4CLNA

Structure of a recombinant calmodulin from drosophila melanogaster refined at 2.2-angstroms resolution
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
148
structure length
148
Chain Sequence
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVTMMTSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALMODULIN
publication title Structure of a recombinant calmodulin from Drosophila melanogaster refined at 2.2-A resolution.
pubmed rcsb
source organism Drosophila melanogaster
molecule tags Calcium binding protein
total genus 42
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 1991-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4clnA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4clnA02
3QRXA 1JFJA 2JNXA 1J7RA 5D69A 2PASA 2BL0B 4HRHA 2K2AA 4HRGA 5CSIA 2ISDA 3RM1A 1EG3A 2JTTA 2JOJA 1V1FA 2B1UA 1JFKA 3EVVA 4PALA 1IH0A 5G08A 2LE9B 2PSRA 3KHEA 3PLFB 3BUXB 1B7TZ 1DJYA 3FWCA 1DTLA 1S3PA 1A4PA 4L9MA 1D1OA 5K89A 4DUQA 1NPQA 1J1EA 3WNXB 2M97A 2IS9A 5KTYA 1K9PA 2JPTA 1OSAA 4N5XA 3WXAA 1SL9A 1CM4A 1QJTA 1R2UA 1XK4A 2OPOA 2KI6C 4ORBB 1SR6B 4M2PA 4PE1A 2EHBA 3MSEB 4I5NB 4PHJA 1TRFA 3IQOA 4OR9B 1BOCA 4DS7A 2KI6D 3PM8A 1GQMA 5D7FA 3CGAA 2MJWB 4WQ3A 5DKQA 3CS1A 4YBHB 1W7JB 2MRDA 1ALWA 4GFTA 5KU1A 1N65A 2VRGA 3TS5C 1YX8A 1FF1A 1AVSA 5I2QA 1RWYA 4FQOA 4YGEB 1NX2A 1KK8C 1KQMB 2LLSA 4ORAB 1S36A 3KEVA 1CKKA 1KFXL 3SG6A 4XJKA 2JRFA 2KHNA 2M7NA 1SK6D 3LK1A 4TNCA 1QLSA 2M7LA 2KNEA 1YURA 5CSFA 2K7CA 1H4BA 1Y1XA 4JPZB 1F70A 2EGDA 4I5KA 3CTNA 3DVMA 1KWOC 3SIBA 2LP3A 3K21A 1NIWA 3PN7B 1LA3A 3IF7A 3EVUA 4XJKB 1F71A 1QV1A 2ZN8A 1V1GA 1IQ3A 4MRYA 1QV0A 2WC8A 2M1UA 1WDCB 3NSIA 2ZNEA 1LXFC 1CFCA 4PHNA 1MF8B 4GAOA 1OOJA 2WCEA 3LLEA 2PALA 3DF0A 1M46A 1JC2A 2AUCA 2L5XB 4M2OA 1IWQA 2EC6C 3O6BA 4ZCVA 2CTNA 1RTP1 4MZKA 4WQ2A 1CDNA 2I7AA 2WOSA 3DF0B 1ZACA 1SCMB 2M9GA 2F3ZA 2V53A 5JJGA 3VRPA 1SL7A 1BLQA 3EK4A 4YI9A 1UHIA 1PSBA 1M45A 5DKRA 2QPTA 3HCMA 2M29A 4CIDA 1HT9A 4MZJA 1OZOA 2DOQA 2TN4A 3LCPC 4PE0A 2KFGA 1B47A 3OHMB 2OS8B 1SMGA 1GGWA 1N0YA 2JWWA 1JF2A 1M63B 4I5LB 2PVBA 2MA2A 3SJSA 1K96A 2M49B 5PALA 4DRWA 5B8IB 3DVKA 1SYMA 2K0JA 1PSRA 1X02A 2LAPA 3NSKA 1NCZA 1TNXA 1CTRA 1YRTB 1IRJA 4QJ5B 1JUOA 2KQYA 3JTDC 1TNPA 1TNWA 5HKYA 2K7DA 4GGFC 3AAJA 1FW4A 2LMTA 3KO0A 1L2OC 3BUMB 1YRUB 5CSJA 1QTXA 1QXPA 3OB1B 1QX2A 3NXAA 3PFVA 2KQ6A 2A4JA 5KSZA 4AQJA 1A03A 1JSAA 1PVBA 1HQVA 2SCPA 1EG4A 2E6WA 1QX5B 1SL8A 1SY9A 1C7VA 1QIWA 1LINA 1ZMZA 2GGZA 1KCYA 2KFFA 4YGBB 1U5IB 3VGOA 4NQGA 1GGZA 1CMGA 1YVHA 1A75A 3I5HC 4ETOA 1G8IA 1NX1A 1VRKA 3BOWA 5ER5A 1NWDA 2F2PA 4AOMA 2KYCA 1EJ3A 1MQ1A 1XVJA 1QIVA 2FJUB 1F4QA 2Y5IA 2FCDA 2KYFA 4PE7A 4USLA 5HKZA 2K7OA 1PK0D 1F8HA 1LVCD 1RFJA 5F6TA 3I5IC 3TDZA 2KGBC 1RJVA 3TUYC 2L98A 2CXJA 3CR2A 2P6BB 4JWQA 1A2XA 2Y1MA 1CB1A 2LUCA 3IQQA 1YTZC 2BBNA 2KI4C 1SW8A 2HPSA 1BMOA 2OTGB 2BE6A 1B8CA 3SG7A 2O5GA 3BYAA 1L7ZA 4MRXA 2LV7A 4DCKA 2JTZA 2CNPA 5AEQA 2LVVA 3VRNA 4UPGA 3EVRA 2CT9A 1PALA 4PCWA 1S6IA 1Q80A 3RLZA 1ODBA 2M1KB 1DVIA 1EL4A 1GJYA 1G4YR 1Y0VH 4FTGA 1UUSA 1UHKA 2MAZA 2KDHA 2NCPA 2HF5A 3H4SE 4GBAA 3EKHA 1S1EA 2K2FA 1Y1AA 5HYDA 2KOTA 1NX0A 3VRQA 3VROA 2BCBA 1IGVA 3D0YA 5HLOA 1BF5A 2KAXA 3VRRA 1CDMA 4QJ4B 1PVAA 4QJ3B 4WRIA 1OMVA 1YUUA 5DKNA 4I5JA 4U8DA 5GQQC 3TDUA 4P5OE 3A4UB 3I5IB 3LL8B 1CM1A 2FCEA 1CDPA 5I2LA 3D0YB 4PDZA 4C0KA 1MHOA 1NCXA 4PE4A 1S6JA 1IJ5A 2KGRA 2ZNDA 3SG2A 1LKJA 1TN4A 2L4HA 2PMYA 5HLVA 1K2HA 4N1GA 1DJXA 3AKBA 5I8NA 1OMRA 1S26D 3PSRA 2JQ6A 3GK1A 4NDCA 1UHHA 3TS5B 4A4CA 2F8PA 1CNPA 1S5GY 5J3XA 2G2BA 1YUTA 2LLTA 2L4IA 2Q91A 1J7PA 1KK8B 1F54A 2Y4QA 2I2RE 2E30A 3CR5X 1EH2A 4NDBA 3DVJA 1B8LA 2NXQA 1RECA 1DJGA 2LVKA 1CFPA 1WLZA 3A8RA 3O4YA 1QATA 4D1EA 1WY9A 1TCFA 2GGMA 1BG1A 3O2PA 2KAYA 4R1EA 2KBIA 3WHTB 1NYAA 4A4BA 1CMFA 2M8UA 3I5GC 1XO5A 3M0WA 1W7IB 1K95A 2BKIB 3JVTC 1WLMA 3WHUB 3FIAA 1KWOB 3OX5A 1LA0A 4BY5A 1FPWA 1AJ4A 2HQWA 2BECA 2KBMA 1YUSA 1AK8A 1KQVA 1AJ5A 4AQIA 2K8MB 2BL0C 1MUXA 1C7WA 2NLNA 3GOFA 2LLUA 1AP4A 3BUWB 1RK9A 4CLNA 4OVNF 1YR5A 1OE9B 1BODA 1XFYO 4CPVA 1OMDA 2F3YA 1Y6WA 1IQ5A 1IG5A 1B1GA 2F2OA 2CBLA 2EC6B 1WRZA 1DGUA 1S6CA 3PATA 1XFXO 4IL1A 4BY4A 1ZFSA 2F33A 1SR6C 2WORA 1UHNA 2RGIA 2K7BA 1BJFA 3EKJA 2H2KA 2HETA 3CWGA 3KPXA 2LM5A 1CLBA 1M31A 3I5FC 4YI8A 3EK7A 1B8RA 4OV2A 3C1VA 1DJZA 1S5GZ 1QVIZ 3BXKA 5CPVA 1NCYA 2L51A 2JXLA 2BBMA 1SRAA 1NX3A 2JT0A 1SCVA 1NP8A 3OP0A 4M2QA 1KFUS 2L2EA 3I5GB 4GGNA 4YGAA 4GGFA 1XFZO 1KQMC 2LVJA 3JVTB 3LK0A 1KFUL 1OQPA 1A75B 1AUIB 4PHMA 3SG3A 3TDIA 1CFFA 3BOWB 1PULA 5HKWA 3BQ3A 1TTXA 3JTDB 2Q4UA 1EXRA 2LHLA 1TCOB 2JNFA 1C07A 4F0ZB 3AAKA 2WCBA 4YRUA 2R2IA 5CSNA 1L2OB 1XFVO 1B4CA 2G9BA 3NSLA 2Y1NA 1FI5A 5IBWA 2BCAA 4C0LA 2MHHA 3PN7C 2HQ8A 2ZN9A 3AKAA 1J7OA 2LC5A 2O60A 4P2YB 1SKTA 3GK4X 1IKUA 5AXIA 1SBJA 1YX7A 1WDCC 2JXCA 2JC2A 2KFHA 2ZFDA 1G33A 2AMIA 1TIZA 2JT8A 1K90D 3HX4A 3OX6A 2I94A 4YGCB 1QS7A 3I5FB 5TNCA 2M3WA 2L0PA 1XYDA 2LVIA 3DD4A 3I5HB 1K8UA 1XFWO 2GV5A 1K93D 1UWOA 1YVLA 1KSMA 1KK7Y 2KAVA 1MXEA 1MXLC 2LMUA 3DVEA 1MR8A 2NCOA 1KFXS 2D8NA 1SCMC 1WRKA 3TZ1A 1BU3A 3SG4A 3TUYB 2SASA 1DMOA 1K9KA 4HSZA 1ZOTB 2BE4A 2JT3A 3F45A 3KF9A 1K9UA 1F4OA 5AERA 1Y1UA 4OKHA 4ZCUA 1J1DA 2CCMA 2OS8C 2KI4B 1J7QA 2FOTA 1FBVA 1DT7B 2I18A 2LANA 1H8BA 2ZRTA 1XA5A 1QASA 2H61C 1N2DA 1NSHA 2LUXA 1QVIY 1UHJA 1BT6A 1CLMA 1JBAA 1KSOA 1BR4B 1B9AA 3E3RA 1NUBA 4ICBA 3CZTX 1DJWA 1DJHA 1XFUO 1CDLA 4NDDA 2WCFA 1IJ6A 4C0JA 2PRUA 1E8AA 1UP5A 3D10A 2WNDA 1K94A 3CLNA 5FYXA 2MBXA 4JQ0D 4MLWA 4PHKA 1B7TY 1DJIA 1BR1B 2LNKA 4Q04A 1ALVA 3SG5A 3NSOA 3ICBA 2ZKMX 2MLEC 1RROA 1DF0A 3CR4X 3ZWHA 1CFDA 2MLFC 5AFPA 1CLLA 4OCIA 2M0RA 2COLB 2H61A 2L50A 4ORCB 1ZUZA 3ZNIA 1M39A 1KK7Z 1F55A 5JOLA 1PRWA 2AAOA 5AANA 1A29A 1R6PA 1SPYA 2BCXA 1DF0B 1TNQA 4MBEA 5ER4X 1JWDA 3GK2A 1WRLA 2LHIA 1MWNA 4GPLB 4DIRA 5I2OA 4MVFA 2LP2A 2KSPA 1J55A 3BUNB 3OB2B 3SIAA 2LMVA 4MZLA 1QX7A 5BPJA 3FWBA 2JULA 4GNKB 1DGVA 3BUOB 3O78A 4XYNA 1QLKA 2LCPA 3EK8A 3FS7A 4MN0A 4MEWA 2OTGC 2NZ0A 1UURA 2JU0A 4HREE 4CFRA 1JF0A 1XK4C 4CFQA 3PALA 2BKHB 4GUKA 1AHRA 1U5IA 1OZSA 4E68A 1FI6A 1TOPA 2ZRSA 4YGDB 2K61A 2JZIA 4MSPA 4N1FA 2QACA 1SNLA
chains in the Genus database with same CATH superfamily
3QRXA 1JFJA 2JNXA 1J7RA 5D69A 2PASA 2BL0B 4HRHA 2K2AA 4HRGA 5CSIA 2ISDA 3RM1A 1EG3A 2JTTA 2JOJA 1V1FA 1ORGA 1JFKA 2B1UA 3CYZA 3EVVA 4PALA 2LE9B 2PSRA 3KHEA 5G08A 3RZSA 3PLFB 3BUXB 1B7TZ 1DJYA 1W9ZA 3FWCA 1DTLA 1S3PA 1A4PA 4L9MA 1D1OA 5K89A 4DUQA 1NPQA 1OOHA 1J1EA 3V2LA 3WNXB 2M97A 2IS9A 5KTYA 1K9PA 2JPTA 3S0EA 3O4XA 1OSAA 4N5XA 3WXAA 1SL9A 1CM4A 1QJTA 1R2UA 1XK4A 2OPOA 2KI6C 2ERBA 1SR6B 4ORBB 4M2PA 4PE1A 3SS4A 2EHBA 3MSEB 4I5NB 4PHJA 1TRFA 3B86A 3IQOA 4OR9B 1BOCA 4DS7A 2KI6D 3PM8A 1GQMA 5D7FA 3CGAA 2MJWB 4WQ3A 5FI2A 1T14A 5DKQA 3CS1A 4YBHB 3R72A 1W7JB 2MRDA 1ALWA 3S0FA 4GFTA 5KU1A 1N65A 2VRGA 1DEKA 3TS5C 1YX8A 3BFAA 1FF1A 1AVSA 5I2QA 1RWYA 4FQOA 4YGEB 1NX2A 1KK8C 1KQMB 2LLSA 4JD9A 4ORAB 1S36A 3KEVA 1CKKA 1KFXL 3SG6A 3L4LA 4XJKA 2JRFA 5EL2A 2KHNA 2M7NA 1SK6D 4FQTA 3LK1A 4TNCA 1QLSA 2M7LA 2KNEA 1YURA 5CSFA 2K7CA 1H4BA 1Y1XA 4JPZB 1F70A 2EGDA 4I5KA 3CTNA 3DVMA 1KWOC 3SIBA 2LP3A 3K21A 1NIWA 3PN7B 1LA3A 3IF7A 3EVUA 4XJKB 3R1PA 1F71A 1QV1A 2ZN8A 2WCMA 1V1GA 1IQ3A 4MRYA 1QV0A 2WC8A 2M1UA 1WDCB 3K1EA 3NSIA 2ZNEA 1LXFC 1CFCA 4PHNA 1MF8B 4JKTA 4GAOA 5D3OA 1OOJA 2P70A 2WCEA 3LLEA 3UNWA 2PALA 3DF0A 1M46A 1JC2A 2AUCA 2L5XB 4M2OA 1IWQA 2EC6C 3O6BA 2H8VA 3N7HA 2KPHA 4ZCVA 2CTNA 4PT1A 1RTP1 4MZKA 4WQ2A 1CDNA 2I7AA 2WOSA 3DF0B 1ZACA 1SCMB 5FI6A 2M9GA 2F3ZA 2V53A 5FI7A 3SS3A 3VRPA 1SL7A 5JJGA 3EK4A 1BLQA 4YI9A 1UHIA 1PSBA 1M45A 5DKRA 2QPTA 3HCMA 2M29A 4CIDA 1HT9A 4MZJA 1OZOA 2WC5A 1DC1A 2DOQA 2TN4A 3LCPC 4PE0A 2KFGA 1B47A 3OHMB 2OS8B 1SMGA 1GGWA 1N0YA 2JWWA 1JF2A 1M63B 4I5LB 2PVBA 1C3ZA 2MA2A 3PM2A 3SJSA 1K96A 2M49B 5PALA 4DRWA 5B8IB 3DVKA 1SYMA 1TWOA 2K0JA 1PSRA 4KYNA 1X02A 2LAPA 3NSKA 1NCZA 1TNXA 1CTRA 1YRTB 3UO9A 1IRJA 4QJ5B 1JUOA 2KQYA 3JTDC 1TNPA 1TNWA 5HKYA 3OBVA 2K7DA 4GGFC 3AAJA 1FW4A 2LMTA 3KO0A 1L2OC 3BUMB 1YRUB 5CSJA 1IIOA 2QEHA 1QTXA 1QXPA 3OB1B 1QX2A 3NXAA 3PFVA 2KQ6A 2A4JA 5KSZA 4AQJA 1QWVA 1A03A 1JSAA 5DICA 1PVBA 1HQVA 1OOGA 2SCPA 1EG4A 2E6WA 1QX5B 1SL8A 1SY9A 1C7VA 1QIWA 1LINA 1ZMZA 2GGZA 1C3YA 1KCYA 2KFFA 4YGBB 1U5IB 3VGOA 4NQGA 1GGZA 3NHIA 1CMGA 1YVHA 1A75A 3I5HC 4ETOA 1G8IA 1NX1A 1VRKA 3BOWA 5ER5A 1NWDA 2F2PA 4AOMA 2KYCA 1EJ3A 1MQ1A 3S0DA 1XVJA 1QIVA 2FJUB 1F4QA 2Y5IA 2FCDA 4IJ7A 2KYFA 4PE7A 4USLA 5HKZA 2K7OA 1PK0D 1F8HA 1LVCD 1RFJA 5F6TA 3I5IC 3TDZA 2KGBC 1RJVA 3D74A 3TUYC 2L98A 2CXJA 3CR2A 2P6BB 4JWQA 3L4AA 1A2XA 2Y1MA 1CB1A 2LUCA 3IQQA 1YTZC 2BBNA 2KI4C 1SW8A 2HPSA 1BMOA 2OTGB 2BE6A 2PQLA 1B8CA 3SG7A 2O5GA 1DELA 3BYAA 1L7ZA 4MRXA 2LV7A 4DCKA 2JTZA 2CNPA 4INWA 2L2CA 2YGUA 5AEQA 2LVVA 3VRNA 2JPOA 3EVRA 4UPGA 2CT9A 1PALA 1SSEB 4PCWA 1S6IA 1Q80A 3RLZA 1ODBA 2M1KB 1DVIA 1EL4A 1GJYA 1G4YR 1Y0VH 4FTGA 3DXLA 1UUSA 1UHKA 2MAZA 3L47A 2KDHA 2NCPA 2WCKA 1Z2CB 2HF5A 3H4SE 4GBAA 3EKHA 1S1EA 3VB1A 2K2FA 1Y1AA 5HYDA 2KOTA 1NX0A 3VRQA 3VROA 2BCBA 3DZTA 1IGVA 3D0YA 5HLOA 1BF5A 3S0GA 2KAXA 3VRRA 1CDMA 4QJ4B 1PVAA 4QJ3B 4WRIA 1OMVA 1YUUA 3CZ1A 4I5JA 4U8DA 5DKNA 5GQQC 3TDUA 4P5OE 3A4UB 3I5IB 3LL8B 1CM1A 2FCEA 1CDPA 5I2LA 3Q8IA 3D0YB 4PDZA 4C0KA 1MHOA 1NCXA 4PE4A 3D78A 1S6JA 1IJ5A 2KGRA 2ZNDA 3SG2A 1LKJA 1TN4A 2L4HA 2PMYA 5HLVA 1K2HA 4N1GA 1DJXA 3AKBA 5I8NA 1OMRA 3S0BA 1S26D 3PSRA 2JQ6A 3GK1A 4NDCA 1UHHA 3TS5B 4A4CA 2F8PA 1CNPA 1S5GY 5J3XA 2G2BA 1YUTA 2LLTA 1GM0A 3BFBA 2L4IA 2KLDA 2Q91A 1J7PA 1KK8B 1F54A 2Y4QA 2I2RE 2E30A 3CR5X 1EH2A 4NDBA 3DVJA 1B8LA 2NXQA 1OOIX 1RECA 1DJGA 2LVKA 1CFPA 1WLZA 3A8RA 3O4YA 1QATA 4D1EA 1WY9A 1TCFA 2GGMA 1BG1A 2KLEA 3O2PA 2KAYA 4R1EA 2KBIA 3WHTB 1NYAA 4A4BA 1CMFA 1OOFA 2M8UA 1LS8A 3I5GC 1XO5A 3FE6A 1W7IB 1K95A 2BKIB 3JVTC 3M0WA 1WLMA 3WHUB 3FIAA 1KWOB 3OX5A 1LA0A 4BY5A 1FPWA 3R1VA 1AJ4A 2HQWA 2BECA 2KBMA 1YUSA 3DY9A 1AK8A 1AJ5A 1KQVA 4AQIA 2K8MB 1MUXA 1C7WA 2BL0C 2NLNA 3GOFA 2LLUA 1AP4A 3BUWB 1RK9A 2QDIA 4OVNF 1YR5A 3CZ2A 4CLNA 1OE9B 1BODA 1XFYO 4CPVA 1OMDA 2F3YA 1Y6WA 1IQ5A 3B87A 1IG5A 1B1GA 2F2OA 2CBLA 2EC6B 1WRZA 1DGUA 1S6CA 3PATA 1XFXO 4IL1A 4BY4A 1ZFSA 2F33A 1SR6C 2WORA 1UHNA 2RGIA 2K7BA 1BJFA 3EKJA 2H2KA 2HETA 3CWGA 3KPXA 2LM5A 1CLBA 1M31A 3I5FC 4YI8A 3EK7A 4OZDA 1B8RA 4OV2A 3C1VA 1DJZA 1S5GZ 1QVIZ 3BXKA 5CPVA 1NCYA 2L51A 2JXLA 2BBMA 1SRAA 1NX3A 2JT0A 1SCVA 1NP8A 3OP0A 4M2QA 1KFUS 2L2EA 3CDNA 3CZ0A 3I5GB 4GGNA 4GGFA 4YGAA 1XFZO 1KQMC 2K60A 2LVJA 3JVTB 3LK0A 1KFUL 2PYQA 1OQPA 1A75B 1AUIB 4PHMA 3SS5A 3SG3A 3TDIA 1CFFA 3BOWB 1PULA 3FE8A 5HKWA 3BQ3A 1TTXA 3DYEA 3JTDB 2Q4UA 1EXRA 2LHLA 1TCOB 2JNFA 3B7AA 1C07A 4F0ZB 3AAKA 2WCBA 4YRUA 2R2IA 5CSNA 1L2OB 1XFVO 3D76A 3FE9A 2BAPA 2G9BA 3NSLA 1B4CA 2BNXA 2Y1NA 5IBWA 2BCAA 4C0LA 1FI5A 1Z4HA 2MHHA 3PN7C 2HQ8A 2ZN9A 3AKAA 1J7OA 2LC5A 2O60A 3PJIA 4P2YB 1SKTA 3GK4X 1IKUA 5AXIA 1SBJA 1YX7A 1WDCC 2JXCA 2JC2A 2KFHA 2ZFDA 3OGNA 1G33A 2AMIA 1TIZA 2JT8A 1K90D 3HX4A 3OX6A 2I94A 4YGCB 1QS7A 3I5FB 5TNCA 2M3WA 5HL1A 2L0PA 1XYDA 2LVIA 3DD4A 3I5HB 1K8UA 1XFWO 2GV5A 1K93D 1UWOA 1YVLA 1KSMA 1KK7Y 2KAVA 3NHTA 1MXEA 1MXLC 2LMUA 3DVEA 1MR8A 5I94A 2NCOA 3NGVA 1KFXS 2D8NA 3B88A 1SCMC 1WRKA 3TZ1A 1BU3A 3SG4A 3TUYB 2SASA 1DMOA 2QEVA 1K9KA 4HSZA 2FJYA 1ZOTB 2BE4A 2JT3A 3F45A 3KF9A 1K9UA 3CABA 1F4OA 5AERA 1Y1UA 4OKHA 4ZCUA 1J1DA 2CCMA 2OS8C 2KI4B 3QMEA 2FOTA 1J7QA 4F7FA 1TUZA 1FBVA 3D77A 2WC6A 1DT7B 2I18A 2LANA 1H8BA 2ZRTA 1XA5A 1QASA 1IH0A 2H61C 3D73A 1N2DA 1NSHA 2LUXA 1QVIY 1UHJA 2WCHA 1BT6A 1CLMA 1JBAA 1KSOA 1P28A 1BR4B 1B9AA 3E3RA 1NUBA 4INXA 4ICBA 3CZTX 1DJWA 3R1OA 1DJHA 3BJHA 1XFUO 1CDLA 4NDDA 2WCFA 1IJ6A 4C0JA 2PRUA 1E8AA 1UP5A 3D10A 2WNDA 1K94A 3CLNA 5FYXA 2WCJA 2MBXA 4JQ0D 2L5YA 4MLWA 4PHKA 1B7TY 1DJIA 1BR1B 2LNKA 4Q04A 1ALVA 3SG5A 3EG5B 3NSOA 3ICBA 2ZKMX 2MLEC 1RROA 1DF0A 3CR4X 3ZWHA 1CFDA 2MLFC 5AFPA 1CLLA 1TUJA 4OCIA 2M0RA 2COLB 2H61A 2L50A 2WCLA 4ORCB 1ZUZA 3ZNIA 1M39A 1KK7Z 1F55A 5JOLA 3D75A 1PRWA 1OW4A 2AAOA 5AANA 1A29A 1R6PA 3B6XA 1SPYA 2BCXA 1DF0B 1TNQA 4MBEA 5ER4X 1JWDA 3GK2A 1WRLA 2LHIA 1MWNA 4GPLB 4DIRA 5I2OA 4MVFA 2LP2A 2KSPA 1J55A 3BUNB 3IVTA 3OB2B 2LMVA 4MZLA 1QX7A 3SIAA 5BPJA 2QEOA 3FWBA 2JULA 4GNKB 1DGVA 2P71A 3BUOB 3O78A 4XYNA 1QLKA 2LCPA 3EK8A 3FS7A 1XFRA 4MN0A 2QEBA 2OTGC 2NZ0A 4MEWA 1UURA 2JU0A 2GTEA 3BFHA 4HREE 4CFRA 1JF0A 1DQEA 1XK4C 4CFQA 3PALA 2BKHB 4GUKA 1AHRA 1U5IA 1OZSA 4E68A 1FI6A 3S0AA 1TOPA 2ZRSA 4YGDB 2K61A 2JZIA 4MSPA 4N1FA 2QACA 1SNLA
chains in the Genus database with same CATH topology
3QRXA 1JFJA 2JNXA 1J7RA 5D69A 2PASA 2BL0B 4HRHA 2K2AA 4HRGA 5CSIA 2ISDA 3RM1A 1EG3A 2JTTA 2JOJA 1V1FA 2B1UA 1JFKA 3EVVA 4PALA 1IH0A 5G08A 2LE9B 2PSRA 3KHEA 3PLFB 3BUXB 1B7TZ 1DJYA 3FWCA 1DTLA 1S3PA 1A4PA 4L9MA 1D1OA 5K89A 4DUQA 1NPQA 1J1EA 3WNXB 2M97A 2IS9A 5KTYA 1K9PA 2JPTA 1OSAA 4N5XA 3WXAA 1SL9A 1CM4A 1QJTA 1R2UA 1XK4A 2OPOA 2KI6C 4ORBB 1SR6B 4M2PA 4PE1A 2EHBA 3MSEB 4I5NB 4PHJA 1TRFA 3IQOA 4OR9B 1BOCA 4DS7A 2KI6D 3PM8A 1GQMA 5D7FA 3CGAA 2MJWB 4WQ3A 5DKQA 3CS1A 4YBHB 1W7JB 2MRDA 1ALWA 4GFTA 5KU1A 1N65A 2VRGA 3TS5C 1YX8A 1FF1A 1AVSA 5I2QA 1RWYA 4FQOA 4YGEB 1NX2A 1KK8C 1KQMB 2LLSA 4ORAB 1S36A 3KEVA 1CKKA 1KFXL 3SG6A 4XJKA 2JRFA 2KHNA 2M7NA 1SK6D 3LK1A 4TNCA 1QLSA 2M7LA 2KNEA 1YURA 5CSFA 2K7CA 1H4BA 1Y1XA 4JPZB 1F70A 2EGDA 4I5KA 3CTNA 3DVMA 1KWOC 3SIBA 2LP3A 3K21A 1NIWA 3PN7B 1LA3A 3IF7A 3EVUA 4XJKB 1F71A 1QV1A 2ZN8A 1V1GA 1IQ3A 4MRYA 1QV0A 2WC8A 2M1UA 1WDCB 3NSIA 2ZNEA 1LXFC 1CFCA 4PHNA 1MF8B 4GAOA 1OOJA 2WCEA 3LLEA 2PALA 3DF0A 1M46A 1JC2A 2AUCA 2L5XB 4M2OA 1IWQA 2EC6C 3O6BA 4ZCVA 2CTNA 1RTP1 4MZKA 4WQ2A 1CDNA 2I7AA 2WOSA 3DF0B 1ZACA 1SCMB 2M9GA 2F3ZA 2V53A 5JJGA 3VRPA 1SL7A 1BLQA 3EK4A 4YI9A 1UHIA 1PSBA 1M45A 5DKRA 2QPTA 3HCMA 2M29A 4CIDA 1HT9A 4MZJA 1OZOA 2DOQA 2TN4A 3LCPC 4PE0A 2KFGA 1B47A 3OHMB 2OS8B 1SMGA 1GGWA 1N0YA 2JWWA 1JF2A 1M63B 4I5LB 2PVBA 2MA2A 3SJSA 1K96A 2M49B 5PALA 4DRWA 5B8IB 3DVKA 1SYMA 2K0JA 1PSRA 1X02A 2LAPA 3NSKA 1NCZA 1TNXA 1CTRA 1YRTB 1IRJA 4QJ5B 1JUOA 2KQYA 3JTDC 1TNPA 1TNWA 5HKYA 2K7DA 4GGFC 3AAJA 1FW4A 2LMTA 3KO0A 1L2OC 3BUMB 1YRUB 5CSJA 1QTXA 1QXPA 3OB1B 1QX2A 3NXAA 3PFVA 2KQ6A 2A4JA 5KSZA 4AQJA 1A03A 1JSAA 1PVBA 1HQVA 2SCPA 1EG4A 2E6WA 1QX5B 1SL8A 1SY9A 1C7VA 1QIWA 1LINA 1ZMZA 2GGZA 1KCYA 2KFFA 4YGBB 1U5IB 3VGOA 4NQGA 1GGZA 1CMGA 1YVHA 1A75A 3I5HC 4ETOA 1G8IA 1NX1A 1VRKA 3BOWA 5ER5A 1NWDA 2F2PA 4AOMA 2KYCA 1EJ3A 1MQ1A 1XVJA 1QIVA 2FJUB 1F4QA 2Y5IA 2FCDA 2KYFA 4PE7A 4USLA 5HKZA 2K7OA 1PK0D 1F8HA 1LVCD 1RFJA 5F6TA 3I5IC 3TDZA 2KGBC 1RJVA 3TUYC 2L98A 2CXJA 3CR2A 2P6BB 4JWQA 1A2XA 2Y1MA 1CB1A 2LUCA 3IQQA 1YTZC 2BBNA 2KI4C 1SW8A 2HPSA 1BMOA 2OTGB 2BE6A 1B8CA 3SG7A 2O5GA 3BYAA 1L7ZA 4MRXA 2LV7A 4DCKA 2JTZA 2CNPA 5AEQA 2LVVA 3VRNA 4UPGA 3EVRA 2CT9A 1PALA 4PCWA 1S6IA 1Q80A 3RLZA 1ODBA 2M1KB 1DVIA 1EL4A 1GJYA 1G4YR 1Y0VH 4FTGA 1UUSA 1UHKA 2MAZA 2KDHA 2NCPA 2HF5A 3H4SE 4GBAA 3EKHA 1S1EA 2K2FA 1Y1AA 5HYDA 2KOTA 1NX0A 3VRQA 3VROA 2BCBA 1IGVA 3D0YA 5HLOA 1BF5A 2KAXA 3VRRA 1CDMA 4QJ4B 1PVAA 4QJ3B 4WRIA 1OMVA 1YUUA 5DKNA 4I5JA 4U8DA 5GQQC 3TDUA 4P5OE 3A4UB 3I5IB 3LL8B 1CM1A 2FCEA 1CDPA 5I2LA 3D0YB 4PDZA 4C0KA 1MHOA 1NCXA 4PE4A 1S6JA 1IJ5A 2KGRA 2ZNDA 3SG2A 1LKJA 1TN4A 2L4HA 2PMYA 5HLVA 1K2HA 4N1GA 1DJXA 3AKBA 5I8NA 1OMRA 1S26D 3PSRA 2JQ6A 3GK1A 4NDCA 1UHHA 3TS5B 4A4CA 2F8PA 1CNPA 1S5GY 5J3XA 2G2BA 1YUTA 2LLTA 2L4IA 2Q91A 1J7PA 1KK8B 1F54A 2Y4QA 2I2RE 2E30A 3CR5X 1EH2A 4NDBA 3DVJA 1B8LA 2NXQA 1RECA 1DJGA 2LVKA 1CFPA 1WLZA 3A8RA 3O4YA 1QATA 4D1EA 1WY9A 1TCFA 2GGMA 1BG1A 3O2PA 2KAYA 4R1EA 2KBIA 3WHTB 1NYAA 4A4BA 1CMFA 2M8UA 3I5GC 1XO5A 3M0WA 1W7IB 1K95A 2BKIB 3JVTC 1WLMA 3WHUB 3FIAA 1KWOB 3OX5A 1LA0A 4BY5A 1FPWA 1AJ4A 2HQWA 2BECA 2KBMA 1YUSA 1AK8A 1KQVA 1AJ5A 4AQIA 2K8MB 2BL0C 1MUXA 1C7WA 2NLNA 3GOFA 2LLUA 1AP4A 3BUWB 1RK9A 4CLNA 4OVNF 1YR5A 1OE9B 1BODA 1XFYO 4CPVA 1OMDA 2F3YA 1Y6WA 1IQ5A 1IG5A 1B1GA 2F2OA 2CBLA 2EC6B 1WRZA 1DGUA 1S6CA 3PATA 1XFXO 4IL1A 4BY4A 1ZFSA 2F33A 1SR6C 2WORA 1UHNA 2RGIA 2K7BA 1BJFA 3EKJA 2H2KA 2HETA 3CWGA 3KPXA 2LM5A 1CLBA 1M31A 3I5FC 4YI8A 3EK7A 1B8RA 4OV2A 3C1VA 1DJZA 1S5GZ 1QVIZ 3BXKA 5CPVA 1NCYA 2L51A 2JXLA 2BBMA 1SRAA 1NX3A 2JT0A 1SCVA 1NP8A 3OP0A 4M2QA 1KFUS 2L2EA 3I5GB 4GGNA 4YGAA 4GGFA 1XFZO 1KQMC 2LVJA 3JVTB 3LK0A 1KFUL 1OQPA 1A75B 1AUIB 4PHMA 3SG3A 3TDIA 1CFFA 3BOWB 1PULA 5HKWA 3BQ3A 1TTXA 3JTDB 2Q4UA 1EXRA 2LHLA 1TCOB 2JNFA 1C07A 4F0ZB 3AAKA 2WCBA 4YRUA 2R2IA 5CSNA 1L2OB 1XFVO 1B4CA 2G9BA 3NSLA 2Y1NA 1FI5A 5IBWA 2BCAA 4C0LA 2MHHA 3PN7C 2HQ8A 2ZN9A 3AKAA 1J7OA 2LC5A 2O60A 4P2YB 1SKTA 3GK4X 1IKUA 5AXIA 1SBJA 1YX7A 1WDCC 2JXCA 2JC2A 2KFHA 2ZFDA 1G33A 2AMIA 1TIZA 2JT8A 1K90D 3HX4A 3OX6A 2I94A 4YGCB 1QS7A 3I5FB 5TNCA 2M3WA 2L0PA 1XYDA 2LVIA 3DD4A 3I5HB 1K8UA 1XFWO 2GV5A 1K93D 1UWOA 1YVLA 1KSMA 1KK7Y 2KAVA 1MXEA 1MXLC 2LMUA 3DVEA 1MR8A 2NCOA 1KFXS 2D8NA 1SCMC 1WRKA 3TZ1A 1BU3A 3SG4A 3TUYB 2SASA 1DMOA 1K9KA 4HSZA 1ZOTB 2BE4A 2JT3A 3F45A 3KF9A 1K9UA 1F4OA 5AERA 1Y1UA 4OKHA 4ZCUA 1J1DA 2CCMA 2OS8C 2KI4B 1J7QA 2FOTA 1FBVA 1DT7B 2I18A 2LANA 1H8BA 2ZRTA 1XA5A 1QASA 2H61C 1N2DA 1NSHA 2LUXA 1QVIY 1UHJA 1BT6A 1CLMA 1JBAA 1KSOA 1BR4B 1B9AA 3E3RA 1NUBA 4ICBA 3CZTX 1DJWA 1DJHA 1XFUO 1CDLA 4NDDA 2WCFA 1IJ6A 4C0JA 2PRUA 1E8AA 1UP5A 3D10A 2WNDA 1K94A 3CLNA 5FYXA 2MBXA 4JQ0D 4MLWA 4PHKA 1B7TY 1DJIA 1BR1B 2LNKA 4Q04A 1ALVA 3SG5A 3NSOA 3ICBA 2ZKMX 2MLEC 1RROA 1DF0A 3CR4X 3ZWHA 1CFDA 2MLFC 5AFPA 1CLLA 4OCIA 2M0RA 2COLB 2H61A 2L50A 4ORCB 1ZUZA 3ZNIA 1M39A 1KK7Z 1F55A 5JOLA 1PRWA 2AAOA 5AANA 1A29A 1R6PA 1SPYA 2BCXA 1DF0B 1TNQA 4MBEA 5ER4X 1JWDA 3GK2A 1WRLA 2LHIA 1MWNA 4GPLB 4DIRA 5I2OA 4MVFA 2LP2A 2KSPA 1J55A 3BUNB 3OB2B 3SIAA 2LMVA 4MZLA 1QX7A 5BPJA 3FWBA 2JULA 4GNKB 1DGVA 3BUOB 3O78A 4XYNA 1QLKA 2LCPA 3EK8A 3FS7A 4MN0A 4MEWA 2OTGC 2NZ0A 1UURA 2JU0A 4HREE 4CFRA 1JF0A 1XK4C 4CFQA 3PALA 2BKHB 4GUKA 1AHRA 1U5IA 1OZSA 4E68A 1FI6A 1TOPA 2ZRSA 4YGDB 2K61A 2JZIA 4MSPA 4N1FA 2QACA 1SNLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QRX A;  1JFJ A;  2JNX A;  1J7R A;  5D69 A;  2PAS A;  2BL0 B;  4HRH A;  2K2A A;  4HRG A;  5CSI A;  2ISD A;  3RM1 A;  1EG3 A;  2JTT A;  2JOJ A;  1V1F A;  2B1U A;  1JFK A;  3EVV A;  4PAL A;  1IH0 A;  5G08 A;  2LE9 B;  2PSR A;  3KHE A;  3PLF B;  3BUX B;  1B7T Z;  1DJY A;  3FWC A;  1DTL A;  1S3P A;  1A4P A;  4L9M A;  1D1O A;  5K89 A;  4DUQ A;  1NPQ A;  1J1E A;  3WNX B;  2M97 A;  2IS9 A;  5KTY A;  1K9P A;  2JPT A;  1OSA A;  4N5X A;  3WXA A;  1SL9 A;  1CM4 A;  1QJT A;  1R2U A;  1XK4 A;  2OPO A;  2KI6 C;  4ORB B;  1SR6 B;  4M2P A;  4PE1 A;  2EHB A;  3MSE B;  4I5N B;  4PHJ A;  1TRF A;  3IQO A;  4OR9 B;  1BOC A;  4DS7 A;  2KI6 D;  3PM8 A;  1GQM A;  5D7F A;  3CGA A;  2MJW B;  4WQ3 A;  5DKQ A;  3CS1 A;  4YBH B;  1W7J B;  2MRD A;  1ALW A;  4GFT A;  5KU1 A;  1N65 A;  2VRG A;  3TS5 C;  1YX8 A;  1FF1 A;  1AVS A;  5I2Q A;  1RWY A;  4FQO A;  4YGE B;  1NX2 A;  1KK8 C;  1KQM B;  2LLS A;  4ORA B;  1S36 A;  3KEV A;  1CKK A;  1KFX L;  3SG6 A;  4XJK A;  2JRF A;  2KHN A;  2M7N A;  1SK6 D;  3LK1 A;  4TNC A;  1QLS A;  2M7L A;  2KNE A;  1YUR A;  5CSF A;  2K7C A;  1H4B A;  1Y1X A;  4JPZ B;  1F70 A;  2EGD A;  4I5K A;  3CTN A;  3DVM A;  1KWO C;  3SIB A;  2LP3 A;  3K21 A;  1NIW A;  3PN7 B;  1LA3 A;  3IF7 A;  3EVU A;  4XJK B;  1F71 A;  1QV1 A;  2ZN8 A;  1V1G A;  1IQ3 A;  4MRY A;  1QV0 A;  2WC8 A;  2M1U A;  1WDC B;  3NSI A;  2ZNE A;  1LXF C;  1CFC A;  4PHN A;  1MF8 B;  4GAO A;  1OOJ A;  2WCE A;  3LLE A;  2PAL A;  3DF0 A;  1M46 A;  1JC2 A;  2AUC A;  2L5X B;  4M2O A;  1IWQ A;  2EC6 C;  3O6B A;  4ZCV A;  2CTN A;  1RTP 1;  4MZK A;  4WQ2 A;  1CDN A;  2I7A A;  2WOS A;  3DF0 B;  1ZAC A;  1SCM B;  2M9G A;  2F3Z A;  2V53 A;  5JJG A;  3VRP A;  1SL7 A;  1BLQ A;  3EK4 A;  4YI9 A;  1UHI A;  1PSB A;  1M45 A;  5DKR A;  2QPT A;  3HCM A;  2M29 A;  4CID A;  1HT9 A;  4MZJ A;  1OZO A;  2DOQ A;  2TN4 A;  3LCP C;  4PE0 A;  2KFG A;  1B47 A;  3OHM B;  2OS8 B;  1SMG A;  1GGW A;  1N0Y A;  2JWW A;  1JF2 A;  1M63 B;  4I5L B;  2PVB A;  2MA2 A;  3SJS A;  1K96 A;  2M49 B;  5PAL A;  4DRW A;  5B8I B;  3DVK A;  1SYM A;  2K0J A;  1PSR A;  1X02 A;  2LAP A;  3NSK A;  1NCZ A;  1TNX A;  1CTR A;  1YRT B;  1IRJ A;  4QJ5 B;  1JUO A;  2KQY A;  3JTD C;  1TNP A;  1TNW A;  5HKY A;  2K7D A;  4GGF C;  3AAJ A;  1FW4 A;  2LMT A;  3KO0 A;  1L2O C;  3BUM B;  1YRU B;  5CSJ A;  1QTX A;  1QXP A;  3OB1 B;  1QX2 A;  3NXA A;  3PFV A;  2KQ6 A;  2A4J A;  5KSZ A;  4AQJ A;  1A03 A;  1JSA A;  1PVB A;  1HQV A;  2SCP A;  1EG4 A;  2E6W A;  1QX5 B;  1SL8 A;  1SY9 A;  1C7V A;  1QIW A;  1LIN A;  1ZMZ A;  2GGZ A;  1KCY A;  2KFF A;  4YGB B;  1U5I B;  3VGO A;  4NQG A;  1GGZ A;  1CMG A;  1YVH A;  1A75 A;  3I5H C;  4ETO A;  1G8I A;  1NX1 A;  1VRK A;  3BOW A;  5ER5 A;  1NWD A;  2F2P A;  4AOM A;  2KYC A;  1EJ3 A;  1MQ1 A;  1XVJ A;  1QIV A;  2FJU B;  1F4Q A;  2Y5I A;  2FCD A;  2KYF A;  4PE7 A;  4USL A;  5HKZ A;  2K7O A;  1PK0 D;  1F8H A;  1LVC D;  1RFJ A;  5F6T A;  3I5I C;  3TDZ A;  2KGB C;  1RJV A;  3TUY C;  2L98 A;  2CXJ A;  3CR2 A;  2P6B B;  4JWQ A;  1A2X A;  2Y1M A;  1CB1 A;  2LUC A;  3IQQ A;  1YTZ C;  2BBN A;  2KI4 C;  1SW8 A;  2HPS A;  1BMO A;  2OTG B;  2BE6 A;  1B8C A;  3SG7 A;  2O5G A;  3BYA A;  1L7Z A;  4MRX A;  2LV7 A;  4DCK A;  2JTZ A;  2CNP A;  5AEQ A;  2LVV A;  3VRN A;  4UPG A;  3EVR A;  2CT9 A;  1PAL A;  4PCW A;  1S6I A;  1Q80 A;  3RLZ A;  1ODB A;  2M1K B;  1DVI A;  1EL4 A;  1GJY A;  1G4Y R;  1Y0V H;  4FTG A;  1UUS A;  1UHK A;  2MAZ A;  2KDH A;  2NCP A;  2HF5 A;  3H4S E;  4GBA A;  3EKH A;  1S1E A;  2K2F A;  1Y1A A;  5HYD A;  2KOT A;  1NX0 A;  3VRQ A;  3VRO A;  2BCB A;  1IGV A;  3D0Y A;  5HLO A;  1BF5 A;  2KAX A;  3VRR A;  1CDM A;  4QJ4 B;  1PVA A;  4QJ3 B;  4WRI A;  1OMV A;  1YUU A;  5DKN A;  4I5J A;  4U8D A;  5GQQ C;  3TDU A;  4P5O E;  3A4U B;  3I5I B;  3LL8 B;  1CM1 A;  2FCE A;  1CDP A;  5I2L A;  3D0Y B;  4PDZ A;  4C0K A;  1MHO A;  1NCX A;  4PE4 A;  1S6J A;  1IJ5 A;  2KGR A;  2ZND A;  3SG2 A;  1LKJ A;  1TN4 A;  2L4H A;  2PMY A;  5HLV A;  1K2H A;  4N1G A;  1DJX A;  3AKB A;  5I8N A;  1OMR A;  1S26 D;  3PSR A;  2JQ6 A;  3GK1 A;  4NDC A;  1UHH A;  3TS5 B;  4A4C A;  2F8P A;  1CNP A;  1S5G Y;  5J3X A;  2G2B A;  1YUT A;  2LLT A;  2L4I A;  2Q91 A;  1J7P A;  1KK8 B;  1F54 A;  2Y4Q A;  2I2R E;  2E30 A;  3CR5 X;  1EH2 A;  4NDB A;  3DVJ A;  1B8L A;  2NXQ A;  1REC A;  1DJG A;  2LVK A;  1CFP A;  1WLZ A;  3A8R A;  3O4Y A;  1QAT A;  4D1E A;  1WY9 A;  1TCF A;  2GGM A;  1BG1 A;  3O2P A;  2KAY A;  4R1E A;  2KBI A;  3WHT B;  1NYA A;  4A4B A;  1CMF A;  2M8U A;  3I5G C;  1XO5 A;  3M0W A;  1W7I B;  1K95 A;  2BKI B;  3JVT C;  1WLM A;  3WHU B;  3FIA A;  1KWO B;  3OX5 A;  1LA0 A;  4BY5 A;  1FPW A;  1AJ4 A;  2HQW A;  2BEC A;  2KBM A;  1YUS A;  1AK8 A;  1KQV A;  1AJ5 A;  4AQI A;  2K8M B;  2BL0 C;  1MUX A;  1C7W A;  2NLN A;  3GOF A;  2LLU A;  1AP4 A;  3BUW B;  1RK9 A;  4CLN A;  4OVN F;  1YR5 A;  1OE9 B;  1BOD A;  1XFY O;  4CPV A;  1OMD A;  2F3Y A;  1Y6W A;  1IQ5 A;  1IG5 A;  1B1G A;  2F2O A;  2CBL A;  2EC6 B;  1WRZ A;  1DGU A;  1S6C A;  3PAT A;  1XFX O;  4IL1 A;  4BY4 A;  1ZFS A;  2F33 A;  1SR6 C;  2WOR A;  1UHN A;  2RGI A;  2K7B A;  1BJF A;  3EKJ A;  2H2K A;  2HET A;  3CWG A;  3KPX A;  2LM5 A;  1CLB A;  1M31 A;  3I5F C;  4YI8 A;  3EK7 A;  1B8R A;  4OV2 A;  3C1V A;  1DJZ A;  1S5G Z;  1QVI Z;  3BXK A;  5CPV A;  1NCY A;  2L51 A;  2JXL A;  2BBM A;  1SRA A;  1NX3 A;  2JT0 A;  1SCV A;  1NP8 A;  3OP0 A;  4M2Q A;  1KFU S;  2L2E A;  3I5G B;  4GGN A;  4YGA A;  4GGF A;  1XFZ O;  1KQM C;  2LVJ A;  3JVT B;  3LK0 A;  1KFU L;  1OQP A;  1A75 B;  1AUI B;  4PHM A;  3SG3 A;  3TDI A;  1CFF A;  3BOW B;  1PUL A;  5HKW A;  3BQ3 A;  1TTX A;  3JTD B;  2Q4U A;  1EXR A;  2LHL A;  1TCO B;  2JNF A;  1C07 A;  4F0Z B;  3AAK A;  2WCB A;  4YRU A;  2R2I A;  5CSN A;  1L2O B;  1XFV O;  1B4C A;  2G9B A;  3NSL A;  2Y1N A;  1FI5 A;  5IBW A;  2BCA A;  4C0L A;  2MHH A;  3PN7 C;  2HQ8 A;  2ZN9 A;  3AKA A;  1J7O A;  2LC5 A;  2O60 A;  4P2Y B;  1SKT A;  3GK4 X;  1IKU A;  5AXI A;  1SBJ A;  1YX7 A;  1WDC C;  2JXC A;  2JC2 A;  2KFH A;  2ZFD A;  1G33 A;  2AMI A;  1TIZ A;  2JT8 A;  1K90 D;  3HX4 A;  3OX6 A;  2I94 A;  4YGC B;  1QS7 A;  3I5F B;  5TNC A;  2M3W A;  2L0P A;  1XYD A;  2LVI A;  3DD4 A;  3I5H B;  1K8U A;  1XFW O;  2GV5 A;  1K93 D;  1UWO A;  1YVL A;  1KSM A;  1KK7 Y;  2KAV A;  1MXE A;  1MXL C;  2LMU A;  3DVE A;  1MR8 A;  2NCO A;  1KFX S;  2D8N A;  1SCM C;  1WRK A;  3TZ1 A;  1BU3 A;  3SG4 A;  3TUY B;  2SAS A;  1DMO A;  1K9K A;  4HSZ A;  1ZOT B;  2BE4 A;  2JT3 A;  3F45 A;  3KF9 A;  1K9U A;  1F4O A;  5AER A;  1Y1U A;  4OKH A;  4ZCU A;  1J1D A;  2CCM A;  2OS8 C;  2KI4 B;  1J7Q A;  2FOT A;  1FBV A;  1DT7 B;  2I18 A;  2LAN A;  1H8B A;  2ZRT A;  1XA5 A;  1QAS A;  2H61 C;  1N2D A;  1NSH A;  2LUX A;  1QVI Y;  1UHJ A;  1BT6 A;  1CLM A;  1JBA A;  1KSO A;  1BR4 B;  1B9A A;  3E3R A;  1NUB A;  4ICB A;  3CZT X;  1DJW A;  1DJH A;  1XFU O;  1CDL A;  4NDD A;  2WCF A;  1IJ6 A;  4C0J A;  2PRU A;  1E8A A;  1UP5 A;  3D10 A;  2WND A;  1K94 A;  3CLN A;  5FYX A;  2MBX A;  4JQ0 D;  4MLW A;  4PHK A;  1B7T Y;  1DJI A;  1BR1 B;  2LNK A;  4Q04 A;  1ALV A;  3SG5 A;  3NSO A;  3ICB A;  2ZKM X;  2MLE C;  1RRO A;  1DF0 A;  3CR4 X;  3ZWH A;  1CFD A;  2MLF C;  5AFP A;  1CLL A;  4OCI A;  2M0R A;  2COL B;  2H61 A;  2L50 A;  4ORC B;  1ZUZ A;  3ZNI A;  1M39 A;  1KK7 Z;  1F55 A;  5JOL A;  1PRW A;  2AAO A;  5AAN A;  1A29 A;  1R6P A;  1SPY A;  2BCX A;  1DF0 B;  1TNQ A;  4MBE A;  5ER4 X;  1JWD A;  3GK2 A;  1WRL A;  2LHI A;  1MWN A;  4GPL B;  4DIR A;  5I2O A;  4MVF A;  2LP2 A;  2KSP A;  1J55 A;  3BUN B;  3OB2 B;  3SIA A;  2LMV A;  4MZL A;  1QX7 A;  5BPJ A;  3FWB A;  2JUL A;  4GNK B;  1DGV A;  3BUO B;  3O78 A;  4XYN A;  1QLK A;  2LCP A;  3EK8 A;  3FS7 A;  4MN0 A;  4MEW A;  2OTG C;  2NZ0 A;  1UUR A;  2JU0 A;  4HRE E;  4CFR A;  1JF0 A;  1XK4 C;  4CFQ A;  3PAL A;  2BKH B;  4GUK A;  1AHR A;  1U5I A;  1OZS A;  4E68 A;  1FI6 A;  1TOP A;  2ZRS A;  4YGD B;  2K61 A;  2JZI A;  4MSP A;  4N1F A;  2QAC A;  1SNL A; 
#chains in the Genus database with same CATH topology
 3QRX A;  1JFJ A;  2JNX A;  1J7R A;  5D69 A;  2PAS A;  2BL0 B;  4HRH A;  2K2A A;  4HRG A;  5CSI A;  2ISD A;  3RM1 A;  1EG3 A;  2JTT A;  2JOJ A;  1V1F A;  1ORG A;  1JFK A;  2B1U A;  3CYZ A;  3EVV A;  4PAL A;  2LE9 B;  2PSR A;  3KHE A;  5G08 A;  3RZS A;  3PLF B;  3BUX B;  1B7T Z;  1DJY A;  1W9Z A;  3FWC A;  1DTL A;  1S3P A;  1A4P A;  4L9M A;  1D1O A;  5K89 A;  4DUQ A;  1NPQ A;  1OOH A;  1J1E A;  3V2L A;  3WNX B;  2M97 A;  2IS9 A;  5KTY A;  1K9P A;  2JPT A;  3S0E A;  3O4X A;  1OSA A;  4N5X A;  3WXA A;  1SL9 A;  1CM4 A;  1QJT A;  1R2U A;  1XK4 A;  2OPO A;  2KI6 C;  2ERB A;  1SR6 B;  4ORB B;  4M2P A;  4PE1 A;  3SS4 A;  2EHB A;  3MSE B;  4I5N B;  4PHJ A;  1TRF A;  3B86 A;  3IQO A;  4OR9 B;  1BOC A;  4DS7 A;  2KI6 D;  3PM8 A;  1GQM A;  5D7F A;  3CGA A;  2MJW B;  4WQ3 A;  5FI2 A;  1T14 A;  5DKQ A;  3CS1 A;  4YBH B;  3R72 A;  1W7J B;  2MRD A;  1ALW A;  3S0F A;  4GFT A;  5KU1 A;  1N65 A;  2VRG A;  1DEK A;  3TS5 C;  1YX8 A;  3BFA A;  1FF1 A;  1AVS A;  5I2Q A;  1RWY A;  4FQO A;  4YGE B;  1NX2 A;  1KK8 C;  1KQM B;  2LLS A;  4JD9 A;  4ORA B;  1S36 A;  3KEV A;  1CKK A;  1KFX L;  3SG6 A;  3L4L A;  4XJK A;  2JRF A;  5EL2 A;  2KHN A;  2M7N A;  1SK6 D;  4FQT A;  3LK1 A;  4TNC A;  1QLS A;  2M7L A;  2KNE A;  1YUR A;  5CSF A;  2K7C A;  1H4B A;  1Y1X A;  4JPZ B;  1F70 A;  2EGD A;  4I5K A;  3CTN A;  3DVM A;  1KWO C;  3SIB A;  2LP3 A;  3K21 A;  1NIW A;  3PN7 B;  1LA3 A;  3IF7 A;  3EVU A;  4XJK B;  3R1P A;  1F71 A;  1QV1 A;  2ZN8 A;  2WCM A;  1V1G A;  1IQ3 A;  4MRY A;  1QV0 A;  2WC8 A;  2M1U A;  1WDC B;  3K1E A;  3NSI A;  2ZNE A;  1LXF C;  1CFC A;  4PHN A;  1MF8 B;  4JKT A;  4GAO A;  5D3O A;  1OOJ A;  2P70 A;  2WCE A;  3LLE A;  3UNW A;  2PAL A;  3DF0 A;  1M46 A;  1JC2 A;  2AUC A;  2L5X B;  4M2O A;  1IWQ A;  2EC6 C;  3O6B A;  2H8V A;  3N7H A;  2KPH A;  4ZCV A;  2CTN A;  4PT1 A;  1RTP 1;  4MZK A;  4WQ2 A;  1CDN A;  2I7A A;  2WOS A;  3DF0 B;  1ZAC A;  1SCM B;  5FI6 A;  2M9G A;  2F3Z A;  2V53 A;  5FI7 A;  3SS3 A;  3VRP A;  1SL7 A;  5JJG A;  3EK4 A;  1BLQ A;  4YI9 A;  1UHI A;  1PSB A;  1M45 A;  5DKR A;  2QPT A;  3HCM A;  2M29 A;  4CID A;  1HT9 A;  4MZJ A;  1OZO A;  2WC5 A;  1DC1 A;  2DOQ A;  2TN4 A;  3LCP C;  4PE0 A;  2KFG A;  1B47 A;  3OHM B;  2OS8 B;  1SMG A;  1GGW A;  1N0Y A;  2JWW A;  1JF2 A;  1M63 B;  4I5L B;  2PVB A;  1C3Z A;  2MA2 A;  3PM2 A;  3SJS A;  1K96 A;  2M49 B;  5PAL A;  4DRW A;  5B8I B;  3DVK A;  1SYM A;  1TWO A;  2K0J A;  1PSR A;  4KYN A;  1X02 A;  2LAP A;  3NSK A;  1NCZ A;  1TNX A;  1CTR A;  1YRT B;  3UO9 A;  1IRJ A;  4QJ5 B;  1JUO A;  2KQY A;  3JTD C;  1TNP A;  1TNW A;  5HKY A;  3OBV A;  2K7D A;  4GGF C;  3AAJ A;  1FW4 A;  2LMT A;  3KO0 A;  1L2O C;  3BUM B;  1YRU B;  5CSJ A;  1IIO A;  2QEH A;  1QTX A;  1QXP A;  3OB1 B;  1QX2 A;  3NXA A;  3PFV A;  2KQ6 A;  2A4J A;  5KSZ A;  4AQJ A;  1QWV A;  1A03 A;  1JSA A;  5DIC A;  1PVB A;  1HQV A;  1OOG A;  2SCP A;  1EG4 A;  2E6W A;  1QX5 B;  1SL8 A;  1SY9 A;  1C7V A;  1QIW A;  1LIN A;  1ZMZ A;  2GGZ A;  1C3Y A;  1KCY A;  2KFF A;  4YGB B;  1U5I B;  3VGO A;  4NQG A;  1GGZ A;  3NHI A;  1CMG A;  1YVH A;  1A75 A;  3I5H C;  4ETO A;  1G8I A;  1NX1 A;  1VRK A;  3BOW A;  5ER5 A;  1NWD A;  2F2P A;  4AOM A;  2KYC A;  1EJ3 A;  1MQ1 A;  3S0D A;  1XVJ A;  1QIV A;  2FJU B;  1F4Q A;  2Y5I A;  2FCD A;  4IJ7 A;  2KYF A;  4PE7 A;  4USL A;  5HKZ A;  2K7O A;  1PK0 D;  1F8H A;  1LVC D;  1RFJ A;  5F6T A;  3I5I C;  3TDZ A;  2KGB C;  1RJV A;  3D74 A;  3TUY C;  2L98 A;  2CXJ A;  3CR2 A;  2P6B B;  4JWQ A;  3L4A A;  1A2X A;  2Y1M A;  1CB1 A;  2LUC A;  3IQQ A;  1YTZ C;  2BBN A;  2KI4 C;  1SW8 A;  2HPS A;  1BMO A;  2OTG B;  2BE6 A;  2PQL A;  1B8C A;  3SG7 A;  2O5G A;  1DEL A;  3BYA A;  1L7Z A;  4MRX A;  2LV7 A;  4DCK A;  2JTZ A;  2CNP A;  4INW A;  2L2C A;  2YGU A;  5AEQ A;  2LVV A;  3VRN A;  2JPO A;  3EVR A;  4UPG A;  2CT9 A;  1PAL A;  1SSE B;  4PCW A;  1S6I A;  1Q80 A;  3RLZ A;  1ODB A;  2M1K B;  1DVI A;  1EL4 A;  1GJY A;  1G4Y R;  1Y0V H;  4FTG A;  3DXL A;  1UUS A;  1UHK A;  2MAZ A;  3L47 A;  2KDH A;  2NCP A;  2WCK A;  1Z2C B;  2HF5 A;  3H4S E;  4GBA A;  3EKH A;  1S1E A;  3VB1 A;  2K2F A;  1Y1A A;  5HYD A;  2KOT A;  1NX0 A;  3VRQ A;  3VRO A;  2BCB A;  3DZT A;  1IGV A;  3D0Y A;  5HLO A;  1BF5 A;  3S0G A;  2KAX A;  3VRR A;  1CDM A;  4QJ4 B;  1PVA A;  4QJ3 B;  4WRI A;  1OMV A;  1YUU A;  3CZ1 A;  4I5J A;  4U8D A;  5DKN A;  5GQQ C;  3TDU A;  4P5O E;  3A4U B;  3I5I B;  3LL8 B;  1CM1 A;  2FCE A;  1CDP A;  5I2L A;  3Q8I A;  3D0Y B;  4PDZ A;  4C0K A;  1MHO A;  1NCX A;  4PE4 A;  3D78 A;  1S6J A;  1IJ5 A;  2KGR A;  2ZND A;  3SG2 A;  1LKJ A;  1TN4 A;  2L4H A;  2PMY A;  5HLV A;  1K2H A;  4N1G A;  1DJX A;  3AKB A;  5I8N A;  1OMR A;  3S0B A;  1S26 D;  3PSR A;  2JQ6 A;  3GK1 A;  4NDC A;  1UHH A;  3TS5 B;  4A4C A;  2F8P A;  1CNP A;  1S5G Y;  5J3X A;  2G2B A;  1YUT A;  2LLT A;  1GM0 A;  3BFB A;  2L4I A;  2KLD A;  2Q91 A;  1J7P A;  1KK8 B;  1F54 A;  2Y4Q A;  2I2R E;  2E30 A;  3CR5 X;  1EH2 A;  4NDB A;  3DVJ A;  1B8L A;  2NXQ A;  1OOI X;  1REC A;  1DJG A;  2LVK A;  1CFP A;  1WLZ A;  3A8R A;  3O4Y A;  1QAT A;  4D1E A;  1WY9 A;  1TCF A;  2GGM A;  1BG1 A;  2KLE A;  3O2P A;  2KAY A;  4R1E A;  2KBI A;  3WHT B;  1NYA A;  4A4B A;  1CMF A;  1OOF A;  2M8U A;  1LS8 A;  3I5G C;  1XO5 A;  3FE6 A;  1W7I B;  1K95 A;  2BKI B;  3JVT C;  3M0W A;  1WLM A;  3WHU B;  3FIA A;  1KWO B;  3OX5 A;  1LA0 A;  4BY5 A;  1FPW A;  3R1V A;  1AJ4 A;  2HQW A;  2BEC A;  2KBM A;  1YUS A;  3DY9 A;  1AK8 A;  1AJ5 A;  1KQV A;  4AQI A;  2K8M B;  1MUX A;  1C7W A;  2BL0 C;  2NLN A;  3GOF A;  2LLU A;  1AP4 A;  3BUW B;  1RK9 A;  2QDI A;  4OVN F;  1YR5 A;  3CZ2 A;  4CLN A;  1OE9 B;  1BOD A;  1XFY O;  4CPV A;  1OMD A;  2F3Y A;  1Y6W A;  1IQ5 A;  3B87 A;  1IG5 A;  1B1G A;  2F2O A;  2CBL A;  2EC6 B;  1WRZ A;  1DGU A;  1S6C A;  3PAT A;  1XFX O;  4IL1 A;  4BY4 A;  1ZFS A;  2F33 A;  1SR6 C;  2WOR A;  1UHN A;  2RGI A;  2K7B A;  1BJF A;  3EKJ A;  2H2K A;  2HET A;  3CWG A;  3KPX A;  2LM5 A;  1CLB A;  1M31 A;  3I5F C;  4YI8 A;  3EK7 A;  4OZD A;  1B8R A;  4OV2 A;  3C1V A;  1DJZ A;  1S5G Z;  1QVI Z;  3BXK A;  5CPV A;  1NCY A;  2L51 A;  2JXL A;  2BBM A;  1SRA A;  1NX3 A;  2JT0 A;  1SCV A;  1NP8 A;  3OP0 A;  4M2Q A;  1KFU S;  2L2E A;  3CDN A;  3CZ0 A;  3I5G B;  4GGN A;  4GGF A;  4YGA A;  1XFZ O;  1KQM C;  2K60 A;  2LVJ A;  3JVT B;  3LK0 A;  1KFU L;  2PYQ A;  1OQP A;  1A75 B;  1AUI B;  4PHM A;  3SS5 A;  3SG3 A;  3TDI A;  1CFF A;  3BOW B;  1PUL A;  3FE8 A;  5HKW A;  3BQ3 A;  1TTX A;  3DYE A;  3JTD B;  2Q4U A;  1EXR A;  2LHL A;  1TCO B;  2JNF A;  3B7A A;  1C07 A;  4F0Z B;  3AAK A;  2WCB A;  4YRU A;  2R2I A;  5CSN A;  1L2O B;  1XFV O;  3D76 A;  3FE9 A;  2BAP A;  2G9B A;  3NSL A;  1B4C A;  2BNX A;  2Y1N A;  5IBW A;  2BCA A;  4C0L A;  1FI5 A;  1Z4H A;  2MHH A;  3PN7 C;  2HQ8 A;  2ZN9 A;  3AKA A;  1J7O A;  2LC5 A;  2O60 A;  3PJI A;  4P2Y B;  1SKT A;  3GK4 X;  1IKU A;  5AXI A;  1SBJ A;  1YX7 A;  1WDC C;  2JXC A;  2JC2 A;  2KFH A;  2ZFD A;  3OGN A;  1G33 A;  2AMI A;  1TIZ A;  2JT8 A;  1K90 D;  3HX4 A;  3OX6 A;  2I94 A;  4YGC B;  1QS7 A;  3I5F B;  5TNC A;  2M3W A;  5HL1 A;  2L0P A;  1XYD A;  2LVI A;  3DD4 A;  3I5H B;  1K8U A;  1XFW O;  2GV5 A;  1K93 D;  1UWO A;  1YVL A;  1KSM A;  1KK7 Y;  2KAV A;  3NHT A;  1MXE A;  1MXL C;  2LMU A;  3DVE A;  1MR8 A;  5I94 A;  2NCO A;  3NGV A;  1KFX S;  2D8N A;  3B88 A;  1SCM C;  1WRK A;  3TZ1 A;  1BU3 A;  3SG4 A;  3TUY B;  2SAS A;  1DMO A;  2QEV A;  1K9K A;  4HSZ A;  2FJY A;  1ZOT B;  2BE4 A;  2JT3 A;  3F45 A;  3KF9 A;  1K9U A;  3CAB A;  1F4O A;  5AER A;  1Y1U A;  4OKH A;  4ZCU A;  1J1D A;  2CCM A;  2OS8 C;  2KI4 B;  3QME A;  2FOT A;  1J7Q A;  4F7F A;  1TUZ A;  1FBV A;  3D77 A;  2WC6 A;  1DT7 B;  2I18 A;  2LAN A;  1H8B A;  2ZRT A;  1XA5 A;  1QAS A;  1IH0 A;  2H61 C;  3D73 A;  1N2D A;  1NSH A;  2LUX A;  1QVI Y;  1UHJ A;  2WCH A;  1BT6 A;  1CLM A;  1JBA A;  1KSO A;  1P28 A;  1BR4 B;  1B9A A;  3E3R A;  1NUB A;  4INX A;  4ICB A;  3CZT X;  1DJW A;  3R1O A;  1DJH A;  3BJH A;  1XFU O;  1CDL A;  4NDD A;  2WCF A;  1IJ6 A;  4C0J A;  2PRU A;  1E8A A;  1UP5 A;  3D10 A;  2WND A;  1K94 A;  3CLN A;  5FYX A;  2WCJ A;  2MBX A;  4JQ0 D;  2L5Y A;  4MLW A;  4PHK A;  1B7T Y;  1DJI A;  1BR1 B;  2LNK A;  4Q04 A;  1ALV A;  3SG5 A;  3EG5 B;  3NSO A;  3ICB A;  2ZKM X;  2MLE C;  1RRO A;  1DF0 A;  3CR4 X;  3ZWH A;  1CFD A;  2MLF C;  5AFP A;  1CLL A;  1TUJ A;  4OCI A;  2M0R A;  2COL B;  2H61 A;  2L50 A;  2WCL A;  4ORC B;  1ZUZ A;  3ZNI A;  1M39 A;  1KK7 Z;  1F55 A;  5JOL A;  3D75 A;  1PRW A;  1OW4 A;  2AAO A;  5AAN A;  1A29 A;  1R6P A;  3B6X A;  1SPY A;  2BCX A;  1DF0 B;  1TNQ A;  4MBE A;  5ER4 X;  1JWD A;  3GK2 A;  1WRL A;  2LHI A;  1MWN A;  4GPL B;  4DIR A;  5I2O A;  4MVF A;  2LP2 A;  2KSP A;  1J55 A;  3BUN B;  3IVT A;  3OB2 B;  2LMV A;  4MZL A;  1QX7 A;  3SIA A;  5BPJ A;  2QEO A;  3FWB A;  2JUL A;  4GNK B;  1DGV A;  2P71 A;  3BUO B;  3O78 A;  4XYN A;  1QLK A;  2LCP A;  3EK8 A;  3FS7 A;  1XFR A;  4MN0 A;  2QEB A;  2OTG C;  2NZ0 A;  4MEW A;  1UUR A;  2JU0 A;  2GTE A;  3BFH A;  4HRE E;  4CFR A;  1JF0 A;  1DQE A;  1XK4 C;  4CFQ A;  3PAL A;  2BKH B;  4GUK A;  1AHR A;  1U5I A;  1OZS A;  4E68 A;  1FI6 A;  3S0A A;  1TOP A;  2ZRS A;  4YGD B;  2K61 A;  2JZI A;  4MSP A;  4N1F A;  2QAC A;  1SNL A; 
#chains in the Genus database with same CATH homology
 3QRX A;  1JFJ A;  2JNX A;  1J7R A;  5D69 A;  2PAS A;  2BL0 B;  4HRH A;  2K2A A;  4HRG A;  5CSI A;  2ISD A;  3RM1 A;  1EG3 A;  2JTT A;  2JOJ A;  1V1F A;  2B1U A;  1JFK A;  3EVV A;  4PAL A;  1IH0 A;  5G08 A;  2LE9 B;  2PSR A;  3KHE A;  3PLF B;  3BUX B;  1B7T Z;  1DJY A;  3FWC A;  1DTL A;  1S3P A;  1A4P A;  4L9M A;  1D1O A;  5K89 A;  4DUQ A;  1NPQ A;  1J1E A;  3WNX B;  2M97 A;  2IS9 A;  5KTY A;  1K9P A;  2JPT A;  1OSA A;  4N5X A;  3WXA A;  1SL9 A;  1CM4 A;  1QJT A;  1R2U A;  1XK4 A;  2OPO A;  2KI6 C;  4ORB B;  1SR6 B;  4M2P A;  4PE1 A;  2EHB A;  3MSE B;  4I5N B;  4PHJ A;  1TRF A;  3IQO A;  4OR9 B;  1BOC A;  4DS7 A;  2KI6 D;  3PM8 A;  1GQM A;  5D7F A;  3CGA A;  2MJW B;  4WQ3 A;  5DKQ A;  3CS1 A;  4YBH B;  1W7J B;  2MRD A;  1ALW A;  4GFT A;  5KU1 A;  1N65 A;  2VRG A;  3TS5 C;  1YX8 A;  1FF1 A;  1AVS A;  5I2Q A;  1RWY A;  4FQO A;  4YGE B;  1NX2 A;  1KK8 C;  1KQM B;  2LLS A;  4ORA B;  1S36 A;  3KEV A;  1CKK A;  1KFX L;  3SG6 A;  4XJK A;  2JRF A;  2KHN A;  2M7N A;  1SK6 D;  3LK1 A;  4TNC A;  1QLS A;  2M7L A;  2KNE A;  1YUR A;  5CSF A;  2K7C A;  1H4B A;  1Y1X A;  4JPZ B;  1F70 A;  2EGD A;  4I5K A;  3CTN A;  3DVM A;  1KWO C;  3SIB A;  2LP3 A;  3K21 A;  1NIW A;  3PN7 B;  1LA3 A;  3IF7 A;  3EVU A;  4XJK B;  1F71 A;  1QV1 A;  2ZN8 A;  1V1G A;  1IQ3 A;  4MRY A;  1QV0 A;  2WC8 A;  2M1U A;  1WDC B;  3NSI A;  2ZNE A;  1LXF C;  1CFC A;  4PHN A;  1MF8 B;  4GAO A;  1OOJ A;  2WCE A;  3LLE A;  2PAL A;  3DF0 A;  1M46 A;  1JC2 A;  2AUC A;  2L5X B;  4M2O A;  1IWQ A;  2EC6 C;  3O6B A;  4ZCV A;  2CTN A;  1RTP 1;  4MZK A;  4WQ2 A;  1CDN A;  2I7A A;  2WOS A;  3DF0 B;  1ZAC A;  1SCM B;  2M9G A;  2F3Z A;  2V53 A;  5JJG A;  3VRP A;  1SL7 A;  1BLQ A;  3EK4 A;  4YI9 A;  1UHI A;  1PSB A;  1M45 A;  5DKR A;  2QPT A;  3HCM A;  2M29 A;  4CID A;  1HT9 A;  4MZJ A;  1OZO A;  2DOQ A;  2TN4 A;  3LCP C;  4PE0 A;  2KFG A;  1B47 A;  3OHM B;  2OS8 B;  1SMG A;  1GGW A;  1N0Y A;  2JWW A;  1JF2 A;  1M63 B;  4I5L B;  2PVB A;  2MA2 A;  3SJS A;  1K96 A;  2M49 B;  5PAL A;  4DRW A;  5B8I B;  3DVK A;  1SYM A;  2K0J A;  1PSR A;  1X02 A;  2LAP A;  3NSK A;  1NCZ A;  1TNX A;  1CTR A;  1YRT B;  1IRJ A;  4QJ5 B;  1JUO A;  2KQY A;  3JTD C;  1TNP A;  1TNW A;  5HKY A;  2K7D A;  4GGF C;  3AAJ A;  1FW4 A;  2LMT A;  3KO0 A;  1L2O C;  3BUM B;  1YRU B;  5CSJ A;  1QTX A;  1QXP A;  3OB1 B;  1QX2 A;  3NXA A;  3PFV A;  2KQ6 A;  2A4J A;  5KSZ A;  4AQJ A;  1A03 A;  1JSA A;  1PVB A;  1HQV A;  2SCP A;  1EG4 A;  2E6W A;  1QX5 B;  1SL8 A;  1SY9 A;  1C7V A;  1QIW A;  1LIN A;  1ZMZ A;  2GGZ A;  1KCY A;  2KFF A;  4YGB B;  1U5I B;  3VGO A;  4NQG A;  1GGZ A;  1CMG A;  1YVH A;  1A75 A;  3I5H C;  4ETO A;  1G8I A;  1NX1 A;  1VRK A;  3BOW A;  5ER5 A;  1NWD A;  2F2P A;  4AOM A;  2KYC A;  1EJ3 A;  1MQ1 A;  1XVJ A;  1QIV A;  2FJU B;  1F4Q A;  2Y5I A;  2FCD A;  2KYF A;  4PE7 A;  4USL A;  5HKZ A;  2K7O A;  1PK0 D;  1F8H A;  1LVC D;  1RFJ A;  5F6T A;  3I5I C;  3TDZ A;  2KGB C;  1RJV A;  3TUY C;  2L98 A;  2CXJ A;  3CR2 A;  2P6B B;  4JWQ A;  1A2X A;  2Y1M A;  1CB1 A;  2LUC A;  3IQQ A;  1YTZ C;  2BBN A;  2KI4 C;  1SW8 A;  2HPS A;  1BMO A;  2OTG B;  2BE6 A;  1B8C A;  3SG7 A;  2O5G A;  3BYA A;  1L7Z A;  4MRX A;  2LV7 A;  4DCK A;  2JTZ A;  2CNP A;  5AEQ A;  2LVV A;  3VRN A;  4UPG A;  3EVR A;  2CT9 A;  1PAL A;  4PCW A;  1S6I A;  1Q80 A;  3RLZ A;  1ODB A;  2M1K B;  1DVI A;  1EL4 A;  1GJY A;  1G4Y R;  1Y0V H;  4FTG A;  1UUS A;  1UHK A;  2MAZ A;  2KDH A;  2NCP A;  2HF5 A;  3H4S E;  4GBA A;  3EKH A;  1S1E A;  2K2F A;  1Y1A A;  5HYD A;  2KOT A;  1NX0 A;  3VRQ A;  3VRO A;  2BCB A;  1IGV A;  3D0Y A;  5HLO A;  1BF5 A;  2KAX A;  3VRR A;  1CDM A;  4QJ4 B;  1PVA A;  4QJ3 B;  4WRI A;  1OMV A;  1YUU A;  5DKN A;  4I5J A;  4U8D A;  5GQQ C;  3TDU A;  4P5O E;  3A4U B;  3I5I B;  3LL8 B;  1CM1 A;  2FCE A;  1CDP A;  5I2L A;  3D0Y B;  4PDZ A;  4C0K A;  1MHO A;  1NCX A;  4PE4 A;  1S6J A;  1IJ5 A;  2KGR A;  2ZND A;  3SG2 A;  1LKJ A;  1TN4 A;  2L4H A;  2PMY A;  5HLV A;  1K2H A;  4N1G A;  1DJX A;  3AKB A;  5I8N A;  1OMR A;  1S26 D;  3PSR A;  2JQ6 A;  3GK1 A;  4NDC A;  1UHH A;  3TS5 B;  4A4C A;  2F8P A;  1CNP A;  1S5G Y;  5J3X A;  2G2B A;  1YUT A;  2LLT A;  2L4I A;  2Q91 A;  1J7P A;  1KK8 B;  1F54 A;  2Y4Q A;  2I2R E;  2E30 A;  3CR5 X;  1EH2 A;  4NDB A;  3DVJ A;  1B8L A;  2NXQ A;  1REC A;  1DJG A;  2LVK A;  1CFP A;  1WLZ A;  3A8R A;  3O4Y A;  1QAT A;  4D1E A;  1WY9 A;  1TCF A;  2GGM A;  1BG1 A;  3O2P A;  2KAY A;  4R1E A;  2KBI A;  3WHT B;  1NYA A;  4A4B A;  1CMF A;  2M8U A;  3I5G C;  1XO5 A;  3M0W A;  1W7I B;  1K95 A;  2BKI B;  3JVT C;  1WLM A;  3WHU B;  3FIA A;  1KWO B;  3OX5 A;  1LA0 A;  4BY5 A;  1FPW A;  1AJ4 A;  2HQW A;  2BEC A;  2KBM A;  1YUS A;  1AK8 A;  1KQV A;  1AJ5 A;  4AQI A;  2K8M B;  2BL0 C;  1MUX A;  1C7W A;  2NLN A;  3GOF A;  2LLU A;  1AP4 A;  3BUW B;  1RK9 A;  4CLN A;  4OVN F;  1YR5 A;  1OE9 B;  1BOD A;  1XFY O;  4CPV A;  1OMD A;  2F3Y A;  1Y6W A;  1IQ5 A;  1IG5 A;  1B1G A;  2F2O A;  2CBL A;  2EC6 B;  1WRZ A;  1DGU A;  1S6C A;  3PAT A;  1XFX O;  4IL1 A;  4BY4 A;  1ZFS A;  2F33 A;  1SR6 C;  2WOR A;  1UHN A;  2RGI A;  2K7B A;  1BJF A;  3EKJ A;  2H2K A;  2HET A;  3CWG A;  3KPX A;  2LM5 A;  1CLB A;  1M31 A;  3I5F C;  4YI8 A;  3EK7 A;  1B8R A;  4OV2 A;  3C1V A;  1DJZ A;  1S5G Z;  1QVI Z;  3BXK A;  5CPV A;  1NCY A;  2L51 A;  2JXL A;  2BBM A;  1SRA A;  1NX3 A;  2JT0 A;  1SCV A;  1NP8 A;  3OP0 A;  4M2Q A;  1KFU S;  2L2E A;  3I5G B;  4GGN A;  4YGA A;  4GGF A;  1XFZ O;  1KQM C;  2LVJ A;  3JVT B;  3LK0 A;  1KFU L;  1OQP A;  1A75 B;  1AUI B;  4PHM A;  3SG3 A;  3TDI A;  1CFF A;  3BOW B;  1PUL A;  5HKW A;  3BQ3 A;  1TTX A;  3JTD B;  2Q4U A;  1EXR A;  2LHL A;  1TCO B;  2JNF A;  1C07 A;  4F0Z B;  3AAK A;  2WCB A;  4YRU A;  2R2I A;  5CSN A;  1L2O B;  1XFV O;  1B4C A;  2G9B A;  3NSL A;  2Y1N A;  1FI5 A;  5IBW A;  2BCA A;  4C0L A;  2MHH A;  3PN7 C;  2HQ8 A;  2ZN9 A;  3AKA A;  1J7O A;  2LC5 A;  2O60 A;  4P2Y B;  1SKT A;  3GK4 X;  1IKU A;  5AXI A;  1SBJ A;  1YX7 A;  1WDC C;  2JXC A;  2JC2 A;  2KFH A;  2ZFD A;  1G33 A;  2AMI A;  1TIZ A;  2JT8 A;  1K90 D;  3HX4 A;  3OX6 A;  2I94 A;  4YGC B;  1QS7 A;  3I5F B;  5TNC A;  2M3W A;  2L0P A;  1XYD A;  2LVI A;  3DD4 A;  3I5H B;  1K8U A;  1XFW O;  2GV5 A;  1K93 D;  1UWO A;  1YVL A;  1KSM A;  1KK7 Y;  2KAV A;  1MXE A;  1MXL C;  2LMU A;  3DVE A;  1MR8 A;  2NCO A;  1KFX S;  2D8N A;  1SCM C;  1WRK A;  3TZ1 A;  1BU3 A;  3SG4 A;  3TUY B;  2SAS A;  1DMO A;  1K9K A;  4HSZ A;  1ZOT B;  2BE4 A;  2JT3 A;  3F45 A;  3KF9 A;  1K9U A;  1F4O A;  5AER A;  1Y1U A;  4OKH A;  4ZCU A;  1J1D A;  2CCM A;  2OS8 C;  2KI4 B;  1J7Q A;  2FOT A;  1FBV A;  1DT7 B;  2I18 A;  2LAN A;  1H8B A;  2ZRT A;  1XA5 A;  1QAS A;  2H61 C;  1N2D A;  1NSH A;  2LUX A;  1QVI Y;  1UHJ A;  1BT6 A;  1CLM A;  1JBA A;  1KSO A;  1BR4 B;  1B9A A;  3E3R A;  1NUB A;  4ICB A;  3CZT X;  1DJW A;  1DJH A;  1XFU O;  1CDL A;  4NDD A;  2WCF A;  1IJ6 A;  4C0J A;  2PRU A;  1E8A A;  1UP5 A;  3D10 A;  2WND A;  1K94 A;  3CLN A;  5FYX A;  2MBX A;  4JQ0 D;  4MLW A;  4PHK A;  1B7T Y;  1DJI A;  1BR1 B;  2LNK A;  4Q04 A;  1ALV A;  3SG5 A;  3NSO A;  3ICB A;  2ZKM X;  2MLE C;  1RRO A;  1DF0 A;  3CR4 X;  3ZWH A;  1CFD A;  2MLF C;  5AFP A;  1CLL A;  4OCI A;  2M0R A;  2COL B;  2H61 A;  2L50 A;  4ORC B;  1ZUZ A;  3ZNI A;  1M39 A;  1KK7 Z;  1F55 A;  5JOL A;  1PRW A;  2AAO A;  5AAN A;  1A29 A;  1R6P A;  1SPY A;  2BCX A;  1DF0 B;  1TNQ A;  4MBE A;  5ER4 X;  1JWD A;  3GK2 A;  1WRL A;  2LHI A;  1MWN A;  4GPL B;  4DIR A;  5I2O A;  4MVF A;  2LP2 A;  2KSP A;  1J55 A;  3BUN B;  3OB2 B;  3SIA A;  2LMV A;  4MZL A;  1QX7 A;  5BPJ A;  3FWB A;  2JUL A;  4GNK B;  1DGV A;  3BUO B;  3O78 A;  4XYN A;  1QLK A;  2LCP A;  3EK8 A;  3FS7 A;  4MN0 A;  4MEW A;  2OTG C;  2NZ0 A;  1UUR A;  2JU0 A;  4HRE E;  4CFR A;  1JF0 A;  1XK4 C;  4CFQ A;  3PAL A;  2BKH B;  4GUK A;  1AHR A;  1U5I A;  1OZS A;  4E68 A;  1FI6 A;  1TOP A;  2ZRS A;  4YGD B;  2K61 A;  2JZI A;  4MSP A;  4N1F A;  2QAC A;  1SNL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...