4XYNA 2I18A 2ZFDA 1JF2A 2WCHA 1J55A 2LAPA 2DOQA 2NZ0A 1S5GZ 2M9GA 3BUOB 2P6BB 2KYCA 1PULA 1NX3A 2K2FA 4P2YB 5HLOA 3HCMA 3IVTA 1CDLA 4OV2A 1ODBA 1QJTA 2LUCA 1OMRA 1YUTA 1MR8A 5GQQC 3RM1A 3I5FB 2FJUB 3NSKA 2Q91A 5I94A 5DKRA 2M29A 1BMOA 2FOTA 5ER4X 2OTGC 4A4CA 1GQMA 3CLNA 1VRKA 5KU1A 1EH2A 2M8UA 2WCEA 4PT1A 1OZOA 4HREE 3D77A 4DUQA 3EK7A 3S0AA 1EL4A 1UHKA 5K89A 3CZ2A 2KDHA 2LP3A
chains in the Genus database with same CATH topology
4DRWA 1J7PA 5G08A 1IRJA 1SNLA 1ZOTB 4ZCUA 1WDCC 4UPGA 4E68A 2BBMA 3VROA 4CPVA 1DF0B 3SG5A 3OX6A 1RFJA 3QRXA 3VRNA 2M3WA 3RLZA 4ORBB 5AERA 5HKZA 1QVIY 4HRGA 4PHMA 2F8PA 2JT8A 1YRTB 2B1UA 5KTYA 5PALA 4QJ5B 1A29A 2E6WA 3SG4A 1KK7Y 1SPYA 5KSZA 1M39A 3DVJA 5CSFA 1CM1A 2JT3A 2KBMA 2NLNA 4JQ0D 2GGZA 3SG3A 1DGUA 1QV0A 1AJ4A 3OHMB 4DIRA 1NWDA 2EGDA 1SL7A 1IJ5A 1Y6WA 3BYAA 3I5IC 4N1FA 1CNPA 1YVLA 1TRFA 3I5GB 2L4IA 3PALA 5DKQA 1S36A 1XVJA 1OOJA 1QX2A 1C07A 2BKHB 4AQJA 1CLLA 1XK4A 4DCKA 1KFUL 4MSPA 2LNKA 3VRQA 3DF0B 1MUXA 3TUYC 2K7BA 1K8UA 2LMUA 5IBWA 1DJHA 3NSLA 2PMYA 4MBEA 1YURA 1SR6B 2LVJA 1DMOA 1NCXA 2L4HA 2BKIB 2L50A 1LINA 1MQ1A 2BCXA 1NP8A 2JT0A 2G9BA 2JXLA 5CSIA 1A03A 1DJWA 1XFYO 2OS8C 2WCBA 4PHNA 3VRPA 1AVSA 4XJKA 4MZLA 1DF0A 4U8DA 4ETOA 1MXEA 3I5IB 2PASA 1FF1A 2MJWB 2PALA 1NUBA 1A75B 1OQPA 1SY9A 1K95A 2VRGA 4I5NB 4MVFA 1K2HA 2K61A 4C0JA 1NCZA 2KAVA 3OB2B 2I94A 2JTZA 4YBHB 1YUUA 2L5XB 1PVAA 1X02A 3TUYB 1QV1A 1QIWA 1AHRA 1ZMZA 3VGOA 2KAYA 1QX5B 2M0RA 5AXIA 4CFRA 1YX7A 1QVIZ 3EKJA 1RROA 3ICBA 3OP0A 5AFPA 1B7TY 2L2EA 2F3YA 1AJ5A 2L51A 2OS8B 2QPTA 2HF5A 3PM8A 1KK7Z 1SCMB 1IG5A 3IF7A 2L98A 4I5KA 1CLBA 1C7WA 5CSJA 1FBVA 3TDIA 1UHIA 2CT9A 1QIVA 2KI4C 1V1GA 1N2DA 1F4OA 3BUMB 4GGNA 1K96A 2SASA 3DF0A 1XFVO 1NIWA 5J3XA 3LLEA 5I8NA 3TS5C 1QTXA 1KSOA 3FIAA 3AKAA 3NXAA 1K9PA 1G8IA 3O4YA 1TTXA 4YGEB 3TDUA 4BY5A 2KGRA 4OVNF 1DT7B 3WHUB 2LLUA 1RECA 2KFFA 3FWBA 1KWOC 2Y4QA 4R1EA 1SKTA 1XA5A 4MEWA 2LHLA 2Y1NA 1QATA 3O78A 4GPLB 2KNEA 2LC5A 3SJSA 3D10A 1K9UA 1HT9A 1A75A 1DGVA 2KHNA 2LUXA 3BUNB 1YX8A 3WNXB 2KI4B 1Y0VH 1B8LA 1QLKA 1NSHA 3PFVA 3I5HB 2HQWA 1KFXL 1RTP1 1GJYA 2PSRA 4WRIA 1R6PA 3EK8A 5JJGA 4D1EA 2KI6D 1ZUZA 1S6IA 2HETA 2HQ8A 1WLZA 2ZKMX 3DVKA 3JVTC 4MRYA 2SCPA 1IWQA 4XJKB 2KFHA 1YR5A 2LVKA 3FWCA 1XO5A 2LMTA 3BUWB 5I2LA 3EVRA 4GGFA 1CM4A 3ZWHA 3O6BA 1F8HA 5I2OA 5ER5A 3EVUA 1UHJA 3LK0A 1TCOB 3BXKA 4ORAB 1YUSA 5F6TA 3PATA 3O2PA 1QS7A 1EG4A 2Q4UA 5HYDA 3SIAA 1A2XA 1YRUB 3FS7A 2OTGB 1F70A 2H2KA 1B7TZ 2L0PA 2CBLA 4OR9B 5TNCA 1FW4A 2CTNA 1S3PA 4F0ZB 1PK0D 1S6JA 1J7QA 1WLMA 4MZJA 1EJ3A 2AUCA 1FI6A 3IQOA 1NX2A 1L2OC 1NCYA 1WRLA 3CGAA 3WXAA 3JVTB 3CTNA 2JRFA 1SRAA 2K7DA 1WDCB 2LE9B 4M2QA 1JSAA 1B8CA 3KHEA 1Y1XA 4PCWA 2A4JA 1JC2A 2BL0C 1TCFA 2I2RE 1QX7A 3SIBA 2KSPA 4CLNA 4BY4A 1TOPA 4I5LB 3M0WA 1JFKA 2EC6C 2IS9A 5B8IB 3CWGA 2KFGA 2KQ6A 1MF8B 2WNDA 1U5IA 2BECA 2KAXA 1XFWO 3LK1A 1G4YR 1Y1AA 3WHTB 1B8RA 3DVMA 1TNXA 1ZACA 3SG7A 1KQMC 1IQ5A 1F55A 4MRXA 4JPZB 2BCBA 1BT6A 1NX1A 2LVIA 2JULA 1YTZC 2GV5A 4MZKA 1BU3A 1CDPA 1WRKA 1ALWA 3NSIA 5FYXA 2KBIA 1BODA 2Y1MA 2WORA 1J7RA 2LHIA 1M31A 2ZN9A 5AANA 1S6CA 2BCAA 1BR1B 1CFDA 4Q04A 1K9KA 1N65A 1B1GA 1HQVA 3GK2A 2E30A 1SL8A 4AQIA 4OCIA 3SG2A 1CLMA 1TNQA 1DVIA 2ZRTA 3TDZA 1ZFSA 1J1EA 1AUIB 4DS7A 1SCVA 4A4BA 3EKHA 1LXFC 1DJIA 1TNWA 2KYFA 4L9MA 4PHJA 4USLA 1KQVA 1UHNA 4GAOA 1IJ6A 1NX0A 1BOCA 1KK8C 2ISDA 1OMVA 1M45A 3KPXA 5HKWA 1IQ3A 4TNCA 2CCMA 1UUSA 4PALA 1W7IB 4N1GA 3AAJA 3E3RA 1R2UA 1LKJA 4YGCB 1M63B 3CR5X 1C7VA 1CKKA 1DJXA 4OKHA 2KGBC 2Y5IA 1CDNA 5I2QA 1AP4A 1EG3A 2FCDA 2LLSA 4P5OE 1SL9A 2PRUA 3HX4A 1QXPA 4CIDA 2AAOA 2AMIA 1GGWA 1IH0A 3BOWB 1LA3A 1N0YA 2M1UA 3PLFB 4NDDA 1RWYA 4YGAA 4AOMA 2H61C 1J7OA 3CR2A 3I5FC 4ICBA 1XFUO 2WOSA 4MLWA 2MLEC 3A4UB 1XYDA 3PN7C 3K21A 2JOJA 2M49B 1JWDA 1CB1A 1XFXO 1QLSA 2O5GA 2R2IA 1JBAA 4GBAA 1RJVA 1OMDA 2OPOA 3CR4X 2NXQA 1OZSA 2ZRSA 1CMFA 2LCPA 2F3ZA 1U5IB 3TS5B 2JNFA 1IKUA 4PE0A 2M97A 1FI5A 5BPJA 4PDZA 2LVVA 4WQ2A 4M2PA 2M7NA 1E8AA 1KSMA 1CTRA 3KO0A 4HRHA 1PRWA 3JTDC 1S1EA 1YVHA 5HLVA 1EXRA 1KWOB 4I5JA 2K8MB 1WRZA 1JFJA 2CXJA 1IGVA 1TNPA 2MAZA 1F71A 3KF9A 1B4CA 2F2OA 2MA2A 1KFXS 4JWQA 4N5XA 2F33A 4WQ3A 2PVBA 2JQ6A 2FCEA 2NCOA 2V53A 3PN7B 1S26D 4QJ4B 2K0JA 2KOTA 2MBXA 5HKYA 1BF5A 1H8BA 2CNPA 4YGBB 3SG6A 2EHBA 1Q80A 1UWOA 2NCPA 2LM5A 4YGDB 3AAKA 4PHKA 1M46A 1B47A 3BOWA 4CFQA 4ORCB 1GGZA 5CPVA 2K2AA 3KEVA 1BR4B 3EK4A 2I7AA 5DKNA 1SW8A 2LANA 3I5GC 1CFPA 3CS1A 4NQGA 5AEQA 3JTDB 1OE9B 3H4SE 1JUOA 2JZIA 3PSRA 2KQYA 1W7JB 1CFFA 4NDBA 4PE4A 3DD4A 1SYMA 2G2BA 3GOFA 2JU0A 3OB1B 1SR6C 1XFZO 3LL8B 3D0YB 3CZTX 4ZCVA 2COLB 4NDCA 1FPWA 1A4PA 5D7FA 1LVCD 2JC2A 4C0LA 1TIZA 1ALVA 1UHHA 2M1KB 3A8RA 2ZNEA 3OX5A 1QASA 4GNKB 1SMGA 1K93D 1UP5A 2H61A 1L2OB 2ZN8A 1KFUS 1K94A 4C0KA 1S5GY 2BE6A 2LLTA 3ZNIA 2MHHA 2BL0B 1D1OA 3VRRA 5CSNA 2M7LA 3BUXB 1SBJA 1BLQA 1CMGA 4YI9A 1DJZA 1K90D 4QJ3B 2EC6B 2RGIA 4PE1A 1G33A 2TN4A 3MSEB 1J1DA 4FTGA 1NYAA 4HSZA 1MHOA 2HPSA 2LP2A 1F54A 1DJGA 3AKBA 1SCMC 4GGFC 1BG1A 2WC8A 1CDMA 1DJYA 1KQMB 1MWNA 2F2PA 3C1VA 2GGMA 1OSAA 5D69A 3IQQA 1PSRA 1PVBA 2D8NA 1DTLA 3F45A 1CFCA 1PSBA 2LV7A 4YI8A 4FQOA 4PE7A 3D0YA 1KCYA 2JNXA 4M2OA 1B9AA 3EVVA 3LCPC 4YRUA 1AK8A 1WY9A 1TN4A 2JXCA 1MXLC 1JF0A 1PALA 3BQ3A 2KI6C 1SK6D 1Y1UA 2O60A 2MRDA 2QACA 3GK4X 4GFTA 3TZ1A 3DVEA 4GUKA 2K7CA 3GK1A 3NSOA 4IL1A 1LA0A 1V1FA 1KK8B 2JPTA 5JOLA 1L7ZA 2LMVA 1XK4C 4MN0A 1RK9A 2JWWA 2BBNA 1UURA 2JTTA 2MLFC 3I5HC 2ZNDA 1F4QA 1BJFA 2WCFA 1NPQA 2K7OA 2BE4A 1H4BA 4XYNA 2I18A 2ZFDA 1JF2A 1J55A 2LAPA 2DOQA 2NZ0A 1S5GZ 2M9GA 3BUOB 2P6BB 2KYCA 1PULA 1NX3A 2K2FA 4P2YB 5HLOA 3HCMA 1CDLA 4OV2A 1ODBA 1QJTA 2LUCA 1OMRA 1YUTA 1MR8A 5GQQC 3RM1A 3I5FB 2FJUB 3NSKA 2Q91A 5DKRA 2M29A 1BMOA 2FOTA 5ER4X 2OTGC 4A4CA 1GQMA 3CLNA 1VRKA 5KU1A 1EH2A 2M8UA 2WCEA 1OZOA 4HREE 4DUQA 3EK7A 1EL4A 1UHKA 5K89A 2KDHA 2LP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DRW A;  1J7P A;  5G08 A;  1IRJ A;  1SNL A;  1ZOT B;  4ZCU A;  1WDC C;  4UPG A;  4E68 A;  2BBM A;  3VRO A;  4CPV A;  1DF0 B;  3SG5 A;  3OX6 A;  1RFJ A;  3QRX A;  3VRN A;  2M3W A;  3RLZ A;  4ORB B;  5AER A;  5HKZ A;  1QVI Y;  4HRG A;  4PHM A;  2F8P A;  2JT8 A;  1YRT B;  2B1U A;  5KTY A;  5PAL A;  4QJ5 B;  1A29 A;  2E6W A;  3SG4 A;  1KK7 Y;  1SPY A;  5KSZ A;  1M39 A;  3DVJ A;  5CSF A;  1CM1 A;  2JT3 A;  2KBM A;  2NLN A;  4JQ0 D;  2GGZ A;  3SG3 A;  1DGU A;  1QV0 A;  1AJ4 A;  3OHM B;  4DIR A;  1NWD A;  2EGD A;  1SL7 A;  1IJ5 A;  1Y6W A;  3BYA A;  3I5I C;  4N1F A;  1CNP A;  1YVL A;  1TRF A;  3I5G B;  2L4I A;  3PAL A;  5DKQ A;  1S36 A;  1XVJ A;  1OOJ A;  1QX2 A;  1C07 A;  2BKH B;  4AQJ A;  1CLL A;  1XK4 A;  4DCK A;  1KFU L;  4MSP A;  2LNK A;  3VRQ A;  3DF0 B;  1MUX A;  3TUY C;  2K7B A;  1K8U A;  2LMU A;  5IBW A;  1DJH A;  3NSL A;  2PMY A;  4MBE A;  1YUR A;  1SR6 B;  2LVJ A;  1DMO A;  1NCX A;  2L4H A;  2BKI B;  2L50 A;  1LIN A;  1MQ1 A;  2BCX A;  1NP8 A;  2JT0 A;  2G9B A;  2JXL A;  5CSI A;  1A03 A;  1DJW A;  1XFY O;  2OS8 C;  2WCB A;  4PHN A;  3VRP A;  1AVS A;  4XJK A;  4MZL A;  1DF0 A;  4U8D A;  4ETO A;  1MXE A;  3I5I B;  2PAS A;  1FF1 A;  2MJW B;  2PAL A;  1NUB A;  1A75 B;  1OQP A;  1SY9 A;  1K95 A;  2VRG A;  4I5N B;  4MVF A;  1K2H A;  2K61 A;  4C0J A;  1NCZ A;  2KAV A;  3OB2 B;  2I94 A;  2JTZ A;  4YBH B;  1YUU A;  2L5X B;  1PVA A;  1X02 A;  3TUY B;  1QV1 A;  1QIW A;  1AHR A;  1ZMZ A;  3VGO A;  2KAY A;  1QX5 B;  2M0R A;  5AXI A;  4CFR A;  1YX7 A;  1QVI Z;  3EKJ A;  1RRO A;  3ICB A;  3OP0 A;  5AFP A;  1B7T Y;  2L2E A;  2F3Y A;  1AJ5 A;  2L51 A;  2OS8 B;  2QPT A;  2HF5 A;  3PM8 A;  1KK7 Z;  1SCM B;  1IG5 A;  3IF7 A;  2L98 A;  4I5K A;  1CLB A;  1C7W A;  5CSJ A;  1FBV A;  3TDI A;  1UHI A;  2CT9 A;  1QIV A;  2KI4 C;  1V1G A;  1N2D A;  1F4O A;  3BUM B;  4GGN A;  1K96 A;  2SAS A;  3DF0 A;  1XFV O;  1NIW A;  5J3X A;  3LLE A;  5I8N A;  3TS5 C;  1QTX A;  1KSO A;  3FIA A;  3AKA A;  3NXA A;  1K9P A;  1G8I A;  3O4Y A;  1TTX A;  4YGE B;  3TDU A;  4BY5 A;  2KGR A;  4OVN F;  1DT7 B;  3WHU B;  2LLU A;  1REC A;  2KFF A;  3FWB A;  1KWO C;  2Y4Q A;  4R1E A;  1SKT A;  1XA5 A;  4MEW A;  2LHL A;  2Y1N A;  1QAT A;  3O78 A;  4GPL B;  2KNE A;  2LC5 A;  3SJS A;  3D10 A;  1K9U A;  1HT9 A;  1A75 A;  1DGV A;  2KHN A;  2LUX A;  3BUN B;  1YX8 A;  3WNX B;  2KI4 B;  1Y0V H;  1B8L A;  1QLK A;  1NSH A;  3PFV A;  3I5H B;  2HQW A;  1KFX L;  1RTP 1;  1GJY A;  2PSR A;  4WRI A;  1R6P A;  3EK8 A;  5JJG A;  4D1E A;  2KI6 D;  1ZUZ A;  1S6I A;  2HET A;  2HQ8 A;  1WLZ A;  2ZKM X;  3DVK A;  3JVT C;  4MRY A;  2SCP A;  1IWQ A;  4XJK B;  2KFH A;  1YR5 A;  2LVK A;  3FWC A;  1XO5 A;  2LMT A;  3BUW B;  5I2L A;  3EVR A;  4GGF A;  1CM4 A;  3ZWH A;  3O6B A;  1F8H A;  5I2O A;  5ER5 A;  3EVU A;  1UHJ A;  3LK0 A;  1TCO B;  3BXK A;  4ORA B;  1YUS A;  5F6T A;  3PAT A;  3O2P A;  1QS7 A;  1EG4 A;  2Q4U A;  5HYD A;  3SIA A;  1A2X A;  1YRU B;  3FS7 A;  2OTG B;  1F70 A;  2H2K A;  1B7T Z;  2L0P A;  2CBL A;  4OR9 B;  5TNC A;  1FW4 A;  2CTN A;  1S3P A;  4F0Z B;  1PK0 D;  1S6J A;  1J7Q A;  1WLM A;  4MZJ A;  1EJ3 A;  2AUC A;  1FI6 A;  3IQO A;  1NX2 A;  1L2O C;  1NCY A;  1WRL A;  3CGA A;  3WXA A;  3JVT B;  3CTN A;  2JRF A;  1SRA A;  2K7D A;  1WDC B;  2LE9 B;  4M2Q A;  1JSA A;  1B8C A;  3KHE A;  1Y1X A;  4PCW A;  2A4J A;  1JC2 A;  2BL0 C;  1TCF A;  2I2R E;  1QX7 A;  3SIB A;  2KSP A;  4CLN A;  4BY4 A;  1TOP A;  4I5L B;  3M0W A;  1JFK A;  2EC6 C;  2IS9 A;  5B8I B;  3CWG A;  2KFG A;  2KQ6 A;  1MF8 B;  2WND A;  1U5I A;  2BEC A;  2KAX A;  1XFW O;  3LK1 A;  1G4Y R;  1Y1A A;  3WHT B;  1B8R A;  3DVM A;  1TNX A;  1ZAC A;  3SG7 A;  1KQM C;  1IQ5 A;  1F55 A;  4MRX A;  4JPZ B;  2BCB A;  1BT6 A;  1NX1 A;  2LVI A;  2JUL A;  1YTZ C;  2GV5 A;  4MZK A;  1BU3 A;  1CDP A;  1WRK A;  1ALW A;  3NSI A;  5FYX A;  2KBI A;  1BOD A;  2Y1M A;  2WOR A;  1J7R A;  2LHI A;  1M31 A;  2ZN9 A;  5AAN A;  1S6C A;  2BCA A;  1BR1 B;  1CFD A;  4Q04 A;  1K9K A;  1N65 A;  1B1G A;  1HQV A;  3GK2 A;  2E30 A;  1SL8 A;  4AQI A;  4OCI A;  3SG2 A;  1CLM A;  1TNQ A;  1DVI A;  2ZRT A;  3TDZ A;  1ZFS A;  1J1E A;  1AUI B;  4DS7 A;  1SCV A;  4A4B A;  3EKH A;  1LXF C;  1DJI A;  1TNW A;  2KYF A;  4L9M A;  4PHJ A;  4USL A;  1KQV A;  1UHN A;  4GAO A;  1IJ6 A;  1NX0 A;  1BOC A;  1KK8 C;  2ISD A;  1OMV A;  1M45 A;  3KPX A;  5HKW A;  1IQ3 A;  4TNC A;  2CCM A;  1UUS A;  4PAL A;  1W7I B;  4N1G A;  3AAJ A;  3E3R A;  1R2U A;  1LKJ A;  4YGC B;  1M63 B;  3CR5 X;  1C7V A;  1CKK A;  1DJX A;  4OKH A;  2KGB C;  2Y5I A;  1CDN A;  5I2Q A;  1AP4 A;  1EG3 A;  2FCD A;  2LLS A;  4P5O E;  1SL9 A;  2PRU A;  3HX4 A;  1QXP A;  4CID A;  2AAO A;  2AMI A;  1GGW A;  1IH0 A;  3BOW B;  1LA3 A;  1N0Y A;  2M1U A;  3PLF B;  4NDD A;  1RWY A;  4YGA A;  4AOM A;  2H61 C;  1J7O A;  3CR2 A;  3I5F C;  4ICB A;  1XFU O;  2WOS A;  4MLW A;  2MLE C;  3A4U B;  1XYD A;  3PN7 C;  3K21 A;  2JOJ A;  2M49 B;  1JWD A;  1CB1 A;  1XFX O;  1QLS A;  2O5G A;  2R2I A;  1JBA A;  4GBA A;  1RJV A;  1OMD A;  2OPO A;  3CR4 X;  2NXQ A;  1OZS A;  2ZRS A;  1CMF A;  2LCP A;  2F3Z A;  1U5I B;  3TS5 B;  2JNF A;  1IKU A;  4PE0 A;  2M97 A;  1FI5 A;  5BPJ A;  4PDZ A;  2LVV A;  4WQ2 A;  4M2P A;  2M7N A;  1E8A A;  1KSM A;  1CTR A;  3KO0 A;  4HRH A;  1PRW A;  3JTD C;  1S1E A;  1YVH A;  5HLV A;  1EXR A;  1KWO B;  4I5J A;  2K8M B;  1WRZ A;  1JFJ A;  2CXJ A;  1IGV A;  1TNP A;  2MAZ A;  1F71 A;  3KF9 A;  1B4C A;  2F2O A;  2MA2 A;  1KFX S;  4JWQ A;  4N5X A;  2F33 A;  4WQ3 A;  2PVB A;  2JQ6 A;  2FCE A;  2NCO A;  2V53 A;  3PN7 B;  1S26 D;  4QJ4 B;  2K0J A;  2KOT A;  2MBX A;  5HKY A;  1BF5 A;  1H8B A;  2CNP A;  4YGB B;  3SG6 A;  2EHB A;  1Q80 A;  1UWO A;  2NCP A;  2LM5 A;  4YGD B;  3AAK A;  4PHK A;  1M46 A;  1B47 A;  3BOW A;  4CFQ A;  4ORC B;  1GGZ A;  5CPV A;  2K2A A;  3KEV A;  1BR4 B;  3EK4 A;  2I7A A;  5DKN A;  1SW8 A;  2LAN A;  3I5G C;  1CFP A;  3CS1 A;  4NQG A;  5AEQ A;  3JTD B;  1OE9 B;  3H4S E;  1JUO A;  2JZI A;  3PSR A;  2KQY A;  1W7J B;  1CFF A;  4NDB A;  4PE4 A;  3DD4 A;  1SYM A;  2G2B A;  3GOF A;  2JU0 A;  3OB1 B;  1SR6 C;  1XFZ O;  3LL8 B;  3D0Y B;  3CZT X;  4ZCV A;  2COL B;  4NDC A;  1FPW A;  1A4P A;  5D7F A;  1LVC D;  2JC2 A;  4C0L A;  1TIZ A;  1ALV A;  1UHH A;  2M1K B;  3A8R A;  2ZNE A;  3OX5 A;  1QAS A;  4GNK B;  1SMG A;  1K93 D;  1UP5 A;  2H61 A;  1L2O B;  2ZN8 A;  1KFU S;  1K94 A;  4C0K A;  1S5G Y;  2BE6 A;  2LLT A;  3ZNI A;  2MHH A;  2BL0 B;  1D1O A;  3VRR A;  5CSN A;  2M7L A;  3BUX B;  1SBJ A;  1BLQ A;  1CMG A;  4YI9 A;  1DJZ A;  1K90 D;  4QJ3 B;  2EC6 B;  2RGI A;  4PE1 A;  1G33 A;  2TN4 A;  3MSE B;  1J1D A;  4FTG A;  1NYA A;  4HSZ A;  1MHO A;  2HPS A;  2LP2 A;  1F54 A;  1DJG A;  3AKB A;  1SCM C;  4GGF C;  1BG1 A;  2WC8 A;  1CDM A;  1DJY A;  1KQM B;  1MWN A;  2F2P A;  3C1V A;  2GGM A;  1OSA A;  5D69 A;  3IQQ A;  1PSR A;  1PVB A;  2D8N A;  1DTL A;  3F45 A;  1CFC A;  1PSB A;  2LV7 A;  4YI8 A;  4FQO A;  4PE7 A;  3D0Y A;  1KCY A;  2JNX A;  4M2O A;  1B9A A;  3EVV A;  3LCP C;  4YRU A;  1AK8 A;  1WY9 A;  1TN4 A;  2JXC A;  1MXL C;  1JF0 A;  1PAL A;  3BQ3 A;  2KI6 C;  1SK6 D;  1Y1U A;  2O60 A;  2MRD A;  2QAC A;  3GK4 X;  4GFT A;  3TZ1 A;  3DVE A;  4GUK A;  2K7C A;  3GK1 A;  3NSO A;  4IL1 A;  1LA0 A;  1V1F A;  1KK8 B;  2JPT A;  5JOL A;  1L7Z A;  2LMV A;  1XK4 C;  4MN0 A;  1RK9 A;  2JWW A;  2BBN A;  1UUR A;  2JTT A;  2MLF C;  3I5H C;  2ZND A;  1F4Q A;  1BJF A;  2WCF A;  1NPQ A;  2K7O A;  2BE4 A;  1H4B A;  4XYN A;  2I18 A;  2ZFD A;  1JF2 A;  1J55 A;  2LAP A;  2DOQ A;  2NZ0 A;  1S5G Z;  2M9G A;  3BUO B;  2P6B B;  2KYC A;  1PUL A;  1NX3 A;  2K2F A;  4P2Y B;  5HLO A;  3HCM A;  1CDL A;  4OV2 A;  1ODB A;  1QJT A;  2LUC A;  1OMR A;  1YUT A;  1MR8 A;  5GQQ C;  3RM1 A;  3I5F B;  2FJU B;  3NSK A;  2Q91 A;  5DKR A;  2M29 A;  1BMO A;  2FOT A;  5ER4 X;  2OTG C;  4A4C A;  1GQM A;  3CLN A;  1VRK A;  5KU1 A;  1EH2 A;  2M8U A;  2WCE A;  1OZO A;  4HRE E;  4DUQ A;  3EK7 A;  1EL4 A;  1UHK A;  5K89 A;  2KDH A;  2LP3 A; 
#chains in the Genus database with same CATH topology
 4DRW A;  1J7P A;  5G08 A;  1IRJ A;  1SNL A;  1ZOT B;  4ZCU A;  1WDC C;  4UPG A;  4E68 A;  2BBM A;  3VRO A;  4CPV A;  1DF0 B;  2QEB A;  2KPH A;  3SG5 A;  3OX6 A;  1RFJ A;  3QRX A;  1ORG A;  3VRN A;  2M3W A;  3RLZ A;  4ORB B;  3UO9 A;  5AER A;  5HKZ A;  1QVI Y;  4HRG A;  3BFB A;  4PHM A;  2F8P A;  2JT8 A;  1YRT B;  2B1U A;  3CZ1 A;  5PAL A;  4QJ5 B;  1A29 A;  5KTY A;  2E6W A;  1QWV A;  3SG4 A;  5D3O A;  3D73 A;  1KK7 Y;  3BFA A;  1SPY A;  5KSZ A;  1M39 A;  3DVJ A;  5CSF A;  1CM1 A;  2JT3 A;  2KBM A;  2NLN A;  3BJH A;  2L5Y A;  5FI7 A;  4JQ0 D;  2GGZ A;  3SG3 A;  1DGU A;  1QV0 A;  1XFR A;  1DEK A;  1AJ4 A;  3OHM B;  4DIR A;  1NWD A;  2EGD A;  3L4L A;  1SL7 A;  1IJ5 A;  1Y6W A;  3BYA A;  3I5I C;  4N1F A;  1CNP A;  1YVL A;  3DYE A;  1Z2C B;  1TRF A;  3I5G B;  2L4I A;  3PAL A;  5DKQ A;  1S36 A;  1XVJ A;  1OOJ A;  1QX2 A;  2P70 A;  4F7F A;  1C07 A;  2BKH B;  3S0E A;  1CLL A;  1XK4 A;  4AQJ A;  1KFU L;  4DCK A;  4MSP A;  2LNK A;  3VRQ A;  3DF0 B;  3PM2 A;  1MUX A;  3TUY C;  2K7B A;  1K8U A;  2LMU A;  5IBW A;  1DJH A;  3NSL A;  2PMY A;  3R1O A;  1YUR A;  4MBE A;  1SR6 B;  2LVJ A;  3SS4 A;  1DMO A;  1NCX A;  2L4H A;  2BKI B;  2L50 A;  1LIN A;  1MQ1 A;  2BCX A;  1NP8 A;  2JT0 A;  2G9B A;  2JXL A;  5CSI A;  1A03 A;  1DJW A;  1XFY O;  2OS8 C;  2WCB A;  4PHN A;  3VRP A;  1AVS A;  3NGV A;  4MZL A;  4XJK A;  5FI2 A;  1DF0 A;  3B6X A;  4U8D A;  4ETO A;  1MXE A;  3I5I B;  2PAS A;  1FF1 A;  2MJW B;  3Q8I A;  1P28 A;  2WC5 A;  3S0D A;  2PAL A;  1NUB A;  1A75 B;  1OQP A;  1SY9 A;  1K95 A;  2VRG A;  4I5N B;  4MVF A;  1K2H A;  2K61 A;  4C0J A;  4JKT A;  1NCZ A;  2KAV A;  3OB2 B;  2I94 A;  2JTZ A;  4YBH B;  1YUU A;  2L5X B;  2WC6 A;  1PVA A;  1X02 A;  3TUY B;  1QV1 A;  1QIW A;  1AHR A;  1ZMZ A;  3VGO A;  2KAY A;  1QX5 B;  2M0R A;  5AXI A;  4CFR A;  5HL1 A;  1YX7 A;  3FE9 A;  3BFH A;  1OOI X;  1QVI Z;  3EKJ A;  1RRO A;  2K60 A;  3ICB A;  3OP0 A;  1IIO A;  5AFP A;  1B7T Y;  2L2E A;  2F3Y A;  1AJ5 A;  1OW4 A;  2L51 A;  2OS8 B;  2HF5 A;  2QPT A;  3FE6 A;  3PM8 A;  1KK7 Z;  1SCM B;  1IG5 A;  3IF7 A;  2L98 A;  4I5K A;  1CLB A;  1C7W A;  3D75 A;  5CSJ A;  1FBV A;  3TDI A;  1UHI A;  2CT9 A;  1QIV A;  2KI4 C;  1V1G A;  1N2D A;  1F4O A;  3BUM B;  4GGN A;  1K96 A;  1Z4H A;  2SAS A;  3DF0 A;  1XFV O;  1NIW A;  5J3X A;  2GTE A;  3LLE A;  5I8N A;  3TS5 C;  1QTX A;  3S0G A;  1KSO A;  3FIA A;  3AKA A;  3NXA A;  1K9P A;  1G8I A;  3O4Y A;  1TTX A;  4YGE B;  1DEL A;  3TDU A;  4BY5 A;  2KGR A;  4OVN F;  1TUZ A;  3WHU B;  2LLU A;  1REC A;  1DT7 B;  2KFF A;  3FWB A;  1KWO C;  2Y4Q A;  4R1E A;  1SKT A;  2ERB A;  1XA5 A;  4MEW A;  2LHL A;  2Y1N A;  1QAT A;  3O78 A;  4GPL B;  2KNE A;  2LC5 A;  3SJS A;  3D10 A;  1K9U A;  1HT9 A;  1DC1 A;  1A75 A;  1DGV A;  2KHN A;  2LUX A;  3BUN B;  4KYN A;  1YX8 A;  3WNX B;  2KI4 B;  1Y0V H;  1B8L A;  1QLK A;  1NSH A;  3PFV A;  3I5H B;  2HQW A;  1KFX L;  3SS3 A;  1RTP 1;  1GJY A;  2WCL A;  2PSR A;  4WRI A;  1R6P A;  3EK8 A;  5JJG A;  4D1E A;  2KI6 D;  1ZUZ A;  1S6I A;  2HET A;  2HQ8 A;  3B87 A;  1WLZ A;  2ZKM X;  3DVK A;  3JVT C;  4MRY A;  3DZT A;  2SCP A;  1IWQ A;  4XJK B;  2KFH A;  1YR5 A;  2LVK A;  3FWC A;  1XO5 A;  2LMT A;  3BUW B;  5I2L A;  3EVR A;  4GGF A;  1CM4 A;  3N7H A;  3O6B A;  3ZWH A;  5I2O A;  1F8H A;  5ER5 A;  3EVU A;  3PJI A;  1UHJ A;  3LK0 A;  1W9Z A;  1TCO B;  3BXK A;  4ORA B;  1YUS A;  5F6T A;  3PAT A;  3O2P A;  1QS7 A;  1EG4 A;  2Q4U A;  5HYD A;  3SIA A;  1A2X A;  1YRU B;  3FS7 A;  3R1V A;  2OTG B;  1F70 A;  2H2K A;  1B7T Z;  2L0P A;  2CBL A;  4OR9 B;  5TNC A;  1FW4 A;  2CTN A;  1S3P A;  4F0Z B;  1PK0 D;  1S6J A;  1J7Q A;  1WLM A;  4MZJ A;  3D76 A;  3NHT A;  1C3Y A;  1EJ3 A;  2AUC A;  1FI6 A;  3IQO A;  1NX2 A;  1L2O C;  1NCY A;  1WRL A;  3CGA A;  2L2C A;  3JVT B;  3WXA A;  3CTN A;  2JRF A;  1SRA A;  2K7D A;  1WDC B;  2LE9 B;  4M2Q A;  1JSA A;  3CDN A;  1B8C A;  3KHE A;  1Y1X A;  4PCW A;  2A4J A;  1JC2 A;  1TCF A;  2BL0 C;  2I2R E;  1QX7 A;  3SIB A;  2KSP A;  4CLN A;  4OZD A;  4BY4 A;  3R1P A;  1TOP A;  4INW A;  3SS5 A;  4I5L B;  3M0W A;  1JFK A;  2H8V A;  2EC6 C;  2IS9 A;  5B8I B;  3CWG A;  2KFG A;  2KQ6 A;  4INX A;  1MF8 B;  2WND A;  1U5I A;  2BEC A;  2KAX A;  1XFW O;  3LK1 A;  1G4Y R;  1Y1A A;  1OOG A;  3VB1 A;  3WHT B;  1B8R A;  2YGU A;  3DVM A;  1TNX A;  1ZAC A;  3SG7 A;  1KQM C;  1IQ5 A;  1F55 A;  4MRX A;  4JPZ B;  2BCB A;  1BT6 A;  1NX1 A;  2KLE A;  2LVI A;  2JUL A;  1YTZ C;  2GV5 A;  3CYZ A;  4MZK A;  1BU3 A;  1CDP A;  1WRK A;  1ALW A;  3NSI A;  5FYX A;  2KBI A;  1BOD A;  2Y1M A;  2WOR A;  1J7R A;  2LHI A;  1M31 A;  2ZN9 A;  5AAN A;  1S6C A;  2BCA A;  1BR1 B;  1CFD A;  4Q04 A;  1K9K A;  1TWO A;  1N65 A;  1B1G A;  1HQV A;  3GK2 A;  2E30 A;  2PQL A;  1SL8 A;  4AQI A;  4OCI A;  3SG2 A;  1CLM A;  1TNQ A;  1DVI A;  2ZRT A;  3TDZ A;  1ZFS A;  1J1E A;  1AUI B;  3OGN A;  4DS7 A;  1SCV A;  4A4B A;  3EKH A;  1LXF C;  1DJI A;  1TNW A;  2KYF A;  2PYQ A;  4L9M A;  4PHJ A;  4USL A;  1UHN A;  4GAO A;  1IJ6 A;  3DY9 A;  1KQV A;  1NX0 A;  1BOC A;  1KK8 C;  2ISD A;  1SSE B;  1C3Z A;  1OMV A;  1M45 A;  3KPX A;  5HKW A;  1IQ3 A;  4TNC A;  2CCM A;  3FE8 A;  1UUS A;  4PAL A;  1W7I B;  4N1G A;  3AAJ A;  3E3R A;  1R2U A;  1LKJ A;  4YGC B;  1M63 B;  3CR5 X;  1C7V A;  1CKK A;  1DJX A;  4OKH A;  2KGB C;  2Y5I A;  5FI6 A;  1CDN A;  5I2Q A;  1TUJ A;  1EG3 A;  2FCD A;  2LLS A;  4P5O E;  3L47 A;  1AP4 A;  3CZ0 A;  3NHI A;  1SL9 A;  2PRU A;  3HX4 A;  1QXP A;  4CID A;  2AAO A;  2AMI A;  1GGW A;  1IH0 A;  3BOW B;  1LA3 A;  1N0Y A;  2M1U A;  3PLF B;  4NDD A;  1RWY A;  4YGA A;  4AOM A;  2H61 C;  1J7O A;  3CR2 A;  3I5F C;  4ICB A;  1XFU O;  2WOS A;  4MLW A;  4JD9 A;  2MLE C;  3A4U B;  1XYD A;  3PN7 C;  3K21 A;  2JOJ A;  2M49 B;  1JWD A;  1CB1 A;  1XFX O;  1QLS A;  2O5G A;  2FJY A;  2R2I A;  4GBA A;  1JBA A;  1RJV A;  2QEH A;  1OMD A;  2OPO A;  3CR4 X;  2NXQ A;  1OZS A;  3RZS A;  2ZRS A;  1CMF A;  2LCP A;  2F3Z A;  1U5I B;  3TS5 B;  2JNF A;  3D74 A;  3K1E A;  4PE0 A;  2M97 A;  1IKU A;  3R72 A;  1FI5 A;  5BPJ A;  4PDZ A;  2LVV A;  4WQ2 A;  4M2P A;  2M7N A;  1E8A A;  1KSM A;  3B88 A;  1CTR A;  3KO0 A;  4HRH A;  1PRW A;  3JTD C;  3OBV A;  1S1E A;  3D78 A;  1YVH A;  5HLV A;  1EXR A;  1KWO B;  4I5J A;  1GM0 A;  2K8M B;  1OOF A;  1WRZ A;  1JFJ A;  2CXJ A;  1IGV A;  1TNP A;  2MAZ A;  1F71 A;  3KF9 A;  1B4C A;  2F2O A;  2MA2 A;  1KFX S;  4JWQ A;  4N5X A;  2F33 A;  4WQ3 A;  2PVB A;  2JQ6 A;  2FCE A;  2NCO A;  2V53 A;  3PN7 B;  1S26 D;  4QJ4 B;  2K0J A;  2KOT A;  2MBX A;  5HKY A;  1BF5 A;  1H8B A;  2CNP A;  3DXL A;  4YGB B;  3SG6 A;  2EHB A;  1Q80 A;  1UWO A;  2NCP A;  2LM5 A;  4YGD B;  3AAK A;  4PHK A;  1M46 A;  1B47 A;  3BOW A;  4CFQ A;  4ORC B;  1GGZ A;  5CPV A;  2K2A A;  3KEV A;  1BR4 B;  3QME A;  3B86 A;  3EK4 A;  2I7A A;  5DKN A;  1SW8 A;  2LAN A;  3I5G C;  5EL2 A;  1CFP A;  3CS1 A;  4NQG A;  5AEQ A;  2QEV A;  2WCJ A;  3JTD B;  1OE9 B;  3H4S E;  1JUO A;  2JZI A;  3PSR A;  2KQY A;  2WCM A;  3L4A A;  1W7J B;  1CFF A;  3UNW A;  3EG5 B;  4NDB A;  4PE4 A;  3DD4 A;  1SYM A;  2G2B A;  2BNX A;  3GOF A;  2JU0 A;  3OB1 B;  1SR6 C;  1XFZ O;  3LL8 B;  3D0Y B;  3CZT X;  4ZCV A;  2COL B;  4NDC A;  2WCK A;  1DQE A;  1A4P A;  1FPW A;  3B7A A;  5D7F A;  1LVC D;  2JC2 A;  4C0L A;  1TIZ A;  1ALV A;  1UHH A;  2M1K B;  3A8R A;  2ZNE A;  3OX5 A;  4IJ7 A;  1QAS A;  4GNK B;  1SMG A;  1K93 D;  1UP5 A;  2H61 A;  1L2O B;  2QEO A;  2ZN8 A;  2P71 A;  1KFU S;  1K94 A;  4C0K A;  1S5G Y;  2BE6 A;  2LLT A;  3V2L A;  2MHH A;  2BL0 B;  3ZNI A;  3VRR A;  1D1O A;  5CSN A;  2M7L A;  3BUX B;  1SBJ A;  1BLQ A;  1OOH A;  1CMG A;  4YI9 A;  1DJZ A;  1K90 D;  1T14 A;  2EC6 B;  4QJ3 B;  2RGI A;  4PE1 A;  1G33 A;  2TN4 A;  3MSE B;  1LS8 A;  1J1D A;  4FTG A;  1NYA A;  4HSZ A;  1MHO A;  2HPS A;  2LP2 A;  1F54 A;  1DJG A;  3AKB A;  1SCM C;  4GGF C;  2KLD A;  1BG1 A;  2WC8 A;  1CDM A;  1DJY A;  1KQM B;  1MWN A;  2BAP A;  2F2P A;  4FQT A;  3C1V A;  3S0B A;  2GGM A;  1OSA A;  5D69 A;  3IQQ A;  1PSR A;  1PVB A;  2D8N A;  1DTL A;  2QDI A;  3F45 A;  1CFC A;  1PSB A;  2LV7 A;  4YI8 A;  4FQO A;  4PE7 A;  3D0Y A;  1KCY A;  2JNX A;  4M2O A;  1B9A A;  3EVV A;  3LCP C;  4YRU A;  1AK8 A;  1WY9 A;  1TN4 A;  2JXC A;  1MXL C;  1JF0 A;  1PAL A;  3BQ3 A;  2JPO A;  2KI6 C;  1SK6 D;  1Y1U A;  2O60 A;  2MRD A;  2QAC A;  3GK4 X;  4GFT A;  3TZ1 A;  3DVE A;  4GUK A;  2K7C A;  3GK1 A;  3NSO A;  4IL1 A;  1LA0 A;  1V1F A;  1KK8 B;  2JPT A;  3O4X A;  5JOL A;  1L7Z A;  2LMV A;  1XK4 C;  4MN0 A;  3S0F A;  1RK9 A;  5DIC A;  3CAB A;  2JWW A;  2BBN A;  1UUR A;  2JTT A;  2MLF C;  3I5H C;  2ZND A;  1F4Q A;  1BJF A;  2WCF A;  1NPQ A;  2K7O A;  2BE4 A;  1H4B A;  4XYN A;  2I18 A;  2ZFD A;  1JF2 A;  2WCH A;  1J55 A;  2LAP A;  2DOQ A;  2NZ0 A;  1S5G Z;  2M9G A;  3BUO B;  2P6B B;  2KYC A;  1PUL A;  1NX3 A;  2K2F A;  4P2Y B;  5HLO A;  3HCM A;  3IVT A;  1CDL A;  4OV2 A;  1ODB A;  1QJT A;  2LUC A;  1OMR A;  1YUT A;  1MR8 A;  5GQQ C;  3RM1 A;  3I5F B;  2FJU B;  3NSK A;  2Q91 A;  5I94 A;  5DKR A;  2M29 A;  1BMO A;  2FOT A;  5ER4 X;  2OTG C;  4A4C A;  1GQM A;  3CLN A;  1VRK A;  5KU1 A;  1EH2 A;  2M8U A;  2WCE A;  4PT1 A;  1OZO A;  4HRE E;  3D77 A;  4DUQ A;  3EK7 A;  3S0A A;  1EL4 A;  1UHK A;  5K89 A;  3CZ2 A;  2KDH A;  2LP3 A; 
#chains in the Genus database with same CATH homology
 4DRW A;  1J7P A;  5G08 A;  1IRJ A;  1SNL A;  1ZOT B;  4ZCU A;  1WDC C;  4UPG A;  4E68 A;  2BBM A;  3VRO A;  4CPV A;  1DF0 B;  3SG5 A;  3OX6 A;  1RFJ A;  3QRX A;  3VRN A;  2M3W A;  3RLZ A;  4ORB B;  5AER A;  5HKZ A;  1QVI Y;  4HRG A;  4PHM A;  2F8P A;  2JT8 A;  1YRT B;  2B1U A;  5KTY A;  5PAL A;  4QJ5 B;  1A29 A;  2E6W A;  3SG4 A;  1KK7 Y;  1SPY A;  5KSZ A;  1M39 A;  3DVJ A;  5CSF A;  1CM1 A;  2JT3 A;  2KBM A;  2NLN A;  4JQ0 D;  2GGZ A;  3SG3 A;  1DGU A;  1QV0 A;  1AJ4 A;  3OHM B;  4DIR A;  1NWD A;  2EGD A;  1SL7 A;  1IJ5 A;  1Y6W A;  3BYA A;  3I5I C;  4N1F A;  1CNP A;  1YVL A;  1TRF A;  3I5G B;  2L4I A;  3PAL A;  5DKQ A;  1S36 A;  1XVJ A;  1OOJ A;  1QX2 A;  1C07 A;  2BKH B;  4AQJ A;  1CLL A;  1XK4 A;  4DCK A;  1KFU L;  4MSP A;  2LNK A;  3VRQ A;  3DF0 B;  1MUX A;  3TUY C;  2K7B A;  1K8U A;  2LMU A;  5IBW A;  1DJH A;  3NSL A;  2PMY A;  4MBE A;  1YUR A;  1SR6 B;  2LVJ A;  1DMO A;  1NCX A;  2L4H A;  2BKI B;  2L50 A;  1LIN A;  1MQ1 A;  2BCX A;  1NP8 A;  2JT0 A;  2G9B A;  2JXL A;  5CSI A;  1A03 A;  1DJW A;  1XFY O;  2OS8 C;  2WCB A;  4PHN A;  3VRP A;  1AVS A;  4XJK A;  4MZL A;  1DF0 A;  4U8D A;  4ETO A;  1MXE A;  3I5I B;  2PAS A;  1FF1 A;  2MJW B;  2PAL A;  1NUB A;  1A75 B;  1OQP A;  1SY9 A;  1K95 A;  2VRG A;  4I5N B;  4MVF A;  1K2H A;  2K61 A;  4C0J A;  1NCZ A;  2KAV A;  3OB2 B;  2I94 A;  2JTZ A;  4YBH B;  1YUU A;  2L5X B;  1PVA A;  1X02 A;  3TUY B;  1QV1 A;  1QIW A;  1AHR A;  1ZMZ A;  3VGO A;  2KAY A;  1QX5 B;  2M0R A;  5AXI A;  4CFR A;  1YX7 A;  1QVI Z;  3EKJ A;  1RRO A;  3ICB A;  3OP0 A;  5AFP A;  1B7T Y;  2L2E A;  2F3Y A;  1AJ5 A;  2L51 A;  2OS8 B;  2QPT A;  2HF5 A;  3PM8 A;  1KK7 Z;  1SCM B;  1IG5 A;  3IF7 A;  2L98 A;  4I5K A;  1CLB A;  1C7W A;  5CSJ A;  1FBV A;  3TDI A;  1UHI A;  2CT9 A;  1QIV A;  2KI4 C;  1V1G A;  1N2D A;  1F4O A;  3BUM B;  4GGN A;  1K96 A;  2SAS A;  3DF0 A;  1XFV O;  1NIW A;  5J3X A;  3LLE A;  5I8N A;  3TS5 C;  1QTX A;  1KSO A;  3FIA A;  3AKA A;  3NXA A;  1K9P A;  1G8I A;  3O4Y A;  1TTX A;  4YGE B;  3TDU A;  4BY5 A;  2KGR A;  4OVN F;  1DT7 B;  3WHU B;  2LLU A;  1REC A;  2KFF A;  3FWB A;  1KWO C;  2Y4Q A;  4R1E A;  1SKT A;  1XA5 A;  4MEW A;  2LHL A;  2Y1N A;  1QAT A;  3O78 A;  4GPL B;  2KNE A;  2LC5 A;  3SJS A;  3D10 A;  1K9U A;  1HT9 A;  1A75 A;  1DGV A;  2KHN A;  2LUX A;  3BUN B;  1YX8 A;  3WNX B;  2KI4 B;  1Y0V H;  1B8L A;  1QLK A;  1NSH A;  3PFV A;  3I5H B;  2HQW A;  1KFX L;  1RTP 1;  1GJY A;  2PSR A;  4WRI A;  1R6P A;  3EK8 A;  5JJG A;  4D1E A;  2KI6 D;  1ZUZ A;  1S6I A;  2HET A;  2HQ8 A;  1WLZ A;  2ZKM X;  3DVK A;  3JVT C;  4MRY A;  2SCP A;  1IWQ A;  4XJK B;  2KFH A;  1YR5 A;  2LVK A;  3FWC A;  1XO5 A;  2LMT A;  3BUW B;  5I2L A;  3EVR A;  4GGF A;  1CM4 A;  3ZWH A;  3O6B A;  1F8H A;  5I2O A;  5ER5 A;  3EVU A;  1UHJ A;  3LK0 A;  1TCO B;  3BXK A;  4ORA B;  1YUS A;  5F6T A;  3PAT A;  3O2P A;  1QS7 A;  1EG4 A;  2Q4U A;  5HYD A;  3SIA A;  1A2X A;  1YRU B;  3FS7 A;  2OTG B;  1F70 A;  2H2K A;  1B7T Z;  2L0P A;  2CBL A;  4OR9 B;  5TNC A;  1FW4 A;  2CTN A;  1S3P A;  4F0Z B;  1PK0 D;  1S6J A;  1J7Q A;  1WLM A;  4MZJ A;  1EJ3 A;  2AUC A;  1FI6 A;  3IQO A;  1NX2 A;  1L2O C;  1NCY A;  1WRL A;  3CGA A;  3WXA A;  3JVT B;  3CTN A;  2JRF A;  1SRA A;  2K7D A;  1WDC B;  2LE9 B;  4M2Q A;  1JSA A;  1B8C A;  3KHE A;  1Y1X A;  4PCW A;  2A4J A;  1JC2 A;  2BL0 C;  1TCF A;  2I2R E;  1QX7 A;  3SIB A;  2KSP A;  4CLN A;  4BY4 A;  1TOP A;  4I5L B;  3M0W A;  1JFK A;  2EC6 C;  2IS9 A;  5B8I B;  3CWG A;  2KFG A;  2KQ6 A;  1MF8 B;  2WND A;  1U5I A;  2BEC A;  2KAX A;  1XFW O;  3LK1 A;  1G4Y R;  1Y1A A;  3WHT B;  1B8R A;  3DVM A;  1TNX A;  1ZAC A;  3SG7 A;  1KQM C;  1IQ5 A;  1F55 A;  4MRX A;  4JPZ B;  2BCB A;  1BT6 A;  1NX1 A;  2LVI A;  2JUL A;  1YTZ C;  2GV5 A;  4MZK A;  1BU3 A;  1CDP A;  1WRK A;  1ALW A;  3NSI A;  5FYX A;  2KBI A;  1BOD A;  2Y1M A;  2WOR A;  1J7R A;  2LHI A;  1M31 A;  2ZN9 A;  5AAN A;  1S6C A;  2BCA A;  1BR1 B;  1CFD A;  4Q04 A;  1K9K A;  1N65 A;  1B1G A;  1HQV A;  3GK2 A;  2E30 A;  1SL8 A;  4AQI A;  4OCI A;  3SG2 A;  1CLM A;  1TNQ A;  1DVI A;  2ZRT A;  3TDZ A;  1ZFS A;  1J1E A;  1AUI B;  4DS7 A;  1SCV A;  4A4B A;  3EKH A;  1LXF C;  1DJI A;  1TNW A;  2KYF A;  4L9M A;  4PHJ A;  4USL A;  1KQV A;  1UHN A;  4GAO A;  1IJ6 A;  1NX0 A;  1BOC A;  1KK8 C;  2ISD A;  1OMV A;  1M45 A;  3KPX A;  5HKW A;  1IQ3 A;  4TNC A;  2CCM A;  1UUS A;  4PAL A;  1W7I B;  4N1G A;  3AAJ A;  3E3R A;  1R2U A;  1LKJ A;  4YGC B;  1M63 B;  3CR5 X;  1C7V A;  1CKK A;  1DJX A;  4OKH A;  2KGB C;  2Y5I A;  1CDN A;  5I2Q A;  1AP4 A;  1EG3 A;  2FCD A;  2LLS A;  4P5O E;  1SL9 A;  2PRU A;  3HX4 A;  1QXP A;  4CID A;  2AAO A;  2AMI A;  1GGW A;  1IH0 A;  3BOW B;  1LA3 A;  1N0Y A;  2M1U A;  3PLF B;  4NDD A;  1RWY A;  4YGA A;  4AOM A;  2H61 C;  1J7O A;  3CR2 A;  3I5F C;  4ICB A;  1XFU O;  2WOS A;  4MLW A;  2MLE C;  3A4U B;  1XYD A;  3PN7 C;  3K21 A;  2JOJ A;  2M49 B;  1JWD A;  1CB1 A;  1XFX O;  1QLS A;  2O5G A;  2R2I A;  1JBA A;  4GBA A;  1RJV A;  1OMD A;  2OPO A;  3CR4 X;  2NXQ A;  1OZS A;  2ZRS A;  1CMF A;  2LCP A;  2F3Z A;  1U5I B;  3TS5 B;  2JNF A;  1IKU A;  4PE0 A;  2M97 A;  1FI5 A;  5BPJ A;  4PDZ A;  2LVV A;  4WQ2 A;  4M2P A;  2M7N A;  1E8A A;  1KSM A;  1CTR A;  3KO0 A;  4HRH A;  1PRW A;  3JTD C;  1S1E A;  1YVH A;  5HLV A;  1EXR A;  1KWO B;  4I5J A;  2K8M B;  1WRZ A;  1JFJ A;  2CXJ A;  1IGV A;  1TNP A;  2MAZ A;  1F71 A;  3KF9 A;  1B4C A;  2F2O A;  2MA2 A;  1KFX S;  4JWQ A;  4N5X A;  2F33 A;  4WQ3 A;  2PVB A;  2JQ6 A;  2FCE A;  2NCO A;  2V53 A;  3PN7 B;  1S26 D;  4QJ4 B;  2K0J A;  2KOT A;  2MBX A;  5HKY A;  1BF5 A;  1H8B A;  2CNP A;  4YGB B;  3SG6 A;  2EHB A;  1Q80 A;  1UWO A;  2NCP A;  2LM5 A;  4YGD B;  3AAK A;  4PHK A;  1M46 A;  1B47 A;  3BOW A;  4CFQ A;  4ORC B;  1GGZ A;  5CPV A;  2K2A A;  3KEV A;  1BR4 B;  3EK4 A;  2I7A A;  5DKN A;  1SW8 A;  2LAN A;  3I5G C;  1CFP A;  3CS1 A;  4NQG A;  5AEQ A;  3JTD B;  1OE9 B;  3H4S E;  1JUO A;  2JZI A;  3PSR A;  2KQY A;  1W7J B;  1CFF A;  4NDB A;  4PE4 A;  3DD4 A;  1SYM A;  2G2B A;  3GOF A;  2JU0 A;  3OB1 B;  1SR6 C;  1XFZ O;  3LL8 B;  3D0Y B;  3CZT X;  4ZCV A;  2COL B;  4NDC A;  1FPW A;  1A4P A;  5D7F A;  1LVC D;  2JC2 A;  4C0L A;  1TIZ A;  1ALV A;  1UHH A;  2M1K B;  3A8R A;  2ZNE A;  3OX5 A;  1QAS A;  4GNK B;  1SMG A;  1K93 D;  1UP5 A;  2H61 A;  1L2O B;  2ZN8 A;  1KFU S;  1K94 A;  4C0K A;  1S5G Y;  2BE6 A;  2LLT A;  3ZNI A;  2MHH A;  2BL0 B;  1D1O A;  3VRR A;  5CSN A;  2M7L A;  3BUX B;  1SBJ A;  1BLQ A;  1CMG A;  4YI9 A;  1DJZ A;  1K90 D;  4QJ3 B;  2EC6 B;  2RGI A;  4PE1 A;  1G33 A;  2TN4 A;  3MSE B;  1J1D A;  4FTG A;  1NYA A;  4HSZ A;  1MHO A;  2HPS A;  2LP2 A;  1F54 A;  1DJG A;  3AKB A;  1SCM C;  4GGF C;  1BG1 A;  2WC8 A;  1CDM A;  1DJY A;  1KQM B;  1MWN A;  2F2P A;  3C1V A;  2GGM A;  1OSA A;  5D69 A;  3IQQ A;  1PSR A;  1PVB A;  2D8N A;  1DTL A;  3F45 A;  1CFC A;  1PSB A;  2LV7 A;  4YI8 A;  4FQO A;  4PE7 A;  3D0Y A;  1KCY A;  2JNX A;  4M2O A;  1B9A A;  3EVV A;  3LCP C;  4YRU A;  1AK8 A;  1WY9 A;  1TN4 A;  2JXC A;  1MXL C;  1JF0 A;  1PAL A;  3BQ3 A;  2KI6 C;  1SK6 D;  1Y1U A;  2O60 A;  2MRD A;  2QAC A;  3GK4 X;  4GFT A;  3TZ1 A;  3DVE A;  4GUK A;  2K7C A;  3GK1 A;  3NSO A;  4IL1 A;  1LA0 A;  1V1F A;  1KK8 B;  2JPT A;  5JOL A;  1L7Z A;  2LMV A;  1XK4 C;  4MN0 A;  1RK9 A;  2JWW A;  2BBN A;  1UUR A;  2JTT A;  2MLF C;  3I5H C;  2ZND A;  1F4Q A;  1BJF A;  2WCF A;  1NPQ A;  2K7O A;  2BE4 A;  1H4B A;  4XYN A;  2I18 A;  2ZFD A;  1JF2 A;  1J55 A;  2LAP A;  2DOQ A;  2NZ0 A;  1S5G Z;  2M9G A;  3BUO B;  2P6B B;  2KYC A;  1PUL A;  1NX3 A;  2K2F A;  4P2Y B;  5HLO A;  3HCM A;  1CDL A;  4OV2 A;  1ODB A;  1QJT A;  2LUC A;  1OMR A;  1YUT A;  1MR8 A;  5GQQ C;  3RM1 A;  3I5F B;  2FJU B;  3NSK A;  2Q91 A;  5DKR A;  2M29 A;  1BMO A;  2FOT A;  5ER4 X;  2OTG C;  4A4C A;  1GQM A;  3CLN A;  1VRK A;  5KU1 A;  1EH2 A;  2M8U A;  2WCE A;  1OZO A;  4HRE E;  4DUQ A;  3EK7 A;  1EL4 A;  1UHK A;  5K89 A;  2KDH A;  2LP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...