2K2FA

Solution structure of ca2+-s100a1-ryrp12
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
93
structure length
93
Chain Sequence
b'GSELETAMETLINVFHAHSGKEGDKYKLSKKELKDLLQTELSSFLDVQKDADAVDKIMKELDENGDGEVDFQEFVVLVAALTVACNNFFWENS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ryanodine receptor 1 peptide
molecule tags Metal binding protein
source organism Rattus norvegicus
publication title S100A1 and Calmodulin Compete for the Same Binding Site on Ryanodine Receptor.
pubmed doi rcsb
total genus 22
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2k2fA00
3WNXB 1RROA 2PMYA 3LCPC 5AFPA 5B8IB 3IQQA 1SCVA 3DVEA 1CM4A 2JT8A 2GGMA 1KSOA 1CFFA 5D7FA 1N65A 1MXEA 2K8MB 5CSIA 1K9PA 1DJGA 1QVIY 1RFJA 1J1DA 1QV0A 1WLMA 2RGIA 2TN4A 5I2OA 1CFCA 1S6JA 2FOTA 1KQMC 1Y1AA 1XFVO 2LVKA 4GNKB 1B47A 4C0JA 1LINA 1CM1A 1QATA 3PN7C 1QJTA 3I5IC 4OKHA 5D69A 1BODA 1SCMB 2KQ6A 4U8DA 3H4SE 3O6BA 4GGFC 4OCIA 2HPSA 2BL0C 3DD4A 2MLEC 2V53A 1CDNA 2MA2A 1OZOA 3TDUA 1CKKA 3EVVA 1S5GY 1S5GZ 1PRWA 3SG6A 5I2QA 1ZFSA 5JJGA 1SL7A 1QLKA 3EVRA 4YGEB 1H8BA 2AUCA 1PVBA 3EK4A 3BOWB 1CMGA 1A4PA 1NWDA 2KI6C 1BR4B 1EL4A 4PE4A 1DJWA 1WRKA 1S6IA 2L0PA 2LLUA 4MLWA 2H61A 1YURA 1K9UA 1W7IB 4A4BA 4E68A 1SR6C 2GV5A 4DRWA 2EHBA 4CFQA 1IGVA 2AMIA 3FWBA 3PATA 4MZJA 1XVJA 2ZRSA 5CSFA 1NX2A 1DTLA 1L2OB 1QIWA 3KF9A 2SASA 1XFYO 2JNXA 1FPWA 5HKYA 4OR9B 3NSKA 5KSZA 4PALA 4BY5A 1ODBA 1E8AA 2P6BB 4DCKA 2QPTA 3QRXA 1CDMA 1PALA 1SR6B 2Y5IA 1SK6D 4YGDB 2L2EA 1IJ5A 2AAOA 1UHJA 2PALA 1AHRA 3NSOA 2LHLA 3RLZA 1UUSA 1UHNA 2JTZA 1EG4A 1K8UA 4M2OA 4DS7A 2BBMA 1C7VA 1JF0A 3EVUA 4ZCVA 1QASA 1AK8A 1IQ3A 4ORAB 1K90D 5K89A 2PVBA 1K95A 2LLSA 2ZNEA 1C7WA 2Y1NA 3HX4A 4I5JA 4JWQA 3SJSA 1YTZC 2LVIA 1ZACA 2JXLA 1YVHA 3SG3A 2LHIA 1TRFA 2JC2A 3JVTB 3I5GC 3EKJA 3TS5B 1FI6A 1SPYA 1FBVA 3A4UB 2M1KB 2CT9A 2A4JA 4GGFA 2F3YA 4PE0A 4CIDA 1AVSA 1NX0A 2WCBA 2JT0A 2L50A 2MLFC 2JU0A 1OSAA 1S26D 3VRNA 3SG4A 2OS8C 1DJYA 2NLNA 1ZUZA 4I5KA 2EGDA 2EC6C 1YUTA 4GFTA 1XFXO 1OMDA 2KI6D 1R6PA 4YI8A 2KBIA 1XO5A 3LK1A 2JTTA 4P5OE 1M63B 1R2UA 3NXAA 3O2PA 1QX5B 5AERA 1A29A 1SYMA 2M7NA 2LVVA 1SRAA 1TNQA 1UP5A 3FS7A 1QLSA 1A75A 4ORBB 1AUIB 1EJ3A 4YBHB 1F70A 1TCOB 1YX7A 1ZOTB 5HLOA 1MR8A 2ZNDA 2H2KA 4MSPA 5AEQA 4AQJA 4OVNF 2ZKMX 2MRDA 1BU3A 4PE7A 2LUCA 2Y4QA 3VROA 3IQOA 2ZN8A 1XFZO 5CSNA 2KFGA 1KK7Y 1MXLC 1OZSA 1M46A 3GK2A 1YUSA 2M3WA 1NYAA 1UWOA 2JQ6A 5G08A 3TZ1A 1K2HA 3EKHA 2KYFA 1S36A 1QVIZ 3BOWA 2L51A 4YI9A 4PHJA 2BKHB 3WXAA 3GOFA 1MUXA 4HREE 1RTP1 4PHKA 2KAXA 4CPVA 2I2RE 1S3PA 1EG3A 5GQQC 1IH0A 4DIRA 4YGAA 2KI4C 4GUKA 3JTDC 1NUBA 3F45A 1RK9A 1MQ1A 3OP0A 1KQMB 2KFHA 4XYNA 2M7LA 3PSRA 2Q91A 2KAYA 2JULA 4ORCB 1QV1A 4YGBB 2BCBA 4IL1A 2LM5A 1CNPA 1AJ5A 4M2PA 3KHEA 1Y6WA 1N0YA 4MEWA 5ER4X 3C1VA 1DJIA 2EC6B 5PALA 1SNLA 1TN4A 3HCMA 1DT7B 1B1GA 1CB1A 1J7QA 1KK8C 1KFUS 3OX5A 4GPLB 4OV2A 4USLA 2KQYA 3M0WA 2JPTA 3OHMB 2LVJA 5DKRA 4HRGA 1NX3A 1K96A 2KYCA 5JOLA 2HQWA 1BG1A 1D1OA 1XFWO 1BMOA 3E3RA 1NCYA 1WY9A 1UHIA 3OB1B 1LKJA 3SG5A 4WQ2A 2BE6A 3CLNA 1B8CA 2PSRA 1QS7A 5AANA 1KCYA 1YR5A 2CCMA 3TDIA 3ZNIA 1PSRA 2R2IA 1DJHA 2KBMA 5DKQA 2B1UA 1B9AA 1CDPA 4PHNA 5HLVA 3SIBA 1IKUA 1BOCA 5I2LA 1B8LA 3GK4X 4NDBA 3RM1A 3VGOA 2GGZA 2K2AA 2Q4UA 3PALA 4PHMA 1SMGA 4WRIA 3I5HC 1OMVA 4YRUA 1H4BA 2E6WA 1DMOA 2ISDA 1DGVA 1ALVA 4AQIA 3LK0A 2ZN9A 2LNKA 1YRTB 3D0YB 5AXIA 4MZKA 5HKWA 4PDZA 1A75B 2KGBC 2Y1MA 4C0KA 3D0YA 2JOJA 2HETA 3I5IB 1MHOA 2F2PA 1KK7Z 1UHHA 4GGNA 1EXRA 2I18A 2OTGB 1NX1A 1SCMC 2KOTA 3PN7B 1AP4A 5KTYA 1KQVA 3CZTX 4QJ5B 1YX8A 1LVCD 4MN0A 1NPQA 2LMTA 3BUXB 5CPVA 1JC2A 1K94A 2NCPA 1DVIA 1CTRA 4PE1A 2K0JA 2M97A 1OQPA 1QIVA 3KO0A 1F4QA 1CMFA 3CS1A 1CDLA 1NIWA 2JZIA 3BQ3A 1TNPA 1CLLA 1TIZA 3O4YA 4N1FA 2MHHA 1AJ4A 2KNEA 2LANA 3BUNB 3DVJA 2CBLA 3D10A 2MJWB 4JQ0D 5ER5A 3BUWB 4A4CA 1XA5A 2L98A 1JFJA 1BF5A 4QJ4B 3WHTB 5HKZA 1PVAA 1K9KA 1IG5A 1PSBA 2FJUB 1NCZA 2K7BA 4HSZA 3SG7A 1SKTA 1XK4C 2NXQA 2VRGA 2WC8A 4NDDA 2KFFA 1GGWA 1F8HA 1B8RA 2PRUA 3NSIA 1A03A 3SIAA 4HRHA 1B7TZ 2LLTA 3BUOB 2LAPA 3AAJA 3GK1A 1SY9A 4F0ZB 3LLEA 3OX6A 2M1UA 3TUYB 1SL8A 2DOQA 1OMRA 4D1EA 4P2YB 1WDCC 1NP8A 3NSLA 1RECA 3BUMB 4I5LB 2M49B 3DF0A 4MBEA 5CSJA 2MAZA 4L9MA 3DVKA 1J7PA 2O60A 2BBNA 1W7JB 2OPOA 3DF0B 4MVFA 3VRPA 5FYXA 1JF2A 5F6TA 2LV7A 1BT6A 5J3XA 1CFDA 2FCEA 1XYDA 3LL8B 4MRXA 4ICBA 3AKAA 4ZCUA 5IBWA 1OOJA 1YRUB 3VRRA 2CXJA 5DKNA 1JWDA 1BJFA 1U5IA 4QJ3B 1CLMA 1LA0A 1SBJA 1J1EA 1LXFC 3TDZA 1XFUO 1WRZA 4BY4A 1N2DA 2SCPA 3SG2A 4Q04A 1JBAA 1JSAA 1DJXA 2LMUA 2CNPA 2QACA 1J7RA 1NSHA 2BKIB 1KFXL 1JUOA 1KWOB 2PASA 1TOPA 1Y1UA 2I7AA 2WCEA 2MBXA 1F55A 1G33A 4JPZB 1RJVA 2OTGC 1A2XA 4MRYA 4GAOA 3CR5X 4C0LA 1JFKA 3JTDB 1F71A 1TNXA 1KFUL 1MWNA 2NZ0A 3WHUB 5KU1A 1F4OA 4N5XA 4FQOA 1S6CA 1DGUA 1DF0B 3CTNA 4M2QA 4CLNA 1KK8B 1PK0D 1SW8A 2F33A 2K7OA 3TUYC 1DF0A 1CLBA 1V1FA 1Y1XA 1Y0VH 2JRFA 2KGRA 1X02A 2M29A 1WRLA 1B4CA 1FF1A 3OB2B 4FTGA 2KAVA 2OS8B 2KSPA 1YVLA 2KHNA 3EK8A 2WORA 1GQMA 1J55A 1WLZA 2LMVA 2WNDA 1YUUA 4MZLA 5BPJA 3ICBA 3MSEB 3CR2A 2WCFA 3FIAA 1CFPA 1M31A 3PFVA 2KI4B 3TS5C 2BCAA 1BLQA 3PM8A 4WQ3A 1IJ6A 1KFXS 1KWOC 5TNCA 2D8NA 3KEVA 2K2FA 1HT9A 1IWQA 2ZFDA 1IRJA 3I5FC 2BE4A 5HYDA 1TNWA 2L4HA 4PCWA 1GGZA 3EK7A 2WOSA 4NQGA 3VRQA 2H61C 1NCXA 1G8IA 1ZMZA 2M0RA 2G9BA 2LUXA 2LP3A 2JXCA 1TTXA 2KDHA 3CWGA 1M39A 2HQ8A 1RWYA 3CGAA 2O5GA 2BL0B 5I8NA 1G4YR 4YGCB 1Q80A 1FI5A 4I5NB 2M8UA 1L2OC 2LC5A 3AAKA 4ETOA 1QXPA 1ALWA 1WDCB 2ZRTA 1PULA 1B7TY 2BCXA 1BR1B 2NCOA 1DJZA 1QX2A 2K7CA 1F54A 1U5IB 1OE9B 3I5HB 4N1GA 2G2BA 2FCDA 3IF7A 1SL9A 3BXKA 2IS9A 1KSMA 2F3ZA 2JWWA 4UPGA 1HQVA 1S1EA 3K21A 2COLB 4TNCA 2L4IA 4AOMA 2M9GA 1GJYA 4GBAA 2F2OA 3DVMA 1C07A 2HF5A 3KPXA 1TCFA 1FW4A 2LCPA 2JNFA 3I5FB 3PLFB 2LE9B 2K7DA 1XK4A 3BYAA 4XJKB 2BECA 3A8RA 3CR4X 3O78A 4DUQA 1K93D 2L5XB 2LP2A 1EH2A 1IQ5A 1QTXA 1M45A 3I5GB 4XJKA 1L7ZA 1UHKA 2F8PA 3JVTC 4R1EA 1VRKA 4NDCA 3FWCA 1UURA 3AKBA 1V1GA 1LA3A 1J7OA 2I94A 3ZWHA 4CFRA 1MF8B 1QX7A 2E30A 2CTNA 2JT3A 2K61A
chains in the Genus database with same CATH superfamily
3WNXB 1RROA 2PMYA 3LCPC 5AFPA 5B8IB 3IQQA 1SCVA 3DVEA 1CM4A 2JT8A 2GGMA 1KSOA 1CFFA 5D7FA 1N65A 1OOHA 1MXEA 2K8MB 5CSIA 1K9PA 1DJGA 1QVIY 1RFJA 1J1DA 1QV0A 1WLMA 2RGIA 2TN4A 4KYNA 5I2OA 1S6JA 2FOTA 1CFCA 1KQMC 1Y1AA 1XFVO 2LVKA 4GNKB 1B47A 4C0JA 1LINA 1CM1A 1QATA 3PN7C 1QJTA 3I5IC 4OKHA 5D69A 1BODA 1SCMB 2KQ6A 4U8DA 3H4SE 3O6BA 4GGFC 4OCIA 2HPSA 2BL0C 3DD4A 2MLEC 2V53A 4FQTA 1CDNA 2MA2A 1OZOA 3TDUA 1CKKA 3EVVA 1S5GY 3Q8IA 1S5GZ 1PRWA 3SG6A 5I2QA 1ZFSA 3UNWA 5JJGA 1SL7A 1QLKA 3EVRA 4YGEB 1H8BA 2AUCA 1PVBA 3EK4A 3BOWB 1CMGA 1A4PA 3IVTA 1NWDA 2KI6C 1BR4B 1EL4A 4PE4A 1DJWA 1WRKA 1S6IA 2L0PA 2LLUA 4MLWA 4PT1A 2H61A 1YURA 1K9UA 1W7IB 4A4BA 4E68A 1SR6C 2GV5A 4DRWA 2EHBA 4CFQA 1IGVA 1OOFA 2AMIA 3FWBA 2L5YA 1XVJA 3PATA 2ZRSA 4MZJA 5CSFA 1NX2A 1DTLA 1L2OB 1QIWA 3KF9A 2L2CA 1OOIX 2SASA 1XFYO 2JNXA 1FPWA 5HKYA 4OR9B 3NSKA 5KSZA 4PALA 3OGNA 4BY5A 1C3YA 1ODBA 1E8AA 2P6BB 4DCKA 2QPTA 3QMEA 3QRXA 1CDMA 1PALA 1SR6B 3BFBA 2Y5IA 1SK6D 4YGDB 2L2EA 1IJ5A 2AAOA 1UHJA 2PALA 3N7HA 3R1PA 1AHRA 3NSOA 2LHLA 3UO9A 3O4XA 3RLZA 1UUSA 1UHNA 2JTZA 1EG4A 1K8UA 4M2OA 4DS7A 3B6XA 2BBMA 1C7VA 1JF0A 3EVUA 4ZCVA 1QASA 3D76A 1AK8A 3CZ2A 1K2HA 1IQ3A 4ORAB 1K90D 5K89A 2PVBA 1K95A 2LLSA 2ZNEA 1C7WA 2Y1NA 3HX4A 3R72A 4I5JA 3D74A 4JWQA 1YTZC 3SJSA 2LVIA 1ZACA 2JXLA 5FI2A 5BPJA 1YVHA 3SG3A 2LHIA 1TRFA 2JC2A 3B86A 3JVTB 3D75A 3I5GC 3EKJA 3TS5B 1FI6A 1SPYA 1FBVA 3A4UB 2M1KB 2CT9A 2A4JA 4GGFA 3VB1A 2F3YA 4PE0A 4CIDA 1AVSA 1NX0A 2WCBA 2JT0A 2L50A 2MLFC 2JU0A 1OSAA 3FE8A 1S26D 3VRNA 3SG4A 2OS8C 1DJYA 2NLNA 1ZUZA 4I5KA 2EGDA 2EC6C 1YUTA 5FI7A 4GFTA 1XFXO 1OMDA 2KI6D 1R6PA 4YI8A 2KBIA 1XO5A 3LK1A 2JTTA 4P5OE 1M63B 1R2UA 3NXAA 3O2PA 1DC1A 1QX5B 5AERA 1A29A 1SYMA 2M7NA 2LVVA 1SRAA 2QEOA 2P71A 1TNQA 1UP5A 3FS7A 1QLSA 1A75A 4ORBB 1AUIB 1EJ3A 4YBHB 1T14A 3V2LA 1F70A 1TCOB 1YX7A 1ZOTB 5HLOA 1MR8A 2ZNDA 2H2KA 4MSPA 5AEQA 4AQJA 4OVNF 3L47A 2ZKMX 2MRDA 1BU3A 4PE7A 2LUCA 2Y4QA 3VROA 3IQOA 2ZN8A 1XFZO 5CSNA 2KFGA 1KK7Y 1MXLC 1OZSA 1M46A 3GK2A 1YUSA 2M3WA 1NYAA 1UWOA 2JQ6A 2WC5A 5G08A 3TZ1A 1P28A 2KYFA 3EKHA 1S36A 1QVIZ 3BOWA 2L51A 3PM2A 4YI9A 4PHJA 2YGUA 2BKHB 3WXAA 3GOFA 1MUXA 4HREE 1RTP1 4PHKA 2KAXA 4CPVA 2I2RE 1S3PA 1EG3A 5GQQC 3B7AA 1IH0A 4INXA 4DIRA 2WCKA 4YGAA 2KI4C 4GUKA 3JTDC 1NUBA 3F45A 1RK9A 1MQ1A 3NHIA 1KQMB 2KFHA 3OP0A 4XYNA 2M7LA 3PSRA 2Q91A 2KAYA 2JULA 4ORCB 1QV1A 4YGBB 2BCBA 4IL1A 2LM5A 1CNPA 1AJ5A 4M2PA 3KHEA 1Y6WA 1IIOA 1N0YA 4MEWA 5ER4X 3C1VA 1DJIA 2EC6B 5PALA 1SNLA 2BNXA 1TN4A 3HCMA 1DT7B 1B1GA 1CB1A 2QEVA 4OZDA 1KK8C 1KFUS 3OX5A 4GPLB 4OV2A 4USLA 1J7QA 2KQYA 3M0WA 2JPTA 3OHMB 1OOGA 2LVJA 5DKRA 4HRGA 1NX3A 1K96A 2KYCA 5JOLA 2HQWA 1BG1A 1D1OA 1XFWO 1BMOA 3E3RA 1GM0A 3NGVA 1NCYA 1WY9A 1UHIA 3OB1B 1LKJA 3SG5A 4WQ2A 2BE6A 3CLNA 1B8CA 2PSRA 1OW4A 1QS7A 5AANA 1KCYA 1YR5A 1TWOA 2CCMA 3TDIA 3ZNIA 1PSRA 2R2IA 1DJHA 2KBMA 2QEBA 5DKQA 1Z2CB 2B1UA 1B9AA 1CDPA 4PHNA 5HLVA 3SIBA 2P70A 1IKUA 3K1EA 1BOCA 2GTEA 5I2LA 1B8LA 3FE9A 3GK4X 4NDBA 3RM1A 5FI6A 2K60A 1DEKA 2GGZA 2K2AA 2Q4UA 3PALA 1SMGA 4PHMA 4WRIA 3VGOA 3I5HC 1OMVA 4YRUA 1H4BA 2E6WA 2KLDA 1DMOA 2ISDA 2JPOA 5D3OA 1DGVA 1ALVA 4AQIA 3LK0A 2ZN9A 2LNKA 1YRTB 3D0YB 5AXIA 3R1VA 4MZKA 5HKWA 4PDZA 1A75B 2KGBC 5HL1A 2Y1MA 4C0KA 3D0YA 2JOJA 2HETA 3I5IB 1MHOA 2F2PA 1QWVA 1KK7Z 1UHHA 4GGNA 1EXRA 2I18A 2WCJA 2OTGB 1NX1A 1SCMC 2KOTA 3PN7B 1AP4A 1SSEB 2ERBA 5KTYA 1KQVA 3CZTX 4QJ5B 3PJIA 1YX8A 1LVCD 4MN0A 1NPQA 2LMTA 3BUXB 5CPVA 1JC2A 1K94A 2NCPA 1DVIA 1CTRA 3BJHA 4PE1A 2K0JA 2M97A 1C3ZA 1OQPA 1QIVA 3KO0A 1F4QA 3CDNA 3CS1A 1CMFA 1CDLA 1NIWA 2JZIA 3BQ3A 1TNPA 1CLLA 1TIZA 3L4LA 3O4YA 4N1FA 2MHHA 1AJ4A 2KNEA 2LANA 3BUNB 3DVJA 2CBLA 3NHTA 3D10A 1Z4HA 2MJWB 4JQ0D 5ER5A 3BUWB 4A4CA 1XA5A 2L98A 1JFJA 1BF5A 4QJ4B 3WHTB 5HKZA 1PVAA 1K9KA 3CYZA 1IG5A 1PSBA 2FJUB 1NCZA 2K7BA 4HSZA 3SG7A 1SKTA 1XK4C 2NXQA 2VRGA 2WC8A 4NDDA 2KFFA 1GGWA 1F8HA 1B8RA 2PRUA 3NSIA 1A03A 3SIAA 4HRHA 1B7TZ 2LLTA 3BUOB 2LAPA 3AAJA 3GK1A 1SY9A 4F0ZB 3SS5A 3LLEA 3OX6A 2M1UA 3TUYB 1SL8A 2H8VA 2DOQA 1OMRA 4D1EA 4P2YB 1WDCC 1NP8A 3NSLA 1RECA 3BUMB 4I5LB 2M49B 3DF0A 4MBEA 5CSJA 4IJ7A 2MAZA 4L9MA 3DVKA 1J7PA 2O60A 2BBNA 1W7JB 1DELA 2OPOA 3DF0B 4MVFA 3VRPA 5FYXA 1JF2A 5F6TA 2LV7A 1BT6A 5J3XA 1CFDA 2FCEA 3CZ1A 1XYDA 3LL8B 4MRXA 4ICBA 3AKAA 4ZCUA 5IBWA 1OOJA 1YRUB 3DZTA 3VRRA 2CXJA 5DKNA 1JWDA 1BJFA 1U5IA 4QJ3B 1CLMA 1LA0A 1SBJA 1J1EA 1LXFC 3TDZA 1XFUO 1WRZA 4BY4A 1N2DA 2SCPA 3SG2A 4Q04A 1JBAA 3SS3A 1JSAA 1DJXA 1W9ZA 2LMUA 3L4AA 2CNPA 2QACA 1J7RA 1NSHA 4JD9A 2BKIB 1KFXL 1JUOA 2FJYA 1KWOB 3B87A 2PASA 1TOPA 1Y1UA 2I7AA 2WCEA 3S0BA 2MBXA 1F55A 1G33A 4JPZB 1RJVA 2OTGC 1A2XA 3DYEA 4MRYA 3EG5B 4GAOA 3CR5X 4C0LA 1JFKA 3JTDB 1F71A 1TNXA 1KFUL 3SS4A 1MWNA 2NZ0A 2WC6A 2QDIA 1LS8A 1TUZA 3WHUB 5KU1A 1F4OA 4N5XA 4FQOA 1S6CA 1DGUA 1DF0B 3CTNA 4M2QA 4CLNA 1KK8B 1PK0D 1SW8A 2F33A 2K7OA 3TUYC 1DF0A 1CLBA 1V1FA 1Y1XA 3OBVA 1Y0VH 2JRFA 2KGRA 1X02A 2M29A 1WRLA 1B4CA 1FF1A 3OB2B 4FTGA 2KAVA 2OS8B 3S0GA 2KSPA 1YVLA 2KHNA 3DY9A 3EK8A 2WORA 1GQMA 3S0EA 1J55A 1WLZA 2LMVA 2WNDA 1YUUA 3DXLA 4MZLA 3ICBA 3MSEB 3CR2A 2WCFA 3FIAA 3S0DA 1CFPA 1M31A 3PFVA 2KI4B 3TS5C 2BCAA 1BLQA 3PM8A 4WQ3A 1IJ6A 1KFXS 2KPHA 1KWOC 3D73A 5TNCA 3CZ0A 2D8NA 3KEVA 2K2FA 1HT9A 1IWQA 2ZFDA 1IRJA 3I5FC 2BE4A 2QEHA 5HYDA 1TNWA 3D78A 2KLEA 2L4HA 4PCWA 1GGZA 3EK7A 2WOSA 4NQGA 5DICA 3VRQA 3BFHA 2H61C 1NCXA 1G8IA 1ZMZA 3B88A 1DQEA 2M0RA 2G9BA 2LUXA 2LP3A 2JXCA 1TTXA 2KDHA 2WCMA 3CWGA 1M39A 2HQ8A 3S0AA 1RWYA 3CGAA 2PQLA 3S0FA 2O5GA 2BL0B 5I8NA 1G4YR 4YGCB 1ORGA 1Q80A 1FI5A 4I5NB 2M8UA 1L2OC 2LC5A 3FE6A 3AAKA 4ETOA 1QXPA 1ALWA 1WDCB 2ZRTA 4JKTA 1PULA 1B7TY 2BCXA 1BR1B 2NCOA 1DJZA 1QX2A 2K7CA 1F54A 1U5IB 1OE9B 3I5HB 4N1GA 2G2BA 2FCDA 3IF7A 1SL9A 3BXKA 2IS9A 1KSMA 2F3ZA 4INWA 2JWWA 4UPGA 2BAPA 1HQVA 1S1EA 3K21A 2COLB 4TNCA 2L4IA 4AOMA 2M9GA 1GJYA 4GBAA 2F2OA 3DVMA 1C07A 2HF5A 2PYQA 3KPXA 1TCFA 3D77A 1FW4A 2LCPA 2JNFA 3I5FB 3PLFB 2LE9B 2K7DA 1XK4A 3BYAA 4XJKB 1TUJA 2BECA 3A8RA 2WCHA 3CR4X 3CABA 3O78A 1K93D 4DUQA 2L5XB 2LP2A 4F7FA 1IQ5A 3RZSA 1EH2A 1QTXA 1M45A 3I5GB 4XJKA 1L7ZA 1UHKA 2F8PA 3JVTC 4R1EA 1VRKA 4NDCA 3FWCA 1UURA 1XFRA 3AKBA 1V1GA 1LA3A 3R1OA 3BFAA 2I94A 2WCLA 1J7OA 3ZWHA 4CFRA 1MF8B 5EL2A 1QX7A 5I94A 2E30A 2CTNA 2JT3A 2K61A
chains in the Genus database with same CATH topology
3WNXB 1RROA 2PMYA 3LCPC 5AFPA 5B8IB 3IQQA 1SCVA 3DVEA 1CM4A 2JT8A 2GGMA 1KSOA 1CFFA 5D7FA 1N65A 1MXEA 2K8MB 5CSIA 1K9PA 1DJGA 1QVIY 1RFJA 1J1DA 1QV0A 1WLMA 2RGIA 2TN4A 5I2OA 1CFCA 1S6JA 2FOTA 1KQMC 1Y1AA 1XFVO 2LVKA 4GNKB 1B47A 4C0JA 1LINA 1CM1A 1QATA 3PN7C 1QJTA 3I5IC 4OKHA 5D69A 1BODA 1SCMB 2KQ6A 4U8DA 3H4SE 3O6BA 4GGFC 4OCIA 2HPSA 2BL0C 3DD4A 2MLEC 2V53A 1CDNA 2MA2A 1OZOA 3TDUA 1CKKA 3EVVA 1S5GY 1S5GZ 1PRWA 3SG6A 5I2QA 1ZFSA 5JJGA 1SL7A 1QLKA 3EVRA 4YGEB 1H8BA 2AUCA 1PVBA 3EK4A 3BOWB 1CMGA 1A4PA 1NWDA 2KI6C 1BR4B 1EL4A 4PE4A 1DJWA 1WRKA 1S6IA 2L0PA 2LLUA 4MLWA 2H61A 1YURA 1K9UA 1W7IB 4A4BA 4E68A 1SR6C 2GV5A 4DRWA 2EHBA 4CFQA 1IGVA 2AMIA 3FWBA 3PATA 4MZJA 1XVJA 2ZRSA 5CSFA 1NX2A 1DTLA 1L2OB 1QIWA 3KF9A 2SASA 1XFYO 2JNXA 1FPWA 5HKYA 4OR9B 3NSKA 5KSZA 4PALA 4BY5A 1ODBA 1E8AA 2P6BB 4DCKA 2QPTA 3QRXA 1CDMA 1PALA 1SR6B 2Y5IA 1SK6D 4YGDB 2L2EA 1IJ5A 2AAOA 1UHJA 2PALA 1AHRA 3NSOA 2LHLA 3RLZA 1UUSA 1UHNA 2JTZA 1EG4A 1K8UA 4M2OA 4DS7A 2BBMA 1C7VA 1JF0A 3EVUA 4ZCVA 1QASA 1AK8A 1IQ3A 4ORAB 1K90D 5K89A 2PVBA 1K95A 2LLSA 2ZNEA 1C7WA 2Y1NA 3HX4A 4I5JA 4JWQA 3SJSA 1YTZC 2LVIA 1ZACA 2JXLA 1YVHA 3SG3A 2LHIA 1TRFA 2JC2A 3JVTB 3I5GC 3EKJA 3TS5B 1FI6A 1SPYA 1FBVA 3A4UB 2M1KB 2CT9A 2A4JA 4GGFA 2F3YA 4PE0A 4CIDA 1AVSA 1NX0A 2WCBA 2JT0A 2L50A 2MLFC 2JU0A 1OSAA 1S26D 3VRNA 3SG4A 2OS8C 1DJYA 2NLNA 1ZUZA 4I5KA 2EGDA 2EC6C 1YUTA 4GFTA 1XFXO 1OMDA 2KI6D 1R6PA 4YI8A 2KBIA 1XO5A 3LK1A 2JTTA 4P5OE 1M63B 1R2UA 3NXAA 3O2PA 1QX5B 5AERA 1A29A 1SYMA 2M7NA 2LVVA 1SRAA 1TNQA 1UP5A 3FS7A 1QLSA 1A75A 4ORBB 1AUIB 1EJ3A 4YBHB 1F70A 1TCOB 1YX7A 1ZOTB 5HLOA 1MR8A 2ZNDA 2H2KA 4MSPA 5AEQA 4AQJA 4OVNF 2ZKMX 2MRDA 1BU3A 4PE7A 2LUCA 2Y4QA 3VROA 3IQOA 2ZN8A 1XFZO 5CSNA 2KFGA 1KK7Y 1MXLC 1OZSA 1M46A 3GK2A 1YUSA 2M3WA 1NYAA 1UWOA 2JQ6A 5G08A 3TZ1A 1K2HA 3EKHA 2KYFA 1S36A 1QVIZ 3BOWA 2L51A 4YI9A 4PHJA 2BKHB 3WXAA 3GOFA 1MUXA 4HREE 1RTP1 4PHKA 2KAXA 4CPVA 2I2RE 1S3PA 1EG3A 5GQQC 1IH0A 4DIRA 4YGAA 2KI4C 4GUKA 3JTDC 1NUBA 3F45A 1RK9A 1MQ1A 3OP0A 1KQMB 2KFHA 4XYNA 2M7LA 3PSRA 2Q91A 2KAYA 2JULA 4ORCB 1QV1A 4YGBB 2BCBA 4IL1A 2LM5A 1CNPA 1AJ5A 4M2PA 3KHEA 1Y6WA 1N0YA 4MEWA 5ER4X 3C1VA 1DJIA 2EC6B 5PALA 1SNLA 1TN4A 3HCMA 1DT7B 1B1GA 1CB1A 1J7QA 1KK8C 1KFUS 3OX5A 4GPLB 4OV2A 4USLA 2KQYA 3M0WA 2JPTA 3OHMB 2LVJA 5DKRA 4HRGA 1NX3A 1K96A 2KYCA 5JOLA 2HQWA 1BG1A 1D1OA 1XFWO 1BMOA 3E3RA 1NCYA 1WY9A 1UHIA 3OB1B 1LKJA 3SG5A 4WQ2A 2BE6A 3CLNA 1B8CA 2PSRA 1QS7A 5AANA 1KCYA 1YR5A 2CCMA 3TDIA 3ZNIA 1PSRA 2R2IA 1DJHA 2KBMA 5DKQA 2B1UA 1B9AA 1CDPA 4PHNA 5HLVA 3SIBA 1IKUA 1BOCA 5I2LA 1B8LA 3GK4X 4NDBA 3RM1A 3VGOA 2GGZA 2K2AA 2Q4UA 3PALA 4PHMA 1SMGA 4WRIA 3I5HC 1OMVA 4YRUA 1H4BA 2E6WA 1DMOA 2ISDA 1DGVA 1ALVA 4AQIA 3LK0A 2ZN9A 2LNKA 1YRTB 3D0YB 5AXIA 4MZKA 5HKWA 4PDZA 1A75B 2KGBC 2Y1MA 4C0KA 3D0YA 2JOJA 2HETA 3I5IB 1MHOA 2F2PA 1KK7Z 1UHHA 4GGNA 1EXRA 2I18A 2OTGB 1NX1A 1SCMC 2KOTA 3PN7B 1AP4A 5KTYA 1KQVA 3CZTX 4QJ5B 1YX8A 1LVCD 4MN0A 1NPQA 2LMTA 3BUXB 5CPVA 1JC2A 1K94A 2NCPA 1DVIA 1CTRA 4PE1A 2K0JA 2M97A 1OQPA 1QIVA 3KO0A 1F4QA 1CMFA 3CS1A 1CDLA 1NIWA 2JZIA 3BQ3A 1TNPA 1CLLA 1TIZA 3O4YA 4N1FA 2MHHA 1AJ4A 2KNEA 2LANA 3BUNB 3DVJA 2CBLA 3D10A 2MJWB 4JQ0D 5ER5A 3BUWB 4A4CA 1XA5A 2L98A 1JFJA 1BF5A 4QJ4B 3WHTB 5HKZA 1PVAA 1K9KA 1IG5A 1PSBA 2FJUB 1NCZA 2K7BA 4HSZA 3SG7A 1SKTA 1XK4C 2NXQA 2VRGA 2WC8A 4NDDA 2KFFA 1GGWA 1F8HA 1B8RA 2PRUA 3NSIA 1A03A 3SIAA 4HRHA 1B7TZ 2LLTA 3BUOB 2LAPA 3AAJA 3GK1A 1SY9A 4F0ZB 3LLEA 3OX6A 2M1UA 3TUYB 1SL8A 2DOQA 1OMRA 4D1EA 4P2YB 1WDCC 1NP8A 3NSLA 1RECA 3BUMB 4I5LB 2M49B 3DF0A 4MBEA 5CSJA 2MAZA 4L9MA 3DVKA 1J7PA 2O60A 2BBNA 1W7JB 2OPOA 3DF0B 4MVFA 3VRPA 5FYXA 1JF2A 5F6TA 2LV7A 1BT6A 5J3XA 1CFDA 2FCEA 1XYDA 3LL8B 4MRXA 4ICBA 3AKAA 4ZCUA 5IBWA 1OOJA 1YRUB 3VRRA 2CXJA 5DKNA 1JWDA 1BJFA 1U5IA 4QJ3B 1CLMA 1LA0A 1SBJA 1J1EA 1LXFC 3TDZA 1XFUO 1WRZA 4BY4A 1N2DA 2SCPA 3SG2A 4Q04A 1JBAA 1JSAA 1DJXA 2LMUA 2CNPA 2QACA 1J7RA 1NSHA 2BKIB 1KFXL 1JUOA 1KWOB 2PASA 1TOPA 1Y1UA 2I7AA 2WCEA 2MBXA 1F55A 1G33A 4JPZB 1RJVA 2OTGC 1A2XA 4MRYA 4GAOA 3CR5X 4C0LA 1JFKA 3JTDB 1F71A 1TNXA 1KFUL 1MWNA 2NZ0A 3WHUB 5KU1A 1F4OA 4N5XA 4FQOA 1S6CA 1DGUA 1DF0B 3CTNA 4M2QA 4CLNA 1KK8B 1PK0D 1SW8A 2F33A 2K7OA 3TUYC 1DF0A 1CLBA 1V1FA 1Y1XA 1Y0VH 2JRFA 2KGRA 1X02A 2M29A 1WRLA 1B4CA 1FF1A 3OB2B 4FTGA 2KAVA 2OS8B 2KSPA 1YVLA 2KHNA 3EK8A 2WORA 1GQMA 1J55A 1WLZA 2LMVA 2WNDA 1YUUA 4MZLA 5BPJA 3ICBA 3MSEB 3CR2A 2WCFA 3FIAA 1CFPA 1M31A 3PFVA 2KI4B 3TS5C 2BCAA 1BLQA 3PM8A 4WQ3A 1IJ6A 1KFXS 1KWOC 5TNCA 2D8NA 3KEVA 2K2FA 1HT9A 1IWQA 2ZFDA 1IRJA 3I5FC 2BE4A 5HYDA 1TNWA 2L4HA 4PCWA 1GGZA 3EK7A 2WOSA 4NQGA 3VRQA 2H61C 1NCXA 1G8IA 1ZMZA 2M0RA 2G9BA 2LUXA 2LP3A 2JXCA 1TTXA 2KDHA 3CWGA 1M39A 2HQ8A 1RWYA 3CGAA 2O5GA 2BL0B 5I8NA 1G4YR 4YGCB 1Q80A 1FI5A 4I5NB 2M8UA 1L2OC 2LC5A 3AAKA 4ETOA 1QXPA 1ALWA 1WDCB 2ZRTA 1PULA 1B7TY 2BCXA 1BR1B 2NCOA 1DJZA 1QX2A 2K7CA 1F54A 1U5IB 1OE9B 3I5HB 4N1GA 2G2BA 2FCDA 3IF7A 1SL9A 3BXKA 2IS9A 1KSMA 2F3ZA 2JWWA 4UPGA 1HQVA 1S1EA 3K21A 2COLB 4TNCA 2L4IA 4AOMA 2M9GA 1GJYA 4GBAA 2F2OA 3DVMA 1C07A 2HF5A 3KPXA 1TCFA 1FW4A 2LCPA 2JNFA 3I5FB 3PLFB 2LE9B 2K7DA 1XK4A 3BYAA 4XJKB 2BECA 3A8RA 3CR4X 3O78A 4DUQA 1K93D 2L5XB 2LP2A 1EH2A 1IQ5A 1QTXA 1M45A 3I5GB 4XJKA 1L7ZA 1UHKA 2F8PA 3JVTC 4R1EA 1VRKA 4NDCA 3FWCA 1UURA 3AKBA 1V1GA 1LA3A 1J7OA 2I94A 3ZWHA 4CFRA 1MF8B 1QX7A 2E30A 2CTNA 2JT3A 2K61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WNX B;  1RRO A;  2PMY A;  3LCP C;  5AFP A;  5B8I B;  3IQQ A;  1SCV A;  3DVE A;  1CM4 A;  2JT8 A;  2GGM A;  1KSO A;  1CFF A;  5D7F A;  1N65 A;  1MXE A;  2K8M B;  5CSI A;  1K9P A;  1DJG A;  1QVI Y;  1RFJ A;  1J1D A;  1QV0 A;  1WLM A;  2RGI A;  2TN4 A;  5I2O A;  1CFC A;  1S6J A;  2FOT A;  1KQM C;  1Y1A A;  1XFV O;  2LVK A;  4GNK B;  1B47 A;  4C0J A;  1LIN A;  1CM1 A;  1QAT A;  3PN7 C;  1QJT A;  3I5I C;  4OKH A;  5D69 A;  1BOD A;  1SCM B;  2KQ6 A;  4U8D A;  3H4S E;  3O6B A;  4GGF C;  4OCI A;  2HPS A;  2BL0 C;  3DD4 A;  2MLE C;  2V53 A;  1CDN A;  2MA2 A;  1OZO A;  3TDU A;  1CKK A;  3EVV A;  1S5G Y;  1S5G Z;  1PRW A;  3SG6 A;  5I2Q A;  1ZFS A;  5JJG A;  1SL7 A;  1QLK A;  3EVR A;  4YGE B;  1H8B A;  2AUC A;  1PVB A;  3EK4 A;  3BOW B;  1CMG A;  1A4P A;  1NWD A;  2KI6 C;  1BR4 B;  1EL4 A;  4PE4 A;  1DJW A;  1WRK A;  1S6I A;  2L0P A;  2LLU A;  4MLW A;  2H61 A;  1YUR A;  1K9U A;  1W7I B;  4A4B A;  4E68 A;  1SR6 C;  2GV5 A;  4DRW A;  2EHB A;  4CFQ A;  1IGV A;  2AMI A;  3FWB A;  3PAT A;  4MZJ A;  1XVJ A;  2ZRS A;  5CSF A;  1NX2 A;  1DTL A;  1L2O B;  1QIW A;  3KF9 A;  2SAS A;  1XFY O;  2JNX A;  1FPW A;  5HKY A;  4OR9 B;  3NSK A;  5KSZ A;  4PAL A;  4BY5 A;  1ODB A;  1E8A A;  2P6B B;  4DCK A;  2QPT A;  3QRX A;  1CDM A;  1PAL A;  1SR6 B;  2Y5I A;  1SK6 D;  4YGD B;  2L2E A;  1IJ5 A;  2AAO A;  1UHJ A;  2PAL A;  1AHR A;  3NSO A;  2LHL A;  3RLZ A;  1UUS A;  1UHN A;  2JTZ A;  1EG4 A;  1K8U A;  4M2O A;  4DS7 A;  2BBM A;  1C7V A;  1JF0 A;  3EVU A;  4ZCV A;  1QAS A;  1AK8 A;  1IQ3 A;  4ORA B;  1K90 D;  5K89 A;  2PVB A;  1K95 A;  2LLS A;  2ZNE A;  1C7W A;  2Y1N A;  3HX4 A;  4I5J A;  4JWQ A;  3SJS A;  1YTZ C;  2LVI A;  1ZAC A;  2JXL A;  1YVH A;  3SG3 A;  2LHI A;  1TRF A;  2JC2 A;  3JVT B;  3I5G C;  3EKJ A;  3TS5 B;  1FI6 A;  1SPY A;  1FBV A;  3A4U B;  2M1K B;  2CT9 A;  2A4J A;  4GGF A;  2F3Y A;  4PE0 A;  4CID A;  1AVS A;  1NX0 A;  2WCB A;  2JT0 A;  2L50 A;  2MLF C;  2JU0 A;  1OSA A;  1S26 D;  3VRN A;  3SG4 A;  2OS8 C;  1DJY A;  2NLN A;  1ZUZ A;  4I5K A;  2EGD A;  2EC6 C;  1YUT A;  4GFT A;  1XFX O;  1OMD A;  2KI6 D;  1R6P A;  4YI8 A;  2KBI A;  1XO5 A;  3LK1 A;  2JTT A;  4P5O E;  1M63 B;  1R2U A;  3NXA A;  3O2P A;  1QX5 B;  5AER A;  1A29 A;  1SYM A;  2M7N A;  2LVV A;  1SRA A;  1TNQ A;  1UP5 A;  3FS7 A;  1QLS A;  1A75 A;  4ORB B;  1AUI B;  1EJ3 A;  4YBH B;  1F70 A;  1TCO B;  1YX7 A;  1ZOT B;  5HLO A;  1MR8 A;  2ZND A;  2H2K A;  4MSP A;  5AEQ A;  4AQJ A;  4OVN F;  2ZKM X;  2MRD A;  1BU3 A;  4PE7 A;  2LUC A;  2Y4Q A;  3VRO A;  3IQO A;  2ZN8 A;  1XFZ O;  5CSN A;  2KFG A;  1KK7 Y;  1MXL C;  1OZS A;  1M46 A;  3GK2 A;  1YUS A;  2M3W A;  1NYA A;  1UWO A;  2JQ6 A;  5G08 A;  3TZ1 A;  1K2H A;  3EKH A;  2KYF A;  1S36 A;  1QVI Z;  3BOW A;  2L51 A;  4YI9 A;  4PHJ A;  2BKH B;  3WXA A;  3GOF A;  1MUX A;  4HRE E;  1RTP 1;  4PHK A;  2KAX A;  4CPV A;  2I2R E;  1S3P A;  1EG3 A;  5GQQ C;  1IH0 A;  4DIR A;  4YGA A;  2KI4 C;  4GUK A;  3JTD C;  1NUB A;  3F45 A;  1RK9 A;  1MQ1 A;  3OP0 A;  1KQM B;  2KFH A;  4XYN A;  2M7L A;  3PSR A;  2Q91 A;  2KAY A;  2JUL A;  4ORC B;  1QV1 A;  4YGB B;  2BCB A;  4IL1 A;  2LM5 A;  1CNP A;  1AJ5 A;  4M2P A;  3KHE A;  1Y6W A;  1N0Y A;  4MEW A;  5ER4 X;  3C1V A;  1DJI A;  2EC6 B;  5PAL A;  1SNL A;  1TN4 A;  3HCM A;  1DT7 B;  1B1G A;  1CB1 A;  1J7Q A;  1KK8 C;  1KFU S;  3OX5 A;  4GPL B;  4OV2 A;  4USL A;  2KQY A;  3M0W A;  2JPT A;  3OHM B;  2LVJ A;  5DKR A;  4HRG A;  1NX3 A;  1K96 A;  2KYC A;  5JOL A;  2HQW A;  1BG1 A;  1D1O A;  1XFW O;  1BMO A;  3E3R A;  1NCY A;  1WY9 A;  1UHI A;  3OB1 B;  1LKJ A;  3SG5 A;  4WQ2 A;  2BE6 A;  3CLN A;  1B8C A;  2PSR A;  1QS7 A;  5AAN A;  1KCY A;  1YR5 A;  2CCM A;  3TDI A;  3ZNI A;  1PSR A;  2R2I A;  1DJH A;  2KBM A;  5DKQ A;  2B1U A;  1B9A A;  1CDP A;  4PHN A;  5HLV A;  3SIB A;  1IKU A;  1BOC A;  5I2L A;  1B8L A;  3GK4 X;  4NDB A;  3RM1 A;  3VGO A;  2GGZ A;  2K2A A;  2Q4U A;  3PAL A;  4PHM A;  1SMG A;  4WRI A;  3I5H C;  1OMV A;  4YRU A;  1H4B A;  2E6W A;  1DMO A;  2ISD A;  1DGV A;  1ALV A;  4AQI A;  3LK0 A;  2ZN9 A;  2LNK A;  1YRT B;  3D0Y B;  5AXI A;  4MZK A;  5HKW A;  4PDZ A;  1A75 B;  2KGB C;  2Y1M A;  4C0K A;  3D0Y A;  2JOJ A;  2HET A;  3I5I B;  1MHO A;  2F2P A;  1KK7 Z;  1UHH A;  4GGN A;  1EXR A;  2I18 A;  2OTG B;  1NX1 A;  1SCM C;  2KOT A;  3PN7 B;  1AP4 A;  5KTY A;  1KQV A;  3CZT X;  4QJ5 B;  1YX8 A;  1LVC D;  4MN0 A;  1NPQ A;  2LMT A;  3BUX B;  5CPV A;  1JC2 A;  1K94 A;  2NCP A;  1DVI A;  1CTR A;  4PE1 A;  2K0J A;  2M97 A;  1OQP A;  1QIV A;  3KO0 A;  1F4Q A;  1CMF A;  3CS1 A;  1CDL A;  1NIW A;  2JZI A;  3BQ3 A;  1TNP A;  1CLL A;  1TIZ A;  3O4Y A;  4N1F A;  2MHH A;  1AJ4 A;  2KNE A;  2LAN A;  3BUN B;  3DVJ A;  2CBL A;  3D10 A;  2MJW B;  4JQ0 D;  5ER5 A;  3BUW B;  4A4C A;  1XA5 A;  2L98 A;  1JFJ A;  1BF5 A;  4QJ4 B;  3WHT B;  5HKZ A;  1PVA A;  1K9K A;  1IG5 A;  1PSB A;  2FJU B;  1NCZ A;  2K7B A;  4HSZ A;  3SG7 A;  1SKT A;  1XK4 C;  2NXQ A;  2VRG A;  2WC8 A;  4NDD A;  2KFF A;  1GGW A;  1F8H A;  1B8R A;  2PRU A;  3NSI A;  1A03 A;  3SIA A;  4HRH A;  1B7T Z;  2LLT A;  3BUO B;  2LAP A;  3AAJ A;  3GK1 A;  1SY9 A;  4F0Z B;  3LLE A;  3OX6 A;  2M1U A;  3TUY B;  1SL8 A;  2DOQ A;  1OMR A;  4D1E A;  4P2Y B;  1WDC C;  1NP8 A;  3NSL A;  1REC A;  3BUM B;  4I5L B;  2M49 B;  3DF0 A;  4MBE A;  5CSJ A;  2MAZ A;  4L9M A;  3DVK A;  1J7P A;  2O60 A;  2BBN A;  1W7J B;  2OPO A;  3DF0 B;  4MVF A;  3VRP A;  5FYX A;  1JF2 A;  5F6T A;  2LV7 A;  1BT6 A;  5J3X A;  1CFD A;  2FCE A;  1XYD A;  3LL8 B;  4MRX A;  4ICB A;  3AKA A;  4ZCU A;  5IBW A;  1OOJ A;  1YRU B;  3VRR A;  2CXJ A;  5DKN A;  1JWD A;  1BJF A;  1U5I A;  4QJ3 B;  1CLM A;  1LA0 A;  1SBJ A;  1J1E A;  1LXF C;  3TDZ A;  1XFU O;  1WRZ A;  4BY4 A;  1N2D A;  2SCP A;  3SG2 A;  4Q04 A;  1JBA A;  1JSA A;  1DJX A;  2LMU A;  2CNP A;  2QAC A;  1J7R A;  1NSH A;  2BKI B;  1KFX L;  1JUO A;  1KWO B;  2PAS A;  1TOP A;  1Y1U A;  2I7A A;  2WCE A;  2MBX A;  1F55 A;  1G33 A;  4JPZ B;  1RJV A;  2OTG C;  1A2X A;  4MRY A;  4GAO A;  3CR5 X;  4C0L A;  1JFK A;  3JTD B;  1F71 A;  1TNX A;  1KFU L;  1MWN A;  2NZ0 A;  3WHU B;  5KU1 A;  1F4O A;  4N5X A;  4FQO A;  1S6C A;  1DGU A;  1DF0 B;  3CTN A;  4M2Q A;  4CLN A;  1KK8 B;  1PK0 D;  1SW8 A;  2F33 A;  2K7O A;  3TUY C;  1DF0 A;  1CLB A;  1V1F A;  1Y1X A;  1Y0V H;  2JRF A;  2KGR A;  1X02 A;  2M29 A;  1WRL A;  1B4C A;  1FF1 A;  3OB2 B;  4FTG A;  2KAV A;  2OS8 B;  2KSP A;  1YVL A;  2KHN A;  3EK8 A;  2WOR A;  1GQM A;  1J55 A;  1WLZ A;  2LMV A;  2WND A;  1YUU A;  4MZL A;  5BPJ A;  3ICB A;  3MSE B;  3CR2 A;  2WCF A;  3FIA A;  1CFP A;  1M31 A;  3PFV A;  2KI4 B;  3TS5 C;  2BCA A;  1BLQ A;  3PM8 A;  4WQ3 A;  1IJ6 A;  1KFX S;  1KWO C;  5TNC A;  2D8N A;  3KEV A;  2K2F A;  1HT9 A;  1IWQ A;  2ZFD A;  1IRJ A;  3I5F C;  2BE4 A;  5HYD A;  1TNW A;  2L4H A;  4PCW A;  1GGZ A;  3EK7 A;  2WOS A;  4NQG A;  3VRQ A;  2H61 C;  1NCX A;  1G8I A;  1ZMZ A;  2M0R A;  2G9B A;  2LUX A;  2LP3 A;  2JXC A;  1TTX A;  2KDH A;  3CWG A;  1M39 A;  2HQ8 A;  1RWY A;  3CGA A;  2O5G A;  2BL0 B;  5I8N A;  1G4Y R;  4YGC B;  1Q80 A;  1FI5 A;  4I5N B;  2M8U A;  1L2O C;  2LC5 A;  3AAK A;  4ETO A;  1QXP A;  1ALW A;  1WDC B;  2ZRT A;  1PUL A;  1B7T Y;  2BCX A;  1BR1 B;  2NCO A;  1DJZ A;  1QX2 A;  2K7C A;  1F54 A;  1U5I B;  1OE9 B;  3I5H B;  4N1G A;  2G2B A;  2FCD A;  3IF7 A;  1SL9 A;  3BXK A;  2IS9 A;  1KSM A;  2F3Z A;  2JWW A;  4UPG A;  1HQV A;  1S1E A;  3K21 A;  2COL B;  4TNC A;  2L4I A;  4AOM A;  2M9G A;  1GJY A;  4GBA A;  2F2O A;  3DVM A;  1C07 A;  2HF5 A;  3KPX A;  1TCF A;  1FW4 A;  2LCP A;  2JNF A;  3I5F B;  3PLF B;  2LE9 B;  2K7D A;  1XK4 A;  3BYA A;  4XJK B;  2BEC A;  3A8R A;  3CR4 X;  3O78 A;  4DUQ A;  1K93 D;  2L5X B;  2LP2 A;  1EH2 A;  1IQ5 A;  1QTX A;  1M45 A;  3I5G B;  4XJK A;  1L7Z A;  1UHK A;  2F8P A;  3JVT C;  4R1E A;  1VRK A;  4NDC A;  3FWC A;  1UUR A;  3AKB A;  1V1G A;  1LA3 A;  1J7O A;  2I94 A;  3ZWH A;  4CFR A;  1MF8 B;  1QX7 A;  2E30 A;  2CTN A;  2JT3 A;  2K61 A; 
#chains in the Genus database with same CATH topology
 3WNX B;  1RRO A;  2PMY A;  3LCP C;  5AFP A;  5B8I B;  3IQQ A;  1SCV A;  3DVE A;  1CM4 A;  2JT8 A;  2GGM A;  1KSO A;  1CFF A;  5D7F A;  1N65 A;  1OOH A;  1MXE A;  2K8M B;  5CSI A;  1K9P A;  1DJG A;  1QVI Y;  1RFJ A;  1J1D A;  1QV0 A;  1WLM A;  2RGI A;  2TN4 A;  4KYN A;  5I2O A;  1S6J A;  2FOT A;  1CFC A;  1KQM C;  1Y1A A;  1XFV O;  2LVK A;  4GNK B;  1B47 A;  4C0J A;  1LIN A;  1CM1 A;  1QAT A;  3PN7 C;  1QJT A;  3I5I C;  4OKH A;  5D69 A;  1BOD A;  1SCM B;  2KQ6 A;  4U8D A;  3H4S E;  3O6B A;  4GGF C;  4OCI A;  2HPS A;  2BL0 C;  3DD4 A;  2MLE C;  2V53 A;  4FQT A;  1CDN A;  2MA2 A;  1OZO A;  3TDU A;  1CKK A;  3EVV A;  1S5G Y;  3Q8I A;  1S5G Z;  1PRW A;  3SG6 A;  5I2Q A;  1ZFS A;  3UNW A;  5JJG A;  1SL7 A;  1QLK A;  3EVR A;  4YGE B;  1H8B A;  2AUC A;  1PVB A;  3EK4 A;  3BOW B;  1CMG A;  1A4P A;  3IVT A;  1NWD A;  2KI6 C;  1BR4 B;  1EL4 A;  4PE4 A;  1DJW A;  1WRK A;  1S6I A;  2L0P A;  2LLU A;  4MLW A;  4PT1 A;  2H61 A;  1YUR A;  1K9U A;  1W7I B;  4A4B A;  4E68 A;  1SR6 C;  2GV5 A;  4DRW A;  2EHB A;  4CFQ A;  1IGV A;  1OOF A;  2AMI A;  3FWB A;  2L5Y A;  1XVJ A;  3PAT A;  2ZRS A;  4MZJ A;  5CSF A;  1NX2 A;  1DTL A;  1L2O B;  1QIW A;  3KF9 A;  2L2C A;  1OOI X;  2SAS A;  1XFY O;  2JNX A;  1FPW A;  5HKY A;  4OR9 B;  3NSK A;  5KSZ A;  4PAL A;  3OGN A;  4BY5 A;  1C3Y A;  1ODB A;  1E8A A;  2P6B B;  4DCK A;  2QPT A;  3QME A;  3QRX A;  1CDM A;  1PAL A;  1SR6 B;  3BFB A;  2Y5I A;  1SK6 D;  4YGD B;  2L2E A;  1IJ5 A;  2AAO A;  1UHJ A;  2PAL A;  3N7H A;  3R1P A;  1AHR A;  3NSO A;  2LHL A;  3UO9 A;  3O4X A;  3RLZ A;  1UUS A;  1UHN A;  2JTZ A;  1EG4 A;  1K8U A;  4M2O A;  4DS7 A;  3B6X A;  2BBM A;  1C7V A;  1JF0 A;  3EVU A;  4ZCV A;  1QAS A;  3D76 A;  1AK8 A;  3CZ2 A;  1K2H A;  1IQ3 A;  4ORA B;  1K90 D;  5K89 A;  2PVB A;  1K95 A;  2LLS A;  2ZNE A;  1C7W A;  2Y1N A;  3HX4 A;  3R72 A;  4I5J A;  3D74 A;  4JWQ A;  1YTZ C;  3SJS A;  2LVI A;  1ZAC A;  2JXL A;  5FI2 A;  5BPJ A;  1YVH A;  3SG3 A;  2LHI A;  1TRF A;  2JC2 A;  3B86 A;  3JVT B;  3D75 A;  3I5G C;  3EKJ A;  3TS5 B;  1FI6 A;  1SPY A;  1FBV A;  3A4U B;  2M1K B;  2CT9 A;  2A4J A;  4GGF A;  3VB1 A;  2F3Y A;  4PE0 A;  4CID A;  1AVS A;  1NX0 A;  2WCB A;  2JT0 A;  2L50 A;  2MLF C;  2JU0 A;  1OSA A;  3FE8 A;  1S26 D;  3VRN A;  3SG4 A;  2OS8 C;  1DJY A;  2NLN A;  1ZUZ A;  4I5K A;  2EGD A;  2EC6 C;  1YUT A;  5FI7 A;  4GFT A;  1XFX O;  1OMD A;  2KI6 D;  1R6P A;  4YI8 A;  2KBI A;  1XO5 A;  3LK1 A;  2JTT A;  4P5O E;  1M63 B;  1R2U A;  3NXA A;  3O2P A;  1DC1 A;  1QX5 B;  5AER A;  1A29 A;  1SYM A;  2M7N A;  2LVV A;  1SRA A;  2QEO A;  2P71 A;  1TNQ A;  1UP5 A;  3FS7 A;  1QLS A;  1A75 A;  4ORB B;  1AUI B;  1EJ3 A;  4YBH B;  1T14 A;  3V2L A;  1F70 A;  1TCO B;  1YX7 A;  1ZOT B;  5HLO A;  1MR8 A;  2ZND A;  2H2K A;  4MSP A;  5AEQ A;  4AQJ A;  4OVN F;  3L47 A;  2ZKM X;  2MRD A;  1BU3 A;  4PE7 A;  2LUC A;  2Y4Q A;  3VRO A;  3IQO A;  2ZN8 A;  1XFZ O;  5CSN A;  2KFG A;  1KK7 Y;  1MXL C;  1OZS A;  1M46 A;  3GK2 A;  1YUS A;  2M3W A;  1NYA A;  1UWO A;  2JQ6 A;  2WC5 A;  5G08 A;  3TZ1 A;  1P28 A;  2KYF A;  3EKH A;  1S36 A;  1QVI Z;  3BOW A;  2L51 A;  3PM2 A;  4YI9 A;  4PHJ A;  2YGU A;  2BKH B;  3WXA A;  3GOF A;  1MUX A;  4HRE E;  1RTP 1;  4PHK A;  2KAX A;  4CPV A;  2I2R E;  1S3P A;  1EG3 A;  5GQQ C;  3B7A A;  1IH0 A;  4INX A;  4DIR A;  2WCK A;  4YGA A;  2KI4 C;  4GUK A;  3JTD C;  1NUB A;  3F45 A;  1RK9 A;  1MQ1 A;  3NHI A;  1KQM B;  2KFH A;  3OP0 A;  4XYN A;  2M7L A;  3PSR A;  2Q91 A;  2KAY A;  2JUL A;  4ORC B;  1QV1 A;  4YGB B;  2BCB A;  4IL1 A;  2LM5 A;  1CNP A;  1AJ5 A;  4M2P A;  3KHE A;  1Y6W A;  1IIO A;  1N0Y A;  4MEW A;  5ER4 X;  3C1V A;  1DJI A;  2EC6 B;  5PAL A;  1SNL A;  2BNX A;  1TN4 A;  3HCM A;  1DT7 B;  1B1G A;  1CB1 A;  2QEV A;  4OZD A;  1KK8 C;  1KFU S;  3OX5 A;  4GPL B;  4OV2 A;  4USL A;  1J7Q A;  2KQY A;  3M0W A;  2JPT A;  3OHM B;  1OOG A;  2LVJ A;  5DKR A;  4HRG A;  1NX3 A;  1K96 A;  2KYC A;  5JOL A;  2HQW A;  1BG1 A;  1D1O A;  1XFW O;  1BMO A;  3E3R A;  1GM0 A;  3NGV A;  1NCY A;  1WY9 A;  1UHI A;  3OB1 B;  1LKJ A;  3SG5 A;  4WQ2 A;  2BE6 A;  3CLN A;  1B8C A;  2PSR A;  1OW4 A;  1QS7 A;  5AAN A;  1KCY A;  1YR5 A;  1TWO A;  2CCM A;  3TDI A;  3ZNI A;  1PSR A;  2R2I A;  1DJH A;  2KBM A;  2QEB A;  5DKQ A;  1Z2C B;  2B1U A;  1B9A A;  1CDP A;  4PHN A;  5HLV A;  3SIB A;  2P70 A;  1IKU A;  3K1E A;  1BOC A;  2GTE A;  5I2L A;  1B8L A;  3FE9 A;  3GK4 X;  4NDB A;  3RM1 A;  5FI6 A;  2K60 A;  1DEK A;  2GGZ A;  2K2A A;  2Q4U A;  3PAL A;  1SMG A;  4PHM A;  4WRI A;  3VGO A;  3I5H C;  1OMV A;  4YRU A;  1H4B A;  2E6W A;  2KLD A;  1DMO A;  2ISD A;  2JPO A;  5D3O A;  1DGV A;  1ALV A;  4AQI A;  3LK0 A;  2ZN9 A;  2LNK A;  1YRT B;  3D0Y B;  5AXI A;  3R1V A;  4MZK A;  5HKW A;  4PDZ A;  1A75 B;  2KGB C;  5HL1 A;  2Y1M A;  4C0K A;  3D0Y A;  2JOJ A;  2HET A;  3I5I B;  1MHO A;  2F2P A;  1QWV A;  1KK7 Z;  1UHH A;  4GGN A;  1EXR A;  2I18 A;  2WCJ A;  2OTG B;  1NX1 A;  1SCM C;  2KOT A;  3PN7 B;  1AP4 A;  1SSE B;  2ERB A;  5KTY A;  1KQV A;  3CZT X;  4QJ5 B;  3PJI A;  1YX8 A;  1LVC D;  4MN0 A;  1NPQ A;  2LMT A;  3BUX B;  5CPV A;  1JC2 A;  1K94 A;  2NCP A;  1DVI A;  1CTR A;  3BJH A;  4PE1 A;  2K0J A;  2M97 A;  1C3Z A;  1OQP A;  1QIV A;  3KO0 A;  1F4Q A;  3CDN A;  3CS1 A;  1CMF A;  1CDL A;  1NIW A;  2JZI A;  3BQ3 A;  1TNP A;  1CLL A;  1TIZ A;  3L4L A;  3O4Y A;  4N1F A;  2MHH A;  1AJ4 A;  2KNE A;  2LAN A;  3BUN B;  3DVJ A;  2CBL A;  3NHT A;  3D10 A;  1Z4H A;  2MJW B;  4JQ0 D;  5ER5 A;  3BUW B;  4A4C A;  1XA5 A;  2L98 A;  1JFJ A;  1BF5 A;  4QJ4 B;  3WHT B;  5HKZ A;  1PVA A;  1K9K A;  3CYZ A;  1IG5 A;  1PSB A;  2FJU B;  1NCZ A;  2K7B A;  4HSZ A;  3SG7 A;  1SKT A;  1XK4 C;  2NXQ A;  2VRG A;  2WC8 A;  4NDD A;  2KFF A;  1GGW A;  1F8H A;  1B8R A;  2PRU A;  3NSI A;  1A03 A;  3SIA A;  4HRH A;  1B7T Z;  2LLT A;  3BUO B;  2LAP A;  3AAJ A;  3GK1 A;  1SY9 A;  4F0Z B;  3SS5 A;  3LLE A;  3OX6 A;  2M1U A;  3TUY B;  1SL8 A;  2H8V A;  2DOQ A;  1OMR A;  4D1E A;  4P2Y B;  1WDC C;  1NP8 A;  3NSL A;  1REC A;  3BUM B;  4I5L B;  2M49 B;  3DF0 A;  4MBE A;  5CSJ A;  4IJ7 A;  2MAZ A;  4L9M A;  3DVK A;  1J7P A;  2O60 A;  2BBN A;  1W7J B;  1DEL A;  2OPO A;  3DF0 B;  4MVF A;  3VRP A;  5FYX A;  1JF2 A;  5F6T A;  2LV7 A;  1BT6 A;  5J3X A;  1CFD A;  2FCE A;  3CZ1 A;  1XYD A;  3LL8 B;  4MRX A;  4ICB A;  3AKA A;  4ZCU A;  5IBW A;  1OOJ A;  1YRU B;  3DZT A;  3VRR A;  2CXJ A;  5DKN A;  1JWD A;  1BJF A;  1U5I A;  4QJ3 B;  1CLM A;  1LA0 A;  1SBJ A;  1J1E A;  1LXF C;  3TDZ A;  1XFU O;  1WRZ A;  4BY4 A;  1N2D A;  2SCP A;  3SG2 A;  4Q04 A;  1JBA A;  3SS3 A;  1JSA A;  1DJX A;  1W9Z A;  2LMU A;  3L4A A;  2CNP A;  2QAC A;  1J7R A;  1NSH A;  4JD9 A;  2BKI B;  1KFX L;  1JUO A;  2FJY A;  1KWO B;  3B87 A;  2PAS A;  1TOP A;  1Y1U A;  2I7A A;  2WCE A;  3S0B A;  2MBX A;  1F55 A;  1G33 A;  4JPZ B;  1RJV A;  2OTG C;  1A2X A;  3DYE A;  4MRY A;  3EG5 B;  4GAO A;  3CR5 X;  4C0L A;  1JFK A;  3JTD B;  1F71 A;  1TNX A;  1KFU L;  3SS4 A;  1MWN A;  2NZ0 A;  2WC6 A;  2QDI A;  1LS8 A;  1TUZ A;  3WHU B;  5KU1 A;  1F4O A;  4N5X A;  4FQO A;  1S6C A;  1DGU A;  1DF0 B;  3CTN A;  4M2Q A;  4CLN A;  1KK8 B;  1PK0 D;  1SW8 A;  2F33 A;  2K7O A;  3TUY C;  1DF0 A;  1CLB A;  1V1F A;  1Y1X A;  3OBV A;  1Y0V H;  2JRF A;  2KGR A;  1X02 A;  2M29 A;  1WRL A;  1B4C A;  1FF1 A;  3OB2 B;  4FTG A;  2KAV A;  2OS8 B;  3S0G A;  2KSP A;  1YVL A;  2KHN A;  3DY9 A;  3EK8 A;  2WOR A;  1GQM A;  3S0E A;  1J55 A;  1WLZ A;  2LMV A;  2WND A;  1YUU A;  3DXL A;  4MZL A;  3ICB A;  3MSE B;  3CR2 A;  2WCF A;  3FIA A;  3S0D A;  1CFP A;  1M31 A;  3PFV A;  2KI4 B;  3TS5 C;  2BCA A;  1BLQ A;  3PM8 A;  4WQ3 A;  1IJ6 A;  1KFX S;  2KPH A;  1KWO C;  3D73 A;  5TNC A;  3CZ0 A;  2D8N A;  3KEV A;  2K2F A;  1HT9 A;  1IWQ A;  2ZFD A;  1IRJ A;  3I5F C;  2BE4 A;  2QEH A;  5HYD A;  1TNW A;  3D78 A;  2KLE A;  2L4H A;  4PCW A;  1GGZ A;  3EK7 A;  2WOS A;  4NQG A;  5DIC A;  3VRQ A;  3BFH A;  2H61 C;  1NCX A;  1G8I A;  1ZMZ A;  3B88 A;  1DQE A;  2M0R A;  2G9B A;  2LUX A;  2LP3 A;  2JXC A;  1TTX A;  2KDH A;  2WCM A;  3CWG A;  1M39 A;  2HQ8 A;  3S0A A;  1RWY A;  3CGA A;  2PQL A;  3S0F A;  2O5G A;  2BL0 B;  5I8N A;  1G4Y R;  4YGC B;  1ORG A;  1Q80 A;  1FI5 A;  4I5N B;  2M8U A;  1L2O C;  2LC5 A;  3FE6 A;  3AAK A;  4ETO A;  1QXP A;  1ALW A;  1WDC B;  2ZRT A;  4JKT A;  1PUL A;  1B7T Y;  2BCX A;  1BR1 B;  2NCO A;  1DJZ A;  1QX2 A;  2K7C A;  1F54 A;  1U5I B;  1OE9 B;  3I5H B;  4N1G A;  2G2B A;  2FCD A;  3IF7 A;  1SL9 A;  3BXK A;  2IS9 A;  1KSM A;  2F3Z A;  4INW A;  2JWW A;  4UPG A;  2BAP A;  1HQV A;  1S1E A;  3K21 A;  2COL B;  4TNC A;  2L4I A;  4AOM A;  2M9G A;  1GJY A;  4GBA A;  2F2O A;  3DVM A;  1C07 A;  2HF5 A;  2PYQ A;  3KPX A;  1TCF A;  3D77 A;  1FW4 A;  2LCP A;  2JNF A;  3I5F B;  3PLF B;  2LE9 B;  2K7D A;  1XK4 A;  3BYA A;  4XJK B;  1TUJ A;  2BEC A;  3A8R A;  2WCH A;  3CR4 X;  3CAB A;  3O78 A;  1K93 D;  4DUQ A;  2L5X B;  2LP2 A;  4F7F A;  1IQ5 A;  3RZS A;  1EH2 A;  1QTX A;  1M45 A;  3I5G B;  4XJK A;  1L7Z A;  1UHK A;  2F8P A;  3JVT C;  4R1E A;  1VRK A;  4NDC A;  3FWC A;  1UUR A;  1XFR A;  3AKB A;  1V1G A;  1LA3 A;  3R1O A;  3BFA A;  2I94 A;  2WCL A;  1J7O A;  3ZWH A;  4CFR A;  1MF8 B;  5EL2 A;  1QX7 A;  5I94 A;  2E30 A;  2CTN A;  2JT3 A;  2K61 A; 
#chains in the Genus database with same CATH homology
 3WNX B;  1RRO A;  2PMY A;  3LCP C;  5AFP A;  5B8I B;  3IQQ A;  1SCV A;  3DVE A;  1CM4 A;  2JT8 A;  2GGM A;  1KSO A;  1CFF A;  5D7F A;  1N65 A;  1MXE A;  2K8M B;  5CSI A;  1K9P A;  1DJG A;  1QVI Y;  1RFJ A;  1J1D A;  1QV0 A;  1WLM A;  2RGI A;  2TN4 A;  5I2O A;  1CFC A;  1S6J A;  2FOT A;  1KQM C;  1Y1A A;  1XFV O;  2LVK A;  4GNK B;  1B47 A;  4C0J A;  1LIN A;  1CM1 A;  1QAT A;  3PN7 C;  1QJT A;  3I5I C;  4OKH A;  5D69 A;  1BOD A;  1SCM B;  2KQ6 A;  4U8D A;  3H4S E;  3O6B A;  4GGF C;  4OCI A;  2HPS A;  2BL0 C;  3DD4 A;  2MLE C;  2V53 A;  1CDN A;  2MA2 A;  1OZO A;  3TDU A;  1CKK A;  3EVV A;  1S5G Y;  1S5G Z;  1PRW A;  3SG6 A;  5I2Q A;  1ZFS A;  5JJG A;  1SL7 A;  1QLK A;  3EVR A;  4YGE B;  1H8B A;  2AUC A;  1PVB A;  3EK4 A;  3BOW B;  1CMG A;  1A4P A;  1NWD A;  2KI6 C;  1BR4 B;  1EL4 A;  4PE4 A;  1DJW A;  1WRK A;  1S6I A;  2L0P A;  2LLU A;  4MLW A;  2H61 A;  1YUR A;  1K9U A;  1W7I B;  4A4B A;  4E68 A;  1SR6 C;  2GV5 A;  4DRW A;  2EHB A;  4CFQ A;  1IGV A;  2AMI A;  3FWB A;  3PAT A;  4MZJ A;  1XVJ A;  2ZRS A;  5CSF A;  1NX2 A;  1DTL A;  1L2O B;  1QIW A;  3KF9 A;  2SAS A;  1XFY O;  2JNX A;  1FPW A;  5HKY A;  4OR9 B;  3NSK A;  5KSZ A;  4PAL A;  4BY5 A;  1ODB A;  1E8A A;  2P6B B;  4DCK A;  2QPT A;  3QRX A;  1CDM A;  1PAL A;  1SR6 B;  2Y5I A;  1SK6 D;  4YGD B;  2L2E A;  1IJ5 A;  2AAO A;  1UHJ A;  2PAL A;  1AHR A;  3NSO A;  2LHL A;  3RLZ A;  1UUS A;  1UHN A;  2JTZ A;  1EG4 A;  1K8U A;  4M2O A;  4DS7 A;  2BBM A;  1C7V A;  1JF0 A;  3EVU A;  4ZCV A;  1QAS A;  1AK8 A;  1IQ3 A;  4ORA B;  1K90 D;  5K89 A;  2PVB A;  1K95 A;  2LLS A;  2ZNE A;  1C7W A;  2Y1N A;  3HX4 A;  4I5J A;  4JWQ A;  3SJS A;  1YTZ C;  2LVI A;  1ZAC A;  2JXL A;  1YVH A;  3SG3 A;  2LHI A;  1TRF A;  2JC2 A;  3JVT B;  3I5G C;  3EKJ A;  3TS5 B;  1FI6 A;  1SPY A;  1FBV A;  3A4U B;  2M1K B;  2CT9 A;  2A4J A;  4GGF A;  2F3Y A;  4PE0 A;  4CID A;  1AVS A;  1NX0 A;  2WCB A;  2JT0 A;  2L50 A;  2MLF C;  2JU0 A;  1OSA A;  1S26 D;  3VRN A;  3SG4 A;  2OS8 C;  1DJY A;  2NLN A;  1ZUZ A;  4I5K A;  2EGD A;  2EC6 C;  1YUT A;  4GFT A;  1XFX O;  1OMD A;  2KI6 D;  1R6P A;  4YI8 A;  2KBI A;  1XO5 A;  3LK1 A;  2JTT A;  4P5O E;  1M63 B;  1R2U A;  3NXA A;  3O2P A;  1QX5 B;  5AER A;  1A29 A;  1SYM A;  2M7N A;  2LVV A;  1SRA A;  1TNQ A;  1UP5 A;  3FS7 A;  1QLS A;  1A75 A;  4ORB B;  1AUI B;  1EJ3 A;  4YBH B;  1F70 A;  1TCO B;  1YX7 A;  1ZOT B;  5HLO A;  1MR8 A;  2ZND A;  2H2K A;  4MSP A;  5AEQ A;  4AQJ A;  4OVN F;  2ZKM X;  2MRD A;  1BU3 A;  4PE7 A;  2LUC A;  2Y4Q A;  3VRO A;  3IQO A;  2ZN8 A;  1XFZ O;  5CSN A;  2KFG A;  1KK7 Y;  1MXL C;  1OZS A;  1M46 A;  3GK2 A;  1YUS A;  2M3W A;  1NYA A;  1UWO A;  2JQ6 A;  5G08 A;  3TZ1 A;  1K2H A;  3EKH A;  2KYF A;  1S36 A;  1QVI Z;  3BOW A;  2L51 A;  4YI9 A;  4PHJ A;  2BKH B;  3WXA A;  3GOF A;  1MUX A;  4HRE E;  1RTP 1;  4PHK A;  2KAX A;  4CPV A;  2I2R E;  1S3P A;  1EG3 A;  5GQQ C;  1IH0 A;  4DIR A;  4YGA A;  2KI4 C;  4GUK A;  3JTD C;  1NUB A;  3F45 A;  1RK9 A;  1MQ1 A;  3OP0 A;  1KQM B;  2KFH A;  4XYN A;  2M7L A;  3PSR A;  2Q91 A;  2KAY A;  2JUL A;  4ORC B;  1QV1 A;  4YGB B;  2BCB A;  4IL1 A;  2LM5 A;  1CNP A;  1AJ5 A;  4M2P A;  3KHE A;  1Y6W A;  1N0Y A;  4MEW A;  5ER4 X;  3C1V A;  1DJI A;  2EC6 B;  5PAL A;  1SNL A;  1TN4 A;  3HCM A;  1DT7 B;  1B1G A;  1CB1 A;  1J7Q A;  1KK8 C;  1KFU S;  3OX5 A;  4GPL B;  4OV2 A;  4USL A;  2KQY A;  3M0W A;  2JPT A;  3OHM B;  2LVJ A;  5DKR A;  4HRG A;  1NX3 A;  1K96 A;  2KYC A;  5JOL A;  2HQW A;  1BG1 A;  1D1O A;  1XFW O;  1BMO A;  3E3R A;  1NCY A;  1WY9 A;  1UHI A;  3OB1 B;  1LKJ A;  3SG5 A;  4WQ2 A;  2BE6 A;  3CLN A;  1B8C A;  2PSR A;  1QS7 A;  5AAN A;  1KCY A;  1YR5 A;  2CCM A;  3TDI A;  3ZNI A;  1PSR A;  2R2I A;  1DJH A;  2KBM A;  5DKQ A;  2B1U A;  1B9A A;  1CDP A;  4PHN A;  5HLV A;  3SIB A;  1IKU A;  1BOC A;  5I2L A;  1B8L A;  3GK4 X;  4NDB A;  3RM1 A;  3VGO A;  2GGZ A;  2K2A A;  2Q4U A;  3PAL A;  4PHM A;  1SMG A;  4WRI A;  3I5H C;  1OMV A;  4YRU A;  1H4B A;  2E6W A;  1DMO A;  2ISD A;  1DGV A;  1ALV A;  4AQI A;  3LK0 A;  2ZN9 A;  2LNK A;  1YRT B;  3D0Y B;  5AXI A;  4MZK A;  5HKW A;  4PDZ A;  1A75 B;  2KGB C;  2Y1M A;  4C0K A;  3D0Y A;  2JOJ A;  2HET A;  3I5I B;  1MHO A;  2F2P A;  1KK7 Z;  1UHH A;  4GGN A;  1EXR A;  2I18 A;  2OTG B;  1NX1 A;  1SCM C;  2KOT A;  3PN7 B;  1AP4 A;  5KTY A;  1KQV A;  3CZT X;  4QJ5 B;  1YX8 A;  1LVC D;  4MN0 A;  1NPQ A;  2LMT A;  3BUX B;  5CPV A;  1JC2 A;  1K94 A;  2NCP A;  1DVI A;  1CTR A;  4PE1 A;  2K0J A;  2M97 A;  1OQP A;  1QIV A;  3KO0 A;  1F4Q A;  1CMF A;  3CS1 A;  1CDL A;  1NIW A;  2JZI A;  3BQ3 A;  1TNP A;  1CLL A;  1TIZ A;  3O4Y A;  4N1F A;  2MHH A;  1AJ4 A;  2KNE A;  2LAN A;  3BUN B;  3DVJ A;  2CBL A;  3D10 A;  2MJW B;  4JQ0 D;  5ER5 A;  3BUW B;  4A4C A;  1XA5 A;  2L98 A;  1JFJ A;  1BF5 A;  4QJ4 B;  3WHT B;  5HKZ A;  1PVA A;  1K9K A;  1IG5 A;  1PSB A;  2FJU B;  1NCZ A;  2K7B A;  4HSZ A;  3SG7 A;  1SKT A;  1XK4 C;  2NXQ A;  2VRG A;  2WC8 A;  4NDD A;  2KFF A;  1GGW A;  1F8H A;  1B8R A;  2PRU A;  3NSI A;  1A03 A;  3SIA A;  4HRH A;  1B7T Z;  2LLT A;  3BUO B;  2LAP A;  3AAJ A;  3GK1 A;  1SY9 A;  4F0Z B;  3LLE A;  3OX6 A;  2M1U A;  3TUY B;  1SL8 A;  2DOQ A;  1OMR A;  4D1E A;  4P2Y B;  1WDC C;  1NP8 A;  3NSL A;  1REC A;  3BUM B;  4I5L B;  2M49 B;  3DF0 A;  4MBE A;  5CSJ A;  2MAZ A;  4L9M A;  3DVK A;  1J7P A;  2O60 A;  2BBN A;  1W7J B;  2OPO A;  3DF0 B;  4MVF A;  3VRP A;  5FYX A;  1JF2 A;  5F6T A;  2LV7 A;  1BT6 A;  5J3X A;  1CFD A;  2FCE A;  1XYD A;  3LL8 B;  4MRX A;  4ICB A;  3AKA A;  4ZCU A;  5IBW A;  1OOJ A;  1YRU B;  3VRR A;  2CXJ A;  5DKN A;  1JWD A;  1BJF A;  1U5I A;  4QJ3 B;  1CLM A;  1LA0 A;  1SBJ A;  1J1E A;  1LXF C;  3TDZ A;  1XFU O;  1WRZ A;  4BY4 A;  1N2D A;  2SCP A;  3SG2 A;  4Q04 A;  1JBA A;  1JSA A;  1DJX A;  2LMU A;  2CNP A;  2QAC A;  1J7R A;  1NSH A;  2BKI B;  1KFX L;  1JUO A;  1KWO B;  2PAS A;  1TOP A;  1Y1U A;  2I7A A;  2WCE A;  2MBX A;  1F55 A;  1G33 A;  4JPZ B;  1RJV A;  2OTG C;  1A2X A;  4MRY A;  4GAO A;  3CR5 X;  4C0L A;  1JFK A;  3JTD B;  1F71 A;  1TNX A;  1KFU L;  1MWN A;  2NZ0 A;  3WHU B;  5KU1 A;  1F4O A;  4N5X A;  4FQO A;  1S6C A;  1DGU A;  1DF0 B;  3CTN A;  4M2Q A;  4CLN A;  1KK8 B;  1PK0 D;  1SW8 A;  2F33 A;  2K7O A;  3TUY C;  1DF0 A;  1CLB A;  1V1F A;  1Y1X A;  1Y0V H;  2JRF A;  2KGR A;  1X02 A;  2M29 A;  1WRL A;  1B4C A;  1FF1 A;  3OB2 B;  4FTG A;  2KAV A;  2OS8 B;  2KSP A;  1YVL A;  2KHN A;  3EK8 A;  2WOR A;  1GQM A;  1J55 A;  1WLZ A;  2LMV A;  2WND A;  1YUU A;  4MZL A;  5BPJ A;  3ICB A;  3MSE B;  3CR2 A;  2WCF A;  3FIA A;  1CFP A;  1M31 A;  3PFV A;  2KI4 B;  3TS5 C;  2BCA A;  1BLQ A;  3PM8 A;  4WQ3 A;  1IJ6 A;  1KFX S;  1KWO C;  5TNC A;  2D8N A;  3KEV A;  2K2F A;  1HT9 A;  1IWQ A;  2ZFD A;  1IRJ A;  3I5F C;  2BE4 A;  5HYD A;  1TNW A;  2L4H A;  4PCW A;  1GGZ A;  3EK7 A;  2WOS A;  4NQG A;  3VRQ A;  2H61 C;  1NCX A;  1G8I A;  1ZMZ A;  2M0R A;  2G9B A;  2LUX A;  2LP3 A;  2JXC A;  1TTX A;  2KDH A;  3CWG A;  1M39 A;  2HQ8 A;  1RWY A;  3CGA A;  2O5G A;  2BL0 B;  5I8N A;  1G4Y R;  4YGC B;  1Q80 A;  1FI5 A;  4I5N B;  2M8U A;  1L2O C;  2LC5 A;  3AAK A;  4ETO A;  1QXP A;  1ALW A;  1WDC B;  2ZRT A;  1PUL A;  1B7T Y;  2BCX A;  1BR1 B;  2NCO A;  1DJZ A;  1QX2 A;  2K7C A;  1F54 A;  1U5I B;  1OE9 B;  3I5H B;  4N1G A;  2G2B A;  2FCD A;  3IF7 A;  1SL9 A;  3BXK A;  2IS9 A;  1KSM A;  2F3Z A;  2JWW A;  4UPG A;  1HQV A;  1S1E A;  3K21 A;  2COL B;  4TNC A;  2L4I A;  4AOM A;  2M9G A;  1GJY A;  4GBA A;  2F2O A;  3DVM A;  1C07 A;  2HF5 A;  3KPX A;  1TCF A;  1FW4 A;  2LCP A;  2JNF A;  3I5F B;  3PLF B;  2LE9 B;  2K7D A;  1XK4 A;  3BYA A;  4XJK B;  2BEC A;  3A8R A;  3CR4 X;  3O78 A;  4DUQ A;  1K93 D;  2L5X B;  2LP2 A;  1EH2 A;  1IQ5 A;  1QTX A;  1M45 A;  3I5G B;  4XJK A;  1L7Z A;  1UHK A;  2F8P A;  3JVT C;  4R1E A;  1VRK A;  4NDC A;  3FWC A;  1UUR A;  3AKB A;  1V1G A;  1LA3 A;  1J7O A;  2I94 A;  3ZWH A;  4CFR A;  1MF8 B;  1QX7 A;  2E30 A;  2CTN A;  2JT3 A;  2K61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...