2K2FA

Solution structure of ca2+-s100a1-ryrp12
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
93
structure length
93
Chain Sequence
GSELETAMETLINVFHAHSGKEGDKYKLSKKELKDLLQTELSSFLDVQKDADAVDKIMKELDENGDGEVDFQEFVVLVAALTVACNNFFWENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ryanodine receptor 1 peptide
publication title S100A1 and Calmodulin Compete for the Same Binding Site on Ryanodine Receptor.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal binding protein
total genus 22
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2k2fA00
2LMUA 1IJ6A 2CXJA 4BY5A 1TNXA 1MXEA 1FI5A 1TCOB 1HQVA 2LC5A 1UHKA 2KGBC 2Y1NA 3CGAA 1DF0B 1J7QA 3OHMB 4A4CA 1YRUB 1CDMA 2ZNDA 1SR6B 1CFFA 2TN4A 2K2AA 4TNCA 1K94A 4MLWA 1ODBA 1J7OA 1C07A 2KDHA 1C7WA 2WCBA 1XK4C 2JWWA 3CLNA 1LXFC 3WXAA 3FS7A 5HKYA 4I5JA 1FI6A 1TNPA 3SIBA 1J1DA 1A29A 1QIVA 4Q04A 1OOJA 1B7TY 4PCWA 2M1KB 3E3RA 4WQ2A 5AANA 5ER4X 1EG3A 1AK8A 2F3ZA 2LVKA 4PALA 3OP0A 1SL9A 3PN7C 1QASA 1IKUA 2LMTA 1FPWA 3A8RA 3CR2A 1F54A 1ALVA 1AUIB 3ZNIA 4ZCUA 1W7IB 2JNFA 1NUBA 3FWBA 1PSBA 2LLSA 4OKHA 5CSNA 2JZIA 1N0YA 2B1UA 5CSJA 1IJ5A 4QJ5B 4MBEA 2QPTA 3WHUB 1KSOA 1Y1AA 1AVSA 1UHJA 2BE6A 4QJ4B 1CDNA 1QLSA 1YRTB 2KGRA 1NSHA 1RTP1 1SW8A 3I5IC 1Y1UA 3DVEA 2O5GA 3SIAA 1WRZA 4CFQA 1QX7A 3BUWB 1QX5B 4NDBA 3PN7B 2JNXA 1ZACA 3EK4A 1QTXA 3GK1A 1XVJA 1BG1A 1JFJA 2LHLA 4ORBB 4E68A 1KFUL 1PSRA 1Q80A 1IH0A 1F4OA 3CWGA 3OX5A 4XYNA 3KO0A 1TOPA 1Y1XA 4PHNA 3JVTC 5KTYA 1RWYA 2FCDA 3CTNA 5F6TA 4M2OA 1BJFA 3GOFA 4P5OE 1KCYA 2LANA 2LP3A 3I5IB 3TDUA 5HKWA 1RJVA 1WLZA 1KK8B 2SASA 1NWDA 4A4BA 2M3WA 2ISDA 1XYDA 4ETOA 3JTDC 1NX2A 1OMDA 1WY9A 4MRXA 1BODA 4I5LB 1F4QA 2L0PA 1TTXA 4P2YB 2GGZA 2ZRTA 3NSKA 1QIWA 1KFXS 2LM5A 3VRPA 2IS9A 2KHNA 4GUKA 4M2PA 1YVHA 1NYAA 2F2PA 3RM1A 4FQOA 1FBVA 3WNXB 2M7LA 1XFYO 1SRAA 1DVIA 3JVTB 4GFTA 1DTLA 1MQ1A 4I5KA 1B8RA 1WLMA 1K8UA 2LLTA 2R2IA 1BMOA 1DJGA 1NCYA 2O60A 3VROA 3ZWHA 2HQWA 2BE4A 3CR4X 1YX8A 1H4BA 3WHTB 2KBIA 4PE4A 2KYFA 1DJWA 3JTDB 1DMOA 1QVIY 5JOLA 1JWDA 5HLVA 2NXQA 5HKZA 4WRIA 1GQMA 2M49B 1W7JB 1QV1A 1MR8A 1OQPA 2I7AA 1N65A 1XFZO 1IQ5A 1DJHA 4YI9A 1DGVA 2L2EA 2LP2A 1WDCB 5AXIA 3FWCA 2AMIA 4BY4A 3KPXA 1BF5A 1CMFA 1XFVO 1J1EA 1BOCA 2ZN9A 4N5XA 3BOWB 3BXKA 3LLEA 1EL4A 1MUXA 2JULA 1ZFSA 5D69A 2MLFC 1JBAA 2GV5A 5CPVA 2CNPA 1HT9A 5J3XA 1SYMA 2F33A 4PE1A 2F8PA 4JWQA 2Q91A 3HCMA 4U8DA 5AFPA 1TCFA 2LUXA 5DKRA 1F55A 1D1OA 2K7BA 2M7NA 1E8AA 3IF7A 1K93D 2JT0A 4DCKA 1LA3A 5KSZA 3LK0A 4ORAB 2BCAA 1TN4A 1A75B 1YTZC 2BL0C 3EKHA 1CFDA 1MWNA 1YUUA 1MF8B 1DT7B 1R6PA 4MVFA 1S26D 2WC8A 1OSAA 2AUCA 1SCVA 2KAVA 2KNEA 1BLQA 2KFFA 2Y5IA 1K9PA 2K8MB 2OTGC 1DJZA 2M29A 4XJKA 4YGCB 4GGFC 4YGBB 2FJUB 1IG5A 2LVVA 2NLNA 2Q4UA 2G9BA 4N1GA 1U5IA 1WRLA 3D0YB 4PHJA 2I94A 5KU1A 3LL8B 1CLBA 5DKQA 4AOMA 4GBAA 2LE9B 1M63B 1UUSA 3BQ3A 3O4YA 2P6BB 3TDIA 2ZNEA 4YI8A 1KWOC 2BL0B 2SCPA 3KF9A 1NX1A 4AQJA 1F71A 4FTGA 2BECA 1AP4A 1CNPA 1RROA 1CTRA 2WCFA 1J7PA 1NPQA 2E30A 4GNKB 1K2HA 1OZOA 1PK0D 3CR5X 1K95A 1OZSA 2JTZA 1B1GA 2PSRA 4HRHA 2MBXA 4MN0A 3VRQA 1DJIA 1S1EA 3ICBA 4ICBA 2KI6D 1S3PA 5HYDA 2G2BA 3BOWA 5FYXA 2LHIA 1KWOB 3I5GC 5JJGA 3EKJA 2L5XB 2JOJA 2ZRSA 2JTTA 1TNWA 3I5FC 5BPJA 1S5GZ 3KEVA 4NDDA 1DF0A 1V1GA 2KAYA 2WOSA 3O2PA 4I5NB 1XFUO 4HSZA 5AEQA 2PALA 1PRWA 1OMVA 1SPYA 2H61A 2K7DA 1XFXO 3DVJA 3EVVA 4CPVA 4DS7A 3BUXB 1J55A 3AKAA 5I8NA 2KQ6A 1XFWO 5G08A 3TUYC 2NCPA 2H2KA 1V1FA 1UURA 2JT8A 2BKHB 1GGWA 4HREE 3PFVA 3NSOA 1DJXA 2K61A 1A75A 2F3YA 5DKNA 3I5GB 2BCBA 3TS5C 1DJYA 1KK7Z 2JQ6A 1Y0VH 3M0WA 2BCXA 3AAJA 1SNLA 1DGUA 1VRKA 2HPSA 3I5FB 4GAOA 1UP5A 4C0JA 4YGAA 4OVNF 2LCPA 1UHNA 3DVKA 1JF0A 2JXLA 3BUNB 1NX0A 1YUTA 2I18A 5CSFA 2CBLA 1SKTA 4CLNA 2COLB 3EK7A 1QXPA 3O78A 3PLFB 4YRUA 2K7CA 4MRYA 1L2OC 1X02A 1TRFA 3IQOA 3NSLA 1JFKA 2MJWB 2OPOA 1B8CA 1PVAA 1ZUZA 2CT9A 2DOQA 4MSPA 4PDZA 3VRRA 1LVCD 1CLLA 3BYAA 1SL8A 4WQ3A 1M46A 1XK4A 1JSAA 1TIZA 3TS5B 4JQ0D 4HRGA 1CKKA 1G8IA 3BUOB 1AHRA 1M39A 3SJSA 2KI6C 3IQQA 3CS1A 1IGVA 2L4HA 1YURA 2PMYA 1NIWA 1S6IA 1KFUS 5ER5A 1FF1A 2L98A 5PALA 2LVJA 1PULA 1UWOA 1YX7A 2BBNA 1QV0A 2WNDA 1Y6WA 2KBMA 3SG2A 1L2OB 4MZLA 2ZKMX 4D1EA 1XA5A 2Y4QA 1B4CA 1CDLA 1K96A 2K7OA 3I5HC 4PHKA 2LNKA 4CFRA 2L51A 1JC2A 2JC2A 4C0LA 1S5GY 1SY9A 4DRWA 1A03A 1QATA 1G33A 3PM8A 1CM1A 1EJ3A 2KOTA 2NCOA 1LINA 3EK8A 4N1FA 1M45A 3TDZA 4OR9B 4YGDB 2PVBA 2AAOA 3RLZA 2Y1MA 1CM4A 3D10A 2F2OA 1QX2A 1CDPA 4NDCA 1WRKA 1PVBA 4NQGA 2JU0A 4QJ3B 4R1EA 1IQ3A 4M2QA 3O6BA 3PSRA 1CB1A 1YVLA 1KK7Y 1OMRA 1JUOA 3I5HB 5TNCA 2K0JA 1K9UA 2KAXA 1QLKA 3DF0B 3F45A 4DIRA 1NCZA 3AAKA 2QACA 2CCMA 2JRFA 1SL7A 1F70A 2CTNA 4PE7A 2GGMA 1KFXL 2FOTA 5D7FA 2WCEA 3NXAA 1B8LA 1EH2A 3EVRA 1K9KA 3PATA 4ZCVA 1AJ5A 1A2XA 2OTGB 1BR4B 3GK2A 1G4YR 2MRDA 1IWQA 1F8HA 5HLOA 4AQIA 2PRUA 4PHMA 1MXLC 1SCMC 3KHEA 2KQYA 1S6JA 2K2FA 3QRXA 2LLUA 3AKBA 4F0ZB 1QVIZ 2MAZA 2M9GA 5IBWA 5I2QA 2M0RA 1NP8A 2EHBA 2BBMA 2V53A 1GGZA 1NX3A 4GGNA 1QS7A 2ZFDA 4OV2A 3MSEB 3SG7A 3CZTX 1KQMC 1A4PA 2A4JA 1BR1B 4ORCB 1KK8C 5I2LA 1LA0A 2EC6C 1SBJA 3NSIA 1S6CA 2OS8C 1BU3A 2VRGA 1L7ZA 1SK6D 2HQ8A 1AJ4A 1SCMB 1UHHA 4C0KA 1YR5A 2JT3A 3LK1A 2MA2A 2EGDA 4IL1A 3OB1B 1MHOA 3VGOA 1LKJA 2KFGA 4JPZB 5GQQC 2KYCA 2I2RE 3TZ1A 3BUMB 5I2OA 1EG4A 2M97A 3DD4A 1S36A 1H8BA 1KQMB 3SG3A 2MLEC 4DUQA 1ALWA 2HF5A 4MZJA 2JPTA 1M31A 4PE0A 1RFJA 2KI4C 2EC6B 4L9MA 2OS8B 3DVMA 3A4UB 1C7VA 4GPLB 3LCPC 2NZ0A 2LVIA 3D0YA 3DF0A 2MHHA 3OB2B 4USLA 4YGEB 1CLMA 1GJYA 3TUYB 1B7TZ 1JF2A 4MZKA 5K89A 4XJKB 2LV7A 2RGIA 1UHIA 2L50A 5CSIA 1KQVA 2JXCA 3OX6A 2LMVA 1U5IB 1ZOTB 2FCEA 2ZN8A 3PALA 2WORA 1B47A 1B9AA 2PASA 2BKIB 2E6WA 3HX4A 1WDCC 2LUCA 3VRNA 1BT6A 4MEWA 2M8UA 4UPGA 1FW4A 1NCXA 5B8IB 2HETA 3SG5A 2KFHA 1PALA 3C1VA 2KI4B 2L4IA 4GGFA 5AERA 1CFCA 4YBHB 1YUSA 2D8NA 1SMGA 1SR6C 2H61C 1R2UA 2KSPA 3SG6A 1RK9A 1N2DA 1OE9B 1XO5A 4OCIA 1CMGA 1K90D 2LAPA 1CFPA 1IRJA 3K21A 1TNQA 3SG4A 1QJTA 1J7RA 2M1UA 3FIAA 1RECA 1EXRA 3H4SE 3GK4X 4CIDA 3EVUA 1ZMZA 1KSMA
chains in the Genus database with same CATH superfamily
2LMUA 1IJ6A 2CXJA 4BY5A 1TNXA 1MXEA 1FI5A 1TCOB 1HQVA 1OOFA 1UHKA 2KGBC 2LC5A 2Y1NA 3CGAA 1DF0B 1J7QA 3OHMB 4A4CA 1YRUB 1CDMA 2ZNDA 1SR6B 3S0AA 1CFFA 2TN4A 2K2AA 4TNCA 1K94A 4MLWA 1ODBA 3B88A 1J7OA 1C07A 2KDHA 1C7WA 2WCBA 1XK4C 3D76A 3PM2A 2JWWA 3CLNA 1LXFC 3WXAA 3FS7A 5HKYA 4I5JA 1FI6A 1TNPA 3SIBA 1J1DA 2WCHA 1A29A 1QIVA 4Q04A 3K1EA 1OOJA 1B7TY 4PCWA 2M1KB 3E3RA 1LS8A 4WQ2A 5AANA 3IVTA 5ER4X 1EG3A 1AK8A 2F3ZA 2LVKA 1Z4HA 2KPHA 4PALA 3OP0A 1SL9A 3PN7C 1QASA 1IKUA 2LMTA 1FPWA 3A8RA 3CR2A 1F54A 1ALVA 1AUIB 3ZNIA 4ZCUA 1W7IB 2JNFA 1NUBA 2WCMA 1PSBA 2LLSA 3FWBA 4OKHA 5CSNA 2JZIA 1N0YA 2B1UA 5CSJA 1IJ5A 2WC5A 4QJ5B 4MBEA 2QPTA 3WHUB 1KSOA 1Y1AA 1AVSA 1UHJA 2BE6A 4QJ4B 1CDNA 1QLSA 1YRTB 2KGRA 3RZSA 1NSHA 1RTP1 1SW8A 3I5IC 1Y1UA 3DVEA 2O5GA 3SIAA 1WRZA 4CFQA 1QX7A 3BUWB 1QX5B 3CZ0A 4NDBA 3PN7B 2JNXA 1ZACA 3EK4A 1QTXA 3GK1A 1XVJA 3SS4A 1BG1A 1JFJA 2LHLA 4ORBB 4E68A 1KFUL 1PSRA 1Q80A 4JD9A 1F4OA 1IH0A 2KLDA 2KLEA 3CWGA 3OX5A 4XYNA 3KO0A 1TOPA 1Y1XA 4PHNA 3JVTC 1OW4A 5KTYA 1RWYA 2FCDA 3CTNA 3DYEA 5F6TA 4M2OA 1BJFA 3GOFA 4P5OE 1KCYA 2LANA 2LP3A 3I5IB 3TDUA 3B86A 5HKWA 1RJVA 1WLZA 1KK8B 2SASA 1NWDA 3FE9A 4A4BA 2M3WA 2ISDA 1XYDA 4ETOA 3JTDC 1NX2A 1OMDA 1WY9A 4MRXA 4PT1A 1BODA 4I5LB 1F4QA 2L0PA 1TTXA 3B87A 4P2YB 2GGZA 2ZRTA 3NSKA 1QIWA 1KFXS 2LM5A 3VB1A 2IS9A 2KHNA 3UO9A 3VRPA 4GUKA 4M2PA 1YVHA 1NYAA 2F2PA 3RM1A 4FQOA 1FBVA 3S0EA 3WNXB 2M7LA 1XFYO 1SRAA 1DVIA 3JVTB 4GFTA 1DTLA 1MQ1A 4I5KA 1B8RA 1WLMA 1K8UA 2LLTA 1IIOA 2R2IA 1BMOA 1DJGA 1NCYA 3DXLA 3OGNA 2O60A 3CZ2A 3VROA 3ZWHA 2HQWA 2BE4A 3CR4X 1YX8A 1H4BA 3BJHA 1DQEA 3R72A 3WHTB 2KBIA 4PE4A 2KYFA 1DJWA 3JTDB 1DMOA 1QVIY 5JOLA 1JWDA 3BFBA 3R1VA 2NXQA 3DZTA 5HLVA 5HKZA 4WRIA 1GQMA 2M49B 1W7JB 1QV1A 1MR8A 1OQPA 2I7AA 1C3YA 1N65A 1XFZO 1IQ5A 5D3OA 1TUJA 1DJHA 4YI9A 1DGVA 2L2EA 2LP2A 1WDCB 5AXIA 3FWCA 2AMIA 4BY4A 3KPXA 1BF5A 3S0GA 1CMFA 1XFVO 1J1EA 1BOCA 2ZN9A 4N5XA 3BOWB 3BXKA 3FE8A 3LLEA 1EL4A 2L5YA 1MUXA 2JULA 1ZFSA 5D69A 2MLFC 1JBAA 2GV5A 5CPVA 2CNPA 1HT9A 5J3XA 1SYMA 2F33A 4PE1A 2F8PA 4JWQA 2Q91A 3HCMA 4U8DA 5AFPA 1TCFA 2LUXA 3B6XA 5DKRA 1D1OA 2K7BA 2M7NA 1F55A 1E8AA 3IF7A 3V2LA 1K93D 2BNXA 2JT0A 2P71A 4DCKA 1QWVA 1LA3A 5KSZA 3LK0A 4ORAB 2BCAA 1TN4A 1A75B 1YTZC 2BL0C 3EKHA 1CFDA 1MWNA 1YUUA 1MF8B 1DT7B 1R6PA 4MVFA 1S26D 2WC8A 1OSAA 2AUCA 1SCVA 2KAVA 2KNEA 1BLQA 1XFRA 2KFFA 2Y5IA 1K9PA 5I94A 2K8MB 2OTGC 1DJZA 2M29A 4XJKA 4YGCB 1SSEB 4GGFC 4OZDA 4YGBB 2FJUB 1IG5A 2LVVA 2NLNA 2Q4UA 2G9BA 4N1GA 1U5IA 1WRLA 3D0YB 4PHJA 2I94A 5KU1A 3LL8B 1CLBA 5DKQA 4AOMA 4GBAA 2LE9B 1M63B 1UUSA 3BQ3A 3O4YA 2P6BB 3TDIA 3NGVA 2ZNEA 4YI8A 1KWOC 2BL0B 2SCPA 3KF9A 3SS5A 1NX1A 4AQJA 1F71A 4FTGA 2BECA 1AP4A 1CNPA 1RROA 1CTRA 2WCFA 1J7PA 1NPQA 2E30A 3N7HA 3D77A 4GNKB 1K2HA 1OZOA 1PK0D 3CR5X 1K95A 1OZSA 2JTZA 1B1GA 2PSRA 4HRHA 2MBXA 4MN0A 3VRQA 1DJIA 1S1EA 3ICBA 1OOHA 4ICBA 2KI6D 1S3PA 3D75A 2G2BA 2YGUA 5HYDA 3BOWA 5FYXA 2LHIA 1KWOB 3I5GC 5JJGA 3NHIA 3EKJA 2L5XB 1DC1A 2JOJA 2ZRSA 4KYNA 2JTTA 1TNWA 3I5FC 5BPJA 1S5GZ 3KEVA 4NDDA 1DF0A 1V1GA 2KAYA 2WOSA 3D78A 3O2PA 1XFUO 4HSZA 4I5NB 2PALA 1PRWA 5AEQA 1OMVA 1SPYA 3D74A 2H61A 2K7DA 1XFXO 3DVJA 3EVVA 4CPVA 4DS7A 3BUXB 1J55A 3AKAA 1DELA 5I8NA 2KQ6A 1XFWO 5G08A 3TUYC 2NCPA 3R1PA 2H2KA 1V1FA 1UURA 2JT8A 2BKHB 1GGWA 1W9ZA 3DY9A 4HREE 3PFVA 3NSOA 1DJXA 2K61A 1A75A 2F3YA 5DKNA 3I5GB 2GTEA 2BCBA 3TS5C 1DJYA 1KK7Z 2JQ6A 1Y0VH 3M0WA 2BCXA 3AAJA 1SNLA 1DGUA 1VRKA 2HPSA 3I5FB 4GAOA 1UP5A 4C0JA 4YGAA 1C3ZA 4OVNF 2LCPA 1UHNA 3DVKA 1GM0A 1JF0A 2JXLA 3BUNB 1NX0A 1YUTA 2I18A 5CSFA 2CBLA 1SKTA 4CLNA 5EL2A 2COLB 3EK7A 1QXPA 3O78A 3PLFB 5DICA 4YRUA 2K7CA 4MRYA 1L2OC 1X02A 1TRFA 3IQOA 3NSLA 1JFKA 2MJWB 2OPOA 1B8CA 1PVAA 1ZUZA 2CT9A 2DOQA 4MSPA 4PDZA 3VRRA 1LVCD 1CLLA 3BYAA 1SL8A 4WQ3A 1M46A 1XK4A 1JSAA 1TIZA 3TS5B 4JQ0D 4INWA 1TWOA 4HRGA 1CKKA 1G8IA 3BUOB 1AHRA 3CABA 1M39A 3OBVA 3SJSA 2KI6C 3IQQA 3CS1A 1IGVA 2L4HA 3L47A 1ORGA 1YURA 3L4AA 2PMYA 1NIWA 1S6IA 1KFUS 2P70A 5ER5A 1FF1A 2L98A 4IJ7A 4INXA 2LVJA 5PALA 1PULA 1UWOA 1YX7A 2BBNA 2JPOA 1QV0A 2WNDA 1Y6WA 2KBMA 3SG2A 1L2OB 4MZLA 2ZKMX 3CYZA 4D1EA 2QEBA 1XA5A 2Y4QA 1B4CA 1CDLA 1K96A 2K7OA 3I5HC 3CDNA 2LNKA 4PHKA 4CFRA 2L51A 2QEHA 1JC2A 2L2CA 2ERBA 2JC2A 4C0LA 1S5GY 1DEKA 1SY9A 4DRWA 1A03A 3SS3A 1QATA 1G33A 3PM8A 1CM1A 1EJ3A 1P28A 2KOTA 1LINA 2NCOA 3EK8A 1M45A 4N1FA 3S0BA 3TDZA 4OR9B 4YGDB 2PVBA 2AAOA 3RLZA 2Y1MA 1CM4A 3D10A 2F2OA 1QX2A 1CDPA 4NDCA 1OOGA 1WRKA 1PVBA 4NQGA 2JU0A 4QJ3B 4R1EA 4F7FA 1IQ3A 4M2QA 3O6BA 3PSRA 1CB1A 1YVLA 1KK7Y 1OMRA 1JUOA 3I5HB 5TNCA 2K0JA 4FQTA 3PJIA 3D73A 1K9UA 2KAXA 1QLKA 3DF0B 3F45A 4DIRA 1NCZA 3L4LA 3AAKA 2QACA 2CCMA 2JRFA 2WCLA 2QEOA 1SL7A 1F70A 2CTNA 4PE7A 5FI7A 2GGMA 1KFXL 2FOTA 5D7FA 2WCEA 3NHTA 3UNWA 3NXAA 1B8LA 1EH2A 3EVRA 1K9KA 3PATA 4ZCVA 1AJ5A 1A2XA 2OTGB 1BR4B 3GK2A 1G4YR 2MRDA 1IWQA 1T14A 3O4XA 1F8HA 5HLOA 4AQIA 2PRUA 4PHMA 2WCKA 1MXLC 1SCMC 2QDIA 3KHEA 2KQYA 1S6JA 2K2FA 3QRXA 2LLUA 3AKBA 2PYQA 4F0ZB 1QVIZ 2MAZA 2M9GA 2WC6A 5IBWA 5I2QA 2M0RA 1NP8A 2EHBA 2BBMA 2V53A 1GGZA 1NX3A 3B7AA 4GGNA 1QS7A 2ZFDA 4OV2A 1Z2CB 3MSEB 3SG7A 3CZTX 1KQMC 1A4PA 2A4JA 5FI2A 1BR1B 4ORCB 1KK8C 3QMEA 5I2LA 1LA0A 2EC6C 1SBJA 3NSIA 1S6CA 2FJYA 2OS8C 2BAPA 1BU3A 2VRGA 1L7ZA 1SK6D 2HQ8A 1AJ4A 1SCMB 1UHHA 4JKTA 4C0KA 1OOIX 1YR5A 2JT3A 3LK1A 3S0FA 1TUZA 2EGDA 2MA2A 4IL1A 3OB1B 1MHOA 3VGOA 1LKJA 3BFHA 5HL1A 2KFGA 4JPZB 5GQQC 2KYCA 3S0DA 2I2RE 3TZ1A 3BUMB 5I2OA 1EG4A 2M97A 3FE6A 3DD4A 1S36A 3EG5B 1H8BA 1KQMB 3BFAA 2MLEC 3SG3A 4DUQA 1ALWA 2K60A 2HF5A 4MZJA 2JPTA 1M31A 4PE0A 1RFJA 5FI6A 2KI4C 2EC6B 4L9MA 2OS8B 3CZ1A 3DVMA 3A4UB 1C7VA 4GPLB 3LCPC 2NZ0A 2LVIA 3D0YA 3DF0A 2H8VA 2MHHA 3OB2B 4USLA 4YGEB 1CLMA 1GJYA 3TUYB 1B7TZ 1JF2A 4MZKA 5K89A 4XJKB 2LV7A 2RGIA 1UHIA 2L50A 3R1OA 5CSIA 1KQVA 2JXCA 3OX6A 2LMVA 1U5IB 1ZOTB 2PQLA 2FCEA 2ZN8A 3PALA 2WORA 1B47A 1B9AA 2PASA 2BKIB 2E6WA 3HX4A 1WDCC 2QEVA 2LUCA 2WCJA 3VRNA 1BT6A 4MEWA 2M8UA 4UPGA 1FW4A 1NCXA 5B8IB 2HETA 3SG5A 2KFHA 1PALA 3C1VA 2KI4B 2L4IA 4GGFA 5AERA 1CFCA 3Q8IA 4YBHB 1YUSA 2D8NA 1SMGA 1SR6C 2H61C 1R2UA 2KSPA 3SG6A 1RK9A 1N2DA 1OE9B 1XO5A 4OCIA 1CMGA 1K90D 2LAPA 1CFPA 1IRJA 3K21A 1TNQA 3SG4A 1QJTA 1J7RA 2M1UA 3FIAA 1RECA 1EXRA 3H4SE 3GK4X 4CIDA 3EVUA 1ZMZA 1KSMA
chains in the Genus database with same CATH topology
2LMUA 1IJ6A 2CXJA 4BY5A 1TNXA 1MXEA 1FI5A 1TCOB 1HQVA 2LC5A 1UHKA 2KGBC 2Y1NA 3CGAA 1DF0B 1J7QA 3OHMB 4A4CA 1YRUB 1CDMA 2ZNDA 1SR6B 1CFFA 2TN4A 2K2AA 4TNCA 1K94A 4MLWA 1ODBA 1J7OA 1C07A 2KDHA 1C7WA 2WCBA 1XK4C 2JWWA 3CLNA 1LXFC 3WXAA 3FS7A 5HKYA 4I5JA 1FI6A 1TNPA 3SIBA 1J1DA 1A29A 1QIVA 4Q04A 1OOJA 1B7TY 4PCWA 2M1KB 3E3RA 4WQ2A 5AANA 5ER4X 1EG3A 1AK8A 2F3ZA 2LVKA 4PALA 3OP0A 1SL9A 3PN7C 1QASA 1IKUA 2LMTA 1FPWA 3A8RA 3CR2A 1F54A 1ALVA 1AUIB 3ZNIA 4ZCUA 1W7IB 2JNFA 1NUBA 3FWBA 1PSBA 2LLSA 4OKHA 5CSNA 2JZIA 1N0YA 2B1UA 5CSJA 1IJ5A 4QJ5B 4MBEA 2QPTA 3WHUB 1KSOA 1Y1AA 1AVSA 1UHJA 2BE6A 4QJ4B 1CDNA 1QLSA 1YRTB 2KGRA 1NSHA 1RTP1 1SW8A 3I5IC 1Y1UA 3DVEA 2O5GA 3SIAA 1WRZA 4CFQA 1QX7A 3BUWB 1QX5B 4NDBA 3PN7B 2JNXA 1ZACA 3EK4A 1QTXA 3GK1A 1XVJA 1BG1A 1JFJA 2LHLA 4ORBB 4E68A 1KFUL 1PSRA 1Q80A 1IH0A 1F4OA 3CWGA 3OX5A 4XYNA 3KO0A 1TOPA 1Y1XA 4PHNA 3JVTC 5KTYA 1RWYA 2FCDA 3CTNA 5F6TA 4M2OA 1BJFA 3GOFA 4P5OE 1KCYA 2LANA 2LP3A 3I5IB 3TDUA 5HKWA 1RJVA 1WLZA 1KK8B 2SASA 1NWDA 4A4BA 2M3WA 2ISDA 1XYDA 4ETOA 3JTDC 1NX2A 1OMDA 1WY9A 4MRXA 1BODA 4I5LB 1F4QA 2L0PA 1TTXA 4P2YB 2GGZA 2ZRTA 3NSKA 1QIWA 1KFXS 2LM5A 3VRPA 2IS9A 2KHNA 4GUKA 4M2PA 1YVHA 1NYAA 2F2PA 3RM1A 4FQOA 1FBVA 3WNXB 2M7LA 1XFYO 1SRAA 1DVIA 3JVTB 4GFTA 1DTLA 1MQ1A 4I5KA 1B8RA 1WLMA 1K8UA 2LLTA 2R2IA 1BMOA 1DJGA 1NCYA 2O60A 3VROA 3ZWHA 2HQWA 2BE4A 3CR4X 1YX8A 1H4BA 3WHTB 2KBIA 4PE4A 2KYFA 1DJWA 3JTDB 1DMOA 1QVIY 5JOLA 1JWDA 5HLVA 2NXQA 5HKZA 4WRIA 1GQMA 2M49B 1W7JB 1QV1A 1MR8A 1OQPA 2I7AA 1N65A 1XFZO 1IQ5A 1DJHA 4YI9A 1DGVA 2L2EA 2LP2A 1WDCB 5AXIA 3FWCA 2AMIA 4BY4A 3KPXA 1BF5A 1CMFA 1XFVO 1J1EA 1BOCA 2ZN9A 4N5XA 3BOWB 3BXKA 3LLEA 1EL4A 1MUXA 2JULA 1ZFSA 5D69A 2MLFC 1JBAA 2GV5A 5CPVA 2CNPA 1HT9A 5J3XA 1SYMA 2F33A 4PE1A 2F8PA 4JWQA 2Q91A 3HCMA 4U8DA 5AFPA 1TCFA 2LUXA 5DKRA 1F55A 1D1OA 2K7BA 2M7NA 1E8AA 3IF7A 1K93D 2JT0A 4DCKA 1LA3A 5KSZA 3LK0A 4ORAB 2BCAA 1TN4A 1A75B 1YTZC 2BL0C 3EKHA 1CFDA 1MWNA 1YUUA 1MF8B 1DT7B 1R6PA 4MVFA 1S26D 2WC8A 1OSAA 2AUCA 1SCVA 2KAVA 2KNEA 1BLQA 2KFFA 2Y5IA 1K9PA 2K8MB 2OTGC 1DJZA 2M29A 4XJKA 4YGCB 4GGFC 4YGBB 2FJUB 1IG5A 2LVVA 2NLNA 2Q4UA 2G9BA 4N1GA 1U5IA 1WRLA 3D0YB 4PHJA 2I94A 5KU1A 3LL8B 1CLBA 5DKQA 4AOMA 4GBAA 2LE9B 1M63B 1UUSA 3BQ3A 3O4YA 2P6BB 3TDIA 2ZNEA 4YI8A 1KWOC 2BL0B 2SCPA 3KF9A 1NX1A 4AQJA 1F71A 4FTGA 2BECA 1AP4A 1CNPA 1RROA 1CTRA 2WCFA 1J7PA 1NPQA 2E30A 4GNKB 1K2HA 1OZOA 1PK0D 3CR5X 1K95A 1OZSA 2JTZA 1B1GA 2PSRA 4HRHA 2MBXA 4MN0A 3VRQA 1DJIA 1S1EA 3ICBA 4ICBA 2KI6D 1S3PA 5HYDA 2G2BA 3BOWA 5FYXA 2LHIA 1KWOB 3I5GC 5JJGA 3EKJA 2L5XB 2JOJA 2ZRSA 2JTTA 1TNWA 3I5FC 5BPJA 1S5GZ 3KEVA 4NDDA 1DF0A 1V1GA 2KAYA 2WOSA 3O2PA 4I5NB 1XFUO 4HSZA 5AEQA 2PALA 1PRWA 1OMVA 1SPYA 2H61A 2K7DA 1XFXO 3DVJA 3EVVA 4CPVA 4DS7A 3BUXB 1J55A 3AKAA 5I8NA 2KQ6A 1XFWO 5G08A 3TUYC 2NCPA 2H2KA 1V1FA 1UURA 2JT8A 2BKHB 1GGWA 4HREE 3PFVA 3NSOA 1DJXA 2K61A 1A75A 2F3YA 5DKNA 3I5GB 2BCBA 3TS5C 1DJYA 1KK7Z 2JQ6A 1Y0VH 3M0WA 2BCXA 3AAJA 1SNLA 1DGUA 1VRKA 2HPSA 3I5FB 4GAOA 1UP5A 4C0JA 4YGAA 4OVNF 2LCPA 1UHNA 3DVKA 1JF0A 2JXLA 3BUNB 1NX0A 1YUTA 2I18A 5CSFA 2CBLA 1SKTA 4CLNA 2COLB 3EK7A 1QXPA 3O78A 3PLFB 4YRUA 2K7CA 4MRYA 1L2OC 1X02A 1TRFA 3IQOA 3NSLA 1JFKA 2MJWB 2OPOA 1B8CA 1PVAA 1ZUZA 2CT9A 2DOQA 4MSPA 4PDZA 3VRRA 1LVCD 1CLLA 3BYAA 1SL8A 4WQ3A 1M46A 1XK4A 1JSAA 1TIZA 3TS5B 4JQ0D 4HRGA 1CKKA 1G8IA 3BUOB 1AHRA 1M39A 3SJSA 2KI6C 3IQQA 3CS1A 1IGVA 2L4HA 1YURA 2PMYA 1NIWA 1S6IA 1KFUS 5ER5A 1FF1A 2L98A 5PALA 2LVJA 1PULA 1UWOA 1YX7A 2BBNA 1QV0A 2WNDA 1Y6WA 2KBMA 3SG2A 1L2OB 4MZLA 2ZKMX 4D1EA 1XA5A 2Y4QA 1B4CA 1CDLA 1K96A 2K7OA 3I5HC 4PHKA 2LNKA 4CFRA 2L51A 1JC2A 2JC2A 4C0LA 1S5GY 1SY9A 4DRWA 1A03A 1QATA 1G33A 3PM8A 1CM1A 1EJ3A 2KOTA 2NCOA 1LINA 3EK8A 4N1FA 1M45A 3TDZA 4OR9B 4YGDB 2PVBA 2AAOA 3RLZA 2Y1MA 1CM4A 3D10A 2F2OA 1QX2A 1CDPA 4NDCA 1WRKA 1PVBA 4NQGA 2JU0A 4QJ3B 4R1EA 1IQ3A 4M2QA 3O6BA 3PSRA 1CB1A 1YVLA 1KK7Y 1OMRA 1JUOA 3I5HB 5TNCA 2K0JA 1K9UA 2KAXA 1QLKA 3DF0B 3F45A 4DIRA 1NCZA 3AAKA 2QACA 2CCMA 2JRFA 1SL7A 1F70A 2CTNA 4PE7A 2GGMA 1KFXL 2FOTA 5D7FA 2WCEA 3NXAA 1B8LA 1EH2A 3EVRA 1K9KA 3PATA 4ZCVA 1AJ5A 1A2XA 2OTGB 1BR4B 3GK2A 1G4YR 2MRDA 1IWQA 1F8HA 5HLOA 4AQIA 2PRUA 4PHMA 1MXLC 1SCMC 3KHEA 2KQYA 1S6JA 2K2FA 3QRXA 2LLUA 3AKBA 4F0ZB 1QVIZ 2MAZA 2M9GA 5IBWA 5I2QA 2M0RA 1NP8A 2EHBA 2BBMA 2V53A 1GGZA 1NX3A 4GGNA 1QS7A 2ZFDA 4OV2A 3MSEB 3SG7A 3CZTX 1KQMC 1A4PA 2A4JA 1BR1B 4ORCB 1KK8C 5I2LA 1LA0A 2EC6C 1SBJA 3NSIA 1S6CA 2OS8C 1BU3A 2VRGA 1L7ZA 1SK6D 2HQ8A 1AJ4A 1SCMB 1UHHA 4C0KA 1YR5A 2JT3A 3LK1A 2MA2A 2EGDA 4IL1A 3OB1B 1MHOA 3VGOA 1LKJA 2KFGA 4JPZB 5GQQC 2KYCA 2I2RE 3TZ1A 3BUMB 5I2OA 1EG4A 2M97A 3DD4A 1S36A 1H8BA 1KQMB 3SG3A 2MLEC 4DUQA 1ALWA 2HF5A 4MZJA 2JPTA 1M31A 4PE0A 1RFJA 2KI4C 2EC6B 4L9MA 2OS8B 3DVMA 3A4UB 1C7VA 4GPLB 3LCPC 2NZ0A 2LVIA 3D0YA 3DF0A 2MHHA 3OB2B 4USLA 4YGEB 1CLMA 1GJYA 3TUYB 1B7TZ 1JF2A 4MZKA 5K89A 4XJKB 2LV7A 2RGIA 1UHIA 2L50A 5CSIA 1KQVA 2JXCA 3OX6A 2LMVA 1U5IB 1ZOTB 2FCEA 2ZN8A 3PALA 2WORA 1B47A 1B9AA 2PASA 2BKIB 2E6WA 3HX4A 1WDCC 2LUCA 3VRNA 1BT6A 4MEWA 2M8UA 4UPGA 1FW4A 1NCXA 5B8IB 2HETA 3SG5A 2KFHA 1PALA 3C1VA 2KI4B 2L4IA 4GGFA 5AERA 1CFCA 4YBHB 1YUSA 2D8NA 1SMGA 1SR6C 2H61C 1R2UA 2KSPA 3SG6A 1RK9A 1N2DA 1OE9B 1XO5A 4OCIA 1CMGA 1K90D 2LAPA 1CFPA 1IRJA 3K21A 1TNQA 3SG4A 1QJTA 1J7RA 2M1UA 3FIAA 1RECA 1EXRA 3H4SE 3GK4X 4CIDA 3EVUA 1ZMZA 1KSMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LMU A;  1IJ6 A;  2CXJ A;  4BY5 A;  1TNX A;  1MXE A;  1FI5 A;  1TCO B;  1HQV A;  2LC5 A;  1UHK A;  2KGB C;  2Y1N A;  3CGA A;  1DF0 B;  1J7Q A;  3OHM B;  4A4C A;  1YRU B;  1CDM A;  2ZND A;  1SR6 B;  1CFF A;  2TN4 A;  2K2A A;  4TNC A;  1K94 A;  4MLW A;  1ODB A;  1J7O A;  1C07 A;  2KDH A;  1C7W A;  2WCB A;  1XK4 C;  2JWW A;  3CLN A;  1LXF C;  3WXA A;  3FS7 A;  5HKY A;  4I5J A;  1FI6 A;  1TNP A;  3SIB A;  1J1D A;  1A29 A;  1QIV A;  4Q04 A;  1OOJ A;  1B7T Y;  4PCW A;  2M1K B;  3E3R A;  4WQ2 A;  5AAN A;  5ER4 X;  1EG3 A;  1AK8 A;  2F3Z A;  2LVK A;  4PAL A;  3OP0 A;  1SL9 A;  3PN7 C;  1QAS A;  1IKU A;  2LMT A;  1FPW A;  3A8R A;  3CR2 A;  1F54 A;  1ALV A;  1AUI B;  3ZNI A;  4ZCU A;  1W7I B;  2JNF A;  1NUB A;  3FWB A;  1PSB A;  2LLS A;  4OKH A;  5CSN A;  2JZI A;  1N0Y A;  2B1U A;  5CSJ A;  1IJ5 A;  4QJ5 B;  4MBE A;  2QPT A;  3WHU B;  1KSO A;  1Y1A A;  1AVS A;  1UHJ A;  2BE6 A;  4QJ4 B;  1CDN A;  1QLS A;  1YRT B;  2KGR A;  1NSH A;  1RTP 1;  1SW8 A;  3I5I C;  1Y1U A;  3DVE A;  2O5G A;  3SIA A;  1WRZ A;  4CFQ A;  1QX7 A;  3BUW B;  1QX5 B;  4NDB A;  3PN7 B;  2JNX A;  1ZAC A;  3EK4 A;  1QTX A;  3GK1 A;  1XVJ A;  1BG1 A;  1JFJ A;  2LHL A;  4ORB B;  4E68 A;  1KFU L;  1PSR A;  1Q80 A;  1IH0 A;  1F4O A;  3CWG A;  3OX5 A;  4XYN A;  3KO0 A;  1TOP A;  1Y1X A;  4PHN A;  3JVT C;  5KTY A;  1RWY A;  2FCD A;  3CTN A;  5F6T A;  4M2O A;  1BJF A;  3GOF A;  4P5O E;  1KCY A;  2LAN A;  2LP3 A;  3I5I B;  3TDU A;  5HKW A;  1RJV A;  1WLZ A;  1KK8 B;  2SAS A;  1NWD A;  4A4B A;  2M3W A;  2ISD A;  1XYD A;  4ETO A;  3JTD C;  1NX2 A;  1OMD A;  1WY9 A;  4MRX A;  1BOD A;  4I5L B;  1F4Q A;  2L0P A;  1TTX A;  4P2Y B;  2GGZ A;  2ZRT A;  3NSK A;  1QIW A;  1KFX S;  2LM5 A;  3VRP A;  2IS9 A;  2KHN A;  4GUK A;  4M2P A;  1YVH A;  1NYA A;  2F2P A;  3RM1 A;  4FQO A;  1FBV A;  3WNX B;  2M7L A;  1XFY O;  1SRA A;  1DVI A;  3JVT B;  4GFT A;  1DTL A;  1MQ1 A;  4I5K A;  1B8R A;  1WLM A;  1K8U A;  2LLT A;  2R2I A;  1BMO A;  1DJG A;  1NCY A;  2O60 A;  3VRO A;  3ZWH A;  2HQW A;  2BE4 A;  3CR4 X;  1YX8 A;  1H4B A;  3WHT B;  2KBI A;  4PE4 A;  2KYF A;  1DJW A;  3JTD B;  1DMO A;  1QVI Y;  5JOL A;  1JWD A;  5HLV A;  2NXQ A;  5HKZ A;  4WRI A;  1GQM A;  2M49 B;  1W7J B;  1QV1 A;  1MR8 A;  1OQP A;  2I7A A;  1N65 A;  1XFZ O;  1IQ5 A;  1DJH A;  4YI9 A;  1DGV A;  2L2E A;  2LP2 A;  1WDC B;  5AXI A;  3FWC A;  2AMI A;  4BY4 A;  3KPX A;  1BF5 A;  1CMF A;  1XFV O;  1J1E A;  1BOC A;  2ZN9 A;  4N5X A;  3BOW B;  3BXK A;  3LLE A;  1EL4 A;  1MUX A;  2JUL A;  1ZFS A;  5D69 A;  2MLF C;  1JBA A;  2GV5 A;  5CPV A;  2CNP A;  1HT9 A;  5J3X A;  1SYM A;  2F33 A;  4PE1 A;  2F8P A;  4JWQ A;  2Q91 A;  3HCM A;  4U8D A;  5AFP A;  1TCF A;  2LUX A;  5DKR A;  1F55 A;  1D1O A;  2K7B A;  2M7N A;  1E8A A;  3IF7 A;  1K93 D;  2JT0 A;  4DCK A;  1LA3 A;  5KSZ A;  3LK0 A;  4ORA B;  2BCA A;  1TN4 A;  1A75 B;  1YTZ C;  2BL0 C;  3EKH A;  1CFD A;  1MWN A;  1YUU A;  1MF8 B;  1DT7 B;  1R6P A;  4MVF A;  1S26 D;  2WC8 A;  1OSA A;  2AUC A;  1SCV A;  2KAV A;  2KNE A;  1BLQ A;  2KFF A;  2Y5I A;  1K9P A;  2K8M B;  2OTG C;  1DJZ A;  2M29 A;  4XJK A;  4YGC B;  4GGF C;  4YGB B;  2FJU B;  1IG5 A;  2LVV A;  2NLN A;  2Q4U A;  2G9B A;  4N1G A;  1U5I A;  1WRL A;  3D0Y B;  4PHJ A;  2I94 A;  5KU1 A;  3LL8 B;  1CLB A;  5DKQ A;  4AOM A;  4GBA A;  2LE9 B;  1M63 B;  1UUS A;  3BQ3 A;  3O4Y A;  2P6B B;  3TDI A;  2ZNE A;  4YI8 A;  1KWO C;  2BL0 B;  2SCP A;  3KF9 A;  1NX1 A;  4AQJ A;  1F71 A;  4FTG A;  2BEC A;  1AP4 A;  1CNP A;  1RRO A;  1CTR A;  2WCF A;  1J7P A;  1NPQ A;  2E30 A;  4GNK B;  1K2H A;  1OZO A;  1PK0 D;  3CR5 X;  1K95 A;  1OZS A;  2JTZ A;  1B1G A;  2PSR A;  4HRH A;  2MBX A;  4MN0 A;  3VRQ A;  1DJI A;  1S1E A;  3ICB A;  4ICB A;  2KI6 D;  1S3P A;  5HYD A;  2G2B A;  3BOW A;  5FYX A;  2LHI A;  1KWO B;  3I5G C;  5JJG A;  3EKJ A;  2L5X B;  2JOJ A;  2ZRS A;  2JTT A;  1TNW A;  3I5F C;  5BPJ A;  1S5G Z;  3KEV A;  4NDD A;  1DF0 A;  1V1G A;  2KAY A;  2WOS A;  3O2P A;  4I5N B;  1XFU O;  4HSZ A;  5AEQ A;  2PAL A;  1PRW A;  1OMV A;  1SPY A;  2H61 A;  2K7D A;  1XFX O;  3DVJ A;  3EVV A;  4CPV A;  4DS7 A;  3BUX B;  1J55 A;  3AKA A;  5I8N A;  2KQ6 A;  1XFW O;  5G08 A;  3TUY C;  2NCP A;  2H2K A;  1V1F A;  1UUR A;  2JT8 A;  2BKH B;  1GGW A;  4HRE E;  3PFV A;  3NSO A;  1DJX A;  2K61 A;  1A75 A;  2F3Y A;  5DKN A;  3I5G B;  2BCB A;  3TS5 C;  1DJY A;  1KK7 Z;  2JQ6 A;  1Y0V H;  3M0W A;  2BCX A;  3AAJ A;  1SNL A;  1DGU A;  1VRK A;  2HPS A;  3I5F B;  4GAO A;  1UP5 A;  4C0J A;  4YGA A;  4OVN F;  2LCP A;  1UHN A;  3DVK A;  1JF0 A;  2JXL A;  3BUN B;  1NX0 A;  1YUT A;  2I18 A;  5CSF A;  2CBL A;  1SKT A;  4CLN A;  2COL B;  3EK7 A;  1QXP A;  3O78 A;  3PLF B;  4YRU A;  2K7C A;  4MRY A;  1L2O C;  1X02 A;  1TRF A;  3IQO A;  3NSL A;  1JFK A;  2MJW B;  2OPO A;  1B8C A;  1PVA A;  1ZUZ A;  2CT9 A;  2DOQ A;  4MSP A;  4PDZ A;  3VRR A;  1LVC D;  1CLL A;  3BYA A;  1SL8 A;  4WQ3 A;  1M46 A;  1XK4 A;  1JSA A;  1TIZ A;  3TS5 B;  4JQ0 D;  4HRG A;  1CKK A;  1G8I A;  3BUO B;  1AHR A;  1M39 A;  3SJS A;  2KI6 C;  3IQQ A;  3CS1 A;  1IGV A;  2L4H A;  1YUR A;  2PMY A;  1NIW A;  1S6I A;  1KFU S;  5ER5 A;  1FF1 A;  2L98 A;  5PAL A;  2LVJ A;  1PUL A;  1UWO A;  1YX7 A;  2BBN A;  1QV0 A;  2WND A;  1Y6W A;  2KBM A;  3SG2 A;  1L2O B;  4MZL A;  2ZKM X;  4D1E A;  1XA5 A;  2Y4Q A;  1B4C A;  1CDL A;  1K96 A;  2K7O A;  3I5H C;  4PHK A;  2LNK A;  4CFR A;  2L51 A;  1JC2 A;  2JC2 A;  4C0L A;  1S5G Y;  1SY9 A;  4DRW A;  1A03 A;  1QAT A;  1G33 A;  3PM8 A;  1CM1 A;  1EJ3 A;  2KOT A;  2NCO A;  1LIN A;  3EK8 A;  4N1F A;  1M45 A;  3TDZ A;  4OR9 B;  4YGD B;  2PVB A;  2AAO A;  3RLZ A;  2Y1M A;  1CM4 A;  3D10 A;  2F2O A;  1QX2 A;  1CDP A;  4NDC A;  1WRK A;  1PVB A;  4NQG A;  2JU0 A;  4QJ3 B;  4R1E A;  1IQ3 A;  4M2Q A;  3O6B A;  3PSR A;  1CB1 A;  1YVL A;  1KK7 Y;  1OMR A;  1JUO A;  3I5H B;  5TNC A;  2K0J A;  1K9U A;  2KAX A;  1QLK A;  3DF0 B;  3F45 A;  4DIR A;  1NCZ A;  3AAK A;  2QAC A;  2CCM A;  2JRF A;  1SL7 A;  1F70 A;  2CTN A;  4PE7 A;  2GGM A;  1KFX L;  2FOT A;  5D7F A;  2WCE A;  3NXA A;  1B8L A;  1EH2 A;  3EVR A;  1K9K A;  3PAT A;  4ZCV A;  1AJ5 A;  1A2X A;  2OTG B;  1BR4 B;  3GK2 A;  1G4Y R;  2MRD A;  1IWQ A;  1F8H A;  5HLO A;  4AQI A;  2PRU A;  4PHM A;  1MXL C;  1SCM C;  3KHE A;  2KQY A;  1S6J A;  2K2F A;  3QRX A;  2LLU A;  3AKB A;  4F0Z B;  1QVI Z;  2MAZ A;  2M9G A;  5IBW A;  5I2Q A;  2M0R A;  1NP8 A;  2EHB A;  2BBM A;  2V53 A;  1GGZ A;  1NX3 A;  4GGN A;  1QS7 A;  2ZFD A;  4OV2 A;  3MSE B;  3SG7 A;  3CZT X;  1KQM C;  1A4P A;  2A4J A;  1BR1 B;  4ORC B;  1KK8 C;  5I2L A;  1LA0 A;  2EC6 C;  1SBJ A;  3NSI A;  1S6C A;  2OS8 C;  1BU3 A;  2VRG A;  1L7Z A;  1SK6 D;  2HQ8 A;  1AJ4 A;  1SCM B;  1UHH A;  4C0K A;  1YR5 A;  2JT3 A;  3LK1 A;  2MA2 A;  2EGD A;  4IL1 A;  3OB1 B;  1MHO A;  3VGO A;  1LKJ A;  2KFG A;  4JPZ B;  5GQQ C;  2KYC A;  2I2R E;  3TZ1 A;  3BUM B;  5I2O A;  1EG4 A;  2M97 A;  3DD4 A;  1S36 A;  1H8B A;  1KQM B;  3SG3 A;  2MLE C;  4DUQ A;  1ALW A;  2HF5 A;  4MZJ A;  2JPT A;  1M31 A;  4PE0 A;  1RFJ A;  2KI4 C;  2EC6 B;  4L9M A;  2OS8 B;  3DVM A;  3A4U B;  1C7V A;  4GPL B;  3LCP C;  2NZ0 A;  2LVI A;  3D0Y A;  3DF0 A;  2MHH A;  3OB2 B;  4USL A;  4YGE B;  1CLM A;  1GJY A;  3TUY B;  1B7T Z;  1JF2 A;  4MZK A;  5K89 A;  4XJK B;  2LV7 A;  2RGI A;  1UHI A;  2L50 A;  5CSI A;  1KQV A;  2JXC A;  3OX6 A;  2LMV A;  1U5I B;  1ZOT B;  2FCE A;  2ZN8 A;  3PAL A;  2WOR A;  1B47 A;  1B9A A;  2PAS A;  2BKI B;  2E6W A;  3HX4 A;  1WDC C;  2LUC A;  3VRN A;  1BT6 A;  4MEW A;  2M8U A;  4UPG A;  1FW4 A;  1NCX A;  5B8I B;  2HET A;  3SG5 A;  2KFH A;  1PAL A;  3C1V A;  2KI4 B;  2L4I A;  4GGF A;  5AER A;  1CFC A;  4YBH B;  1YUS A;  2D8N A;  1SMG A;  1SR6 C;  2H61 C;  1R2U A;  2KSP A;  3SG6 A;  1RK9 A;  1N2D A;  1OE9 B;  1XO5 A;  4OCI A;  1CMG A;  1K90 D;  2LAP A;  1CFP A;  1IRJ A;  3K21 A;  1TNQ A;  3SG4 A;  1QJT A;  1J7R A;  2M1U A;  3FIA A;  1REC A;  1EXR A;  3H4S E;  3GK4 X;  4CID A;  3EVU A;  1ZMZ A;  1KSM A; 
#chains in the Genus database with same CATH topology
 2LMU A;  1IJ6 A;  2CXJ A;  4BY5 A;  1TNX A;  1MXE A;  1FI5 A;  1TCO B;  1HQV A;  1OOF A;  1UHK A;  2KGB C;  2LC5 A;  2Y1N A;  3CGA A;  1DF0 B;  1J7Q A;  3OHM B;  4A4C A;  1YRU B;  1CDM A;  2ZND A;  1SR6 B;  3S0A A;  1CFF A;  2TN4 A;  2K2A A;  4TNC A;  1K94 A;  4MLW A;  1ODB A;  3B88 A;  1J7O A;  1C07 A;  2KDH A;  1C7W A;  2WCB A;  1XK4 C;  3D76 A;  3PM2 A;  2JWW A;  3CLN A;  1LXF C;  3WXA A;  3FS7 A;  5HKY A;  4I5J A;  1FI6 A;  1TNP A;  3SIB A;  1J1D A;  2WCH A;  1A29 A;  1QIV A;  4Q04 A;  3K1E A;  1OOJ A;  1B7T Y;  4PCW A;  2M1K B;  3E3R A;  1LS8 A;  4WQ2 A;  5AAN A;  3IVT A;  5ER4 X;  1EG3 A;  1AK8 A;  2F3Z A;  2LVK A;  1Z4H A;  2KPH A;  4PAL A;  3OP0 A;  1SL9 A;  3PN7 C;  1QAS A;  1IKU A;  2LMT A;  1FPW A;  3A8R A;  3CR2 A;  1F54 A;  1ALV A;  1AUI B;  3ZNI A;  4ZCU A;  1W7I B;  2JNF A;  1NUB A;  2WCM A;  1PSB A;  2LLS A;  3FWB A;  4OKH A;  5CSN A;  2JZI A;  1N0Y A;  2B1U A;  5CSJ A;  1IJ5 A;  2WC5 A;  4QJ5 B;  4MBE A;  2QPT A;  3WHU B;  1KSO A;  1Y1A A;  1AVS A;  1UHJ A;  2BE6 A;  4QJ4 B;  1CDN A;  1QLS A;  1YRT B;  2KGR A;  3RZS A;  1NSH A;  1RTP 1;  1SW8 A;  3I5I C;  1Y1U A;  3DVE A;  2O5G A;  3SIA A;  1WRZ A;  4CFQ A;  1QX7 A;  3BUW B;  1QX5 B;  3CZ0 A;  4NDB A;  3PN7 B;  2JNX A;  1ZAC A;  3EK4 A;  1QTX A;  3GK1 A;  1XVJ A;  3SS4 A;  1BG1 A;  1JFJ A;  2LHL A;  4ORB B;  4E68 A;  1KFU L;  1PSR A;  1Q80 A;  4JD9 A;  1F4O A;  1IH0 A;  2KLD A;  2KLE A;  3CWG A;  3OX5 A;  4XYN A;  3KO0 A;  1TOP A;  1Y1X A;  4PHN A;  3JVT C;  1OW4 A;  5KTY A;  1RWY A;  2FCD A;  3CTN A;  3DYE A;  5F6T A;  4M2O A;  1BJF A;  3GOF A;  4P5O E;  1KCY A;  2LAN A;  2LP3 A;  3I5I B;  3TDU A;  3B86 A;  5HKW A;  1RJV A;  1WLZ A;  1KK8 B;  2SAS A;  1NWD A;  3FE9 A;  4A4B A;  2M3W A;  2ISD A;  1XYD A;  4ETO A;  3JTD C;  1NX2 A;  1OMD A;  1WY9 A;  4MRX A;  4PT1 A;  1BOD A;  4I5L B;  1F4Q A;  2L0P A;  1TTX A;  3B87 A;  4P2Y B;  2GGZ A;  2ZRT A;  3NSK A;  1QIW A;  1KFX S;  2LM5 A;  3VB1 A;  2IS9 A;  2KHN A;  3UO9 A;  3VRP A;  4GUK A;  4M2P A;  1YVH A;  1NYA A;  2F2P A;  3RM1 A;  4FQO A;  1FBV A;  3S0E A;  3WNX B;  2M7L A;  1XFY O;  1SRA A;  1DVI A;  3JVT B;  4GFT A;  1DTL A;  1MQ1 A;  4I5K A;  1B8R A;  1WLM A;  1K8U A;  2LLT A;  1IIO A;  2R2I A;  1BMO A;  1DJG A;  1NCY A;  3DXL A;  3OGN A;  2O60 A;  3CZ2 A;  3VRO A;  3ZWH A;  2HQW A;  2BE4 A;  3CR4 X;  1YX8 A;  1H4B A;  3BJH A;  1DQE A;  3R72 A;  3WHT B;  2KBI A;  4PE4 A;  2KYF A;  1DJW A;  3JTD B;  1DMO A;  1QVI Y;  5JOL A;  1JWD A;  3BFB A;  3R1V A;  2NXQ A;  3DZT A;  5HLV A;  5HKZ A;  4WRI A;  1GQM A;  2M49 B;  1W7J B;  1QV1 A;  1MR8 A;  1OQP A;  2I7A A;  1C3Y A;  1N65 A;  1XFZ O;  1IQ5 A;  5D3O A;  1TUJ A;  1DJH A;  4YI9 A;  1DGV A;  2L2E A;  2LP2 A;  1WDC B;  5AXI A;  3FWC A;  2AMI A;  4BY4 A;  3KPX A;  1BF5 A;  3S0G A;  1CMF A;  1XFV O;  1J1E A;  1BOC A;  2ZN9 A;  4N5X A;  3BOW B;  3BXK A;  3FE8 A;  3LLE A;  1EL4 A;  2L5Y A;  1MUX A;  2JUL A;  1ZFS A;  5D69 A;  2MLF C;  1JBA A;  2GV5 A;  5CPV A;  2CNP A;  1HT9 A;  5J3X A;  1SYM A;  2F33 A;  4PE1 A;  2F8P A;  4JWQ A;  2Q91 A;  3HCM A;  4U8D A;  5AFP A;  1TCF A;  2LUX A;  3B6X A;  5DKR A;  1D1O A;  2K7B A;  2M7N A;  1F55 A;  1E8A A;  3IF7 A;  3V2L A;  1K93 D;  2BNX A;  2JT0 A;  2P71 A;  4DCK A;  1QWV A;  1LA3 A;  5KSZ A;  3LK0 A;  4ORA B;  2BCA A;  1TN4 A;  1A75 B;  1YTZ C;  2BL0 C;  3EKH A;  1CFD A;  1MWN A;  1YUU A;  1MF8 B;  1DT7 B;  1R6P A;  4MVF A;  1S26 D;  2WC8 A;  1OSA A;  2AUC A;  1SCV A;  2KAV A;  2KNE A;  1BLQ A;  1XFR A;  2KFF A;  2Y5I A;  1K9P A;  5I94 A;  2K8M B;  2OTG C;  1DJZ A;  2M29 A;  4XJK A;  4YGC B;  1SSE B;  4GGF C;  4OZD A;  4YGB B;  2FJU B;  1IG5 A;  2LVV A;  2NLN A;  2Q4U A;  2G9B A;  4N1G A;  1U5I A;  1WRL A;  3D0Y B;  4PHJ A;  2I94 A;  5KU1 A;  3LL8 B;  1CLB A;  5DKQ A;  4AOM A;  4GBA A;  2LE9 B;  1M63 B;  1UUS A;  3BQ3 A;  3O4Y A;  2P6B B;  3TDI A;  3NGV A;  2ZNE A;  4YI8 A;  1KWO C;  2BL0 B;  2SCP A;  3KF9 A;  3SS5 A;  1NX1 A;  4AQJ A;  1F71 A;  4FTG A;  2BEC A;  1AP4 A;  1CNP A;  1RRO A;  1CTR A;  2WCF A;  1J7P A;  1NPQ A;  2E30 A;  3N7H A;  3D77 A;  4GNK B;  1K2H A;  1OZO A;  1PK0 D;  3CR5 X;  1K95 A;  1OZS A;  2JTZ A;  1B1G A;  2PSR A;  4HRH A;  2MBX A;  4MN0 A;  3VRQ A;  1DJI A;  1S1E A;  3ICB A;  1OOH A;  4ICB A;  2KI6 D;  1S3P A;  3D75 A;  2G2B A;  2YGU A;  5HYD A;  3BOW A;  5FYX A;  2LHI A;  1KWO B;  3I5G C;  5JJG A;  3NHI A;  3EKJ A;  2L5X B;  1DC1 A;  2JOJ A;  2ZRS A;  4KYN A;  2JTT A;  1TNW A;  3I5F C;  5BPJ A;  1S5G Z;  3KEV A;  4NDD A;  1DF0 A;  1V1G A;  2KAY A;  2WOS A;  3D78 A;  3O2P A;  1XFU O;  4HSZ A;  4I5N B;  2PAL A;  1PRW A;  5AEQ A;  1OMV A;  1SPY A;  3D74 A;  2H61 A;  2K7D A;  1XFX O;  3DVJ A;  3EVV A;  4CPV A;  4DS7 A;  3BUX B;  1J55 A;  3AKA A;  1DEL A;  5I8N A;  2KQ6 A;  1XFW O;  5G08 A;  3TUY C;  2NCP A;  3R1P A;  2H2K A;  1V1F A;  1UUR A;  2JT8 A;  2BKH B;  1GGW A;  1W9Z A;  3DY9 A;  4HRE E;  3PFV A;  3NSO A;  1DJX A;  2K61 A;  1A75 A;  2F3Y A;  5DKN A;  3I5G B;  2GTE A;  2BCB A;  3TS5 C;  1DJY A;  1KK7 Z;  2JQ6 A;  1Y0V H;  3M0W A;  2BCX A;  3AAJ A;  1SNL A;  1DGU A;  1VRK A;  2HPS A;  3I5F B;  4GAO A;  1UP5 A;  4C0J A;  4YGA A;  1C3Z A;  4OVN F;  2LCP A;  1UHN A;  3DVK A;  1GM0 A;  1JF0 A;  2JXL A;  3BUN B;  1NX0 A;  1YUT A;  2I18 A;  5CSF A;  2CBL A;  1SKT A;  4CLN A;  5EL2 A;  2COL B;  3EK7 A;  1QXP A;  3O78 A;  3PLF B;  5DIC A;  4YRU A;  2K7C A;  4MRY A;  1L2O C;  1X02 A;  1TRF A;  3IQO A;  3NSL A;  1JFK A;  2MJW B;  2OPO A;  1B8C A;  1PVA A;  1ZUZ A;  2CT9 A;  2DOQ A;  4MSP A;  4PDZ A;  3VRR A;  1LVC D;  1CLL A;  3BYA A;  1SL8 A;  4WQ3 A;  1M46 A;  1XK4 A;  1JSA A;  1TIZ A;  3TS5 B;  4JQ0 D;  4INW A;  1TWO A;  4HRG A;  1CKK A;  1G8I A;  3BUO B;  1AHR A;  3CAB A;  1M39 A;  3OBV A;  3SJS A;  2KI6 C;  3IQQ A;  3CS1 A;  1IGV A;  2L4H A;  3L47 A;  1ORG A;  1YUR A;  3L4A A;  2PMY A;  1NIW A;  1S6I A;  1KFU S;  2P70 A;  5ER5 A;  1FF1 A;  2L98 A;  4IJ7 A;  4INX A;  2LVJ A;  5PAL A;  1PUL A;  1UWO A;  1YX7 A;  2BBN A;  2JPO A;  1QV0 A;  2WND A;  1Y6W A;  2KBM A;  3SG2 A;  1L2O B;  4MZL A;  2ZKM X;  3CYZ A;  4D1E A;  2QEB A;  1XA5 A;  2Y4Q A;  1B4C A;  1CDL A;  1K96 A;  2K7O A;  3I5H C;  3CDN A;  2LNK A;  4PHK A;  4CFR A;  2L51 A;  2QEH A;  1JC2 A;  2L2C A;  2ERB A;  2JC2 A;  4C0L A;  1S5G Y;  1DEK A;  1SY9 A;  4DRW A;  1A03 A;  3SS3 A;  1QAT A;  1G33 A;  3PM8 A;  1CM1 A;  1EJ3 A;  1P28 A;  2KOT A;  1LIN A;  2NCO A;  3EK8 A;  1M45 A;  4N1F A;  3S0B A;  3TDZ A;  4OR9 B;  4YGD B;  2PVB A;  2AAO A;  3RLZ A;  2Y1M A;  1CM4 A;  3D10 A;  2F2O A;  1QX2 A;  1CDP A;  4NDC A;  1OOG A;  1WRK A;  1PVB A;  4NQG A;  2JU0 A;  4QJ3 B;  4R1E A;  4F7F A;  1IQ3 A;  4M2Q A;  3O6B A;  3PSR A;  1CB1 A;  1YVL A;  1KK7 Y;  1OMR A;  1JUO A;  3I5H B;  5TNC A;  2K0J A;  4FQT A;  3PJI A;  3D73 A;  1K9U A;  2KAX A;  1QLK A;  3DF0 B;  3F45 A;  4DIR A;  1NCZ A;  3L4L A;  3AAK A;  2QAC A;  2CCM A;  2JRF A;  2WCL A;  2QEO A;  1SL7 A;  1F70 A;  2CTN A;  4PE7 A;  5FI7 A;  2GGM A;  1KFX L;  2FOT A;  5D7F A;  2WCE A;  3NHT A;  3UNW A;  3NXA A;  1B8L A;  1EH2 A;  3EVR A;  1K9K A;  3PAT A;  4ZCV A;  1AJ5 A;  1A2X A;  2OTG B;  1BR4 B;  3GK2 A;  1G4Y R;  2MRD A;  1IWQ A;  1T14 A;  3O4X A;  1F8H A;  5HLO A;  4AQI A;  2PRU A;  4PHM A;  2WCK A;  1MXL C;  1SCM C;  2QDI A;  3KHE A;  2KQY A;  1S6J A;  2K2F A;  3QRX A;  2LLU A;  3AKB A;  2PYQ A;  4F0Z B;  1QVI Z;  2MAZ A;  2M9G A;  2WC6 A;  5IBW A;  5I2Q A;  2M0R A;  1NP8 A;  2EHB A;  2BBM A;  2V53 A;  1GGZ A;  1NX3 A;  3B7A A;  4GGN A;  1QS7 A;  2ZFD A;  4OV2 A;  1Z2C B;  3MSE B;  3SG7 A;  3CZT X;  1KQM C;  1A4P A;  2A4J A;  5FI2 A;  1BR1 B;  4ORC B;  1KK8 C;  3QME A;  5I2L A;  1LA0 A;  2EC6 C;  1SBJ A;  3NSI A;  1S6C A;  2FJY A;  2OS8 C;  2BAP A;  1BU3 A;  2VRG A;  1L7Z A;  1SK6 D;  2HQ8 A;  1AJ4 A;  1SCM B;  1UHH A;  4JKT A;  4C0K A;  1OOI X;  1YR5 A;  2JT3 A;  3LK1 A;  3S0F A;  1TUZ A;  2EGD A;  2MA2 A;  4IL1 A;  3OB1 B;  1MHO A;  3VGO A;  1LKJ A;  3BFH A;  5HL1 A;  2KFG A;  4JPZ B;  5GQQ C;  2KYC A;  3S0D A;  2I2R E;  3TZ1 A;  3BUM B;  5I2O A;  1EG4 A;  2M97 A;  3FE6 A;  3DD4 A;  1S36 A;  3EG5 B;  1H8B A;  1KQM B;  3BFA A;  2MLE C;  3SG3 A;  4DUQ A;  1ALW A;  2K60 A;  2HF5 A;  4MZJ A;  2JPT A;  1M31 A;  4PE0 A;  1RFJ A;  5FI6 A;  2KI4 C;  2EC6 B;  4L9M A;  2OS8 B;  3CZ1 A;  3DVM A;  3A4U B;  1C7V A;  4GPL B;  3LCP C;  2NZ0 A;  2LVI A;  3D0Y A;  3DF0 A;  2H8V A;  2MHH A;  3OB2 B;  4USL A;  4YGE B;  1CLM A;  1GJY A;  3TUY B;  1B7T Z;  1JF2 A;  4MZK A;  5K89 A;  4XJK B;  2LV7 A;  2RGI A;  1UHI A;  2L50 A;  3R1O A;  5CSI A;  1KQV A;  2JXC A;  3OX6 A;  2LMV A;  1U5I B;  1ZOT B;  2PQL A;  2FCE A;  2ZN8 A;  3PAL A;  2WOR A;  1B47 A;  1B9A A;  2PAS A;  2BKI B;  2E6W A;  3HX4 A;  1WDC C;  2QEV A;  2LUC A;  2WCJ A;  3VRN A;  1BT6 A;  4MEW A;  2M8U A;  4UPG A;  1FW4 A;  1NCX A;  5B8I B;  2HET A;  3SG5 A;  2KFH A;  1PAL A;  3C1V A;  2KI4 B;  2L4I A;  4GGF A;  5AER A;  1CFC A;  3Q8I A;  4YBH B;  1YUS A;  2D8N A;  1SMG A;  1SR6 C;  2H61 C;  1R2U A;  2KSP A;  3SG6 A;  1RK9 A;  1N2D A;  1OE9 B;  1XO5 A;  4OCI A;  1CMG A;  1K90 D;  2LAP A;  1CFP A;  1IRJ A;  3K21 A;  1TNQ A;  3SG4 A;  1QJT A;  1J7R A;  2M1U A;  3FIA A;  1REC A;  1EXR A;  3H4S E;  3GK4 X;  4CID A;  3EVU A;  1ZMZ A;  1KSM A; 
#chains in the Genus database with same CATH homology
 2LMU A;  1IJ6 A;  2CXJ A;  4BY5 A;  1TNX A;  1MXE A;  1FI5 A;  1TCO B;  1HQV A;  2LC5 A;  1UHK A;  2KGB C;  2Y1N A;  3CGA A;  1DF0 B;  1J7Q A;  3OHM B;  4A4C A;  1YRU B;  1CDM A;  2ZND A;  1SR6 B;  1CFF A;  2TN4 A;  2K2A A;  4TNC A;  1K94 A;  4MLW A;  1ODB A;  1J7O A;  1C07 A;  2KDH A;  1C7W A;  2WCB A;  1XK4 C;  2JWW A;  3CLN A;  1LXF C;  3WXA A;  3FS7 A;  5HKY A;  4I5J A;  1FI6 A;  1TNP A;  3SIB A;  1J1D A;  1A29 A;  1QIV A;  4Q04 A;  1OOJ A;  1B7T Y;  4PCW A;  2M1K B;  3E3R A;  4WQ2 A;  5AAN A;  5ER4 X;  1EG3 A;  1AK8 A;  2F3Z A;  2LVK A;  4PAL A;  3OP0 A;  1SL9 A;  3PN7 C;  1QAS A;  1IKU A;  2LMT A;  1FPW A;  3A8R A;  3CR2 A;  1F54 A;  1ALV A;  1AUI B;  3ZNI A;  4ZCU A;  1W7I B;  2JNF A;  1NUB A;  3FWB A;  1PSB A;  2LLS A;  4OKH A;  5CSN A;  2JZI A;  1N0Y A;  2B1U A;  5CSJ A;  1IJ5 A;  4QJ5 B;  4MBE A;  2QPT A;  3WHU B;  1KSO A;  1Y1A A;  1AVS A;  1UHJ A;  2BE6 A;  4QJ4 B;  1CDN A;  1QLS A;  1YRT B;  2KGR A;  1NSH A;  1RTP 1;  1SW8 A;  3I5I C;  1Y1U A;  3DVE A;  2O5G A;  3SIA A;  1WRZ A;  4CFQ A;  1QX7 A;  3BUW B;  1QX5 B;  4NDB A;  3PN7 B;  2JNX A;  1ZAC A;  3EK4 A;  1QTX A;  3GK1 A;  1XVJ A;  1BG1 A;  1JFJ A;  2LHL A;  4ORB B;  4E68 A;  1KFU L;  1PSR A;  1Q80 A;  1IH0 A;  1F4O A;  3CWG A;  3OX5 A;  4XYN A;  3KO0 A;  1TOP A;  1Y1X A;  4PHN A;  3JVT C;  5KTY A;  1RWY A;  2FCD A;  3CTN A;  5F6T A;  4M2O A;  1BJF A;  3GOF A;  4P5O E;  1KCY A;  2LAN A;  2LP3 A;  3I5I B;  3TDU A;  5HKW A;  1RJV A;  1WLZ A;  1KK8 B;  2SAS A;  1NWD A;  4A4B A;  2M3W A;  2ISD A;  1XYD A;  4ETO A;  3JTD C;  1NX2 A;  1OMD A;  1WY9 A;  4MRX A;  1BOD A;  4I5L B;  1F4Q A;  2L0P A;  1TTX A;  4P2Y B;  2GGZ A;  2ZRT A;  3NSK A;  1QIW A;  1KFX S;  2LM5 A;  3VRP A;  2IS9 A;  2KHN A;  4GUK A;  4M2P A;  1YVH A;  1NYA A;  2F2P A;  3RM1 A;  4FQO A;  1FBV A;  3WNX B;  2M7L A;  1XFY O;  1SRA A;  1DVI A;  3JVT B;  4GFT A;  1DTL A;  1MQ1 A;  4I5K A;  1B8R A;  1WLM A;  1K8U A;  2LLT A;  2R2I A;  1BMO A;  1DJG A;  1NCY A;  2O60 A;  3VRO A;  3ZWH A;  2HQW A;  2BE4 A;  3CR4 X;  1YX8 A;  1H4B A;  3WHT B;  2KBI A;  4PE4 A;  2KYF A;  1DJW A;  3JTD B;  1DMO A;  1QVI Y;  5JOL A;  1JWD A;  5HLV A;  2NXQ A;  5HKZ A;  4WRI A;  1GQM A;  2M49 B;  1W7J B;  1QV1 A;  1MR8 A;  1OQP A;  2I7A A;  1N65 A;  1XFZ O;  1IQ5 A;  1DJH A;  4YI9 A;  1DGV A;  2L2E A;  2LP2 A;  1WDC B;  5AXI A;  3FWC A;  2AMI A;  4BY4 A;  3KPX A;  1BF5 A;  1CMF A;  1XFV O;  1J1E A;  1BOC A;  2ZN9 A;  4N5X A;  3BOW B;  3BXK A;  3LLE A;  1EL4 A;  1MUX A;  2JUL A;  1ZFS A;  5D69 A;  2MLF C;  1JBA A;  2GV5 A;  5CPV A;  2CNP A;  1HT9 A;  5J3X A;  1SYM A;  2F33 A;  4PE1 A;  2F8P A;  4JWQ A;  2Q91 A;  3HCM A;  4U8D A;  5AFP A;  1TCF A;  2LUX A;  5DKR A;  1F55 A;  1D1O A;  2K7B A;  2M7N A;  1E8A A;  3IF7 A;  1K93 D;  2JT0 A;  4DCK A;  1LA3 A;  5KSZ A;  3LK0 A;  4ORA B;  2BCA A;  1TN4 A;  1A75 B;  1YTZ C;  2BL0 C;  3EKH A;  1CFD A;  1MWN A;  1YUU A;  1MF8 B;  1DT7 B;  1R6P A;  4MVF A;  1S26 D;  2WC8 A;  1OSA A;  2AUC A;  1SCV A;  2KAV A;  2KNE A;  1BLQ A;  2KFF A;  2Y5I A;  1K9P A;  2K8M B;  2OTG C;  1DJZ A;  2M29 A;  4XJK A;  4YGC B;  4GGF C;  4YGB B;  2FJU B;  1IG5 A;  2LVV A;  2NLN A;  2Q4U A;  2G9B A;  4N1G A;  1U5I A;  1WRL A;  3D0Y B;  4PHJ A;  2I94 A;  5KU1 A;  3LL8 B;  1CLB A;  5DKQ A;  4AOM A;  4GBA A;  2LE9 B;  1M63 B;  1UUS A;  3BQ3 A;  3O4Y A;  2P6B B;  3TDI A;  2ZNE A;  4YI8 A;  1KWO C;  2BL0 B;  2SCP A;  3KF9 A;  1NX1 A;  4AQJ A;  1F71 A;  4FTG A;  2BEC A;  1AP4 A;  1CNP A;  1RRO A;  1CTR A;  2WCF A;  1J7P A;  1NPQ A;  2E30 A;  4GNK B;  1K2H A;  1OZO A;  1PK0 D;  3CR5 X;  1K95 A;  1OZS A;  2JTZ A;  1B1G A;  2PSR A;  4HRH A;  2MBX A;  4MN0 A;  3VRQ A;  1DJI A;  1S1E A;  3ICB A;  4ICB A;  2KI6 D;  1S3P A;  5HYD A;  2G2B A;  3BOW A;  5FYX A;  2LHI A;  1KWO B;  3I5G C;  5JJG A;  3EKJ A;  2L5X B;  2JOJ A;  2ZRS A;  2JTT A;  1TNW A;  3I5F C;  5BPJ A;  1S5G Z;  3KEV A;  4NDD A;  1DF0 A;  1V1G A;  2KAY A;  2WOS A;  3O2P A;  4I5N B;  1XFU O;  4HSZ A;  5AEQ A;  2PAL A;  1PRW A;  1OMV A;  1SPY A;  2H61 A;  2K7D A;  1XFX O;  3DVJ A;  3EVV A;  4CPV A;  4DS7 A;  3BUX B;  1J55 A;  3AKA A;  5I8N A;  2KQ6 A;  1XFW O;  5G08 A;  3TUY C;  2NCP A;  2H2K A;  1V1F A;  1UUR A;  2JT8 A;  2BKH B;  1GGW A;  4HRE E;  3PFV A;  3NSO A;  1DJX A;  2K61 A;  1A75 A;  2F3Y A;  5DKN A;  3I5G B;  2BCB A;  3TS5 C;  1DJY A;  1KK7 Z;  2JQ6 A;  1Y0V H;  3M0W A;  2BCX A;  3AAJ A;  1SNL A;  1DGU A;  1VRK A;  2HPS A;  3I5F B;  4GAO A;  1UP5 A;  4C0J A;  4YGA A;  4OVN F;  2LCP A;  1UHN A;  3DVK A;  1JF0 A;  2JXL A;  3BUN B;  1NX0 A;  1YUT A;  2I18 A;  5CSF A;  2CBL A;  1SKT A;  4CLN A;  2COL B;  3EK7 A;  1QXP A;  3O78 A;  3PLF B;  4YRU A;  2K7C A;  4MRY A;  1L2O C;  1X02 A;  1TRF A;  3IQO A;  3NSL A;  1JFK A;  2MJW B;  2OPO A;  1B8C A;  1PVA A;  1ZUZ A;  2CT9 A;  2DOQ A;  4MSP A;  4PDZ A;  3VRR A;  1LVC D;  1CLL A;  3BYA A;  1SL8 A;  4WQ3 A;  1M46 A;  1XK4 A;  1JSA A;  1TIZ A;  3TS5 B;  4JQ0 D;  4HRG A;  1CKK A;  1G8I A;  3BUO B;  1AHR A;  1M39 A;  3SJS A;  2KI6 C;  3IQQ A;  3CS1 A;  1IGV A;  2L4H A;  1YUR A;  2PMY A;  1NIW A;  1S6I A;  1KFU S;  5ER5 A;  1FF1 A;  2L98 A;  5PAL A;  2LVJ A;  1PUL A;  1UWO A;  1YX7 A;  2BBN A;  1QV0 A;  2WND A;  1Y6W A;  2KBM A;  3SG2 A;  1L2O B;  4MZL A;  2ZKM X;  4D1E A;  1XA5 A;  2Y4Q A;  1B4C A;  1CDL A;  1K96 A;  2K7O A;  3I5H C;  4PHK A;  2LNK A;  4CFR A;  2L51 A;  1JC2 A;  2JC2 A;  4C0L A;  1S5G Y;  1SY9 A;  4DRW A;  1A03 A;  1QAT A;  1G33 A;  3PM8 A;  1CM1 A;  1EJ3 A;  2KOT A;  2NCO A;  1LIN A;  3EK8 A;  4N1F A;  1M45 A;  3TDZ A;  4OR9 B;  4YGD B;  2PVB A;  2AAO A;  3RLZ A;  2Y1M A;  1CM4 A;  3D10 A;  2F2O A;  1QX2 A;  1CDP A;  4NDC A;  1WRK A;  1PVB A;  4NQG A;  2JU0 A;  4QJ3 B;  4R1E A;  1IQ3 A;  4M2Q A;  3O6B A;  3PSR A;  1CB1 A;  1YVL A;  1KK7 Y;  1OMR A;  1JUO A;  3I5H B;  5TNC A;  2K0J A;  1K9U A;  2KAX A;  1QLK A;  3DF0 B;  3F45 A;  4DIR A;  1NCZ A;  3AAK A;  2QAC A;  2CCM A;  2JRF A;  1SL7 A;  1F70 A;  2CTN A;  4PE7 A;  2GGM A;  1KFX L;  2FOT A;  5D7F A;  2WCE A;  3NXA A;  1B8L A;  1EH2 A;  3EVR A;  1K9K A;  3PAT A;  4ZCV A;  1AJ5 A;  1A2X A;  2OTG B;  1BR4 B;  3GK2 A;  1G4Y R;  2MRD A;  1IWQ A;  1F8H A;  5HLO A;  4AQI A;  2PRU A;  4PHM A;  1MXL C;  1SCM C;  3KHE A;  2KQY A;  1S6J A;  2K2F A;  3QRX A;  2LLU A;  3AKB A;  4F0Z B;  1QVI Z;  2MAZ A;  2M9G A;  5IBW A;  5I2Q A;  2M0R A;  1NP8 A;  2EHB A;  2BBM A;  2V53 A;  1GGZ A;  1NX3 A;  4GGN A;  1QS7 A;  2ZFD A;  4OV2 A;  3MSE B;  3SG7 A;  3CZT X;  1KQM C;  1A4P A;  2A4J A;  1BR1 B;  4ORC B;  1KK8 C;  5I2L A;  1LA0 A;  2EC6 C;  1SBJ A;  3NSI A;  1S6C A;  2OS8 C;  1BU3 A;  2VRG A;  1L7Z A;  1SK6 D;  2HQ8 A;  1AJ4 A;  1SCM B;  1UHH A;  4C0K A;  1YR5 A;  2JT3 A;  3LK1 A;  2MA2 A;  2EGD A;  4IL1 A;  3OB1 B;  1MHO A;  3VGO A;  1LKJ A;  2KFG A;  4JPZ B;  5GQQ C;  2KYC A;  2I2R E;  3TZ1 A;  3BUM B;  5I2O A;  1EG4 A;  2M97 A;  3DD4 A;  1S36 A;  1H8B A;  1KQM B;  3SG3 A;  2MLE C;  4DUQ A;  1ALW A;  2HF5 A;  4MZJ A;  2JPT A;  1M31 A;  4PE0 A;  1RFJ A;  2KI4 C;  2EC6 B;  4L9M A;  2OS8 B;  3DVM A;  3A4U B;  1C7V A;  4GPL B;  3LCP C;  2NZ0 A;  2LVI A;  3D0Y A;  3DF0 A;  2MHH A;  3OB2 B;  4USL A;  4YGE B;  1CLM A;  1GJY A;  3TUY B;  1B7T Z;  1JF2 A;  4MZK A;  5K89 A;  4XJK B;  2LV7 A;  2RGI A;  1UHI A;  2L50 A;  5CSI A;  1KQV A;  2JXC A;  3OX6 A;  2LMV A;  1U5I B;  1ZOT B;  2FCE A;  2ZN8 A;  3PAL A;  2WOR A;  1B47 A;  1B9A A;  2PAS A;  2BKI B;  2E6W A;  3HX4 A;  1WDC C;  2LUC A;  3VRN A;  1BT6 A;  4MEW A;  2M8U A;  4UPG A;  1FW4 A;  1NCX A;  5B8I B;  2HET A;  3SG5 A;  2KFH A;  1PAL A;  3C1V A;  2KI4 B;  2L4I A;  4GGF A;  5AER A;  1CFC A;  4YBH B;  1YUS A;  2D8N A;  1SMG A;  1SR6 C;  2H61 C;  1R2U A;  2KSP A;  3SG6 A;  1RK9 A;  1N2D A;  1OE9 B;  1XO5 A;  4OCI A;  1CMG A;  1K90 D;  2LAP A;  1CFP A;  1IRJ A;  3K21 A;  1TNQ A;  3SG4 A;  1QJT A;  1J7R A;  2M1U A;  3FIA A;  1REC A;  1EXR A;  3H4S E;  3GK4 X;  4CID A;  3EVU A;  1ZMZ A;  1KSM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...