2K2FA

Solution structure of ca2+-s100a1-ryrp12
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
93
structure length
93
Chain Sequence
GSELETAMETLINVFHAHSGKEGDKYKLSKKELKDLLQTELSSFLDVQKDADAVDKIMKELDENGDGEVDFQEFVVLVAALTVACNNFFWENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ryanodine receptor 1 peptide
publication title S100A1 and Calmodulin Compete for the Same Binding Site on Ryanodine Receptor.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal binding protein
total genus 22
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2k2fA00
1KFXL 4DRWA 1ODBA 1V1FA 1KWOB 5HKZA 1JFJA 3SG2A 4GGFC 2F2OA 2O60A 2Y1MA 4BY5A 4JPZB 1W7IB 1MXEA 1WRLA 5CSIA 2IS9A 2MLEC 2PRUA 1DJWA 1UHNA 3E3RA 2OS8B 2JOJA 3LK0A 1CMGA 2LP3A 2PSRA 1V1GA 2M0RA 5G08A 4GPLB 1NCXA 1F71A 2ZNEA 3M0WA 1WDCC 2LNKA 5IBWA 1C7WA 1UHKA 4DIRA 1UHHA 2KYFA 1B9AA 2NCOA 3GK4X 2KOTA 4PHMA 3I5GB 2CCMA 3VRNA 1CMFA 1D1OA 1S5GY 1MQ1A 3OB1B 1EG3A 3BOWA 4YGBB 1J55A 1OQPA 1KK8B 1YTZC 2LV7A 2WC8A 1G4YR 4YRUA 4NDCA 1XK4C 4R1EA 1TNXA 3AKBA 3PATA 3CTNA 1YRUB 3WXAA 1SPYA 1B1GA 2WCEA 4PE1A 3SIBA 1QX2A 2K61A 2H61A 1ZACA 3FS7A 1SYMA 1AJ5A 1PSBA 1AP4A 1E8AA 1TNPA 3TUYB 1G33A 2KAXA 4CIDA 1CFCA 1IRJA 1B7TZ 3LCPC 4IL1A 5F6TA 2OTGC 1NX0A 2LUCA 1AHRA 2FCDA 3CZTX 2DOQA 1TTXA 1TNQA 2KI4B 2BE4A 1R2UA 2F2PA 2LANA 3O78A 1QIVA 3SG7A 2M7LA 1A03A 2HETA 2BCBA 2LM5A 1J7OA 1OZOA 1KK7Y 2ZN8A 3O4YA 4ORAB 1NX1A 4HRGA 1FF1A 3AKAA 3BUMB 1F4OA 2PMYA 2G9BA 2M9GA 2Y5IA 1TCFA 2BKIB 3I5HC 1DF0B 2HF5A 3PM8A 4YGDB 1KCYA 2KHNA 3RM1A 2LMTA 2SASA 5HLOA 2M8UA 2K7DA 2KFHA 2KDHA 3PN7B 3TS5C 3JTDC 2ZRTA 4MLWA 2I94A 1WLMA 4YGEB 5AEQA 1TNWA 3EK4A 1MR8A 1QV0A 1AUIB 2JT3A 2FJUB 3SJSA 2BCAA 2BKHB 1ZFSA 4F0ZB 4WQ3A 1NX2A 1M39A 2JU0A 2KGBC 2QPTA 3EVUA 1QLKA 4PDZA 1SCMC 3SG4A 4QJ4B 5DKQA 3DF0B 3GK2A 1WRKA 1A29A 1LKJA 1M46A 1RFJA 3I5IC 1SL8A 2EC6B 3RLZA 2BBNA 1L2OB 2KNEA 2RGIA 4I5JA 2K2FA 3BUOB 4GBAA 2Y4QA 3QRXA 1CFPA 1K2HA 4OKHA 1S6CA 4PHJA 5D7FA 1F55A 2EGDA 1DJZA 1XVJA 2LCPA 4A4BA 2KAVA 1XFVO 2I18A 2JC2A 3CR5X 1ALWA 2M1KB 2A4JA 3IF7A 1CB1A 1K93D 1JF0A 3NSOA 3ZNIA 5HYDA 1JSAA 1K96A 5FYXA 3KPXA 1QVIY 3BXKA 5AXIA 1SKTA 1F54A 2NZ0A 2D8NA 1SNLA 3BQ3A 1NIWA 4QJ3B 3O2PA 1B8CA 4HSZA 1WY9A 4I5LB 1K9PA 2WORA 1DJYA 1YVLA 4GFTA 3AAKA 1Q80A 2WNDA 2L98A 3VROA 1YX7A 4YI8A 3JVTB 1OMVA 1N65A 2JT0A 1RROA 3EK8A 4ORBB 1RK9A 1SBJA 3C1VA 4GNKB 4N5XA 1S1EA 1OOJA 1EG4A 1ZMZA 4M2OA 4AOMA 3DF0A 1LXFC 1N0YA 4P2YB 2G2BA 2GV5A 2K7BA 1K94A 1TRFA 3VGOA 1RWYA 1IG5A 1SL9A 1CDMA 2JXLA 5J3XA 4XJKB 1PVBA 1CKKA 1DTLA 1DJXA 1KWOC 1R6PA 1WLZA 2H2KA 2KFFA 3AAJA 1PK0D 1KFUL 2M49B 4M2QA 5HKWA 4N1GA 1J1DA 2LHLA 3PFVA 3CS1A 2KBMA 3GK1A 2COLB 2ZNDA 4MRYA 2K8MB 3OX6A 1UP5A 2K2AA 1CFFA 1EXRA 4WRIA 3F45A 3VRRA 1TCOB 1YURA 1PVAA 2Y1NA 3SG3A 2MHHA 1IKUA 2CBLA 1BJFA 1TIZA 1MHOA 1OE9B 5GQQC 1LVCD 2F33A 5I2LA 4MN0A 1DT7B 1FI6A 1J7QA 2LHIA 4E68A 1F70A 1KK7Z 4PE4A 3PLFB 5ER5A 1UHIA 2ZKMX 1NWDA 1XA5A 5D69A 2PASA 1JBAA 1K9UA 2I7AA 1KK8C 3OP0A 1IGVA 2L4HA 1GJYA 4JWQA 1SY9A 1LINA 1UHJA 2ZN9A 4D1EA 3DD4A 1CFDA 1NX3A 1KQMB 2EHBA 5I2QA 4OR9B 2F8PA 1IH0A 4XYNA 3FWBA 5ER4X 1S6IA 3EKHA 1QIWA 2ZFDA 3TUYC 4XJKA 2K0JA 3TDUA 3BUNB 1A75B 5K89A 1W7JB 2NLNA 3SG6A 4L9MA 2KFGA 2MLFC 2NCPA 1J1EA 2JT8A 3LK1A 5I8NA 1IJ5A 2KI4C 2KQYA 2LLTA 1Y1AA 1ZOTB 4NDBA 2MA2A 1AVSA 3TDIA 2CT9A 5JOLA 4C0JA 2B1UA 5CSNA 3K21A 1JFKA 1KSMA 2WCBA 1EL4A 4N1FA 1G8IA 1RECA 1BR4B 2I2RE 3DVEA 2KBIA 1HQVA 2L0PA 4AQIA 1PULA 4MZKA 1X02A 2Q91A 2K7CA 1H4BA 3PN7C 3HCMA 5KTYA 3CGAA 3CLNA 4USLA 4ZCUA 1NCZA 1QVIZ 2BCXA 4MRXA 3JTDB 1NYAA 1SK6D 2KAYA 4CFRA 4ETOA 4UPGA 1YUUA 3EVRA 3FIAA 2BE6A 1UURA 2LVIA 1B8LA 1NPQA 1UUSA 3BUXB 1CM1A 1JUOA 1YVHA 5TNCA 3KHEA 1FI5A 1NCYA 1K8UA 1DVIA 2CNPA 4PCWA 4CLNA 1GGZA 1GGWA 1MF8B 1S6JA 1CLMA 3TZ1A 1S3PA 1SCMB 1XK4A 2LAPA 1CTRA 1S26D 3MSEB 1M63B 1CLBA 1U5IA 1N2DA 4CPVA 1ZUZA 1KFUS 4GAOA 2JZIA 2VRGA 1SL7A 3I5IB 4AQJA 1QV1A 4A4CA 1BODA 2JTZA 1A75A 1CDPA 2BL0C 2WCFA 2JTTA 1H8BA 2LP2A 1RTP1 1A2XA 2JWWA 4PE0A 4GUKA 2L2EA 1OZSA 1B4CA 4MEWA 4C0KA 3NSLA 5B8IB 2V53A 4MZLA 1Y1UA 2PVBA 1PRWA 3SG5A 2LC5A 3IQQA 1JWDA 2JNXA 1L7ZA 2KI6C 3WHTB 3I5FB 1SR6C 1QX5B 1ALVA 4MBEA 1JC2A 3O6BA 1TOPA 5I2OA 1XFYO 2CXJA 2LLUA 2CTNA 1FW4A 2GGMA 4NQGA 5DKNA 3D0YA 1S5GZ 1DJIA 2JNFA 4QJ5B 2KSPA 2LVVA 3JVTC 2LMUA 3A4UB 2LLSA 4Q04A 2TN4A 2H61C 2HQ8A 2MBXA 4DUQA 1IQ3A 2M3WA 2LUXA 2KYCA 3CR4X 1KSOA 1XFWO 1QLSA 4HREE 3WNXB 1MUXA 1BT6A 1S36A 3EVVA 2SCPA 1Y0VH 3D10A 1EH2A 3NXAA 4PHNA 2LVJA 5JJGA 2R2IA 2OS8C 3HX4A 4P5OE 4PHKA 5HLVA 5HKYA 2PALA 1XO5A 4MSPA 1C7VA 4I5KA 3OX5A 1F4QA 4GGNA 1GQMA 3GOFA 2AAOA 4CFQA 1YUTA 1K90D 3EKJA 1WDCB 1SMGA 1OMRA 3DVJA 1PALA 2MAZA 1CDNA 2M1UA 3I5GC 2JQ6A 1SCVA 1XFUO 5KSZA 3CR2A 3NSKA 4YI9A 5KU1A 1IJ6A 1M31A 1QS7A 3CWGA 4FQOA 2L5XB 2KGRA 4ICBA 4I5NB 4MZJA 3FWCA 2JULA 4OVNF 2K7OA 5AANA 1BOCA 4HRHA 3VRQA 1U5IB 1MXLC 2FOTA 4JQ0D 1FBVA 2MJWB 3ZWHA 4M2PA 3KO0A 5CSJA 2AUCA 2FCEA 1CLLA 3BYAA 3OB2B 2M7NA 2M29A 2ZRSA 1LA0A 1CDLA 1BG1A 1KQMC 2LE9B 5AFPA 1F8HA 1Y6WA 2OTGB 4GGFA 4NDDA 1MWNA 2E30A 1AJ4A 3IQOA 2WOSA 5BPJA 1BMOA 4FTGA 4YGAA 1DJGA 1PSRA 1YUSA 3ICBA 1J7PA 5DKRA 3DVKA 5CPVA 3LLEA 1WRZA 2P6BB 1BLQA 1VRKA 3I5HB 1C07A 1QX7A 2JXCA 2M97A 1QJTA 1SRAA 4TNCA 2AMIA 4ZCVA 3VRPA 1BR1B 3NSIA 1OMDA 3TS5B 3D0YB 1KQVA 4ORCB 4YBHB 1QASA 1QXPA 2JRFA 2F3YA 5CSFA 3BUWB 4OCIA 3OHMB 2NXQA 2JPTA 2HPSA 2GGZA 1IQ5A 1B7TY 1OSAA 2L50A 1BF5A 1JF2A 2LVKA 2EC6C 2MRDA 1XFXO 1B8RA 1L2OC 1M45A 4U8DA 1LA3A 1DGUA 1RJVA 3PSRA 1KFXS 3DVMA 1K95A 1CNPA 1Y1XA 2BECA 1UWOA 2QACA 1YRTB 4BY4A 3PALA 2KI6D 3TDZA 2LMVA 2KQ6A 2OPOA 1HT9A 2BL0B 1TN4A 1IWQA 3H4SE 1EJ3A 4DS7A 3A8RA 3LL8B 1J7RA 1NUBA 3KEVA 4OV2A 4DCKA 1QATA 1XFZO 3I5FC 1DMOA 1NSHA 4PALA 1DGVA 1XYDA 4MVFA 4YGCB 3WHUB 1FPWA 1SR6B 2L51A 1DF0A 2BBMA 1K9KA 2E6WA 3BOWB 1CM4A 5AERA 4PE7A 4WQ2A 1A4PA 1BU3A 3SIAA 2ISDA 1NP8A 2L4IA 1AK8A 2O5GA 5PALA 3KF9A 2HQWA 1YR5A 3EK7A 4C0LA 1YX8A 2F3ZA 1SW8A 1QTXA 2Q4UA 1DJHA 1B47A
chains in the Genus database with same CATH superfamily
1KFXL 4DRWA 1ODBA 1V1FA 1KWOB 5HKZA 1JFJA 3D74A 3UO9A 3SG2A 4GGFC 2F2OA 2O60A 2Y1MA 4BY5A 4JPZB 1W7IB 1MXEA 1WRLA 5CSIA 2IS9A 4F7FA 2MLEC 2PRUA 1DJWA 1UHNA 3E3RA 2OS8B 2JOJA 3LK0A 1CMGA 2LP3A 2PSRA 1V1GA 2M0RA 5G08A 4GPLB 5I94A 1NCXA 1F71A 2ZNEA 3M0WA 1WDCC 5EL2A 2LNKA 5IBWA 1C7WA 1UHKA 4DIRA 1UHHA 2KYFA 1B9AA 1QWVA 2KLEA 2NCOA 3GK4X 1Z2CB 2KOTA 4PHMA 3I5GB 2CCMA 3VRNA 1CMFA 1D1OA 1S5GY 1MQ1A 3OB1B 1EG3A 1TUZA 3BOWA 4YGBB 1J55A 1OQPA 3CZ2A 1KK8B 1YTZC 2LV7A 2WC8A 1G4YR 4YRUA 4NDCA 1XK4C 3D76A 4R1EA 1TNXA 3AKBA 3PATA 3CTNA 2YGUA 1YRUB 3WXAA 1SPYA 1B1GA 2WCEA 4PE1A 3SIBA 1QX2A 3RZSA 2K61A 2H61A 1ZACA 3FS7A 1SYMA 1AJ5A 1PSBA 1AP4A 1E8AA 1TNPA 3TUYB 1G33A 3FE9A 2KAXA 4CIDA 1CFCA 1IRJA 1B7TZ 3LCPC 4IL1A 5F6TA 2OTGC 1NX0A 2LUCA 1AHRA 2FCDA 3CZTX 2DOQA 1TTXA 1TNQA 2KI4B 2WCJA 2BE4A 1R2UA 2F2PA 2LANA 3O78A 1QIVA 3FE6A 3SG7A 2M7LA 1A03A 2HETA 2BCBA 4KYNA 2LM5A 1J7OA 1OZOA 1KK7Y 2ZN8A 3O4YA 4ORAB 1NX1A 4HRGA 1FF1A 3AKAA 3BUMB 1F4OA 2PMYA 2G9BA 2M9GA 2Y5IA 1TCFA 2BKIB 3I5HC 1DF0B 2HF5A 3PM8A 4YGDB 1KCYA 2KHNA 3RM1A 2LMTA 2SASA 5HLOA 2M8UA 2H8VA 2K7DA 2KFHA 2KDHA 3PN7B 3TS5C 3JTDC 2ZRTA 1DQEA 4INXA 4MLWA 2I94A 1WLMA 4YGEB 5AEQA 1TNWA 3EK4A 1MR8A 1QV0A 1AUIB 2JT3A 2FJUB 3EG5B 2BCAA 2BKHB 1ZFSA 2WCKA 3OGNA 4WQ3A 3SJSA 4F0ZB 1NX2A 1M39A 2JU0A 2KGBC 2QPTA 3EVUA 1QLKA 3BFAA 4PDZA 1SCMC 3SG4A 4QJ4B 5DKQA 3DF0B 3GK2A 1WRKA 1A29A 1LKJA 1M46A 1RFJA 3I5IC 4IJ7A 1SL8A 2EC6B 3RLZA 2BBNA 1L2OB 3FE8A 2KNEA 2RGIA 4I5JA 2K2FA 3BUOB 4GBAA 2Y4QA 3QRXA 4JD9A 5FI6A 1CFPA 1K2HA 4OKHA 1S6CA 4PHJA 1OOFA 5D7FA 1F55A 2EGDA 1DJZA 1XVJA 2LCPA 4A4BA 2KAVA 1XFVO 2I18A 2JC2A 3CR5X 1ALWA 2M1KB 3CDNA 3K1EA 2A4JA 3IF7A 1CB1A 1GM0A 1K93D 3B86A 1JF0A 3NSOA 3ZNIA 5HYDA 1JSAA 1K96A 3SS4A 3R72A 2QDIA 5FYXA 2KLDA 3KPXA 3S0BA 1QVIY 3BXKA 5AXIA 1SKTA 1F54A 2NZ0A 2D8NA 1SNLA 3BQ3A 1NIWA 4QJ3B 3O2PA 1B8CA 3PM2A 4HSZA 2QEBA 1WY9A 4I5LB 1K9PA 1DC1A 2L5YA 2WORA 1DJYA 1YVLA 4GFTA 3AAKA 1Q80A 2WNDA 2L98A 3VROA 1YX7A 4YI8A 3JVTB 1OMVA 1N65A 2JT0A 1RROA 3EK8A 4ORBB 1RK9A 1SBJA 3C1VA 4GNKB 4N5XA 1S1EA 3SS5A 1OOJA 1EG4A 1ZMZA 1IIOA 4M2OA 4AOMA 3DF0A 1LXFC 3QMEA 3R1VA 1N0YA 4P2YB 2G2BA 2GV5A 2K7BA 1K94A 1TRFA 3VGOA 1RWYA 1IG5A 1SL9A 1CDMA 2JXLA 3DY9A 3CYZA 3R1PA 3D75A 4XJKB 1PVBA 5J3XA 1CKKA 1DTLA 1DJXA 1KWOC 1R6PA 1WLZA 2H2KA 2KFFA 3AAJA 1PK0D 1KFUL 2M49B 3B87A 4FQTA 4M2QA 5FI2A 5HL1A 5HKWA 4N1GA 1J1DA 2LHLA 3PFVA 3CS1A 2KBMA 3GK1A 2COLB 2QEVA 2ZNDA 4MRYA 2K8MB 3OX6A 1UP5A 2K2AA 1CFFA 1EXRA 4WRIA 3F45A 3VRRA 1TCOB 1YURA 1PVAA 2Y1NA 3SG3A 2MHHA 2WC5A 3V2LA 1IKUA 2CBLA 1BJFA 1TIZA 1MHOA 1OE9B 5GQQC 1LVCD 2F33A 5I2LA 4MN0A 1DT7B 1FI6A 2PQLA 1J7QA 2LHIA 4E68A 1F70A 1KK7Z 4PE4A 3PLFB 3B6XA 5ER5A 1UHIA 2GTEA 2ZKMX 1NWDA 1XA5A 5D69A 2PASA 2P71A 5FI7A 1K9UA 1JBAA 2I7AA 1KK8C 3OP0A 1IGVA 2L4HA 1GJYA 4JWQA 1SY9A 1LINA 1UHJA 2ZN9A 4D1EA 3DD4A 1CFDA 1NX3A 1KQMB 2EHBA 5I2QA 4OR9B 2F8PA 1IH0A 4XYNA 3FWBA 5ER4X 1S6IA 3EKHA 1QIWA 2ZFDA 3TUYC 4XJKA 2K0JA 3TDUA 3BUNB 1A75B 5K89A 1W7JB 2FJYA 2NLNA 3SG6A 4L9MA 2KFGA 2MLFC 2NCPA 1J1EA 2JT8A 3LK1A 5I8NA 1IJ5A 2KI4C 2KQYA 2LLTA 1Y1AA 1ZOTB 3NHIA 4NDBA 3O4XA 2MA2A 1AVSA 3TDIA 2CT9A 5JOLA 4C0JA 3UNWA 2B1UA 5CSNA 3K21A 1JFKA 1KSMA 2WCBA 2WCLA 1EL4A 4N1FA 1G8IA 1RECA 2P70A 2WCMA 1BR4B 2I2RE 3DVEA 2KBIA 1HQVA 2L0PA 4AQIA 1PULA 3R1OA 4MZKA 1X02A 2K60A 1DELA 2Q91A 2K7CA 1H4BA 2BNXA 3HCMA 3PN7C 5KTYA 3CGAA 3CLNA 4USLA 4ZCUA 1NCZA 4INWA 1QVIZ 2BCXA 4MRXA 2WCHA 3JTDB 1NYAA 1SK6D 1XFRA 2KAYA 4CFRA 4ETOA 4UPGA 1YUUA 3EVRA 3FIAA 2BE6A 1UURA 3B7AA 2LVIA 1B8LA 1NPQA 1UUSA 3BUXB 3S0EA 1CM1A 1ORGA 1JUOA 1YVHA 5TNCA 3KHEA 1FI5A 1NCYA 1K8UA 1P28A 1DVIA 3CZ0A 2CNPA 4PCWA 4CLNA 1GGZA 2PYQA 2BAPA 1MF8B 1S6JA 1GGWA 1CLMA 3TZ1A 1S3PA 1SCMB 1XK4A 2LAPA 1CTRA 1S26D 3MSEB 1M63B 1CLBA 1U5IA 1N2DA 4CPVA 1ZUZA 1KFUS 4GAOA 2JZIA 2VRGA 1SL7A 3I5IB 4AQJA 1QV1A 4A4CA 1BODA 2JTZA 1A75A 1CDPA 2BL0C 2QEHA 2WCFA 2JTTA 3L4LA 1H8BA 2LP2A 1RTP1 1A2XA 2JWWA 4PE0A 4GUKA 2L2EA 1OZSA 1B4CA 3BJHA 4MEWA 4C0KA 3NSLA 5B8IB 5D3OA 3OBVA 2V53A 4MZLA 3IVTA 1Y1UA 2PVBA 1PRWA 3SG5A 2LC5A 3IQQA 1JWDA 2L2CA 2JNXA 1L7ZA 2KI6C 3WHTB 3I5FB 1SR6C 1QX5B 1ALVA 4MBEA 1JC2A 3O6BA 1TOPA 5I2OA 1XFYO 2CXJA 2LLUA 2CTNA 1FW4A 2GGMA 4NQGA 5DKNA 3D0YA 1S5GZ 1DJIA 2JNFA 4QJ5B 2KSPA 2LVVA 3JVTC 2LMUA 3A4UB 2LLSA 4Q04A 2TN4A 2H61C 2HQ8A 2MBXA 4DUQA 1IQ3A 2M3WA 2LUXA 2KYCA 3CR4X 1KSOA 1XFWO 1QLSA 2JPOA 4HREE 3WNXB 1MUXA 1BT6A 1S36A 3EVVA 2SCPA 1Y0VH 3D10A 3SS3A 1EH2A 3N7HA 3NXAA 4PHNA 2LVJA 5JJGA 2R2IA 2OS8C 3HX4A 4P5OE 4PHKA 5HLVA 5HKYA 2PALA 1T14A 1XO5A 4MSPA 4I5KA 3OX5A 1C7VA 1F4QA 4GGNA 3CABA 1GQMA 3GOFA 2AAOA 4CFQA 1YUTA 1K90D 3EKJA 1WDCB 1SMGA 1OMRA 1OOIX 3DVJA 1PALA 2MAZA 1CDNA 2M1UA 3I5GC 1OOHA 2JQ6A 1SCVA 1XFUO 5KSZA 3CR2A 3NSKA 2WC6A 4YI9A 5KU1A 1IJ6A 3NGVA 1M31A 1QS7A 3CWGA 4FQOA 2L5XB 2KGRA 4ICBA 4I5NB 4MZJA 3FWCA 2JULA 4OVNF 2K7OA 5AANA 1BOCA 4HRHA 3VRQA 1U5IB 1MXLC 2FOTA 3S0GA 4JQ0D 1FBVA 2MJWB 3ZWHA 4M2PA 3KO0A 5CSJA 2AUCA 2FCEA 1CLLA 3BYAA 3OB2B 1TUJA 2M7NA 3S0FA 2M29A 2ZRSA 1LA0A 1CDLA 1BG1A 1KQMC 2LE9B 5AFPA 1F8HA 1Y6WA 2OTGB 4GGFA 4NDDA 1MWNA 1OW4A 1AJ4A 2E30A 3IQOA 2WOSA 5BPJA 1BMOA 4FTGA 3L47A 4YGAA 1DJGA 1PSRA 1YUSA 3ICBA 4PT1A 1J7PA 5DKRA 1TWOA 3DVKA 5CPVA 1LS8A 1WRZA 2P6BB 3L4AA 3LLEA 1VRKA 3I5HB 1BLQA 1C07A 1QX7A 2JXCA 2M97A 1QJTA 1SRAA 4TNCA 2AMIA 3S0DA 4ZCVA 3VRPA 1SSEB 1BR1B 3NSIA 1OMDA 3TS5B 2ERBA 3D0YB 3Q8IA 4ORCB 4YBHB 1QASA 1KQVA 1QXPA 2JRFA 2F3YA 3B88A 3BUWB 5CSFA 4OCIA 3OHMB 2NXQA 2JPTA 2HPSA 4JKTA 2GGZA 1IQ5A 1B7TY 3D77A 3DYEA 1OSAA 2L50A 1BF5A 1JF2A 2LVKA 2EC6C 2MRDA 1XFXO 1B8RA 1L2OC 1M45A 4U8DA 3CZ1A 1LA3A 1DGUA 1RJVA 3D73A 3PSRA 2KPHA 1KFXS 2QEOA 3DVMA 1K95A 1CNPA 1Y1XA 3BFBA 2BECA 1UWOA 2QACA 1YRTB 4BY4A 3PALA 2KI6D 3VB1A 3TDZA 2LMVA 2KQ6A 3S0AA 1C3ZA 2OPOA 1HT9A 2BL0B 4OZDA 1TN4A 1IWQA 3BFHA 3H4SE 3PJIA 1EJ3A 4DS7A 3A8RA 3LL8B 1J7RA 1NUBA 3KEVA 1OOGA 4OV2A 4DCKA 1QATA 1XFZO 3I5FC 5DICA 1DMOA 1NSHA 4PALA 1DGVA 1XYDA 4MVFA 4YGCB 3WHUB 1FPWA 1SR6B 1W9ZA 2L51A 1DF0A 1DEKA 2BBMA 1K9KA 2E6WA 3BOWB 1CM4A 5AERA 4PE7A 3DZTA 4WQ2A 1A4PA 1BU3A 3SIAA 2ISDA 1Z4HA 1NP8A 1C3YA 2L4IA 1AK8A 3DXLA 2O5GA 5PALA 3D78A 2HQWA 1YR5A 3KF9A 3EK7A 4C0LA 1YX8A 2F3ZA 1SW8A 1QTXA 3NHTA 2Q4UA 1DJHA 1B47A
chains in the Genus database with same CATH topology
1KFXL 4DRWA 1ODBA 1V1FA 1KWOB 5HKZA 1JFJA 3SG2A 4GGFC 2F2OA 2O60A 2Y1MA 4BY5A 4JPZB 1W7IB 1MXEA 1WRLA 5CSIA 2IS9A 2MLEC 2PRUA 1DJWA 1UHNA 3E3RA 2OS8B 2JOJA 3LK0A 1CMGA 2LP3A 2PSRA 1V1GA 2M0RA 5G08A 4GPLB 1NCXA 1F71A 2ZNEA 3M0WA 1WDCC 2LNKA 5IBWA 1C7WA 1UHKA 4DIRA 1UHHA 2KYFA 1B9AA 2NCOA 3GK4X 2KOTA 4PHMA 3I5GB 2CCMA 3VRNA 1CMFA 1D1OA 1S5GY 1MQ1A 3OB1B 1EG3A 3BOWA 4YGBB 1J55A 1OQPA 1KK8B 1YTZC 2LV7A 2WC8A 1G4YR 4YRUA 4NDCA 1XK4C 4R1EA 1TNXA 3AKBA 3PATA 3CTNA 1YRUB 3WXAA 1SPYA 1B1GA 2WCEA 4PE1A 3SIBA 1QX2A 2K61A 2H61A 1ZACA 3FS7A 1SYMA 1AJ5A 1PSBA 1AP4A 1E8AA 1TNPA 3TUYB 1G33A 2KAXA 4CIDA 1CFCA 1IRJA 1B7TZ 3LCPC 4IL1A 5F6TA 2OTGC 1NX0A 2LUCA 1AHRA 2FCDA 3CZTX 2DOQA 1TTXA 1TNQA 2KI4B 2BE4A 1R2UA 2F2PA 2LANA 3O78A 1QIVA 3SG7A 2M7LA 1A03A 2HETA 2BCBA 2LM5A 1J7OA 1OZOA 1KK7Y 2ZN8A 3O4YA 4ORAB 1NX1A 4HRGA 1FF1A 3AKAA 3BUMB 1F4OA 2PMYA 2G9BA 2M9GA 2Y5IA 1TCFA 2BKIB 3I5HC 1DF0B 2HF5A 3PM8A 4YGDB 1KCYA 2KHNA 3RM1A 2LMTA 2SASA 5HLOA 2M8UA 2K7DA 2KFHA 2KDHA 3PN7B 3TS5C 3JTDC 2ZRTA 4MLWA 2I94A 1WLMA 4YGEB 5AEQA 1TNWA 3EK4A 1MR8A 1QV0A 1AUIB 2JT3A 2FJUB 3SJSA 2BCAA 2BKHB 1ZFSA 4F0ZB 4WQ3A 1NX2A 1M39A 2JU0A 2KGBC 2QPTA 3EVUA 1QLKA 4PDZA 1SCMC 3SG4A 4QJ4B 5DKQA 3DF0B 3GK2A 1WRKA 1A29A 1LKJA 1M46A 1RFJA 3I5IC 1SL8A 2EC6B 3RLZA 2BBNA 1L2OB 2KNEA 2RGIA 4I5JA 2K2FA 3BUOB 4GBAA 2Y4QA 3QRXA 1CFPA 1K2HA 4OKHA 1S6CA 4PHJA 5D7FA 1F55A 2EGDA 1DJZA 1XVJA 2LCPA 4A4BA 2KAVA 1XFVO 2I18A 2JC2A 3CR5X 1ALWA 2M1KB 2A4JA 3IF7A 1CB1A 1K93D 1JF0A 3NSOA 3ZNIA 5HYDA 1JSAA 1K96A 5FYXA 3KPXA 1QVIY 3BXKA 5AXIA 1SKTA 1F54A 2NZ0A 2D8NA 1SNLA 3BQ3A 1NIWA 4QJ3B 3O2PA 1B8CA 4HSZA 1WY9A 4I5LB 1K9PA 2WORA 1DJYA 1YVLA 4GFTA 3AAKA 1Q80A 2WNDA 2L98A 3VROA 1YX7A 4YI8A 3JVTB 1OMVA 1N65A 2JT0A 1RROA 3EK8A 4ORBB 1RK9A 1SBJA 3C1VA 4GNKB 4N5XA 1S1EA 1OOJA 1EG4A 1ZMZA 4M2OA 4AOMA 3DF0A 1LXFC 1N0YA 4P2YB 2G2BA 2GV5A 2K7BA 1K94A 1TRFA 3VGOA 1RWYA 1IG5A 1SL9A 1CDMA 2JXLA 5J3XA 4XJKB 1PVBA 1CKKA 1DTLA 1DJXA 1KWOC 1R6PA 1WLZA 2H2KA 2KFFA 3AAJA 1PK0D 1KFUL 2M49B 4M2QA 5HKWA 4N1GA 1J1DA 2LHLA 3PFVA 3CS1A 2KBMA 3GK1A 2COLB 2ZNDA 4MRYA 2K8MB 3OX6A 1UP5A 2K2AA 1CFFA 1EXRA 4WRIA 3F45A 3VRRA 1TCOB 1YURA 1PVAA 2Y1NA 3SG3A 2MHHA 1IKUA 2CBLA 1BJFA 1TIZA 1MHOA 1OE9B 5GQQC 1LVCD 2F33A 5I2LA 4MN0A 1DT7B 1FI6A 1J7QA 2LHIA 4E68A 1F70A 1KK7Z 4PE4A 3PLFB 5ER5A 1UHIA 2ZKMX 1NWDA 1XA5A 5D69A 2PASA 1JBAA 1K9UA 2I7AA 1KK8C 3OP0A 1IGVA 2L4HA 1GJYA 4JWQA 1SY9A 1LINA 1UHJA 2ZN9A 4D1EA 3DD4A 1CFDA 1NX3A 1KQMB 2EHBA 5I2QA 4OR9B 2F8PA 1IH0A 4XYNA 3FWBA 5ER4X 1S6IA 3EKHA 1QIWA 2ZFDA 3TUYC 4XJKA 2K0JA 3TDUA 3BUNB 1A75B 5K89A 1W7JB 2NLNA 3SG6A 4L9MA 2KFGA 2MLFC 2NCPA 1J1EA 2JT8A 3LK1A 5I8NA 1IJ5A 2KI4C 2KQYA 2LLTA 1Y1AA 1ZOTB 4NDBA 2MA2A 1AVSA 3TDIA 2CT9A 5JOLA 4C0JA 2B1UA 5CSNA 3K21A 1JFKA 1KSMA 2WCBA 1EL4A 4N1FA 1G8IA 1RECA 1BR4B 2I2RE 3DVEA 2KBIA 1HQVA 2L0PA 4AQIA 1PULA 4MZKA 1X02A 2Q91A 2K7CA 1H4BA 3PN7C 3HCMA 5KTYA 3CGAA 3CLNA 4USLA 4ZCUA 1NCZA 1QVIZ 2BCXA 4MRXA 3JTDB 1NYAA 1SK6D 2KAYA 4CFRA 4ETOA 4UPGA 1YUUA 3EVRA 3FIAA 2BE6A 1UURA 2LVIA 1B8LA 1NPQA 1UUSA 3BUXB 1CM1A 1JUOA 1YVHA 5TNCA 3KHEA 1FI5A 1NCYA 1K8UA 1DVIA 2CNPA 4PCWA 4CLNA 1GGZA 1GGWA 1MF8B 1S6JA 1CLMA 3TZ1A 1S3PA 1SCMB 1XK4A 2LAPA 1CTRA 1S26D 3MSEB 1M63B 1CLBA 1U5IA 1N2DA 4CPVA 1ZUZA 1KFUS 4GAOA 2JZIA 2VRGA 1SL7A 3I5IB 4AQJA 1QV1A 4A4CA 1BODA 2JTZA 1A75A 1CDPA 2BL0C 2WCFA 2JTTA 1H8BA 2LP2A 1RTP1 1A2XA 2JWWA 4PE0A 4GUKA 2L2EA 1OZSA 1B4CA 4MEWA 4C0KA 3NSLA 5B8IB 2V53A 4MZLA 1Y1UA 2PVBA 1PRWA 3SG5A 2LC5A 3IQQA 1JWDA 2JNXA 1L7ZA 2KI6C 3WHTB 3I5FB 1SR6C 1QX5B 1ALVA 4MBEA 1JC2A 3O6BA 1TOPA 5I2OA 1XFYO 2CXJA 2LLUA 2CTNA 1FW4A 2GGMA 4NQGA 5DKNA 3D0YA 1S5GZ 1DJIA 2JNFA 4QJ5B 2KSPA 2LVVA 3JVTC 2LMUA 3A4UB 2LLSA 4Q04A 2TN4A 2H61C 2HQ8A 2MBXA 4DUQA 1IQ3A 2M3WA 2LUXA 2KYCA 3CR4X 1KSOA 1XFWO 1QLSA 4HREE 3WNXB 1MUXA 1BT6A 1S36A 3EVVA 2SCPA 1Y0VH 3D10A 1EH2A 3NXAA 4PHNA 2LVJA 5JJGA 2R2IA 2OS8C 3HX4A 4P5OE 4PHKA 5HLVA 5HKYA 2PALA 1XO5A 4MSPA 1C7VA 4I5KA 3OX5A 1F4QA 4GGNA 1GQMA 3GOFA 2AAOA 4CFQA 1YUTA 1K90D 3EKJA 1WDCB 1SMGA 1OMRA 3DVJA 1PALA 2MAZA 1CDNA 2M1UA 3I5GC 2JQ6A 1SCVA 1XFUO 5KSZA 3CR2A 3NSKA 4YI9A 5KU1A 1IJ6A 1M31A 1QS7A 3CWGA 4FQOA 2L5XB 2KGRA 4ICBA 4I5NB 4MZJA 3FWCA 2JULA 4OVNF 2K7OA 5AANA 1BOCA 4HRHA 3VRQA 1U5IB 1MXLC 2FOTA 4JQ0D 1FBVA 2MJWB 3ZWHA 4M2PA 3KO0A 5CSJA 2AUCA 2FCEA 1CLLA 3BYAA 3OB2B 2M7NA 2M29A 2ZRSA 1LA0A 1CDLA 1BG1A 1KQMC 2LE9B 5AFPA 1F8HA 1Y6WA 2OTGB 4GGFA 4NDDA 1MWNA 2E30A 1AJ4A 3IQOA 2WOSA 5BPJA 1BMOA 4FTGA 4YGAA 1DJGA 1PSRA 1YUSA 3ICBA 1J7PA 5DKRA 3DVKA 5CPVA 3LLEA 1WRZA 2P6BB 1BLQA 1VRKA 3I5HB 1C07A 1QX7A 2JXCA 2M97A 1QJTA 1SRAA 4TNCA 2AMIA 4ZCVA 3VRPA 1BR1B 3NSIA 1OMDA 3TS5B 3D0YB 1KQVA 4ORCB 4YBHB 1QASA 1QXPA 2JRFA 2F3YA 5CSFA 3BUWB 4OCIA 3OHMB 2NXQA 2JPTA 2HPSA 2GGZA 1IQ5A 1B7TY 1OSAA 2L50A 1BF5A 1JF2A 2LVKA 2EC6C 2MRDA 1XFXO 1B8RA 1L2OC 1M45A 4U8DA 1LA3A 1DGUA 1RJVA 3PSRA 1KFXS 3DVMA 1K95A 1CNPA 1Y1XA 2BECA 1UWOA 2QACA 1YRTB 4BY4A 3PALA 2KI6D 3TDZA 2LMVA 2KQ6A 2OPOA 1HT9A 2BL0B 1TN4A 1IWQA 3H4SE 1EJ3A 4DS7A 3A8RA 3LL8B 1J7RA 1NUBA 3KEVA 4OV2A 4DCKA 1QATA 1XFZO 3I5FC 1DMOA 1NSHA 4PALA 1DGVA 1XYDA 4MVFA 4YGCB 3WHUB 1FPWA 1SR6B 2L51A 1DF0A 2BBMA 1K9KA 2E6WA 3BOWB 1CM4A 5AERA 4PE7A 4WQ2A 1A4PA 1BU3A 3SIAA 2ISDA 1NP8A 2L4IA 1AK8A 2O5GA 5PALA 3KF9A 2HQWA 1YR5A 3EK7A 4C0LA 1YX8A 2F3ZA 1SW8A 1QTXA 2Q4UA 1DJHA 1B47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KFX L;  4DRW A;  1ODB A;  1V1F A;  1KWO B;  5HKZ A;  1JFJ A;  3SG2 A;  4GGF C;  2F2O A;  2O60 A;  2Y1M A;  4BY5 A;  4JPZ B;  1W7I B;  1MXE A;  1WRL A;  5CSI A;  2IS9 A;  2MLE C;  2PRU A;  1DJW A;  1UHN A;  3E3R A;  2OS8 B;  2JOJ A;  3LK0 A;  1CMG A;  2LP3 A;  2PSR A;  1V1G A;  2M0R A;  5G08 A;  4GPL B;  1NCX A;  1F71 A;  2ZNE A;  3M0W A;  1WDC C;  2LNK A;  5IBW A;  1C7W A;  1UHK A;  4DIR A;  1UHH A;  2KYF A;  1B9A A;  2NCO A;  3GK4 X;  2KOT A;  4PHM A;  3I5G B;  2CCM A;  3VRN A;  1CMF A;  1D1O A;  1S5G Y;  1MQ1 A;  3OB1 B;  1EG3 A;  3BOW A;  4YGB B;  1J55 A;  1OQP A;  1KK8 B;  1YTZ C;  2LV7 A;  2WC8 A;  1G4Y R;  4YRU A;  4NDC A;  1XK4 C;  4R1E A;  1TNX A;  3AKB A;  3PAT A;  3CTN A;  1YRU B;  3WXA A;  1SPY A;  1B1G A;  2WCE A;  4PE1 A;  3SIB A;  1QX2 A;  2K61 A;  2H61 A;  1ZAC A;  3FS7 A;  1SYM A;  1AJ5 A;  1PSB A;  1AP4 A;  1E8A A;  1TNP A;  3TUY B;  1G33 A;  2KAX A;  4CID A;  1CFC A;  1IRJ A;  1B7T Z;  3LCP C;  4IL1 A;  5F6T A;  2OTG C;  1NX0 A;  2LUC A;  1AHR A;  2FCD A;  3CZT X;  2DOQ A;  1TTX A;  1TNQ A;  2KI4 B;  2BE4 A;  1R2U A;  2F2P A;  2LAN A;  3O78 A;  1QIV A;  3SG7 A;  2M7L A;  1A03 A;  2HET A;  2BCB A;  2LM5 A;  1J7O A;  1OZO A;  1KK7 Y;  2ZN8 A;  3O4Y A;  4ORA B;  1NX1 A;  4HRG A;  1FF1 A;  3AKA A;  3BUM B;  1F4O A;  2PMY A;  2G9B A;  2M9G A;  2Y5I A;  1TCF A;  2BKI B;  3I5H C;  1DF0 B;  2HF5 A;  3PM8 A;  4YGD B;  1KCY A;  2KHN A;  3RM1 A;  2LMT A;  2SAS A;  5HLO A;  2M8U A;  2K7D A;  2KFH A;  2KDH A;  3PN7 B;  3TS5 C;  3JTD C;  2ZRT A;  4MLW A;  2I94 A;  1WLM A;  4YGE B;  5AEQ A;  1TNW A;  3EK4 A;  1MR8 A;  1QV0 A;  1AUI B;  2JT3 A;  2FJU B;  3SJS A;  2BCA A;  2BKH B;  1ZFS A;  4F0Z B;  4WQ3 A;  1NX2 A;  1M39 A;  2JU0 A;  2KGB C;  2QPT A;  3EVU A;  1QLK A;  4PDZ A;  1SCM C;  3SG4 A;  4QJ4 B;  5DKQ A;  3DF0 B;  3GK2 A;  1WRK A;  1A29 A;  1LKJ A;  1M46 A;  1RFJ A;  3I5I C;  1SL8 A;  2EC6 B;  3RLZ A;  2BBN A;  1L2O B;  2KNE A;  2RGI A;  4I5J A;  2K2F A;  3BUO B;  4GBA A;  2Y4Q A;  3QRX A;  1CFP A;  1K2H A;  4OKH A;  1S6C A;  4PHJ A;  5D7F A;  1F55 A;  2EGD A;  1DJZ A;  1XVJ A;  2LCP A;  4A4B A;  2KAV A;  1XFV O;  2I18 A;  2JC2 A;  3CR5 X;  1ALW A;  2M1K B;  2A4J A;  3IF7 A;  1CB1 A;  1K93 D;  1JF0 A;  3NSO A;  3ZNI A;  5HYD A;  1JSA A;  1K96 A;  5FYX A;  3KPX A;  1QVI Y;  3BXK A;  5AXI A;  1SKT A;  1F54 A;  2NZ0 A;  2D8N A;  1SNL A;  3BQ3 A;  1NIW A;  4QJ3 B;  3O2P A;  1B8C A;  4HSZ A;  1WY9 A;  4I5L B;  1K9P A;  2WOR A;  1DJY A;  1YVL A;  4GFT A;  3AAK A;  1Q80 A;  2WND A;  2L98 A;  3VRO A;  1YX7 A;  4YI8 A;  3JVT B;  1OMV A;  1N65 A;  2JT0 A;  1RRO A;  3EK8 A;  4ORB B;  1RK9 A;  1SBJ A;  3C1V A;  4GNK B;  4N5X A;  1S1E A;  1OOJ A;  1EG4 A;  1ZMZ A;  4M2O A;  4AOM A;  3DF0 A;  1LXF C;  1N0Y A;  4P2Y B;  2G2B A;  2GV5 A;  2K7B A;  1K94 A;  1TRF A;  3VGO A;  1RWY A;  1IG5 A;  1SL9 A;  1CDM A;  2JXL A;  5J3X A;  4XJK B;  1PVB A;  1CKK A;  1DTL A;  1DJX A;  1KWO C;  1R6P A;  1WLZ A;  2H2K A;  2KFF A;  3AAJ A;  1PK0 D;  1KFU L;  2M49 B;  4M2Q A;  5HKW A;  4N1G A;  1J1D A;  2LHL A;  3PFV A;  3CS1 A;  2KBM A;  3GK1 A;  2COL B;  2ZND A;  4MRY A;  2K8M B;  3OX6 A;  1UP5 A;  2K2A A;  1CFF A;  1EXR A;  4WRI A;  3F45 A;  3VRR A;  1TCO B;  1YUR A;  1PVA A;  2Y1N A;  3SG3 A;  2MHH A;  1IKU A;  2CBL A;  1BJF A;  1TIZ A;  1MHO A;  1OE9 B;  5GQQ C;  1LVC D;  2F33 A;  5I2L A;  4MN0 A;  1DT7 B;  1FI6 A;  1J7Q A;  2LHI A;  4E68 A;  1F70 A;  1KK7 Z;  4PE4 A;  3PLF B;  5ER5 A;  1UHI A;  2ZKM X;  1NWD A;  1XA5 A;  5D69 A;  2PAS A;  1JBA A;  1K9U A;  2I7A A;  1KK8 C;  3OP0 A;  1IGV A;  2L4H A;  1GJY A;  4JWQ A;  1SY9 A;  1LIN A;  1UHJ A;  2ZN9 A;  4D1E A;  3DD4 A;  1CFD A;  1NX3 A;  1KQM B;  2EHB A;  5I2Q A;  4OR9 B;  2F8P A;  1IH0 A;  4XYN A;  3FWB A;  5ER4 X;  1S6I A;  3EKH A;  1QIW A;  2ZFD A;  3TUY C;  4XJK A;  2K0J A;  3TDU A;  3BUN B;  1A75 B;  5K89 A;  1W7J B;  2NLN A;  3SG6 A;  4L9M A;  2KFG A;  2MLF C;  2NCP A;  1J1E A;  2JT8 A;  3LK1 A;  5I8N A;  1IJ5 A;  2KI4 C;  2KQY A;  2LLT A;  1Y1A A;  1ZOT B;  4NDB A;  2MA2 A;  1AVS A;  3TDI A;  2CT9 A;  5JOL A;  4C0J A;  2B1U A;  5CSN A;  3K21 A;  1JFK A;  1KSM A;  2WCB A;  1EL4 A;  4N1F A;  1G8I A;  1REC A;  1BR4 B;  2I2R E;  3DVE A;  2KBI A;  1HQV A;  2L0P A;  4AQI A;  1PUL A;  4MZK A;  1X02 A;  2Q91 A;  2K7C A;  1H4B A;  3PN7 C;  3HCM A;  5KTY A;  3CGA A;  3CLN A;  4USL A;  4ZCU A;  1NCZ A;  1QVI Z;  2BCX A;  4MRX A;  3JTD B;  1NYA A;  1SK6 D;  2KAY A;  4CFR A;  4ETO A;  4UPG A;  1YUU A;  3EVR A;  3FIA A;  2BE6 A;  1UUR A;  2LVI A;  1B8L A;  1NPQ A;  1UUS A;  3BUX B;  1CM1 A;  1JUO A;  1YVH A;  5TNC A;  3KHE A;  1FI5 A;  1NCY A;  1K8U A;  1DVI A;  2CNP A;  4PCW A;  4CLN A;  1GGZ A;  1GGW A;  1MF8 B;  1S6J A;  1CLM A;  3TZ1 A;  1S3P A;  1SCM B;  1XK4 A;  2LAP A;  1CTR A;  1S26 D;  3MSE B;  1M63 B;  1CLB A;  1U5I A;  1N2D A;  4CPV A;  1ZUZ A;  1KFU S;  4GAO A;  2JZI A;  2VRG A;  1SL7 A;  3I5I B;  4AQJ A;  1QV1 A;  4A4C A;  1BOD A;  2JTZ A;  1A75 A;  1CDP A;  2BL0 C;  2WCF A;  2JTT A;  1H8B A;  2LP2 A;  1RTP 1;  1A2X A;  2JWW A;  4PE0 A;  4GUK A;  2L2E A;  1OZS A;  1B4C A;  4MEW A;  4C0K A;  3NSL A;  5B8I B;  2V53 A;  4MZL A;  1Y1U A;  2PVB A;  1PRW A;  3SG5 A;  2LC5 A;  3IQQ A;  1JWD A;  2JNX A;  1L7Z A;  2KI6 C;  3WHT B;  3I5F B;  1SR6 C;  1QX5 B;  1ALV A;  4MBE A;  1JC2 A;  3O6B A;  1TOP A;  5I2O A;  1XFY O;  2CXJ A;  2LLU A;  2CTN A;  1FW4 A;  2GGM A;  4NQG A;  5DKN A;  3D0Y A;  1S5G Z;  1DJI A;  2JNF A;  4QJ5 B;  2KSP A;  2LVV A;  3JVT C;  2LMU A;  3A4U B;  2LLS A;  4Q04 A;  2TN4 A;  2H61 C;  2HQ8 A;  2MBX A;  4DUQ A;  1IQ3 A;  2M3W A;  2LUX A;  2KYC A;  3CR4 X;  1KSO A;  1XFW O;  1QLS A;  4HRE E;  3WNX B;  1MUX A;  1BT6 A;  1S36 A;  3EVV A;  2SCP A;  1Y0V H;  3D10 A;  1EH2 A;  3NXA A;  4PHN A;  2LVJ A;  5JJG A;  2R2I A;  2OS8 C;  3HX4 A;  4P5O E;  4PHK A;  5HLV A;  5HKY A;  2PAL A;  1XO5 A;  4MSP A;  1C7V A;  4I5K A;  3OX5 A;  1F4Q A;  4GGN A;  1GQM A;  3GOF A;  2AAO A;  4CFQ A;  1YUT A;  1K90 D;  3EKJ A;  1WDC B;  1SMG A;  1OMR A;  3DVJ A;  1PAL A;  2MAZ A;  1CDN A;  2M1U A;  3I5G C;  2JQ6 A;  1SCV A;  1XFU O;  5KSZ A;  3CR2 A;  3NSK A;  4YI9 A;  5KU1 A;  1IJ6 A;  1M31 A;  1QS7 A;  3CWG A;  4FQO A;  2L5X B;  2KGR A;  4ICB A;  4I5N B;  4MZJ A;  3FWC A;  2JUL A;  4OVN F;  2K7O A;  5AAN A;  1BOC A;  4HRH A;  3VRQ A;  1U5I B;  1MXL C;  2FOT A;  4JQ0 D;  1FBV A;  2MJW B;  3ZWH A;  4M2P A;  3KO0 A;  5CSJ A;  2AUC A;  2FCE A;  1CLL A;  3BYA A;  3OB2 B;  2M7N A;  2M29 A;  2ZRS A;  1LA0 A;  1CDL A;  1BG1 A;  1KQM C;  2LE9 B;  5AFP A;  1F8H A;  1Y6W A;  2OTG B;  4GGF A;  4NDD A;  1MWN A;  2E30 A;  1AJ4 A;  3IQO A;  2WOS A;  5BPJ A;  1BMO A;  4FTG A;  4YGA A;  1DJG A;  1PSR A;  1YUS A;  3ICB A;  1J7P A;  5DKR A;  3DVK A;  5CPV A;  3LLE A;  1WRZ A;  2P6B B;  1BLQ A;  1VRK A;  3I5H B;  1C07 A;  1QX7 A;  2JXC A;  2M97 A;  1QJT A;  1SRA A;  4TNC A;  2AMI A;  4ZCV A;  3VRP A;  1BR1 B;  3NSI A;  1OMD A;  3TS5 B;  3D0Y B;  1KQV A;  4ORC B;  4YBH B;  1QAS A;  1QXP A;  2JRF A;  2F3Y A;  5CSF A;  3BUW B;  4OCI A;  3OHM B;  2NXQ A;  2JPT A;  2HPS A;  2GGZ A;  1IQ5 A;  1B7T Y;  1OSA A;  2L50 A;  1BF5 A;  1JF2 A;  2LVK A;  2EC6 C;  2MRD A;  1XFX O;  1B8R A;  1L2O C;  1M45 A;  4U8D A;  1LA3 A;  1DGU A;  1RJV A;  3PSR A;  1KFX S;  3DVM A;  1K95 A;  1CNP A;  1Y1X A;  2BEC A;  1UWO A;  2QAC A;  1YRT B;  4BY4 A;  3PAL A;  2KI6 D;  3TDZ A;  2LMV A;  2KQ6 A;  2OPO A;  1HT9 A;  2BL0 B;  1TN4 A;  1IWQ A;  3H4S E;  1EJ3 A;  4DS7 A;  3A8R A;  3LL8 B;  1J7R A;  1NUB A;  3KEV A;  4OV2 A;  4DCK A;  1QAT A;  1XFZ O;  3I5F C;  1DMO A;  1NSH A;  4PAL A;  1DGV A;  1XYD A;  4MVF A;  4YGC B;  3WHU B;  1FPW A;  1SR6 B;  2L51 A;  1DF0 A;  2BBM A;  1K9K A;  2E6W A;  3BOW B;  1CM4 A;  5AER A;  4PE7 A;  4WQ2 A;  1A4P A;  1BU3 A;  3SIA A;  2ISD A;  1NP8 A;  2L4I A;  1AK8 A;  2O5G A;  5PAL A;  3KF9 A;  2HQW A;  1YR5 A;  3EK7 A;  4C0L A;  1YX8 A;  2F3Z A;  1SW8 A;  1QTX A;  2Q4U A;  1DJH A;  1B47 A; 
#chains in the Genus database with same CATH topology
 1KFX L;  4DRW A;  1ODB A;  1V1F A;  1KWO B;  5HKZ A;  1JFJ A;  3D74 A;  3UO9 A;  3SG2 A;  4GGF C;  2F2O A;  2O60 A;  2Y1M A;  4BY5 A;  4JPZ B;  1W7I B;  1MXE A;  1WRL A;  5CSI A;  2IS9 A;  4F7F A;  2MLE C;  2PRU A;  1DJW A;  1UHN A;  3E3R A;  2OS8 B;  2JOJ A;  3LK0 A;  1CMG A;  2LP3 A;  2PSR A;  1V1G A;  2M0R A;  5G08 A;  4GPL B;  5I94 A;  1NCX A;  1F71 A;  2ZNE A;  3M0W A;  1WDC C;  5EL2 A;  2LNK A;  5IBW A;  1C7W A;  1UHK A;  4DIR A;  1UHH A;  2KYF A;  1B9A A;  1QWV A;  2KLE A;  2NCO A;  3GK4 X;  1Z2C B;  2KOT A;  4PHM A;  3I5G B;  2CCM A;  3VRN A;  1CMF A;  1D1O A;  1S5G Y;  1MQ1 A;  3OB1 B;  1EG3 A;  1TUZ A;  3BOW A;  4YGB B;  1J55 A;  1OQP A;  3CZ2 A;  1KK8 B;  1YTZ C;  2LV7 A;  2WC8 A;  1G4Y R;  4YRU A;  4NDC A;  1XK4 C;  3D76 A;  4R1E A;  1TNX A;  3AKB A;  3PAT A;  3CTN A;  2YGU A;  1YRU B;  3WXA A;  1SPY A;  1B1G A;  2WCE A;  4PE1 A;  3SIB A;  1QX2 A;  3RZS A;  2K61 A;  2H61 A;  1ZAC A;  3FS7 A;  1SYM A;  1AJ5 A;  1PSB A;  1AP4 A;  1E8A A;  1TNP A;  3TUY B;  1G33 A;  3FE9 A;  2KAX A;  4CID A;  1CFC A;  1IRJ A;  1B7T Z;  3LCP C;  4IL1 A;  5F6T A;  2OTG C;  1NX0 A;  2LUC A;  1AHR A;  2FCD A;  3CZT X;  2DOQ A;  1TTX A;  1TNQ A;  2KI4 B;  2WCJ A;  2BE4 A;  1R2U A;  2F2P A;  2LAN A;  3O78 A;  1QIV A;  3FE6 A;  3SG7 A;  2M7L A;  1A03 A;  2HET A;  2BCB A;  4KYN A;  2LM5 A;  1J7O A;  1OZO A;  1KK7 Y;  2ZN8 A;  3O4Y A;  4ORA B;  1NX1 A;  4HRG A;  1FF1 A;  3AKA A;  3BUM B;  1F4O A;  2PMY A;  2G9B A;  2M9G A;  2Y5I A;  1TCF A;  2BKI B;  3I5H C;  1DF0 B;  2HF5 A;  3PM8 A;  4YGD B;  1KCY A;  2KHN A;  3RM1 A;  2LMT A;  2SAS A;  5HLO A;  2M8U A;  2H8V A;  2K7D A;  2KFH A;  2KDH A;  3PN7 B;  3TS5 C;  3JTD C;  2ZRT A;  1DQE A;  4INX A;  4MLW A;  2I94 A;  1WLM A;  4YGE B;  5AEQ A;  1TNW A;  3EK4 A;  1MR8 A;  1QV0 A;  1AUI B;  2JT3 A;  2FJU B;  3EG5 B;  2BCA A;  2BKH B;  1ZFS A;  2WCK A;  3OGN A;  4WQ3 A;  3SJS A;  4F0Z B;  1NX2 A;  1M39 A;  2JU0 A;  2KGB C;  2QPT A;  3EVU A;  1QLK A;  3BFA A;  4PDZ A;  1SCM C;  3SG4 A;  4QJ4 B;  5DKQ A;  3DF0 B;  3GK2 A;  1WRK A;  1A29 A;  1LKJ A;  1M46 A;  1RFJ A;  3I5I C;  4IJ7 A;  1SL8 A;  2EC6 B;  3RLZ A;  2BBN A;  1L2O B;  3FE8 A;  2KNE A;  2RGI A;  4I5J A;  2K2F A;  3BUO B;  4GBA A;  2Y4Q A;  3QRX A;  4JD9 A;  5FI6 A;  1CFP A;  1K2H A;  4OKH A;  1S6C A;  4PHJ A;  1OOF A;  5D7F A;  1F55 A;  2EGD A;  1DJZ A;  1XVJ A;  2LCP A;  4A4B A;  2KAV A;  1XFV O;  2I18 A;  2JC2 A;  3CR5 X;  1ALW A;  2M1K B;  3CDN A;  3K1E A;  2A4J A;  3IF7 A;  1CB1 A;  1GM0 A;  1K93 D;  3B86 A;  1JF0 A;  3NSO A;  3ZNI A;  5HYD A;  1JSA A;  1K96 A;  3SS4 A;  3R72 A;  2QDI A;  5FYX A;  2KLD A;  3KPX A;  3S0B A;  1QVI Y;  3BXK A;  5AXI A;  1SKT A;  1F54 A;  2NZ0 A;  2D8N A;  1SNL A;  3BQ3 A;  1NIW A;  4QJ3 B;  3O2P A;  1B8C A;  3PM2 A;  4HSZ A;  2QEB A;  1WY9 A;  4I5L B;  1K9P A;  1DC1 A;  2L5Y A;  2WOR A;  1DJY A;  1YVL A;  4GFT A;  3AAK A;  1Q80 A;  2WND A;  2L98 A;  3VRO A;  1YX7 A;  4YI8 A;  3JVT B;  1OMV A;  1N65 A;  2JT0 A;  1RRO A;  3EK8 A;  4ORB B;  1RK9 A;  1SBJ A;  3C1V A;  4GNK B;  4N5X A;  1S1E A;  3SS5 A;  1OOJ A;  1EG4 A;  1ZMZ A;  1IIO A;  4M2O A;  4AOM A;  3DF0 A;  1LXF C;  3QME A;  3R1V A;  1N0Y A;  4P2Y B;  2G2B A;  2GV5 A;  2K7B A;  1K94 A;  1TRF A;  3VGO A;  1RWY A;  1IG5 A;  1SL9 A;  1CDM A;  2JXL A;  3DY9 A;  3CYZ A;  3R1P A;  3D75 A;  4XJK B;  1PVB A;  5J3X A;  1CKK A;  1DTL A;  1DJX A;  1KWO C;  1R6P A;  1WLZ A;  2H2K A;  2KFF A;  3AAJ A;  1PK0 D;  1KFU L;  2M49 B;  3B87 A;  4FQT A;  4M2Q A;  5FI2 A;  5HL1 A;  5HKW A;  4N1G A;  1J1D A;  2LHL A;  3PFV A;  3CS1 A;  2KBM A;  3GK1 A;  2COL B;  2QEV A;  2ZND A;  4MRY A;  2K8M B;  3OX6 A;  1UP5 A;  2K2A A;  1CFF A;  1EXR A;  4WRI A;  3F45 A;  3VRR A;  1TCO B;  1YUR A;  1PVA A;  2Y1N A;  3SG3 A;  2MHH A;  2WC5 A;  3V2L A;  1IKU A;  2CBL A;  1BJF A;  1TIZ A;  1MHO A;  1OE9 B;  5GQQ C;  1LVC D;  2F33 A;  5I2L A;  4MN0 A;  1DT7 B;  1FI6 A;  2PQL A;  1J7Q A;  2LHI A;  4E68 A;  1F70 A;  1KK7 Z;  4PE4 A;  3PLF B;  3B6X A;  5ER5 A;  1UHI A;  2GTE A;  2ZKM X;  1NWD A;  1XA5 A;  5D69 A;  2PAS A;  2P71 A;  5FI7 A;  1K9U A;  1JBA A;  2I7A A;  1KK8 C;  3OP0 A;  1IGV A;  2L4H A;  1GJY A;  4JWQ A;  1SY9 A;  1LIN A;  1UHJ A;  2ZN9 A;  4D1E A;  3DD4 A;  1CFD A;  1NX3 A;  1KQM B;  2EHB A;  5I2Q A;  4OR9 B;  2F8P A;  1IH0 A;  4XYN A;  3FWB A;  5ER4 X;  1S6I A;  3EKH A;  1QIW A;  2ZFD A;  3TUY C;  4XJK A;  2K0J A;  3TDU A;  3BUN B;  1A75 B;  5K89 A;  1W7J B;  2FJY A;  2NLN A;  3SG6 A;  4L9M A;  2KFG A;  2MLF C;  2NCP A;  1J1E A;  2JT8 A;  3LK1 A;  5I8N A;  1IJ5 A;  2KI4 C;  2KQY A;  2LLT A;  1Y1A A;  1ZOT B;  3NHI A;  4NDB A;  3O4X A;  2MA2 A;  1AVS A;  3TDI A;  2CT9 A;  5JOL A;  4C0J A;  3UNW A;  2B1U A;  5CSN A;  3K21 A;  1JFK A;  1KSM A;  2WCB A;  2WCL A;  1EL4 A;  4N1F A;  1G8I A;  1REC A;  2P70 A;  2WCM A;  1BR4 B;  2I2R E;  3DVE A;  2KBI A;  1HQV A;  2L0P A;  4AQI A;  1PUL A;  3R1O A;  4MZK A;  1X02 A;  2K60 A;  1DEL A;  2Q91 A;  2K7C A;  1H4B A;  2BNX A;  3HCM A;  3PN7 C;  5KTY A;  3CGA A;  3CLN A;  4USL A;  4ZCU A;  1NCZ A;  4INW A;  1QVI Z;  2BCX A;  4MRX A;  2WCH A;  3JTD B;  1NYA A;  1SK6 D;  1XFR A;  2KAY A;  4CFR A;  4ETO A;  4UPG A;  1YUU A;  3EVR A;  3FIA A;  2BE6 A;  1UUR A;  3B7A A;  2LVI A;  1B8L A;  1NPQ A;  1UUS A;  3BUX B;  3S0E A;  1CM1 A;  1ORG A;  1JUO A;  1YVH A;  5TNC A;  3KHE A;  1FI5 A;  1NCY A;  1K8U A;  1P28 A;  1DVI A;  3CZ0 A;  2CNP A;  4PCW A;  4CLN A;  1GGZ A;  2PYQ A;  2BAP A;  1MF8 B;  1S6J A;  1GGW A;  1CLM A;  3TZ1 A;  1S3P A;  1SCM B;  1XK4 A;  2LAP A;  1CTR A;  1S26 D;  3MSE B;  1M63 B;  1CLB A;  1U5I A;  1N2D A;  4CPV A;  1ZUZ A;  1KFU S;  4GAO A;  2JZI A;  2VRG A;  1SL7 A;  3I5I B;  4AQJ A;  1QV1 A;  4A4C A;  1BOD A;  2JTZ A;  1A75 A;  1CDP A;  2BL0 C;  2QEH A;  2WCF A;  2JTT A;  3L4L A;  1H8B A;  2LP2 A;  1RTP 1;  1A2X A;  2JWW A;  4PE0 A;  4GUK A;  2L2E A;  1OZS A;  1B4C A;  3BJH A;  4MEW A;  4C0K A;  3NSL A;  5B8I B;  5D3O A;  3OBV A;  2V53 A;  4MZL A;  3IVT A;  1Y1U A;  2PVB A;  1PRW A;  3SG5 A;  2LC5 A;  3IQQ A;  1JWD A;  2L2C A;  2JNX A;  1L7Z A;  2KI6 C;  3WHT B;  3I5F B;  1SR6 C;  1QX5 B;  1ALV A;  4MBE A;  1JC2 A;  3O6B A;  1TOP A;  5I2O A;  1XFY O;  2CXJ A;  2LLU A;  2CTN A;  1FW4 A;  2GGM A;  4NQG A;  5DKN A;  3D0Y A;  1S5G Z;  1DJI A;  2JNF A;  4QJ5 B;  2KSP A;  2LVV A;  3JVT C;  2LMU A;  3A4U B;  2LLS A;  4Q04 A;  2TN4 A;  2H61 C;  2HQ8 A;  2MBX A;  4DUQ A;  1IQ3 A;  2M3W A;  2LUX A;  2KYC A;  3CR4 X;  1KSO A;  1XFW O;  1QLS A;  2JPO A;  4HRE E;  3WNX B;  1MUX A;  1BT6 A;  1S36 A;  3EVV A;  2SCP A;  1Y0V H;  3D10 A;  3SS3 A;  1EH2 A;  3N7H A;  3NXA A;  4PHN A;  2LVJ A;  5JJG A;  2R2I A;  2OS8 C;  3HX4 A;  4P5O E;  4PHK A;  5HLV A;  5HKY A;  2PAL A;  1T14 A;  1XO5 A;  4MSP A;  4I5K A;  3OX5 A;  1C7V A;  1F4Q A;  4GGN A;  3CAB A;  1GQM A;  3GOF A;  2AAO A;  4CFQ A;  1YUT A;  1K90 D;  3EKJ A;  1WDC B;  1SMG A;  1OMR A;  1OOI X;  3DVJ A;  1PAL A;  2MAZ A;  1CDN A;  2M1U A;  3I5G C;  1OOH A;  2JQ6 A;  1SCV A;  1XFU O;  5KSZ A;  3CR2 A;  3NSK A;  2WC6 A;  4YI9 A;  5KU1 A;  1IJ6 A;  3NGV A;  1M31 A;  1QS7 A;  3CWG A;  4FQO A;  2L5X B;  2KGR A;  4ICB A;  4I5N B;  4MZJ A;  3FWC A;  2JUL A;  4OVN F;  2K7O A;  5AAN A;  1BOC A;  4HRH A;  3VRQ A;  1U5I B;  1MXL C;  2FOT A;  3S0G A;  4JQ0 D;  1FBV A;  2MJW B;  3ZWH A;  4M2P A;  3KO0 A;  5CSJ A;  2AUC A;  2FCE A;  1CLL A;  3BYA A;  3OB2 B;  1TUJ A;  2M7N A;  3S0F A;  2M29 A;  2ZRS A;  1LA0 A;  1CDL A;  1BG1 A;  1KQM C;  2LE9 B;  5AFP A;  1F8H A;  1Y6W A;  2OTG B;  4GGF A;  4NDD A;  1MWN A;  1OW4 A;  1AJ4 A;  2E30 A;  3IQO A;  2WOS A;  5BPJ A;  1BMO A;  4FTG A;  3L47 A;  4YGA A;  1DJG A;  1PSR A;  1YUS A;  3ICB A;  4PT1 A;  1J7P A;  5DKR A;  1TWO A;  3DVK A;  5CPV A;  1LS8 A;  1WRZ A;  2P6B B;  3L4A A;  3LLE A;  1VRK A;  3I5H B;  1BLQ A;  1C07 A;  1QX7 A;  2JXC A;  2M97 A;  1QJT A;  1SRA A;  4TNC A;  2AMI A;  3S0D A;  4ZCV A;  3VRP A;  1SSE B;  1BR1 B;  3NSI A;  1OMD A;  3TS5 B;  2ERB A;  3D0Y B;  3Q8I A;  4ORC B;  4YBH B;  1QAS A;  1KQV A;  1QXP A;  2JRF A;  2F3Y A;  3B88 A;  3BUW B;  5CSF A;  4OCI A;  3OHM B;  2NXQ A;  2JPT A;  2HPS A;  4JKT A;  2GGZ A;  1IQ5 A;  1B7T Y;  3D77 A;  3DYE A;  1OSA A;  2L50 A;  1BF5 A;  1JF2 A;  2LVK A;  2EC6 C;  2MRD A;  1XFX O;  1B8R A;  1L2O C;  1M45 A;  4U8D A;  3CZ1 A;  1LA3 A;  1DGU A;  1RJV A;  3D73 A;  3PSR A;  2KPH A;  1KFX S;  2QEO A;  3DVM A;  1K95 A;  1CNP A;  1Y1X A;  3BFB A;  2BEC A;  1UWO A;  2QAC A;  1YRT B;  4BY4 A;  3PAL A;  2KI6 D;  3VB1 A;  3TDZ A;  2LMV A;  2KQ6 A;  3S0A A;  1C3Z A;  2OPO A;  1HT9 A;  2BL0 B;  4OZD A;  1TN4 A;  1IWQ A;  3BFH A;  3H4S E;  3PJI A;  1EJ3 A;  4DS7 A;  3A8R A;  3LL8 B;  1J7R A;  1NUB A;  3KEV A;  1OOG A;  4OV2 A;  4DCK A;  1QAT A;  1XFZ O;  3I5F C;  5DIC A;  1DMO A;  1NSH A;  4PAL A;  1DGV A;  1XYD A;  4MVF A;  4YGC B;  3WHU B;  1FPW A;  1SR6 B;  1W9Z A;  2L51 A;  1DF0 A;  1DEK A;  2BBM A;  1K9K A;  2E6W A;  3BOW B;  1CM4 A;  5AER A;  4PE7 A;  3DZT A;  4WQ2 A;  1A4P A;  1BU3 A;  3SIA A;  2ISD A;  1Z4H A;  1NP8 A;  1C3Y A;  2L4I A;  1AK8 A;  3DXL A;  2O5G A;  5PAL A;  3D78 A;  2HQW A;  1YR5 A;  3KF9 A;  3EK7 A;  4C0L A;  1YX8 A;  2F3Z A;  1SW8 A;  1QTX A;  3NHT A;  2Q4U A;  1DJH A;  1B47 A; 
#chains in the Genus database with same CATH homology
 1KFX L;  4DRW A;  1ODB A;  1V1F A;  1KWO B;  5HKZ A;  1JFJ A;  3SG2 A;  4GGF C;  2F2O A;  2O60 A;  2Y1M A;  4BY5 A;  4JPZ B;  1W7I B;  1MXE A;  1WRL A;  5CSI A;  2IS9 A;  2MLE C;  2PRU A;  1DJW A;  1UHN A;  3E3R A;  2OS8 B;  2JOJ A;  3LK0 A;  1CMG A;  2LP3 A;  2PSR A;  1V1G A;  2M0R A;  5G08 A;  4GPL B;  1NCX A;  1F71 A;  2ZNE A;  3M0W A;  1WDC C;  2LNK A;  5IBW A;  1C7W A;  1UHK A;  4DIR A;  1UHH A;  2KYF A;  1B9A A;  2NCO A;  3GK4 X;  2KOT A;  4PHM A;  3I5G B;  2CCM A;  3VRN A;  1CMF A;  1D1O A;  1S5G Y;  1MQ1 A;  3OB1 B;  1EG3 A;  3BOW A;  4YGB B;  1J55 A;  1OQP A;  1KK8 B;  1YTZ C;  2LV7 A;  2WC8 A;  1G4Y R;  4YRU A;  4NDC A;  1XK4 C;  4R1E A;  1TNX A;  3AKB A;  3PAT A;  3CTN A;  1YRU B;  3WXA A;  1SPY A;  1B1G A;  2WCE A;  4PE1 A;  3SIB A;  1QX2 A;  2K61 A;  2H61 A;  1ZAC A;  3FS7 A;  1SYM A;  1AJ5 A;  1PSB A;  1AP4 A;  1E8A A;  1TNP A;  3TUY B;  1G33 A;  2KAX A;  4CID A;  1CFC A;  1IRJ A;  1B7T Z;  3LCP C;  4IL1 A;  5F6T A;  2OTG C;  1NX0 A;  2LUC A;  1AHR A;  2FCD A;  3CZT X;  2DOQ A;  1TTX A;  1TNQ A;  2KI4 B;  2BE4 A;  1R2U A;  2F2P A;  2LAN A;  3O78 A;  1QIV A;  3SG7 A;  2M7L A;  1A03 A;  2HET A;  2BCB A;  2LM5 A;  1J7O A;  1OZO A;  1KK7 Y;  2ZN8 A;  3O4Y A;  4ORA B;  1NX1 A;  4HRG A;  1FF1 A;  3AKA A;  3BUM B;  1F4O A;  2PMY A;  2G9B A;  2M9G A;  2Y5I A;  1TCF A;  2BKI B;  3I5H C;  1DF0 B;  2HF5 A;  3PM8 A;  4YGD B;  1KCY A;  2KHN A;  3RM1 A;  2LMT A;  2SAS A;  5HLO A;  2M8U A;  2K7D A;  2KFH A;  2KDH A;  3PN7 B;  3TS5 C;  3JTD C;  2ZRT A;  4MLW A;  2I94 A;  1WLM A;  4YGE B;  5AEQ A;  1TNW A;  3EK4 A;  1MR8 A;  1QV0 A;  1AUI B;  2JT3 A;  2FJU B;  3SJS A;  2BCA A;  2BKH B;  1ZFS A;  4F0Z B;  4WQ3 A;  1NX2 A;  1M39 A;  2JU0 A;  2KGB C;  2QPT A;  3EVU A;  1QLK A;  4PDZ A;  1SCM C;  3SG4 A;  4QJ4 B;  5DKQ A;  3DF0 B;  3GK2 A;  1WRK A;  1A29 A;  1LKJ A;  1M46 A;  1RFJ A;  3I5I C;  1SL8 A;  2EC6 B;  3RLZ A;  2BBN A;  1L2O B;  2KNE A;  2RGI A;  4I5J A;  2K2F A;  3BUO B;  4GBA A;  2Y4Q A;  3QRX A;  1CFP A;  1K2H A;  4OKH A;  1S6C A;  4PHJ A;  5D7F A;  1F55 A;  2EGD A;  1DJZ A;  1XVJ A;  2LCP A;  4A4B A;  2KAV A;  1XFV O;  2I18 A;  2JC2 A;  3CR5 X;  1ALW A;  2M1K B;  2A4J A;  3IF7 A;  1CB1 A;  1K93 D;  1JF0 A;  3NSO A;  3ZNI A;  5HYD A;  1JSA A;  1K96 A;  5FYX A;  3KPX A;  1QVI Y;  3BXK A;  5AXI A;  1SKT A;  1F54 A;  2NZ0 A;  2D8N A;  1SNL A;  3BQ3 A;  1NIW A;  4QJ3 B;  3O2P A;  1B8C A;  4HSZ A;  1WY9 A;  4I5L B;  1K9P A;  2WOR A;  1DJY A;  1YVL A;  4GFT A;  3AAK A;  1Q80 A;  2WND A;  2L98 A;  3VRO A;  1YX7 A;  4YI8 A;  3JVT B;  1OMV A;  1N65 A;  2JT0 A;  1RRO A;  3EK8 A;  4ORB B;  1RK9 A;  1SBJ A;  3C1V A;  4GNK B;  4N5X A;  1S1E A;  1OOJ A;  1EG4 A;  1ZMZ A;  4M2O A;  4AOM A;  3DF0 A;  1LXF C;  1N0Y A;  4P2Y B;  2G2B A;  2GV5 A;  2K7B A;  1K94 A;  1TRF A;  3VGO A;  1RWY A;  1IG5 A;  1SL9 A;  1CDM A;  2JXL A;  5J3X A;  4XJK B;  1PVB A;  1CKK A;  1DTL A;  1DJX A;  1KWO C;  1R6P A;  1WLZ A;  2H2K A;  2KFF A;  3AAJ A;  1PK0 D;  1KFU L;  2M49 B;  4M2Q A;  5HKW A;  4N1G A;  1J1D A;  2LHL A;  3PFV A;  3CS1 A;  2KBM A;  3GK1 A;  2COL B;  2ZND A;  4MRY A;  2K8M B;  3OX6 A;  1UP5 A;  2K2A A;  1CFF A;  1EXR A;  4WRI A;  3F45 A;  3VRR A;  1TCO B;  1YUR A;  1PVA A;  2Y1N A;  3SG3 A;  2MHH A;  1IKU A;  2CBL A;  1BJF A;  1TIZ A;  1MHO A;  1OE9 B;  5GQQ C;  1LVC D;  2F33 A;  5I2L A;  4MN0 A;  1DT7 B;  1FI6 A;  1J7Q A;  2LHI A;  4E68 A;  1F70 A;  1KK7 Z;  4PE4 A;  3PLF B;  5ER5 A;  1UHI A;  2ZKM X;  1NWD A;  1XA5 A;  5D69 A;  2PAS A;  1JBA A;  1K9U A;  2I7A A;  1KK8 C;  3OP0 A;  1IGV A;  2L4H A;  1GJY A;  4JWQ A;  1SY9 A;  1LIN A;  1UHJ A;  2ZN9 A;  4D1E A;  3DD4 A;  1CFD A;  1NX3 A;  1KQM B;  2EHB A;  5I2Q A;  4OR9 B;  2F8P A;  1IH0 A;  4XYN A;  3FWB A;  5ER4 X;  1S6I A;  3EKH A;  1QIW A;  2ZFD A;  3TUY C;  4XJK A;  2K0J A;  3TDU A;  3BUN B;  1A75 B;  5K89 A;  1W7J B;  2NLN A;  3SG6 A;  4L9M A;  2KFG A;  2MLF C;  2NCP A;  1J1E A;  2JT8 A;  3LK1 A;  5I8N A;  1IJ5 A;  2KI4 C;  2KQY A;  2LLT A;  1Y1A A;  1ZOT B;  4NDB A;  2MA2 A;  1AVS A;  3TDI A;  2CT9 A;  5JOL A;  4C0J A;  2B1U A;  5CSN A;  3K21 A;  1JFK A;  1KSM A;  2WCB A;  1EL4 A;  4N1F A;  1G8I A;  1REC A;  1BR4 B;  2I2R E;  3DVE A;  2KBI A;  1HQV A;  2L0P A;  4AQI A;  1PUL A;  4MZK A;  1X02 A;  2Q91 A;  2K7C A;  1H4B A;  3PN7 C;  3HCM A;  5KTY A;  3CGA A;  3CLN A;  4USL A;  4ZCU A;  1NCZ A;  1QVI Z;  2BCX A;  4MRX A;  3JTD B;  1NYA A;  1SK6 D;  2KAY A;  4CFR A;  4ETO A;  4UPG A;  1YUU A;  3EVR A;  3FIA A;  2BE6 A;  1UUR A;  2LVI A;  1B8L A;  1NPQ A;  1UUS A;  3BUX B;  1CM1 A;  1JUO A;  1YVH A;  5TNC A;  3KHE A;  1FI5 A;  1NCY A;  1K8U A;  1DVI A;  2CNP A;  4PCW A;  4CLN A;  1GGZ A;  1GGW A;  1MF8 B;  1S6J A;  1CLM A;  3TZ1 A;  1S3P A;  1SCM B;  1XK4 A;  2LAP A;  1CTR A;  1S26 D;  3MSE B;  1M63 B;  1CLB A;  1U5I A;  1N2D A;  4CPV A;  1ZUZ A;  1KFU S;  4GAO A;  2JZI A;  2VRG A;  1SL7 A;  3I5I B;  4AQJ A;  1QV1 A;  4A4C A;  1BOD A;  2JTZ A;  1A75 A;  1CDP A;  2BL0 C;  2WCF A;  2JTT A;  1H8B A;  2LP2 A;  1RTP 1;  1A2X A;  2JWW A;  4PE0 A;  4GUK A;  2L2E A;  1OZS A;  1B4C A;  4MEW A;  4C0K A;  3NSL A;  5B8I B;  2V53 A;  4MZL A;  1Y1U A;  2PVB A;  1PRW A;  3SG5 A;  2LC5 A;  3IQQ A;  1JWD A;  2JNX A;  1L7Z A;  2KI6 C;  3WHT B;  3I5F B;  1SR6 C;  1QX5 B;  1ALV A;  4MBE A;  1JC2 A;  3O6B A;  1TOP A;  5I2O A;  1XFY O;  2CXJ A;  2LLU A;  2CTN A;  1FW4 A;  2GGM A;  4NQG A;  5DKN A;  3D0Y A;  1S5G Z;  1DJI A;  2JNF A;  4QJ5 B;  2KSP A;  2LVV A;  3JVT C;  2LMU A;  3A4U B;  2LLS A;  4Q04 A;  2TN4 A;  2H61 C;  2HQ8 A;  2MBX A;  4DUQ A;  1IQ3 A;  2M3W A;  2LUX A;  2KYC A;  3CR4 X;  1KSO A;  1XFW O;  1QLS A;  4HRE E;  3WNX B;  1MUX A;  1BT6 A;  1S36 A;  3EVV A;  2SCP A;  1Y0V H;  3D10 A;  1EH2 A;  3NXA A;  4PHN A;  2LVJ A;  5JJG A;  2R2I A;  2OS8 C;  3HX4 A;  4P5O E;  4PHK A;  5HLV A;  5HKY A;  2PAL A;  1XO5 A;  4MSP A;  1C7V A;  4I5K A;  3OX5 A;  1F4Q A;  4GGN A;  1GQM A;  3GOF A;  2AAO A;  4CFQ A;  1YUT A;  1K90 D;  3EKJ A;  1WDC B;  1SMG A;  1OMR A;  3DVJ A;  1PAL A;  2MAZ A;  1CDN A;  2M1U A;  3I5G C;  2JQ6 A;  1SCV A;  1XFU O;  5KSZ A;  3CR2 A;  3NSK A;  4YI9 A;  5KU1 A;  1IJ6 A;  1M31 A;  1QS7 A;  3CWG A;  4FQO A;  2L5X B;  2KGR A;  4ICB A;  4I5N B;  4MZJ A;  3FWC A;  2JUL A;  4OVN F;  2K7O A;  5AAN A;  1BOC A;  4HRH A;  3VRQ A;  1U5I B;  1MXL C;  2FOT A;  4JQ0 D;  1FBV A;  2MJW B;  3ZWH A;  4M2P A;  3KO0 A;  5CSJ A;  2AUC A;  2FCE A;  1CLL A;  3BYA A;  3OB2 B;  2M7N A;  2M29 A;  2ZRS A;  1LA0 A;  1CDL A;  1BG1 A;  1KQM C;  2LE9 B;  5AFP A;  1F8H A;  1Y6W A;  2OTG B;  4GGF A;  4NDD A;  1MWN A;  2E30 A;  1AJ4 A;  3IQO A;  2WOS A;  5BPJ A;  1BMO A;  4FTG A;  4YGA A;  1DJG A;  1PSR A;  1YUS A;  3ICB A;  1J7P A;  5DKR A;  3DVK A;  5CPV A;  3LLE A;  1WRZ A;  2P6B B;  1BLQ A;  1VRK A;  3I5H B;  1C07 A;  1QX7 A;  2JXC A;  2M97 A;  1QJT A;  1SRA A;  4TNC A;  2AMI A;  4ZCV A;  3VRP A;  1BR1 B;  3NSI A;  1OMD A;  3TS5 B;  3D0Y B;  1KQV A;  4ORC B;  4YBH B;  1QAS A;  1QXP A;  2JRF A;  2F3Y A;  5CSF A;  3BUW B;  4OCI A;  3OHM B;  2NXQ A;  2JPT A;  2HPS A;  2GGZ A;  1IQ5 A;  1B7T Y;  1OSA A;  2L50 A;  1BF5 A;  1JF2 A;  2LVK A;  2EC6 C;  2MRD A;  1XFX O;  1B8R A;  1L2O C;  1M45 A;  4U8D A;  1LA3 A;  1DGU A;  1RJV A;  3PSR A;  1KFX S;  3DVM A;  1K95 A;  1CNP A;  1Y1X A;  2BEC A;  1UWO A;  2QAC A;  1YRT B;  4BY4 A;  3PAL A;  2KI6 D;  3TDZ A;  2LMV A;  2KQ6 A;  2OPO A;  1HT9 A;  2BL0 B;  1TN4 A;  1IWQ A;  3H4S E;  1EJ3 A;  4DS7 A;  3A8R A;  3LL8 B;  1J7R A;  1NUB A;  3KEV A;  4OV2 A;  4DCK A;  1QAT A;  1XFZ O;  3I5F C;  1DMO A;  1NSH A;  4PAL A;  1DGV A;  1XYD A;  4MVF A;  4YGC B;  3WHU B;  1FPW A;  1SR6 B;  2L51 A;  1DF0 A;  2BBM A;  1K9K A;  2E6W A;  3BOW B;  1CM4 A;  5AER A;  4PE7 A;  4WQ2 A;  1A4P A;  1BU3 A;  3SIA A;  2ISD A;  1NP8 A;  2L4I A;  1AK8 A;  2O5G A;  5PAL A;  3KF9 A;  2HQW A;  1YR5 A;  3EK7 A;  4C0L A;  1YX8 A;  2F3Z A;  1SW8 A;  1QTX A;  2Q4U A;  1DJH A;  1B47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...