4CLNA

Structure of a recombinant calmodulin from drosophila melanogaster refined at 2.2-angstroms resolution
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
148
structure length
148
Chain Sequence
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVTMMTSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALMODULIN
publication title Structure of a recombinant calmodulin from Drosophila melanogaster refined at 2.2-A resolution.
pubmed rcsb
source organism Drosophila melanogaster
molecule tags Calcium binding protein
total genus 42
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 1991-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4clnA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4clnA02
2OTGC 1SL9A 1SR6C 3TS5B 1BLQA 2WORA 3EK7A 5CSIA 2PRUA 1NX0A 2JXLA 1BT6A 4NQGA 2K7BA 4U8DA 1QASA 2IS9A 1OOJA 2LANA 3SG3A 3F45A 1ZUZA 2WCFA 4YRUA 1ALVA 1QATA 1QIWA 4A4BA 2MBXA 1C07A 2LLTA 2AUCA 1NIWA 4CLNA 3TZ1A 1KWOB 1BODA 1F70A 1K96A 1YUTA 3KO0A 1BJFA 4MRXA 1IQ5A 1NSHA 1F54A 1YTZC 1XFXO 1PSRA 2I94A 2NXQA 1XYDA 1TNQA 3PFVA 3PN7B 4OV2A 3E3RA 2KI6D 1LXFC 1MXEA 1SL7A 1YVHA 4PHJA 1X02A 2L2EA 2ZNEA 5TNCA 5D69A 1WRLA 2BCAA 3TS5C 3JVTB 5GQQC 5HKZA 1KQMB 3LL8B 2GGMA 4MBEA 2KAVA 2O5GA 4PE4A 3CLNA 3DVEA 1BR4B 4GGFC 1GQMA 5AFPA 1OZSA 1XFWO 2KGRA 1PVAA 3DVMA 1H4BA 2Y5IA 1PK0D 1QVIY 1WRKA 4MRYA 1QX2A 1K2HA 2FCEA 2JNFA 1MWNA 4NDCA 5D7FA 2B1UA 2CT9A 4PHMA 1K94A 2FCDA 1PSBA 3BOWB 4DS7A 2LUCA 1D1OA 1W7JB 3KEVA 1TTXA 1KWOC 4M2QA 3IF7A 4PHNA 3D0YA 2ZFDA 4MN0A 3DF0A 3SIBA 5HYDA 2QPTA 2JWWA 1S5GY 5KU1A 2BCBA 3AKAA 4Q04A 3LK1A 3PN7C 2MJWB 1F8HA 4UPGA 1HQVA 2KYCA 4MZLA 2LVIA 1MXLC 4OVNF 1QTXA 1ALWA 1DF0B 1PALA 2OS8B 3C1VA 1B7TY 2L0PA 1AUIB 4HREE 5HLVA 1KK8B 1J1DA 2F33A 1OMDA 1SY9A 2M49B 2LM5A 3I5IB 3EVUA 5BPJA 1SCVA 1NCZA 3SG2A 1E8AA 1OQPA 1BMOA 5HKYA 3NXAA 5G08A 1ZACA 1YURA 2KBIA 2L4IA 2I18A 2KBMA 4JWQA 1IJ5A 4D1EA 2SASA 3NSIA 4OR9B 4GGFA 1A03A 3TDUA 1JFJA 2JT3A 2NLNA 3A4UB 1GGZA 2F8PA 2KAYA 1K8UA 1DJZA 3PSRA 1KSOA 1QV1A 5KTYA 2CTNA 4DIRA 2WCEA 1XFVO 1JF0A 2RGIA 3SJSA 3M0WA 1G33A 1M45A 4PALA 2KFFA 2E6WA 4PE1A 1S6JA 2M7NA 1SR6B 4MVFA 1HT9A 1AJ4A 3LK0A 2OS8C 2SCPA 4ZCVA 4ORCB 3CWGA 2JXCA 2LVJA 4CFQA 1YUSA 1EL4A 3NSOA 4QJ4B 2BL0C 1IRJA 2K7DA 2JULA 1OE9B 3WNXB 3OHMB 3CZTX 5CSNA 1CFFA 1L7ZA 4PE0A 1S36A 3VRNA 3BUOB 1B1GA 1JUOA 4BY5A 1MQ1A 3FWBA 3NSLA 2GGZA 1G8IA 1KFXL 1M39A 2K8MB 4AQIA 3BOWA 2BCXA 1XA5A 1Y1UA 1TNXA 2PSRA 4PCWA 1UHHA 2K7OA 3DVKA 1TRFA 1RK9A 1V1FA 3FWCA 2K2FA 5DKNA 2NCOA 1J55A 2PMYA 3VRQA 2BECA 1SCMC 1TN4A 2ZN9A 4XYNA 2JPTA 2HQWA 5ER5A 2MLFC 4C0LA 1JBAA 1WY9A 4QJ3B 5CPVA 3D10A 4GFTA 1J7RA 5JJGA 1DF0A 4MLWA 2M1KB 4FTGA 1F71A 2K61A 2R2IA 4IL1A 3SG4A 1YR5A 2KI6C 1H8BA 2F3ZA 1S6CA 5HKWA 2KHNA 4JPZB 2LVVA 4GUKA 3RM1A 2KYFA 1MR8A 3KHEA 1XFZO 3PATA 1M63B 1CFPA 1IKUA 2LHLA 2M29A 2MHHA 4CFRA 4ETOA 4N1GA 2G9BA 5AANA 5F6TA 1F4OA 2AMIA 3HCMA 1KK7Y 2KGBC 2P6BB 2LMTA 3NSKA 3ZNIA 5KSZA 2JTTA 1FBVA 3GOFA 4NDBA 4DRWA 3H4SE 2JZIA 1SK6D 2LUXA 3TUYC 3VRRA 3OB2B 1QVIZ 5DKQA 3I5FB 2V53A 3BXKA 1QV0A 4DUQA 2KSPA 1NX2A 1SRAA 4A4CA 1NPQA 1CFDA 1B8RA 5AERA 4TNCA 1CM1A 3O4YA 1MF8B 4PDZA 3PM8A 2JU0A 3LLEA 3ZWHA 1QX5B 2O60A 4AQJA 3A8RA 1K93D 1RJVA 1V1GA 1CLMA 1EJ3A 1PVBA 3VROA 2F2OA 2L4HA 2KNEA 1N2DA 1UP5A 3O2PA 4GAOA 1SKTA 3VRPA 1L2OB 4HSZA 1AJ5A 2MRDA 3TDZA 3OX5A 2L5XB 5I2QA 5IBWA 1CMFA 4I5LB 1F4QA 2Q91A 2ZNDA 5I2LA 4QJ5B 2NCPA 2BBNA 3BQ3A 2KI4B 1QLSA 3OX6A 4YGCB 1KFUS 1B7TZ 1CDPA 1M31A 1RROA 1WRZA 2LHIA 4I5KA 1CTRA 2JT0A 4GGNA 1XO5A 1VRKA 1MUXA 1ZOTB 3CR4X 3CTNA 1YRUB 4ZCUA 2COLB 1YVLA 1NCXA 1A4PA 3I5FC 3WXAA 1EG4A 2BL0B 2F3YA 1N65A 2MA2A 2Q4UA 1M46A 1QJTA 1KFXS 1IJ6A 3PLFB 4HRHA 3GK4X 1XFYO 1DTLA 2DOQA 1EH2A 1WLZA 2M97A 1NX1A 2I7AA 1J1EA 2LP3A 1CDNA 1L2OC 1WDCB 4DCKA 2KDHA 1UHKA 3EK4A 2LE9B 3WHTB 4YI8A 3SG7A 1SBJA 1IQ3A 2HETA 4P2YB 4WRIA 2KI4C 4NDDA 1XVJA 2M9GA 4FQOA 4I5NB 3SIAA 1BOCA 1SCMB 4OCIA 4YGBB 3SG6A 3SG5A 1JSAA 2JC2A 1QIVA 1K9KA 1BG1A 1DGUA 3BYAA 1S6IA 3LCPC 4E68A 4YGEB 2L51A 2WNDA 1B47A 1CKKA 2Y1NA 3DVJA 2H61C 2KAXA 1F55A 2H2KA 1U5IB 1UURA 1KFUL 3EK8A 1AHRA 3EVVA 1Y0VH 1FF1A 1BF5A 3GK2A 1NP8A 1B4CA 4L9MA 2BBMA 1FW4A 3BUNB 1WDCC 4CIDA 3DD4A 1J7PA 2NZ0A 4MSPA 1S3PA 2Y4QA 4GNKB 2JT8A 2M8UA 2MAZA 2WOSA 1J7QA 2ZRTA 2ISDA 1CNPA 3QRXA 1OMVA 4HRGA 1ODBA 5FYXA 3AAJA 1Y1XA 1TOPA 5J3XA 3TUYB 1DJYA 3FIAA 1C7VA 1NCYA 4I5JA 4GBAA 1DJIA 4WQ3A 3AKBA 1OMRA 2JRFA 2HPSA 1SNLA 1UUSA 3OB1B 1UHNA 3OP0A 2L98A 2H61A 4C0KA 4MZKA 1FI6A 1PULA 3ICBA 3JTDB 1DT7B 2BE4A 1RWYA 2VRGA 1BR1B 1CLLA 2KFGA 1CB1A 1WLMA 5PALA 4P5OE 3I5HB 5I8NA 1AVSA 4N5XA 1CFCA 5JOLA 1S26D 2PVBA 1NWDA 2BE6A 4JQ0D 3VGOA 1RECA 2MLEC 1RTP1 1AK8A 1KK7Z 1UHIA 2TN4A 3EKJA 4OKHA 3BUXB 4ORBB 1YX8A 1NX3A 1A75B 1K9PA 3K21A 1QXPA 2CXJA 2I2RE 3O6BA 3O78A 2LAPA 1QLKA 2PALA 2L50A 1DMOA 4MEWA 1ZMZA 4F0ZB 4YGDB 1JC2A 2AAOA 2WC8A 4XJKB 1KQVA 1FPWA 2CCMA 1OZOA 4YGAA 1YX7A 1DJHA 2M7LA 1OSAA 1Y6WA 1JF2A 1U5IA 3RLZA 4BY4A 2JQ6A 3JTDC 2CNPA 1S5GZ 1DJXA 1GJYA 3AAKA 4PE7A 1RFJA 2K7CA 2LMUA 2HF5A 1G4YR 5AXIA 1DGVA 3EVRA 1EG3A 3I5HC 1IG5A 2EHBA 4AOMA 1ZFSA 4C0JA 2EC6B 4YBHB 3GK1A 1J7OA 1SW8A 1B9AA 1MHOA 2ZKMX 1CDMA 2LV7A 2KFHA 1LKJA 4GPLB 2D8NA 4M2PA 1SMGA 2OPOA 2A4JA 1CM4A 1TNPA 5I2OA 3CGAA 2KQ6A 1AP4A 1DJGA 1SYMA 2LP2A 3BUMB 3PALA 5CSJA 1KCYA 1K95A 1JFKA 1DVIA 1EXRA 1LA0A 1NUBA 1SL8A 1YRTB 1CDLA 2QACA 4ICBA 4USLA 2HQ8A 1KSMA 5CSFA 2G2BA 2JOJA 1TNWA 1R2UA 3JVTC 1N0YA 1KQMC 1Q80A 1XK4C 3IQQA 2LLSA 1S1EA 4WQ2A 2M0RA 2BKHB 1IWQA 1BU3A 5AEQA 2LC5A 5B8IB 1C7WA 1LVCD 2EC6C 4M2OA 3CR5X 1QX7A 2FJUB 2LMVA 2LVKA 3CR2A 1Y1AA 4MZJA 1FI5A 1A2XA 2Y1MA 1K90D 5ER4X 3CS1A 3I5GB 3KF9A 2JNXA 1A75A 1XFUO 2ZN8A 4N1FA 1R6PA 2M3WA 3EKHA 3MSEB 1TIZA 3TDIA 2OTGB 3HX4A 1K9UA 4PHKA 3BUWB 1KK8C 3I5IC 1DJWA 1IH0A 1TCFA 2K0JA 4XJKA 2F2PA 1B8CA 2JTZA 2GV5A 4R1EA 4CPVA 3D0YB 2FOTA 3DF0B 1LINA 4YI9A 5HLOA 2EGDA 1LA3A 3FS7A 1PRWA 1GGWA 1XK4A 2M1UA 2PASA 2KQYA 1A29A 1JWDA 1B8LA 5DKRA 2LLUA 5K89A 3WHUB 1W7IB 4ORAB 2LNKA 1TCOB 2BKIB 1NYAA 2E30A 1QS7A 1YUUA 3I5GC 1IGVA 2ZRSA 2KOTA 1SPYA 1UWOA 2CBLA 2LCPA 1CLBA 2WCBA 2K2AA 1UHJA 1CMGA 3IQOA 3KPXA
chains in the Genus database with same CATH superfamily
3R1OA 2OTGC 1SL9A 1OOGA 1SR6C 3TS5B 2L2CA 3NGVA 1BLQA 2WORA 3EK7A 5CSIA 2PRUA 1NX0A 2JXLA 1BT6A 4NQGA 2K7BA 4U8DA 1QASA 2IS9A 1OOJA 2LANA 3SG3A 4JD9A 3F45A 1ZUZA 2WCFA 4YRUA 1ALVA 1QATA 1QIWA 4A4BA 2MBXA 1C07A 2LLTA 2AUCA 1NIWA 4CLNA 3TZ1A 1KWOB 1BODA 1DELA 3B87A 1F70A 1K96A 1YUTA 3D76A 3EG5B 3KO0A 1BJFA 4MRXA 1IQ5A 1NSHA 1F54A 1YTZC 1XFXO 1PSRA 2I94A 2NXQA 1XYDA 1TNQA 3PFVA 3PN7B 4OV2A 3E3RA 2KI6D 1LXFC 1MXEA 1SL7A 1YVHA 4PHJA 1X02A 2L2EA 2ZNEA 5TNCA 5D69A 3SS3A 1WRLA 2BCAA 3TS5C 3JVTB 5GQQC 5HKZA 1KQMB 3LL8B 2GGMA 1C3ZA 4MBEA 2KAVA 2O5GA 4PE4A 3CLNA 3DVEA 1BR4B 4GGFC 1GQMA 3FE9A 5AFPA 1OZSA 1XFWO 2KGRA 1PVAA 3DVMA 3S0DA 1H4BA 2Y5IA 1PK0D 1QVIY 1WRKA 4MRYA 1QX2A 1K2HA 2FCEA 2JPOA 2JNFA 1MWNA 4NDCA 5D7FA 2B1UA 5HL1A 2CT9A 4PHMA 2PQLA 1K94A 2FCDA 1PSBA 3BOWB 4DS7A 2LUCA 1D1OA 1W7JB 3KEVA 1TTXA 1KWOC 4M2QA 3Q8IA 2WC6A 3IF7A 4PHNA 3D0YA 2ZFDA 4MN0A 3DF0A 5DICA 3SIBA 2QPTA 5HYDA 2GTEA 1OOHA 3S0GA 2JWWA 1S5GY 1OOFA 2KPHA 5KU1A 2BCBA 3AKAA 4Q04A 3LK1A 3PN7C 2MJWB 1F8HA 1DEKA 4UPGA 1HQVA 2KYCA 4MZLA 2LVIA 1MXLC 4OVNF 1QTXA 1ALWA 1DF0B 1PALA 2OS8B 3C1VA 1B7TY 2BNXA 1AUIB 2L0PA 1Z4HA 1KK8B 1J1DA 2F33A 1OMDA 1SY9A 2M49B 2LM5A 3I5IB 3EVUA 5BPJA 1SCVA 4KYNA 1NCZA 3L47A 1E8AA 1OQPA 1BMOA 3SG2A 3NXAA 5HKYA 3QMEA 1TUZA 3IVTA 5G08A 4IJ7A 1ZACA 1YURA 2KBIA 2L4IA 2I18A 2KBMA 4JWQA 3O4XA 1IJ5A 1XFRA 2SASA 3NSIA 4OR9B 4D1EA 4GGFA 1IIOA 2WCKA 1A03A 3TDUA 1JFJA 1ORGA 3OGNA 2JT3A 2NLNA 3A4UB 1GGZA 2F8PA 2KAYA 1K8UA 1DJZA 3PSRA 1KSOA 1QV1A 5KTYA 2CTNA 4OZDA 4DIRA 2WCEA 4F7FA 1XFVO 1JF0A 5HLVA 2RGIA 3SJSA 3M0WA 1G33A 1M45A 4PALA 2KFFA 2E6WA 4PE1A 1S6JA 2M7NA 1SR6B 4MVFA 1HT9A 1AJ4A 3LK0A 2OS8C 2SCPA 4ZCVA 4ORCB 1LS8A 3CWGA 2JXCA 2LVJA 2FJYA 4CFQA 1TWOA 1YUSA 1EL4A 3NSOA 4QJ4B 2BL0C 1IRJA 2K7DA 2JULA 1OE9B 2WCJA 3BFAA 3WNXB 3OHMB 3CZTX 5CSNA 1CFFA 1L7ZA 4PE0A 1S36A 3VRNA 3BUOB 1B1GA 1JUOA 3CZ2A 4BY5A 1MQ1A 3DY9A 3FWBA 3B86A 3NSLA 2GGZA 1G8IA 3UNWA 1KFXL 1M39A 2K8MB 4AQIA 3BOWA 3DZTA 2BCXA 1XA5A 1Y1UA 1TNXA 2PSRA 4PCWA 1UHHA 2K7OA 3DVKA 1TRFA 1RK9A 1V1FA 3SS4A 3FWCA 2K2FA 5DKNA 2NCOA 1J55A 3BJHA 2PMYA 3CZ1A 3VRQA 2BECA 1SCMC 1TN4A 2ZN9A 4XYNA 2JPTA 2HQWA 5ER5A 3S0BA 2MLFC 4C0LA 1JBAA 3N7HA 1WY9A 4QJ3B 5CPVA 3D10A 4GFTA 1J7RA 5JJGA 1DF0A 4MLWA 2M1KB 4FTGA 1F71A 2K61A 2R2IA 4IL1A 3SG4A 1YR5A 2KI6C 1H8BA 2F3ZA 3NHTA 2QEVA 1S6CA 3FE8A 2KHNA 4JPZB 5HKWA 2LVVA 4INWA 4GUKA 3RM1A 2KYFA 1MR8A 3KHEA 1XFZO 3PATA 1M63B 1CFPA 1IKUA 2LHLA 2M29A 2MHHA 4CFRA 4ETOA 4N1GA 3L4LA 2G9BA 5AANA 2H8VA 5F6TA 1F4OA 2AMIA 3HCMA 1KK7Y 2KGBC 2P6BB 2LMTA 3NSKA 4FQTA 3ZNIA 5KSZA 2JTTA 1FBVA 3GOFA 4NDBA 4DRWA 3H4SE 2JZIA 1SK6D 2LUXA 3TUYC 3VRRA 3OB2B 1QVIZ 5DKQA 3I5FB 2V53A 3BXKA 1QV0A 3SS5A 4DUQA 2KSPA 1NX2A 1SRAA 4A4CA 1NPQA 1CFDA 1B8RA 5AERA 4TNCA 3K1EA 1CM1A 3O4YA 1MF8B 4PDZA 3PM8A 2JU0A 3LLEA 3ZWHA 1QX5B 1C3YA 2O60A 4AQJA 3A8RA 1K93D 1RJVA 1V1GA 1CLMA 1EJ3A 1PVBA 3VROA 2F2OA 2L4HA 2KNEA 1N2DA 1UP5A 3O2PA 4GAOA 1SKTA 3VRPA 1L2OB 1OW4A 1AJ5A 2MRDA 4HSZA 3OX5A 2L5XB 3TDZA 5I2QA 5IBWA 1CMFA 4I5LB 1F4QA 2Q91A 2ZNDA 3R1VA 5I2LA 4QJ5B 2NCPA 2BBNA 3BQ3A 2KI4B 1QLSA 3OX6A 4YGCB 1KFUS 1B7TZ 1CDPA 1M31A 1RROA 1WRZA 2LHIA 4I5KA 1CTRA 2JT0A 4GGNA 1XO5A 1VRKA 1MUXA 1ZOTB 3CR4X 3CTNA 1YRUB 2WCMA 4ZCUA 2COLB 1YVLA 1NCXA 1A4PA 3I5FC 3WXAA 1EG4A 2BL0B 2F3YA 1N65A 2MA2A 2Q4UA 3CDNA 1M46A 1OOIX 1QJTA 3OBVA 1KFXS 1IJ6A 3PLFB 4HRHA 2QEBA 3GK4X 1XFYO 1DTLA 2DOQA 1EH2A 1WLZA 2M97A 1NX1A 2I7AA 1J1EA 2LP3A 2P70A 1CDNA 1L2OC 1WDCB 4DCKA 2KDHA 1UHKA 3EK4A 2LE9B 3WHTB 4YI8A 3B88A 3SG7A 1T14A 1SBJA 1IQ3A 2HETA 4P2YB 4WRIA 2KI4C 4NDDA 1XVJA 2M9GA 4FQOA 4I5NB 3SIAA 1BOCA 1SCMB 3BFHA 4OCIA 4YGBB 3SG6A 3SG5A 2JC2A 1QIVA 1K9KA 2KLDA 1BG1A 1DGUA 3BYAA 1S6IA 1P28A 3LCPC 4YGEB 4E68A 2L51A 2WNDA 1B47A 1CKKA 2Y1NA 3DVJA 2H61C 2KAXA 3NHIA 2H2KA 1U5IB 1F55A 1UURA 1KFUL 3EK8A 1AHRA 3EVVA 1Y0VH 1FF1A 1BF5A 3GK2A 1NP8A 1B4CA 4L9MA 5FI7A 2BBMA 1FW4A 3BUNB 1WDCC 4CIDA 3DD4A 1J7PA 2NZ0A 4MSPA 3R72A 1S3PA 2Y4QA 4GNKB 2JT8A 2M8UA 2MAZA 2WOSA 1J7QA 2ZRTA 2ISDA 1CNPA 3QRXA 5D3OA 1OMVA 4HRGA 1ODBA 5FYXA 3AAJA 1TUJA 1Y1XA 1TOPA 5J3XA 3TUYB 1DJYA 3FIAA 1C7VA 3FE6A 1NCYA 4I5JA 4GBAA 1DJIA 4WQ3A 3AKBA 1OMRA 3UO9A 3BFBA 2JRFA 2HPSA 1SNLA 1UUSA 3OB1B 2ERBA 1UHNA 3OP0A 2L98A 2H61A 4C0KA 4MZKA 1FI6A 1PULA 3ICBA 3JTDB 1GM0A 1DT7B 3CABA 2BE4A 1RWYA 2VRGA 1BR1B 1CLLA 2KFGA 1CB1A 1WLMA 3D77A 5PALA 4P5OE 3I5HB 5I8NA 1AVSA 4N5XA 1CFCA 5JOLA 1S26D 2PVBA 1NWDA 2BE6A 4JQ0D 3VGOA 3S0FA 1RECA 2MLEC 1RTP1 1AK8A 1KK7Z 1UHIA 2TN4A 5I94A 3EKJA 4OKHA 3BUXB 4ORBB 1YX8A 1NX3A 1A75B 1K9PA 2QEHA 3K21A 1QXPA 2CXJA 2I2RE 3O6BA 3O78A 2LAPA 5EL2A 1QLKA 2PALA 2L50A 1DMOA 4MEWA 1ZMZA 4F0ZB 4YGDB 1JC2A 2AAOA 2WC8A 4XJKB 1KQVA 1FPWA 2CCMA 1OZOA 4YGAA 1YX7A 3D73A 1DJHA 3D75A 2WCHA 3D78A 2M7LA 1OSAA 1Y6WA 3B6XA 1JF2A 1U5IA 3RLZA 4BY4A 2JQ6A 3JTDC 2P71A 2CNPA 1S5GZ 1DJXA 1GJYA 3AAKA 4PE7A 1RFJA 2K7CA 2LMUA 2HF5A 1G4YR 5AXIA 1DGVA 3EVRA 1EG3A 3I5HC 1IG5A 2EHBA 2YGUA 4JKTA 2BAPA 5FI6A 4AOMA 1ZFSA 2WC5A 4C0JA 2EC6B 4YBHB 3GK1A 1J7OA 5FI2A 1SW8A 1B9AA 1MHOA 2ZKMX 1CDMA 2LV7A 2KFHA 1LKJA 3CYZA 4GPLB 2D8NA 4M2PA 1SMGA 2OPOA 2A4JA 1CM4A 1TNPA 5I2OA 3CGAA 2KQ6A 1AP4A 1DJGA 1SYMA 2LP2A 3BUMB 3PALA 5CSJA 1KCYA 3PM2A 1K95A 1JFKA 1DVIA 1EXRA 2K60A 1LA0A 1NUBA 1SL8A 1YRTB 1CDLA 2QACA 4ICBA 4USLA 2HQ8A 1KSMA 5CSFA 2G2BA 1QWVA 1TNWA 2JOJA 1R2UA 3JVTC 1N0YA 1KQMC 3VB1A 1Q80A 1XK4C 3IQQA 2LLSA 3L4AA 4INXA 1S1EA 3B7AA 2M0RA 4WQ2A 3R1PA 2BKHB 1IWQA 1BU3A 2PYQA 5AEQA 3S0EA 3RZSA 3DXLA 2L5YA 3PJIA 2LC5A 4PT1A 2QDIA 5B8IB 1C7WA 1LVCD 2EC6C 4M2OA 3S0AA 3CR5X 1QX7A 2FJUB 2LMVA 2LVKA 3CR2A 1Y1AA 4MZJA 1FI5A 1A2XA 2QEOA 3CZ0A 2Y1MA 1K90D 5ER4X 3CS1A 4HREE 3I5GB 3KF9A 2WCLA 2JNXA 1A75A 1XFUO 2ZN8A 4N1FA 1R6PA 2M3WA 3EKHA 3MSEB 1TIZA 3TDIA 2OTGB 3D74A 3HX4A 1K9UA 4PHKA 3BUWB 1KK8C 3I5IC 2KLEA 1DJWA 1IH0A 1TCFA 2K0JA 4XJKA 2F2PA 1B8CA 2JTZA 2GV5A 4R1EA 4CPVA 3D0YB 2FOTA 3DF0B 1LINA 4YI9A 5HLOA 2EGDA 1LA3A 3FS7A 1JSAA 1PRWA 1GGWA 1XK4A 2M1UA 1DC1A 2PASA 2KQYA 1A29A 1DQEA 1JWDA 1B8LA 3V2LA 5DKRA 2LLUA 1W9ZA 3WHUB 5K89A 1W7IB 4ORAB 2LNKA 1TCOB 2BKIB 1NYAA 2E30A 1QS7A 1YUUA 3I5GC 1Z2CB 1IGVA 2ZRSA 2KOTA 3DYEA 1SPYA 1UWOA 2CBLA 2LCPA 1CLBA 2WCBA 2K2AA 1UHJA 1CMGA 3IQOA 3KPXA 1SSEB
chains in the Genus database with same CATH topology
2OTGC 1SL9A 1SR6C 3TS5B 1BLQA 2WORA 3EK7A 5CSIA 2PRUA 1NX0A 2JXLA 1BT6A 4NQGA 2K7BA 4U8DA 1QASA 2IS9A 1OOJA 2LANA 3SG3A 3F45A 1ZUZA 2WCFA 4YRUA 1ALVA 1QATA 1QIWA 4A4BA 2MBXA 1C07A 2LLTA 2AUCA 1NIWA 4CLNA 3TZ1A 1KWOB 1BODA 1F70A 1K96A 1YUTA 3KO0A 1BJFA 4MRXA 1IQ5A 1NSHA 1F54A 1YTZC 1XFXO 1PSRA 2I94A 2NXQA 1XYDA 1TNQA 3PFVA 3PN7B 4OV2A 3E3RA 2KI6D 1LXFC 1MXEA 1SL7A 1YVHA 4PHJA 1X02A 2L2EA 2ZNEA 5TNCA 5D69A 1WRLA 2BCAA 3TS5C 3JVTB 5GQQC 5HKZA 1KQMB 3LL8B 2GGMA 4MBEA 2KAVA 2O5GA 4PE4A 3CLNA 3DVEA 1BR4B 4GGFC 1GQMA 5AFPA 1OZSA 1XFWO 2KGRA 1PVAA 3DVMA 1H4BA 2Y5IA 1PK0D 1QVIY 1WRKA 4MRYA 1QX2A 1K2HA 2FCEA 2JNFA 1MWNA 4NDCA 5D7FA 2B1UA 2CT9A 4PHMA 1K94A 2FCDA 1PSBA 3BOWB 4DS7A 2LUCA 1D1OA 1W7JB 3KEVA 1TTXA 1KWOC 4M2QA 3IF7A 4PHNA 3D0YA 2ZFDA 4MN0A 3DF0A 3SIBA 5HYDA 2QPTA 2JWWA 1S5GY 5KU1A 2BCBA 3AKAA 4Q04A 3LK1A 3PN7C 2MJWB 1F8HA 4UPGA 1HQVA 2KYCA 4MZLA 2LVIA 1MXLC 4OVNF 1QTXA 1ALWA 1DF0B 1PALA 2OS8B 3C1VA 1B7TY 2L0PA 1AUIB 4HREE 5HLVA 1KK8B 1J1DA 2F33A 1OMDA 1SY9A 2M49B 2LM5A 3I5IB 3EVUA 5BPJA 1SCVA 1NCZA 3SG2A 1E8AA 1OQPA 1BMOA 5HKYA 3NXAA 5G08A 1ZACA 1YURA 2KBIA 2L4IA 2I18A 2KBMA 4JWQA 1IJ5A 4D1EA 2SASA 3NSIA 4OR9B 4GGFA 1A03A 3TDUA 1JFJA 2JT3A 2NLNA 3A4UB 1GGZA 2F8PA 2KAYA 1K8UA 1DJZA 3PSRA 1KSOA 1QV1A 5KTYA 2CTNA 4DIRA 2WCEA 1XFVO 1JF0A 2RGIA 3SJSA 3M0WA 1G33A 1M45A 4PALA 2KFFA 2E6WA 4PE1A 1S6JA 2M7NA 1SR6B 4MVFA 1HT9A 1AJ4A 3LK0A 2OS8C 2SCPA 4ZCVA 4ORCB 3CWGA 2JXCA 2LVJA 4CFQA 1YUSA 1EL4A 3NSOA 4QJ4B 2BL0C 1IRJA 2K7DA 2JULA 1OE9B 3WNXB 3OHMB 3CZTX 5CSNA 1CFFA 1L7ZA 4PE0A 1S36A 3VRNA 3BUOB 1B1GA 1JUOA 4BY5A 1MQ1A 3FWBA 3NSLA 2GGZA 1G8IA 1KFXL 1M39A 2K8MB 4AQIA 3BOWA 2BCXA 1XA5A 1Y1UA 1TNXA 2PSRA 4PCWA 1UHHA 2K7OA 3DVKA 1TRFA 1RK9A 1V1FA 3FWCA 2K2FA 5DKNA 2NCOA 1J55A 2PMYA 3VRQA 2BECA 1SCMC 1TN4A 2ZN9A 4XYNA 2JPTA 2HQWA 5ER5A 2MLFC 4C0LA 1JBAA 1WY9A 4QJ3B 5CPVA 3D10A 4GFTA 1J7RA 5JJGA 1DF0A 4MLWA 2M1KB 4FTGA 1F71A 2K61A 2R2IA 4IL1A 3SG4A 1YR5A 2KI6C 1H8BA 2F3ZA 1S6CA 5HKWA 2KHNA 4JPZB 2LVVA 4GUKA 3RM1A 2KYFA 1MR8A 3KHEA 1XFZO 3PATA 1M63B 1CFPA 1IKUA 2LHLA 2M29A 2MHHA 4CFRA 4ETOA 4N1GA 2G9BA 5AANA 5F6TA 1F4OA 2AMIA 3HCMA 1KK7Y 2KGBC 2P6BB 2LMTA 3NSKA 3ZNIA 5KSZA 2JTTA 1FBVA 3GOFA 4NDBA 4DRWA 3H4SE 2JZIA 1SK6D 2LUXA 3TUYC 3VRRA 3OB2B 1QVIZ 5DKQA 3I5FB 2V53A 3BXKA 1QV0A 4DUQA 2KSPA 1NX2A 1SRAA 4A4CA 1NPQA 1CFDA 1B8RA 5AERA 4TNCA 1CM1A 3O4YA 1MF8B 4PDZA 3PM8A 2JU0A 3LLEA 3ZWHA 1QX5B 2O60A 4AQJA 3A8RA 1K93D 1RJVA 1V1GA 1CLMA 1EJ3A 1PVBA 3VROA 2F2OA 2L4HA 2KNEA 1N2DA 1UP5A 3O2PA 4GAOA 1SKTA 3VRPA 1L2OB 4HSZA 1AJ5A 2MRDA 3TDZA 3OX5A 2L5XB 5I2QA 5IBWA 1CMFA 4I5LB 1F4QA 2Q91A 2ZNDA 5I2LA 4QJ5B 2NCPA 2BBNA 3BQ3A 2KI4B 1QLSA 3OX6A 4YGCB 1KFUS 1B7TZ 1CDPA 1M31A 1RROA 1WRZA 2LHIA 4I5KA 1CTRA 2JT0A 4GGNA 1XO5A 1VRKA 1MUXA 1ZOTB 3CR4X 3CTNA 1YRUB 4ZCUA 2COLB 1YVLA 1NCXA 1A4PA 3I5FC 3WXAA 1EG4A 2BL0B 2F3YA 1N65A 2MA2A 2Q4UA 1M46A 1QJTA 1KFXS 1IJ6A 3PLFB 4HRHA 3GK4X 1XFYO 1DTLA 2DOQA 1EH2A 1WLZA 2M97A 1NX1A 2I7AA 1J1EA 2LP3A 1CDNA 1L2OC 1WDCB 4DCKA 2KDHA 1UHKA 3EK4A 2LE9B 3WHTB 4YI8A 3SG7A 1SBJA 1IQ3A 2HETA 4P2YB 4WRIA 2KI4C 4NDDA 1XVJA 2M9GA 4FQOA 4I5NB 3SIAA 1BOCA 1SCMB 4OCIA 4YGBB 3SG6A 3SG5A 1JSAA 2JC2A 1QIVA 1K9KA 1BG1A 1DGUA 3BYAA 1S6IA 3LCPC 4E68A 4YGEB 2L51A 2WNDA 1B47A 1CKKA 2Y1NA 3DVJA 2H61C 2KAXA 1F55A 2H2KA 1U5IB 1UURA 1KFUL 3EK8A 1AHRA 3EVVA 1Y0VH 1FF1A 1BF5A 3GK2A 1NP8A 1B4CA 4L9MA 2BBMA 1FW4A 3BUNB 1WDCC 4CIDA 3DD4A 1J7PA 2NZ0A 4MSPA 1S3PA 2Y4QA 4GNKB 2JT8A 2M8UA 2MAZA 2WOSA 1J7QA 2ZRTA 2ISDA 1CNPA 3QRXA 1OMVA 4HRGA 1ODBA 5FYXA 3AAJA 1Y1XA 1TOPA 5J3XA 3TUYB 1DJYA 3FIAA 1C7VA 1NCYA 4I5JA 4GBAA 1DJIA 4WQ3A 3AKBA 1OMRA 2JRFA 2HPSA 1SNLA 1UUSA 3OB1B 1UHNA 3OP0A 2L98A 2H61A 4C0KA 4MZKA 1FI6A 1PULA 3ICBA 3JTDB 1DT7B 2BE4A 1RWYA 2VRGA 1BR1B 1CLLA 2KFGA 1CB1A 1WLMA 5PALA 4P5OE 3I5HB 5I8NA 1AVSA 4N5XA 1CFCA 5JOLA 1S26D 2PVBA 1NWDA 2BE6A 4JQ0D 3VGOA 1RECA 2MLEC 1RTP1 1AK8A 1KK7Z 1UHIA 2TN4A 3EKJA 4OKHA 3BUXB 4ORBB 1YX8A 1NX3A 1A75B 1K9PA 3K21A 1QXPA 2CXJA 2I2RE 3O6BA 3O78A 2LAPA 1QLKA 2PALA 2L50A 1DMOA 4MEWA 1ZMZA 4F0ZB 4YGDB 1JC2A 2AAOA 2WC8A 4XJKB 1KQVA 1FPWA 2CCMA 1OZOA 4YGAA 1YX7A 1DJHA 2M7LA 1OSAA 1Y6WA 1JF2A 1U5IA 3RLZA 4BY4A 2JQ6A 3JTDC 2CNPA 1S5GZ 1DJXA 1GJYA 3AAKA 4PE7A 1RFJA 2K7CA 2LMUA 2HF5A 1G4YR 5AXIA 1DGVA 3EVRA 1EG3A 3I5HC 1IG5A 2EHBA 4AOMA 1ZFSA 4C0JA 2EC6B 4YBHB 3GK1A 1J7OA 1SW8A 1B9AA 1MHOA 2ZKMX 1CDMA 2LV7A 2KFHA 1LKJA 4GPLB 2D8NA 4M2PA 1SMGA 2OPOA 2A4JA 1CM4A 1TNPA 5I2OA 3CGAA 2KQ6A 1AP4A 1DJGA 1SYMA 2LP2A 3BUMB 3PALA 5CSJA 1KCYA 1K95A 1JFKA 1DVIA 1EXRA 1LA0A 1NUBA 1SL8A 1YRTB 1CDLA 2QACA 4ICBA 4USLA 2HQ8A 1KSMA 5CSFA 2G2BA 2JOJA 1TNWA 1R2UA 3JVTC 1N0YA 1KQMC 1Q80A 1XK4C 3IQQA 2LLSA 1S1EA 4WQ2A 2M0RA 2BKHB 1IWQA 1BU3A 5AEQA 2LC5A 5B8IB 1C7WA 1LVCD 2EC6C 4M2OA 3CR5X 1QX7A 2FJUB 2LMVA 2LVKA 3CR2A 1Y1AA 4MZJA 1FI5A 1A2XA 2Y1MA 1K90D 5ER4X 3CS1A 3I5GB 3KF9A 2JNXA 1A75A 1XFUO 2ZN8A 4N1FA 1R6PA 2M3WA 3EKHA 3MSEB 1TIZA 3TDIA 2OTGB 3HX4A 1K9UA 4PHKA 3BUWB 1KK8C 3I5IC 1DJWA 1IH0A 1TCFA 2K0JA 4XJKA 2F2PA 1B8CA 2JTZA 2GV5A 4R1EA 4CPVA 3D0YB 2FOTA 3DF0B 1LINA 4YI9A 5HLOA 2EGDA 1LA3A 3FS7A 1PRWA 1GGWA 1XK4A 2M1UA 2PASA 2KQYA 1A29A 1JWDA 1B8LA 5DKRA 2LLUA 5K89A 3WHUB 1W7IB 4ORAB 2LNKA 1TCOB 2BKIB 1NYAA 2E30A 1QS7A 1YUUA 3I5GC 1IGVA 2ZRSA 2KOTA 1SPYA 1UWOA 2CBLA 2LCPA 1CLBA 2WCBA 2K2AA 1UHJA 1CMGA 3IQOA 3KPXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTG C;  1SL9 A;  1SR6 C;  3TS5 B;  1BLQ A;  2WOR A;  3EK7 A;  5CSI A;  2PRU A;  1NX0 A;  2JXL A;  1BT6 A;  4NQG A;  2K7B A;  4U8D A;  1QAS A;  2IS9 A;  1OOJ A;  2LAN A;  3SG3 A;  3F45 A;  1ZUZ A;  2WCF A;  4YRU A;  1ALV A;  1QAT A;  1QIW A;  4A4B A;  2MBX A;  1C07 A;  2LLT A;  2AUC A;  1NIW A;  4CLN A;  3TZ1 A;  1KWO B;  1BOD A;  1F70 A;  1K96 A;  1YUT A;  3KO0 A;  1BJF A;  4MRX A;  1IQ5 A;  1NSH A;  1F54 A;  1YTZ C;  1XFX O;  1PSR A;  2I94 A;  2NXQ A;  1XYD A;  1TNQ A;  3PFV A;  3PN7 B;  4OV2 A;  3E3R A;  2KI6 D;  1LXF C;  1MXE A;  1SL7 A;  1YVH A;  4PHJ A;  1X02 A;  2L2E A;  2ZNE A;  5TNC A;  5D69 A;  1WRL A;  2BCA A;  3TS5 C;  3JVT B;  5GQQ C;  5HKZ A;  1KQM B;  3LL8 B;  2GGM A;  4MBE A;  2KAV A;  2O5G A;  4PE4 A;  3CLN A;  3DVE A;  1BR4 B;  4GGF C;  1GQM A;  5AFP A;  1OZS A;  1XFW O;  2KGR A;  1PVA A;  3DVM A;  1H4B A;  2Y5I A;  1PK0 D;  1QVI Y;  1WRK A;  4MRY A;  1QX2 A;  1K2H A;  2FCE A;  2JNF A;  1MWN A;  4NDC A;  5D7F A;  2B1U A;  2CT9 A;  4PHM A;  1K94 A;  2FCD A;  1PSB A;  3BOW B;  4DS7 A;  2LUC A;  1D1O A;  1W7J B;  3KEV A;  1TTX A;  1KWO C;  4M2Q A;  3IF7 A;  4PHN A;  3D0Y A;  2ZFD A;  4MN0 A;  3DF0 A;  3SIB A;  5HYD A;  2QPT A;  2JWW A;  1S5G Y;  5KU1 A;  2BCB A;  3AKA A;  4Q04 A;  3LK1 A;  3PN7 C;  2MJW B;  1F8H A;  4UPG A;  1HQV A;  2KYC A;  4MZL A;  2LVI A;  1MXL C;  4OVN F;  1QTX A;  1ALW A;  1DF0 B;  1PAL A;  2OS8 B;  3C1V A;  1B7T Y;  2L0P A;  1AUI B;  4HRE E;  5HLV A;  1KK8 B;  1J1D A;  2F33 A;  1OMD A;  1SY9 A;  2M49 B;  2LM5 A;  3I5I B;  3EVU A;  5BPJ A;  1SCV A;  1NCZ A;  3SG2 A;  1E8A A;  1OQP A;  1BMO A;  5HKY A;  3NXA A;  5G08 A;  1ZAC A;  1YUR A;  2KBI A;  2L4I A;  2I18 A;  2KBM A;  4JWQ A;  1IJ5 A;  4D1E A;  2SAS A;  3NSI A;  4OR9 B;  4GGF A;  1A03 A;  3TDU A;  1JFJ A;  2JT3 A;  2NLN A;  3A4U B;  1GGZ A;  2F8P A;  2KAY A;  1K8U A;  1DJZ A;  3PSR A;  1KSO A;  1QV1 A;  5KTY A;  2CTN A;  4DIR A;  2WCE A;  1XFV O;  1JF0 A;  2RGI A;  3SJS A;  3M0W A;  1G33 A;  1M45 A;  4PAL A;  2KFF A;  2E6W A;  4PE1 A;  1S6J A;  2M7N A;  1SR6 B;  4MVF A;  1HT9 A;  1AJ4 A;  3LK0 A;  2OS8 C;  2SCP A;  4ZCV A;  4ORC B;  3CWG A;  2JXC A;  2LVJ A;  4CFQ A;  1YUS A;  1EL4 A;  3NSO A;  4QJ4 B;  2BL0 C;  1IRJ A;  2K7D A;  2JUL A;  1OE9 B;  3WNX B;  3OHM B;  3CZT X;  5CSN A;  1CFF A;  1L7Z A;  4PE0 A;  1S36 A;  3VRN A;  3BUO B;  1B1G A;  1JUO A;  4BY5 A;  1MQ1 A;  3FWB A;  3NSL A;  2GGZ A;  1G8I A;  1KFX L;  1M39 A;  2K8M B;  4AQI A;  3BOW A;  2BCX A;  1XA5 A;  1Y1U A;  1TNX A;  2PSR A;  4PCW A;  1UHH A;  2K7O A;  3DVK A;  1TRF A;  1RK9 A;  1V1F A;  3FWC A;  2K2F A;  5DKN A;  2NCO A;  1J55 A;  2PMY A;  3VRQ A;  2BEC A;  1SCM C;  1TN4 A;  2ZN9 A;  4XYN A;  2JPT A;  2HQW A;  5ER5 A;  2MLF C;  4C0L A;  1JBA A;  1WY9 A;  4QJ3 B;  5CPV A;  3D10 A;  4GFT A;  1J7R A;  5JJG A;  1DF0 A;  4MLW A;  2M1K B;  4FTG A;  1F71 A;  2K61 A;  2R2I A;  4IL1 A;  3SG4 A;  1YR5 A;  2KI6 C;  1H8B A;  2F3Z A;  1S6C A;  5HKW A;  2KHN A;  4JPZ B;  2LVV A;  4GUK A;  3RM1 A;  2KYF A;  1MR8 A;  3KHE A;  1XFZ O;  3PAT A;  1M63 B;  1CFP A;  1IKU A;  2LHL A;  2M29 A;  2MHH A;  4CFR A;  4ETO A;  4N1G A;  2G9B A;  5AAN A;  5F6T A;  1F4O A;  2AMI A;  3HCM A;  1KK7 Y;  2KGB C;  2P6B B;  2LMT A;  3NSK A;  3ZNI A;  5KSZ A;  2JTT A;  1FBV A;  3GOF A;  4NDB A;  4DRW A;  3H4S E;  2JZI A;  1SK6 D;  2LUX A;  3TUY C;  3VRR A;  3OB2 B;  1QVI Z;  5DKQ A;  3I5F B;  2V53 A;  3BXK A;  1QV0 A;  4DUQ A;  2KSP A;  1NX2 A;  1SRA A;  4A4C A;  1NPQ A;  1CFD A;  1B8R A;  5AER A;  4TNC A;  1CM1 A;  3O4Y A;  1MF8 B;  4PDZ A;  3PM8 A;  2JU0 A;  3LLE A;  3ZWH A;  1QX5 B;  2O60 A;  4AQJ A;  3A8R A;  1K93 D;  1RJV A;  1V1G A;  1CLM A;  1EJ3 A;  1PVB A;  3VRO A;  2F2O A;  2L4H A;  2KNE A;  1N2D A;  1UP5 A;  3O2P A;  4GAO A;  1SKT A;  3VRP A;  1L2O B;  4HSZ A;  1AJ5 A;  2MRD A;  3TDZ A;  3OX5 A;  2L5X B;  5I2Q A;  5IBW A;  1CMF A;  4I5L B;  1F4Q A;  2Q91 A;  2ZND A;  5I2L A;  4QJ5 B;  2NCP A;  2BBN A;  3BQ3 A;  2KI4 B;  1QLS A;  3OX6 A;  4YGC B;  1KFU S;  1B7T Z;  1CDP A;  1M31 A;  1RRO A;  1WRZ A;  2LHI A;  4I5K A;  1CTR A;  2JT0 A;  4GGN A;  1XO5 A;  1VRK A;  1MUX A;  1ZOT B;  3CR4 X;  3CTN A;  1YRU B;  4ZCU A;  2COL B;  1YVL A;  1NCX A;  1A4P A;  3I5F C;  3WXA A;  1EG4 A;  2BL0 B;  2F3Y A;  1N65 A;  2MA2 A;  2Q4U A;  1M46 A;  1QJT A;  1KFX S;  1IJ6 A;  3PLF B;  4HRH A;  3GK4 X;  1XFY O;  1DTL A;  2DOQ A;  1EH2 A;  1WLZ A;  2M97 A;  1NX1 A;  2I7A A;  1J1E A;  2LP3 A;  1CDN A;  1L2O C;  1WDC B;  4DCK A;  2KDH A;  1UHK A;  3EK4 A;  2LE9 B;  3WHT B;  4YI8 A;  3SG7 A;  1SBJ A;  1IQ3 A;  2HET A;  4P2Y B;  4WRI A;  2KI4 C;  4NDD A;  1XVJ A;  2M9G A;  4FQO A;  4I5N B;  3SIA A;  1BOC A;  1SCM B;  4OCI A;  4YGB B;  3SG6 A;  3SG5 A;  1JSA A;  2JC2 A;  1QIV A;  1K9K A;  1BG1 A;  1DGU A;  3BYA A;  1S6I A;  3LCP C;  4E68 A;  4YGE B;  2L51 A;  2WND A;  1B47 A;  1CKK A;  2Y1N A;  3DVJ A;  2H61 C;  2KAX A;  1F55 A;  2H2K A;  1U5I B;  1UUR A;  1KFU L;  3EK8 A;  1AHR A;  3EVV A;  1Y0V H;  1FF1 A;  1BF5 A;  3GK2 A;  1NP8 A;  1B4C A;  4L9M A;  2BBM A;  1FW4 A;  3BUN B;  1WDC C;  4CID A;  3DD4 A;  1J7P A;  2NZ0 A;  4MSP A;  1S3P A;  2Y4Q A;  4GNK B;  2JT8 A;  2M8U A;  2MAZ A;  2WOS A;  1J7Q A;  2ZRT A;  2ISD A;  1CNP A;  3QRX A;  1OMV A;  4HRG A;  1ODB A;  5FYX A;  3AAJ A;  1Y1X A;  1TOP A;  5J3X A;  3TUY B;  1DJY A;  3FIA A;  1C7V A;  1NCY A;  4I5J A;  4GBA A;  1DJI A;  4WQ3 A;  3AKB A;  1OMR A;  2JRF A;  2HPS A;  1SNL A;  1UUS A;  3OB1 B;  1UHN A;  3OP0 A;  2L98 A;  2H61 A;  4C0K A;  4MZK A;  1FI6 A;  1PUL A;  3ICB A;  3JTD B;  1DT7 B;  2BE4 A;  1RWY A;  2VRG A;  1BR1 B;  1CLL A;  2KFG A;  1CB1 A;  1WLM A;  5PAL A;  4P5O E;  3I5H B;  5I8N A;  1AVS A;  4N5X A;  1CFC A;  5JOL A;  1S26 D;  2PVB A;  1NWD A;  2BE6 A;  4JQ0 D;  3VGO A;  1REC A;  2MLE C;  1RTP 1;  1AK8 A;  1KK7 Z;  1UHI A;  2TN4 A;  3EKJ A;  4OKH A;  3BUX B;  4ORB B;  1YX8 A;  1NX3 A;  1A75 B;  1K9P A;  3K21 A;  1QXP A;  2CXJ A;  2I2R E;  3O6B A;  3O78 A;  2LAP A;  1QLK A;  2PAL A;  2L50 A;  1DMO A;  4MEW A;  1ZMZ A;  4F0Z B;  4YGD B;  1JC2 A;  2AAO A;  2WC8 A;  4XJK B;  1KQV A;  1FPW A;  2CCM A;  1OZO A;  4YGA A;  1YX7 A;  1DJH A;  2M7L A;  1OSA A;  1Y6W A;  1JF2 A;  1U5I A;  3RLZ A;  4BY4 A;  2JQ6 A;  3JTD C;  2CNP A;  1S5G Z;  1DJX A;  1GJY A;  3AAK A;  4PE7 A;  1RFJ A;  2K7C A;  2LMU A;  2HF5 A;  1G4Y R;  5AXI A;  1DGV A;  3EVR A;  1EG3 A;  3I5H C;  1IG5 A;  2EHB A;  4AOM A;  1ZFS A;  4C0J A;  2EC6 B;  4YBH B;  3GK1 A;  1J7O A;  1SW8 A;  1B9A A;  1MHO A;  2ZKM X;  1CDM A;  2LV7 A;  2KFH A;  1LKJ A;  4GPL B;  2D8N A;  4M2P A;  1SMG A;  2OPO A;  2A4J A;  1CM4 A;  1TNP A;  5I2O A;  3CGA A;  2KQ6 A;  1AP4 A;  1DJG A;  1SYM A;  2LP2 A;  3BUM B;  3PAL A;  5CSJ A;  1KCY A;  1K95 A;  1JFK A;  1DVI A;  1EXR A;  1LA0 A;  1NUB A;  1SL8 A;  1YRT B;  1CDL A;  2QAC A;  4ICB A;  4USL A;  2HQ8 A;  1KSM A;  5CSF A;  2G2B A;  2JOJ A;  1TNW A;  1R2U A;  3JVT C;  1N0Y A;  1KQM C;  1Q80 A;  1XK4 C;  3IQQ A;  2LLS A;  1S1E A;  4WQ2 A;  2M0R A;  2BKH B;  1IWQ A;  1BU3 A;  5AEQ A;  2LC5 A;  5B8I B;  1C7W A;  1LVC D;  2EC6 C;  4M2O A;  3CR5 X;  1QX7 A;  2FJU B;  2LMV A;  2LVK A;  3CR2 A;  1Y1A A;  4MZJ A;  1FI5 A;  1A2X A;  2Y1M A;  1K90 D;  5ER4 X;  3CS1 A;  3I5G B;  3KF9 A;  2JNX A;  1A75 A;  1XFU O;  2ZN8 A;  4N1F A;  1R6P A;  2M3W A;  3EKH A;  3MSE B;  1TIZ A;  3TDI A;  2OTG B;  3HX4 A;  1K9U A;  4PHK A;  3BUW B;  1KK8 C;  3I5I C;  1DJW A;  1IH0 A;  1TCF A;  2K0J A;  4XJK A;  2F2P A;  1B8C A;  2JTZ A;  2GV5 A;  4R1E A;  4CPV A;  3D0Y B;  2FOT A;  3DF0 B;  1LIN A;  4YI9 A;  5HLO A;  2EGD A;  1LA3 A;  3FS7 A;  1PRW A;  1GGW A;  1XK4 A;  2M1U A;  2PAS A;  2KQY A;  1A29 A;  1JWD A;  1B8L A;  5DKR A;  2LLU A;  5K89 A;  3WHU B;  1W7I B;  4ORA B;  2LNK A;  1TCO B;  2BKI B;  1NYA A;  2E30 A;  1QS7 A;  1YUU A;  3I5G C;  1IGV A;  2ZRS A;  2KOT A;  1SPY A;  1UWO A;  2CBL A;  2LCP A;  1CLB A;  2WCB A;  2K2A A;  1UHJ A;  1CMG A;  3IQO A;  3KPX A; 
#chains in the Genus database with same CATH topology
 3R1O A;  2OTG C;  1SL9 A;  1OOG A;  1SR6 C;  3TS5 B;  2L2C A;  3NGV A;  1BLQ A;  2WOR A;  3EK7 A;  5CSI A;  2PRU A;  1NX0 A;  2JXL A;  1BT6 A;  4NQG A;  2K7B A;  4U8D A;  1QAS A;  2IS9 A;  1OOJ A;  2LAN A;  3SG3 A;  4JD9 A;  3F45 A;  1ZUZ A;  2WCF A;  4YRU A;  1ALV A;  1QAT A;  1QIW A;  4A4B A;  2MBX A;  1C07 A;  2LLT A;  2AUC A;  1NIW A;  4CLN A;  3TZ1 A;  1KWO B;  1BOD A;  1DEL A;  3B87 A;  1F70 A;  1K96 A;  1YUT A;  3D76 A;  3EG5 B;  3KO0 A;  1BJF A;  4MRX A;  1IQ5 A;  1NSH A;  1F54 A;  1YTZ C;  1XFX O;  1PSR A;  2I94 A;  2NXQ A;  1XYD A;  1TNQ A;  3PFV A;  3PN7 B;  4OV2 A;  3E3R A;  2KI6 D;  1LXF C;  1MXE A;  1SL7 A;  1YVH A;  4PHJ A;  1X02 A;  2L2E A;  2ZNE A;  5TNC A;  5D69 A;  3SS3 A;  1WRL A;  2BCA A;  3TS5 C;  3JVT B;  5GQQ C;  5HKZ A;  1KQM B;  3LL8 B;  2GGM A;  1C3Z A;  4MBE A;  2KAV A;  2O5G A;  4PE4 A;  3CLN A;  3DVE A;  1BR4 B;  4GGF C;  1GQM A;  3FE9 A;  5AFP A;  1OZS A;  1XFW O;  2KGR A;  1PVA A;  3DVM A;  3S0D A;  1H4B A;  2Y5I A;  1PK0 D;  1QVI Y;  1WRK A;  4MRY A;  1QX2 A;  1K2H A;  2FCE A;  2JPO A;  2JNF A;  1MWN A;  4NDC A;  5D7F A;  2B1U A;  5HL1 A;  2CT9 A;  4PHM A;  2PQL A;  1K94 A;  2FCD A;  1PSB A;  3BOW B;  4DS7 A;  2LUC A;  1D1O A;  1W7J B;  3KEV A;  1TTX A;  1KWO C;  4M2Q A;  3Q8I A;  2WC6 A;  3IF7 A;  4PHN A;  3D0Y A;  2ZFD A;  4MN0 A;  3DF0 A;  5DIC A;  3SIB A;  2QPT A;  5HYD A;  2GTE A;  1OOH A;  3S0G A;  2JWW A;  1S5G Y;  1OOF A;  2KPH A;  5KU1 A;  2BCB A;  3AKA A;  4Q04 A;  3LK1 A;  3PN7 C;  2MJW B;  1F8H A;  1DEK A;  4UPG A;  1HQV A;  2KYC A;  4MZL A;  2LVI A;  1MXL C;  4OVN F;  1QTX A;  1ALW A;  1DF0 B;  1PAL A;  2OS8 B;  3C1V A;  1B7T Y;  2BNX A;  1AUI B;  2L0P A;  1Z4H A;  1KK8 B;  1J1D A;  2F33 A;  1OMD A;  1SY9 A;  2M49 B;  2LM5 A;  3I5I B;  3EVU A;  5BPJ A;  1SCV A;  4KYN A;  1NCZ A;  3L47 A;  1E8A A;  1OQP A;  1BMO A;  3SG2 A;  3NXA A;  5HKY A;  3QME A;  1TUZ A;  3IVT A;  5G08 A;  4IJ7 A;  1ZAC A;  1YUR A;  2KBI A;  2L4I A;  2I18 A;  2KBM A;  4JWQ A;  3O4X A;  1IJ5 A;  1XFR A;  2SAS A;  3NSI A;  4OR9 B;  4D1E A;  4GGF A;  1IIO A;  2WCK A;  1A03 A;  3TDU A;  1JFJ A;  1ORG A;  3OGN A;  2JT3 A;  2NLN A;  3A4U B;  1GGZ A;  2F8P A;  2KAY A;  1K8U A;  1DJZ A;  3PSR A;  1KSO A;  1QV1 A;  5KTY A;  2CTN A;  4OZD A;  4DIR A;  2WCE A;  4F7F A;  1XFV O;  1JF0 A;  5HLV A;  2RGI A;  3SJS A;  3M0W A;  1G33 A;  1M45 A;  4PAL A;  2KFF A;  2E6W A;  4PE1 A;  1S6J A;  2M7N A;  1SR6 B;  4MVF A;  1HT9 A;  1AJ4 A;  3LK0 A;  2OS8 C;  2SCP A;  4ZCV A;  4ORC B;  1LS8 A;  3CWG A;  2JXC A;  2LVJ A;  2FJY A;  4CFQ A;  1TWO A;  1YUS A;  1EL4 A;  3NSO A;  4QJ4 B;  2BL0 C;  1IRJ A;  2K7D A;  2JUL A;  1OE9 B;  2WCJ A;  3BFA A;  3WNX B;  3OHM B;  3CZT X;  5CSN A;  1CFF A;  1L7Z A;  4PE0 A;  1S36 A;  3VRN A;  3BUO B;  1B1G A;  1JUO A;  3CZ2 A;  4BY5 A;  1MQ1 A;  3DY9 A;  3FWB A;  3B86 A;  3NSL A;  2GGZ A;  1G8I A;  3UNW A;  1KFX L;  1M39 A;  2K8M B;  4AQI A;  3BOW A;  3DZT A;  2BCX A;  1XA5 A;  1Y1U A;  1TNX A;  2PSR A;  4PCW A;  1UHH A;  2K7O A;  3DVK A;  1TRF A;  1RK9 A;  1V1F A;  3SS4 A;  3FWC A;  2K2F A;  5DKN A;  2NCO A;  1J55 A;  3BJH A;  2PMY A;  3CZ1 A;  3VRQ A;  2BEC A;  1SCM C;  1TN4 A;  2ZN9 A;  4XYN A;  2JPT A;  2HQW A;  5ER5 A;  3S0B A;  2MLF C;  4C0L A;  1JBA A;  3N7H A;  1WY9 A;  4QJ3 B;  5CPV A;  3D10 A;  4GFT A;  1J7R A;  5JJG A;  1DF0 A;  4MLW A;  2M1K B;  4FTG A;  1F71 A;  2K61 A;  2R2I A;  4IL1 A;  3SG4 A;  1YR5 A;  2KI6 C;  1H8B A;  2F3Z A;  3NHT A;  2QEV A;  1S6C A;  3FE8 A;  2KHN A;  4JPZ B;  5HKW A;  2LVV A;  4INW A;  4GUK A;  3RM1 A;  2KYF A;  1MR8 A;  3KHE A;  1XFZ O;  3PAT A;  1M63 B;  1CFP A;  1IKU A;  2LHL A;  2M29 A;  2MHH A;  4CFR A;  4ETO A;  4N1G A;  3L4L A;  2G9B A;  5AAN A;  2H8V A;  5F6T A;  1F4O A;  2AMI A;  3HCM A;  1KK7 Y;  2KGB C;  2P6B B;  2LMT A;  3NSK A;  4FQT A;  3ZNI A;  5KSZ A;  2JTT A;  1FBV A;  3GOF A;  4NDB A;  4DRW A;  3H4S E;  2JZI A;  1SK6 D;  2LUX A;  3TUY C;  3VRR A;  3OB2 B;  1QVI Z;  5DKQ A;  3I5F B;  2V53 A;  3BXK A;  1QV0 A;  3SS5 A;  4DUQ A;  2KSP A;  1NX2 A;  1SRA A;  4A4C A;  1NPQ A;  1CFD A;  1B8R A;  5AER A;  4TNC A;  3K1E A;  1CM1 A;  3O4Y A;  1MF8 B;  4PDZ A;  3PM8 A;  2JU0 A;  3LLE A;  3ZWH A;  1QX5 B;  1C3Y A;  2O60 A;  4AQJ A;  3A8R A;  1K93 D;  1RJV A;  1V1G A;  1CLM A;  1EJ3 A;  1PVB A;  3VRO A;  2F2O A;  2L4H A;  2KNE A;  1N2D A;  1UP5 A;  3O2P A;  4GAO A;  1SKT A;  3VRP A;  1L2O B;  1OW4 A;  1AJ5 A;  2MRD A;  4HSZ A;  3OX5 A;  2L5X B;  3TDZ A;  5I2Q A;  5IBW A;  1CMF A;  4I5L B;  1F4Q A;  2Q91 A;  2ZND A;  3R1V A;  5I2L A;  4QJ5 B;  2NCP A;  2BBN A;  3BQ3 A;  2KI4 B;  1QLS A;  3OX6 A;  4YGC B;  1KFU S;  1B7T Z;  1CDP A;  1M31 A;  1RRO A;  1WRZ A;  2LHI A;  4I5K A;  1CTR A;  2JT0 A;  4GGN A;  1XO5 A;  1VRK A;  1MUX A;  1ZOT B;  3CR4 X;  3CTN A;  1YRU B;  2WCM A;  4ZCU A;  2COL B;  1YVL A;  1NCX A;  1A4P A;  3I5F C;  3WXA A;  1EG4 A;  2BL0 B;  2F3Y A;  1N65 A;  2MA2 A;  2Q4U A;  3CDN A;  1M46 A;  1OOI X;  1QJT A;  3OBV A;  1KFX S;  1IJ6 A;  3PLF B;  4HRH A;  2QEB A;  3GK4 X;  1XFY O;  1DTL A;  2DOQ A;  1EH2 A;  1WLZ A;  2M97 A;  1NX1 A;  2I7A A;  1J1E A;  2LP3 A;  2P70 A;  1CDN A;  1L2O C;  1WDC B;  4DCK A;  2KDH A;  1UHK A;  3EK4 A;  2LE9 B;  3WHT B;  4YI8 A;  3B88 A;  3SG7 A;  1T14 A;  1SBJ A;  1IQ3 A;  2HET A;  4P2Y B;  4WRI A;  2KI4 C;  4NDD A;  1XVJ A;  2M9G A;  4FQO A;  4I5N B;  3SIA A;  1BOC A;  1SCM B;  3BFH A;  4OCI A;  4YGB B;  3SG6 A;  3SG5 A;  2JC2 A;  1QIV A;  1K9K A;  2KLD A;  1BG1 A;  1DGU A;  3BYA A;  1S6I A;  1P28 A;  3LCP C;  4YGE B;  4E68 A;  2L51 A;  2WND A;  1B47 A;  1CKK A;  2Y1N A;  3DVJ A;  2H61 C;  2KAX A;  3NHI A;  2H2K A;  1U5I B;  1F55 A;  1UUR A;  1KFU L;  3EK8 A;  1AHR A;  3EVV A;  1Y0V H;  1FF1 A;  1BF5 A;  3GK2 A;  1NP8 A;  1B4C A;  4L9M A;  5FI7 A;  2BBM A;  1FW4 A;  3BUN B;  1WDC C;  4CID A;  3DD4 A;  1J7P A;  2NZ0 A;  4MSP A;  3R72 A;  1S3P A;  2Y4Q A;  4GNK B;  2JT8 A;  2M8U A;  2MAZ A;  2WOS A;  1J7Q A;  2ZRT A;  2ISD A;  1CNP A;  3QRX A;  5D3O A;  1OMV A;  4HRG A;  1ODB A;  5FYX A;  3AAJ A;  1TUJ A;  1Y1X A;  1TOP A;  5J3X A;  3TUY B;  1DJY A;  3FIA A;  1C7V A;  3FE6 A;  1NCY A;  4I5J A;  4GBA A;  1DJI A;  4WQ3 A;  3AKB A;  1OMR A;  3UO9 A;  3BFB A;  2JRF A;  2HPS A;  1SNL A;  1UUS A;  3OB1 B;  2ERB A;  1UHN A;  3OP0 A;  2L98 A;  2H61 A;  4C0K A;  4MZK A;  1FI6 A;  1PUL A;  3ICB A;  3JTD B;  1GM0 A;  1DT7 B;  3CAB A;  2BE4 A;  1RWY A;  2VRG A;  1BR1 B;  1CLL A;  2KFG A;  1CB1 A;  1WLM A;  3D77 A;  5PAL A;  4P5O E;  3I5H B;  5I8N A;  1AVS A;  4N5X A;  1CFC A;  5JOL A;  1S26 D;  2PVB A;  1NWD A;  2BE6 A;  4JQ0 D;  3VGO A;  3S0F A;  1REC A;  2MLE C;  1RTP 1;  1AK8 A;  1KK7 Z;  1UHI A;  2TN4 A;  5I94 A;  3EKJ A;  4OKH A;  3BUX B;  4ORB B;  1YX8 A;  1NX3 A;  1A75 B;  1K9P A;  2QEH A;  3K21 A;  1QXP A;  2CXJ A;  2I2R E;  3O6B A;  3O78 A;  2LAP A;  5EL2 A;  1QLK A;  2PAL A;  2L50 A;  1DMO A;  4MEW A;  1ZMZ A;  4F0Z B;  4YGD B;  1JC2 A;  2AAO A;  2WC8 A;  4XJK B;  1KQV A;  1FPW A;  2CCM A;  1OZO A;  4YGA A;  1YX7 A;  3D73 A;  1DJH A;  3D75 A;  2WCH A;  3D78 A;  2M7L A;  1OSA A;  1Y6W A;  3B6X A;  1JF2 A;  1U5I A;  3RLZ A;  4BY4 A;  2JQ6 A;  3JTD C;  2P71 A;  2CNP A;  1S5G Z;  1DJX A;  1GJY A;  3AAK A;  4PE7 A;  1RFJ A;  2K7C A;  2LMU A;  2HF5 A;  1G4Y R;  5AXI A;  1DGV A;  3EVR A;  1EG3 A;  3I5H C;  1IG5 A;  2EHB A;  2YGU A;  4JKT A;  2BAP A;  5FI6 A;  4AOM A;  1ZFS A;  2WC5 A;  4C0J A;  2EC6 B;  4YBH B;  3GK1 A;  1J7O A;  5FI2 A;  1SW8 A;  1B9A A;  1MHO A;  2ZKM X;  1CDM A;  2LV7 A;  2KFH A;  1LKJ A;  3CYZ A;  4GPL B;  2D8N A;  4M2P A;  1SMG A;  2OPO A;  2A4J A;  1CM4 A;  1TNP A;  5I2O A;  3CGA A;  2KQ6 A;  1AP4 A;  1DJG A;  1SYM A;  2LP2 A;  3BUM B;  3PAL A;  5CSJ A;  1KCY A;  3PM2 A;  1K95 A;  1JFK A;  1DVI A;  1EXR A;  2K60 A;  1LA0 A;  1NUB A;  1SL8 A;  1YRT B;  1CDL A;  2QAC A;  4ICB A;  4USL A;  2HQ8 A;  1KSM A;  5CSF A;  2G2B A;  1QWV A;  1TNW A;  2JOJ A;  1R2U A;  3JVT C;  1N0Y A;  1KQM C;  3VB1 A;  1Q80 A;  1XK4 C;  3IQQ A;  2LLS A;  3L4A A;  4INX A;  1S1E A;  3B7A A;  2M0R A;  4WQ2 A;  3R1P A;  2BKH B;  1IWQ A;  1BU3 A;  2PYQ A;  5AEQ A;  3S0E A;  3RZS A;  3DXL A;  2L5Y A;  3PJI A;  2LC5 A;  4PT1 A;  2QDI A;  5B8I B;  1C7W A;  1LVC D;  2EC6 C;  4M2O A;  3S0A A;  3CR5 X;  1QX7 A;  2FJU B;  2LMV A;  2LVK A;  3CR2 A;  1Y1A A;  4MZJ A;  1FI5 A;  1A2X A;  2QEO A;  3CZ0 A;  2Y1M A;  1K90 D;  5ER4 X;  3CS1 A;  4HRE E;  3I5G B;  3KF9 A;  2WCL A;  2JNX A;  1A75 A;  1XFU O;  2ZN8 A;  4N1F A;  1R6P A;  2M3W A;  3EKH A;  3MSE B;  1TIZ A;  3TDI A;  2OTG B;  3D74 A;  3HX4 A;  1K9U A;  4PHK A;  3BUW B;  1KK8 C;  3I5I C;  2KLE A;  1DJW A;  1IH0 A;  1TCF A;  2K0J A;  4XJK A;  2F2P A;  1B8C A;  2JTZ A;  2GV5 A;  4R1E A;  4CPV A;  3D0Y B;  2FOT A;  3DF0 B;  1LIN A;  4YI9 A;  5HLO A;  2EGD A;  1LA3 A;  3FS7 A;  1JSA A;  1PRW A;  1GGW A;  1XK4 A;  2M1U A;  1DC1 A;  2PAS A;  2KQY A;  1A29 A;  1DQE A;  1JWD A;  1B8L A;  3V2L A;  5DKR A;  2LLU A;  1W9Z A;  3WHU B;  5K89 A;  1W7I B;  4ORA B;  2LNK A;  1TCO B;  2BKI B;  1NYA A;  2E30 A;  1QS7 A;  1YUU A;  3I5G C;  1Z2C B;  1IGV A;  2ZRS A;  2KOT A;  3DYE A;  1SPY A;  1UWO A;  2CBL A;  2LCP A;  1CLB A;  2WCB A;  2K2A A;  1UHJ A;  1CMG A;  3IQO A;  3KPX A;  1SSE B; 
#chains in the Genus database with same CATH homology
 2OTG C;  1SL9 A;  1SR6 C;  3TS5 B;  1BLQ A;  2WOR A;  3EK7 A;  5CSI A;  2PRU A;  1NX0 A;  2JXL A;  1BT6 A;  4NQG A;  2K7B A;  4U8D A;  1QAS A;  2IS9 A;  1OOJ A;  2LAN A;  3SG3 A;  3F45 A;  1ZUZ A;  2WCF A;  4YRU A;  1ALV A;  1QAT A;  1QIW A;  4A4B A;  2MBX A;  1C07 A;  2LLT A;  2AUC A;  1NIW A;  4CLN A;  3TZ1 A;  1KWO B;  1BOD A;  1F70 A;  1K96 A;  1YUT A;  3KO0 A;  1BJF A;  4MRX A;  1IQ5 A;  1NSH A;  1F54 A;  1YTZ C;  1XFX O;  1PSR A;  2I94 A;  2NXQ A;  1XYD A;  1TNQ A;  3PFV A;  3PN7 B;  4OV2 A;  3E3R A;  2KI6 D;  1LXF C;  1MXE A;  1SL7 A;  1YVH A;  4PHJ A;  1X02 A;  2L2E A;  2ZNE A;  5TNC A;  5D69 A;  1WRL A;  2BCA A;  3TS5 C;  3JVT B;  5GQQ C;  5HKZ A;  1KQM B;  3LL8 B;  2GGM A;  4MBE A;  2KAV A;  2O5G A;  4PE4 A;  3CLN A;  3DVE A;  1BR4 B;  4GGF C;  1GQM A;  5AFP A;  1OZS A;  1XFW O;  2KGR A;  1PVA A;  3DVM A;  1H4B A;  2Y5I A;  1PK0 D;  1QVI Y;  1WRK A;  4MRY A;  1QX2 A;  1K2H A;  2FCE A;  2JNF A;  1MWN A;  4NDC A;  5D7F A;  2B1U A;  2CT9 A;  4PHM A;  1K94 A;  2FCD A;  1PSB A;  3BOW B;  4DS7 A;  2LUC A;  1D1O A;  1W7J B;  3KEV A;  1TTX A;  1KWO C;  4M2Q A;  3IF7 A;  4PHN A;  3D0Y A;  2ZFD A;  4MN0 A;  3DF0 A;  3SIB A;  5HYD A;  2QPT A;  2JWW A;  1S5G Y;  5KU1 A;  2BCB A;  3AKA A;  4Q04 A;  3LK1 A;  3PN7 C;  2MJW B;  1F8H A;  4UPG A;  1HQV A;  2KYC A;  4MZL A;  2LVI A;  1MXL C;  4OVN F;  1QTX A;  1ALW A;  1DF0 B;  1PAL A;  2OS8 B;  3C1V A;  1B7T Y;  2L0P A;  1AUI B;  4HRE E;  5HLV A;  1KK8 B;  1J1D A;  2F33 A;  1OMD A;  1SY9 A;  2M49 B;  2LM5 A;  3I5I B;  3EVU A;  5BPJ A;  1SCV A;  1NCZ A;  3SG2 A;  1E8A A;  1OQP A;  1BMO A;  5HKY A;  3NXA A;  5G08 A;  1ZAC A;  1YUR A;  2KBI A;  2L4I A;  2I18 A;  2KBM A;  4JWQ A;  1IJ5 A;  4D1E A;  2SAS A;  3NSI A;  4OR9 B;  4GGF A;  1A03 A;  3TDU A;  1JFJ A;  2JT3 A;  2NLN A;  3A4U B;  1GGZ A;  2F8P A;  2KAY A;  1K8U A;  1DJZ A;  3PSR A;  1KSO A;  1QV1 A;  5KTY A;  2CTN A;  4DIR A;  2WCE A;  1XFV O;  1JF0 A;  2RGI A;  3SJS A;  3M0W A;  1G33 A;  1M45 A;  4PAL A;  2KFF A;  2E6W A;  4PE1 A;  1S6J A;  2M7N A;  1SR6 B;  4MVF A;  1HT9 A;  1AJ4 A;  3LK0 A;  2OS8 C;  2SCP A;  4ZCV A;  4ORC B;  3CWG A;  2JXC A;  2LVJ A;  4CFQ A;  1YUS A;  1EL4 A;  3NSO A;  4QJ4 B;  2BL0 C;  1IRJ A;  2K7D A;  2JUL A;  1OE9 B;  3WNX B;  3OHM B;  3CZT X;  5CSN A;  1CFF A;  1L7Z A;  4PE0 A;  1S36 A;  3VRN A;  3BUO B;  1B1G A;  1JUO A;  4BY5 A;  1MQ1 A;  3FWB A;  3NSL A;  2GGZ A;  1G8I A;  1KFX L;  1M39 A;  2K8M B;  4AQI A;  3BOW A;  2BCX A;  1XA5 A;  1Y1U A;  1TNX A;  2PSR A;  4PCW A;  1UHH A;  2K7O A;  3DVK A;  1TRF A;  1RK9 A;  1V1F A;  3FWC A;  2K2F A;  5DKN A;  2NCO A;  1J55 A;  2PMY A;  3VRQ A;  2BEC A;  1SCM C;  1TN4 A;  2ZN9 A;  4XYN A;  2JPT A;  2HQW A;  5ER5 A;  2MLF C;  4C0L A;  1JBA A;  1WY9 A;  4QJ3 B;  5CPV A;  3D10 A;  4GFT A;  1J7R A;  5JJG A;  1DF0 A;  4MLW A;  2M1K B;  4FTG A;  1F71 A;  2K61 A;  2R2I A;  4IL1 A;  3SG4 A;  1YR5 A;  2KI6 C;  1H8B A;  2F3Z A;  1S6C A;  5HKW A;  2KHN A;  4JPZ B;  2LVV A;  4GUK A;  3RM1 A;  2KYF A;  1MR8 A;  3KHE A;  1XFZ O;  3PAT A;  1M63 B;  1CFP A;  1IKU A;  2LHL A;  2M29 A;  2MHH A;  4CFR A;  4ETO A;  4N1G A;  2G9B A;  5AAN A;  5F6T A;  1F4O A;  2AMI A;  3HCM A;  1KK7 Y;  2KGB C;  2P6B B;  2LMT A;  3NSK A;  3ZNI A;  5KSZ A;  2JTT A;  1FBV A;  3GOF A;  4NDB A;  4DRW A;  3H4S E;  2JZI A;  1SK6 D;  2LUX A;  3TUY C;  3VRR A;  3OB2 B;  1QVI Z;  5DKQ A;  3I5F B;  2V53 A;  3BXK A;  1QV0 A;  4DUQ A;  2KSP A;  1NX2 A;  1SRA A;  4A4C A;  1NPQ A;  1CFD A;  1B8R A;  5AER A;  4TNC A;  1CM1 A;  3O4Y A;  1MF8 B;  4PDZ A;  3PM8 A;  2JU0 A;  3LLE A;  3ZWH A;  1QX5 B;  2O60 A;  4AQJ A;  3A8R A;  1K93 D;  1RJV A;  1V1G A;  1CLM A;  1EJ3 A;  1PVB A;  3VRO A;  2F2O A;  2L4H A;  2KNE A;  1N2D A;  1UP5 A;  3O2P A;  4GAO A;  1SKT A;  3VRP A;  1L2O B;  4HSZ A;  1AJ5 A;  2MRD A;  3TDZ A;  3OX5 A;  2L5X B;  5I2Q A;  5IBW A;  1CMF A;  4I5L B;  1F4Q A;  2Q91 A;  2ZND A;  5I2L A;  4QJ5 B;  2NCP A;  2BBN A;  3BQ3 A;  2KI4 B;  1QLS A;  3OX6 A;  4YGC B;  1KFU S;  1B7T Z;  1CDP A;  1M31 A;  1RRO A;  1WRZ A;  2LHI A;  4I5K A;  1CTR A;  2JT0 A;  4GGN A;  1XO5 A;  1VRK A;  1MUX A;  1ZOT B;  3CR4 X;  3CTN A;  1YRU B;  4ZCU A;  2COL B;  1YVL A;  1NCX A;  1A4P A;  3I5F C;  3WXA A;  1EG4 A;  2BL0 B;  2F3Y A;  1N65 A;  2MA2 A;  2Q4U A;  1M46 A;  1QJT A;  1KFX S;  1IJ6 A;  3PLF B;  4HRH A;  3GK4 X;  1XFY O;  1DTL A;  2DOQ A;  1EH2 A;  1WLZ A;  2M97 A;  1NX1 A;  2I7A A;  1J1E A;  2LP3 A;  1CDN A;  1L2O C;  1WDC B;  4DCK A;  2KDH A;  1UHK A;  3EK4 A;  2LE9 B;  3WHT B;  4YI8 A;  3SG7 A;  1SBJ A;  1IQ3 A;  2HET A;  4P2Y B;  4WRI A;  2KI4 C;  4NDD A;  1XVJ A;  2M9G A;  4FQO A;  4I5N B;  3SIA A;  1BOC A;  1SCM B;  4OCI A;  4YGB B;  3SG6 A;  3SG5 A;  1JSA A;  2JC2 A;  1QIV A;  1K9K A;  1BG1 A;  1DGU A;  3BYA A;  1S6I A;  3LCP C;  4E68 A;  4YGE B;  2L51 A;  2WND A;  1B47 A;  1CKK A;  2Y1N A;  3DVJ A;  2H61 C;  2KAX A;  1F55 A;  2H2K A;  1U5I B;  1UUR A;  1KFU L;  3EK8 A;  1AHR A;  3EVV A;  1Y0V H;  1FF1 A;  1BF5 A;  3GK2 A;  1NP8 A;  1B4C A;  4L9M A;  2BBM A;  1FW4 A;  3BUN B;  1WDC C;  4CID A;  3DD4 A;  1J7P A;  2NZ0 A;  4MSP A;  1S3P A;  2Y4Q A;  4GNK B;  2JT8 A;  2M8U A;  2MAZ A;  2WOS A;  1J7Q A;  2ZRT A;  2ISD A;  1CNP A;  3QRX A;  1OMV A;  4HRG A;  1ODB A;  5FYX A;  3AAJ A;  1Y1X A;  1TOP A;  5J3X A;  3TUY B;  1DJY A;  3FIA A;  1C7V A;  1NCY A;  4I5J A;  4GBA A;  1DJI A;  4WQ3 A;  3AKB A;  1OMR A;  2JRF A;  2HPS A;  1SNL A;  1UUS A;  3OB1 B;  1UHN A;  3OP0 A;  2L98 A;  2H61 A;  4C0K A;  4MZK A;  1FI6 A;  1PUL A;  3ICB A;  3JTD B;  1DT7 B;  2BE4 A;  1RWY A;  2VRG A;  1BR1 B;  1CLL A;  2KFG A;  1CB1 A;  1WLM A;  5PAL A;  4P5O E;  3I5H B;  5I8N A;  1AVS A;  4N5X A;  1CFC A;  5JOL A;  1S26 D;  2PVB A;  1NWD A;  2BE6 A;  4JQ0 D;  3VGO A;  1REC A;  2MLE C;  1RTP 1;  1AK8 A;  1KK7 Z;  1UHI A;  2TN4 A;  3EKJ A;  4OKH A;  3BUX B;  4ORB B;  1YX8 A;  1NX3 A;  1A75 B;  1K9P A;  3K21 A;  1QXP A;  2CXJ A;  2I2R E;  3O6B A;  3O78 A;  2LAP A;  1QLK A;  2PAL A;  2L50 A;  1DMO A;  4MEW A;  1ZMZ A;  4F0Z B;  4YGD B;  1JC2 A;  2AAO A;  2WC8 A;  4XJK B;  1KQV A;  1FPW A;  2CCM A;  1OZO A;  4YGA A;  1YX7 A;  1DJH A;  2M7L A;  1OSA A;  1Y6W A;  1JF2 A;  1U5I A;  3RLZ A;  4BY4 A;  2JQ6 A;  3JTD C;  2CNP A;  1S5G Z;  1DJX A;  1GJY A;  3AAK A;  4PE7 A;  1RFJ A;  2K7C A;  2LMU A;  2HF5 A;  1G4Y R;  5AXI A;  1DGV A;  3EVR A;  1EG3 A;  3I5H C;  1IG5 A;  2EHB A;  4AOM A;  1ZFS A;  4C0J A;  2EC6 B;  4YBH B;  3GK1 A;  1J7O A;  1SW8 A;  1B9A A;  1MHO A;  2ZKM X;  1CDM A;  2LV7 A;  2KFH A;  1LKJ A;  4GPL B;  2D8N A;  4M2P A;  1SMG A;  2OPO A;  2A4J A;  1CM4 A;  1TNP A;  5I2O A;  3CGA A;  2KQ6 A;  1AP4 A;  1DJG A;  1SYM A;  2LP2 A;  3BUM B;  3PAL A;  5CSJ A;  1KCY A;  1K95 A;  1JFK A;  1DVI A;  1EXR A;  1LA0 A;  1NUB A;  1SL8 A;  1YRT B;  1CDL A;  2QAC A;  4ICB A;  4USL A;  2HQ8 A;  1KSM A;  5CSF A;  2G2B A;  2JOJ A;  1TNW A;  1R2U A;  3JVT C;  1N0Y A;  1KQM C;  1Q80 A;  1XK4 C;  3IQQ A;  2LLS A;  1S1E A;  4WQ2 A;  2M0R A;  2BKH B;  1IWQ A;  1BU3 A;  5AEQ A;  2LC5 A;  5B8I B;  1C7W A;  1LVC D;  2EC6 C;  4M2O A;  3CR5 X;  1QX7 A;  2FJU B;  2LMV A;  2LVK A;  3CR2 A;  1Y1A A;  4MZJ A;  1FI5 A;  1A2X A;  2Y1M A;  1K90 D;  5ER4 X;  3CS1 A;  3I5G B;  3KF9 A;  2JNX A;  1A75 A;  1XFU O;  2ZN8 A;  4N1F A;  1R6P A;  2M3W A;  3EKH A;  3MSE B;  1TIZ A;  3TDI A;  2OTG B;  3HX4 A;  1K9U A;  4PHK A;  3BUW B;  1KK8 C;  3I5I C;  1DJW A;  1IH0 A;  1TCF A;  2K0J A;  4XJK A;  2F2P A;  1B8C A;  2JTZ A;  2GV5 A;  4R1E A;  4CPV A;  3D0Y B;  2FOT A;  3DF0 B;  1LIN A;  4YI9 A;  5HLO A;  2EGD A;  1LA3 A;  3FS7 A;  1PRW A;  1GGW A;  1XK4 A;  2M1U A;  2PAS A;  2KQY A;  1A29 A;  1JWD A;  1B8L A;  5DKR A;  2LLU A;  5K89 A;  3WHU B;  1W7I B;  4ORA B;  2LNK A;  1TCO B;  2BKI B;  1NYA A;  2E30 A;  1QS7 A;  1YUU A;  3I5G C;  1IGV A;  2ZRS A;  2KOT A;  1SPY A;  1UWO A;  2CBL A;  2LCP A;  1CLB A;  2WCB A;  2K2A A;  1UHJ A;  1CMG A;  3IQO A;  3KPX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...