4CLNA

Structure of a recombinant calmodulin from drosophila melanogaster refined at 2.2-angstroms resolution
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
148
structure length
148
Chain Sequence
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVTMMTSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium binding protein
molecule keywords CALMODULIN
publication title Structure of a recombinant calmodulin from Drosophila melanogaster refined at 2.2-A resolution.
pubmed rcsb
source organism Drosophila melanogaster
total genus 42
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 1991-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4clnA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4clnA02
1R6PA 2JNXA 4WQ2A 4CFRA 4DUQA 4E68A 1MWNA 4AQJA 3FWCA 2LUXA 1DJIA 3KHEA 1FI6A 1SR6B 1S3PA 1CTRA 1OQPA 2M7NA 1WRZA 3VRQA 3I5FC 1YX8A 1DJYA 2F3ZA 2CCMA 4USLA 3CWGA 2JTZA 2OS8C 3LK1A 1BODA 1KFXS 2KI6C 2MAZA 3LK0A 2KQYA 3I5IC 3I5GB 1MF8B 1ZUZA 1CMGA 3BUOB 4MN0A 1GJYA 3SJSA 1B8CA 4NDCA 1CB1A 1BR1B 1Y1XA 2F8PA 2K7OA 4GGFC 1XFZO 1FF1A 1SCMB 2LVVA 1M46A 2KI4C 1V1FA 2KOTA 1D1OA 2KBIA 4WRIA 1UP5A 1NSHA 4YGCB 5AANA 3JVTB 5B8IB 4M2OA 5HKWA 1NPQA 1SL7A 2L4HA 5KTYA 3BUNB 3DVEA 2KAYA 4JPZB 1DJWA 1KK7Z 3VRPA 1HT9A 2ZRSA 1IG5A 4U8DA 2JULA 3O78A 4CLNA 1KQMB 2CNPA 1S6IA 2L51A 2KGRA 1S5GZ 1EG3A 2QACA 4XJKB 1BF5A 2K2FA 1JF0A 1IH0A 2H61A 1S6JA 2LLUA 1CLLA 2KBMA 3DF0A 5ER4X 3JTDB 3BOWA 5CPVA 2ZNEA 2NZ0A 3GK1A 4GNKB 3BUXB 2JC2A 5GQQC 4YGEB 4OCIA 1J7RA 4JQ0D 3PN7B 4MLWA 4N1FA 1IGVA 3D0YA 4QJ5B 4MRXA 1IKUA 2TN4A 4M2QA 4PHJA 2EGDA 1QATA 2WNDA 1QLSA 4NQGA 4ORBB 1KK8B 2MLFC 2M9GA 4DS7A 2L0PA 3PSRA 1UHIA 1KSOA 1XVJA 2L98A 2K61A 1MXEA 2BL0C 4MZLA 1MR8A 1CLBA 3WHUB 4BY4A 2M29A 4JWQA 2HQWA 4GFTA 4N1GA 3GK4X 2OTGC 1L2OC 1B47A 5I2QA 1WLMA 3E3RA 1A75A 1YX7A 3NSOA 1OZOA 2NLNA 2ZRTA 2BE6A 2E6WA 4I5LB 4A4CA 1X02A 3DF0B 3O4YA 1DF0B 1YVHA 1B7TZ 1LINA 1PULA 2Q91A 3KEVA 3A8RA 5AXIA 1C07A 2BBNA 2PRUA 3DVJA 3PM8A 2JPTA 2KSPA 3TZ1A 4DCKA 4MRYA 5CSIA 4PDZA 3D0YB 3NSLA 3ZWHA 1K94A 5TNCA 2CXJA 1CFFA 1DJHA 1CM1A 1F55A 1MXLC 4YGBB 2Q4UA 2SASA 5ER5A 3IQOA 1SL9A 1W7JB 4ICBA 4N5XA 1SR6C 2WCBA 4GPLB 1OMVA 1JBAA 1M45A 2WCEA 1SKTA 2F33A 1WDCB 1SRAA 4NDBA 2E30A 2MLEC 1SYMA 4C0KA 2JT8A 1JC2A 2R2IA 5DKNA 1JSAA 5G08A 1XA5A 4ZCUA 4CPVA 3I5GC 1M31A 2JXLA 4UPGA 1AHRA 1BOCA 4QJ3B 1A03A 1DJZA 1UUSA 2I7AA 3FIAA 3KF9A 1SCMC 4GUKA 1KCYA 2M97A 3NSKA 3OX5A 1Y1AA 2K7DA 2PMYA 1Q80A 5DKRA 1B4CA 2BCBA 2NCPA 1XFXO 2ZKMX 2K8MB 4YRUA 1SW8A 3JVTC 2M49B 2B1UA 1BMOA 2CTNA 3FS7A 1NX2A 1K9KA 1TN4A 2GGMA 1CDLA 1F8HA 1WY9A 1QJTA 2JQ6A 2VRGA 3GK2A 2CT9A 1NCXA 2M7LA 3ICBA 1PSBA 1OMDA 1KQMC 3RM1A 2D8NA 1EH2A 1SK6D 1J7QA 1M39A 1QVIY 1UHNA 4MZJA 2MRDA 1DGVA 4OR9B 3JTDC 4PHNA 1IQ3A 3CGAA 1ZMZA 4NDDA 5I8NA 2JT0A 1TRFA 3D10A 4WQ3A 1SCVA 1CFCA 3PN7C 2L4IA 1YRTB 4GAOA 5IBWA 1MUXA 1AUIB 1BG1A 2Y4QA 1KK8C 5HLVA 1J1DA 5CSJA 3NXAA 2WORA 4OV2A 3WHTB 1AP4A 1DVIA 1KFXL 1IJ6A 4YGAA 1EG4A 3EVUA 1RROA 1Y6WA 1ZFSA 2JZIA 5AEQA 2PVBA 2RGIA 3CZTX 1PVAA 1BR4B 3SG3A 1XK4C 1BU3A 5CSFA 2M1UA 5HLOA 1JUOA 2LVJA 4YGDB 4A4BA 2COLB 1UHHA 1U5IA 1CNPA 2H61C 3GOFA 1PALA 1CFDA 3IF7A 4GBAA 4PCWA 4DIRA 1LXFC 1YURA 3M0WA 1RWYA 2FCDA 1IWQA 1K9PA 2M3WA 2P6BB 4PALA 5DKQA 2SCPA 1PSRA 5FYXA 4R1EA 1A4PA 3OP0A 4PE7A 3H4SE 4C0JA 2LM5A 2F2PA 3WNXB 2KFGA 3TDZA 1DGUA 2I94A 2LCPA 4AOMA 4FTGA 2KGBC 2L2EA 2BKIB 3O6BA 4ETOA 1DT7B 1C7VA 1OSAA 3CS1A 1B1GA 3SG6A 2F3YA 1TOPA 2A4JA 1QV1A 2Y5IA 1WDCC 3OX6A 2ZNDA 1KQVA 4YI8A 1TCFA 1A2XA 1QX7A 5AFPA 2PSRA 1NWDA 4F0ZB 2LP2A 1QS7A 1W7IB 1H4BA 2MHHA 3AKBA 4MZKA 1FW4A 3PLFB 2JOJA 3PFVA 1UURA 1IQ5A 2GV5A 2JWWA 3QRXA 5HKZA 1QXPA 3BOWB 1B8LA 4BY5A 1PRWA 1SY9A 1CDNA 2BCXA 1CMFA 1KSMA 1F54A 2JNFA 1UWOA 1RJVA 2BBMA 2O5GA 4HREE 2MA2A 1YRUB 1SBJA 1J7OA 1KWOB 4AQIA 3ZNIA 2LVKA 2LC5A 2M1KB 4PE1A 1YTZC 1AK8A 3KPXA 1ALVA 4FQOA 2KQ6A 3OB2B 5BPJA 2EC6B 3NSIA 2KAVA 2L5XB 3PALA 1RECA 1N65A 1N0YA 3OHMB 3CR2A 1HQVA 5KSZA 1BJFA 1RTP1 2F2OA 4I5NB 4MBEA 2PASA 1EL4A 1YR5A 3EKJA 4D1EA 1B8RA 5D69A 1S26D 5AERA 1OMRA 1QASA 3DVMA 1G8IA 1Y0VH 2LAPA 1A75B 1KFUS 3TDUA 2LP3A 3TS5B 1AJ4A 2MBXA 2KNEA 5I2OA 2O60A 1F70A 1IRJA 2OPOA 1ODBA 3HX4A 2G2BA 1K8UA 2JT3A 2IS9A 1XFYO 2Y1NA 1J7PA 1L7ZA 2ISDA 3CTNA 1RFJA 2Y1MA 1VRKA 1YUTA 2JU0A 1AVSA 1CLMA 2KHNA 5HYDA 1GQMA 2LMUA 4I5JA 4OVNF 2ZN9A 3SIAA 3EK8A 5K89A 1J1EA 1QTXA 1EXRA 1K95A 2NCOA 1B9AA 4L9MA 1JWDA 3CR5X 1LA0A 5J3XA 4IL1A 2FJUB 5HKYA 1EJ3A 1K96A 3DVKA 1UHKA 2LANA 4HRHA 1BT6A 4CIDA 1N2DA 1QX5B 2KAXA 1NX3A 3BXKA 4PHMA 3EK4A 1PK0D 2KYCA 3OB1B 2LLSA 1XFVO 3WXAA 2JXCA 1LA3A 4YI9A 1G4YR 1CDMA 4PE0A 2G9BA 4QJ4B 1NIWA 1TNPA 1FBVA 2HPSA 3SG5A 1ZOTB 3EK7A 2PALA 1QVIZ 2ZN8A 1M63B 3I5HB 2JTTA 4XJKA 1JFKA 1IJ5A 4GGNA 3MSEB 1ZACA 3O2PA 1F4OA 1TNXA 3TDIA 1NCZA 2LMTA 3RLZA 3AAJA 2CBLA 1NX0A 1LKJA 4ORCB 4XYNA 1KK7Y 2ZFDA 3VRRA 1GGWA 3TUYB 4GGFA 2KI6D 1K90D 1OE9B 2BE4A 3KO0A 3F45A 1S5GY 4MVFA 1E8AA 1JFJA 2HF5A 2K2AA 1NX1A 1SL8A 3EVVA 3LCPC 3SG7A 1DTLA 1ALWA 3HCMA 3EKHA 4PHKA 1F71A 1QIVA 1CDPA 2LHLA 2LHIA 2LMVA 1SPYA 1KWOC 1NUBA 1NP8A 2KFHA 3I5FB 5CSNA 3CLNA 1XK4A 3EVRA 3SG2A 1Y1UA 2K7CA 2NXQA 5I2LA 2EHBA 2OS8B 2M8UA 1WRLA 2EC6C 3LL8B 4P2YB 2DOQA 4DRWA 3I5IB 3VROA 1WRKA 4TNCA 1DF0A 1QIWA 1J55A 1A29A 1NYAA 5F6TA 2H2KA 1JF2A 5JJGA 1PVBA 1BLQA 1YVLA 3TS5C 4OKHA 1DJGA 1K9UA 4CFQA 1U5IB 2KI4B 2AUCA 2LNKA 2WCFA 3BUMB 4I5KA 1QX2A 4YBHB 2M0RA 2WC8A 1S1EA 3AKAA 3FWBA 1C7WA 2I2RE 1B7TY 3BUWB 5KU1A 2BECA 3VRNA 3IQQA 3BYAA 1H8BA 2KDHA 2LLTA 4Q04A 1XO5A 4HRGA 1WLZA 3VGOA 1SMGA 1F4QA 1K2HA 2I18A 2LE9B 1MHOA 1OZSA 1XFWO 3AAKA 2AMIA 2KYFA 3LLEA 3BQ3A 1GGZA 1QLKA 1OOJA 2K0JA 1MQ1A 2LV7A 2QPTA 3A4UB 3DD4A 3SIBA 5JOLA 2LVIA 1SNLA 2HQ8A 1R2UA 2JRFA 2FOTA 2KFFA 1AJ5A 3C1VA 1TIZA 4ZCVA 5PALA 1TNWA 1LVCD 2LUCA 2L50A 1NCYA 3PATA 3K21A 1CM4A 4PE4A 4MEWA 1K93D 2BCAA 1DMOA 1G33A 4MSPA 1YUUA 2BL0B 2MJWB 4M2PA 3CR4X 1XYDA 4C0LA 3I5HC 2OTGB 1DJXA 1L2OB 2K7BA 1V1GA 2WOSA 1KFUL 2HETA 4HSZA 1TCOB 2V53A 1UHJA 1CFPA 1S36A 2BKHB 3SG4A 1QV0A 4ORAB 1FI5A 1RK9A 3TUYC 1YUSA 1S6CA 1FPWA 1TNQA 5D7FA 1XFUO 1TTXA 1CKKA 2FCEA 2GGZA 4P5OE 2AAOA
chains in the Genus database with same CATH superfamily
1R6PA 2JNXA 2KLEA 4WQ2A 4CFRA 4DUQA 4E68A 1MWNA 4AQJA 3FWCA 2LUXA 1DJIA 1OOIX 3KHEA 1FI6A 1SR6B 1S3PA 1CTRA 1OQPA 2M7NA 1WRZA 3VRQA 3I5FC 1YX8A 1DJYA 2F3ZA 2CCMA 1C3ZA 4USLA 3CWGA 3NHIA 2JTZA 2OS8C 1C3YA 3LK1A 2WCLA 1BODA 1KFXS 2KI6C 2MAZA 3LK0A 2KQYA 3I5IC 3I5GB 1MF8B 1ZUZA 1CMGA 3BUOB 4MN0A 1GJYA 1Z2CB 2WC6A 3SJSA 1B8CA 4NDCA 1CB1A 1BR1B 1Y1XA 3FE6A 2F8PA 2K7OA 4GGFC 1XFZO 1FF1A 1SCMB 3BJHA 2LVVA 1M46A 2KI4C 1V1FA 2KOTA 1D1OA 2KBIA 4WRIA 1UP5A 1NSHA 4YGCB 5AANA 3JVTB 5B8IB 4M2OA 5HKWA 1NPQA 1SL7A 2L4HA 5KTYA 3BUNB 3DVEA 2KAYA 4JPZB 1TUJA 4KYNA 1DJWA 1KK7Z 3VRPA 1HT9A 2ZRSA 1IG5A 4U8DA 2JULA 3O78A 1Z4HA 1KQMB 2CNPA 4CLNA 3B87A 1S6IA 2L51A 2KGRA 1S5GZ 1EG3A 2QACA 4XJKB 1BF5A 2K2FA 1JF0A 1IH0A 2H61A 1S6JA 2LLUA 3L4AA 3OBVA 1CLLA 2KBMA 3DF0A 3CABA 5ER4X 3JTDB 3BOWA 5CPVA 2ZNEA 5EL2A 2NZ0A 1OOHA 3GK1A 4GNKB 5DICA 3BUXB 2JC2A 5GQQC 4YGEB 4OCIA 1J7RA 4JQ0D 3PN7B 4MLWA 4N1FA 1IGVA 3D0YA 4QJ5B 4MRXA 1IKUA 2TN4A 4M2QA 4PHJA 2EGDA 3NHTA 1QATA 2WNDA 1QLSA 4NQGA 4ORBB 1KK8B 2MLFC 2M9GA 4DS7A 2L0PA 3PSRA 1UHIA 1KSOA 1XVJA 2L98A 2K61A 1MXEA 2BL0C 4MZLA 1MR8A 1CLBA 3WHUB 4BY4A 2M29A 4JWQA 2HQWA 4GFTA 4N1GA 3L4LA 3GK4X 2OTGC 1L2OC 1B47A 5I2QA 1WLMA 3E3RA 3OGNA 1LS8A 1A75A 1YX7A 3NSOA 1OZOA 2GTEA 2NLNA 2ZRTA 2BE6A 2E6WA 4I5LB 4A4CA 1X02A 3DF0B 2P70A 3O4YA 1DF0B 1YVHA 1B7TZ 1LINA 1PULA 2Q91A 3KEVA 3A8RA 5AXIA 1C07A 2BBNA 2PRUA 3DVJA 3PM8A 2JPTA 3B86A 2KSPA 3TZ1A 4DCKA 4MRYA 5CSIA 4PDZA 3D0YB 3BFHA 3NSLA 3ZWHA 1K94A 5TNCA 2CXJA 1CFFA 1DJHA 1CM1A 1F55A 1MXLC 3N7HA 4YGBB 2Q4UA 2SASA 5ER5A 3FE9A 1SL9A 1W7JB 3IQOA 4ICBA 4N5XA 1SR6C 2WCBA 4GPLB 3SS4A 1OMVA 1JBAA 1M45A 2WCEA 1SKTA 1OOGA 2F33A 1WDCB 1SRAA 4NDBA 2E30A 2MLEC 1SYMA 4C0KA 2JT8A 1JC2A 2ERBA 2H8VA 2R2IA 5DKNA 2PQLA 1JSAA 5G08A 1XA5A 4ZCUA 4JD9A 4CPVA 3I5GC 1M31A 2JXLA 4UPGA 3CZ2A 1W9ZA 1AHRA 3R72A 1BOCA 4QJ3B 1A03A 1DJZA 1UUSA 2I7AA 3FIAA 3KF9A 1SCMC 4GUKA 1KCYA 2M97A 3NSKA 3OX5A 1Y1AA 2K7DA 2PMYA 1Q80A 5DKRA 1B4CA 3S0DA 2BCBA 2NCPA 1XFXO 2ZKMX 1TWOA 2K8MB 4YRUA 1SW8A 3JVTC 2M49B 2B1UA 1BMOA 2YGUA 2CTNA 2PYQA 3FS7A 1NX2A 1K9KA 1TN4A 2GGMA 1CDLA 1F8HA 1WY9A 1QJTA 2JQ6A 2VRGA 3GK2A 2CT9A 2WCKA 1NCXA 2M7LA 3D74A 3ICBA 1PSBA 1OMDA 1KQMC 3D78A 3RM1A 1OW4A 2D8NA 1EH2A 1SK6D 1J7QA 1M39A 1QVIY 1UHNA 4MZJA 2MRDA 1DGVA 4OR9B 3JTDC 4PHNA 1IQ3A 1DC1A 3CGAA 1ZMZA 4NDDA 5I8NA 2JT0A 1TRFA 3D10A 3D77A 1TUZA 4WQ3A 2QEBA 1SCVA 1CFCA 3PN7C 2L4IA 1YRTB 4GAOA 5IBWA 1MUXA 1AUIB 1BG1A 1P28A 2Y4QA 1KK8C 5HLVA 1J1DA 5CSJA 3NXAA 2WORA 3QMEA 4OV2A 3WHTB 3L47A 1DVIA 1KFXL 1IJ6A 1AP4A 4YGAA 1EG4A 3EVUA 1RROA 1Y6WA 1ZFSA 2JZIA 5AEQA 2PVBA 2RGIA 3CZTX 1PVAA 1BR4B 3SG3A 1XK4C 1BU3A 5CSFA 2M1UA 5HLOA 1JUOA 2LVJA 4YGDB 4A4BA 3R1OA 2COLB 1DQEA 1UHHA 1U5IA 1CNPA 2H61C 3GOFA 1PALA 1CFDA 3IF7A 4GBAA 4PCWA 4DIRA 1LXFC 1YURA 3M0WA 1RWYA 1DEKA 1IWQA 2FCDA 1K9PA 2M3WA 2P6BB 4FQTA 4PALA 5DKQA 2SCPA 1PSRA 5FYXA 1SSEB 4R1EA 1A4PA 3OP0A 4PE7A 3H4SE 3Q8IA 4C0JA 2LM5A 2F2PA 3WNXB 2KFGA 3TDZA 1DGUA 2I94A 2LCPA 4AOMA 4FTGA 2KGBC 2L2EA 2BKIB 3DZTA 3O6BA 4ETOA 1DT7B 1C7VA 1OSAA 3CS1A 2BAPA 1B1GA 3CYZA 3SG6A 2F3YA 1TOPA 2A4JA 1QV1A 2Y5IA 3CDNA 1WDCC 3OX6A 2ZNDA 3DXLA 1KQVA 4YI8A 1TCFA 1A2XA 1QX7A 2QEOA 5AFPA 2PSRA 1NWDA 4F0ZB 2LP2A 1QS7A 1W7IB 1H4BA 2JPOA 2MHHA 3AKBA 4MZKA 1FW4A 3PLFB 2JOJA 3PFVA 1UURA 1IQ5A 2GV5A 2JWWA 3QRXA 5HKZA 1QXPA 3BOWB 1B8LA 4BY5A 1PRWA 1SY9A 4INWA 4PT1A 1CDNA 2BCXA 1CMFA 1KSMA 1F54A 2JNFA 1UWOA 1RJVA 2BBMA 2O5GA 4HREE 2MA2A 1YRUB 3V2LA 1SBJA 3RZSA 1J7OA 1KWOB 4AQIA 3ZNIA 1DELA 2LC5A 2LVKA 2M1KB 1YTZC 4PE1A 2BNXA 1AK8A 3KPXA 1ALVA 4FQOA 2KQ6A 3OB2B 5BPJA 2EC6B 3NSIA 2KAVA 2L5XB 3B6XA 3PALA 1RECA 1N65A 1N0YA 3OHMB 3CR2A 1HQVA 5KSZA 1BJFA 2QEVA 1RTP1 2F2OA 4I5NB 4F7FA 4MBEA 2PASA 1EL4A 1YR5A 3EKJA 4D1EA 1B8RA 5D69A 1S26D 5AERA 1OMRA 1QASA 2P71A 3DVMA 1G8IA 1Y0VH 2LAPA 1A75B 1KFUS 3S0GA 2LP3A 3TDUA 1AJ4A 2MBXA 2KNEA 3TS5B 2O60A 5I2OA 1IRJA 2OPOA 1F70A 5FI2A 1ODBA 3HX4A 2G2BA 1K8UA 2JT3A 3D75A 2IS9A 2FJYA 1XFYO 2Y1NA 2WCMA 1J7PA 1L7ZA 5D3OA 2QEHA 2ISDA 5FI6A 3CTNA 1RFJA 2Y1MA 1VRKA 1YUTA 2JU0A 1AVSA 1CLMA 2KHNA 3PM2A 5HYDA 1GQMA 3UO9A 2LMUA 4I5JA 4OVNF 2ZN9A 3SIAA 3EK8A 5K89A 1J1EA 1QTXA 1EXRA 1K95A 2NCOA 1B9AA 4L9MA 1JWDA 3CR5X 2KLDA 1LA0A 5J3XA 4IL1A 2FJUB 5HKYA 1EJ3A 1K96A 3DVKA 4INXA 3NGVA 1UHKA 2LANA 3B7AA 4HRHA 1BT6A 4CIDA 1N2DA 1QX5B 2KAXA 1NX3A 3BXKA 4PHMA 3EK4A 1PK0D 1T14A 2KYCA 3OB1B 2LLSA 1XFVO 3WXAA 2JXCA 3EG5B 3D76A 1LA3A 4YI9A 1G4YR 1CDMA 4PE0A 2G9BA 4QJ4B 1NIWA 1TNPA 1FBVA 2HPSA 3SG5A 1ZOTB 3EK7A 2PALA 1QVIZ 2ZN8A 1M63B 3I5HB 2JTTA 4XJKA 1JFKA 1IJ5A 4GGNA 3MSEB 1QWVA 1ZACA 1F4OA 1TNXA 3O2PA 4JKTA 3TDIA 1NCZA 2LMTA 3RLZA 3AAJA 2CBLA 1NX0A 1LKJA 4ORCB 4XYNA 1KK7Y 2ZFDA 3VRRA 1GGWA 2WCJA 3TUYB 4GGFA 3CZ1A 2KI6D 1K90D 2L5YA 1OE9B 2BE4A 3KO0A 3F45A 3UNWA 1S5GY 4MVFA 1E8AA 3DYEA 2HF5A 2K2AA 1JFJA 1NX1A 1SL8A 3O4XA 3EVVA 3LCPC 3SG7A 1DTLA 1ALWA 3HCMA 3R1VA 3CZ0A 3EKHA 4IJ7A 4PHKA 1QIVA 1CDPA 1F71A 2LHLA 2K60A 2LHIA 2WC5A 2LMVA 1SPYA 3R1PA 1KWOC 1NUBA 1NP8A 2KFHA 3I5FB 5CSNA 3CLNA 1XK4A 3EVRA 3SG2A 1Y1UA 2K7CA 2NXQA 5I2LA 3SS5A 5HL1A 2QDIA 2EHBA 2OS8B 2M8UA 3IVTA 1WRLA 2L2CA 2EC6C 3LL8B 4P2YB 2DOQA 4DRWA 1ORGA 3I5IB 3VROA 1WRKA 3BFBA 4TNCA 1DF0A 1QIWA 1J55A 1A29A 1NYAA 5F6TA 2H2KA 1JF2A 5JJGA 1PVBA 1BLQA 1YVLA 5FI7A 3TS5C 4OKHA 1DJGA 1K9UA 4CFQA 1U5IB 2KI4B 2AUCA 2LNKA 2WCFA 3BUMB 4I5KA 1QX2A 4YBHB 2M0RA 2WC8A 1S1EA 3AKAA 3FWBA 1C7WA 1OOFA 3S0EA 1XFRA 3K1EA 2I2RE 1B7TY 3FE8A 3BUWB 3PJIA 2BECA 3VRNA 5KU1A 3IQQA 3BYAA 1IIOA 1H8BA 2KDHA 2LLTA 4Q04A 1XO5A 3S0FA 4HRGA 1WLZA 4OZDA 1SMGA 3VGOA 1GM0A 5I94A 1F4QA 3BFAA 1K2HA 3SS3A 2I18A 2LE9B 1MHOA 1OZSA 1XFWO 2KPHA 3AAKA 3S0BA 2AMIA 2KYFA 3LLEA 3BQ3A 1GGZA 1QLKA 1OOJA 2K0JA 1MQ1A 2LV7A 2QPTA 3A4UB 3DD4A 3SIBA 5JOLA 2LVIA 1SNLA 2HQ8A 1R2UA 2JRFA 2FOTA 2KFFA 1AJ5A 3C1VA 1TIZA 4ZCVA 5PALA 1TNWA 1LVCD 2LUCA 2L50A 1NCYA 3VB1A 3PATA 3K21A 1CM4A 4PE4A 4MEWA 1K93D 2BCAA 1DMOA 1G33A 4MSPA 2WCHA 1YUUA 2BL0B 2MJWB 4M2PA 3CR4X 1XYDA 4C0LA 3B88A 3I5HC 2OTGB 1DJXA 1L2OB 2K7BA 1V1GA 2WOSA 1KFUL 2HETA 4HSZA 1TCOB 2V53A 1UHJA 3S0AA 1CFPA 1S36A 2BKHB 3SG4A 1QV0A 4ORAB 1FI5A 1RK9A 3TUYC 1YUSA 1S6CA 1FPWA 1TNQA 5D7FA 3DY9A 1XFUO 1TTXA 3D73A 2FCEA 2GGZA 4P5OE 1CKKA 2AAOA
chains in the Genus database with same CATH topology
1R6PA 2JNXA 4WQ2A 4CFRA 4DUQA 4E68A 1MWNA 4AQJA 3FWCA 2LUXA 1DJIA 3KHEA 1FI6A 1SR6B 1S3PA 1CTRA 1OQPA 2M7NA 1WRZA 3VRQA 3I5FC 1YX8A 1DJYA 2F3ZA 2CCMA 4USLA 3CWGA 2JTZA 2OS8C 3LK1A 1BODA 1KFXS 2KI6C 2MAZA 3LK0A 2KQYA 3I5IC 3I5GB 1MF8B 1ZUZA 1CMGA 3BUOB 4MN0A 1GJYA 3SJSA 1B8CA 4NDCA 1CB1A 1BR1B 1Y1XA 2F8PA 2K7OA 4GGFC 1XFZO 1FF1A 1SCMB 2LVVA 1M46A 2KI4C 1V1FA 2KOTA 1D1OA 2KBIA 4WRIA 1UP5A 1NSHA 4YGCB 5AANA 3JVTB 5B8IB 4M2OA 5HKWA 1NPQA 1SL7A 2L4HA 5KTYA 3BUNB 3DVEA 2KAYA 4JPZB 1DJWA 1KK7Z 3VRPA 1HT9A 2ZRSA 1IG5A 4U8DA 2JULA 3O78A 4CLNA 1KQMB 2CNPA 1S6IA 2L51A 2KGRA 1S5GZ 1EG3A 2QACA 4XJKB 1BF5A 2K2FA 1JF0A 1IH0A 2H61A 1S6JA 2LLUA 1CLLA 2KBMA 3DF0A 5ER4X 3JTDB 3BOWA 5CPVA 2ZNEA 2NZ0A 3GK1A 4GNKB 3BUXB 2JC2A 5GQQC 4YGEB 4OCIA 1J7RA 4JQ0D 3PN7B 4MLWA 4N1FA 1IGVA 3D0YA 4QJ5B 4MRXA 1IKUA 2TN4A 4M2QA 4PHJA 2EGDA 1QATA 2WNDA 1QLSA 4NQGA 4ORBB 1KK8B 2MLFC 2M9GA 4DS7A 2L0PA 3PSRA 1UHIA 1KSOA 1XVJA 2L98A 2K61A 1MXEA 2BL0C 4MZLA 1MR8A 1CLBA 3WHUB 4BY4A 2M29A 4JWQA 2HQWA 4GFTA 4N1GA 3GK4X 2OTGC 1L2OC 1B47A 5I2QA 1WLMA 3E3RA 1A75A 1YX7A 3NSOA 1OZOA 2NLNA 2ZRTA 2BE6A 2E6WA 4I5LB 4A4CA 1X02A 3DF0B 3O4YA 1DF0B 1YVHA 1B7TZ 1LINA 1PULA 2Q91A 3KEVA 3A8RA 5AXIA 1C07A 2BBNA 2PRUA 3DVJA 3PM8A 2JPTA 2KSPA 3TZ1A 4DCKA 4MRYA 5CSIA 4PDZA 3D0YB 3NSLA 3ZWHA 1K94A 5TNCA 2CXJA 1CFFA 1DJHA 1CM1A 1F55A 1MXLC 4YGBB 2Q4UA 2SASA 5ER5A 3IQOA 1SL9A 1W7JB 4ICBA 4N5XA 1SR6C 2WCBA 4GPLB 1OMVA 1JBAA 1M45A 2WCEA 1SKTA 2F33A 1WDCB 1SRAA 4NDBA 2E30A 2MLEC 1SYMA 4C0KA 2JT8A 1JC2A 2R2IA 5DKNA 1JSAA 5G08A 1XA5A 4ZCUA 4CPVA 3I5GC 1M31A 2JXLA 4UPGA 1AHRA 1BOCA 4QJ3B 1A03A 1DJZA 1UUSA 2I7AA 3FIAA 3KF9A 1SCMC 4GUKA 1KCYA 2M97A 3NSKA 3OX5A 1Y1AA 2K7DA 2PMYA 1Q80A 5DKRA 1B4CA 2BCBA 2NCPA 1XFXO 2ZKMX 2K8MB 4YRUA 1SW8A 3JVTC 2M49B 2B1UA 1BMOA 2CTNA 3FS7A 1NX2A 1K9KA 1TN4A 2GGMA 1CDLA 1F8HA 1WY9A 1QJTA 2JQ6A 2VRGA 3GK2A 2CT9A 1NCXA 2M7LA 3ICBA 1PSBA 1OMDA 1KQMC 3RM1A 2D8NA 1EH2A 1SK6D 1J7QA 1M39A 1QVIY 1UHNA 4MZJA 2MRDA 1DGVA 4OR9B 3JTDC 4PHNA 1IQ3A 3CGAA 1ZMZA 4NDDA 5I8NA 2JT0A 1TRFA 3D10A 4WQ3A 1SCVA 1CFCA 3PN7C 2L4IA 1YRTB 4GAOA 5IBWA 1MUXA 1AUIB 1BG1A 2Y4QA 1KK8C 5HLVA 1J1DA 5CSJA 3NXAA 2WORA 4OV2A 3WHTB 1AP4A 1DVIA 1KFXL 1IJ6A 4YGAA 1EG4A 3EVUA 1RROA 1Y6WA 1ZFSA 2JZIA 5AEQA 2PVBA 2RGIA 3CZTX 1PVAA 1BR4B 3SG3A 1XK4C 1BU3A 5CSFA 2M1UA 5HLOA 1JUOA 2LVJA 4YGDB 4A4BA 2COLB 1UHHA 1U5IA 1CNPA 2H61C 3GOFA 1PALA 1CFDA 3IF7A 4GBAA 4PCWA 4DIRA 1LXFC 1YURA 3M0WA 1RWYA 2FCDA 1IWQA 1K9PA 2M3WA 2P6BB 4PALA 5DKQA 2SCPA 1PSRA 5FYXA 4R1EA 1A4PA 3OP0A 4PE7A 3H4SE 4C0JA 2LM5A 2F2PA 3WNXB 2KFGA 3TDZA 1DGUA 2I94A 2LCPA 4AOMA 4FTGA 2KGBC 2L2EA 2BKIB 3O6BA 4ETOA 1DT7B 1C7VA 1OSAA 3CS1A 1B1GA 3SG6A 2F3YA 1TOPA 2A4JA 1QV1A 2Y5IA 1WDCC 3OX6A 2ZNDA 1KQVA 4YI8A 1TCFA 1A2XA 1QX7A 5AFPA 2PSRA 1NWDA 4F0ZB 2LP2A 1QS7A 1W7IB 1H4BA 2MHHA 3AKBA 4MZKA 1FW4A 3PLFB 2JOJA 3PFVA 1UURA 1IQ5A 2GV5A 2JWWA 3QRXA 5HKZA 1QXPA 3BOWB 1B8LA 4BY5A 1PRWA 1SY9A 1CDNA 2BCXA 1CMFA 1KSMA 1F54A 2JNFA 1UWOA 1RJVA 2BBMA 2O5GA 4HREE 2MA2A 1YRUB 1SBJA 1J7OA 1KWOB 4AQIA 3ZNIA 2LVKA 2LC5A 2M1KB 4PE1A 1YTZC 1AK8A 3KPXA 1ALVA 4FQOA 2KQ6A 3OB2B 5BPJA 2EC6B 3NSIA 2KAVA 2L5XB 3PALA 1RECA 1N65A 1N0YA 3OHMB 3CR2A 1HQVA 5KSZA 1BJFA 1RTP1 2F2OA 4I5NB 4MBEA 2PASA 1EL4A 1YR5A 3EKJA 4D1EA 1B8RA 5D69A 1S26D 5AERA 1OMRA 1QASA 3DVMA 1G8IA 1Y0VH 2LAPA 1A75B 1KFUS 3TDUA 2LP3A 3TS5B 1AJ4A 2MBXA 2KNEA 5I2OA 2O60A 1F70A 1IRJA 2OPOA 1ODBA 3HX4A 2G2BA 1K8UA 2JT3A 2IS9A 1XFYO 2Y1NA 1J7PA 1L7ZA 2ISDA 3CTNA 1RFJA 2Y1MA 1VRKA 1YUTA 2JU0A 1AVSA 1CLMA 2KHNA 5HYDA 1GQMA 2LMUA 4I5JA 4OVNF 2ZN9A 3SIAA 3EK8A 5K89A 1J1EA 1QTXA 1EXRA 1K95A 2NCOA 1B9AA 4L9MA 1JWDA 3CR5X 1LA0A 5J3XA 4IL1A 2FJUB 5HKYA 1EJ3A 1K96A 3DVKA 1UHKA 2LANA 4HRHA 1BT6A 4CIDA 1N2DA 1QX5B 2KAXA 1NX3A 3BXKA 4PHMA 3EK4A 1PK0D 2KYCA 3OB1B 2LLSA 1XFVO 3WXAA 2JXCA 1LA3A 4YI9A 1G4YR 1CDMA 4PE0A 2G9BA 4QJ4B 1NIWA 1TNPA 1FBVA 2HPSA 3SG5A 1ZOTB 3EK7A 2PALA 1QVIZ 2ZN8A 1M63B 3I5HB 2JTTA 4XJKA 1JFKA 1IJ5A 4GGNA 3MSEB 1ZACA 3O2PA 1F4OA 1TNXA 3TDIA 1NCZA 2LMTA 3RLZA 3AAJA 2CBLA 1NX0A 1LKJA 4ORCB 4XYNA 1KK7Y 2ZFDA 3VRRA 1GGWA 3TUYB 4GGFA 2KI6D 1K90D 1OE9B 2BE4A 3KO0A 3F45A 1S5GY 4MVFA 1E8AA 1JFJA 2HF5A 2K2AA 1NX1A 1SL8A 3EVVA 3LCPC 3SG7A 1DTLA 1ALWA 3HCMA 3EKHA 4PHKA 1F71A 1QIVA 1CDPA 2LHLA 2LHIA 2LMVA 1SPYA 1KWOC 1NUBA 1NP8A 2KFHA 3I5FB 5CSNA 3CLNA 1XK4A 3EVRA 3SG2A 1Y1UA 2K7CA 2NXQA 5I2LA 2EHBA 2OS8B 2M8UA 1WRLA 2EC6C 3LL8B 4P2YB 2DOQA 4DRWA 3I5IB 3VROA 1WRKA 4TNCA 1DF0A 1QIWA 1J55A 1A29A 1NYAA 5F6TA 2H2KA 1JF2A 5JJGA 1PVBA 1BLQA 1YVLA 3TS5C 4OKHA 1DJGA 1K9UA 4CFQA 1U5IB 2KI4B 2AUCA 2LNKA 2WCFA 3BUMB 4I5KA 1QX2A 4YBHB 2M0RA 2WC8A 1S1EA 3AKAA 3FWBA 1C7WA 2I2RE 1B7TY 3BUWB 5KU1A 2BECA 3VRNA 3IQQA 3BYAA 1H8BA 2KDHA 2LLTA 4Q04A 1XO5A 4HRGA 1WLZA 3VGOA 1SMGA 1F4QA 1K2HA 2I18A 2LE9B 1MHOA 1OZSA 1XFWO 3AAKA 2AMIA 2KYFA 3LLEA 3BQ3A 1GGZA 1QLKA 1OOJA 2K0JA 1MQ1A 2LV7A 2QPTA 3A4UB 3DD4A 3SIBA 5JOLA 2LVIA 1SNLA 2HQ8A 1R2UA 2JRFA 2FOTA 2KFFA 1AJ5A 3C1VA 1TIZA 4ZCVA 5PALA 1TNWA 1LVCD 2LUCA 2L50A 1NCYA 3PATA 3K21A 1CM4A 4PE4A 4MEWA 1K93D 2BCAA 1DMOA 1G33A 4MSPA 1YUUA 2BL0B 2MJWB 4M2PA 3CR4X 1XYDA 4C0LA 3I5HC 2OTGB 1DJXA 1L2OB 2K7BA 1V1GA 2WOSA 1KFUL 2HETA 4HSZA 1TCOB 2V53A 1UHJA 1CFPA 1S36A 2BKHB 3SG4A 1QV0A 4ORAB 1FI5A 1RK9A 3TUYC 1YUSA 1S6CA 1FPWA 1TNQA 5D7FA 1XFUO 1TTXA 1CKKA 2FCEA 2GGZA 4P5OE 2AAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R6P A;  2JNX A;  4WQ2 A;  4CFR A;  4DUQ A;  4E68 A;  1MWN A;  4AQJ A;  3FWC A;  2LUX A;  1DJI A;  3KHE A;  1FI6 A;  1SR6 B;  1S3P A;  1CTR A;  1OQP A;  2M7N A;  1WRZ A;  3VRQ A;  3I5F C;  1YX8 A;  1DJY A;  2F3Z A;  2CCM A;  4USL A;  3CWG A;  2JTZ A;  2OS8 C;  3LK1 A;  1BOD A;  1KFX S;  2KI6 C;  2MAZ A;  3LK0 A;  2KQY A;  3I5I C;  3I5G B;  1MF8 B;  1ZUZ A;  1CMG A;  3BUO B;  4MN0 A;  1GJY A;  3SJS A;  1B8C A;  4NDC A;  1CB1 A;  1BR1 B;  1Y1X A;  2F8P A;  2K7O A;  4GGF C;  1XFZ O;  1FF1 A;  1SCM B;  2LVV A;  1M46 A;  2KI4 C;  1V1F A;  2KOT A;  1D1O A;  2KBI A;  4WRI A;  1UP5 A;  1NSH A;  4YGC B;  5AAN A;  3JVT B;  5B8I B;  4M2O A;  5HKW A;  1NPQ A;  1SL7 A;  2L4H A;  5KTY A;  3BUN B;  3DVE A;  2KAY A;  4JPZ B;  1DJW A;  1KK7 Z;  3VRP A;  1HT9 A;  2ZRS A;  1IG5 A;  4U8D A;  2JUL A;  3O78 A;  4CLN A;  1KQM B;  2CNP A;  1S6I A;  2L51 A;  2KGR A;  1S5G Z;  1EG3 A;  2QAC A;  4XJK B;  1BF5 A;  2K2F A;  1JF0 A;  1IH0 A;  2H61 A;  1S6J A;  2LLU A;  1CLL A;  2KBM A;  3DF0 A;  5ER4 X;  3JTD B;  3BOW A;  5CPV A;  2ZNE A;  2NZ0 A;  3GK1 A;  4GNK B;  3BUX B;  2JC2 A;  5GQQ C;  4YGE B;  4OCI A;  1J7R A;  4JQ0 D;  3PN7 B;  4MLW A;  4N1F A;  1IGV A;  3D0Y A;  4QJ5 B;  4MRX A;  1IKU A;  2TN4 A;  4M2Q A;  4PHJ A;  2EGD A;  1QAT A;  2WND A;  1QLS A;  4NQG A;  4ORB B;  1KK8 B;  2MLF C;  2M9G A;  4DS7 A;  2L0P A;  3PSR A;  1UHI A;  1KSO A;  1XVJ A;  2L98 A;  2K61 A;  1MXE A;  2BL0 C;  4MZL A;  1MR8 A;  1CLB A;  3WHU B;  4BY4 A;  2M29 A;  4JWQ A;  2HQW A;  4GFT A;  4N1G A;  3GK4 X;  2OTG C;  1L2O C;  1B47 A;  5I2Q A;  1WLM A;  3E3R A;  1A75 A;  1YX7 A;  3NSO A;  1OZO A;  2NLN A;  2ZRT A;  2BE6 A;  2E6W A;  4I5L B;  4A4C A;  1X02 A;  3DF0 B;  3O4Y A;  1DF0 B;  1YVH A;  1B7T Z;  1LIN A;  1PUL A;  2Q91 A;  3KEV A;  3A8R A;  5AXI A;  1C07 A;  2BBN A;  2PRU A;  3DVJ A;  3PM8 A;  2JPT A;  2KSP A;  3TZ1 A;  4DCK A;  4MRY A;  5CSI A;  4PDZ A;  3D0Y B;  3NSL A;  3ZWH A;  1K94 A;  5TNC A;  2CXJ A;  1CFF A;  1DJH A;  1CM1 A;  1F55 A;  1MXL C;  4YGB B;  2Q4U A;  2SAS A;  5ER5 A;  3IQO A;  1SL9 A;  1W7J B;  4ICB A;  4N5X A;  1SR6 C;  2WCB A;  4GPL B;  1OMV A;  1JBA A;  1M45 A;  2WCE A;  1SKT A;  2F33 A;  1WDC B;  1SRA A;  4NDB A;  2E30 A;  2MLE C;  1SYM A;  4C0K A;  2JT8 A;  1JC2 A;  2R2I A;  5DKN A;  1JSA A;  5G08 A;  1XA5 A;  4ZCU A;  4CPV A;  3I5G C;  1M31 A;  2JXL A;  4UPG A;  1AHR A;  1BOC A;  4QJ3 B;  1A03 A;  1DJZ A;  1UUS A;  2I7A A;  3FIA A;  3KF9 A;  1SCM C;  4GUK A;  1KCY A;  2M97 A;  3NSK A;  3OX5 A;  1Y1A A;  2K7D A;  2PMY A;  1Q80 A;  5DKR A;  1B4C A;  2BCB A;  2NCP A;  1XFX O;  2ZKM X;  2K8M B;  4YRU A;  1SW8 A;  3JVT C;  2M49 B;  2B1U A;  1BMO A;  2CTN A;  3FS7 A;  1NX2 A;  1K9K A;  1TN4 A;  2GGM A;  1CDL A;  1F8H A;  1WY9 A;  1QJT A;  2JQ6 A;  2VRG A;  3GK2 A;  2CT9 A;  1NCX A;  2M7L A;  3ICB A;  1PSB A;  1OMD A;  1KQM C;  3RM1 A;  2D8N A;  1EH2 A;  1SK6 D;  1J7Q A;  1M39 A;  1QVI Y;  1UHN A;  4MZJ A;  2MRD A;  1DGV A;  4OR9 B;  3JTD C;  4PHN A;  1IQ3 A;  3CGA A;  1ZMZ A;  4NDD A;  5I8N A;  2JT0 A;  1TRF A;  3D10 A;  4WQ3 A;  1SCV A;  1CFC A;  3PN7 C;  2L4I A;  1YRT B;  4GAO A;  5IBW A;  1MUX A;  1AUI B;  1BG1 A;  2Y4Q A;  1KK8 C;  5HLV A;  1J1D A;  5CSJ A;  3NXA A;  2WOR A;  4OV2 A;  3WHT B;  1AP4 A;  1DVI A;  1KFX L;  1IJ6 A;  4YGA A;  1EG4 A;  3EVU A;  1RRO A;  1Y6W A;  1ZFS A;  2JZI A;  5AEQ A;  2PVB A;  2RGI A;  3CZT X;  1PVA A;  1BR4 B;  3SG3 A;  1XK4 C;  1BU3 A;  5CSF A;  2M1U A;  5HLO A;  1JUO A;  2LVJ A;  4YGD B;  4A4B A;  2COL B;  1UHH A;  1U5I A;  1CNP A;  2H61 C;  3GOF A;  1PAL A;  1CFD A;  3IF7 A;  4GBA A;  4PCW A;  4DIR A;  1LXF C;  1YUR A;  3M0W A;  1RWY A;  2FCD A;  1IWQ A;  1K9P A;  2M3W A;  2P6B B;  4PAL A;  5DKQ A;  2SCP A;  1PSR A;  5FYX A;  4R1E A;  1A4P A;  3OP0 A;  4PE7 A;  3H4S E;  4C0J A;  2LM5 A;  2F2P A;  3WNX B;  2KFG A;  3TDZ A;  1DGU A;  2I94 A;  2LCP A;  4AOM A;  4FTG A;  2KGB C;  2L2E A;  2BKI B;  3O6B A;  4ETO A;  1DT7 B;  1C7V A;  1OSA A;  3CS1 A;  1B1G A;  3SG6 A;  2F3Y A;  1TOP A;  2A4J A;  1QV1 A;  2Y5I A;  1WDC C;  3OX6 A;  2ZND A;  1KQV A;  4YI8 A;  1TCF A;  1A2X A;  1QX7 A;  5AFP A;  2PSR A;  1NWD A;  4F0Z B;  2LP2 A;  1QS7 A;  1W7I B;  1H4B A;  2MHH A;  3AKB A;  4MZK A;  1FW4 A;  3PLF B;  2JOJ A;  3PFV A;  1UUR A;  1IQ5 A;  2GV5 A;  2JWW A;  3QRX A;  5HKZ A;  1QXP A;  3BOW B;  1B8L A;  4BY5 A;  1PRW A;  1SY9 A;  1CDN A;  2BCX A;  1CMF A;  1KSM A;  1F54 A;  2JNF A;  1UWO A;  1RJV A;  2BBM A;  2O5G A;  4HRE E;  2MA2 A;  1YRU B;  1SBJ A;  1J7O A;  1KWO B;  4AQI A;  3ZNI A;  2LVK A;  2LC5 A;  2M1K B;  4PE1 A;  1YTZ C;  1AK8 A;  3KPX A;  1ALV A;  4FQO A;  2KQ6 A;  3OB2 B;  5BPJ A;  2EC6 B;  3NSI A;  2KAV A;  2L5X B;  3PAL A;  1REC A;  1N65 A;  1N0Y A;  3OHM B;  3CR2 A;  1HQV A;  5KSZ A;  1BJF A;  1RTP 1;  2F2O A;  4I5N B;  4MBE A;  2PAS A;  1EL4 A;  1YR5 A;  3EKJ A;  4D1E A;  1B8R A;  5D69 A;  1S26 D;  5AER A;  1OMR A;  1QAS A;  3DVM A;  1G8I A;  1Y0V H;  2LAP A;  1A75 B;  1KFU S;  3TDU A;  2LP3 A;  3TS5 B;  1AJ4 A;  2MBX A;  2KNE A;  5I2O A;  2O60 A;  1F70 A;  1IRJ A;  2OPO A;  1ODB A;  3HX4 A;  2G2B A;  1K8U A;  2JT3 A;  2IS9 A;  1XFY O;  2Y1N A;  1J7P A;  1L7Z A;  2ISD A;  3CTN A;  1RFJ A;  2Y1M A;  1VRK A;  1YUT A;  2JU0 A;  1AVS A;  1CLM A;  2KHN A;  5HYD A;  1GQM A;  2LMU A;  4I5J A;  4OVN F;  2ZN9 A;  3SIA A;  3EK8 A;  5K89 A;  1J1E A;  1QTX A;  1EXR A;  1K95 A;  2NCO A;  1B9A A;  4L9M A;  1JWD A;  3CR5 X;  1LA0 A;  5J3X A;  4IL1 A;  2FJU B;  5HKY A;  1EJ3 A;  1K96 A;  3DVK A;  1UHK A;  2LAN A;  4HRH A;  1BT6 A;  4CID A;  1N2D A;  1QX5 B;  2KAX A;  1NX3 A;  3BXK A;  4PHM A;  3EK4 A;  1PK0 D;  2KYC A;  3OB1 B;  2LLS A;  1XFV O;  3WXA A;  2JXC A;  1LA3 A;  4YI9 A;  1G4Y R;  1CDM A;  4PE0 A;  2G9B A;  4QJ4 B;  1NIW A;  1TNP A;  1FBV A;  2HPS A;  3SG5 A;  1ZOT B;  3EK7 A;  2PAL A;  1QVI Z;  2ZN8 A;  1M63 B;  3I5H B;  2JTT A;  4XJK A;  1JFK A;  1IJ5 A;  4GGN A;  3MSE B;  1ZAC A;  3O2P A;  1F4O A;  1TNX A;  3TDI A;  1NCZ A;  2LMT A;  3RLZ A;  3AAJ A;  2CBL A;  1NX0 A;  1LKJ A;  4ORC B;  4XYN A;  1KK7 Y;  2ZFD A;  3VRR A;  1GGW A;  3TUY B;  4GGF A;  2KI6 D;  1K90 D;  1OE9 B;  2BE4 A;  3KO0 A;  3F45 A;  1S5G Y;  4MVF A;  1E8A A;  1JFJ A;  2HF5 A;  2K2A A;  1NX1 A;  1SL8 A;  3EVV A;  3LCP C;  3SG7 A;  1DTL A;  1ALW A;  3HCM A;  3EKH A;  4PHK A;  1F71 A;  1QIV A;  1CDP A;  2LHL A;  2LHI A;  2LMV A;  1SPY A;  1KWO C;  1NUB A;  1NP8 A;  2KFH A;  3I5F B;  5CSN A;  3CLN A;  1XK4 A;  3EVR A;  3SG2 A;  1Y1U A;  2K7C A;  2NXQ A;  5I2L A;  2EHB A;  2OS8 B;  2M8U A;  1WRL A;  2EC6 C;  3LL8 B;  4P2Y B;  2DOQ A;  4DRW A;  3I5I B;  3VRO A;  1WRK A;  4TNC A;  1DF0 A;  1QIW A;  1J55 A;  1A29 A;  1NYA A;  5F6T A;  2H2K A;  1JF2 A;  5JJG A;  1PVB A;  1BLQ A;  1YVL A;  3TS5 C;  4OKH A;  1DJG A;  1K9U A;  4CFQ A;  1U5I B;  2KI4 B;  2AUC A;  2LNK A;  2WCF A;  3BUM B;  4I5K A;  1QX2 A;  4YBH B;  2M0R A;  2WC8 A;  1S1E A;  3AKA A;  3FWB A;  1C7W A;  2I2R E;  1B7T Y;  3BUW B;  5KU1 A;  2BEC A;  3VRN A;  3IQQ A;  3BYA A;  1H8B A;  2KDH A;  2LLT A;  4Q04 A;  1XO5 A;  4HRG A;  1WLZ A;  3VGO A;  1SMG A;  1F4Q A;  1K2H A;  2I18 A;  2LE9 B;  1MHO A;  1OZS A;  1XFW O;  3AAK A;  2AMI A;  2KYF A;  3LLE A;  3BQ3 A;  1GGZ A;  1QLK A;  1OOJ A;  2K0J A;  1MQ1 A;  2LV7 A;  2QPT A;  3A4U B;  3DD4 A;  3SIB A;  5JOL A;  2LVI A;  1SNL A;  2HQ8 A;  1R2U A;  2JRF A;  2FOT A;  2KFF A;  1AJ5 A;  3C1V A;  1TIZ A;  4ZCV A;  5PAL A;  1TNW A;  1LVC D;  2LUC A;  2L50 A;  1NCY A;  3PAT A;  3K21 A;  1CM4 A;  4PE4 A;  4MEW A;  1K93 D;  2BCA A;  1DMO A;  1G33 A;  4MSP A;  1YUU A;  2BL0 B;  2MJW B;  4M2P A;  3CR4 X;  1XYD A;  4C0L A;  3I5H C;  2OTG B;  1DJX A;  1L2O B;  2K7B A;  1V1G A;  2WOS A;  1KFU L;  2HET A;  4HSZ A;  1TCO B;  2V53 A;  1UHJ A;  1CFP A;  1S36 A;  2BKH B;  3SG4 A;  1QV0 A;  4ORA B;  1FI5 A;  1RK9 A;  3TUY C;  1YUS A;  1S6C A;  1FPW A;  1TNQ A;  5D7F A;  1XFU O;  1TTX A;  1CKK A;  2FCE A;  2GGZ A;  4P5O E;  2AAO A; 
#chains in the Genus database with same CATH topology
 1R6P A;  2JNX A;  2KLE A;  4WQ2 A;  4CFR A;  4DUQ A;  4E68 A;  1MWN A;  4AQJ A;  3FWC A;  2LUX A;  1DJI A;  1OOI X;  3KHE A;  1FI6 A;  1SR6 B;  1S3P A;  1CTR A;  1OQP A;  2M7N A;  1WRZ A;  3VRQ A;  3I5F C;  1YX8 A;  1DJY A;  2F3Z A;  2CCM A;  1C3Z A;  4USL A;  3CWG A;  3NHI A;  2JTZ A;  2OS8 C;  1C3Y A;  3LK1 A;  2WCL A;  1BOD A;  1KFX S;  2KI6 C;  2MAZ A;  3LK0 A;  2KQY A;  3I5I C;  3I5G B;  1MF8 B;  1ZUZ A;  1CMG A;  3BUO B;  4MN0 A;  1GJY A;  1Z2C B;  2WC6 A;  3SJS A;  1B8C A;  4NDC A;  1CB1 A;  1BR1 B;  1Y1X A;  3FE6 A;  2F8P A;  2K7O A;  4GGF C;  1XFZ O;  1FF1 A;  1SCM B;  3BJH A;  2LVV A;  1M46 A;  2KI4 C;  1V1F A;  2KOT A;  1D1O A;  2KBI A;  4WRI A;  1UP5 A;  1NSH A;  4YGC B;  5AAN A;  3JVT B;  5B8I B;  4M2O A;  5HKW A;  1NPQ A;  1SL7 A;  2L4H A;  5KTY A;  3BUN B;  3DVE A;  2KAY A;  4JPZ B;  1TUJ A;  4KYN A;  1DJW A;  1KK7 Z;  3VRP A;  1HT9 A;  2ZRS A;  1IG5 A;  4U8D A;  2JUL A;  3O78 A;  1Z4H A;  1KQM B;  2CNP A;  4CLN A;  3B87 A;  1S6I A;  2L51 A;  2KGR A;  1S5G Z;  1EG3 A;  2QAC A;  4XJK B;  1BF5 A;  2K2F A;  1JF0 A;  1IH0 A;  2H61 A;  1S6J A;  2LLU A;  3L4A A;  3OBV A;  1CLL A;  2KBM A;  3DF0 A;  3CAB A;  5ER4 X;  3JTD B;  3BOW A;  5CPV A;  2ZNE A;  5EL2 A;  2NZ0 A;  1OOH A;  3GK1 A;  4GNK B;  5DIC A;  3BUX B;  2JC2 A;  5GQQ C;  4YGE B;  4OCI A;  1J7R A;  4JQ0 D;  3PN7 B;  4MLW A;  4N1F A;  1IGV A;  3D0Y A;  4QJ5 B;  4MRX A;  1IKU A;  2TN4 A;  4M2Q A;  4PHJ A;  2EGD A;  3NHT A;  1QAT A;  2WND A;  1QLS A;  4NQG A;  4ORB B;  1KK8 B;  2MLF C;  2M9G A;  4DS7 A;  2L0P A;  3PSR A;  1UHI A;  1KSO A;  1XVJ A;  2L98 A;  2K61 A;  1MXE A;  2BL0 C;  4MZL A;  1MR8 A;  1CLB A;  3WHU B;  4BY4 A;  2M29 A;  4JWQ A;  2HQW A;  4GFT A;  4N1G A;  3L4L A;  3GK4 X;  2OTG C;  1L2O C;  1B47 A;  5I2Q A;  1WLM A;  3E3R A;  3OGN A;  1LS8 A;  1A75 A;  1YX7 A;  3NSO A;  1OZO A;  2GTE A;  2NLN A;  2ZRT A;  2BE6 A;  2E6W A;  4I5L B;  4A4C A;  1X02 A;  3DF0 B;  2P70 A;  3O4Y A;  1DF0 B;  1YVH A;  1B7T Z;  1LIN A;  1PUL A;  2Q91 A;  3KEV A;  3A8R A;  5AXI A;  1C07 A;  2BBN A;  2PRU A;  3DVJ A;  3PM8 A;  2JPT A;  3B86 A;  2KSP A;  3TZ1 A;  4DCK A;  4MRY A;  5CSI A;  4PDZ A;  3D0Y B;  3BFH A;  3NSL A;  3ZWH A;  1K94 A;  5TNC A;  2CXJ A;  1CFF A;  1DJH A;  1CM1 A;  1F55 A;  1MXL C;  3N7H A;  4YGB B;  2Q4U A;  2SAS A;  5ER5 A;  3FE9 A;  1SL9 A;  1W7J B;  3IQO A;  4ICB A;  4N5X A;  1SR6 C;  2WCB A;  4GPL B;  3SS4 A;  1OMV A;  1JBA A;  1M45 A;  2WCE A;  1SKT A;  1OOG A;  2F33 A;  1WDC B;  1SRA A;  4NDB A;  2E30 A;  2MLE C;  1SYM A;  4C0K A;  2JT8 A;  1JC2 A;  2ERB A;  2H8V A;  2R2I A;  5DKN A;  2PQL A;  1JSA A;  5G08 A;  1XA5 A;  4ZCU A;  4JD9 A;  4CPV A;  3I5G C;  1M31 A;  2JXL A;  4UPG A;  3CZ2 A;  1W9Z A;  1AHR A;  3R72 A;  1BOC A;  4QJ3 B;  1A03 A;  1DJZ A;  1UUS A;  2I7A A;  3FIA A;  3KF9 A;  1SCM C;  4GUK A;  1KCY A;  2M97 A;  3NSK A;  3OX5 A;  1Y1A A;  2K7D A;  2PMY A;  1Q80 A;  5DKR A;  1B4C A;  3S0D A;  2BCB A;  2NCP A;  1XFX O;  2ZKM X;  1TWO A;  2K8M B;  4YRU A;  1SW8 A;  3JVT C;  2M49 B;  2B1U A;  1BMO A;  2YGU A;  2CTN A;  2PYQ A;  3FS7 A;  1NX2 A;  1K9K A;  1TN4 A;  2GGM A;  1CDL A;  1F8H A;  1WY9 A;  1QJT A;  2JQ6 A;  2VRG A;  3GK2 A;  2CT9 A;  2WCK A;  1NCX A;  2M7L A;  3D74 A;  3ICB A;  1PSB A;  1OMD A;  1KQM C;  3D78 A;  3RM1 A;  1OW4 A;  2D8N A;  1EH2 A;  1SK6 D;  1J7Q A;  1M39 A;  1QVI Y;  1UHN A;  4MZJ A;  2MRD A;  1DGV A;  4OR9 B;  3JTD C;  4PHN A;  1IQ3 A;  1DC1 A;  3CGA A;  1ZMZ A;  4NDD A;  5I8N A;  2JT0 A;  1TRF A;  3D10 A;  3D77 A;  1TUZ A;  4WQ3 A;  2QEB A;  1SCV A;  1CFC A;  3PN7 C;  2L4I A;  1YRT B;  4GAO A;  5IBW A;  1MUX A;  1AUI B;  1BG1 A;  1P28 A;  2Y4Q A;  1KK8 C;  5HLV A;  1J1D A;  5CSJ A;  3NXA A;  2WOR A;  3QME A;  4OV2 A;  3WHT B;  3L47 A;  1DVI A;  1KFX L;  1IJ6 A;  1AP4 A;  4YGA A;  1EG4 A;  3EVU A;  1RRO A;  1Y6W A;  1ZFS A;  2JZI A;  5AEQ A;  2PVB A;  2RGI A;  3CZT X;  1PVA A;  1BR4 B;  3SG3 A;  1XK4 C;  1BU3 A;  5CSF A;  2M1U A;  5HLO A;  1JUO A;  2LVJ A;  4YGD B;  4A4B A;  3R1O A;  2COL B;  1DQE A;  1UHH A;  1U5I A;  1CNP A;  2H61 C;  3GOF A;  1PAL A;  1CFD A;  3IF7 A;  4GBA A;  4PCW A;  4DIR A;  1LXF C;  1YUR A;  3M0W A;  1RWY A;  1DEK A;  1IWQ A;  2FCD A;  1K9P A;  2M3W A;  2P6B B;  4FQT A;  4PAL A;  5DKQ A;  2SCP A;  1PSR A;  5FYX A;  1SSE B;  4R1E A;  1A4P A;  3OP0 A;  4PE7 A;  3H4S E;  3Q8I A;  4C0J A;  2LM5 A;  2F2P A;  3WNX B;  2KFG A;  3TDZ A;  1DGU A;  2I94 A;  2LCP A;  4AOM A;  4FTG A;  2KGB C;  2L2E A;  2BKI B;  3DZT A;  3O6B A;  4ETO A;  1DT7 B;  1C7V A;  1OSA A;  3CS1 A;  2BAP A;  1B1G A;  3CYZ A;  3SG6 A;  2F3Y A;  1TOP A;  2A4J A;  1QV1 A;  2Y5I A;  3CDN A;  1WDC C;  3OX6 A;  2ZND A;  3DXL A;  1KQV A;  4YI8 A;  1TCF A;  1A2X A;  1QX7 A;  2QEO A;  5AFP A;  2PSR A;  1NWD A;  4F0Z B;  2LP2 A;  1QS7 A;  1W7I B;  1H4B A;  2JPO A;  2MHH A;  3AKB A;  4MZK A;  1FW4 A;  3PLF B;  2JOJ A;  3PFV A;  1UUR A;  1IQ5 A;  2GV5 A;  2JWW A;  3QRX A;  5HKZ A;  1QXP A;  3BOW B;  1B8L A;  4BY5 A;  1PRW A;  1SY9 A;  4INW A;  4PT1 A;  1CDN A;  2BCX A;  1CMF A;  1KSM A;  1F54 A;  2JNF A;  1UWO A;  1RJV A;  2BBM A;  2O5G A;  4HRE E;  2MA2 A;  1YRU B;  3V2L A;  1SBJ A;  3RZS A;  1J7O A;  1KWO B;  4AQI A;  3ZNI A;  1DEL A;  2LC5 A;  2LVK A;  2M1K B;  1YTZ C;  4PE1 A;  2BNX A;  1AK8 A;  3KPX A;  1ALV A;  4FQO A;  2KQ6 A;  3OB2 B;  5BPJ A;  2EC6 B;  3NSI A;  2KAV A;  2L5X B;  3B6X A;  3PAL A;  1REC A;  1N65 A;  1N0Y A;  3OHM B;  3CR2 A;  1HQV A;  5KSZ A;  1BJF A;  2QEV A;  1RTP 1;  2F2O A;  4I5N B;  4F7F A;  4MBE A;  2PAS A;  1EL4 A;  1YR5 A;  3EKJ A;  4D1E A;  1B8R A;  5D69 A;  1S26 D;  5AER A;  1OMR A;  1QAS A;  2P71 A;  3DVM A;  1G8I A;  1Y0V H;  2LAP A;  1A75 B;  1KFU S;  3S0G A;  2LP3 A;  3TDU A;  1AJ4 A;  2MBX A;  2KNE A;  3TS5 B;  2O60 A;  5I2O A;  1IRJ A;  2OPO A;  1F70 A;  5FI2 A;  1ODB A;  3HX4 A;  2G2B A;  1K8U A;  2JT3 A;  3D75 A;  2IS9 A;  2FJY A;  1XFY O;  2Y1N A;  2WCM A;  1J7P A;  1L7Z A;  5D3O A;  2QEH A;  2ISD A;  5FI6 A;  3CTN A;  1RFJ A;  2Y1M A;  1VRK A;  1YUT A;  2JU0 A;  1AVS A;  1CLM A;  2KHN A;  3PM2 A;  5HYD A;  1GQM A;  3UO9 A;  2LMU A;  4I5J A;  4OVN F;  2ZN9 A;  3SIA A;  3EK8 A;  5K89 A;  1J1E A;  1QTX A;  1EXR A;  1K95 A;  2NCO A;  1B9A A;  4L9M A;  1JWD A;  3CR5 X;  2KLD A;  1LA0 A;  5J3X A;  4IL1 A;  2FJU B;  5HKY A;  1EJ3 A;  1K96 A;  3DVK A;  4INX A;  3NGV A;  1UHK A;  2LAN A;  3B7A A;  4HRH A;  1BT6 A;  4CID A;  1N2D A;  1QX5 B;  2KAX A;  1NX3 A;  3BXK A;  4PHM A;  3EK4 A;  1PK0 D;  1T14 A;  2KYC A;  3OB1 B;  2LLS A;  1XFV O;  3WXA A;  2JXC A;  3EG5 B;  3D76 A;  1LA3 A;  4YI9 A;  1G4Y R;  1CDM A;  4PE0 A;  2G9B A;  4QJ4 B;  1NIW A;  1TNP A;  1FBV A;  2HPS A;  3SG5 A;  1ZOT B;  3EK7 A;  2PAL A;  1QVI Z;  2ZN8 A;  1M63 B;  3I5H B;  2JTT A;  4XJK A;  1JFK A;  1IJ5 A;  4GGN A;  3MSE B;  1QWV A;  1ZAC A;  1F4O A;  1TNX A;  3O2P A;  4JKT A;  3TDI A;  1NCZ A;  2LMT A;  3RLZ A;  3AAJ A;  2CBL A;  1NX0 A;  1LKJ A;  4ORC B;  4XYN A;  1KK7 Y;  2ZFD A;  3VRR A;  1GGW A;  2WCJ A;  3TUY B;  4GGF A;  3CZ1 A;  2KI6 D;  1K90 D;  2L5Y A;  1OE9 B;  2BE4 A;  3KO0 A;  3F45 A;  3UNW A;  1S5G Y;  4MVF A;  1E8A A;  3DYE A;  2HF5 A;  2K2A A;  1JFJ A;  1NX1 A;  1SL8 A;  3O4X A;  3EVV A;  3LCP C;  3SG7 A;  1DTL A;  1ALW A;  3HCM A;  3R1V A;  3CZ0 A;  3EKH A;  4IJ7 A;  4PHK A;  1QIV A;  1CDP A;  1F71 A;  2LHL A;  2K60 A;  2LHI A;  2WC5 A;  2LMV A;  1SPY A;  3R1P A;  1KWO C;  1NUB A;  1NP8 A;  2KFH A;  3I5F B;  5CSN A;  3CLN A;  1XK4 A;  3EVR A;  3SG2 A;  1Y1U A;  2K7C A;  2NXQ A;  5I2L A;  3SS5 A;  5HL1 A;  2QDI A;  2EHB A;  2OS8 B;  2M8U A;  3IVT A;  1WRL A;  2L2C A;  2EC6 C;  3LL8 B;  4P2Y B;  2DOQ A;  4DRW A;  1ORG A;  3I5I B;  3VRO A;  1WRK A;  3BFB A;  4TNC A;  1DF0 A;  1QIW A;  1J55 A;  1A29 A;  1NYA A;  5F6T A;  2H2K A;  1JF2 A;  5JJG A;  1PVB A;  1BLQ A;  1YVL A;  5FI7 A;  3TS5 C;  4OKH A;  1DJG A;  1K9U A;  4CFQ A;  1U5I B;  2KI4 B;  2AUC A;  2LNK A;  2WCF A;  3BUM B;  4I5K A;  1QX2 A;  4YBH B;  2M0R A;  2WC8 A;  1S1E A;  3AKA A;  3FWB A;  1C7W A;  1OOF A;  3S0E A;  1XFR A;  3K1E A;  2I2R E;  1B7T Y;  3FE8 A;  3BUW B;  3PJI A;  2BEC A;  3VRN A;  5KU1 A;  3IQQ A;  3BYA A;  1IIO A;  1H8B A;  2KDH A;  2LLT A;  4Q04 A;  1XO5 A;  3S0F A;  4HRG A;  1WLZ A;  4OZD A;  1SMG A;  3VGO A;  1GM0 A;  5I94 A;  1F4Q A;  3BFA A;  1K2H A;  3SS3 A;  2I18 A;  2LE9 B;  1MHO A;  1OZS A;  1XFW O;  2KPH A;  3AAK A;  3S0B A;  2AMI A;  2KYF A;  3LLE A;  3BQ3 A;  1GGZ A;  1QLK A;  1OOJ A;  2K0J A;  1MQ1 A;  2LV7 A;  2QPT A;  3A4U B;  3DD4 A;  3SIB A;  5JOL A;  2LVI A;  1SNL A;  2HQ8 A;  1R2U A;  2JRF A;  2FOT A;  2KFF A;  1AJ5 A;  3C1V A;  1TIZ A;  4ZCV A;  5PAL A;  1TNW A;  1LVC D;  2LUC A;  2L50 A;  1NCY A;  3VB1 A;  3PAT A;  3K21 A;  1CM4 A;  4PE4 A;  4MEW A;  1K93 D;  2BCA A;  1DMO A;  1G33 A;  4MSP A;  2WCH A;  1YUU A;  2BL0 B;  2MJW B;  4M2P A;  3CR4 X;  1XYD A;  4C0L A;  3B88 A;  3I5H C;  2OTG B;  1DJX A;  1L2O B;  2K7B A;  1V1G A;  2WOS A;  1KFU L;  2HET A;  4HSZ A;  1TCO B;  2V53 A;  1UHJ A;  3S0A A;  1CFP A;  1S36 A;  2BKH B;  3SG4 A;  1QV0 A;  4ORA B;  1FI5 A;  1RK9 A;  3TUY C;  1YUS A;  1S6C A;  1FPW A;  1TNQ A;  5D7F A;  3DY9 A;  1XFU O;  1TTX A;  3D73 A;  2FCE A;  2GGZ A;  4P5O E;  1CKK A;  2AAO A; 
#chains in the Genus database with same CATH homology
 1R6P A;  2JNX A;  4WQ2 A;  4CFR A;  4DUQ A;  4E68 A;  1MWN A;  4AQJ A;  3FWC A;  2LUX A;  1DJI A;  3KHE A;  1FI6 A;  1SR6 B;  1S3P A;  1CTR A;  1OQP A;  2M7N A;  1WRZ A;  3VRQ A;  3I5F C;  1YX8 A;  1DJY A;  2F3Z A;  2CCM A;  4USL A;  3CWG A;  2JTZ A;  2OS8 C;  3LK1 A;  1BOD A;  1KFX S;  2KI6 C;  2MAZ A;  3LK0 A;  2KQY A;  3I5I C;  3I5G B;  1MF8 B;  1ZUZ A;  1CMG A;  3BUO B;  4MN0 A;  1GJY A;  3SJS A;  1B8C A;  4NDC A;  1CB1 A;  1BR1 B;  1Y1X A;  2F8P A;  2K7O A;  4GGF C;  1XFZ O;  1FF1 A;  1SCM B;  2LVV A;  1M46 A;  2KI4 C;  1V1F A;  2KOT A;  1D1O A;  2KBI A;  4WRI A;  1UP5 A;  1NSH A;  4YGC B;  5AAN A;  3JVT B;  5B8I B;  4M2O A;  5HKW A;  1NPQ A;  1SL7 A;  2L4H A;  5KTY A;  3BUN B;  3DVE A;  2KAY A;  4JPZ B;  1DJW A;  1KK7 Z;  3VRP A;  1HT9 A;  2ZRS A;  1IG5 A;  4U8D A;  2JUL A;  3O78 A;  4CLN A;  1KQM B;  2CNP A;  1S6I A;  2L51 A;  2KGR A;  1S5G Z;  1EG3 A;  2QAC A;  4XJK B;  1BF5 A;  2K2F A;  1JF0 A;  1IH0 A;  2H61 A;  1S6J A;  2LLU A;  1CLL A;  2KBM A;  3DF0 A;  5ER4 X;  3JTD B;  3BOW A;  5CPV A;  2ZNE A;  2NZ0 A;  3GK1 A;  4GNK B;  3BUX B;  2JC2 A;  5GQQ C;  4YGE B;  4OCI A;  1J7R A;  4JQ0 D;  3PN7 B;  4MLW A;  4N1F A;  1IGV A;  3D0Y A;  4QJ5 B;  4MRX A;  1IKU A;  2TN4 A;  4M2Q A;  4PHJ A;  2EGD A;  1QAT A;  2WND A;  1QLS A;  4NQG A;  4ORB B;  1KK8 B;  2MLF C;  2M9G A;  4DS7 A;  2L0P A;  3PSR A;  1UHI A;  1KSO A;  1XVJ A;  2L98 A;  2K61 A;  1MXE A;  2BL0 C;  4MZL A;  1MR8 A;  1CLB A;  3WHU B;  4BY4 A;  2M29 A;  4JWQ A;  2HQW A;  4GFT A;  4N1G A;  3GK4 X;  2OTG C;  1L2O C;  1B47 A;  5I2Q A;  1WLM A;  3E3R A;  1A75 A;  1YX7 A;  3NSO A;  1OZO A;  2NLN A;  2ZRT A;  2BE6 A;  2E6W A;  4I5L B;  4A4C A;  1X02 A;  3DF0 B;  3O4Y A;  1DF0 B;  1YVH A;  1B7T Z;  1LIN A;  1PUL A;  2Q91 A;  3KEV A;  3A8R A;  5AXI A;  1C07 A;  2BBN A;  2PRU A;  3DVJ A;  3PM8 A;  2JPT A;  2KSP A;  3TZ1 A;  4DCK A;  4MRY A;  5CSI A;  4PDZ A;  3D0Y B;  3NSL A;  3ZWH A;  1K94 A;  5TNC A;  2CXJ A;  1CFF A;  1DJH A;  1CM1 A;  1F55 A;  1MXL C;  4YGB B;  2Q4U A;  2SAS A;  5ER5 A;  3IQO A;  1SL9 A;  1W7J B;  4ICB A;  4N5X A;  1SR6 C;  2WCB A;  4GPL B;  1OMV A;  1JBA A;  1M45 A;  2WCE A;  1SKT A;  2F33 A;  1WDC B;  1SRA A;  4NDB A;  2E30 A;  2MLE C;  1SYM A;  4C0K A;  2JT8 A;  1JC2 A;  2R2I A;  5DKN A;  1JSA A;  5G08 A;  1XA5 A;  4ZCU A;  4CPV A;  3I5G C;  1M31 A;  2JXL A;  4UPG A;  1AHR A;  1BOC A;  4QJ3 B;  1A03 A;  1DJZ A;  1UUS A;  2I7A A;  3FIA A;  3KF9 A;  1SCM C;  4GUK A;  1KCY A;  2M97 A;  3NSK A;  3OX5 A;  1Y1A A;  2K7D A;  2PMY A;  1Q80 A;  5DKR A;  1B4C A;  2BCB A;  2NCP A;  1XFX O;  2ZKM X;  2K8M B;  4YRU A;  1SW8 A;  3JVT C;  2M49 B;  2B1U A;  1BMO A;  2CTN A;  3FS7 A;  1NX2 A;  1K9K A;  1TN4 A;  2GGM A;  1CDL A;  1F8H A;  1WY9 A;  1QJT A;  2JQ6 A;  2VRG A;  3GK2 A;  2CT9 A;  1NCX A;  2M7L A;  3ICB A;  1PSB A;  1OMD A;  1KQM C;  3RM1 A;  2D8N A;  1EH2 A;  1SK6 D;  1J7Q A;  1M39 A;  1QVI Y;  1UHN A;  4MZJ A;  2MRD A;  1DGV A;  4OR9 B;  3JTD C;  4PHN A;  1IQ3 A;  3CGA A;  1ZMZ A;  4NDD A;  5I8N A;  2JT0 A;  1TRF A;  3D10 A;  4WQ3 A;  1SCV A;  1CFC A;  3PN7 C;  2L4I A;  1YRT B;  4GAO A;  5IBW A;  1MUX A;  1AUI B;  1BG1 A;  2Y4Q A;  1KK8 C;  5HLV A;  1J1D A;  5CSJ A;  3NXA A;  2WOR A;  4OV2 A;  3WHT B;  1AP4 A;  1DVI A;  1KFX L;  1IJ6 A;  4YGA A;  1EG4 A;  3EVU A;  1RRO A;  1Y6W A;  1ZFS A;  2JZI A;  5AEQ A;  2PVB A;  2RGI A;  3CZT X;  1PVA A;  1BR4 B;  3SG3 A;  1XK4 C;  1BU3 A;  5CSF A;  2M1U A;  5HLO A;  1JUO A;  2LVJ A;  4YGD B;  4A4B A;  2COL B;  1UHH A;  1U5I A;  1CNP A;  2H61 C;  3GOF A;  1PAL A;  1CFD A;  3IF7 A;  4GBA A;  4PCW A;  4DIR A;  1LXF C;  1YUR A;  3M0W A;  1RWY A;  2FCD A;  1IWQ A;  1K9P A;  2M3W A;  2P6B B;  4PAL A;  5DKQ A;  2SCP A;  1PSR A;  5FYX A;  4R1E A;  1A4P A;  3OP0 A;  4PE7 A;  3H4S E;  4C0J A;  2LM5 A;  2F2P A;  3WNX B;  2KFG A;  3TDZ A;  1DGU A;  2I94 A;  2LCP A;  4AOM A;  4FTG A;  2KGB C;  2L2E A;  2BKI B;  3O6B A;  4ETO A;  1DT7 B;  1C7V A;  1OSA A;  3CS1 A;  1B1G A;  3SG6 A;  2F3Y A;  1TOP A;  2A4J A;  1QV1 A;  2Y5I A;  1WDC C;  3OX6 A;  2ZND A;  1KQV A;  4YI8 A;  1TCF A;  1A2X A;  1QX7 A;  5AFP A;  2PSR A;  1NWD A;  4F0Z B;  2LP2 A;  1QS7 A;  1W7I B;  1H4B A;  2MHH A;  3AKB A;  4MZK A;  1FW4 A;  3PLF B;  2JOJ A;  3PFV A;  1UUR A;  1IQ5 A;  2GV5 A;  2JWW A;  3QRX A;  5HKZ A;  1QXP A;  3BOW B;  1B8L A;  4BY5 A;  1PRW A;  1SY9 A;  1CDN A;  2BCX A;  1CMF A;  1KSM A;  1F54 A;  2JNF A;  1UWO A;  1RJV A;  2BBM A;  2O5G A;  4HRE E;  2MA2 A;  1YRU B;  1SBJ A;  1J7O A;  1KWO B;  4AQI A;  3ZNI A;  2LVK A;  2LC5 A;  2M1K B;  4PE1 A;  1YTZ C;  1AK8 A;  3KPX A;  1ALV A;  4FQO A;  2KQ6 A;  3OB2 B;  5BPJ A;  2EC6 B;  3NSI A;  2KAV A;  2L5X B;  3PAL A;  1REC A;  1N65 A;  1N0Y A;  3OHM B;  3CR2 A;  1HQV A;  5KSZ A;  1BJF A;  1RTP 1;  2F2O A;  4I5N B;  4MBE A;  2PAS A;  1EL4 A;  1YR5 A;  3EKJ A;  4D1E A;  1B8R A;  5D69 A;  1S26 D;  5AER A;  1OMR A;  1QAS A;  3DVM A;  1G8I A;  1Y0V H;  2LAP A;  1A75 B;  1KFU S;  3TDU A;  2LP3 A;  3TS5 B;  1AJ4 A;  2MBX A;  2KNE A;  5I2O A;  2O60 A;  1F70 A;  1IRJ A;  2OPO A;  1ODB A;  3HX4 A;  2G2B A;  1K8U A;  2JT3 A;  2IS9 A;  1XFY O;  2Y1N A;  1J7P A;  1L7Z A;  2ISD A;  3CTN A;  1RFJ A;  2Y1M A;  1VRK A;  1YUT A;  2JU0 A;  1AVS A;  1CLM A;  2KHN A;  5HYD A;  1GQM A;  2LMU A;  4I5J A;  4OVN F;  2ZN9 A;  3SIA A;  3EK8 A;  5K89 A;  1J1E A;  1QTX A;  1EXR A;  1K95 A;  2NCO A;  1B9A A;  4L9M A;  1JWD A;  3CR5 X;  1LA0 A;  5J3X A;  4IL1 A;  2FJU B;  5HKY A;  1EJ3 A;  1K96 A;  3DVK A;  1UHK A;  2LAN A;  4HRH A;  1BT6 A;  4CID A;  1N2D A;  1QX5 B;  2KAX A;  1NX3 A;  3BXK A;  4PHM A;  3EK4 A;  1PK0 D;  2KYC A;  3OB1 B;  2LLS A;  1XFV O;  3WXA A;  2JXC A;  1LA3 A;  4YI9 A;  1G4Y R;  1CDM A;  4PE0 A;  2G9B A;  4QJ4 B;  1NIW A;  1TNP A;  1FBV A;  2HPS A;  3SG5 A;  1ZOT B;  3EK7 A;  2PAL A;  1QVI Z;  2ZN8 A;  1M63 B;  3I5H B;  2JTT A;  4XJK A;  1JFK A;  1IJ5 A;  4GGN A;  3MSE B;  1ZAC A;  3O2P A;  1F4O A;  1TNX A;  3TDI A;  1NCZ A;  2LMT A;  3RLZ A;  3AAJ A;  2CBL A;  1NX0 A;  1LKJ A;  4ORC B;  4XYN A;  1KK7 Y;  2ZFD A;  3VRR A;  1GGW A;  3TUY B;  4GGF A;  2KI6 D;  1K90 D;  1OE9 B;  2BE4 A;  3KO0 A;  3F45 A;  1S5G Y;  4MVF A;  1E8A A;  1JFJ A;  2HF5 A;  2K2A A;  1NX1 A;  1SL8 A;  3EVV A;  3LCP C;  3SG7 A;  1DTL A;  1ALW A;  3HCM A;  3EKH A;  4PHK A;  1F71 A;  1QIV A;  1CDP A;  2LHL A;  2LHI A;  2LMV A;  1SPY A;  1KWO C;  1NUB A;  1NP8 A;  2KFH A;  3I5F B;  5CSN A;  3CLN A;  1XK4 A;  3EVR A;  3SG2 A;  1Y1U A;  2K7C A;  2NXQ A;  5I2L A;  2EHB A;  2OS8 B;  2M8U A;  1WRL A;  2EC6 C;  3LL8 B;  4P2Y B;  2DOQ A;  4DRW A;  3I5I B;  3VRO A;  1WRK A;  4TNC A;  1DF0 A;  1QIW A;  1J55 A;  1A29 A;  1NYA A;  5F6T A;  2H2K A;  1JF2 A;  5JJG A;  1PVB A;  1BLQ A;  1YVL A;  3TS5 C;  4OKH A;  1DJG A;  1K9U A;  4CFQ A;  1U5I B;  2KI4 B;  2AUC A;  2LNK A;  2WCF A;  3BUM B;  4I5K A;  1QX2 A;  4YBH B;  2M0R A;  2WC8 A;  1S1E A;  3AKA A;  3FWB A;  1C7W A;  2I2R E;  1B7T Y;  3BUW B;  5KU1 A;  2BEC A;  3VRN A;  3IQQ A;  3BYA A;  1H8B A;  2KDH A;  2LLT A;  4Q04 A;  1XO5 A;  4HRG A;  1WLZ A;  3VGO A;  1SMG A;  1F4Q A;  1K2H A;  2I18 A;  2LE9 B;  1MHO A;  1OZS A;  1XFW O;  3AAK A;  2AMI A;  2KYF A;  3LLE A;  3BQ3 A;  1GGZ A;  1QLK A;  1OOJ A;  2K0J A;  1MQ1 A;  2LV7 A;  2QPT A;  3A4U B;  3DD4 A;  3SIB A;  5JOL A;  2LVI A;  1SNL A;  2HQ8 A;  1R2U A;  2JRF A;  2FOT A;  2KFF A;  1AJ5 A;  3C1V A;  1TIZ A;  4ZCV A;  5PAL A;  1TNW A;  1LVC D;  2LUC A;  2L50 A;  1NCY A;  3PAT A;  3K21 A;  1CM4 A;  4PE4 A;  4MEW A;  1K93 D;  2BCA A;  1DMO A;  1G33 A;  4MSP A;  1YUU A;  2BL0 B;  2MJW B;  4M2P A;  3CR4 X;  1XYD A;  4C0L A;  3I5H C;  2OTG B;  1DJX A;  1L2O B;  2K7B A;  1V1G A;  2WOS A;  1KFU L;  2HET A;  4HSZ A;  1TCO B;  2V53 A;  1UHJ A;  1CFP A;  1S36 A;  2BKH B;  3SG4 A;  1QV0 A;  4ORA B;  1FI5 A;  1RK9 A;  3TUY C;  1YUS A;  1S6C A;  1FPW A;  1TNQ A;  5D7F A;  1XFU O;  1TTX A;  1CKK A;  2FCE A;  2GGZ A;  4P5O E;  2AAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...