2K2FA

Solution structure of ca2+-s100a1-ryrp12
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
93
structure length
93
Chain Sequence
GSELETAMETLINVFHAHSGKEGDKYKLSKKELKDLLQTELSSFLDVQKDADAVDKIMKELDENGDGEVDFQEFVVLVAALTVACNNFFWENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Ryanodine receptor 1 peptide
publication title S100A1 and Calmodulin Compete for the Same Binding Site on Ryanodine Receptor.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 22
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2k2fA00
4D1EA 1AJ5A 2MRDA 1TRFA 1B8RA 1QXPA 1RK9A 1EH2A 2HQWA 1KCYA 4XYNA 1NX3A 1BG1A 1SBJA 3VGOA 3D0YB 2HETA 1CLLA 1Y1AA 4R1EA 2B1UA 2BE4A 4AQIA 1XFZO 1N2DA 2JU0A 3TS5B 1KWOC 3IF7A 3JTDB 1Y1UA 1FI5A 3VRRA 5I2QA 4PE0A 1J7OA 1CKKA 4GAOA 3LK1A 1CFCA 4ORAB 4PE1A 1DJIA 2ZKMX 1BT6A 2GGMA 4MZJA 2KQ6A 1J7QA 4YGCB 2PASA 2L4HA 1F71A 4GFTA 5B8IB 4GGFC 1CM4A 2K7OA 1YVLA 4C0LA 2KI4B 3O78A 1DMOA 3TS5C 1CFPA 1QVIY 4DIRA 1BU3A 1IQ3A 3A4UB 3BOWA 4F0ZB 1NCYA 2E30A 2WCBA 1RFJA 2I7AA 2JTTA 4OVNF 4C0JA 5HKYA 5ER4X 1U5IA 2LC5A 1F4QA 4ZCVA 1NSHA 3ZWHA 3I5GB 3I5HC 4C0KA 4A4BA 3O2PA 2L98A 1DJXA 2R2IA 5HKWA 4CPVA 1DTLA 1K9KA 5CSJA 3PN7B 1RTP1 2F33A 2L2EA 2M1KB 2WORA 2Y5IA 3TZ1A 1NUBA 1Y1XA 4JQ0D 3VROA 3DVMA 1F8HA 2F2OA 1H4BA 2I2RE 2M97A 1NPQA 2BKIB 2L5XB 2M49B 2NLNA 1B7TZ 2LUXA 2V53A 3KF9A 1L2OC 2KAVA 5D69A 3VRPA 4YBHB 1YRTB 2Q4UA 1PVBA 2LVKA 2NZ0A 4FTGA 2JQ6A 4MZKA 1B1GA 1YRUB 2KBIA 3I5GC 4GPLB 3I5FB 1QX2A 1SW8A 3SG6A 5KTYA 3NXAA 3KEVA 2I94A 3PN7C 2KDHA 5KU1A 2ZFDA 1J55A 3SIAA 1LA3A 2A4JA 1A03A 1A75A 1WRZA 1K90D 5D7FA 3LL8B 1BMOA 3SIBA 1ZMZA 1ALVA 2LP2A 1HQVA 1K93D 1TIZA 1B7TY 1JF2A 5JJGA 4PHJA 3I5FC 2TN4A 2F3ZA 1RWYA 1PALA 2CCMA 1G8IA 2HF5A 2LNKA 5J3XA 1DVIA 2M8UA 2LLTA 1SL8A 1WLZA 1NP8A 1DGUA 4I5KA 4WRIA 1NYAA 1Y6WA 4AQJA 2WNDA 1SNLA 2JT3A 2LHIA 2F2PA 1TNPA 1LKJA 1SR6B 1S1EA 4GNKB 3RLZA 2ZN8A 2BCAA 1HT9A 1TNXA 2LM5A 1NWDA 3PLFB 4OR9B 2KYCA 4E68A 2FCEA 1TOPA 4P5OE 1CM1A 2K0JA 2CXJA 2Q91A 1IJ5A 2M3WA 1FBVA 2EHBA 3KO0A 2ZNEA 3BUNB 2LVVA 1X02A 2LVJA 2ZRTA 4N1GA 4MZLA 1DF0B 2KFGA 2M9GA 2QACA 4BY5A 3VRQA 2CT9A 1M31A 1CB1A 1SR6C 1FI6A 3TDIA 2M7NA 3TUYB 3EK7A 1QV0A 4HSZA 4ORCB 3PM8A 2PVBA 1SRAA 2JNXA 4YGDB 5GQQC 1CDPA 2JXCA 3PALA 4WQ2A 1S5GZ 3DVEA 1QV1A 1QTXA 1QX7A 4ORBB 1F54A 3D10A 1WY9A 1UHNA 1U5IB 4QJ5B 3DVKA 2Y1MA 2LAPA 5FYXA 1WLMA 1SCVA 2M0RA 1TCOB 1BR1B 1UHJA 3SG3A 1QLSA 1NCXA 3TUYC 2LP3A 1MF8B 2NCOA 1A29A 2LANA 1RJVA 3A8RA 4DRWA 4CLNA 1SPYA 1ZOTB 1R6PA 4MRXA 3FS7A 1OMRA 2NXQA 1NX2A 1IJ6A 1SL9A 3PSRA 1PULA 5I2LA 5TNCA 4I5NB 3I5HB 2M7LA 1AVSA 1S6IA 1JUOA 1S6JA 1ZUZA 1BLQA 2OPOA 4M2OA 1N0YA 1NIWA 2JWWA 1OZOA 2D8NA 4YI9A 2GGZA 5BPJA 3EKJA 4HREE 4I5JA 3WXAA 2QPTA 1YUTA 1YTZC 1YURA 5G08A 2KYFA 1IQ5A 1L2OB 1CFDA 1IGVA 5I8NA 1DGVA 3JVTB 4CFQA 2H61C 3OX5A 4FQOA 3CR4X 3O6BA 1LINA 3HX4A 2VRGA 1LVCD 2MA2A 2KFHA 2BKHB 1KQMB 3MSEB 1KQVA 2H2KA 2LUCA 4NDDA 1OOJA 1LXFC 3DD4A 2G9BA 4MRYA 1J7RA 1DJZA 1RROA 3PATA 3AKAA 3BXKA 3DF0B 4TNCA 2BCBA 2LVIA 1AP4A 3WHTB 1S6CA 1BOCA 2EGDA 1KFXL 3AAJA 1OE9B 1D1OA 1CTRA 1AK8A 3JVTC 2ZRSA 5K89A 4P2YB 1M63B 4YI8A 3D0YA 1CMGA 4GGFA 4M2PA 1JFKA 1RECA 1KQMC 1QX5B 4OCIA 3AKBA 1KFUL 3CTNA 5KSZA 1XFYO 1FPWA 1KFXS 1QIVA 2BL0B 3TDUA 1QATA 1IWQA 1GGZA 1LA0A 1AUIB 5DKNA 2L4IA 2BE6A 3CR2A 3GK2A 1NX1A 1PVAA 4PE7A 1EL4A 4DCKA 2K7DA 2PSRA 1KFUS 2BBNA 2F3YA 2ZN9A 3EK8A 2PALA 1CMFA 2LV7A 2K2FA 2NCPA 4BY4A 1GJYA 2LLSA 1CLMA 4USLA 2JNFA 3BUMB 2JULA 1H8BA 5AFPA 1XFVO 1K94A 1Y0VH 1XFXO 3FWCA 1CDNA 2KQYA 2AAOA 1ALWA 1TTXA 2BL0C 4MBEA 3CLNA 1M39A 1B47A 3EVUA 2CNPA 1CLBA 1J1EA 1TCFA 3LLEA 2HPSA 5DKQA 2L51A 1PSBA 2WCEA 2K7CA 2WC8A 3FWBA 4UPGA 1PK0D 2DOQA 1QASA 2K2AA 3F45A 1KK8B 1BR4B 1QJTA 4IL1A 1GGWA 1KK7Z 2LLUA 2MBXA 4CFRA 1UWOA 1MWNA 4QJ3B 4CIDA 5ER5A 2Y4QA 3IQQA 2KNEA 1BF5A 3OX6A 1B8CA 5HYDA 1UURA 1UHKA 3C1VA 1XA5A 3O4YA 1XK4A 1C7VA 3E3RA 1SMGA 1KSMA 1ZFSA 2JOJA 5HLOA 4L9MA 3EK4A 3PFVA 2MJWB 4M2QA 1PRWA 1KK8C 3IQOA 3BOWB 4AOMA 3BUWB 1BJFA 1FW4A 2LCPA 4YRUA 1C07A 1TNWA 2KAYA 2LE9B 1SKTA 3EVRA 2WOSA 1JWDA 2CBLA 1OMVA 1NCZA 3H4SE 1G33A 2MHHA 2FCDA 1QS7A 1CNPA 1YX8A 4N1FA 1SCMB 3I5IB 3LCPC 1BODA 4MEWA 4PHKA 3ZNIA 2IS9A 2ISDA 4MSPA 1PSRA 4HRHA 4PDZA 2BBMA 1F55A 1KSOA 4A4CA 1IG5A 1K8UA 2OTGB 3LK0A 2G2BA 1XFUO 3EVVA 5AXIA 2HQ8A 1C7WA 1S5GY 3QRXA 5F6TA 2LHLA 5AEQA 1V1FA 1OSAA 2KOTA 2AMIA 4N5XA 4OKHA 2KFFA 1IH0A 3BQ3A 3RM1A 2PMYA 4NDCA 2E6WA 5AERA 1EXRA 1MQ1A 1WRLA 1G4YR 3GK1A 3NSIA 4XJKA 1K9PA 1SCMC 1QVIZ 3I5IC 1F70A 1EG3A 1B9AA 4YGBB 1B8LA 1DT7B 3DVJA 4ETOA 2KI6D 3CGAA 1A75B 1GQMA 2OTGC 3SG4A 1K9UA 1W7IB 1YR5A 1V1GA 1UHHA 1CDMA 2I18A 1Q80A 1K2HA 2K61A 2O5GA 1DF0A 2M1UA 1M45A 2JRFA 1SYMA 1MXLC 2FOTA 3OP0A 3JTDC 5CSIA 4YGEB 2K8MB 1UHIA 4MVFA 1QLKA 1YX7A 1YVHA 1OZSA 4WQ3A 1NX0A 1OQPA 1AJ4A 2RGIA 3OB2B 1YUSA 2KSPA 1F4OA 1S26D 4QJ4B 1XYDA 2MLFC 3VRNA 1MR8A 3WHUB 1JC2A 1J1DA 2OS8B 2SASA 3WNXB 1MUXA 4NDBA 3BYAA 4MLWA 2KI4C 1CDLA 4U8DA 2MAZA 3CS1A 1WRKA 1SL7A 2F8PA 2SCPA 4JWQA 2H61A 4I5LB 4GUKA 3CWGA 3NSOA 1J7PA 1ZACA 4GBAA 2BCXA 1JFJA 3KHEA 4PHMA 1WDCB 1FF1A 2OS8C 1OMDA 1EJ3A 4PCWA 1S36A 5IBWA 1A2XA 1AHRA 1VRKA 2CTNA 1IKUA 2GV5A 5CPVA 1CFFA 2MLEC 3GOFA 3ICBA 1YUUA 5I2OA 3FIAA 2KI6C 3M0WA 4MN0A 2ZNDA 2JT8A 4DS7A 3SJSA 4ZCUA 1M46A 3KPXA 5JOLA 1DJYA 3BUOB 2P6BB 1E8AA 2EC6B 1XK4C 1QIWA 3NSLA 2O60A 2LMVA 1EG4A 3HCMA 4PALA 3SG5A 4OV2A 1DJWA 1R2UA 1WDCC 2KAXA 1XFWO 5AANA 2KHNA 4YGAA 1DJGA 3DF0A 3SG7A 1XVJA 1JBAA 1XO5A 1TNQA 2JTZA 2JPTA 2L50A 2LMTA 3AAKA 3OB1B 3NSKA 1ODBA 1IRJA 3GK4X 1L7ZA 2EC6C 2L0PA 5CSFA 4PHNA 5CSNA 3K21A 5DKRA 2BECA 2JZIA 1UP5A 3BUXB 3SG2A 4Q04A 4HRGA 2KBMA 5HLVA 4XJKB 2PRUA 2FJUB 1SY9A 1TN4A 1UUSA 1K95A 1KK7Y 5HKZA 3TDZA 2KGRA 1JF0A 1JSAA 4GGNA 2JXLA 2JC2A 2KGBC 4DUQA 3CR5X 1W7JB 1DJHA 1N65A 1MHOA 2K7BA 2WCFA 2COLB 4ICBA 2AUCA 4NQGA 2JT0A 4JPZB 5PALA 1S3PA 4PE4A 2LMUA 2Y1NA 3CZTX 1A4PA 1KWOB 2M29A 3EKHA 1SK6D 1MXEA 3OHMB 1K96A 1B4CA
chains in the Genus database with same CATH superfamily
4D1EA 1AJ5A 3SS4A 2MRDA 1TRFA 1B8RA 5I94A 1QXPA 1RK9A 1EH2A 2HQWA 1KCYA 4XYNA 1NX3A 3BFHA 3L47A 1BG1A 1SBJA 3VGOA 3D0YB 2HETA 1CLLA 1Y1AA 4R1EA 2B1UA 2QEOA 2BE4A 4AQIA 1XFZO 1N2DA 1Z4HA 2JU0A 3TS5B 1KWOC 3IF7A 3JTDB 1Y1UA 1FI5A 3VRRA 2WCHA 5I2QA 2KPHA 4PE0A 1J7OA 1CKKA 4GAOA 3LK1A 1CFCA 4ORAB 4PE1A 1DJIA 1OOGA 2ZKMX 1BT6A 2GGMA 4MZJA 2KQ6A 1J7QA 4YGCB 2PASA 2L4HA 1F71A 4GFTA 5B8IB 4GGFC 1CM4A 1DQEA 2K7OA 1YVLA 4C0LA 2KI4B 3O78A 1DMOA 3TS5C 1CFPA 1QVIY 4DIRA 1BU3A 1IQ3A 3A4UB 3BOWA 4F0ZB 1DEKA 1NCYA 2E30A 2WCBA 1RFJA 2I7AA 3CYZA 2JTTA 4OVNF 4C0JA 5HKYA 5ER4X 2QEBA 1U5IA 2LC5A 1F4QA 4ZCVA 1NSHA 3ZWHA 2K60A 3I5GB 3I5HC 4C0KA 4A4BA 3O2PA 2L98A 1DJXA 2R2IA 5HKWA 4CPVA 1DTLA 1K9KA 5CSJA 3PN7B 1RTP1 3D78A 2F33A 2L2EA 2M1KB 2WORA 2Y5IA 3TZ1A 1NUBA 1Y1XA 4JQ0D 1OW4A 3VROA 3DVMA 1F8HA 2F2OA 1H4BA 2I2RE 2M97A 1NPQA 2BKIB 2L5XB 2M49B 2NLNA 1B7TZ 2LUXA 2V53A 3KF9A 1L2OC 2KAVA 5D69A 2PYQA 3VRPA 4YBHB 1YRTB 2Q4UA 1PVBA 2LVKA 2FJYA 2NZ0A 4FTGA 2JQ6A 4MZKA 1B1GA 1YRUB 2KBIA 3I5GC 4GPLB 3I5FB 1QX2A 1SW8A 3B6XA 3SG6A 5KTYA 3NXAA 3KEVA 2I94A 3PN7C 2KDHA 5KU1A 2ZFDA 1J55A 2BAPA 3SIAA 1LA3A 2A4JA 1A03A 1A75A 1WRZA 1K90D 5D7FA 3CZ1A 1W9ZA 3LL8B 1BMOA 3SIBA 1ZMZA 1ORGA 3Q8IA 1ALVA 2LP2A 1HQVA 1K93D 3NHTA 1TIZA 4F7FA 1B7TY 1JF2A 3B7AA 2P70A 5JJGA 4PHJA 3I5FC 2TN4A 2F3ZA 1RWYA 1PALA 2CCMA 1G8IA 2HF5A 2LNKA 5J3XA 1DVIA 2M8UA 2LLTA 1SL8A 1WLZA 1NP8A 1DGUA 4I5KA 4WRIA 1NYAA 3D74A 1Y6WA 4AQJA 2WNDA 1SNLA 2JT3A 2LHIA 2F2PA 3B88A 1TNPA 1LKJA 1SR6B 1S1EA 4GNKB 3RLZA 2ZN8A 3L4AA 3DY9A 2BCAA 1HT9A 1TNXA 2LM5A 1NWDA 3CZ0A 3PLFB 5D3OA 4OR9B 2KYCA 4E68A 2FCEA 1TOPA 4P5OE 1CM1A 2K0JA 2CXJA 3D76A 2Q91A 1IJ5A 2M3WA 1FBVA 2EHBA 3KO0A 2ZNEA 3BUNB 4INXA 2LVVA 1X02A 4JKTA 2LVJA 2ZRTA 3V2LA 4N1GA 4KYNA 4MZLA 1DF0B 2KFGA 2M9GA 2QACA 4BY5A 3VRQA 2CT9A 1M31A 1CB1A 1SR6C 1FI6A 3TDIA 2M7NA 3TUYB 3EK7A 1QV0A 4HSZA 1OOHA 4ORCB 3PM8A 2P71A 1SRAA 2JNXA 2PVBA 4YGDB 5GQQC 1CDPA 2JXCA 2ERBA 3PALA 4WQ2A 1S5GZ 3DVEA 1QV1A 1QTXA 1TUZA 1QX7A 4ORBB 1F54A 3D10A 1WY9A 3EG5B 1UHNA 1U5IB 4QJ5B 3SS5A 3DVKA 2Y1MA 2LAPA 5FYXA 1WLMA 1SCVA 2M0RA 1TCOB 1BR1B 1UHJA 3FE9A 3SG3A 1QLSA 1OOFA 1NCXA 3TUYC 2LP3A 1MF8B 2NCOA 1A29A 3L4LA 2LANA 1RJVA 3A8RA 4DRWA 4CLNA 2L5YA 3S0DA 1SPYA 1ZOTB 1R6PA 4MRXA 3FS7A 1OMRA 2NXQA 3K1EA 1NX2A 1IJ6A 1SL9A 3N7HA 1PULA 3PSRA 5FI2A 4I5NB 5I2LA 3I5HB 5TNCA 2M7LA 1AVSA 1S6IA 1JUOA 1S6JA 1ZUZA 3B87A 3NHIA 1BLQA 2OPOA 2GTEA 4FQTA 4M2OA 1N0YA 1NIWA 2JWWA 3D77A 1OZOA 2D8NA 4YI9A 2GGZA 3NGVA 5BPJA 3EKJA 4HREE 4I5JA 3WXAA 2QPTA 1YUTA 1YTZC 1YURA 5G08A 3B86A 2KYFA 3OGNA 1IQ5A 1L2OB 1CFDA 1IGVA 5I8NA 1DGVA 3JVTB 4CFQA 2H61C 3OX5A 4FQOA 3CR4X 3O6BA 1LINA 3HX4A 2VRGA 1LVCD 2MA2A 2KFHA 2BKHB 1KQMB 3MSEB 1KQVA 2H2KA 2LUCA 4NDDA 1OOJA 1LXFC 3BFBA 3DD4A 2G9BA 4MRYA 1J7RA 1DJZA 1P28A 1RROA 3CZ2A 3AKAA 3BXKA 3PATA 3DF0B 4TNCA 1QWVA 2L2CA 1C3ZA 2BCBA 2LVIA 1AP4A 3WHTB 1S6CA 1BOCA 2EGDA 1KFXL 3AAJA 1OE9B 3SS3A 1D1OA 3S0FA 1CTRA 1AK8A 3JVTC 3R1VA 2ZRSA 5K89A 4P2YB 1M63B 4YI8A 3D0YA 1CMGA 4GGFA 4M2PA 1JFKA 1RECA 1KQMC 1QX5B 4JD9A 3UNWA 4OCIA 3AKBA 1KFUL 3CTNA 5KSZA 1XFYO 1FPWA 1KFXS 1QIVA 2BL0B 2H8VA 1QATA 3TDUA 1IWQA 1GGZA 1LA0A 1AUIB 5DKNA 2L4IA 2BE6A 3CR2A 3GK2A 1T14A 1NX1A 1PVAA 4PE7A 1EL4A 4DCKA 3R1OA 2K7DA 2PSRA 1KFUS 2BBNA 2F3YA 2QEHA 2ZN9A 2PALA 3EK8A 1CMFA 2LV7A 2K2FA 2NCPA 4BY4A 1GJYA 2LLSA 1CLMA 4USLA 2JNFA 3BUMB 2JULA 1H8BA 5AFPA 1XFVO 1K94A 1Y0VH 1XFXO 3D75A 3FWCA 1CDNA 3O4XA 2KQYA 2PQLA 2AAOA 3R1PA 1ALWA 1TTXA 2BL0C 4MBEA 2KLDA 3CLNA 1M39A 1B47A 3EVUA 3S0AA 2CNPA 1CLBA 5DICA 1J1EA 1TCFA 2WCKA 3LLEA 2HPSA 2BNXA 5DKQA 2L51A 1PSBA 2WCEA 2K7CA 5EL2A 2WC8A 3FWBA 4UPGA 1PK0D 2DOQA 1QASA 2K2AA 3F45A 1KK8B 1BR4B 1QJTA 4IL1A 1GGWA 1KK7Z 2LLUA 3R72A 2MBXA 4CFRA 3PJIA 1UWOA 1MWNA 1TWOA 4QJ3B 4CIDA 1GM0A 5ER5A 2Y4QA 3IQQA 2KNEA 1BF5A 1Z2CB 3OX6A 1B8CA 5HYDA 1UURA 1UHKA 3C1VA 1XA5A 3S0GA 3O4YA 1XK4A 1C7VA 3E3RA 1SMGA 1KSMA 1ZFSA 3BJHA 2JOJA 2YGUA 5HLOA 4L9MA 3UO9A 3S0EA 3EK4A 3PFVA 2MJWB 4M2QA 1PRWA 1KK8C 3FE8A 3IQOA 3BOWB 4AOMA 3BUWB 1BJFA 1FW4A 2LCPA 4YRUA 1C07A 1TNWA 2KAYA 3D73A 2LE9B 1SKTA 3EVRA 2WOSA 1JWDA 2CBLA 1OMVA 1NCZA 3H4SE 1G33A 2MHHA 2FCDA 1QS7A 1CNPA 1YX8A 4N1FA 3IVTA 5FI6A 1SCMB 3I5IB 3LCPC 3DXLA 4MEWA 4PHKA 3ZNIA 1BODA 2IS9A 2ISDA 2WCJA 4MSPA 1PSRA 1XFRA 4HRHA 4PDZA 2BBMA 5FI7A 4OZDA 1KSOA 4A4CA 1F55A 1DELA 1IG5A 1K8UA 2OTGB 3LK0A 2G2BA 3PM2A 1XFUO 3EVVA 5AXIA 2HQ8A 1C7WA 1S5GY 3QRXA 5F6TA 2LHLA 5AEQA 1V1FA 1OSAA 2KOTA 2AMIA 2WCMA 4N5XA 2KFFA 4OKHA 3BQ3A 1IH0A 3RM1A 2PMYA 4NDCA 2E6WA 5AERA 1EXRA 1MQ1A 1WRLA 1G4YR 3GK1A 3NSIA 4XJKA 1K9PA 1SCMC 1QVIZ 3I5IC 3RZSA 3FE6A 1F70A 1EG3A 1B9AA 4YGBB 1B8LA 1DT7B 3DVJA 4ETOA 2KI6D 3CGAA 1A75B 1GQMA 2OTGC 3SG4A 1K9UA 1W7IB 3CABA 4IJ7A 1YR5A 1V1GA 3DZTA 1UHHA 1CDMA 2I18A 1Q80A 1K2HA 2K61A 2O5GA 1DF0A 4INWA 2M1UA 1M45A 1TUJA 2JRFA 1SYMA 1MXLC 2FOTA 3OP0A 3JTDC 5CSIA 4YGEB 2K8MB 1UHIA 4MVFA 1QLKA 1OOIX 1YVHA 1OZSA 1YX7A 4WQ3A 1NX0A 1OQPA 1AJ4A 2RGIA 3OB2B 1YUSA 2KSPA 1F4OA 1S26D 4QJ4B 1XYDA 2MLFC 3VRNA 1MR8A 3WHUB 1JC2A 1J1DA 2OS8B 2SASA 3WNXB 3BFAA 1MUXA 2WCLA 4NDBA 3BYAA 4MLWA 2KI4C 1CDLA 4U8DA 2MAZA 1C3YA 3QMEA 2WC5A 3CS1A 1WRKA 1SL7A 2F8PA 2SCPA 4JWQA 2H61A 2WC6A 4I5LB 3VB1A 4GUKA 3CWGA 3NSOA 1J7PA 1ZACA 4GBAA 2BCXA 1JFJA 3KHEA 4PHMA 1WDCB 3OBVA 2OS8C 1OMDA 1EJ3A 1FF1A 4PCWA 1S36A 5IBWA 1A2XA 1AHRA 1VRKA 2CTNA 2QEVA 2GV5A 5CPVA 1IKUA 1CFFA 2MLEC 3GOFA 3ICBA 3DYEA 1YUUA 5I2OA 3FIAA 2KI6C 3M0WA 4MN0A 2ZNDA 2JT8A 5HL1A 4DS7A 3SJSA 4ZCUA 1M46A 3KPXA 5JOLA 1DJYA 3BUOB 2P6BB 1E8AA 2EC6B 1XK4C 1QIWA 3NSLA 1DC1A 2O60A 2LMVA 1EG4A 3HCMA 4PALA 1LS8A 3SG5A 4OV2A 1DJWA 1R2UA 1WDCC 1SSEB 2KAXA 1XFWO 5AANA 2KHNA 4YGAA 1DJGA 3DF0A 3SG7A 1XVJA 1JBAA 1IIOA 1XO5A 1TNQA 2JTZA 2JPTA 2L50A 2LMTA 3AAKA 3S0BA 3OB1B 3NSKA 1ODBA 1IRJA 3GK4X 1L7ZA 2EC6C 2L0PA 5CSFA 4PHNA 5CSNA 3K21A 5DKRA 2BECA 2JZIA 1UP5A 3BUXB 3SG2A 4Q04A 4HRGA 2KBMA 5HLVA 4XJKB 2PRUA 2FJUB 1SY9A 1TN4A 1UUSA 2QDIA 1K95A 1KK7Y 5HKZA 3TDZA 2KGRA 1JF0A 1JSAA 4GGNA 2JXLA 2JC2A 2KGBC 4DUQA 3CR5X 1W7JB 1DJHA 1N65A 1MHOA 2JPOA 2K7BA 2WCFA 2COLB 4ICBA 2AUCA 4NQGA 2JT0A 4JPZB 5PALA 1S3PA 4PE4A 2LMUA 2Y1NA 3CZTX 1A4PA 1KWOB 3CDNA 2M29A 3EKHA 2KLEA 1SK6D 1MXEA 3OHMB 4PT1A 1K96A 1B4CA
chains in the Genus database with same CATH topology
4D1EA 1AJ5A 2MRDA 1TRFA 1B8RA 1QXPA 1RK9A 1EH2A 2HQWA 1KCYA 4XYNA 1NX3A 1BG1A 1SBJA 3VGOA 3D0YB 2HETA 1CLLA 1Y1AA 4R1EA 2B1UA 2BE4A 4AQIA 1XFZO 1N2DA 2JU0A 3TS5B 1KWOC 3IF7A 3JTDB 1Y1UA 1FI5A 3VRRA 5I2QA 4PE0A 1J7OA 1CKKA 4GAOA 3LK1A 1CFCA 4ORAB 4PE1A 1DJIA 2ZKMX 1BT6A 2GGMA 4MZJA 2KQ6A 1J7QA 4YGCB 2PASA 2L4HA 1F71A 4GFTA 5B8IB 4GGFC 1CM4A 2K7OA 1YVLA 4C0LA 2KI4B 3O78A 1DMOA 3TS5C 1CFPA 1QVIY 4DIRA 1BU3A 1IQ3A 3A4UB 3BOWA 4F0ZB 1NCYA 2E30A 2WCBA 1RFJA 2I7AA 2JTTA 4OVNF 4C0JA 5HKYA 5ER4X 1U5IA 2LC5A 1F4QA 4ZCVA 1NSHA 3ZWHA 3I5GB 3I5HC 4C0KA 4A4BA 3O2PA 2L98A 1DJXA 2R2IA 5HKWA 4CPVA 1DTLA 1K9KA 5CSJA 3PN7B 1RTP1 2F33A 2L2EA 2M1KB 2WORA 2Y5IA 3TZ1A 1NUBA 1Y1XA 4JQ0D 3VROA 3DVMA 1F8HA 2F2OA 1H4BA 2I2RE 2M97A 1NPQA 2BKIB 2L5XB 2M49B 2NLNA 1B7TZ 2LUXA 2V53A 3KF9A 1L2OC 2KAVA 5D69A 3VRPA 4YBHB 1YRTB 2Q4UA 1PVBA 2LVKA 2NZ0A 4FTGA 2JQ6A 4MZKA 1B1GA 1YRUB 2KBIA 3I5GC 4GPLB 3I5FB 1QX2A 1SW8A 3SG6A 5KTYA 3NXAA 3KEVA 2I94A 3PN7C 2KDHA 5KU1A 2ZFDA 1J55A 3SIAA 1LA3A 2A4JA 1A03A 1A75A 1WRZA 1K90D 5D7FA 3LL8B 1BMOA 3SIBA 1ZMZA 1ALVA 2LP2A 1HQVA 1K93D 1TIZA 1B7TY 1JF2A 5JJGA 4PHJA 3I5FC 2TN4A 2F3ZA 1RWYA 1PALA 2CCMA 1G8IA 2HF5A 2LNKA 5J3XA 1DVIA 2M8UA 2LLTA 1SL8A 1WLZA 1NP8A 1DGUA 4I5KA 4WRIA 1NYAA 1Y6WA 4AQJA 2WNDA 1SNLA 2JT3A 2LHIA 2F2PA 1TNPA 1LKJA 1SR6B 1S1EA 4GNKB 3RLZA 2ZN8A 2BCAA 1HT9A 1TNXA 2LM5A 1NWDA 3PLFB 4OR9B 2KYCA 4E68A 2FCEA 1TOPA 4P5OE 1CM1A 2K0JA 2CXJA 2Q91A 1IJ5A 2M3WA 1FBVA 2EHBA 3KO0A 2ZNEA 3BUNB 2LVVA 1X02A 2LVJA 2ZRTA 4N1GA 4MZLA 1DF0B 2KFGA 2M9GA 2QACA 4BY5A 3VRQA 2CT9A 1M31A 1CB1A 1SR6C 1FI6A 3TDIA 2M7NA 3TUYB 3EK7A 1QV0A 4HSZA 4ORCB 3PM8A 2PVBA 1SRAA 2JNXA 4YGDB 5GQQC 1CDPA 2JXCA 3PALA 4WQ2A 1S5GZ 3DVEA 1QV1A 1QTXA 1QX7A 4ORBB 1F54A 3D10A 1WY9A 1UHNA 1U5IB 4QJ5B 3DVKA 2Y1MA 2LAPA 5FYXA 1WLMA 1SCVA 2M0RA 1TCOB 1BR1B 1UHJA 3SG3A 1QLSA 1NCXA 3TUYC 2LP3A 1MF8B 2NCOA 1A29A 2LANA 1RJVA 3A8RA 4DRWA 4CLNA 1SPYA 1ZOTB 1R6PA 4MRXA 3FS7A 1OMRA 2NXQA 1NX2A 1IJ6A 1SL9A 3PSRA 1PULA 5I2LA 5TNCA 4I5NB 3I5HB 2M7LA 1AVSA 1S6IA 1JUOA 1S6JA 1ZUZA 1BLQA 2OPOA 4M2OA 1N0YA 1NIWA 2JWWA 1OZOA 2D8NA 4YI9A 2GGZA 5BPJA 3EKJA 4HREE 4I5JA 3WXAA 2QPTA 1YUTA 1YTZC 1YURA 5G08A 2KYFA 1IQ5A 1L2OB 1CFDA 1IGVA 5I8NA 1DGVA 3JVTB 4CFQA 2H61C 3OX5A 4FQOA 3CR4X 3O6BA 1LINA 3HX4A 2VRGA 1LVCD 2MA2A 2KFHA 2BKHB 1KQMB 3MSEB 1KQVA 2H2KA 2LUCA 4NDDA 1OOJA 1LXFC 3DD4A 2G9BA 4MRYA 1J7RA 1DJZA 1RROA 3PATA 3AKAA 3BXKA 3DF0B 4TNCA 2BCBA 2LVIA 1AP4A 3WHTB 1S6CA 1BOCA 2EGDA 1KFXL 3AAJA 1OE9B 1D1OA 1CTRA 1AK8A 3JVTC 2ZRSA 5K89A 4P2YB 1M63B 4YI8A 3D0YA 1CMGA 4GGFA 4M2PA 1JFKA 1RECA 1KQMC 1QX5B 4OCIA 3AKBA 1KFUL 3CTNA 5KSZA 1XFYO 1FPWA 1KFXS 1QIVA 2BL0B 3TDUA 1QATA 1IWQA 1GGZA 1LA0A 1AUIB 5DKNA 2L4IA 2BE6A 3CR2A 3GK2A 1NX1A 1PVAA 4PE7A 1EL4A 4DCKA 2K7DA 2PSRA 1KFUS 2BBNA 2F3YA 2ZN9A 3EK8A 2PALA 1CMFA 2LV7A 2K2FA 2NCPA 4BY4A 1GJYA 2LLSA 1CLMA 4USLA 2JNFA 3BUMB 2JULA 1H8BA 5AFPA 1XFVO 1K94A 1Y0VH 1XFXO 3FWCA 1CDNA 2KQYA 2AAOA 1ALWA 1TTXA 2BL0C 4MBEA 3CLNA 1M39A 1B47A 3EVUA 2CNPA 1CLBA 1J1EA 1TCFA 3LLEA 2HPSA 5DKQA 2L51A 1PSBA 2WCEA 2K7CA 2WC8A 3FWBA 4UPGA 1PK0D 2DOQA 1QASA 2K2AA 3F45A 1KK8B 1BR4B 1QJTA 4IL1A 1GGWA 1KK7Z 2LLUA 2MBXA 4CFRA 1UWOA 1MWNA 4QJ3B 4CIDA 5ER5A 2Y4QA 3IQQA 2KNEA 1BF5A 3OX6A 1B8CA 5HYDA 1UURA 1UHKA 3C1VA 1XA5A 3O4YA 1XK4A 1C7VA 3E3RA 1SMGA 1KSMA 1ZFSA 2JOJA 5HLOA 4L9MA 3EK4A 3PFVA 2MJWB 4M2QA 1PRWA 1KK8C 3IQOA 3BOWB 4AOMA 3BUWB 1BJFA 1FW4A 2LCPA 4YRUA 1C07A 1TNWA 2KAYA 2LE9B 1SKTA 3EVRA 2WOSA 1JWDA 2CBLA 1OMVA 1NCZA 3H4SE 1G33A 2MHHA 2FCDA 1QS7A 1CNPA 1YX8A 4N1FA 1SCMB 3I5IB 3LCPC 1BODA 4MEWA 4PHKA 3ZNIA 2IS9A 2ISDA 4MSPA 1PSRA 4HRHA 4PDZA 2BBMA 1F55A 1KSOA 4A4CA 1IG5A 1K8UA 2OTGB 3LK0A 2G2BA 1XFUO 3EVVA 5AXIA 2HQ8A 1C7WA 1S5GY 3QRXA 5F6TA 2LHLA 5AEQA 1V1FA 1OSAA 2KOTA 2AMIA 4N5XA 4OKHA 2KFFA 1IH0A 3BQ3A 3RM1A 2PMYA 4NDCA 2E6WA 5AERA 1EXRA 1MQ1A 1WRLA 1G4YR 3GK1A 3NSIA 4XJKA 1K9PA 1SCMC 1QVIZ 3I5IC 1F70A 1EG3A 1B9AA 4YGBB 1B8LA 1DT7B 3DVJA 4ETOA 2KI6D 3CGAA 1A75B 1GQMA 2OTGC 3SG4A 1K9UA 1W7IB 1YR5A 1V1GA 1UHHA 1CDMA 2I18A 1Q80A 1K2HA 2K61A 2O5GA 1DF0A 2M1UA 1M45A 2JRFA 1SYMA 1MXLC 2FOTA 3OP0A 3JTDC 5CSIA 4YGEB 2K8MB 1UHIA 4MVFA 1QLKA 1YX7A 1YVHA 1OZSA 4WQ3A 1NX0A 1OQPA 1AJ4A 2RGIA 3OB2B 1YUSA 2KSPA 1F4OA 1S26D 4QJ4B 1XYDA 2MLFC 3VRNA 1MR8A 3WHUB 1JC2A 1J1DA 2OS8B 2SASA 3WNXB 1MUXA 4NDBA 3BYAA 4MLWA 2KI4C 1CDLA 4U8DA 2MAZA 3CS1A 1WRKA 1SL7A 2F8PA 2SCPA 4JWQA 2H61A 4I5LB 4GUKA 3CWGA 3NSOA 1J7PA 1ZACA 4GBAA 2BCXA 1JFJA 3KHEA 4PHMA 1WDCB 1FF1A 2OS8C 1OMDA 1EJ3A 4PCWA 1S36A 5IBWA 1A2XA 1AHRA 1VRKA 2CTNA 1IKUA 2GV5A 5CPVA 1CFFA 2MLEC 3GOFA 3ICBA 1YUUA 5I2OA 3FIAA 2KI6C 3M0WA 4MN0A 2ZNDA 2JT8A 4DS7A 3SJSA 4ZCUA 1M46A 3KPXA 5JOLA 1DJYA 3BUOB 2P6BB 1E8AA 2EC6B 1XK4C 1QIWA 3NSLA 2O60A 2LMVA 1EG4A 3HCMA 4PALA 3SG5A 4OV2A 1DJWA 1R2UA 1WDCC 2KAXA 1XFWO 5AANA 2KHNA 4YGAA 1DJGA 3DF0A 3SG7A 1XVJA 1JBAA 1XO5A 1TNQA 2JTZA 2JPTA 2L50A 2LMTA 3AAKA 3OB1B 3NSKA 1ODBA 1IRJA 3GK4X 1L7ZA 2EC6C 2L0PA 5CSFA 4PHNA 5CSNA 3K21A 5DKRA 2BECA 2JZIA 1UP5A 3BUXB 3SG2A 4Q04A 4HRGA 2KBMA 5HLVA 4XJKB 2PRUA 2FJUB 1SY9A 1TN4A 1UUSA 1K95A 1KK7Y 5HKZA 3TDZA 2KGRA 1JF0A 1JSAA 4GGNA 2JXLA 2JC2A 2KGBC 4DUQA 3CR5X 1W7JB 1DJHA 1N65A 1MHOA 2K7BA 2WCFA 2COLB 4ICBA 2AUCA 4NQGA 2JT0A 4JPZB 5PALA 1S3PA 4PE4A 2LMUA 2Y1NA 3CZTX 1A4PA 1KWOB 2M29A 3EKHA 1SK6D 1MXEA 3OHMB 1K96A 1B4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D1E A;  1AJ5 A;  2MRD A;  1TRF A;  1B8R A;  1QXP A;  1RK9 A;  1EH2 A;  2HQW A;  1KCY A;  4XYN A;  1NX3 A;  1BG1 A;  1SBJ A;  3VGO A;  3D0Y B;  2HET A;  1CLL A;  1Y1A A;  4R1E A;  2B1U A;  2BE4 A;  4AQI A;  1XFZ O;  1N2D A;  2JU0 A;  3TS5 B;  1KWO C;  3IF7 A;  3JTD B;  1Y1U A;  1FI5 A;  3VRR A;  5I2Q A;  4PE0 A;  1J7O A;  1CKK A;  4GAO A;  3LK1 A;  1CFC A;  4ORA B;  4PE1 A;  1DJI A;  2ZKM X;  1BT6 A;  2GGM A;  4MZJ A;  2KQ6 A;  1J7Q A;  4YGC B;  2PAS A;  2L4H A;  1F71 A;  4GFT A;  5B8I B;  4GGF C;  1CM4 A;  2K7O A;  1YVL A;  4C0L A;  2KI4 B;  3O78 A;  1DMO A;  3TS5 C;  1CFP A;  1QVI Y;  4DIR A;  1BU3 A;  1IQ3 A;  3A4U B;  3BOW A;  4F0Z B;  1NCY A;  2E30 A;  2WCB A;  1RFJ A;  2I7A A;  2JTT A;  4OVN F;  4C0J A;  5HKY A;  5ER4 X;  1U5I A;  2LC5 A;  1F4Q A;  4ZCV A;  1NSH A;  3ZWH A;  3I5G B;  3I5H C;  4C0K A;  4A4B A;  3O2P A;  2L98 A;  1DJX A;  2R2I A;  5HKW A;  4CPV A;  1DTL A;  1K9K A;  5CSJ A;  3PN7 B;  1RTP 1;  2F33 A;  2L2E A;  2M1K B;  2WOR A;  2Y5I A;  3TZ1 A;  1NUB A;  1Y1X A;  4JQ0 D;  3VRO A;  3DVM A;  1F8H A;  2F2O A;  1H4B A;  2I2R E;  2M97 A;  1NPQ A;  2BKI B;  2L5X B;  2M49 B;  2NLN A;  1B7T Z;  2LUX A;  2V53 A;  3KF9 A;  1L2O C;  2KAV A;  5D69 A;  3VRP A;  4YBH B;  1YRT B;  2Q4U A;  1PVB A;  2LVK A;  2NZ0 A;  4FTG A;  2JQ6 A;  4MZK A;  1B1G A;  1YRU B;  2KBI A;  3I5G C;  4GPL B;  3I5F B;  1QX2 A;  1SW8 A;  3SG6 A;  5KTY A;  3NXA A;  3KEV A;  2I94 A;  3PN7 C;  2KDH A;  5KU1 A;  2ZFD A;  1J55 A;  3SIA A;  1LA3 A;  2A4J A;  1A03 A;  1A75 A;  1WRZ A;  1K90 D;  5D7F A;  3LL8 B;  1BMO A;  3SIB A;  1ZMZ A;  1ALV A;  2LP2 A;  1HQV A;  1K93 D;  1TIZ A;  1B7T Y;  1JF2 A;  5JJG A;  4PHJ A;  3I5F C;  2TN4 A;  2F3Z A;  1RWY A;  1PAL A;  2CCM A;  1G8I A;  2HF5 A;  2LNK A;  5J3X A;  1DVI A;  2M8U A;  2LLT A;  1SL8 A;  1WLZ A;  1NP8 A;  1DGU A;  4I5K A;  4WRI A;  1NYA A;  1Y6W A;  4AQJ A;  2WND A;  1SNL A;  2JT3 A;  2LHI A;  2F2P A;  1TNP A;  1LKJ A;  1SR6 B;  1S1E A;  4GNK B;  3RLZ A;  2ZN8 A;  2BCA A;  1HT9 A;  1TNX A;  2LM5 A;  1NWD A;  3PLF B;  4OR9 B;  2KYC A;  4E68 A;  2FCE A;  1TOP A;  4P5O E;  1CM1 A;  2K0J A;  2CXJ A;  2Q91 A;  1IJ5 A;  2M3W A;  1FBV A;  2EHB A;  3KO0 A;  2ZNE A;  3BUN B;  2LVV A;  1X02 A;  2LVJ A;  2ZRT A;  4N1G A;  4MZL A;  1DF0 B;  2KFG A;  2M9G A;  2QAC A;  4BY5 A;  3VRQ A;  2CT9 A;  1M31 A;  1CB1 A;  1SR6 C;  1FI6 A;  3TDI A;  2M7N A;  3TUY B;  3EK7 A;  1QV0 A;  4HSZ A;  4ORC B;  3PM8 A;  2PVB A;  1SRA A;  2JNX A;  4YGD B;  5GQQ C;  1CDP A;  2JXC A;  3PAL A;  4WQ2 A;  1S5G Z;  3DVE A;  1QV1 A;  1QTX A;  1QX7 A;  4ORB B;  1F54 A;  3D10 A;  1WY9 A;  1UHN A;  1U5I B;  4QJ5 B;  3DVK A;  2Y1M A;  2LAP A;  5FYX A;  1WLM A;  1SCV A;  2M0R A;  1TCO B;  1BR1 B;  1UHJ A;  3SG3 A;  1QLS A;  1NCX A;  3TUY C;  2LP3 A;  1MF8 B;  2NCO A;  1A29 A;  2LAN A;  1RJV A;  3A8R A;  4DRW A;  4CLN A;  1SPY A;  1ZOT B;  1R6P A;  4MRX A;  3FS7 A;  1OMR A;  2NXQ A;  1NX2 A;  1IJ6 A;  1SL9 A;  3PSR A;  1PUL A;  5I2L A;  5TNC A;  4I5N B;  3I5H B;  2M7L A;  1AVS A;  1S6I A;  1JUO A;  1S6J A;  1ZUZ A;  1BLQ A;  2OPO A;  4M2O A;  1N0Y A;  1NIW A;  2JWW A;  1OZO A;  2D8N A;  4YI9 A;  2GGZ A;  5BPJ A;  3EKJ A;  4HRE E;  4I5J A;  3WXA A;  2QPT A;  1YUT A;  1YTZ C;  1YUR A;  5G08 A;  2KYF A;  1IQ5 A;  1L2O B;  1CFD A;  1IGV A;  5I8N A;  1DGV A;  3JVT B;  4CFQ A;  2H61 C;  3OX5 A;  4FQO A;  3CR4 X;  3O6B A;  1LIN A;  3HX4 A;  2VRG A;  1LVC D;  2MA2 A;  2KFH A;  2BKH B;  1KQM B;  3MSE B;  1KQV A;  2H2K A;  2LUC A;  4NDD A;  1OOJ A;  1LXF C;  3DD4 A;  2G9B A;  4MRY A;  1J7R A;  1DJZ A;  1RRO A;  3PAT A;  3AKA A;  3BXK A;  3DF0 B;  4TNC A;  2BCB A;  2LVI A;  1AP4 A;  3WHT B;  1S6C A;  1BOC A;  2EGD A;  1KFX L;  3AAJ A;  1OE9 B;  1D1O A;  1CTR A;  1AK8 A;  3JVT C;  2ZRS A;  5K89 A;  4P2Y B;  1M63 B;  4YI8 A;  3D0Y A;  1CMG A;  4GGF A;  4M2P A;  1JFK A;  1REC A;  1KQM C;  1QX5 B;  4OCI A;  3AKB A;  1KFU L;  3CTN A;  5KSZ A;  1XFY O;  1FPW A;  1KFX S;  1QIV A;  2BL0 B;  3TDU A;  1QAT A;  1IWQ A;  1GGZ A;  1LA0 A;  1AUI B;  5DKN A;  2L4I A;  2BE6 A;  3CR2 A;  3GK2 A;  1NX1 A;  1PVA A;  4PE7 A;  1EL4 A;  4DCK A;  2K7D A;  2PSR A;  1KFU S;  2BBN A;  2F3Y A;  2ZN9 A;  3EK8 A;  2PAL A;  1CMF A;  2LV7 A;  2K2F A;  2NCP A;  4BY4 A;  1GJY A;  2LLS A;  1CLM A;  4USL A;  2JNF A;  3BUM B;  2JUL A;  1H8B A;  5AFP A;  1XFV O;  1K94 A;  1Y0V H;  1XFX O;  3FWC A;  1CDN A;  2KQY A;  2AAO A;  1ALW A;  1TTX A;  2BL0 C;  4MBE A;  3CLN A;  1M39 A;  1B47 A;  3EVU A;  2CNP A;  1CLB A;  1J1E A;  1TCF A;  3LLE A;  2HPS A;  5DKQ A;  2L51 A;  1PSB A;  2WCE A;  2K7C A;  2WC8 A;  3FWB A;  4UPG A;  1PK0 D;  2DOQ A;  1QAS A;  2K2A A;  3F45 A;  1KK8 B;  1BR4 B;  1QJT A;  4IL1 A;  1GGW A;  1KK7 Z;  2LLU A;  2MBX A;  4CFR A;  1UWO A;  1MWN A;  4QJ3 B;  4CID A;  5ER5 A;  2Y4Q A;  3IQQ A;  2KNE A;  1BF5 A;  3OX6 A;  1B8C A;  5HYD A;  1UUR A;  1UHK A;  3C1V A;  1XA5 A;  3O4Y A;  1XK4 A;  1C7V A;  3E3R A;  1SMG A;  1KSM A;  1ZFS A;  2JOJ A;  5HLO A;  4L9M A;  3EK4 A;  3PFV A;  2MJW B;  4M2Q A;  1PRW A;  1KK8 C;  3IQO A;  3BOW B;  4AOM A;  3BUW B;  1BJF A;  1FW4 A;  2LCP A;  4YRU A;  1C07 A;  1TNW A;  2KAY A;  2LE9 B;  1SKT A;  3EVR A;  2WOS A;  1JWD A;  2CBL A;  1OMV A;  1NCZ A;  3H4S E;  1G33 A;  2MHH A;  2FCD A;  1QS7 A;  1CNP A;  1YX8 A;  4N1F A;  1SCM B;  3I5I B;  3LCP C;  1BOD A;  4MEW A;  4PHK A;  3ZNI A;  2IS9 A;  2ISD A;  4MSP A;  1PSR A;  4HRH A;  4PDZ A;  2BBM A;  1F55 A;  1KSO A;  4A4C A;  1IG5 A;  1K8U A;  2OTG B;  3LK0 A;  2G2B A;  1XFU O;  3EVV A;  5AXI A;  2HQ8 A;  1C7W A;  1S5G Y;  3QRX A;  5F6T A;  2LHL A;  5AEQ A;  1V1F A;  1OSA A;  2KOT A;  2AMI A;  4N5X A;  4OKH A;  2KFF A;  1IH0 A;  3BQ3 A;  3RM1 A;  2PMY A;  4NDC A;  2E6W A;  5AER A;  1EXR A;  1MQ1 A;  1WRL A;  1G4Y R;  3GK1 A;  3NSI A;  4XJK A;  1K9P A;  1SCM C;  1QVI Z;  3I5I C;  1F70 A;  1EG3 A;  1B9A A;  4YGB B;  1B8L A;  1DT7 B;  3DVJ A;  4ETO A;  2KI6 D;  3CGA A;  1A75 B;  1GQM A;  2OTG C;  3SG4 A;  1K9U A;  1W7I B;  1YR5 A;  1V1G A;  1UHH A;  1CDM A;  2I18 A;  1Q80 A;  1K2H A;  2K61 A;  2O5G A;  1DF0 A;  2M1U A;  1M45 A;  2JRF A;  1SYM A;  1MXL C;  2FOT A;  3OP0 A;  3JTD C;  5CSI A;  4YGE B;  2K8M B;  1UHI A;  4MVF A;  1QLK A;  1YX7 A;  1YVH A;  1OZS A;  4WQ3 A;  1NX0 A;  1OQP A;  1AJ4 A;  2RGI A;  3OB2 B;  1YUS A;  2KSP A;  1F4O A;  1S26 D;  4QJ4 B;  1XYD A;  2MLF C;  3VRN A;  1MR8 A;  3WHU B;  1JC2 A;  1J1D A;  2OS8 B;  2SAS A;  3WNX B;  1MUX A;  4NDB A;  3BYA A;  4MLW A;  2KI4 C;  1CDL A;  4U8D A;  2MAZ A;  3CS1 A;  1WRK A;  1SL7 A;  2F8P A;  2SCP A;  4JWQ A;  2H61 A;  4I5L B;  4GUK A;  3CWG A;  3NSO A;  1J7P A;  1ZAC A;  4GBA A;  2BCX A;  1JFJ A;  3KHE A;  4PHM A;  1WDC B;  1FF1 A;  2OS8 C;  1OMD A;  1EJ3 A;  4PCW A;  1S36 A;  5IBW A;  1A2X A;  1AHR A;  1VRK A;  2CTN A;  1IKU A;  2GV5 A;  5CPV A;  1CFF A;  2MLE C;  3GOF A;  3ICB A;  1YUU A;  5I2O A;  3FIA A;  2KI6 C;  3M0W A;  4MN0 A;  2ZND A;  2JT8 A;  4DS7 A;  3SJS A;  4ZCU A;  1M46 A;  3KPX A;  5JOL A;  1DJY A;  3BUO B;  2P6B B;  1E8A A;  2EC6 B;  1XK4 C;  1QIW A;  3NSL A;  2O60 A;  2LMV A;  1EG4 A;  3HCM A;  4PAL A;  3SG5 A;  4OV2 A;  1DJW A;  1R2U A;  1WDC C;  2KAX A;  1XFW O;  5AAN A;  2KHN A;  4YGA A;  1DJG A;  3DF0 A;  3SG7 A;  1XVJ A;  1JBA A;  1XO5 A;  1TNQ A;  2JTZ A;  2JPT A;  2L50 A;  2LMT A;  3AAK A;  3OB1 B;  3NSK A;  1ODB A;  1IRJ A;  3GK4 X;  1L7Z A;  2EC6 C;  2L0P A;  5CSF A;  4PHN A;  5CSN A;  3K21 A;  5DKR A;  2BEC A;  2JZI A;  1UP5 A;  3BUX B;  3SG2 A;  4Q04 A;  4HRG A;  2KBM A;  5HLV A;  4XJK B;  2PRU A;  2FJU B;  1SY9 A;  1TN4 A;  1UUS A;  1K95 A;  1KK7 Y;  5HKZ A;  3TDZ A;  2KGR A;  1JF0 A;  1JSA A;  4GGN A;  2JXL A;  2JC2 A;  2KGB C;  4DUQ A;  3CR5 X;  1W7J B;  1DJH A;  1N65 A;  1MHO A;  2K7B A;  2WCF A;  2COL B;  4ICB A;  2AUC A;  4NQG A;  2JT0 A;  4JPZ B;  5PAL A;  1S3P A;  4PE4 A;  2LMU A;  2Y1N A;  3CZT X;  1A4P A;  1KWO B;  2M29 A;  3EKH A;  1SK6 D;  1MXE A;  3OHM B;  1K96 A;  1B4C A; 
#chains in the Genus database with same CATH topology
 4D1E A;  1AJ5 A;  3SS4 A;  2MRD A;  1TRF A;  1B8R A;  5I94 A;  1QXP A;  1RK9 A;  1EH2 A;  2HQW A;  1KCY A;  4XYN A;  1NX3 A;  3BFH A;  3L47 A;  1BG1 A;  1SBJ A;  3VGO A;  3D0Y B;  2HET A;  1CLL A;  1Y1A A;  4R1E A;  2B1U A;  2QEO A;  2BE4 A;  4AQI A;  1XFZ O;  1N2D A;  1Z4H A;  2JU0 A;  3TS5 B;  1KWO C;  3IF7 A;  3JTD B;  1Y1U A;  1FI5 A;  3VRR A;  2WCH A;  5I2Q A;  2KPH A;  4PE0 A;  1J7O A;  1CKK A;  4GAO A;  3LK1 A;  1CFC A;  4ORA B;  4PE1 A;  1DJI A;  1OOG A;  2ZKM X;  1BT6 A;  2GGM A;  4MZJ A;  2KQ6 A;  1J7Q A;  4YGC B;  2PAS A;  2L4H A;  1F71 A;  4GFT A;  5B8I B;  4GGF C;  1CM4 A;  1DQE A;  2K7O A;  1YVL A;  4C0L A;  2KI4 B;  3O78 A;  1DMO A;  3TS5 C;  1CFP A;  1QVI Y;  4DIR A;  1BU3 A;  1IQ3 A;  3A4U B;  3BOW A;  4F0Z B;  1DEK A;  1NCY A;  2E30 A;  2WCB A;  1RFJ A;  2I7A A;  3CYZ A;  2JTT A;  4OVN F;  4C0J A;  5HKY A;  5ER4 X;  2QEB A;  1U5I A;  2LC5 A;  1F4Q A;  4ZCV A;  1NSH A;  3ZWH A;  2K60 A;  3I5G B;  3I5H C;  4C0K A;  4A4B A;  3O2P A;  2L98 A;  1DJX A;  2R2I A;  5HKW A;  4CPV A;  1DTL A;  1K9K A;  5CSJ A;  3PN7 B;  1RTP 1;  3D78 A;  2F33 A;  2L2E A;  2M1K B;  2WOR A;  2Y5I A;  3TZ1 A;  1NUB A;  1Y1X A;  4JQ0 D;  1OW4 A;  3VRO A;  3DVM A;  1F8H A;  2F2O A;  1H4B A;  2I2R E;  2M97 A;  1NPQ A;  2BKI B;  2L5X B;  2M49 B;  2NLN A;  1B7T Z;  2LUX A;  2V53 A;  3KF9 A;  1L2O C;  2KAV A;  5D69 A;  2PYQ A;  3VRP A;  4YBH B;  1YRT B;  2Q4U A;  1PVB A;  2LVK A;  2FJY A;  2NZ0 A;  4FTG A;  2JQ6 A;  4MZK A;  1B1G A;  1YRU B;  2KBI A;  3I5G C;  4GPL B;  3I5F B;  1QX2 A;  1SW8 A;  3B6X A;  3SG6 A;  5KTY A;  3NXA A;  3KEV A;  2I94 A;  3PN7 C;  2KDH A;  5KU1 A;  2ZFD A;  1J55 A;  2BAP A;  3SIA A;  1LA3 A;  2A4J A;  1A03 A;  1A75 A;  1WRZ A;  1K90 D;  5D7F A;  3CZ1 A;  1W9Z A;  3LL8 B;  1BMO A;  3SIB A;  1ZMZ A;  1ORG A;  3Q8I A;  1ALV A;  2LP2 A;  1HQV A;  1K93 D;  3NHT A;  1TIZ A;  4F7F A;  1B7T Y;  1JF2 A;  3B7A A;  2P70 A;  5JJG A;  4PHJ A;  3I5F C;  2TN4 A;  2F3Z A;  1RWY A;  1PAL A;  2CCM A;  1G8I A;  2HF5 A;  2LNK A;  5J3X A;  1DVI A;  2M8U A;  2LLT A;  1SL8 A;  1WLZ A;  1NP8 A;  1DGU A;  4I5K A;  4WRI A;  1NYA A;  3D74 A;  1Y6W A;  4AQJ A;  2WND A;  1SNL A;  2JT3 A;  2LHI A;  2F2P A;  3B88 A;  1TNP A;  1LKJ A;  1SR6 B;  1S1E A;  4GNK B;  3RLZ A;  2ZN8 A;  3L4A A;  3DY9 A;  2BCA A;  1HT9 A;  1TNX A;  2LM5 A;  1NWD A;  3CZ0 A;  3PLF B;  5D3O A;  4OR9 B;  2KYC A;  4E68 A;  2FCE A;  1TOP A;  4P5O E;  1CM1 A;  2K0J A;  2CXJ A;  3D76 A;  2Q91 A;  1IJ5 A;  2M3W A;  1FBV A;  2EHB A;  3KO0 A;  2ZNE A;  3BUN B;  4INX A;  2LVV A;  1X02 A;  4JKT A;  2LVJ A;  2ZRT A;  3V2L A;  4N1G A;  4KYN A;  4MZL A;  1DF0 B;  2KFG A;  2M9G A;  2QAC A;  4BY5 A;  3VRQ A;  2CT9 A;  1M31 A;  1CB1 A;  1SR6 C;  1FI6 A;  3TDI A;  2M7N A;  3TUY B;  3EK7 A;  1QV0 A;  4HSZ A;  1OOH A;  4ORC B;  3PM8 A;  2P71 A;  1SRA A;  2JNX A;  2PVB A;  4YGD B;  5GQQ C;  1CDP A;  2JXC A;  2ERB A;  3PAL A;  4WQ2 A;  1S5G Z;  3DVE A;  1QV1 A;  1QTX A;  1TUZ A;  1QX7 A;  4ORB B;  1F54 A;  3D10 A;  1WY9 A;  3EG5 B;  1UHN A;  1U5I B;  4QJ5 B;  3SS5 A;  3DVK A;  2Y1M A;  2LAP A;  5FYX A;  1WLM A;  1SCV A;  2M0R A;  1TCO B;  1BR1 B;  1UHJ A;  3FE9 A;  3SG3 A;  1QLS A;  1OOF A;  1NCX A;  3TUY C;  2LP3 A;  1MF8 B;  2NCO A;  1A29 A;  3L4L A;  2LAN A;  1RJV A;  3A8R A;  4DRW A;  4CLN A;  2L5Y A;  3S0D A;  1SPY A;  1ZOT B;  1R6P A;  4MRX A;  3FS7 A;  1OMR A;  2NXQ A;  3K1E A;  1NX2 A;  1IJ6 A;  1SL9 A;  3N7H A;  1PUL A;  3PSR A;  5FI2 A;  4I5N B;  5I2L A;  3I5H B;  5TNC A;  2M7L A;  1AVS A;  1S6I A;  1JUO A;  1S6J A;  1ZUZ A;  3B87 A;  3NHI A;  1BLQ A;  2OPO A;  2GTE A;  4FQT A;  4M2O A;  1N0Y A;  1NIW A;  2JWW A;  3D77 A;  1OZO A;  2D8N A;  4YI9 A;  2GGZ A;  3NGV A;  5BPJ A;  3EKJ A;  4HRE E;  4I5J A;  3WXA A;  2QPT A;  1YUT A;  1YTZ C;  1YUR A;  5G08 A;  3B86 A;  2KYF A;  3OGN A;  1IQ5 A;  1L2O B;  1CFD A;  1IGV A;  5I8N A;  1DGV A;  3JVT B;  4CFQ A;  2H61 C;  3OX5 A;  4FQO A;  3CR4 X;  3O6B A;  1LIN A;  3HX4 A;  2VRG A;  1LVC D;  2MA2 A;  2KFH A;  2BKH B;  1KQM B;  3MSE B;  1KQV A;  2H2K A;  2LUC A;  4NDD A;  1OOJ A;  1LXF C;  3BFB A;  3DD4 A;  2G9B A;  4MRY A;  1J7R A;  1DJZ A;  1P28 A;  1RRO A;  3CZ2 A;  3AKA A;  3BXK A;  3PAT A;  3DF0 B;  4TNC A;  1QWV A;  2L2C A;  1C3Z A;  2BCB A;  2LVI A;  1AP4 A;  3WHT B;  1S6C A;  1BOC A;  2EGD A;  1KFX L;  3AAJ A;  1OE9 B;  3SS3 A;  1D1O A;  3S0F A;  1CTR A;  1AK8 A;  3JVT C;  3R1V A;  2ZRS A;  5K89 A;  4P2Y B;  1M63 B;  4YI8 A;  3D0Y A;  1CMG A;  4GGF A;  4M2P A;  1JFK A;  1REC A;  1KQM C;  1QX5 B;  4JD9 A;  3UNW A;  4OCI A;  3AKB A;  1KFU L;  3CTN A;  5KSZ A;  1XFY O;  1FPW A;  1KFX S;  1QIV A;  2BL0 B;  2H8V A;  1QAT A;  3TDU A;  1IWQ A;  1GGZ A;  1LA0 A;  1AUI B;  5DKN A;  2L4I A;  2BE6 A;  3CR2 A;  3GK2 A;  1T14 A;  1NX1 A;  1PVA A;  4PE7 A;  1EL4 A;  4DCK A;  3R1O A;  2K7D A;  2PSR A;  1KFU S;  2BBN A;  2F3Y A;  2QEH A;  2ZN9 A;  2PAL A;  3EK8 A;  1CMF A;  2LV7 A;  2K2F A;  2NCP A;  4BY4 A;  1GJY A;  2LLS A;  1CLM A;  4USL A;  2JNF A;  3BUM B;  2JUL A;  1H8B A;  5AFP A;  1XFV O;  1K94 A;  1Y0V H;  1XFX O;  3D75 A;  3FWC A;  1CDN A;  3O4X A;  2KQY A;  2PQL A;  2AAO A;  3R1P A;  1ALW A;  1TTX A;  2BL0 C;  4MBE A;  2KLD A;  3CLN A;  1M39 A;  1B47 A;  3EVU A;  3S0A A;  2CNP A;  1CLB A;  5DIC A;  1J1E A;  1TCF A;  2WCK A;  3LLE A;  2HPS A;  2BNX A;  5DKQ A;  2L51 A;  1PSB A;  2WCE A;  2K7C A;  5EL2 A;  2WC8 A;  3FWB A;  4UPG A;  1PK0 D;  2DOQ A;  1QAS A;  2K2A A;  3F45 A;  1KK8 B;  1BR4 B;  1QJT A;  4IL1 A;  1GGW A;  1KK7 Z;  2LLU A;  3R72 A;  2MBX A;  4CFR A;  3PJI A;  1UWO A;  1MWN A;  1TWO A;  4QJ3 B;  4CID A;  1GM0 A;  5ER5 A;  2Y4Q A;  3IQQ A;  2KNE A;  1BF5 A;  1Z2C B;  3OX6 A;  1B8C A;  5HYD A;  1UUR A;  1UHK A;  3C1V A;  1XA5 A;  3S0G A;  3O4Y A;  1XK4 A;  1C7V A;  3E3R A;  1SMG A;  1KSM A;  1ZFS A;  3BJH A;  2JOJ A;  2YGU A;  5HLO A;  4L9M A;  3UO9 A;  3S0E A;  3EK4 A;  3PFV A;  2MJW B;  4M2Q A;  1PRW A;  1KK8 C;  3FE8 A;  3IQO A;  3BOW B;  4AOM A;  3BUW B;  1BJF A;  1FW4 A;  2LCP A;  4YRU A;  1C07 A;  1TNW A;  2KAY A;  3D73 A;  2LE9 B;  1SKT A;  3EVR A;  2WOS A;  1JWD A;  2CBL A;  1OMV A;  1NCZ A;  3H4S E;  1G33 A;  2MHH A;  2FCD A;  1QS7 A;  1CNP A;  1YX8 A;  4N1F A;  3IVT A;  5FI6 A;  1SCM B;  3I5I B;  3LCP C;  3DXL A;  4MEW A;  4PHK A;  3ZNI A;  1BOD A;  2IS9 A;  2ISD A;  2WCJ A;  4MSP A;  1PSR A;  1XFR A;  4HRH A;  4PDZ A;  2BBM A;  5FI7 A;  4OZD A;  1KSO A;  4A4C A;  1F55 A;  1DEL A;  1IG5 A;  1K8U A;  2OTG B;  3LK0 A;  2G2B A;  3PM2 A;  1XFU O;  3EVV A;  5AXI A;  2HQ8 A;  1C7W A;  1S5G Y;  3QRX A;  5F6T A;  2LHL A;  5AEQ A;  1V1F A;  1OSA A;  2KOT A;  2AMI A;  2WCM A;  4N5X A;  2KFF A;  4OKH A;  3BQ3 A;  1IH0 A;  3RM1 A;  2PMY A;  4NDC A;  2E6W A;  5AER A;  1EXR A;  1MQ1 A;  1WRL A;  1G4Y R;  3GK1 A;  3NSI A;  4XJK A;  1K9P A;  1SCM C;  1QVI Z;  3I5I C;  3RZS A;  3FE6 A;  1F70 A;  1EG3 A;  1B9A A;  4YGB B;  1B8L A;  1DT7 B;  3DVJ A;  4ETO A;  2KI6 D;  3CGA A;  1A75 B;  1GQM A;  2OTG C;  3SG4 A;  1K9U A;  1W7I B;  3CAB A;  4IJ7 A;  1YR5 A;  1V1G A;  3DZT A;  1UHH A;  1CDM A;  2I18 A;  1Q80 A;  1K2H A;  2K61 A;  2O5G A;  1DF0 A;  4INW A;  2M1U A;  1M45 A;  1TUJ A;  2JRF A;  1SYM A;  1MXL C;  2FOT A;  3OP0 A;  3JTD C;  5CSI A;  4YGE B;  2K8M B;  1UHI A;  4MVF A;  1QLK A;  1OOI X;  1YVH A;  1OZS A;  1YX7 A;  4WQ3 A;  1NX0 A;  1OQP A;  1AJ4 A;  2RGI A;  3OB2 B;  1YUS A;  2KSP A;  1F4O A;  1S26 D;  4QJ4 B;  1XYD A;  2MLF C;  3VRN A;  1MR8 A;  3WHU B;  1JC2 A;  1J1D A;  2OS8 B;  2SAS A;  3WNX B;  3BFA A;  1MUX A;  2WCL A;  4NDB A;  3BYA A;  4MLW A;  2KI4 C;  1CDL A;  4U8D A;  2MAZ A;  1C3Y A;  3QME A;  2WC5 A;  3CS1 A;  1WRK A;  1SL7 A;  2F8P A;  2SCP A;  4JWQ A;  2H61 A;  2WC6 A;  4I5L B;  3VB1 A;  4GUK A;  3CWG A;  3NSO A;  1J7P A;  1ZAC A;  4GBA A;  2BCX A;  1JFJ A;  3KHE A;  4PHM A;  1WDC B;  3OBV A;  2OS8 C;  1OMD A;  1EJ3 A;  1FF1 A;  4PCW A;  1S36 A;  5IBW A;  1A2X A;  1AHR A;  1VRK A;  2CTN A;  2QEV A;  2GV5 A;  5CPV A;  1IKU A;  1CFF A;  2MLE C;  3GOF A;  3ICB A;  3DYE A;  1YUU A;  5I2O A;  3FIA A;  2KI6 C;  3M0W A;  4MN0 A;  2ZND A;  2JT8 A;  5HL1 A;  4DS7 A;  3SJS A;  4ZCU A;  1M46 A;  3KPX A;  5JOL A;  1DJY A;  3BUO B;  2P6B B;  1E8A A;  2EC6 B;  1XK4 C;  1QIW A;  3NSL A;  1DC1 A;  2O60 A;  2LMV A;  1EG4 A;  3HCM A;  4PAL A;  1LS8 A;  3SG5 A;  4OV2 A;  1DJW A;  1R2U A;  1WDC C;  1SSE B;  2KAX A;  1XFW O;  5AAN A;  2KHN A;  4YGA A;  1DJG A;  3DF0 A;  3SG7 A;  1XVJ A;  1JBA A;  1IIO A;  1XO5 A;  1TNQ A;  2JTZ A;  2JPT A;  2L50 A;  2LMT A;  3AAK A;  3S0B A;  3OB1 B;  3NSK A;  1ODB A;  1IRJ A;  3GK4 X;  1L7Z A;  2EC6 C;  2L0P A;  5CSF A;  4PHN A;  5CSN A;  3K21 A;  5DKR A;  2BEC A;  2JZI A;  1UP5 A;  3BUX B;  3SG2 A;  4Q04 A;  4HRG A;  2KBM A;  5HLV A;  4XJK B;  2PRU A;  2FJU B;  1SY9 A;  1TN4 A;  1UUS A;  2QDI A;  1K95 A;  1KK7 Y;  5HKZ A;  3TDZ A;  2KGR A;  1JF0 A;  1JSA A;  4GGN A;  2JXL A;  2JC2 A;  2KGB C;  4DUQ A;  3CR5 X;  1W7J B;  1DJH A;  1N65 A;  1MHO A;  2JPO A;  2K7B A;  2WCF A;  2COL B;  4ICB A;  2AUC A;  4NQG A;  2JT0 A;  4JPZ B;  5PAL A;  1S3P A;  4PE4 A;  2LMU A;  2Y1N A;  3CZT X;  1A4P A;  1KWO B;  3CDN A;  2M29 A;  3EKH A;  2KLE A;  1SK6 D;  1MXE A;  3OHM B;  4PT1 A;  1K96 A;  1B4C A; 
#chains in the Genus database with same CATH homology
 4D1E A;  1AJ5 A;  2MRD A;  1TRF A;  1B8R A;  1QXP A;  1RK9 A;  1EH2 A;  2HQW A;  1KCY A;  4XYN A;  1NX3 A;  1BG1 A;  1SBJ A;  3VGO A;  3D0Y B;  2HET A;  1CLL A;  1Y1A A;  4R1E A;  2B1U A;  2BE4 A;  4AQI A;  1XFZ O;  1N2D A;  2JU0 A;  3TS5 B;  1KWO C;  3IF7 A;  3JTD B;  1Y1U A;  1FI5 A;  3VRR A;  5I2Q A;  4PE0 A;  1J7O A;  1CKK A;  4GAO A;  3LK1 A;  1CFC A;  4ORA B;  4PE1 A;  1DJI A;  2ZKM X;  1BT6 A;  2GGM A;  4MZJ A;  2KQ6 A;  1J7Q A;  4YGC B;  2PAS A;  2L4H A;  1F71 A;  4GFT A;  5B8I B;  4GGF C;  1CM4 A;  2K7O A;  1YVL A;  4C0L A;  2KI4 B;  3O78 A;  1DMO A;  3TS5 C;  1CFP A;  1QVI Y;  4DIR A;  1BU3 A;  1IQ3 A;  3A4U B;  3BOW A;  4F0Z B;  1NCY A;  2E30 A;  2WCB A;  1RFJ A;  2I7A A;  2JTT A;  4OVN F;  4C0J A;  5HKY A;  5ER4 X;  1U5I A;  2LC5 A;  1F4Q A;  4ZCV A;  1NSH A;  3ZWH A;  3I5G B;  3I5H C;  4C0K A;  4A4B A;  3O2P A;  2L98 A;  1DJX A;  2R2I A;  5HKW A;  4CPV A;  1DTL A;  1K9K A;  5CSJ A;  3PN7 B;  1RTP 1;  2F33 A;  2L2E A;  2M1K B;  2WOR A;  2Y5I A;  3TZ1 A;  1NUB A;  1Y1X A;  4JQ0 D;  3VRO A;  3DVM A;  1F8H A;  2F2O A;  1H4B A;  2I2R E;  2M97 A;  1NPQ A;  2BKI B;  2L5X B;  2M49 B;  2NLN A;  1B7T Z;  2LUX A;  2V53 A;  3KF9 A;  1L2O C;  2KAV A;  5D69 A;  3VRP A;  4YBH B;  1YRT B;  2Q4U A;  1PVB A;  2LVK A;  2NZ0 A;  4FTG A;  2JQ6 A;  4MZK A;  1B1G A;  1YRU B;  2KBI A;  3I5G C;  4GPL B;  3I5F B;  1QX2 A;  1SW8 A;  3SG6 A;  5KTY A;  3NXA A;  3KEV A;  2I94 A;  3PN7 C;  2KDH A;  5KU1 A;  2ZFD A;  1J55 A;  3SIA A;  1LA3 A;  2A4J A;  1A03 A;  1A75 A;  1WRZ A;  1K90 D;  5D7F A;  3LL8 B;  1BMO A;  3SIB A;  1ZMZ A;  1ALV A;  2LP2 A;  1HQV A;  1K93 D;  1TIZ A;  1B7T Y;  1JF2 A;  5JJG A;  4PHJ A;  3I5F C;  2TN4 A;  2F3Z A;  1RWY A;  1PAL A;  2CCM A;  1G8I A;  2HF5 A;  2LNK A;  5J3X A;  1DVI A;  2M8U A;  2LLT A;  1SL8 A;  1WLZ A;  1NP8 A;  1DGU A;  4I5K A;  4WRI A;  1NYA A;  1Y6W A;  4AQJ A;  2WND A;  1SNL A;  2JT3 A;  2LHI A;  2F2P A;  1TNP A;  1LKJ A;  1SR6 B;  1S1E A;  4GNK B;  3RLZ A;  2ZN8 A;  2BCA A;  1HT9 A;  1TNX A;  2LM5 A;  1NWD A;  3PLF B;  4OR9 B;  2KYC A;  4E68 A;  2FCE A;  1TOP A;  4P5O E;  1CM1 A;  2K0J A;  2CXJ A;  2Q91 A;  1IJ5 A;  2M3W A;  1FBV A;  2EHB A;  3KO0 A;  2ZNE A;  3BUN B;  2LVV A;  1X02 A;  2LVJ A;  2ZRT A;  4N1G A;  4MZL A;  1DF0 B;  2KFG A;  2M9G A;  2QAC A;  4BY5 A;  3VRQ A;  2CT9 A;  1M31 A;  1CB1 A;  1SR6 C;  1FI6 A;  3TDI A;  2M7N A;  3TUY B;  3EK7 A;  1QV0 A;  4HSZ A;  4ORC B;  3PM8 A;  2PVB A;  1SRA A;  2JNX A;  4YGD B;  5GQQ C;  1CDP A;  2JXC A;  3PAL A;  4WQ2 A;  1S5G Z;  3DVE A;  1QV1 A;  1QTX A;  1QX7 A;  4ORB B;  1F54 A;  3D10 A;  1WY9 A;  1UHN A;  1U5I B;  4QJ5 B;  3DVK A;  2Y1M A;  2LAP A;  5FYX A;  1WLM A;  1SCV A;  2M0R A;  1TCO B;  1BR1 B;  1UHJ A;  3SG3 A;  1QLS A;  1NCX A;  3TUY C;  2LP3 A;  1MF8 B;  2NCO A;  1A29 A;  2LAN A;  1RJV A;  3A8R A;  4DRW A;  4CLN A;  1SPY A;  1ZOT B;  1R6P A;  4MRX A;  3FS7 A;  1OMR A;  2NXQ A;  1NX2 A;  1IJ6 A;  1SL9 A;  3PSR A;  1PUL A;  5I2L A;  5TNC A;  4I5N B;  3I5H B;  2M7L A;  1AVS A;  1S6I A;  1JUO A;  1S6J A;  1ZUZ A;  1BLQ A;  2OPO A;  4M2O A;  1N0Y A;  1NIW A;  2JWW A;  1OZO A;  2D8N A;  4YI9 A;  2GGZ A;  5BPJ A;  3EKJ A;  4HRE E;  4I5J A;  3WXA A;  2QPT A;  1YUT A;  1YTZ C;  1YUR A;  5G08 A;  2KYF A;  1IQ5 A;  1L2O B;  1CFD A;  1IGV A;  5I8N A;  1DGV A;  3JVT B;  4CFQ A;  2H61 C;  3OX5 A;  4FQO A;  3CR4 X;  3O6B A;  1LIN A;  3HX4 A;  2VRG A;  1LVC D;  2MA2 A;  2KFH A;  2BKH B;  1KQM B;  3MSE B;  1KQV A;  2H2K A;  2LUC A;  4NDD A;  1OOJ A;  1LXF C;  3DD4 A;  2G9B A;  4MRY A;  1J7R A;  1DJZ A;  1RRO A;  3PAT A;  3AKA A;  3BXK A;  3DF0 B;  4TNC A;  2BCB A;  2LVI A;  1AP4 A;  3WHT B;  1S6C A;  1BOC A;  2EGD A;  1KFX L;  3AAJ A;  1OE9 B;  1D1O A;  1CTR A;  1AK8 A;  3JVT C;  2ZRS A;  5K89 A;  4P2Y B;  1M63 B;  4YI8 A;  3D0Y A;  1CMG A;  4GGF A;  4M2P A;  1JFK A;  1REC A;  1KQM C;  1QX5 B;  4OCI A;  3AKB A;  1KFU L;  3CTN A;  5KSZ A;  1XFY O;  1FPW A;  1KFX S;  1QIV A;  2BL0 B;  3TDU A;  1QAT A;  1IWQ A;  1GGZ A;  1LA0 A;  1AUI B;  5DKN A;  2L4I A;  2BE6 A;  3CR2 A;  3GK2 A;  1NX1 A;  1PVA A;  4PE7 A;  1EL4 A;  4DCK A;  2K7D A;  2PSR A;  1KFU S;  2BBN A;  2F3Y A;  2ZN9 A;  3EK8 A;  2PAL A;  1CMF A;  2LV7 A;  2K2F A;  2NCP A;  4BY4 A;  1GJY A;  2LLS A;  1CLM A;  4USL A;  2JNF A;  3BUM B;  2JUL A;  1H8B A;  5AFP A;  1XFV O;  1K94 A;  1Y0V H;  1XFX O;  3FWC A;  1CDN A;  2KQY A;  2AAO A;  1ALW A;  1TTX A;  2BL0 C;  4MBE A;  3CLN A;  1M39 A;  1B47 A;  3EVU A;  2CNP A;  1CLB A;  1J1E A;  1TCF A;  3LLE A;  2HPS A;  5DKQ A;  2L51 A;  1PSB A;  2WCE A;  2K7C A;  2WC8 A;  3FWB A;  4UPG A;  1PK0 D;  2DOQ A;  1QAS A;  2K2A A;  3F45 A;  1KK8 B;  1BR4 B;  1QJT A;  4IL1 A;  1GGW A;  1KK7 Z;  2LLU A;  2MBX A;  4CFR A;  1UWO A;  1MWN A;  4QJ3 B;  4CID A;  5ER5 A;  2Y4Q A;  3IQQ A;  2KNE A;  1BF5 A;  3OX6 A;  1B8C A;  5HYD A;  1UUR A;  1UHK A;  3C1V A;  1XA5 A;  3O4Y A;  1XK4 A;  1C7V A;  3E3R A;  1SMG A;  1KSM A;  1ZFS A;  2JOJ A;  5HLO A;  4L9M A;  3EK4 A;  3PFV A;  2MJW B;  4M2Q A;  1PRW A;  1KK8 C;  3IQO A;  3BOW B;  4AOM A;  3BUW B;  1BJF A;  1FW4 A;  2LCP A;  4YRU A;  1C07 A;  1TNW A;  2KAY A;  2LE9 B;  1SKT A;  3EVR A;  2WOS A;  1JWD A;  2CBL A;  1OMV A;  1NCZ A;  3H4S E;  1G33 A;  2MHH A;  2FCD A;  1QS7 A;  1CNP A;  1YX8 A;  4N1F A;  1SCM B;  3I5I B;  3LCP C;  1BOD A;  4MEW A;  4PHK A;  3ZNI A;  2IS9 A;  2ISD A;  4MSP A;  1PSR A;  4HRH A;  4PDZ A;  2BBM A;  1F55 A;  1KSO A;  4A4C A;  1IG5 A;  1K8U A;  2OTG B;  3LK0 A;  2G2B A;  1XFU O;  3EVV A;  5AXI A;  2HQ8 A;  1C7W A;  1S5G Y;  3QRX A;  5F6T A;  2LHL A;  5AEQ A;  1V1F A;  1OSA A;  2KOT A;  2AMI A;  4N5X A;  4OKH A;  2KFF A;  1IH0 A;  3BQ3 A;  3RM1 A;  2PMY A;  4NDC A;  2E6W A;  5AER A;  1EXR A;  1MQ1 A;  1WRL A;  1G4Y R;  3GK1 A;  3NSI A;  4XJK A;  1K9P A;  1SCM C;  1QVI Z;  3I5I C;  1F70 A;  1EG3 A;  1B9A A;  4YGB B;  1B8L A;  1DT7 B;  3DVJ A;  4ETO A;  2KI6 D;  3CGA A;  1A75 B;  1GQM A;  2OTG C;  3SG4 A;  1K9U A;  1W7I B;  1YR5 A;  1V1G A;  1UHH A;  1CDM A;  2I18 A;  1Q80 A;  1K2H A;  2K61 A;  2O5G A;  1DF0 A;  2M1U A;  1M45 A;  2JRF A;  1SYM A;  1MXL C;  2FOT A;  3OP0 A;  3JTD C;  5CSI A;  4YGE B;  2K8M B;  1UHI A;  4MVF A;  1QLK A;  1YX7 A;  1YVH A;  1OZS A;  4WQ3 A;  1NX0 A;  1OQP A;  1AJ4 A;  2RGI A;  3OB2 B;  1YUS A;  2KSP A;  1F4O A;  1S26 D;  4QJ4 B;  1XYD A;  2MLF C;  3VRN A;  1MR8 A;  3WHU B;  1JC2 A;  1J1D A;  2OS8 B;  2SAS A;  3WNX B;  1MUX A;  4NDB A;  3BYA A;  4MLW A;  2KI4 C;  1CDL A;  4U8D A;  2MAZ A;  3CS1 A;  1WRK A;  1SL7 A;  2F8P A;  2SCP A;  4JWQ A;  2H61 A;  4I5L B;  4GUK A;  3CWG A;  3NSO A;  1J7P A;  1ZAC A;  4GBA A;  2BCX A;  1JFJ A;  3KHE A;  4PHM A;  1WDC B;  1FF1 A;  2OS8 C;  1OMD A;  1EJ3 A;  4PCW A;  1S36 A;  5IBW A;  1A2X A;  1AHR A;  1VRK A;  2CTN A;  1IKU A;  2GV5 A;  5CPV A;  1CFF A;  2MLE C;  3GOF A;  3ICB A;  1YUU A;  5I2O A;  3FIA A;  2KI6 C;  3M0W A;  4MN0 A;  2ZND A;  2JT8 A;  4DS7 A;  3SJS A;  4ZCU A;  1M46 A;  3KPX A;  5JOL A;  1DJY A;  3BUO B;  2P6B B;  1E8A A;  2EC6 B;  1XK4 C;  1QIW A;  3NSL A;  2O60 A;  2LMV A;  1EG4 A;  3HCM A;  4PAL A;  3SG5 A;  4OV2 A;  1DJW A;  1R2U A;  1WDC C;  2KAX A;  1XFW O;  5AAN A;  2KHN A;  4YGA A;  1DJG A;  3DF0 A;  3SG7 A;  1XVJ A;  1JBA A;  1XO5 A;  1TNQ A;  2JTZ A;  2JPT A;  2L50 A;  2LMT A;  3AAK A;  3OB1 B;  3NSK A;  1ODB A;  1IRJ A;  3GK4 X;  1L7Z A;  2EC6 C;  2L0P A;  5CSF A;  4PHN A;  5CSN A;  3K21 A;  5DKR A;  2BEC A;  2JZI A;  1UP5 A;  3BUX B;  3SG2 A;  4Q04 A;  4HRG A;  2KBM A;  5HLV A;  4XJK B;  2PRU A;  2FJU B;  1SY9 A;  1TN4 A;  1UUS A;  1K95 A;  1KK7 Y;  5HKZ A;  3TDZ A;  2KGR A;  1JF0 A;  1JSA A;  4GGN A;  2JXL A;  2JC2 A;  2KGB C;  4DUQ A;  3CR5 X;  1W7J B;  1DJH A;  1N65 A;  1MHO A;  2K7B A;  2WCF A;  2COL B;  4ICB A;  2AUC A;  4NQG A;  2JT0 A;  4JPZ B;  5PAL A;  1S3P A;  4PE4 A;  2LMU A;  2Y1N A;  3CZT X;  1A4P A;  1KWO B;  2M29 A;  3EKH A;  1SK6 D;  1MXE A;  3OHM B;  1K96 A;  1B4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...