4PHJA

The structural basis of differential inhibition of human calpain by indole and phenyl alpha-mercaptoacrylic acids: human unliganded protein
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
173
structure length
173
Chain Sequence
b'EEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calpain small subunit 1
publication title The structural basis of differential inhibition of human calpain by indole and phenyl alpha-mercaptoacrylic acids.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 66
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4phjA00
2WORA 1G4YR 1KCYA 4FQOA 1UURA 1M31A 2F3YA 1JUOA 2KYCA 1J7OA 3JTDB 2QACA 2LUCA 1IG5A 2ZNEA 1UWOA 5DKRA 2L50A 1F55A 2H2KA 1WDCB 2Y4QA 4Q04A 3AAJA 2LLSA 1IJ5A 5TNCA 4GFTA 1LA0A 2H61A 1QS7A 3O4YA 2E6WA 4P5OE 4NDDA 2M7LA 1Y0VH 1MUXA 1YUUA 3SIAA 2M7NA 1JF0A 1XA5A 3LLEA 3RM1A 1K8UA 4HRHA 4PHKA 3TDIA 3NSLA 5ER4X 1PVBA 2BECA 3FIAA 1KWOB 1B8LA 2WCEA 1SK6D 5AEQA 4MVFA 1RROA 5AANA 4C0LA 1TOPA 1J7RA 2PALA 1N2DA 3D0YB 4N5XA 4OVNF 2KDHA 2L4IA 2K0JA 1M45A 4M2PA 3DF0B 4GAOA 1ZACA 2G2BA 3CTNA 1XFWO 3KPXA 1QX5B 2L4HA 1OMRA 1B47A 2KI6C 1S5GZ 1CB1A 4YI8A 1AJ5A 1R2UA 1DJZA 3OB2B 5AERA 2TN4A 2CT9A 1SR6B 1QX2A 1TNXA 2ZN8A 3LK0A 5HLOA 1CNPA 2BBNA 2Q4UA 5GQQC 1ALVA 1QXPA 5I2QA 3AAKA 1SCMB 1S6IA 4CFRA 1XK4A 1QLKA 3AKAA 3SG6A 3I5IB 1S3PA 3I5HC 3SG4A 1EJ3A 4ORAB 2M1KB 3TUYC 2AAOA 3JVTC 1NPQA 1NYAA 4CFQA 2PMYA 2K7BA 4DCKA 1EL4A 1NIWA 1PALA 2KSPA 3OX6A 2O60A 1EH2A 2LNKA 3BYAA 1SL7A 1IRJA 2BL0B 1F4OA 2Y1MA 2OS8B 2M97A 5CSNA 5CSFA 3BXKA 4YGEB 4GGFA 1F71A 2AMIA 1BJFA 1TIZA 1CMGA 5I2OA 1NX3A 1F4QA 1F8HA 3GK1A 2H61C 2LVJA 2MJWB 2FOTA 1AUIB 3CS1A 1MQ1A 1KK8B 1DMOA 3IQQA 1YTZC 3SG5A 4CIDA 1FPWA 2L5XB 2K2FA 1F54A 4WQ3A 1TN4A 1NCYA 2I18A 4DUQA 1A75B 1G8IA 3EVRA 1NCXA 4I5JA 4E68A 1YUSA 1ZFSA 4OCIA 2BCXA 1XFVO 4PHNA 2LV7A 4MZKA 2LHLA 4AOMA 1A4PA 2GV5A 1QX7A 4GNKB 2HQ8A 1V1GA 5KTYA 1Y1AA 1OQPA 1EG4A 3PLFB 3D0YA 2KNEA 3VGOA 1TNWA 3TS5B 1FI5A 3DF0A 1L2OC 2JZIA 2BKHB 3DD4A 1AJ4A 1S6CA 2Y1NA 4WRIA 3EK4A 1YX8A 1DJGA 1KQMB 4L9MA 1N65A 3M0WA 1FBVA 3KF9A 1UHKA 1CLLA 1WRKA 2CCMA 3PN7B 4MLWA 2M0RA 2K2AA 1OZSA 1UHJA 1SY9A 1XYDA 5HLVA 1N0YA 3BUXB 1U5IA 4PCWA 2KBIA 2JWWA 1C07A 1DJHA 4M2OA 1FF1A 1RWYA 2L2EA 2BE6A 2KI4B 1B9AA 4HREE 1AK8A 4D1EA 2JTTA 1SPYA 2BE4A 2ZFDA 3OP0A 2WCFA 2I2RE 1RFJA 1CFFA 3JTDC 2L98A 4QJ4B 1YURA 1QV0A 1DJIA 3CWGA 2JXCA 1ZOTB 3I5FB 5DKQA 1WDCC 3DVEA 1RTP1 3NXAA 3EK7A 2ZKMX 4GGFC 1ZMZA 2PSRA 1CFPA 1PSRA 2GGZA 3EVUA 3WXAA 3ZNIA 3GOFA 1YVHA 4QJ5B 5HKYA 2MLEC 1S36A 1X02A 5AXIA 2EGDA 1SNLA 2NZ0A 1EG3A 1Q80A 3PSRA 1XFZO 1A75A 4NDCA 1SRAA 1Y1XA 1DJWA 1EXRA 1KWOC 4PHJA 4JWQA 1DTLA 2LVKA 3PATA 3O78A 2CNPA 2HF5A 2LVVA 1E8AA 3O2PA 3EKJA 3OX5A 1NP8A 1QLSA 5FYXA 5HKZA 1BU3A 3KHEA 1J1EA 2CXJA 5CPVA 3LCPC 1JSAA 1OMVA 1QASA 2LMVA 3BQ3A 1KSOA 3I5GC 3C1VA 3KEVA 4N1GA 2LMTA 1FI6A 2EHBA 3DVJA 1JBAA 1SR6C 2E30A 4PHMA 1K9PA 1RJVA 4MEWA 1QVIZ 2OPOA 1QJTA 1VRKA 5CSIA 3CLNA 2LM5A 3BOWB 2LC5A 1SCMC 4AQJA 3LK1A 3I5IC 1S26D 2M29A 1IH0A 1LINA 1QIWA 1GGWA 1CFDA 2OTGB 4MSPA 2CTNA 4YBHB 2KAXA 1W7JB 5ER5A 4TNCA 4PE0A 2M3WA 1XVJA 1SMGA 3PALA 1V1FA 1XFXO 2GGMA 4BY4A 1FW4A 1TNQA 1UHHA 2JPTA 2I94A 2SCPA 3SJSA 2M9GA 1YUTA 2I7AA 1OE9B 2JT3A 3SG7A 2BL0C 1PVAA 1DJXA 1C7VA 1KFXL 2HPSA 2OS8C 4YI9A 1IGVA 1BR1B 5K89A 3IF7A 2LVIA 2P6BB 1HT9A 2ISDA 5KSZA 1B1GA 3OB1B 1YVLA 2KHNA 1KK8C 1B7TZ 2Y5IA 3CR5X 1DT7B 5PALA 1YRTB 1QV1A 1PULA 2O5GA 3O6BA 1PSBA 1CMFA 1A03A 1LKJA 2KOTA 2K8MB 1IJ6A 1YR5A 5HYDA 3WHUB 2M8UA 1TCFA 3JVTB 1NX1A 2F2PA 1S6JA 1DF0B 1CLMA 2FCEA 1UP5A 3TS5C 3VRQA 1YRUB 3FWCA 2EC6B 4ZCVA 5B8IB 1TRFA 1CKKA 3E3RA 3KO0A 2K7DA 1CTRA 2JU0A 1TTXA 3HCMA 1J1DA 1UHIA 2FJUB 2HETA 1CM1A 1KQMC 1MXEA 2LMUA 3VRPA 5I2LA 2Q91A 3NSIA 3VRRA 5CSJA 4YGAA 4YGDB 1SL9A 3PN7C 4OV2A 1BODA 2LE9B 1IWQA 1KFUL 3MSEB 3BOWA 3FWBA 2JNXA 3RLZA 1KFXS 2BCBA 3A4UB 2KI4C 2HQWA 4BY5A 2KBMA 2PASA 2V53A 1WRZA 3BUWB 1W7IB 4YGBB 4PE7A 1NSHA 1KSMA 1M46A 1D1OA 1SYMA 1YX7A 1WLZA 4HSZA 4AQIA 2KQYA 5DKNA 1S5GY 4FTGA 1A2XA 3F45A 1JF2A 2MA2A 2RGIA 1H8BA 1SKTA 2KGBC 1NWDA 2JNFA 4XJKB 2DOQA 3GK2A 1BG1A 3EK8A 3FS7A 1AP4A 2AUCA 1JC2A 1PK0D 4CLNA 2PRUA 4YRUA 4U8DA 1K2HA 1IQ5A 3A8RA 1NCZA 2ZNDA 2KFHA 3CR2A 2LUXA 3OHMB 3TZ1A 4JQ0D 2JC2A 1GJYA 1K9KA 4I5LB 1DF0A 4R1EA 3ICBA 4YGCB 4NDBA 4XYNA 1XO5A 4I5NB 1WY9A 4GPLB 4I5KA 1KFUS 2LCPA 3CR4X 1IKUA 1J55A 1XFYO 4HRGA 1JFKA 4USLA 1B7TY 2ZRTA 2LLTA 2JT0A 3H4SE 3HX4A 2PVBA 4DIRA 4PE1A 1RECA 4QJ3B 2SASA 4PDZA 2LP2A 2G9BA 1BR4B 2NCOA 1QATA 4ZCUA 3TDZA 2KYFA 2A4JA 1AHRA 2JT8A 1IQ3A 2R2IA 3CGAA 4ORBB 4C0JA 1L7ZA 2OTGC 3BUMB 3D10A 1K96A 1ODBA 1TNPA 2WCBA 2FCDA 1KK7Z 1CDNA 4GUKA 1J7PA 1TCOB 4MRXA 4MZJA 2JULA 3WHTB 1M63B 3LL8B 1SL8A 1G33A 2KQ6A 4A4BA 1NX2A 4A4CA 4ETOA 1MR8A 2WOSA 1DJYA 1SCVA 1DGVA 2L0PA 3I5GB 5G08A 4C0KA 1J7QA 1C7WA 2F8PA 2LLUA 2NCPA 4ICBA 4MZLA 4XJKA 1K93D 4PE4A 1DGUA 3AKBA 4M2QA 3VROA 4DRWA 3PFVA 4P2YB 1BF5A 1JWDA 3SIBA 3GK4X 2KGRA 3IQOA 1BT6A 2F3ZA 4NQGA 3DVMA 1R6PA 1U5IB 1F70A 2MLFC 5IBWA 4OR9B 1CDLA 2MBXA 1OZOA 1RK9A 1QIVA 3VRNA 1WLMA 2LP3A 1BMOA 1LVCD 2JTZA 2LAPA 2M1UA 2KAVA 1UUSA 1MXLC 3I5HB 3WNXB 3TUYB 4F0ZB 3EKHA 2ZN9A 2EC6C 3NSOA 2ZRSA 2K7CA 2KAYA 3EVVA 4ORCB 5J3XA 3SG3A 3NSKA 1BLQA 5AFPA 2K61A 2CBLA 2KI6D 2BCAA 1GGZA 1LXFC 1CDMA 1DVIA 1CM4A 1NUBA 4IL1A 2JQ6A 2JOJA 3ZWHA 2KFGA 1OSAA 1OOJA 2MRDA 2VRGA 5JJGA 3PM8A 2K7OA 1SBJA 1K9UA 1WRLA 1B4CA 1XFUO 1BOCA 1B8CA 1ZUZA 5D7FA 1A29A 3CZTX 4N1FA 1CDPA 3QRXA 4CPVA 4GBAA 1LA3A 3TDUA 4JPZB 4WQ2A 1UHNA 1CFCA 1B8RA 2KFFA 2WC8A 1KQVA 1GQMA 1Y6WA 2BBMA 5HKWA 4OKHA 1K95A 2B1UA 1CLBA 2BKIB 1K94A 2F33A 1PRWA 2M49B 5D69A 1H4BA 5BPJA 2L51A 4UPGA 1S1EA 1ALWA 2QPTA 2NXQA 3I5FC 1MHOA 3BUOB 2LANA 1QVIY 2F2OA 1Y1UA 1L2OB 2JXLA 3K21A 1M39A 1MF8B 4PALA 2NLNA 1NX0A 1SW8A 4GGNA 1K90D 5KU1A 2COLB 2D8NA 2WNDA 1MWNA 4DS7A 1JFJA 2LHIA 3DVKA 1KK7Y 1XK4C 5I8NA 1AVSA 4MBEA 2IS9A 1HQVA 4MRYA 3BUNB 2MAZA 2MHHA 4MN0A 1OMDA 5F6TA 3SG2A 1QTXA 5JOLA 2JRFA
chains in the Genus database with same CATH superfamily
2WORA 1G4YR 1KCYA 4FQOA 1UURA 1M31A 2F3YA 1JUOA 2KYCA 3S0GA 1J7OA 3JTDB 2QACA 2LUCA 1IG5A 2KLDA 2ZNEA 1UWOA 5DKRA 2L50A 1TUJA 1F55A 2H2KA 1WDCB 4PT1A 2Y4QA 4Q04A 3AAJA 2LLSA 1IJ5A 5TNCA 4GFTA 1LA0A 4F7FA 2H61A 1QS7A 3O4YA 2E6WA 4P5OE 4NDDA 2M7LA 1Y0VH 1MUXA 1YUUA 3SIAA 2M7NA 1JF0A 1XA5A 3LLEA 3RM1A 1K8UA 4HRHA 4PHKA 3S0FA 3TDIA 1ORGA 3NSLA 5ER4X 1PVBA 2BECA 3FIAA 1KWOB 1B8LA 3S0BA 2WCEA 1SK6D 2L2CA 5AEQA 4MVFA 1RROA 5AANA 4C0LA 1TOPA 1J7RA 3QMEA 2PALA 1N2DA 3D0YB 4N5XA 4OVNF 2KDHA 2L4IA 2K0JA 1M45A 4M2PA 3DF0B 4GAOA 1ZACA 2G2BA 3CTNA 1XFWO 3KPXA 1QX5B 2L4HA 1OMRA 1B47A 2KI6C 1S5GZ 1CB1A 4YI8A 1AJ5A 1R2UA 1DJZA 3OB2B 5AERA 2TN4A 3B88A 1SR6B 2CT9A 1QX2A 1TNXA 2ZN8A 3LK0A 5HLOA 1CNPA 4JKTA 1C3ZA 2BBNA 2Q4UA 5GQQC 1ALVA 1QXPA 5I2QA 3AAKA 1SCMB 1S6IA 4CFRA 1XK4A 1QLKA 3BFHA 3AKAA 3SG6A 3I5IB 1S3PA 3I5HC 3SG4A 1EJ3A 3N7HA 2M1KB 4ORAB 3TUYC 2AAOA 2QDIA 1DEKA 1NPQA 1NYAA 3JVTC 4CFQA 2PMYA 2K7BA 4DCKA 1EL4A 1NIWA 1PALA 2KSPA 3OX6A 2O60A 2QEOA 1EH2A 2LNKA 3BYAA 3S0AA 3R1OA 3B87A 1SL7A 3CZ1A 1IRJA 2P70A 2L5YA 1QWVA 2BL0B 1F4OA 2Y1MA 2OS8B 2M97A 3D76A 5CSNA 5CSFA 3BXKA 4YGEB 4GGFA 1F71A 2AMIA 5HL1A 1TUZA 1BJFA 1TIZA 1CMGA 5I2OA 1NX3A 1F4QA 1F8HA 3GK1A 2H61C 2LVJA 2MJWB 2FOTA 1AUIB 3CS1A 1MQ1A 1KK8B 1DMOA 3IQQA 1YTZC 3SG5A 4CIDA 1FPWA 2L5XB 2K2FA 1F54A 4WQ3A 1TN4A 1NCYA 2I18A 4DUQA 1A75B 1G8IA 3EVRA 1NCXA 4I5JA 4E68A 4FQTA 1YUSA 1ZFSA 4OCIA 2BCXA 1XFVO 4PHNA 2LV7A 3BFAA 4MZKA 2LHLA 4AOMA 1A4PA 2GV5A 1QX7A 1LS8A 4GNKB 2HQ8A 1V1GA 2FJYA 5KTYA 1Y1AA 1OQPA 1EG4A 3PLFB 5D3OA 3D0YA 2KNEA 3VGOA 1TNWA 3TS5B 1FI5A 3DF0A 1L2OC 2JZIA 2BKHB 3DD4A 1AJ4A 1S6CA 4OZDA 2Y1NA 4WRIA 3EK4A 1YX8A 1DJGA 1KQMB 4L9MA 1N65A 1W9ZA 3M0WA 1FBVA 3KF9A 1UHKA 2QEVA 1CLLA 1WRKA 2CCMA 3PN7B 4MLWA 2M0RA 2K2AA 1OZSA 1UHJA 1SY9A 1XYDA 3PJIA 1N0YA 3DYEA 3S0DA 3BUXB 1U5IA 4PCWA 2KBIA 3CDNA 2JWWA 1C07A 3OGNA 1DJHA 4M2OA 1FF1A 1RWYA 2L2EA 2BE6A 2KI4B 1B9AA 4HREE 3BFBA 4D1EA 2JTTA 1AK8A 1SPYA 2BE4A 2ZFDA 3OP0A 2BNXA 2WCFA 3R1VA 2I2RE 1RFJA 1CFFA 3JTDC 2L98A 4QJ4B 1YURA 1DELA 1QV0A 2WC6A 1DJIA 3CWGA 2PQLA 5DICA 3V2LA 2JXCA 1ZOTB 3I5FB 5DKQA 5EL2A 1WDCC 3DVEA 1RTP1 3NXAA 3EK7A 2ZKMX 4GGFC 1ZMZA 2PSRA 1CFPA 1PSRA 2GGZA 3EVUA 1C3YA 2JPOA 3WXAA 3ZNIA 3GOFA 1YVHA 4QJ5B 3O4XA 5HKYA 2MLEC 1S36A 1X02A 5AXIA 2EGDA 1SNLA 2NZ0A 1EG3A 3DY9A 1Q80A 3PSRA 1XFZO 1A75A 4NDCA 1SRAA 1Y1XA 1DJWA 1EXRA 1KWOC 4PHJA 4JWQA 1DTLA 2LVKA 3PATA 3B6XA 3O78A 2CNPA 3Q8IA 3OBVA 5HLVA 2HF5A 2LVVA 1E8AA 3O2PA 3EKJA 3CZ0A 3OX5A 1NP8A 1QLSA 5FYXA 5HKZA 1BU3A 3KHEA 1J1EA 2CXJA 5CPVA 3LCPC 1JSAA 1OMVA 1QASA 2LMVA 3BQ3A 1KSOA 3I5GC 3C1VA 5FI2A 3KEVA 3CZ2A 4N1GA 2LMTA 1FI6A 2EHBA 3DVJA 1JBAA 1SR6C 2E30A 4PHMA 1K9PA 1RJVA 1OOIX 1QVIZ 2OPOA 1QJTA 1VRKA 3IVTA 4MEWA 5CSIA 3CLNA 2LM5A 3BOWB 2LC5A 1SCMC 4AQJA 3LK1A 3I5IC 1S26D 2M29A 3L4AA 1IH0A 1LINA 1GM0A 1QIWA 1GGWA 1CFDA 2OTGB 4MSPA 2CTNA 4YBHB 2KAXA 1W7JB 2YGUA 5ER5A 4TNCA 4PE0A 2M3WA 1XVJA 1SMGA 3PALA 1V1FA 1XFXO 2GGMA 3PM2A 2QEBA 1FW4A 3D74A 4BY4A 1TNQA 1UHHA 2JPTA 3EG5B 1XFRA 2I94A 2SCPA 3SJSA 2M9GA 1YUTA 2I7AA 1OE9B 2JT3A 3SG7A 2BL0C 1PVAA 1DJXA 3D77A 1C7VA 1KFXL 2HPSA 2OS8C 4YI9A 1IGVA 1BR1B 2QEHA 5K89A 3IF7A 4JD9A 2LVIA 2P6BB 1HT9A 2ISDA 5KSZA 1B1GA 3OB1B 1DC1A 1YVLA 2KHNA 1KK8C 1B7TZ 2Y5IA 2K60A 3CR5X 5PALA 3B86A 1DT7B 3FE6A 1YRTB 1QV1A 1PULA 1SSEB 2O5GA 1PSBA 3O6BA 1CMFA 1A03A 1LKJA 2KOTA 2K8MB 1IJ6A 1YR5A 5HYDA 2KPHA 3WHUB 2M8UA 1TCFA 3JVTB 1NX1A 2F2PA 1S6JA 1DF0B 1CLMA 2FCEA 1UP5A 2P71A 3SS3A 3TS5C 3VRQA 1YRUB 3FWCA 2EC6B 4ZCVA 3UNWA 5B8IB 1TRFA 1CKKA 3E3RA 3KO0A 2K7DA 1CTRA 2JU0A 1TTXA 3HCMA 1J1DA 1UHIA 2FJUB 2HETA 1CM1A 1KQMC 1MXEA 2LMUA 3VRPA 2WC5A 1OOGA 2Q91A 3NSIA 4KYNA 5CSJA 5I2LA 3VRRA 4YGAA 4YGDB 1SL9A 3PN7C 4OV2A 1BODA 2LE9B 1IWQA 1KFUL 3MSEB 3BOWA 3FWBA 2JNXA 2BAPA 3DZTA 3RLZA 1KFXS 2BCBA 3A4UB 2KI4C 2HQWA 4BY5A 2KBMA 3VB1A 2PASA 2V53A 2KLEA 1WRZA 2PYQA 3BUWB 1W7IB 4YGBB 2WCLA 4PE7A 1NSHA 1KSMA 1M46A 1D1OA 1SYMA 1YX7A 1WLZA 4HSZA 5I94A 4AQIA 2KQYA 5DKNA 1S5GY 3BJHA 1DQEA 4FTGA 1A2XA 2ERBA 3F45A 1JF2A 2MA2A 2RGIA 3FE9A 1H8BA 3B7AA 1SKTA 2KGBC 1NWDA 2JNFA 4XJKB 2DOQA 3GK2A 1BG1A 3EK8A 3FS7A 1AP4A 2AUCA 1JC2A 1PK0D 4CLNA 2PRUA 4YRUA 2WCMA 4U8DA 1K2HA 1IQ5A 3A8RA 1NCZA 2ZNDA 4INXA 2KFHA 3CR2A 2LUXA 3OHMB 3TZ1A 1Z2CB 1OOHA 4JQ0D 2JC2A 3CYZA 1GJYA 1K9KA 4I5LB 1DF0A 4R1EA 5FI7A 3ICBA 4YGCB 4NDBA 4XYNA 1XO5A 4I5NB 1WY9A 4GPLB 4I5KA 1KFUS 2LCPA 3CR4X 1IKUA 1J55A 1XFYO 2GTEA 4HRGA 1JFKA 4USLA 1B7TY 2ZRTA 2LLTA 2JT0A 3H4SE 3HX4A 3NGVA 2PVBA 4DIRA 4PE1A 1RECA 4QJ3B 2SASA 1OOFA 4PDZA 2H8VA 2LP2A 2G9BA 1BR4B 2NCOA 1QATA 4ZCUA 3TDZA 2KYFA 2A4JA 1AHRA 2JT8A 1Z4HA 1IQ3A 2R2IA 3CGAA 4ORBB 3NHIA 4C0JA 1L7ZA 2OTGC 3R72A 3BUMB 3D10A 1TWOA 1K96A 1ODBA 1TNPA 2WCBA 2FCDA 3S0EA 1KK7Z 1CDNA 4GUKA 1J7PA 1TCOB 4MRXA 4MZJA 2JULA 3WHTB 1M63B 3LL8B 1SL8A 1G33A 2KQ6A 4A4BA 1NX2A 4A4CA 4ETOA 1MR8A 2WOSA 1DJYA 1SCVA 5FI6A 1DGVA 2L0PA 3I5GB 5G08A 4C0KA 1J7QA 1C7WA 2F8PA 2LLUA 2NCPA 4ICBA 4MZLA 4XJKA 1K93D 4PE4A 1DGUA 3AKBA 4M2QA 3UO9A 3VROA 3PFVA 4P2YB 4DRWA 1JWDA 3SIBA 3GK4X 1OW4A 2KGRA 3IQOA 1BT6A 2F3ZA 4NQGA 3DVMA 1R6PA 1U5IB 1F70A 2MLFC 5IBWA 4OR9B 1CDLA 3K1EA 2MBXA 1OZOA 1RK9A 1QIVA 3VRNA 1WLMA 2LP3A 1BMOA 3DXLA 1LVCD 2JTZA 2LAPA 2M1UA 2KAVA 1UUSA 1P28A 3L47A 1MXLC 3I5HB 2WCHA 3WNXB 3TUYB 4F0ZB 3EKHA 2ZN9A 2EC6C 3D78A 2ZRSA 2K7CA 2KAYA 3EVVA 3NSOA 4ORCB 5J3XA 3NSKA 3SG3A 5AFPA 1BLQA 2K61A 2CBLA 2KI6D 1LXFC 1GGZA 2BCAA 1CDMA 1DVIA 1CM4A 1NUBA 4IL1A 2JQ6A 2JOJA 3R1PA 3ZWHA 2KFGA 1OSAA 1OOJA 2MRDA 2VRGA 5JJGA 1BF5A 3PM8A 2K7OA 1SBJA 1K9UA 1WRLA 1B4CA 1XFUO 1BOCA 1B8CA 1ZUZA 5D7FA 1A29A 3CZTX 4N1FA 1CDPA 3QRXA 4CPVA 3RZSA 4GBAA 1LA3A 3TDUA 4JPZB 4WQ2A 1UHNA 1CFCA 1B8RA 2KFFA 2WC8A 1KQVA 3D75A 1GQMA 1Y6WA 2BBMA 3CABA 1IIOA 5HKWA 4OKHA 1K95A 2B1UA 1CLBA 2BKIB 1K94A 2F33A 1PRWA 2M49B 5D69A 1H4BA 5BPJA 2L51A 4UPGA 1S1EA 1ALWA 2QPTA 2NXQA 3FE8A 4INWA 3I5FC 1MHOA 3NHTA 3D73A 3BUOB 2LANA 1QVIY 2F2OA 1Y1UA 1L2OB 1T14A 2JXLA 3K21A 1M39A 1MF8B 4PALA 2NLNA 1NX0A 1SW8A 4GGNA 3SS5A 1K90D 5KU1A 2COLB 2D8NA 2WNDA 1MWNA 4DS7A 1JFJA 2LHIA 3DVKA 1KK7Y 3L4LA 4IJ7A 1XK4C 2WCKA 5I8NA 1AVSA 4MBEA 2WCJA 2IS9A 3SS4A 1HQVA 4MRYA 3BUNB 2MAZA 2MHHA 4MN0A 1OMDA 5F6TA 3SG2A 1QTXA 5JOLA 2JRFA
chains in the Genus database with same CATH topology
2WORA 1G4YR 1KCYA 4FQOA 1UURA 1M31A 2F3YA 1JUOA 2KYCA 1J7OA 3JTDB 2QACA 2LUCA 1IG5A 2ZNEA 1UWOA 5DKRA 2L50A 1F55A 2H2KA 1WDCB 2Y4QA 4Q04A 3AAJA 2LLSA 1IJ5A 5TNCA 4GFTA 1LA0A 2H61A 1QS7A 3O4YA 2E6WA 4P5OE 4NDDA 2M7LA 1Y0VH 1MUXA 1YUUA 3SIAA 2M7NA 1JF0A 1XA5A 3LLEA 3RM1A 1K8UA 4HRHA 4PHKA 3TDIA 3NSLA 5ER4X 1PVBA 2BECA 3FIAA 1KWOB 1B8LA 2WCEA 1SK6D 5AEQA 4MVFA 1RROA 5AANA 4C0LA 1TOPA 1J7RA 2PALA 1N2DA 3D0YB 4N5XA 4OVNF 2KDHA 2L4IA 2K0JA 1M45A 4M2PA 3DF0B 4GAOA 1ZACA 2G2BA 3CTNA 1XFWO 3KPXA 1QX5B 2L4HA 1OMRA 1B47A 2KI6C 1S5GZ 1CB1A 4YI8A 1AJ5A 1R2UA 1DJZA 3OB2B 5AERA 2TN4A 2CT9A 1SR6B 1QX2A 1TNXA 2ZN8A 3LK0A 5HLOA 1CNPA 2BBNA 2Q4UA 5GQQC 1ALVA 1QXPA 5I2QA 3AAKA 1SCMB 1S6IA 4CFRA 1XK4A 1QLKA 3AKAA 3SG6A 3I5IB 1S3PA 3I5HC 3SG4A 1EJ3A 4ORAB 2M1KB 3TUYC 2AAOA 3JVTC 1NPQA 1NYAA 4CFQA 2PMYA 2K7BA 4DCKA 1EL4A 1NIWA 1PALA 2KSPA 3OX6A 2O60A 1EH2A 2LNKA 3BYAA 1SL7A 1IRJA 2BL0B 1F4OA 2Y1MA 2OS8B 2M97A 5CSNA 5CSFA 3BXKA 4YGEB 4GGFA 1F71A 2AMIA 1BJFA 1TIZA 1CMGA 5I2OA 1NX3A 1F4QA 1F8HA 3GK1A 2H61C 2LVJA 2MJWB 2FOTA 1AUIB 3CS1A 1MQ1A 1KK8B 1DMOA 3IQQA 1YTZC 3SG5A 4CIDA 1FPWA 2L5XB 2K2FA 1F54A 4WQ3A 1TN4A 1NCYA 2I18A 4DUQA 1A75B 1G8IA 3EVRA 1NCXA 4I5JA 4E68A 1YUSA 1ZFSA 4OCIA 2BCXA 1XFVO 4PHNA 2LV7A 4MZKA 2LHLA 4AOMA 1A4PA 2GV5A 1QX7A 4GNKB 2HQ8A 1V1GA 5KTYA 1Y1AA 1OQPA 1EG4A 3PLFB 3D0YA 2KNEA 3VGOA 1TNWA 3TS5B 1FI5A 3DF0A 1L2OC 2JZIA 2BKHB 3DD4A 1AJ4A 1S6CA 2Y1NA 4WRIA 3EK4A 1YX8A 1DJGA 1KQMB 4L9MA 1N65A 3M0WA 1FBVA 3KF9A 1UHKA 1CLLA 1WRKA 2CCMA 3PN7B 4MLWA 2M0RA 2K2AA 1OZSA 1UHJA 1SY9A 1XYDA 5HLVA 1N0YA 3BUXB 1U5IA 4PCWA 2KBIA 2JWWA 1C07A 1DJHA 4M2OA 1FF1A 1RWYA 2L2EA 2BE6A 2KI4B 1B9AA 4HREE 1AK8A 4D1EA 2JTTA 1SPYA 2BE4A 2ZFDA 3OP0A 2WCFA 2I2RE 1RFJA 1CFFA 3JTDC 2L98A 4QJ4B 1YURA 1QV0A 1DJIA 3CWGA 2JXCA 1ZOTB 3I5FB 5DKQA 1WDCC 3DVEA 1RTP1 3NXAA 3EK7A 2ZKMX 4GGFC 1ZMZA 2PSRA 1CFPA 1PSRA 2GGZA 3EVUA 3WXAA 3ZNIA 3GOFA 1YVHA 4QJ5B 5HKYA 2MLEC 1S36A 1X02A 5AXIA 2EGDA 1SNLA 2NZ0A 1EG3A 1Q80A 3PSRA 1XFZO 1A75A 4NDCA 1SRAA 1Y1XA 1DJWA 1EXRA 1KWOC 4PHJA 4JWQA 1DTLA 2LVKA 3PATA 3O78A 2CNPA 2HF5A 2LVVA 1E8AA 3O2PA 3EKJA 3OX5A 1NP8A 1QLSA 5FYXA 5HKZA 1BU3A 3KHEA 1J1EA 2CXJA 5CPVA 3LCPC 1JSAA 1OMVA 1QASA 2LMVA 3BQ3A 1KSOA 3I5GC 3C1VA 3KEVA 4N1GA 2LMTA 1FI6A 2EHBA 3DVJA 1JBAA 1SR6C 2E30A 4PHMA 1K9PA 1RJVA 4MEWA 1QVIZ 2OPOA 1QJTA 1VRKA 5CSIA 3CLNA 2LM5A 3BOWB 2LC5A 1SCMC 4AQJA 3LK1A 3I5IC 1S26D 2M29A 1IH0A 1LINA 1QIWA 1GGWA 1CFDA 2OTGB 4MSPA 2CTNA 4YBHB 2KAXA 1W7JB 5ER5A 4TNCA 4PE0A 2M3WA 1XVJA 1SMGA 3PALA 1V1FA 1XFXO 2GGMA 4BY4A 1FW4A 1TNQA 1UHHA 2JPTA 2I94A 2SCPA 3SJSA 2M9GA 1YUTA 2I7AA 1OE9B 2JT3A 3SG7A 2BL0C 1PVAA 1DJXA 1C7VA 1KFXL 2HPSA 2OS8C 4YI9A 1IGVA 1BR1B 5K89A 3IF7A 2LVIA 2P6BB 1HT9A 2ISDA 5KSZA 1B1GA 3OB1B 1YVLA 2KHNA 1KK8C 1B7TZ 2Y5IA 3CR5X 1DT7B 5PALA 1YRTB 1QV1A 1PULA 2O5GA 3O6BA 1PSBA 1CMFA 1A03A 1LKJA 2KOTA 2K8MB 1IJ6A 1YR5A 5HYDA 3WHUB 2M8UA 1TCFA 3JVTB 1NX1A 2F2PA 1S6JA 1DF0B 1CLMA 2FCEA 1UP5A 3TS5C 3VRQA 1YRUB 3FWCA 2EC6B 4ZCVA 5B8IB 1TRFA 1CKKA 3E3RA 3KO0A 2K7DA 1CTRA 2JU0A 1TTXA 3HCMA 1J1DA 1UHIA 2FJUB 2HETA 1CM1A 1KQMC 1MXEA 2LMUA 3VRPA 5I2LA 2Q91A 3NSIA 3VRRA 5CSJA 4YGAA 4YGDB 1SL9A 3PN7C 4OV2A 1BODA 2LE9B 1IWQA 1KFUL 3MSEB 3BOWA 3FWBA 2JNXA 3RLZA 1KFXS 2BCBA 3A4UB 2KI4C 2HQWA 4BY5A 2KBMA 2PASA 2V53A 1WRZA 3BUWB 1W7IB 4YGBB 4PE7A 1NSHA 1KSMA 1M46A 1D1OA 1SYMA 1YX7A 1WLZA 4HSZA 4AQIA 2KQYA 5DKNA 1S5GY 4FTGA 1A2XA 3F45A 1JF2A 2MA2A 2RGIA 1H8BA 1SKTA 2KGBC 1NWDA 2JNFA 4XJKB 2DOQA 3GK2A 1BG1A 3EK8A 3FS7A 1AP4A 2AUCA 1JC2A 1PK0D 4CLNA 2PRUA 4YRUA 4U8DA 1K2HA 1IQ5A 3A8RA 1NCZA 2ZNDA 2KFHA 3CR2A 2LUXA 3OHMB 3TZ1A 4JQ0D 2JC2A 1GJYA 1K9KA 4I5LB 1DF0A 4R1EA 3ICBA 4YGCB 4NDBA 4XYNA 1XO5A 4I5NB 1WY9A 4GPLB 4I5KA 1KFUS 2LCPA 3CR4X 1IKUA 1J55A 1XFYO 4HRGA 1JFKA 4USLA 1B7TY 2ZRTA 2LLTA 2JT0A 3H4SE 3HX4A 2PVBA 4DIRA 4PE1A 1RECA 4QJ3B 2SASA 4PDZA 2LP2A 2G9BA 1BR4B 2NCOA 1QATA 4ZCUA 3TDZA 2KYFA 2A4JA 1AHRA 2JT8A 1IQ3A 2R2IA 3CGAA 4ORBB 4C0JA 1L7ZA 2OTGC 3BUMB 3D10A 1K96A 1ODBA 1TNPA 2WCBA 2FCDA 1KK7Z 1CDNA 4GUKA 1J7PA 1TCOB 4MRXA 4MZJA 2JULA 3WHTB 1M63B 3LL8B 1SL8A 1G33A 2KQ6A 4A4BA 1NX2A 4A4CA 4ETOA 1MR8A 2WOSA 1DJYA 1SCVA 1DGVA 2L0PA 3I5GB 5G08A 4C0KA 1J7QA 1C7WA 2F8PA 2LLUA 2NCPA 4ICBA 4MZLA 4XJKA 1K93D 4PE4A 1DGUA 3AKBA 4M2QA 3VROA 4DRWA 3PFVA 4P2YB 1BF5A 1JWDA 3SIBA 3GK4X 2KGRA 3IQOA 1BT6A 2F3ZA 4NQGA 3DVMA 1R6PA 1U5IB 1F70A 2MLFC 5IBWA 4OR9B 1CDLA 2MBXA 1OZOA 1RK9A 1QIVA 3VRNA 1WLMA 2LP3A 1BMOA 1LVCD 2JTZA 2LAPA 2M1UA 2KAVA 1UUSA 1MXLC 3I5HB 3WNXB 3TUYB 4F0ZB 3EKHA 2ZN9A 2EC6C 3NSOA 2ZRSA 2K7CA 2KAYA 3EVVA 4ORCB 5J3XA 3SG3A 3NSKA 1BLQA 5AFPA 2K61A 2CBLA 2KI6D 2BCAA 1GGZA 1LXFC 1CDMA 1DVIA 1CM4A 1NUBA 4IL1A 2JQ6A 2JOJA 3ZWHA 2KFGA 1OSAA 1OOJA 2MRDA 2VRGA 5JJGA 3PM8A 2K7OA 1SBJA 1K9UA 1WRLA 1B4CA 1XFUO 1BOCA 1B8CA 1ZUZA 5D7FA 1A29A 3CZTX 4N1FA 1CDPA 3QRXA 4CPVA 4GBAA 1LA3A 3TDUA 4JPZB 4WQ2A 1UHNA 1CFCA 1B8RA 2KFFA 2WC8A 1KQVA 1GQMA 1Y6WA 2BBMA 5HKWA 4OKHA 1K95A 2B1UA 1CLBA 2BKIB 1K94A 2F33A 1PRWA 2M49B 5D69A 1H4BA 5BPJA 2L51A 4UPGA 1S1EA 1ALWA 2QPTA 2NXQA 3I5FC 1MHOA 3BUOB 2LANA 1QVIY 2F2OA 1Y1UA 1L2OB 2JXLA 3K21A 1M39A 1MF8B 4PALA 2NLNA 1NX0A 1SW8A 4GGNA 1K90D 5KU1A 2COLB 2D8NA 2WNDA 1MWNA 4DS7A 1JFJA 2LHIA 3DVKA 1KK7Y 1XK4C 5I8NA 1AVSA 4MBEA 2IS9A 1HQVA 4MRYA 3BUNB 2MAZA 2MHHA 4MN0A 1OMDA 5F6TA 3SG2A 1QTXA 5JOLA 2JRFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WOR A;  1G4Y R;  1KCY A;  4FQO A;  1UUR A;  1M31 A;  2F3Y A;  1JUO A;  2KYC A;  1J7O A;  3JTD B;  2QAC A;  2LUC A;  1IG5 A;  2ZNE A;  1UWO A;  5DKR A;  2L50 A;  1F55 A;  2H2K A;  1WDC B;  2Y4Q A;  4Q04 A;  3AAJ A;  2LLS A;  1IJ5 A;  5TNC A;  4GFT A;  1LA0 A;  2H61 A;  1QS7 A;  3O4Y A;  2E6W A;  4P5O E;  4NDD A;  2M7L A;  1Y0V H;  1MUX A;  1YUU A;  3SIA A;  2M7N A;  1JF0 A;  1XA5 A;  3LLE A;  3RM1 A;  1K8U A;  4HRH A;  4PHK A;  3TDI A;  3NSL A;  5ER4 X;  1PVB A;  2BEC A;  3FIA A;  1KWO B;  1B8L A;  2WCE A;  1SK6 D;  5AEQ A;  4MVF A;  1RRO A;  5AAN A;  4C0L A;  1TOP A;  1J7R A;  2PAL A;  1N2D A;  3D0Y B;  4N5X A;  4OVN F;  2KDH A;  2L4I A;  2K0J A;  1M45 A;  4M2P A;  3DF0 B;  4GAO A;  1ZAC A;  2G2B A;  3CTN A;  1XFW O;  3KPX A;  1QX5 B;  2L4H A;  1OMR A;  1B47 A;  2KI6 C;  1S5G Z;  1CB1 A;  4YI8 A;  1AJ5 A;  1R2U A;  1DJZ A;  3OB2 B;  5AER A;  2TN4 A;  2CT9 A;  1SR6 B;  1QX2 A;  1TNX A;  2ZN8 A;  3LK0 A;  5HLO A;  1CNP A;  2BBN A;  2Q4U A;  5GQQ C;  1ALV A;  1QXP A;  5I2Q A;  3AAK A;  1SCM B;  1S6I A;  4CFR A;  1XK4 A;  1QLK A;  3AKA A;  3SG6 A;  3I5I B;  1S3P A;  3I5H C;  3SG4 A;  1EJ3 A;  4ORA B;  2M1K B;  3TUY C;  2AAO A;  3JVT C;  1NPQ A;  1NYA A;  4CFQ A;  2PMY A;  2K7B A;  4DCK A;  1EL4 A;  1NIW A;  1PAL A;  2KSP A;  3OX6 A;  2O60 A;  1EH2 A;  2LNK A;  3BYA A;  1SL7 A;  1IRJ A;  2BL0 B;  1F4O A;  2Y1M A;  2OS8 B;  2M97 A;  5CSN A;  5CSF A;  3BXK A;  4YGE B;  4GGF A;  1F71 A;  2AMI A;  1BJF A;  1TIZ A;  1CMG A;  5I2O A;  1NX3 A;  1F4Q A;  1F8H A;  3GK1 A;  2H61 C;  2LVJ A;  2MJW B;  2FOT A;  1AUI B;  3CS1 A;  1MQ1 A;  1KK8 B;  1DMO A;  3IQQ A;  1YTZ C;  3SG5 A;  4CID A;  1FPW A;  2L5X B;  2K2F A;  1F54 A;  4WQ3 A;  1TN4 A;  1NCY A;  2I18 A;  4DUQ A;  1A75 B;  1G8I A;  3EVR A;  1NCX A;  4I5J A;  4E68 A;  1YUS A;  1ZFS A;  4OCI A;  2BCX A;  1XFV O;  4PHN A;  2LV7 A;  4MZK A;  2LHL A;  4AOM A;  1A4P A;  2GV5 A;  1QX7 A;  4GNK B;  2HQ8 A;  1V1G A;  5KTY A;  1Y1A A;  1OQP A;  1EG4 A;  3PLF B;  3D0Y A;  2KNE A;  3VGO A;  1TNW A;  3TS5 B;  1FI5 A;  3DF0 A;  1L2O C;  2JZI A;  2BKH B;  3DD4 A;  1AJ4 A;  1S6C A;  2Y1N A;  4WRI A;  3EK4 A;  1YX8 A;  1DJG A;  1KQM B;  4L9M A;  1N65 A;  3M0W A;  1FBV A;  3KF9 A;  1UHK A;  1CLL A;  1WRK A;  2CCM A;  3PN7 B;  4MLW A;  2M0R A;  2K2A A;  1OZS A;  1UHJ A;  1SY9 A;  1XYD A;  5HLV A;  1N0Y A;  3BUX B;  1U5I A;  4PCW A;  2KBI A;  2JWW A;  1C07 A;  1DJH A;  4M2O A;  1FF1 A;  1RWY A;  2L2E A;  2BE6 A;  2KI4 B;  1B9A A;  4HRE E;  1AK8 A;  4D1E A;  2JTT A;  1SPY A;  2BE4 A;  2ZFD A;  3OP0 A;  2WCF A;  2I2R E;  1RFJ A;  1CFF A;  3JTD C;  2L98 A;  4QJ4 B;  1YUR A;  1QV0 A;  1DJI A;  3CWG A;  2JXC A;  1ZOT B;  3I5F B;  5DKQ A;  1WDC C;  3DVE A;  1RTP 1;  3NXA A;  3EK7 A;  2ZKM X;  4GGF C;  1ZMZ A;  2PSR A;  1CFP A;  1PSR A;  2GGZ A;  3EVU A;  3WXA A;  3ZNI A;  3GOF A;  1YVH A;  4QJ5 B;  5HKY A;  2MLE C;  1S36 A;  1X02 A;  5AXI A;  2EGD A;  1SNL A;  2NZ0 A;  1EG3 A;  1Q80 A;  3PSR A;  1XFZ O;  1A75 A;  4NDC A;  1SRA A;  1Y1X A;  1DJW A;  1EXR A;  1KWO C;  4PHJ A;  4JWQ A;  1DTL A;  2LVK A;  3PAT A;  3O78 A;  2CNP A;  2HF5 A;  2LVV A;  1E8A A;  3O2P A;  3EKJ A;  3OX5 A;  1NP8 A;  1QLS A;  5FYX A;  5HKZ A;  1BU3 A;  3KHE A;  1J1E A;  2CXJ A;  5CPV A;  3LCP C;  1JSA A;  1OMV A;  1QAS A;  2LMV A;  3BQ3 A;  1KSO A;  3I5G C;  3C1V A;  3KEV A;  4N1G A;  2LMT A;  1FI6 A;  2EHB A;  3DVJ A;  1JBA A;  1SR6 C;  2E30 A;  4PHM A;  1K9P A;  1RJV A;  4MEW A;  1QVI Z;  2OPO A;  1QJT A;  1VRK A;  5CSI A;  3CLN A;  2LM5 A;  3BOW B;  2LC5 A;  1SCM C;  4AQJ A;  3LK1 A;  3I5I C;  1S26 D;  2M29 A;  1IH0 A;  1LIN A;  1QIW A;  1GGW A;  1CFD A;  2OTG B;  4MSP A;  2CTN A;  4YBH B;  2KAX A;  1W7J B;  5ER5 A;  4TNC A;  4PE0 A;  2M3W A;  1XVJ A;  1SMG A;  3PAL A;  1V1F A;  1XFX O;  2GGM A;  4BY4 A;  1FW4 A;  1TNQ A;  1UHH A;  2JPT A;  2I94 A;  2SCP A;  3SJS A;  2M9G A;  1YUT A;  2I7A A;  1OE9 B;  2JT3 A;  3SG7 A;  2BL0 C;  1PVA A;  1DJX A;  1C7V A;  1KFX L;  2HPS A;  2OS8 C;  4YI9 A;  1IGV A;  1BR1 B;  5K89 A;  3IF7 A;  2LVI A;  2P6B B;  1HT9 A;  2ISD A;  5KSZ A;  1B1G A;  3OB1 B;  1YVL A;  2KHN A;  1KK8 C;  1B7T Z;  2Y5I A;  3CR5 X;  1DT7 B;  5PAL A;  1YRT B;  1QV1 A;  1PUL A;  2O5G A;  3O6B A;  1PSB A;  1CMF A;  1A03 A;  1LKJ A;  2KOT A;  2K8M B;  1IJ6 A;  1YR5 A;  5HYD A;  3WHU B;  2M8U A;  1TCF A;  3JVT B;  1NX1 A;  2F2P A;  1S6J A;  1DF0 B;  1CLM A;  2FCE A;  1UP5 A;  3TS5 C;  3VRQ A;  1YRU B;  3FWC A;  2EC6 B;  4ZCV A;  5B8I B;  1TRF A;  1CKK A;  3E3R A;  3KO0 A;  2K7D A;  1CTR A;  2JU0 A;  1TTX A;  3HCM A;  1J1D A;  1UHI A;  2FJU B;  2HET A;  1CM1 A;  1KQM C;  1MXE A;  2LMU A;  3VRP A;  5I2L A;  2Q91 A;  3NSI A;  3VRR A;  5CSJ A;  4YGA A;  4YGD B;  1SL9 A;  3PN7 C;  4OV2 A;  1BOD A;  2LE9 B;  1IWQ A;  1KFU L;  3MSE B;  3BOW A;  3FWB A;  2JNX A;  3RLZ A;  1KFX S;  2BCB A;  3A4U B;  2KI4 C;  2HQW A;  4BY5 A;  2KBM A;  2PAS A;  2V53 A;  1WRZ A;  3BUW B;  1W7I B;  4YGB B;  4PE7 A;  1NSH A;  1KSM A;  1M46 A;  1D1O A;  1SYM A;  1YX7 A;  1WLZ A;  4HSZ A;  4AQI A;  2KQY A;  5DKN A;  1S5G Y;  4FTG A;  1A2X A;  3F45 A;  1JF2 A;  2MA2 A;  2RGI A;  1H8B A;  1SKT A;  2KGB C;  1NWD A;  2JNF A;  4XJK B;  2DOQ A;  3GK2 A;  1BG1 A;  3EK8 A;  3FS7 A;  1AP4 A;  2AUC A;  1JC2 A;  1PK0 D;  4CLN A;  2PRU A;  4YRU A;  4U8D A;  1K2H A;  1IQ5 A;  3A8R A;  1NCZ A;  2ZND A;  2KFH A;  3CR2 A;  2LUX A;  3OHM B;  3TZ1 A;  4JQ0 D;  2JC2 A;  1GJY A;  1K9K A;  4I5L B;  1DF0 A;  4R1E A;  3ICB A;  4YGC B;  4NDB A;  4XYN A;  1XO5 A;  4I5N B;  1WY9 A;  4GPL B;  4I5K A;  1KFU S;  2LCP A;  3CR4 X;  1IKU A;  1J55 A;  1XFY O;  4HRG A;  1JFK A;  4USL A;  1B7T Y;  2ZRT A;  2LLT A;  2JT0 A;  3H4S E;  3HX4 A;  2PVB A;  4DIR A;  4PE1 A;  1REC A;  4QJ3 B;  2SAS A;  4PDZ A;  2LP2 A;  2G9B A;  1BR4 B;  2NCO A;  1QAT A;  4ZCU A;  3TDZ A;  2KYF A;  2A4J A;  1AHR A;  2JT8 A;  1IQ3 A;  2R2I A;  3CGA A;  4ORB B;  4C0J A;  1L7Z A;  2OTG C;  3BUM B;  3D10 A;  1K96 A;  1ODB A;  1TNP A;  2WCB A;  2FCD A;  1KK7 Z;  1CDN A;  4GUK A;  1J7P A;  1TCO B;  4MRX A;  4MZJ A;  2JUL A;  3WHT B;  1M63 B;  3LL8 B;  1SL8 A;  1G33 A;  2KQ6 A;  4A4B A;  1NX2 A;  4A4C A;  4ETO A;  1MR8 A;  2WOS A;  1DJY A;  1SCV A;  1DGV A;  2L0P A;  3I5G B;  5G08 A;  4C0K A;  1J7Q A;  1C7W A;  2F8P A;  2LLU A;  2NCP A;  4ICB A;  4MZL A;  4XJK A;  1K93 D;  4PE4 A;  1DGU A;  3AKB A;  4M2Q A;  3VRO A;  4DRW A;  3PFV A;  4P2Y B;  1BF5 A;  1JWD A;  3SIB A;  3GK4 X;  2KGR A;  3IQO A;  1BT6 A;  2F3Z A;  4NQG A;  3DVM A;  1R6P A;  1U5I B;  1F70 A;  2MLF C;  5IBW A;  4OR9 B;  1CDL A;  2MBX A;  1OZO A;  1RK9 A;  1QIV A;  3VRN A;  1WLM A;  2LP3 A;  1BMO A;  1LVC D;  2JTZ A;  2LAP A;  2M1U A;  2KAV A;  1UUS A;  1MXL C;  3I5H B;  3WNX B;  3TUY B;  4F0Z B;  3EKH A;  2ZN9 A;  2EC6 C;  3NSO A;  2ZRS A;  2K7C A;  2KAY A;  3EVV A;  4ORC B;  5J3X A;  3SG3 A;  3NSK A;  1BLQ A;  5AFP A;  2K61 A;  2CBL A;  2KI6 D;  2BCA A;  1GGZ A;  1LXF C;  1CDM A;  1DVI A;  1CM4 A;  1NUB A;  4IL1 A;  2JQ6 A;  2JOJ A;  3ZWH A;  2KFG A;  1OSA A;  1OOJ A;  2MRD A;  2VRG A;  5JJG A;  3PM8 A;  2K7O A;  1SBJ A;  1K9U A;  1WRL A;  1B4C A;  1XFU O;  1BOC A;  1B8C A;  1ZUZ A;  5D7F A;  1A29 A;  3CZT X;  4N1F A;  1CDP A;  3QRX A;  4CPV A;  4GBA A;  1LA3 A;  3TDU A;  4JPZ B;  4WQ2 A;  1UHN A;  1CFC A;  1B8R A;  2KFF A;  2WC8 A;  1KQV A;  1GQM A;  1Y6W A;  2BBM A;  5HKW A;  4OKH A;  1K95 A;  2B1U A;  1CLB A;  2BKI B;  1K94 A;  2F33 A;  1PRW A;  2M49 B;  5D69 A;  1H4B A;  5BPJ A;  2L51 A;  4UPG A;  1S1E A;  1ALW A;  2QPT A;  2NXQ A;  3I5F C;  1MHO A;  3BUO B;  2LAN A;  1QVI Y;  2F2O A;  1Y1U A;  1L2O B;  2JXL A;  3K21 A;  1M39 A;  1MF8 B;  4PAL A;  2NLN A;  1NX0 A;  1SW8 A;  4GGN A;  1K90 D;  5KU1 A;  2COL B;  2D8N A;  2WND A;  1MWN A;  4DS7 A;  1JFJ A;  2LHI A;  3DVK A;  1KK7 Y;  1XK4 C;  5I8N A;  1AVS A;  4MBE A;  2IS9 A;  1HQV A;  4MRY A;  3BUN B;  2MAZ A;  2MHH A;  4MN0 A;  1OMD A;  5F6T A;  3SG2 A;  1QTX A;  5JOL A;  2JRF A; 
#chains in the Genus database with same CATH topology
 2WOR A;  1G4Y R;  1KCY A;  4FQO A;  1UUR A;  1M31 A;  2F3Y A;  1JUO A;  2KYC A;  3S0G A;  1J7O A;  3JTD B;  2QAC A;  2LUC A;  1IG5 A;  2KLD A;  2ZNE A;  1UWO A;  5DKR A;  2L50 A;  1TUJ A;  1F55 A;  2H2K A;  1WDC B;  4PT1 A;  2Y4Q A;  4Q04 A;  3AAJ A;  2LLS A;  1IJ5 A;  5TNC A;  4GFT A;  1LA0 A;  4F7F A;  2H61 A;  1QS7 A;  3O4Y A;  2E6W A;  4P5O E;  4NDD A;  2M7L A;  1Y0V H;  1MUX A;  1YUU A;  3SIA A;  2M7N A;  1JF0 A;  1XA5 A;  3LLE A;  3RM1 A;  1K8U A;  4HRH A;  4PHK A;  3S0F A;  3TDI A;  1ORG A;  3NSL A;  5ER4 X;  1PVB A;  2BEC A;  3FIA A;  1KWO B;  1B8L A;  3S0B A;  2WCE A;  1SK6 D;  2L2C A;  5AEQ A;  4MVF A;  1RRO A;  5AAN A;  4C0L A;  1TOP A;  1J7R A;  3QME A;  2PAL A;  1N2D A;  3D0Y B;  4N5X A;  4OVN F;  2KDH A;  2L4I A;  2K0J A;  1M45 A;  4M2P A;  3DF0 B;  4GAO A;  1ZAC A;  2G2B A;  3CTN A;  1XFW O;  3KPX A;  1QX5 B;  2L4H A;  1OMR A;  1B47 A;  2KI6 C;  1S5G Z;  1CB1 A;  4YI8 A;  1AJ5 A;  1R2U A;  1DJZ A;  3OB2 B;  5AER A;  2TN4 A;  3B88 A;  1SR6 B;  2CT9 A;  1QX2 A;  1TNX A;  2ZN8 A;  3LK0 A;  5HLO A;  1CNP A;  4JKT A;  1C3Z A;  2BBN A;  2Q4U A;  5GQQ C;  1ALV A;  1QXP A;  5I2Q A;  3AAK A;  1SCM B;  1S6I A;  4CFR A;  1XK4 A;  1QLK A;  3BFH A;  3AKA A;  3SG6 A;  3I5I B;  1S3P A;  3I5H C;  3SG4 A;  1EJ3 A;  3N7H A;  2M1K B;  4ORA B;  3TUY C;  2AAO A;  2QDI A;  1DEK A;  1NPQ A;  1NYA A;  3JVT C;  4CFQ A;  2PMY A;  2K7B A;  4DCK A;  1EL4 A;  1NIW A;  1PAL A;  2KSP A;  3OX6 A;  2O60 A;  2QEO A;  1EH2 A;  2LNK A;  3BYA A;  3S0A A;  3R1O A;  3B87 A;  1SL7 A;  3CZ1 A;  1IRJ A;  2P70 A;  2L5Y A;  1QWV A;  2BL0 B;  1F4O A;  2Y1M A;  2OS8 B;  2M97 A;  3D76 A;  5CSN A;  5CSF A;  3BXK A;  4YGE B;  4GGF A;  1F71 A;  2AMI A;  5HL1 A;  1TUZ A;  1BJF A;  1TIZ A;  1CMG A;  5I2O A;  1NX3 A;  1F4Q A;  1F8H A;  3GK1 A;  2H61 C;  2LVJ A;  2MJW B;  2FOT A;  1AUI B;  3CS1 A;  1MQ1 A;  1KK8 B;  1DMO A;  3IQQ A;  1YTZ C;  3SG5 A;  4CID A;  1FPW A;  2L5X B;  2K2F A;  1F54 A;  4WQ3 A;  1TN4 A;  1NCY A;  2I18 A;  4DUQ A;  1A75 B;  1G8I A;  3EVR A;  1NCX A;  4I5J A;  4E68 A;  4FQT A;  1YUS A;  1ZFS A;  4OCI A;  2BCX A;  1XFV O;  4PHN A;  2LV7 A;  3BFA A;  4MZK A;  2LHL A;  4AOM A;  1A4P A;  2GV5 A;  1QX7 A;  1LS8 A;  4GNK B;  2HQ8 A;  1V1G A;  2FJY A;  5KTY A;  1Y1A A;  1OQP A;  1EG4 A;  3PLF B;  5D3O A;  3D0Y A;  2KNE A;  3VGO A;  1TNW A;  3TS5 B;  1FI5 A;  3DF0 A;  1L2O C;  2JZI A;  2BKH B;  3DD4 A;  1AJ4 A;  1S6C A;  4OZD A;  2Y1N A;  4WRI A;  3EK4 A;  1YX8 A;  1DJG A;  1KQM B;  4L9M A;  1N65 A;  1W9Z A;  3M0W A;  1FBV A;  3KF9 A;  1UHK A;  2QEV A;  1CLL A;  1WRK A;  2CCM A;  3PN7 B;  4MLW A;  2M0R A;  2K2A A;  1OZS A;  1UHJ A;  1SY9 A;  1XYD A;  3PJI A;  1N0Y A;  3DYE A;  3S0D A;  3BUX B;  1U5I A;  4PCW A;  2KBI A;  3CDN A;  2JWW A;  1C07 A;  3OGN A;  1DJH A;  4M2O A;  1FF1 A;  1RWY A;  2L2E A;  2BE6 A;  2KI4 B;  1B9A A;  4HRE E;  3BFB A;  4D1E A;  2JTT A;  1AK8 A;  1SPY A;  2BE4 A;  2ZFD A;  3OP0 A;  2BNX A;  2WCF A;  3R1V A;  2I2R E;  1RFJ A;  1CFF A;  3JTD C;  2L98 A;  4QJ4 B;  1YUR A;  1DEL A;  1QV0 A;  2WC6 A;  1DJI A;  3CWG A;  2PQL A;  5DIC A;  3V2L A;  2JXC A;  1ZOT B;  3I5F B;  5DKQ A;  5EL2 A;  1WDC C;  3DVE A;  1RTP 1;  3NXA A;  3EK7 A;  2ZKM X;  4GGF C;  1ZMZ A;  2PSR A;  1CFP A;  1PSR A;  2GGZ A;  3EVU A;  1C3Y A;  2JPO A;  3WXA A;  3ZNI A;  3GOF A;  1YVH A;  4QJ5 B;  3O4X A;  5HKY A;  2MLE C;  1S36 A;  1X02 A;  5AXI A;  2EGD A;  1SNL A;  2NZ0 A;  1EG3 A;  3DY9 A;  1Q80 A;  3PSR A;  1XFZ O;  1A75 A;  4NDC A;  1SRA A;  1Y1X A;  1DJW A;  1EXR A;  1KWO C;  4PHJ A;  4JWQ A;  1DTL A;  2LVK A;  3PAT A;  3B6X A;  3O78 A;  2CNP A;  3Q8I A;  3OBV A;  5HLV A;  2HF5 A;  2LVV A;  1E8A A;  3O2P A;  3EKJ A;  3CZ0 A;  3OX5 A;  1NP8 A;  1QLS A;  5FYX A;  5HKZ A;  1BU3 A;  3KHE A;  1J1E A;  2CXJ A;  5CPV A;  3LCP C;  1JSA A;  1OMV A;  1QAS A;  2LMV A;  3BQ3 A;  1KSO A;  3I5G C;  3C1V A;  5FI2 A;  3KEV A;  3CZ2 A;  4N1G A;  2LMT A;  1FI6 A;  2EHB A;  3DVJ A;  1JBA A;  1SR6 C;  2E30 A;  4PHM A;  1K9P A;  1RJV A;  1OOI X;  1QVI Z;  2OPO A;  1QJT A;  1VRK A;  3IVT A;  4MEW A;  5CSI A;  3CLN A;  2LM5 A;  3BOW B;  2LC5 A;  1SCM C;  4AQJ A;  3LK1 A;  3I5I C;  1S26 D;  2M29 A;  3L4A A;  1IH0 A;  1LIN A;  1GM0 A;  1QIW A;  1GGW A;  1CFD A;  2OTG B;  4MSP A;  2CTN A;  4YBH B;  2KAX A;  1W7J B;  2YGU A;  5ER5 A;  4TNC A;  4PE0 A;  2M3W A;  1XVJ A;  1SMG A;  3PAL A;  1V1F A;  1XFX O;  2GGM A;  3PM2 A;  2QEB A;  1FW4 A;  3D74 A;  4BY4 A;  1TNQ A;  1UHH A;  2JPT A;  3EG5 B;  1XFR A;  2I94 A;  2SCP A;  3SJS A;  2M9G A;  1YUT A;  2I7A A;  1OE9 B;  2JT3 A;  3SG7 A;  2BL0 C;  1PVA A;  1DJX A;  3D77 A;  1C7V A;  1KFX L;  2HPS A;  2OS8 C;  4YI9 A;  1IGV A;  1BR1 B;  2QEH A;  5K89 A;  3IF7 A;  4JD9 A;  2LVI A;  2P6B B;  1HT9 A;  2ISD A;  5KSZ A;  1B1G A;  3OB1 B;  1DC1 A;  1YVL A;  2KHN A;  1KK8 C;  1B7T Z;  2Y5I A;  2K60 A;  3CR5 X;  5PAL A;  3B86 A;  1DT7 B;  3FE6 A;  1YRT B;  1QV1 A;  1PUL A;  1SSE B;  2O5G A;  1PSB A;  3O6B A;  1CMF A;  1A03 A;  1LKJ A;  2KOT A;  2K8M B;  1IJ6 A;  1YR5 A;  5HYD A;  2KPH A;  3WHU B;  2M8U A;  1TCF A;  3JVT B;  1NX1 A;  2F2P A;  1S6J A;  1DF0 B;  1CLM A;  2FCE A;  1UP5 A;  2P71 A;  3SS3 A;  3TS5 C;  3VRQ A;  1YRU B;  3FWC A;  2EC6 B;  4ZCV A;  3UNW A;  5B8I B;  1TRF A;  1CKK A;  3E3R A;  3KO0 A;  2K7D A;  1CTR A;  2JU0 A;  1TTX A;  3HCM A;  1J1D A;  1UHI A;  2FJU B;  2HET A;  1CM1 A;  1KQM C;  1MXE A;  2LMU A;  3VRP A;  2WC5 A;  1OOG A;  2Q91 A;  3NSI A;  4KYN A;  5CSJ A;  5I2L A;  3VRR A;  4YGA A;  4YGD B;  1SL9 A;  3PN7 C;  4OV2 A;  1BOD A;  2LE9 B;  1IWQ A;  1KFU L;  3MSE B;  3BOW A;  3FWB A;  2JNX A;  2BAP A;  3DZT A;  3RLZ A;  1KFX S;  2BCB A;  3A4U B;  2KI4 C;  2HQW A;  4BY5 A;  2KBM A;  3VB1 A;  2PAS A;  2V53 A;  2KLE A;  1WRZ A;  2PYQ A;  3BUW B;  1W7I B;  4YGB B;  2WCL A;  4PE7 A;  1NSH A;  1KSM A;  1M46 A;  1D1O A;  1SYM A;  1YX7 A;  1WLZ A;  4HSZ A;  5I94 A;  4AQI A;  2KQY A;  5DKN A;  1S5G Y;  3BJH A;  1DQE A;  4FTG A;  1A2X A;  2ERB A;  3F45 A;  1JF2 A;  2MA2 A;  2RGI A;  3FE9 A;  1H8B A;  3B7A A;  1SKT A;  2KGB C;  1NWD A;  2JNF A;  4XJK B;  2DOQ A;  3GK2 A;  1BG1 A;  3EK8 A;  3FS7 A;  1AP4 A;  2AUC A;  1JC2 A;  1PK0 D;  4CLN A;  2PRU A;  4YRU A;  2WCM A;  4U8D A;  1K2H A;  1IQ5 A;  3A8R A;  1NCZ A;  2ZND A;  4INX A;  2KFH A;  3CR2 A;  2LUX A;  3OHM B;  3TZ1 A;  1Z2C B;  1OOH A;  4JQ0 D;  2JC2 A;  3CYZ A;  1GJY A;  1K9K A;  4I5L B;  1DF0 A;  4R1E A;  5FI7 A;  3ICB A;  4YGC B;  4NDB A;  4XYN A;  1XO5 A;  4I5N B;  1WY9 A;  4GPL B;  4I5K A;  1KFU S;  2LCP A;  3CR4 X;  1IKU A;  1J55 A;  1XFY O;  2GTE A;  4HRG A;  1JFK A;  4USL A;  1B7T Y;  2ZRT A;  2LLT A;  2JT0 A;  3H4S E;  3HX4 A;  3NGV A;  2PVB A;  4DIR A;  4PE1 A;  1REC A;  4QJ3 B;  2SAS A;  1OOF A;  4PDZ A;  2H8V A;  2LP2 A;  2G9B A;  1BR4 B;  2NCO A;  1QAT A;  4ZCU A;  3TDZ A;  2KYF A;  2A4J A;  1AHR A;  2JT8 A;  1Z4H A;  1IQ3 A;  2R2I A;  3CGA A;  4ORB B;  3NHI A;  4C0J A;  1L7Z A;  2OTG C;  3R72 A;  3BUM B;  3D10 A;  1TWO A;  1K96 A;  1ODB A;  1TNP A;  2WCB A;  2FCD A;  3S0E A;  1KK7 Z;  1CDN A;  4GUK A;  1J7P A;  1TCO B;  4MRX A;  4MZJ A;  2JUL A;  3WHT B;  1M63 B;  3LL8 B;  1SL8 A;  1G33 A;  2KQ6 A;  4A4B A;  1NX2 A;  4A4C A;  4ETO A;  1MR8 A;  2WOS A;  1DJY A;  1SCV A;  5FI6 A;  1DGV A;  2L0P A;  3I5G B;  5G08 A;  4C0K A;  1J7Q A;  1C7W A;  2F8P A;  2LLU A;  2NCP A;  4ICB A;  4MZL A;  4XJK A;  1K93 D;  4PE4 A;  1DGU A;  3AKB A;  4M2Q A;  3UO9 A;  3VRO A;  3PFV A;  4P2Y B;  4DRW A;  1JWD A;  3SIB A;  3GK4 X;  1OW4 A;  2KGR A;  3IQO A;  1BT6 A;  2F3Z A;  4NQG A;  3DVM A;  1R6P A;  1U5I B;  1F70 A;  2MLF C;  5IBW A;  4OR9 B;  1CDL A;  3K1E A;  2MBX A;  1OZO A;  1RK9 A;  1QIV A;  3VRN A;  1WLM A;  2LP3 A;  1BMO A;  3DXL A;  1LVC D;  2JTZ A;  2LAP A;  2M1U A;  2KAV A;  1UUS A;  1P28 A;  3L47 A;  1MXL C;  3I5H B;  2WCH A;  3WNX B;  3TUY B;  4F0Z B;  3EKH A;  2ZN9 A;  2EC6 C;  3D78 A;  2ZRS A;  2K7C A;  2KAY A;  3EVV A;  3NSO A;  4ORC B;  5J3X A;  3NSK A;  3SG3 A;  5AFP A;  1BLQ A;  2K61 A;  2CBL A;  2KI6 D;  1LXF C;  1GGZ A;  2BCA A;  1CDM A;  1DVI A;  1CM4 A;  1NUB A;  4IL1 A;  2JQ6 A;  2JOJ A;  3R1P A;  3ZWH A;  2KFG A;  1OSA A;  1OOJ A;  2MRD A;  2VRG A;  5JJG A;  1BF5 A;  3PM8 A;  2K7O A;  1SBJ A;  1K9U A;  1WRL A;  1B4C A;  1XFU O;  1BOC A;  1B8C A;  1ZUZ A;  5D7F A;  1A29 A;  3CZT X;  4N1F A;  1CDP A;  3QRX A;  4CPV A;  3RZS A;  4GBA A;  1LA3 A;  3TDU A;  4JPZ B;  4WQ2 A;  1UHN A;  1CFC A;  1B8R A;  2KFF A;  2WC8 A;  1KQV A;  3D75 A;  1GQM A;  1Y6W A;  2BBM A;  3CAB A;  1IIO A;  5HKW A;  4OKH A;  1K95 A;  2B1U A;  1CLB A;  2BKI B;  1K94 A;  2F33 A;  1PRW A;  2M49 B;  5D69 A;  1H4B A;  5BPJ A;  2L51 A;  4UPG A;  1S1E A;  1ALW A;  2QPT A;  2NXQ A;  3FE8 A;  4INW A;  3I5F C;  1MHO A;  3NHT A;  3D73 A;  3BUO B;  2LAN A;  1QVI Y;  2F2O A;  1Y1U A;  1L2O B;  1T14 A;  2JXL A;  3K21 A;  1M39 A;  1MF8 B;  4PAL A;  2NLN A;  1NX0 A;  1SW8 A;  4GGN A;  3SS5 A;  1K90 D;  5KU1 A;  2COL B;  2D8N A;  2WND A;  1MWN A;  4DS7 A;  1JFJ A;  2LHI A;  3DVK A;  1KK7 Y;  3L4L A;  4IJ7 A;  1XK4 C;  2WCK A;  5I8N A;  1AVS A;  4MBE A;  2WCJ A;  2IS9 A;  3SS4 A;  1HQV A;  4MRY A;  3BUN B;  2MAZ A;  2MHH A;  4MN0 A;  1OMD A;  5F6T A;  3SG2 A;  1QTX A;  5JOL A;  2JRF A; 
#chains in the Genus database with same CATH homology
 2WOR A;  1G4Y R;  1KCY A;  4FQO A;  1UUR A;  1M31 A;  2F3Y A;  1JUO A;  2KYC A;  1J7O A;  3JTD B;  2QAC A;  2LUC A;  1IG5 A;  2ZNE A;  1UWO A;  5DKR A;  2L50 A;  1F55 A;  2H2K A;  1WDC B;  2Y4Q A;  4Q04 A;  3AAJ A;  2LLS A;  1IJ5 A;  5TNC A;  4GFT A;  1LA0 A;  2H61 A;  1QS7 A;  3O4Y A;  2E6W A;  4P5O E;  4NDD A;  2M7L A;  1Y0V H;  1MUX A;  1YUU A;  3SIA A;  2M7N A;  1JF0 A;  1XA5 A;  3LLE A;  3RM1 A;  1K8U A;  4HRH A;  4PHK A;  3TDI A;  3NSL A;  5ER4 X;  1PVB A;  2BEC A;  3FIA A;  1KWO B;  1B8L A;  2WCE A;  1SK6 D;  5AEQ A;  4MVF A;  1RRO A;  5AAN A;  4C0L A;  1TOP A;  1J7R A;  2PAL A;  1N2D A;  3D0Y B;  4N5X A;  4OVN F;  2KDH A;  2L4I A;  2K0J A;  1M45 A;  4M2P A;  3DF0 B;  4GAO A;  1ZAC A;  2G2B A;  3CTN A;  1XFW O;  3KPX A;  1QX5 B;  2L4H A;  1OMR A;  1B47 A;  2KI6 C;  1S5G Z;  1CB1 A;  4YI8 A;  1AJ5 A;  1R2U A;  1DJZ A;  3OB2 B;  5AER A;  2TN4 A;  2CT9 A;  1SR6 B;  1QX2 A;  1TNX A;  2ZN8 A;  3LK0 A;  5HLO A;  1CNP A;  2BBN A;  2Q4U A;  5GQQ C;  1ALV A;  1QXP A;  5I2Q A;  3AAK A;  1SCM B;  1S6I A;  4CFR A;  1XK4 A;  1QLK A;  3AKA A;  3SG6 A;  3I5I B;  1S3P A;  3I5H C;  3SG4 A;  1EJ3 A;  4ORA B;  2M1K B;  3TUY C;  2AAO A;  3JVT C;  1NPQ A;  1NYA A;  4CFQ A;  2PMY A;  2K7B A;  4DCK A;  1EL4 A;  1NIW A;  1PAL A;  2KSP A;  3OX6 A;  2O60 A;  1EH2 A;  2LNK A;  3BYA A;  1SL7 A;  1IRJ A;  2BL0 B;  1F4O A;  2Y1M A;  2OS8 B;  2M97 A;  5CSN A;  5CSF A;  3BXK A;  4YGE B;  4GGF A;  1F71 A;  2AMI A;  1BJF A;  1TIZ A;  1CMG A;  5I2O A;  1NX3 A;  1F4Q A;  1F8H A;  3GK1 A;  2H61 C;  2LVJ A;  2MJW B;  2FOT A;  1AUI B;  3CS1 A;  1MQ1 A;  1KK8 B;  1DMO A;  3IQQ A;  1YTZ C;  3SG5 A;  4CID A;  1FPW A;  2L5X B;  2K2F A;  1F54 A;  4WQ3 A;  1TN4 A;  1NCY A;  2I18 A;  4DUQ A;  1A75 B;  1G8I A;  3EVR A;  1NCX A;  4I5J A;  4E68 A;  1YUS A;  1ZFS A;  4OCI A;  2BCX A;  1XFV O;  4PHN A;  2LV7 A;  4MZK A;  2LHL A;  4AOM A;  1A4P A;  2GV5 A;  1QX7 A;  4GNK B;  2HQ8 A;  1V1G A;  5KTY A;  1Y1A A;  1OQP A;  1EG4 A;  3PLF B;  3D0Y A;  2KNE A;  3VGO A;  1TNW A;  3TS5 B;  1FI5 A;  3DF0 A;  1L2O C;  2JZI A;  2BKH B;  3DD4 A;  1AJ4 A;  1S6C A;  2Y1N A;  4WRI A;  3EK4 A;  1YX8 A;  1DJG A;  1KQM B;  4L9M A;  1N65 A;  3M0W A;  1FBV A;  3KF9 A;  1UHK A;  1CLL A;  1WRK A;  2CCM A;  3PN7 B;  4MLW A;  2M0R A;  2K2A A;  1OZS A;  1UHJ A;  1SY9 A;  1XYD A;  5HLV A;  1N0Y A;  3BUX B;  1U5I A;  4PCW A;  2KBI A;  2JWW A;  1C07 A;  1DJH A;  4M2O A;  1FF1 A;  1RWY A;  2L2E A;  2BE6 A;  2KI4 B;  1B9A A;  4HRE E;  1AK8 A;  4D1E A;  2JTT A;  1SPY A;  2BE4 A;  2ZFD A;  3OP0 A;  2WCF A;  2I2R E;  1RFJ A;  1CFF A;  3JTD C;  2L98 A;  4QJ4 B;  1YUR A;  1QV0 A;  1DJI A;  3CWG A;  2JXC A;  1ZOT B;  3I5F B;  5DKQ A;  1WDC C;  3DVE A;  1RTP 1;  3NXA A;  3EK7 A;  2ZKM X;  4GGF C;  1ZMZ A;  2PSR A;  1CFP A;  1PSR A;  2GGZ A;  3EVU A;  3WXA A;  3ZNI A;  3GOF A;  1YVH A;  4QJ5 B;  5HKY A;  2MLE C;  1S36 A;  1X02 A;  5AXI A;  2EGD A;  1SNL A;  2NZ0 A;  1EG3 A;  1Q80 A;  3PSR A;  1XFZ O;  1A75 A;  4NDC A;  1SRA A;  1Y1X A;  1DJW A;  1EXR A;  1KWO C;  4PHJ A;  4JWQ A;  1DTL A;  2LVK A;  3PAT A;  3O78 A;  2CNP A;  2HF5 A;  2LVV A;  1E8A A;  3O2P A;  3EKJ A;  3OX5 A;  1NP8 A;  1QLS A;  5FYX A;  5HKZ A;  1BU3 A;  3KHE A;  1J1E A;  2CXJ A;  5CPV A;  3LCP C;  1JSA A;  1OMV A;  1QAS A;  2LMV A;  3BQ3 A;  1KSO A;  3I5G C;  3C1V A;  3KEV A;  4N1G A;  2LMT A;  1FI6 A;  2EHB A;  3DVJ A;  1JBA A;  1SR6 C;  2E30 A;  4PHM A;  1K9P A;  1RJV A;  4MEW A;  1QVI Z;  2OPO A;  1QJT A;  1VRK A;  5CSI A;  3CLN A;  2LM5 A;  3BOW B;  2LC5 A;  1SCM C;  4AQJ A;  3LK1 A;  3I5I C;  1S26 D;  2M29 A;  1IH0 A;  1LIN A;  1QIW A;  1GGW A;  1CFD A;  2OTG B;  4MSP A;  2CTN A;  4YBH B;  2KAX A;  1W7J B;  5ER5 A;  4TNC A;  4PE0 A;  2M3W A;  1XVJ A;  1SMG A;  3PAL A;  1V1F A;  1XFX O;  2GGM A;  4BY4 A;  1FW4 A;  1TNQ A;  1UHH A;  2JPT A;  2I94 A;  2SCP A;  3SJS A;  2M9G A;  1YUT A;  2I7A A;  1OE9 B;  2JT3 A;  3SG7 A;  2BL0 C;  1PVA A;  1DJX A;  1C7V A;  1KFX L;  2HPS A;  2OS8 C;  4YI9 A;  1IGV A;  1BR1 B;  5K89 A;  3IF7 A;  2LVI A;  2P6B B;  1HT9 A;  2ISD A;  5KSZ A;  1B1G A;  3OB1 B;  1YVL A;  2KHN A;  1KK8 C;  1B7T Z;  2Y5I A;  3CR5 X;  1DT7 B;  5PAL A;  1YRT B;  1QV1 A;  1PUL A;  2O5G A;  3O6B A;  1PSB A;  1CMF A;  1A03 A;  1LKJ A;  2KOT A;  2K8M B;  1IJ6 A;  1YR5 A;  5HYD A;  3WHU B;  2M8U A;  1TCF A;  3JVT B;  1NX1 A;  2F2P A;  1S6J A;  1DF0 B;  1CLM A;  2FCE A;  1UP5 A;  3TS5 C;  3VRQ A;  1YRU B;  3FWC A;  2EC6 B;  4ZCV A;  5B8I B;  1TRF A;  1CKK A;  3E3R A;  3KO0 A;  2K7D A;  1CTR A;  2JU0 A;  1TTX A;  3HCM A;  1J1D A;  1UHI A;  2FJU B;  2HET A;  1CM1 A;  1KQM C;  1MXE A;  2LMU A;  3VRP A;  5I2L A;  2Q91 A;  3NSI A;  3VRR A;  5CSJ A;  4YGA A;  4YGD B;  1SL9 A;  3PN7 C;  4OV2 A;  1BOD A;  2LE9 B;  1IWQ A;  1KFU L;  3MSE B;  3BOW A;  3FWB A;  2JNX A;  3RLZ A;  1KFX S;  2BCB A;  3A4U B;  2KI4 C;  2HQW A;  4BY5 A;  2KBM A;  2PAS A;  2V53 A;  1WRZ A;  3BUW B;  1W7I B;  4YGB B;  4PE7 A;  1NSH A;  1KSM A;  1M46 A;  1D1O A;  1SYM A;  1YX7 A;  1WLZ A;  4HSZ A;  4AQI A;  2KQY A;  5DKN A;  1S5G Y;  4FTG A;  1A2X A;  3F45 A;  1JF2 A;  2MA2 A;  2RGI A;  1H8B A;  1SKT A;  2KGB C;  1NWD A;  2JNF A;  4XJK B;  2DOQ A;  3GK2 A;  1BG1 A;  3EK8 A;  3FS7 A;  1AP4 A;  2AUC A;  1JC2 A;  1PK0 D;  4CLN A;  2PRU A;  4YRU A;  4U8D A;  1K2H A;  1IQ5 A;  3A8R A;  1NCZ A;  2ZND A;  2KFH A;  3CR2 A;  2LUX A;  3OHM B;  3TZ1 A;  4JQ0 D;  2JC2 A;  1GJY A;  1K9K A;  4I5L B;  1DF0 A;  4R1E A;  3ICB A;  4YGC B;  4NDB A;  4XYN A;  1XO5 A;  4I5N B;  1WY9 A;  4GPL B;  4I5K A;  1KFU S;  2LCP A;  3CR4 X;  1IKU A;  1J55 A;  1XFY O;  4HRG A;  1JFK A;  4USL A;  1B7T Y;  2ZRT A;  2LLT A;  2JT0 A;  3H4S E;  3HX4 A;  2PVB A;  4DIR A;  4PE1 A;  1REC A;  4QJ3 B;  2SAS A;  4PDZ A;  2LP2 A;  2G9B A;  1BR4 B;  2NCO A;  1QAT A;  4ZCU A;  3TDZ A;  2KYF A;  2A4J A;  1AHR A;  2JT8 A;  1IQ3 A;  2R2I A;  3CGA A;  4ORB B;  4C0J A;  1L7Z A;  2OTG C;  3BUM B;  3D10 A;  1K96 A;  1ODB A;  1TNP A;  2WCB A;  2FCD A;  1KK7 Z;  1CDN A;  4GUK A;  1J7P A;  1TCO B;  4MRX A;  4MZJ A;  2JUL A;  3WHT B;  1M63 B;  3LL8 B;  1SL8 A;  1G33 A;  2KQ6 A;  4A4B A;  1NX2 A;  4A4C A;  4ETO A;  1MR8 A;  2WOS A;  1DJY A;  1SCV A;  1DGV A;  2L0P A;  3I5G B;  5G08 A;  4C0K A;  1J7Q A;  1C7W A;  2F8P A;  2LLU A;  2NCP A;  4ICB A;  4MZL A;  4XJK A;  1K93 D;  4PE4 A;  1DGU A;  3AKB A;  4M2Q A;  3VRO A;  4DRW A;  3PFV A;  4P2Y B;  1BF5 A;  1JWD A;  3SIB A;  3GK4 X;  2KGR A;  3IQO A;  1BT6 A;  2F3Z A;  4NQG A;  3DVM A;  1R6P A;  1U5I B;  1F70 A;  2MLF C;  5IBW A;  4OR9 B;  1CDL A;  2MBX A;  1OZO A;  1RK9 A;  1QIV A;  3VRN A;  1WLM A;  2LP3 A;  1BMO A;  1LVC D;  2JTZ A;  2LAP A;  2M1U A;  2KAV A;  1UUS A;  1MXL C;  3I5H B;  3WNX B;  3TUY B;  4F0Z B;  3EKH A;  2ZN9 A;  2EC6 C;  3NSO A;  2ZRS A;  2K7C A;  2KAY A;  3EVV A;  4ORC B;  5J3X A;  3SG3 A;  3NSK A;  1BLQ A;  5AFP A;  2K61 A;  2CBL A;  2KI6 D;  2BCA A;  1GGZ A;  1LXF C;  1CDM A;  1DVI A;  1CM4 A;  1NUB A;  4IL1 A;  2JQ6 A;  2JOJ A;  3ZWH A;  2KFG A;  1OSA A;  1OOJ A;  2MRD A;  2VRG A;  5JJG A;  3PM8 A;  2K7O A;  1SBJ A;  1K9U A;  1WRL A;  1B4C A;  1XFU O;  1BOC A;  1B8C A;  1ZUZ A;  5D7F A;  1A29 A;  3CZT X;  4N1F A;  1CDP A;  3QRX A;  4CPV A;  4GBA A;  1LA3 A;  3TDU A;  4JPZ B;  4WQ2 A;  1UHN A;  1CFC A;  1B8R A;  2KFF A;  2WC8 A;  1KQV A;  1GQM A;  1Y6W A;  2BBM A;  5HKW A;  4OKH A;  1K95 A;  2B1U A;  1CLB A;  2BKI B;  1K94 A;  2F33 A;  1PRW A;  2M49 B;  5D69 A;  1H4B A;  5BPJ A;  2L51 A;  4UPG A;  1S1E A;  1ALW A;  2QPT A;  2NXQ A;  3I5F C;  1MHO A;  3BUO B;  2LAN A;  1QVI Y;  2F2O A;  1Y1U A;  1L2O B;  2JXL A;  3K21 A;  1M39 A;  1MF8 B;  4PAL A;  2NLN A;  1NX0 A;  1SW8 A;  4GGN A;  1K90 D;  5KU1 A;  2COL B;  2D8N A;  2WND A;  1MWN A;  4DS7 A;  1JFJ A;  2LHI A;  3DVK A;  1KK7 Y;  1XK4 C;  5I8N A;  1AVS A;  4MBE A;  2IS9 A;  1HQV A;  4MRY A;  3BUN B;  2MAZ A;  2MHH A;  4MN0 A;  1OMD A;  5F6T A;  3SG2 A;  1QTX A;  5JOL A;  2JRF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...