4PHJA

The structural basis of differential inhibition of human calpain by indole and phenyl alpha-mercaptoacrylic acids: human unliganded protein
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
173
structure length
173
Chain Sequence
EEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Calpain small subunit 1
publication title The structural basis of differential inhibition of human calpain by indole and phenyl alpha-mercaptoacrylic acids.
pubmed doi rcsb
source organism Homo sapiens
total genus 66
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4phjA00
2ZFDA 2KAYA 2BCAA 1L2OC 2JULA 1M46A 4YRUA 1Y1UA 3I5FB 2QACA 4M2PA 2LLSA 3BXKA 1S1EA 1OZSA 1NCYA 1SCVA 3EK7A 1JWDA 4OR9B 1YVHA 1R2UA 1G8IA 1BLQA 1NWDA 1TNPA 1NX0A 2JNXA 4MSPA 4PCWA 2EGDA 4AQJA 1LA3A 4GBAA 1R6PA 2HQWA 1UUSA 3HX4A 4CFQA 3KPXA 4DUQA 3D0YA 1S6CA 2AUCA 3AAJA 5CSJA 2L0PA 1BG1A 4PE7A 1JUOA 1PVBA 1TTXA 2CXJA 2LVJA 1RK9A 1DGUA 1K90D 2JT0A 3SG3A 2V53A 3SG4A 1MF8B 4I5JA 1WRKA 2KI4C 2KNEA 2EC6B 1Y6WA 2OTGC 3I5GB 1HT9A 2I18A 2M7NA 1K9KA 1IWQA 1DJYA 1BF5A 1KFXS 1SCMC 1M63B 1JF2A 5GQQC 3TUYC 1ZOTB 2CT9A 2KI6C 3IF7A 3PN7C 1B8RA 4P5OE 2K7DA 2BE6A 2KI6D 2LHLA 1YRUB 2RGIA 5HYDA 4ZCVA 4I5NB 1OZOA 1RECA 1S5GY 2SASA 4JWQA 4E68A 3SG2A 1F55A 1CDPA 1AK8A 1CDMA 1MHOA 3JTDC 1JC2A 3KF9A 2PSRA 1B8LA 1CTRA 3NSLA 1J7RA 2PVBA 1UHNA 1Y1XA 3GOFA 2JT3A 4GUKA 1KK7Z 1UURA 1TRFA 1F70A 1B47A 2FJUB 2F3ZA 1DJXA 1CM4A 1SMGA 1Y1AA 3O6BA 1CDNA 1AUIB 4OV2A 3GK1A 2M1KB 4GGFA 2NZ0A 1HQVA 1JF0A 1SRAA 4YI8A 5CPVA 1K9PA 2KGRA 1M31A 1LVCD 2GGMA 3IQQA 5HKWA 1GQMA 5AANA 2OS8B 1QX5B 1KSMA 2BBNA 3EKHA 2LC5A 4HREE 2JPTA 4MRYA 2K61A 5TNCA 2JZIA 4R1EA 1PK0D 1ALVA 2JC2A 2D8NA 4FTGA 2R2IA 2KAVA 5IBWA 1CNPA 4M2OA 1IGVA 2BL0B 1BR4B 2HF5A 1NCZA 2ZN9A 1IJ5A 4ORCB 2LUXA 3SIBA 1CFFA 1K9UA 1TOPA 1NUBA 1ZACA 1DF0B 1DF0A 3NSOA 1RFJA 2O60A 2NCPA 1S26D 1EH2A 2OPOA 4MZLA 1SR6B 2JTZA 4WQ3A 5ER4X 1QS7A 2MBXA 4CIDA 4ETOA 4AOMA 1K2HA 3VROA 4HRGA 2B1UA 4M2QA 1E8AA 4A4CA 2Y1NA 4FQOA 1BU3A 1SYMA 2WCFA 4L9MA 3TS5C 4BY4A 5AFPA 1GGWA 3BOWA 4AQIA 2E6WA 2G9BA 1N0YA 1IQ5A 3VRQA 2LUCA 1SL8A 3LCPC 1SK6D 1CLBA 1EXRA 2COLB 1KK8C 3JVTB 4MLWA 1OMVA 3BYAA 1CMGA 1JBAA 1GJYA 3SG7A 3IQOA 1CB1A 2CCMA 4YGAA 2EHBA 1N2DA 3PM8A 4YGBB 1F54A 3OP0A 3I5HC 1S6JA 1UHHA 1IQ3A 4XJKB 4XJKA 1M39A 2I94A 2K7BA 1YRTB 1KQMC 3I5IB 1WDCC 3AKBA 4MZJA 2MLEC 5D7FA 1G33A 1PSRA 2CNPA 3C1VA 3OB2B 1A03A 4N5XA 5J3XA 3BUNB 3SG5A 5KTYA 2M3WA 3D0YB 2BE4A 2E30A 1B1GA 4CLNA 4DIRA 2LMTA 3CR2A 1CM1A 2H2KA 2H61A 2VRGA 3EVUA 1NSHA 2K7CA 4TNCA 4CPVA 1S5GZ 1SY9A 1TCOB 2KBIA 4GNKB 1XFZO 1ZFSA 1BMOA 3I5FC 4QJ5B 2JTTA 1NYAA 3OHMB 4Q04A 1SPYA 4BY5A 3DVEA 1CFCA 4MZKA 1XFVO 3PFVA 4GPLB 1PVAA 1MXEA 1XFWO 1QASA 1ZUZA 2L4HA 2WOSA 3SG6A 2BKHB 5AEQA 1AP4A 2LE9B 1CDLA 1YX7A 3RLZA 2M29A 2PALA 1CFDA 3CLNA 2JOJA 5ER5A 1QV1A 2LANA 1TNWA 3BUXB 1XVJA 1LKJA 3DVMA 3VRPA 5BPJA 1QATA 1MWNA 3LL8B 2Y1MA 1DJWA 4PDZA 1G4YR 3TDIA 4JQ0D 2GV5A 1WRZA 1ALWA 1H4BA 2LVKA 2NXQA 1IKUA 2EC6C 2LHIA 1DMOA 3I5GC 1KFUL 1JFJA 1TNQA 4I5KA 2ISDA 2IS9A 1CMFA 1SW8A 1JFKA 2CBLA 2M7LA 1B7TY 4A4BA 1BT6A 2KHNA 3GK4X 1UHJA 2F2OA 2NLNA 3KO0A 1JSAA 2TN4A 3WNXB 2HETA 4F0ZB 4D1EA 1KWOB 1BODA 1QLSA 1GGZA 1QLKA 3CR5X 4MVFA 4PHKA 1YVLA 3CGAA 3BQ3A 1NCXA 2LVIA 5CSNA 1V1GA 3OX6A 4USLA 3A8RA 2MJWB 1K8UA 1B8CA 4PHNA 3K21A 2F3YA 4GGFC 4YGEB 3WXAA 2QPTA 3WHTB 1J7OA 2WCEA 3FS7A 3DD4A 1K95A 4GAOA 4OCIA 1XFUO 1RJVA 1EG4A 1WY9A 1XK4A 2OS8C 2ZNEA 2ZRTA 2JQ6A 1QV0A 3ZWHA 1EJ3A 2K0JA 2JWWA 2L4IA 1VRKA 3DVJA 2FOTA 2HQ8A 4NDCA 1LINA 1NPQA 3QRXA 2BL0C 3A4UB 5DKRA 1QX7A 1C7VA 4PE4A 1YUSA 3TDZA 1KFUS 1PSBA 1YUTA 1C07A 2PRUA 2LMUA 2M97A 2AAOA 3BOWB 3D10A 4MEWA 2LNKA 2L51A 4WRIA 1Y0VH 2L5XB 4PALA 4YGDB 4C0JA 1AJ4A 4U8DA 5B8IB 2LVVA 4NDBA 1XFYO 2LLUA 1SR6C 4MBEA 1NIWA 1D1OA 2M8UA 1CKKA 1MQ1A 2BKIB 3LLEA 3DF0B 3DF0A 3CR4X 2LP2A 1SNLA 2Y5IA 3H4SE 3BUMB 3CS1A 2AMIA 3O2PA 4DCKA 1N65A 4DRWA 4IL1A 1OSAA 1UHIA 2MHHA 3LK1A 3VGOA 1QVIY 3GK2A 5G08A 1TCFA 4OKHA 5F6TA 4N1FA 1FI6A 2MLFC 2BECA 1TN4A 4NQGA 1F4QA 2JXCA 1OMRA 5HLVA 4UPGA 3EVRA 1YX8A 2M9GA 3BUOB 3VRRA 1UP5A 5I2QA 3M0WA 5I2OA 1FW4A 3JVTC 2KFHA 1IG5A 3OX5A 1KFXL 3WHUB 1OMDA 2LV7A 1QXPA 1SKTA 1DGVA 4OVNF 4N1GA 2JT8A 4PHMA 4YI9A 5PALA 4QJ4B 1ZMZA 3TDUA 1M45A 1KQVA 2Q4UA 4JPZB 1SBJA 1YR5A 2KQYA 5FYXA 3PLFB 1PRWA 1XA5A 1MR8A 1Q80A 1DJGA 3I5IC 2KI4B 3PSRA 2OTGB 5HKYA 1ODBA 4HSZA 2F8PA 5CSIA 1SCMB 3TUYB 1EL4A 1FPWA 3PN7B 2PASA 1NP8A 2LP3A 2MAZA 5KU1A 4YGCB 2H61C 2KDHA 1B7TZ 2DOQA 3KHEA 1WRLA 5AERA 4QJ3B 3JTDB 4XYNA 1XYDA 3E3RA 3EVVA 2L50A 5AXIA 1CFPA 1OQPA 2G2BA 2WORA 2M49B 3BUWB 3PATA 3NXAA 5JJGA 3MSEB 1BR1B 2NCOA 1C7WA 3NSIA 2M0RA 2LLTA 1LXFC 1QIVA 2L2EA 4C0KA 1RROA 2KOTA 3AAKA 5KSZA 1B4CA 1V1FA 2SCPA 1AVSA 5CSFA 1UHKA 2P6BB 3PALA 3CWGA 2ZNDA 5K89A 1LA0A 1MXLC 1AHRA 2M1UA 3O78A 5I2LA 1L7ZA 2Q91A 2HPSA 1J1DA 1J55A 4PHJA 4GFTA 2I7AA 2LAPA 1CLLA 3ZNIA 1IH0A 1PALA 1H8BA 1K96A 1YUUA 2KAXA 2I2RE 1IJ6A 1IRJA 1B9AA 1RWYA 2K2FA 2O5GA 3F45A 4ZCUA 1DTLA 2JXLA 4P2YB 2K7OA 1WLMA 1A4PA 1F71A 3CZTX 2KFGA 2KBMA 1CLMA 1NX3A 4CFRA 1YTZC 1OOJA 3FWBA 1KWOC 2JU0A 1KK7Y 1TNXA 1W7JB 4ORBB 4ORAB 1EG3A 5HKZA 1S6IA 1XO5A 1OE9B 2K2AA 1QIWA 2CTNA 3KEVA 1KCYA 1A29A 3TS5B 2BCXA 3O4YA 1K93D 2F2PA 2FCDA 1FI5A 3EK8A 4ICBA 2KQ6A 3AKAA 1QVIZ 1UWOA 2JRFA 1J7PA 1QTXA 3OB1B 4DS7A 1FF1A 1X02A 2PMYA 1MUXA 2Y4QA 2FCEA 2F33A 1SL9A 1XK4C 1TIZA 1KK8B 2KGBC 1NX2A 2KSPA 1S3PA 3EKJA 3FIAA 2LCPA 2K8MB 4YBHB 3SJSA 4GGNA 1W7IB 1RTP1 1FBVA 1SL7A 3LK0A 1DVIA 1DJZA 3SIAA 2KFFA 2LM5A 1KSOA 1J7QA 2A4JA 1U5IB 1U5IA 4WQ2A 3VRNA 4MRXA 2WCBA 5I8NA 2ZKMX 4NDDA 1QJTA 1PULA 3I5HB 1L2OB 2BBMA 3HCMA 5HLOA 2WNDA 1F4OA 5DKNA 5D69A 1KQMB 1J1EA 2LMVA 2MRDA 1WDCB 2ZRSA 3EK4A 4PE1A 5JOLA 2WC8A 1NX1A 1YURA 4C0LA 3ICBA 2BCBA 1S36A 3TZ1A 2JNFA 1DT7B 3DVKA 1XFXO 2L98A 2GGZA 2ZN8A 1BJFA 1DJIA 3FWCA 1AJ5A 1A2XA 2KYCA 5DKQA 4HRHA 2MA2A 1WLZA 3CTNA 4PE0A 1K94A 4MN0A 1F8HA 1A75B 1BOCA 3NSKA 1A75A 4I5LB 1QX2A 3RM1A 1DJHA 2KYFA
chains in the Genus database with same CATH superfamily
2ZFDA 2KAYA 2BCAA 1L2OC 2JULA 1M46A 4YRUA 1Y1UA 3I5FB 2QACA 4M2PA 2LLSA 3BXKA 1S1EA 1OZSA 1NCYA 1SCVA 3EK7A 1JWDA 4OR9B 1YVHA 1R2UA 4F7FA 1G8IA 3NGVA 1BLQA 1NWDA 1TNPA 1NX0A 2JNXA 4MSPA 4PCWA 2EGDA 4AQJA 1LA3A 4GBAA 1R6PA 2GTEA 2HQWA 1UUSA 3HX4A 3UO9A 4CFQA 3KPXA 4DUQA 3D0YA 1S6CA 2AUCA 3O4XA 3D78A 3AAJA 5CSJA 2L0PA 1BG1A 1ORGA 3BJHA 2QDIA 4PE7A 1JUOA 3NHTA 1PVBA 1TTXA 2CXJA 2LVJA 1RK9A 1DGUA 1K90D 2JT0A 3CZ0A 3S0DA 2V53A 3SG3A 3SG4A 1MF8B 4I5JA 1WRKA 3BFAA 2KI4C 2KNEA 3S0AA 2EC6B 1Y6WA 2OTGC 3B7AA 3I5GB 1HT9A 2I18A 2M7NA 1K9KA 1IWQA 1DJYA 1BF5A 1KFXS 1SCMC 1M63B 1JF2A 5GQQC 3TUYC 1ZOTB 2CT9A 2KI6C 3IF7A 3PN7C 1B8RA 4P5OE 2K7DA 2BE6A 2KI6D 2LHLA 1YRUB 2RGIA 2QEVA 4ZCVA 4I5NB 5HYDA 1OZOA 1RECA 1S5GY 2SASA 3D75A 4JWQA 3SG2A 4E68A 1F55A 1CDPA 1AK8A 1CDMA 1MHOA 3JTDC 1JC2A 3KF9A 2PSRA 3D76A 1B8LA 1CTRA 3NSLA 1J7RA 2PVBA 1UHNA 1Y1XA 3GOFA 2QEHA 2JT3A 4GUKA 1KK7Z 1UURA 1TRFA 1F70A 1B47A 2FJUB 2K60A 2F3ZA 2PQLA 3L4LA 1DJXA 1CM4A 2H8VA 5DICA 1SMGA 1Y1AA 3O6BA 1CDNA 1AUIB 4OV2A 3GK1A 2M1KB 4GGFA 2NZ0A 1HQVA 1JF0A 1SRAA 3K1EA 4YI8A 1K9PA 2KGRA 1LS8A 1M31A 1LVCD 2GGMA 2PYQA 3IQQA 3N7HA 1GQMA 5HKWA 5AANA 2BNXA 2OS8B 1QX5B 1KSMA 2BBNA 3EKHA 2LC5A 4HREE 2JPTA 4MRYA 2K61A 5TNCA 2JZIA 4R1EA 1PK0D 3S0FA 1ALVA 2JC2A 2D8NA 4FTGA 2R2IA 2KAVA 5IBWA 1CNPA 4M2OA 1IGVA 1XFRA 2BL0B 1BR4B 2HF5A 1NCZA 2ZN9A 1IJ5A 4ORCB 2LUXA 3SIBA 1CFFA 1K9UA 1TOPA 1NUBA 1ZACA 1DF0B 1DF0A 2QEOA 3NSOA 1RFJA 3NHIA 2O60A 2NCPA 1S26D 3CABA 1EH2A 2OPOA 4MZLA 1DQEA 1SR6B 2JTZA 3D74A 3CZ1A 4WQ3A 1OOHA 5ER4X 1QS7A 2MBXA 4CIDA 4ETOA 4OZDA 4AOMA 1K2HA 3VROA 4HRGA 3DXLA 2B1UA 4M2QA 1E8AA 4A4CA 2Y1NA 4FQOA 1BU3A 2JPOA 3R1VA 1SYMA 2WCFA 4L9MA 3TS5C 4BY4A 5AFPA 1GGWA 3BOWA 4AQIA 2E6WA 2BAPA 2G9BA 1N0YA 1IQ5A 3VRQA 2LUCA 1SL8A 3LCPC 1SK6D 1CLBA 1EXRA 2COLB 1KK8C 3JVTB 4MLWA 1OMVA 2WCHA 3BYAA 1CMGA 1JBAA 1GJYA 2WCJA 3SG7A 3IQOA 1CB1A 3VB1A 3B86A 2CCMA 4YGAA 2EHBA 1N2DA 3B6XA 3PM8A 4YGBB 1F54A 3DY9A 3OP0A 2WC6A 1S6JA 1UHHA 3I5HC 1IQ3A 4XJKB 4XJKA 4JKTA 1Z2CB 1M39A 2I94A 2K7BA 1YRTB 1KQMC 3I5IB 1TWOA 1WDCC 3AKBA 4MZJA 3UNWA 2MLEC 5D7FA 1G33A 1PSRA 2CNPA 3C1VA 3OB2B 1A03A 4N5XA 5J3XA 3BUNB 3B87A 3SG5A 5KTYA 2M3WA 3D0YB 2BE4A 2E30A 1B1GA 4CLNA 4DIRA 2LMTA 3CR2A 1CM1A 2H2KA 2H61A 2VRGA 3EVUA 1NSHA 2K7CA 3EKJA 4TNCA 1S5GZ 1SY9A 1TCOB 2KBIA 4CPVA 4GNKB 1XFZO 1ZFSA 1BMOA 3I5FC 4QJ5B 2JTTA 1NYAA 3OHMB 4Q04A 1SPYA 4BY5A 1P28A 3DVEA 1CFCA 4MZKA 1XFVO 3PFVA 4GPLB 3PM2A 1PVAA 1MXEA 1XFWO 1QASA 1ZUZA 2L4HA 2WOSA 3SG6A 2BKHB 5AEQA 1AP4A 2LE9B 1CDLA 1YX7A 3QMEA 3RLZA 2M29A 3SS5A 2PALA 1CFDA 3CLNA 2JOJA 5ER5A 3V2LA 1QV1A 2LANA 1TNWA 3BUXB 1XVJA 1LKJA 3DVMA 3VRPA 5BPJA 1C3YA 1QATA 1W9ZA 1MWNA 3LL8B 2Y1MA 1DJWA 1Z4HA 4PDZA 1G4YR 3S0BA 3TDIA 4JQ0D 2GV5A 1WRZA 1ALWA 2L5YA 1DC1A 2LVKA 2NXQA 1IKUA 2EC6C 1H4BA 2LHIA 2L2CA 1DMOA 3I5GC 1KFUL 1JFJA 1TNQA 4I5KA 2ISDA 2IS9A 1CMFA 1SW8A 1JFKA 2CBLA 2M7LA 1B7TY 4PT1A 4A4BA 1BT6A 3L4AA 2KHNA 3GK4X 1UHJA 2F2OA 2NLNA 3KO0A 1JSAA 2YGUA 2TN4A 3WNXB 2HETA 4F0ZB 4D1EA 1KWOB 1BODA 1QLSA 1GGZA 4IJ7A 1QLKA 3CR5X 4MVFA 4PHKA 1YVLA 3CGAA 3BQ3A 1NCXA 2LVIA 5CSNA 2WCLA 1V1GA 3OX6A 3R1OA 4USLA 2P70A 3A8RA 2MJWB 1K8UA 1B8CA 4PHNA 3K21A 2F3YA 4GGFC 4YGEB 3WXAA 2QPTA 3WHTB 1J7OA 2WCEA 3FS7A 3BFBA 1K95A 3DD4A 4GAOA 4OCIA 3R72A 1XFUO 1RJVA 1EG4A 1WY9A 1XK4A 2OS8C 2ZNEA 2ZRTA 2JQ6A 1QV0A 3RZSA 3ZWHA 1EJ3A 2K0JA 2JWWA 2L4IA 1VRKA 3CYZA 3DVJA 2FOTA 2HQ8A 4NDCA 1LINA 1NPQA 3QRXA 2BL0C 3A4UB 5DKRA 1QX7A 1C7VA 4PE4A 1YUSA 3DZTA 1KFUS 1PSBA 1QWVA 1TUJA 1YUTA 2PRUA 3TDZA 2LMUA 2M97A 2AAOA 3BOWB 3CDNA 3D10A 2LNKA 2L51A 4MEWA 1GM0A 4WRIA 1Y0VH 2L5XB 4PALA 4YGDB 4C0JA 1AJ4A 3FE8A 4U8DA 3OBVA 3SS4A 3R1PA 5B8IB 2LVVA 4NDBA 1XFYO 2LLUA 1SR6C 4MBEA 1NIWA 1D1OA 2M8UA 1CKKA 5I94A 1OOIX 1MQ1A 2BKIB 3LLEA 4FQTA 3DF0B 3SS3A 3DF0A 3EG5B 3CR4X 2LP2A 1SNLA 2Y5IA 3D73A 3H4SE 3BUMB 3CS1A 2AMIA 3O2PA 4DCKA 1N65A 2QEBA 4DRWA 4IL1A 1OSAA 1UHIA 2MHHA 3LK1A 1IIOA 3S0EA 3VGOA 1QVIY 3GK2A 5G08A 1TCFA 4OKHA 5F6TA 4N1FA 1FI6A 2MLFC 2BECA 1TN4A 4NQGA 1F4QA 2JXCA 1OMRA 5HLVA 4UPGA 3EVRA 1YX8A 3Q8IA 2M9GA 3BUOB 3FE9A 1UP5A 3VRRA 5I2QA 3M0WA 5I2OA 1FW4A 3JVTC 2KPHA 2KFHA 1IG5A 3OX5A 1KFXL 3WHUB 1OMDA 2LV7A 1QXPA 1SKTA 1DGVA 4KYNA 4OVNF 4N1GA 2JT8A 4PHMA 4YI9A 5PALA 4QJ4B 1ZMZA 4INXA 3TDUA 1OOGA 3PJIA 1M45A 1KQVA 1DELA 2Q4UA 1SBJA 4JPZB 1YR5A 2KQYA 5FYXA 3PLFB 5HL1A 1PRWA 1XA5A 1MR8A 1Q80A 1DJGA 3I5IC 2KI4B 3CZ2A 2OTGB 3PSRA 5HKYA 2WC5A 1ODBA 4HSZA 2F8PA 5CSIA 5FI7A 1SCMB 3TUYB 1EL4A 1FPWA 3PN7B 2PASA 1NP8A 2LP3A 2MAZA 5KU1A 4YGCB 2H61C 2KDHA 1B7TZ 2DOQA 3KHEA 1WRLA 5AERA 4QJ3B 3JTDB 2KLEA 4XYNA 1XYDA 3E3RA 3EVVA 2L50A 5AXIA 1CFPA 1OQPA 1SSEB 5EL2A 2G2BA 2WORA 2M49B 3BUWB 3PATA 3NXAA 5JJGA 1DEKA 3MSEB 1BR1B 2NCOA 5D3OA 1C7WA 3NSIA 2M0RA 2LLTA 1LXFC 1QIVA 2L2EA 4C0KA 3D77A 1RROA 2KOTA 3AAKA 5KSZA 1B4CA 3DYEA 1V1FA 2SCPA 1AVSA 2KLDA 5CSFA 1UHKA 2P6BB 3PALA 3CWGA 5FI2A 5FI6A 2ZNDA 5K89A 1LA0A 1MXLC 1AHRA 2M1UA 3O78A 5I2LA 1L7ZA 2Q91A 2HPSA 1J1DA 1J55A 3FE6A 4PHJA 4GFTA 2I7AA 2LAPA 3OGNA 1CLLA 3ZNIA 1IH0A 1PALA 1H8BA 1K96A 1YUUA 2WCMA 2KAXA 2I2RE 1IJ6A 4JD9A 1IRJA 1B9AA 1RWYA 2K2FA 2O5GA 3F45A 2WCKA 4ZCUA 1DTLA 2JXLA 4P2YB 2K7OA 1WLMA 1A4PA 1F71A 3CZTX 2KFGA 2KBMA 1CLMA 1NX3A 1OW4A 4CFRA 1YTZC 1OOJA 3FWBA 1KWOC 2JU0A 1KK7Y 1TNXA 1W7JB 4ORBB 4ORAB 1EG3A 5HKZA 1S6IA 1XO5A 1OE9B 2K2AA 3B88A 1QIWA 2CTNA 3KEVA 3L47A 1A29A 1KCYA 3TS5B 4INWA 2BCXA 3O4YA 1K93D 2F2PA 2FCDA 1FI5A 3EK8A 4ICBA 2KQ6A 3AKAA 1QVIZ 1UWOA 1T14A 3IVTA 2JRFA 1J7PA 1QTXA 3OB1B 4DS7A 1FF1A 1X02A 2PMYA 1MUXA 2Y4QA 2FCEA 2F33A 1SL9A 1XK4C 1TIZA 1KK8B 2KGBC 1NX2A 2KSPA 1OOFA 1S3PA 2P71A 2LCPA 2K8MB 3FIAA 4YBHB 5CPVA 3S0GA 3SJSA 4GGNA 1W7IB 1RTP1 1FBVA 1SL7A 3LK0A 1DVIA 1DJZA 3SIAA 2KFFA 2LM5A 1KSOA 1J7QA 2A4JA 1U5IB 1U5IA 4WQ2A 3VRNA 4MRXA 2WCBA 5I8NA 2ZKMX 4NDDA 1QJTA 1PULA 3I5HB 1L2OB 2BBMA 3BFHA 3HCMA 2WNDA 5HLOA 1F4OA 5DKNA 5D69A 2FJYA 1KQMB 2ERBA 1J1EA 2LMVA 1TUZA 1WDCB 2MRDA 2ZRSA 3EK4A 4PE1A 5JOLA 2WC8A 1NX1A 1YURA 4C0LA 1C3ZA 2BCBA 3ICBA 1S36A 3TZ1A 2JNFA 1DT7B 3DVKA 1XFXO 2L98A 2GGZA 2ZN8A 1BJFA 1DJIA 3FWCA 1AJ5A 1A2XA 2KYCA 5DKQA 4HRHA 2MA2A 1WLZA 3CTNA 4PE0A 1K94A 4MN0A 1C07A 1F8HA 1A75B 1BOCA 3NSKA 1A75A 4I5LB 1QX2A 3RM1A 1DJHA 2KYFA
chains in the Genus database with same CATH topology
2ZFDA 2KAYA 2BCAA 1L2OC 2JULA 1M46A 4YRUA 1Y1UA 3I5FB 2QACA 4M2PA 2LLSA 3BXKA 1S1EA 1OZSA 1NCYA 1SCVA 3EK7A 1JWDA 4OR9B 1YVHA 1R2UA 1G8IA 1BLQA 1NWDA 1TNPA 1NX0A 2JNXA 4MSPA 4PCWA 2EGDA 4AQJA 1LA3A 4GBAA 1R6PA 2HQWA 1UUSA 3HX4A 4CFQA 3KPXA 4DUQA 3D0YA 1S6CA 2AUCA 3AAJA 5CSJA 2L0PA 1BG1A 4PE7A 1JUOA 1PVBA 1TTXA 2CXJA 2LVJA 1RK9A 1DGUA 1K90D 2JT0A 3SG3A 2V53A 3SG4A 1MF8B 4I5JA 1WRKA 2KI4C 2KNEA 2EC6B 1Y6WA 2OTGC 3I5GB 1HT9A 2I18A 2M7NA 1K9KA 1IWQA 1DJYA 1BF5A 1KFXS 1SCMC 1M63B 1JF2A 5GQQC 3TUYC 1ZOTB 2CT9A 2KI6C 3IF7A 3PN7C 1B8RA 4P5OE 2K7DA 2BE6A 2KI6D 2LHLA 1YRUB 2RGIA 5HYDA 4ZCVA 4I5NB 1OZOA 1RECA 1S5GY 2SASA 4JWQA 4E68A 3SG2A 1F55A 1CDPA 1AK8A 1CDMA 1MHOA 3JTDC 1JC2A 3KF9A 2PSRA 1B8LA 1CTRA 3NSLA 1J7RA 2PVBA 1UHNA 1Y1XA 3GOFA 2JT3A 4GUKA 1KK7Z 1UURA 1TRFA 1F70A 1B47A 2FJUB 2F3ZA 1DJXA 1CM4A 1SMGA 1Y1AA 3O6BA 1CDNA 1AUIB 4OV2A 3GK1A 2M1KB 4GGFA 2NZ0A 1HQVA 1JF0A 1SRAA 4YI8A 5CPVA 1K9PA 2KGRA 1M31A 1LVCD 2GGMA 3IQQA 5HKWA 1GQMA 5AANA 2OS8B 1QX5B 1KSMA 2BBNA 3EKHA 2LC5A 4HREE 2JPTA 4MRYA 2K61A 5TNCA 2JZIA 4R1EA 1PK0D 1ALVA 2JC2A 2D8NA 4FTGA 2R2IA 2KAVA 5IBWA 1CNPA 4M2OA 1IGVA 2BL0B 1BR4B 2HF5A 1NCZA 2ZN9A 1IJ5A 4ORCB 2LUXA 3SIBA 1CFFA 1K9UA 1TOPA 1NUBA 1ZACA 1DF0B 1DF0A 3NSOA 1RFJA 2O60A 2NCPA 1S26D 1EH2A 2OPOA 4MZLA 1SR6B 2JTZA 4WQ3A 5ER4X 1QS7A 2MBXA 4CIDA 4ETOA 4AOMA 1K2HA 3VROA 4HRGA 2B1UA 4M2QA 1E8AA 4A4CA 2Y1NA 4FQOA 1BU3A 1SYMA 2WCFA 4L9MA 3TS5C 4BY4A 5AFPA 1GGWA 3BOWA 4AQIA 2E6WA 2G9BA 1N0YA 1IQ5A 3VRQA 2LUCA 1SL8A 3LCPC 1SK6D 1CLBA 1EXRA 2COLB 1KK8C 3JVTB 4MLWA 1OMVA 3BYAA 1CMGA 1JBAA 1GJYA 3SG7A 3IQOA 1CB1A 2CCMA 4YGAA 2EHBA 1N2DA 3PM8A 4YGBB 1F54A 3OP0A 3I5HC 1S6JA 1UHHA 1IQ3A 4XJKB 4XJKA 1M39A 2I94A 2K7BA 1YRTB 1KQMC 3I5IB 1WDCC 3AKBA 4MZJA 2MLEC 5D7FA 1G33A 1PSRA 2CNPA 3C1VA 3OB2B 1A03A 4N5XA 5J3XA 3BUNB 3SG5A 5KTYA 2M3WA 3D0YB 2BE4A 2E30A 1B1GA 4CLNA 4DIRA 2LMTA 3CR2A 1CM1A 2H2KA 2H61A 2VRGA 3EVUA 1NSHA 2K7CA 4TNCA 4CPVA 1S5GZ 1SY9A 1TCOB 2KBIA 4GNKB 1XFZO 1ZFSA 1BMOA 3I5FC 4QJ5B 2JTTA 1NYAA 3OHMB 4Q04A 1SPYA 4BY5A 3DVEA 1CFCA 4MZKA 1XFVO 3PFVA 4GPLB 1PVAA 1MXEA 1XFWO 1QASA 1ZUZA 2L4HA 2WOSA 3SG6A 2BKHB 5AEQA 1AP4A 2LE9B 1CDLA 1YX7A 3RLZA 2M29A 2PALA 1CFDA 3CLNA 2JOJA 5ER5A 1QV1A 2LANA 1TNWA 3BUXB 1XVJA 1LKJA 3DVMA 3VRPA 5BPJA 1QATA 1MWNA 3LL8B 2Y1MA 1DJWA 4PDZA 1G4YR 3TDIA 4JQ0D 2GV5A 1WRZA 1ALWA 1H4BA 2LVKA 2NXQA 1IKUA 2EC6C 2LHIA 1DMOA 3I5GC 1KFUL 1JFJA 1TNQA 4I5KA 2ISDA 2IS9A 1CMFA 1SW8A 1JFKA 2CBLA 2M7LA 1B7TY 4A4BA 1BT6A 2KHNA 3GK4X 1UHJA 2F2OA 2NLNA 3KO0A 1JSAA 2TN4A 3WNXB 2HETA 4F0ZB 4D1EA 1KWOB 1BODA 1QLSA 1GGZA 1QLKA 3CR5X 4MVFA 4PHKA 1YVLA 3CGAA 3BQ3A 1NCXA 2LVIA 5CSNA 1V1GA 3OX6A 4USLA 3A8RA 2MJWB 1K8UA 1B8CA 4PHNA 3K21A 2F3YA 4GGFC 4YGEB 3WXAA 2QPTA 3WHTB 1J7OA 2WCEA 3FS7A 3DD4A 1K95A 4GAOA 4OCIA 1XFUO 1RJVA 1EG4A 1WY9A 1XK4A 2OS8C 2ZNEA 2ZRTA 2JQ6A 1QV0A 3ZWHA 1EJ3A 2K0JA 2JWWA 2L4IA 1VRKA 3DVJA 2FOTA 2HQ8A 4NDCA 1LINA 1NPQA 3QRXA 2BL0C 3A4UB 5DKRA 1QX7A 1C7VA 4PE4A 1YUSA 3TDZA 1KFUS 1PSBA 1YUTA 1C07A 2PRUA 2LMUA 2M97A 2AAOA 3BOWB 3D10A 4MEWA 2LNKA 2L51A 4WRIA 1Y0VH 2L5XB 4PALA 4YGDB 4C0JA 1AJ4A 4U8DA 5B8IB 2LVVA 4NDBA 1XFYO 2LLUA 1SR6C 4MBEA 1NIWA 1D1OA 2M8UA 1CKKA 1MQ1A 2BKIB 3LLEA 3DF0B 3DF0A 3CR4X 2LP2A 1SNLA 2Y5IA 3H4SE 3BUMB 3CS1A 2AMIA 3O2PA 4DCKA 1N65A 4DRWA 4IL1A 1OSAA 1UHIA 2MHHA 3LK1A 3VGOA 1QVIY 3GK2A 5G08A 1TCFA 4OKHA 5F6TA 4N1FA 1FI6A 2MLFC 2BECA 1TN4A 4NQGA 1F4QA 2JXCA 1OMRA 5HLVA 4UPGA 3EVRA 1YX8A 2M9GA 3BUOB 3VRRA 1UP5A 5I2QA 3M0WA 5I2OA 1FW4A 3JVTC 2KFHA 1IG5A 3OX5A 1KFXL 3WHUB 1OMDA 2LV7A 1QXPA 1SKTA 1DGVA 4OVNF 4N1GA 2JT8A 4PHMA 4YI9A 5PALA 4QJ4B 1ZMZA 3TDUA 1M45A 1KQVA 2Q4UA 4JPZB 1SBJA 1YR5A 2KQYA 5FYXA 3PLFB 1PRWA 1XA5A 1MR8A 1Q80A 1DJGA 3I5IC 2KI4B 3PSRA 2OTGB 5HKYA 1ODBA 4HSZA 2F8PA 5CSIA 1SCMB 3TUYB 1EL4A 1FPWA 3PN7B 2PASA 1NP8A 2LP3A 2MAZA 5KU1A 4YGCB 2H61C 2KDHA 1B7TZ 2DOQA 3KHEA 1WRLA 5AERA 4QJ3B 3JTDB 4XYNA 1XYDA 3E3RA 3EVVA 2L50A 5AXIA 1CFPA 1OQPA 2G2BA 2WORA 2M49B 3BUWB 3PATA 3NXAA 5JJGA 3MSEB 1BR1B 2NCOA 1C7WA 3NSIA 2M0RA 2LLTA 1LXFC 1QIVA 2L2EA 4C0KA 1RROA 2KOTA 3AAKA 5KSZA 1B4CA 1V1FA 2SCPA 1AVSA 5CSFA 1UHKA 2P6BB 3PALA 3CWGA 2ZNDA 5K89A 1LA0A 1MXLC 1AHRA 2M1UA 3O78A 5I2LA 1L7ZA 2Q91A 2HPSA 1J1DA 1J55A 4PHJA 4GFTA 2I7AA 2LAPA 1CLLA 3ZNIA 1IH0A 1PALA 1H8BA 1K96A 1YUUA 2KAXA 2I2RE 1IJ6A 1IRJA 1B9AA 1RWYA 2K2FA 2O5GA 3F45A 4ZCUA 1DTLA 2JXLA 4P2YB 2K7OA 1WLMA 1A4PA 1F71A 3CZTX 2KFGA 2KBMA 1CLMA 1NX3A 4CFRA 1YTZC 1OOJA 3FWBA 1KWOC 2JU0A 1KK7Y 1TNXA 1W7JB 4ORBB 4ORAB 1EG3A 5HKZA 1S6IA 1XO5A 1OE9B 2K2AA 1QIWA 2CTNA 3KEVA 1KCYA 1A29A 3TS5B 2BCXA 3O4YA 1K93D 2F2PA 2FCDA 1FI5A 3EK8A 4ICBA 2KQ6A 3AKAA 1QVIZ 1UWOA 2JRFA 1J7PA 1QTXA 3OB1B 4DS7A 1FF1A 1X02A 2PMYA 1MUXA 2Y4QA 2FCEA 2F33A 1SL9A 1XK4C 1TIZA 1KK8B 2KGBC 1NX2A 2KSPA 1S3PA 3EKJA 3FIAA 2LCPA 2K8MB 4YBHB 3SJSA 4GGNA 1W7IB 1RTP1 1FBVA 1SL7A 3LK0A 1DVIA 1DJZA 3SIAA 2KFFA 2LM5A 1KSOA 1J7QA 2A4JA 1U5IB 1U5IA 4WQ2A 3VRNA 4MRXA 2WCBA 5I8NA 2ZKMX 4NDDA 1QJTA 1PULA 3I5HB 1L2OB 2BBMA 3HCMA 5HLOA 2WNDA 1F4OA 5DKNA 5D69A 1KQMB 1J1EA 2LMVA 2MRDA 1WDCB 2ZRSA 3EK4A 4PE1A 5JOLA 2WC8A 1NX1A 1YURA 4C0LA 3ICBA 2BCBA 1S36A 3TZ1A 2JNFA 1DT7B 3DVKA 1XFXO 2L98A 2GGZA 2ZN8A 1BJFA 1DJIA 3FWCA 1AJ5A 1A2XA 2KYCA 5DKQA 4HRHA 2MA2A 1WLZA 3CTNA 4PE0A 1K94A 4MN0A 1F8HA 1A75B 1BOCA 3NSKA 1A75A 4I5LB 1QX2A 3RM1A 1DJHA 2KYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZFD A;  2KAY A;  2BCA A;  1L2O C;  2JUL A;  1M46 A;  4YRU A;  1Y1U A;  3I5F B;  2QAC A;  4M2P A;  2LLS A;  3BXK A;  1S1E A;  1OZS A;  1NCY A;  1SCV A;  3EK7 A;  1JWD A;  4OR9 B;  1YVH A;  1R2U A;  1G8I A;  1BLQ A;  1NWD A;  1TNP A;  1NX0 A;  2JNX A;  4MSP A;  4PCW A;  2EGD A;  4AQJ A;  1LA3 A;  4GBA A;  1R6P A;  2HQW A;  1UUS A;  3HX4 A;  4CFQ A;  3KPX A;  4DUQ A;  3D0Y A;  1S6C A;  2AUC A;  3AAJ A;  5CSJ A;  2L0P A;  1BG1 A;  4PE7 A;  1JUO A;  1PVB A;  1TTX A;  2CXJ A;  2LVJ A;  1RK9 A;  1DGU A;  1K90 D;  2JT0 A;  3SG3 A;  2V53 A;  3SG4 A;  1MF8 B;  4I5J A;  1WRK A;  2KI4 C;  2KNE A;  2EC6 B;  1Y6W A;  2OTG C;  3I5G B;  1HT9 A;  2I18 A;  2M7N A;  1K9K A;  1IWQ A;  1DJY A;  1BF5 A;  1KFX S;  1SCM C;  1M63 B;  1JF2 A;  5GQQ C;  3TUY C;  1ZOT B;  2CT9 A;  2KI6 C;  3IF7 A;  3PN7 C;  1B8R A;  4P5O E;  2K7D A;  2BE6 A;  2KI6 D;  2LHL A;  1YRU B;  2RGI A;  5HYD A;  4ZCV A;  4I5N B;  1OZO A;  1REC A;  1S5G Y;  2SAS A;  4JWQ A;  4E68 A;  3SG2 A;  1F55 A;  1CDP A;  1AK8 A;  1CDM A;  1MHO A;  3JTD C;  1JC2 A;  3KF9 A;  2PSR A;  1B8L A;  1CTR A;  3NSL A;  1J7R A;  2PVB A;  1UHN A;  1Y1X A;  3GOF A;  2JT3 A;  4GUK A;  1KK7 Z;  1UUR A;  1TRF A;  1F70 A;  1B47 A;  2FJU B;  2F3Z A;  1DJX A;  1CM4 A;  1SMG A;  1Y1A A;  3O6B A;  1CDN A;  1AUI B;  4OV2 A;  3GK1 A;  2M1K B;  4GGF A;  2NZ0 A;  1HQV A;  1JF0 A;  1SRA A;  4YI8 A;  5CPV A;  1K9P A;  2KGR A;  1M31 A;  1LVC D;  2GGM A;  3IQQ A;  5HKW A;  1GQM A;  5AAN A;  2OS8 B;  1QX5 B;  1KSM A;  2BBN A;  3EKH A;  2LC5 A;  4HRE E;  2JPT A;  4MRY A;  2K61 A;  5TNC A;  2JZI A;  4R1E A;  1PK0 D;  1ALV A;  2JC2 A;  2D8N A;  4FTG A;  2R2I A;  2KAV A;  5IBW A;  1CNP A;  4M2O A;  1IGV A;  2BL0 B;  1BR4 B;  2HF5 A;  1NCZ A;  2ZN9 A;  1IJ5 A;  4ORC B;  2LUX A;  3SIB A;  1CFF A;  1K9U A;  1TOP A;  1NUB A;  1ZAC A;  1DF0 B;  1DF0 A;  3NSO A;  1RFJ A;  2O60 A;  2NCP A;  1S26 D;  1EH2 A;  2OPO A;  4MZL A;  1SR6 B;  2JTZ A;  4WQ3 A;  5ER4 X;  1QS7 A;  2MBX A;  4CID A;  4ETO A;  4AOM A;  1K2H A;  3VRO A;  4HRG A;  2B1U A;  4M2Q A;  1E8A A;  4A4C A;  2Y1N A;  4FQO A;  1BU3 A;  1SYM A;  2WCF A;  4L9M A;  3TS5 C;  4BY4 A;  5AFP A;  1GGW A;  3BOW A;  4AQI A;  2E6W A;  2G9B A;  1N0Y A;  1IQ5 A;  3VRQ A;  2LUC A;  1SL8 A;  3LCP C;  1SK6 D;  1CLB A;  1EXR A;  2COL B;  1KK8 C;  3JVT B;  4MLW A;  1OMV A;  3BYA A;  1CMG A;  1JBA A;  1GJY A;  3SG7 A;  3IQO A;  1CB1 A;  2CCM A;  4YGA A;  2EHB A;  1N2D A;  3PM8 A;  4YGB B;  1F54 A;  3OP0 A;  3I5H C;  1S6J A;  1UHH A;  1IQ3 A;  4XJK B;  4XJK A;  1M39 A;  2I94 A;  2K7B A;  1YRT B;  1KQM C;  3I5I B;  1WDC C;  3AKB A;  4MZJ A;  2MLE C;  5D7F A;  1G33 A;  1PSR A;  2CNP A;  3C1V A;  3OB2 B;  1A03 A;  4N5X A;  5J3X A;  3BUN B;  3SG5 A;  5KTY A;  2M3W A;  3D0Y B;  2BE4 A;  2E30 A;  1B1G A;  4CLN A;  4DIR A;  2LMT A;  3CR2 A;  1CM1 A;  2H2K A;  2H61 A;  2VRG A;  3EVU A;  1NSH A;  2K7C A;  4TNC A;  4CPV A;  1S5G Z;  1SY9 A;  1TCO B;  2KBI A;  4GNK B;  1XFZ O;  1ZFS A;  1BMO A;  3I5F C;  4QJ5 B;  2JTT A;  1NYA A;  3OHM B;  4Q04 A;  1SPY A;  4BY5 A;  3DVE A;  1CFC A;  4MZK A;  1XFV O;  3PFV A;  4GPL B;  1PVA A;  1MXE A;  1XFW O;  1QAS A;  1ZUZ A;  2L4H A;  2WOS A;  3SG6 A;  2BKH B;  5AEQ A;  1AP4 A;  2LE9 B;  1CDL A;  1YX7 A;  3RLZ A;  2M29 A;  2PAL A;  1CFD A;  3CLN A;  2JOJ A;  5ER5 A;  1QV1 A;  2LAN A;  1TNW A;  3BUX B;  1XVJ A;  1LKJ A;  3DVM A;  3VRP A;  5BPJ A;  1QAT A;  1MWN A;  3LL8 B;  2Y1M A;  1DJW A;  4PDZ A;  1G4Y R;  3TDI A;  4JQ0 D;  2GV5 A;  1WRZ A;  1ALW A;  1H4B A;  2LVK A;  2NXQ A;  1IKU A;  2EC6 C;  2LHI A;  1DMO A;  3I5G C;  1KFU L;  1JFJ A;  1TNQ A;  4I5K A;  2ISD A;  2IS9 A;  1CMF A;  1SW8 A;  1JFK A;  2CBL A;  2M7L A;  1B7T Y;  4A4B A;  1BT6 A;  2KHN A;  3GK4 X;  1UHJ A;  2F2O A;  2NLN A;  3KO0 A;  1JSA A;  2TN4 A;  3WNX B;  2HET A;  4F0Z B;  4D1E A;  1KWO B;  1BOD A;  1QLS A;  1GGZ A;  1QLK A;  3CR5 X;  4MVF A;  4PHK A;  1YVL A;  3CGA A;  3BQ3 A;  1NCX A;  2LVI A;  5CSN A;  1V1G A;  3OX6 A;  4USL A;  3A8R A;  2MJW B;  1K8U A;  1B8C A;  4PHN A;  3K21 A;  2F3Y A;  4GGF C;  4YGE B;  3WXA A;  2QPT A;  3WHT B;  1J7O A;  2WCE A;  3FS7 A;  3DD4 A;  1K95 A;  4GAO A;  4OCI A;  1XFU O;  1RJV A;  1EG4 A;  1WY9 A;  1XK4 A;  2OS8 C;  2ZNE A;  2ZRT A;  2JQ6 A;  1QV0 A;  3ZWH A;  1EJ3 A;  2K0J A;  2JWW A;  2L4I A;  1VRK A;  3DVJ A;  2FOT A;  2HQ8 A;  4NDC A;  1LIN A;  1NPQ A;  3QRX A;  2BL0 C;  3A4U B;  5DKR A;  1QX7 A;  1C7V A;  4PE4 A;  1YUS A;  3TDZ A;  1KFU S;  1PSB A;  1YUT A;  1C07 A;  2PRU A;  2LMU A;  2M97 A;  2AAO A;  3BOW B;  3D10 A;  4MEW A;  2LNK A;  2L51 A;  4WRI A;  1Y0V H;  2L5X B;  4PAL A;  4YGD B;  4C0J A;  1AJ4 A;  4U8D A;  5B8I B;  2LVV A;  4NDB A;  1XFY O;  2LLU A;  1SR6 C;  4MBE A;  1NIW A;  1D1O A;  2M8U A;  1CKK A;  1MQ1 A;  2BKI B;  3LLE A;  3DF0 B;  3DF0 A;  3CR4 X;  2LP2 A;  1SNL A;  2Y5I A;  3H4S E;  3BUM B;  3CS1 A;  2AMI A;  3O2P A;  4DCK A;  1N65 A;  4DRW A;  4IL1 A;  1OSA A;  1UHI A;  2MHH A;  3LK1 A;  3VGO A;  1QVI Y;  3GK2 A;  5G08 A;  1TCF A;  4OKH A;  5F6T A;  4N1F A;  1FI6 A;  2MLF C;  2BEC A;  1TN4 A;  4NQG A;  1F4Q A;  2JXC A;  1OMR A;  5HLV A;  4UPG A;  3EVR A;  1YX8 A;  2M9G A;  3BUO B;  3VRR A;  1UP5 A;  5I2Q A;  3M0W A;  5I2O A;  1FW4 A;  3JVT C;  2KFH A;  1IG5 A;  3OX5 A;  1KFX L;  3WHU B;  1OMD A;  2LV7 A;  1QXP A;  1SKT A;  1DGV A;  4OVN F;  4N1G A;  2JT8 A;  4PHM A;  4YI9 A;  5PAL A;  4QJ4 B;  1ZMZ A;  3TDU A;  1M45 A;  1KQV A;  2Q4U A;  4JPZ B;  1SBJ A;  1YR5 A;  2KQY A;  5FYX A;  3PLF B;  1PRW A;  1XA5 A;  1MR8 A;  1Q80 A;  1DJG A;  3I5I C;  2KI4 B;  3PSR A;  2OTG B;  5HKY A;  1ODB A;  4HSZ A;  2F8P A;  5CSI A;  1SCM B;  3TUY B;  1EL4 A;  1FPW A;  3PN7 B;  2PAS A;  1NP8 A;  2LP3 A;  2MAZ A;  5KU1 A;  4YGC B;  2H61 C;  2KDH A;  1B7T Z;  2DOQ A;  3KHE A;  1WRL A;  5AER A;  4QJ3 B;  3JTD B;  4XYN A;  1XYD A;  3E3R A;  3EVV A;  2L50 A;  5AXI A;  1CFP A;  1OQP A;  2G2B A;  2WOR A;  2M49 B;  3BUW B;  3PAT A;  3NXA A;  5JJG A;  3MSE B;  1BR1 B;  2NCO A;  1C7W A;  3NSI A;  2M0R A;  2LLT A;  1LXF C;  1QIV A;  2L2E A;  4C0K A;  1RRO A;  2KOT A;  3AAK A;  5KSZ A;  1B4C A;  1V1F A;  2SCP A;  1AVS A;  5CSF A;  1UHK A;  2P6B B;  3PAL A;  3CWG A;  2ZND A;  5K89 A;  1LA0 A;  1MXL C;  1AHR A;  2M1U A;  3O78 A;  5I2L A;  1L7Z A;  2Q91 A;  2HPS A;  1J1D A;  1J55 A;  4PHJ A;  4GFT A;  2I7A A;  2LAP A;  1CLL A;  3ZNI A;  1IH0 A;  1PAL A;  1H8B A;  1K96 A;  1YUU A;  2KAX A;  2I2R E;  1IJ6 A;  1IRJ A;  1B9A A;  1RWY A;  2K2F A;  2O5G A;  3F45 A;  4ZCU A;  1DTL A;  2JXL A;  4P2Y B;  2K7O A;  1WLM A;  1A4P A;  1F71 A;  3CZT X;  2KFG A;  2KBM A;  1CLM A;  1NX3 A;  4CFR A;  1YTZ C;  1OOJ A;  3FWB A;  1KWO C;  2JU0 A;  1KK7 Y;  1TNX A;  1W7J B;  4ORB B;  4ORA B;  1EG3 A;  5HKZ A;  1S6I A;  1XO5 A;  1OE9 B;  2K2A A;  1QIW A;  2CTN A;  3KEV A;  1KCY A;  1A29 A;  3TS5 B;  2BCX A;  3O4Y A;  1K93 D;  2F2P A;  2FCD A;  1FI5 A;  3EK8 A;  4ICB A;  2KQ6 A;  3AKA A;  1QVI Z;  1UWO A;  2JRF A;  1J7P A;  1QTX A;  3OB1 B;  4DS7 A;  1FF1 A;  1X02 A;  2PMY A;  1MUX A;  2Y4Q A;  2FCE A;  2F33 A;  1SL9 A;  1XK4 C;  1TIZ A;  1KK8 B;  2KGB C;  1NX2 A;  2KSP A;  1S3P A;  3EKJ A;  3FIA A;  2LCP A;  2K8M B;  4YBH B;  3SJS A;  4GGN A;  1W7I B;  1RTP 1;  1FBV A;  1SL7 A;  3LK0 A;  1DVI A;  1DJZ A;  3SIA A;  2KFF A;  2LM5 A;  1KSO A;  1J7Q A;  2A4J A;  1U5I B;  1U5I A;  4WQ2 A;  3VRN A;  4MRX A;  2WCB A;  5I8N A;  2ZKM X;  4NDD A;  1QJT A;  1PUL A;  3I5H B;  1L2O B;  2BBM A;  3HCM A;  5HLO A;  2WND A;  1F4O A;  5DKN A;  5D69 A;  1KQM B;  1J1E A;  2LMV A;  2MRD A;  1WDC B;  2ZRS A;  3EK4 A;  4PE1 A;  5JOL A;  2WC8 A;  1NX1 A;  1YUR A;  4C0L A;  3ICB A;  2BCB A;  1S36 A;  3TZ1 A;  2JNF A;  1DT7 B;  3DVK A;  1XFX O;  2L98 A;  2GGZ A;  2ZN8 A;  1BJF A;  1DJI A;  3FWC A;  1AJ5 A;  1A2X A;  2KYC A;  5DKQ A;  4HRH A;  2MA2 A;  1WLZ A;  3CTN A;  4PE0 A;  1K94 A;  4MN0 A;  1F8H A;  1A75 B;  1BOC A;  3NSK A;  1A75 A;  4I5L B;  1QX2 A;  3RM1 A;  1DJH A;  2KYF A; 
#chains in the Genus database with same CATH topology
 2ZFD A;  2KAY A;  2BCA A;  1L2O C;  2JUL A;  1M46 A;  4YRU A;  1Y1U A;  3I5F B;  2QAC A;  4M2P A;  2LLS A;  3BXK A;  1S1E A;  1OZS A;  1NCY A;  1SCV A;  3EK7 A;  1JWD A;  4OR9 B;  1YVH A;  1R2U A;  4F7F A;  1G8I A;  3NGV A;  1BLQ A;  1NWD A;  1TNP A;  1NX0 A;  2JNX A;  4MSP A;  4PCW A;  2EGD A;  4AQJ A;  1LA3 A;  4GBA A;  1R6P A;  2GTE A;  2HQW A;  1UUS A;  3HX4 A;  3UO9 A;  4CFQ A;  3KPX A;  4DUQ A;  3D0Y A;  1S6C A;  2AUC A;  3O4X A;  3D78 A;  3AAJ A;  5CSJ A;  2L0P A;  1BG1 A;  1ORG A;  3BJH A;  2QDI A;  4PE7 A;  1JUO A;  3NHT A;  1PVB A;  1TTX A;  2CXJ A;  2LVJ A;  1RK9 A;  1DGU A;  1K90 D;  2JT0 A;  3CZ0 A;  3S0D A;  2V53 A;  3SG3 A;  3SG4 A;  1MF8 B;  4I5J A;  1WRK A;  3BFA A;  2KI4 C;  2KNE A;  3S0A A;  2EC6 B;  1Y6W A;  2OTG C;  3B7A A;  3I5G B;  1HT9 A;  2I18 A;  2M7N A;  1K9K A;  1IWQ A;  1DJY A;  1BF5 A;  1KFX S;  1SCM C;  1M63 B;  1JF2 A;  5GQQ C;  3TUY C;  1ZOT B;  2CT9 A;  2KI6 C;  3IF7 A;  3PN7 C;  1B8R A;  4P5O E;  2K7D A;  2BE6 A;  2KI6 D;  2LHL A;  1YRU B;  2RGI A;  2QEV A;  4ZCV A;  4I5N B;  5HYD A;  1OZO A;  1REC A;  1S5G Y;  2SAS A;  3D75 A;  4JWQ A;  3SG2 A;  4E68 A;  1F55 A;  1CDP A;  1AK8 A;  1CDM A;  1MHO A;  3JTD C;  1JC2 A;  3KF9 A;  2PSR A;  3D76 A;  1B8L A;  1CTR A;  3NSL A;  1J7R A;  2PVB A;  1UHN A;  1Y1X A;  3GOF A;  2QEH A;  2JT3 A;  4GUK A;  1KK7 Z;  1UUR A;  1TRF A;  1F70 A;  1B47 A;  2FJU B;  2K60 A;  2F3Z A;  2PQL A;  3L4L A;  1DJX A;  1CM4 A;  2H8V A;  5DIC A;  1SMG A;  1Y1A A;  3O6B A;  1CDN A;  1AUI B;  4OV2 A;  3GK1 A;  2M1K B;  4GGF A;  2NZ0 A;  1HQV A;  1JF0 A;  1SRA A;  3K1E A;  4YI8 A;  1K9P A;  2KGR A;  1LS8 A;  1M31 A;  1LVC D;  2GGM A;  2PYQ A;  3IQQ A;  3N7H A;  1GQM A;  5HKW A;  5AAN A;  2BNX A;  2OS8 B;  1QX5 B;  1KSM A;  2BBN A;  3EKH A;  2LC5 A;  4HRE E;  2JPT A;  4MRY A;  2K61 A;  5TNC A;  2JZI A;  4R1E A;  1PK0 D;  3S0F A;  1ALV A;  2JC2 A;  2D8N A;  4FTG A;  2R2I A;  2KAV A;  5IBW A;  1CNP A;  4M2O A;  1IGV A;  1XFR A;  2BL0 B;  1BR4 B;  2HF5 A;  1NCZ A;  2ZN9 A;  1IJ5 A;  4ORC B;  2LUX A;  3SIB A;  1CFF A;  1K9U A;  1TOP A;  1NUB A;  1ZAC A;  1DF0 B;  1DF0 A;  2QEO A;  3NSO A;  1RFJ A;  3NHI A;  2O60 A;  2NCP A;  1S26 D;  3CAB A;  1EH2 A;  2OPO A;  4MZL A;  1DQE A;  1SR6 B;  2JTZ A;  3D74 A;  3CZ1 A;  4WQ3 A;  1OOH A;  5ER4 X;  1QS7 A;  2MBX A;  4CID A;  4ETO A;  4OZD A;  4AOM A;  1K2H A;  3VRO A;  4HRG A;  3DXL A;  2B1U A;  4M2Q A;  1E8A A;  4A4C A;  2Y1N A;  4FQO A;  1BU3 A;  2JPO A;  3R1V A;  1SYM A;  2WCF A;  4L9M A;  3TS5 C;  4BY4 A;  5AFP A;  1GGW A;  3BOW A;  4AQI A;  2E6W A;  2BAP A;  2G9B A;  1N0Y A;  1IQ5 A;  3VRQ A;  2LUC A;  1SL8 A;  3LCP C;  1SK6 D;  1CLB A;  1EXR A;  2COL B;  1KK8 C;  3JVT B;  4MLW A;  1OMV A;  2WCH A;  3BYA A;  1CMG A;  1JBA A;  1GJY A;  2WCJ A;  3SG7 A;  3IQO A;  1CB1 A;  3VB1 A;  3B86 A;  2CCM A;  4YGA A;  2EHB A;  1N2D A;  3B6X A;  3PM8 A;  4YGB B;  1F54 A;  3DY9 A;  3OP0 A;  2WC6 A;  1S6J A;  1UHH A;  3I5H C;  1IQ3 A;  4XJK B;  4XJK A;  4JKT A;  1Z2C B;  1M39 A;  2I94 A;  2K7B A;  1YRT B;  1KQM C;  3I5I B;  1TWO A;  1WDC C;  3AKB A;  4MZJ A;  3UNW A;  2MLE C;  5D7F A;  1G33 A;  1PSR A;  2CNP A;  3C1V A;  3OB2 B;  1A03 A;  4N5X A;  5J3X A;  3BUN B;  3B87 A;  3SG5 A;  5KTY A;  2M3W A;  3D0Y B;  2BE4 A;  2E30 A;  1B1G A;  4CLN A;  4DIR A;  2LMT A;  3CR2 A;  1CM1 A;  2H2K A;  2H61 A;  2VRG A;  3EVU A;  1NSH A;  2K7C A;  3EKJ A;  4TNC A;  1S5G Z;  1SY9 A;  1TCO B;  2KBI A;  4CPV A;  4GNK B;  1XFZ O;  1ZFS A;  1BMO A;  3I5F C;  4QJ5 B;  2JTT A;  1NYA A;  3OHM B;  4Q04 A;  1SPY A;  4BY5 A;  1P28 A;  3DVE A;  1CFC A;  4MZK A;  1XFV O;  3PFV A;  4GPL B;  3PM2 A;  1PVA A;  1MXE A;  1XFW O;  1QAS A;  1ZUZ A;  2L4H A;  2WOS A;  3SG6 A;  2BKH B;  5AEQ A;  1AP4 A;  2LE9 B;  1CDL A;  1YX7 A;  3QME A;  3RLZ A;  2M29 A;  3SS5 A;  2PAL A;  1CFD A;  3CLN A;  2JOJ A;  5ER5 A;  3V2L A;  1QV1 A;  2LAN A;  1TNW A;  3BUX B;  1XVJ A;  1LKJ A;  3DVM A;  3VRP A;  5BPJ A;  1C3Y A;  1QAT A;  1W9Z A;  1MWN A;  3LL8 B;  2Y1M A;  1DJW A;  1Z4H A;  4PDZ A;  1G4Y R;  3S0B A;  3TDI A;  4JQ0 D;  2GV5 A;  1WRZ A;  1ALW A;  2L5Y A;  1DC1 A;  2LVK A;  2NXQ A;  1IKU A;  2EC6 C;  1H4B A;  2LHI A;  2L2C A;  1DMO A;  3I5G C;  1KFU L;  1JFJ A;  1TNQ A;  4I5K A;  2ISD A;  2IS9 A;  1CMF A;  1SW8 A;  1JFK A;  2CBL A;  2M7L A;  1B7T Y;  4PT1 A;  4A4B A;  1BT6 A;  3L4A A;  2KHN A;  3GK4 X;  1UHJ A;  2F2O A;  2NLN A;  3KO0 A;  1JSA A;  2YGU A;  2TN4 A;  3WNX B;  2HET A;  4F0Z B;  4D1E A;  1KWO B;  1BOD A;  1QLS A;  1GGZ A;  4IJ7 A;  1QLK A;  3CR5 X;  4MVF A;  4PHK A;  1YVL A;  3CGA A;  3BQ3 A;  1NCX A;  2LVI A;  5CSN A;  2WCL A;  1V1G A;  3OX6 A;  3R1O A;  4USL A;  2P70 A;  3A8R A;  2MJW B;  1K8U A;  1B8C A;  4PHN A;  3K21 A;  2F3Y A;  4GGF C;  4YGE B;  3WXA A;  2QPT A;  3WHT B;  1J7O A;  2WCE A;  3FS7 A;  3BFB A;  1K95 A;  3DD4 A;  4GAO A;  4OCI A;  3R72 A;  1XFU O;  1RJV A;  1EG4 A;  1WY9 A;  1XK4 A;  2OS8 C;  2ZNE A;  2ZRT A;  2JQ6 A;  1QV0 A;  3RZS A;  3ZWH A;  1EJ3 A;  2K0J A;  2JWW A;  2L4I A;  1VRK A;  3CYZ A;  3DVJ A;  2FOT A;  2HQ8 A;  4NDC A;  1LIN A;  1NPQ A;  3QRX A;  2BL0 C;  3A4U B;  5DKR A;  1QX7 A;  1C7V A;  4PE4 A;  1YUS A;  3DZT A;  1KFU S;  1PSB A;  1QWV A;  1TUJ A;  1YUT A;  2PRU A;  3TDZ A;  2LMU A;  2M97 A;  2AAO A;  3BOW B;  3CDN A;  3D10 A;  2LNK A;  2L51 A;  4MEW A;  1GM0 A;  4WRI A;  1Y0V H;  2L5X B;  4PAL A;  4YGD B;  4C0J A;  1AJ4 A;  3FE8 A;  4U8D A;  3OBV A;  3SS4 A;  3R1P A;  5B8I B;  2LVV A;  4NDB A;  1XFY O;  2LLU A;  1SR6 C;  4MBE A;  1NIW A;  1D1O A;  2M8U A;  1CKK A;  5I94 A;  1OOI X;  1MQ1 A;  2BKI B;  3LLE A;  4FQT A;  3DF0 B;  3SS3 A;  3DF0 A;  3EG5 B;  3CR4 X;  2LP2 A;  1SNL A;  2Y5I A;  3D73 A;  3H4S E;  3BUM B;  3CS1 A;  2AMI A;  3O2P A;  4DCK A;  1N65 A;  2QEB A;  4DRW A;  4IL1 A;  1OSA A;  1UHI A;  2MHH A;  3LK1 A;  1IIO A;  3S0E A;  3VGO A;  1QVI Y;  3GK2 A;  5G08 A;  1TCF A;  4OKH A;  5F6T A;  4N1F A;  1FI6 A;  2MLF C;  2BEC A;  1TN4 A;  4NQG A;  1F4Q A;  2JXC A;  1OMR A;  5HLV A;  4UPG A;  3EVR A;  1YX8 A;  3Q8I A;  2M9G A;  3BUO B;  3FE9 A;  1UP5 A;  3VRR A;  5I2Q A;  3M0W A;  5I2O A;  1FW4 A;  3JVT C;  2KPH A;  2KFH A;  1IG5 A;  3OX5 A;  1KFX L;  3WHU B;  1OMD A;  2LV7 A;  1QXP A;  1SKT A;  1DGV A;  4KYN A;  4OVN F;  4N1G A;  2JT8 A;  4PHM A;  4YI9 A;  5PAL A;  4QJ4 B;  1ZMZ A;  4INX A;  3TDU A;  1OOG A;  3PJI A;  1M45 A;  1KQV A;  1DEL A;  2Q4U A;  1SBJ A;  4JPZ B;  1YR5 A;  2KQY A;  5FYX A;  3PLF B;  5HL1 A;  1PRW A;  1XA5 A;  1MR8 A;  1Q80 A;  1DJG A;  3I5I C;  2KI4 B;  3CZ2 A;  2OTG B;  3PSR A;  5HKY A;  2WC5 A;  1ODB A;  4HSZ A;  2F8P A;  5CSI A;  5FI7 A;  1SCM B;  3TUY B;  1EL4 A;  1FPW A;  3PN7 B;  2PAS A;  1NP8 A;  2LP3 A;  2MAZ A;  5KU1 A;  4YGC B;  2H61 C;  2KDH A;  1B7T Z;  2DOQ A;  3KHE A;  1WRL A;  5AER A;  4QJ3 B;  3JTD B;  2KLE A;  4XYN A;  1XYD A;  3E3R A;  3EVV A;  2L50 A;  5AXI A;  1CFP A;  1OQP A;  1SSE B;  5EL2 A;  2G2B A;  2WOR A;  2M49 B;  3BUW B;  3PAT A;  3NXA A;  5JJG A;  1DEK A;  3MSE B;  1BR1 B;  2NCO A;  5D3O A;  1C7W A;  3NSI A;  2M0R A;  2LLT A;  1LXF C;  1QIV A;  2L2E A;  4C0K A;  3D77 A;  1RRO A;  2KOT A;  3AAK A;  5KSZ A;  1B4C A;  3DYE A;  1V1F A;  2SCP A;  1AVS A;  2KLD A;  5CSF A;  1UHK A;  2P6B B;  3PAL A;  3CWG A;  5FI2 A;  5FI6 A;  2ZND A;  5K89 A;  1LA0 A;  1MXL C;  1AHR A;  2M1U A;  3O78 A;  5I2L A;  1L7Z A;  2Q91 A;  2HPS A;  1J1D A;  1J55 A;  3FE6 A;  4PHJ A;  4GFT A;  2I7A A;  2LAP A;  3OGN A;  1CLL A;  3ZNI A;  1IH0 A;  1PAL A;  1H8B A;  1K96 A;  1YUU A;  2WCM A;  2KAX A;  2I2R E;  1IJ6 A;  4JD9 A;  1IRJ A;  1B9A A;  1RWY A;  2K2F A;  2O5G A;  3F45 A;  2WCK A;  4ZCU A;  1DTL A;  2JXL A;  4P2Y B;  2K7O A;  1WLM A;  1A4P A;  1F71 A;  3CZT X;  2KFG A;  2KBM A;  1CLM A;  1NX3 A;  1OW4 A;  4CFR A;  1YTZ C;  1OOJ A;  3FWB A;  1KWO C;  2JU0 A;  1KK7 Y;  1TNX A;  1W7J B;  4ORB B;  4ORA B;  1EG3 A;  5HKZ A;  1S6I A;  1XO5 A;  1OE9 B;  2K2A A;  3B88 A;  1QIW A;  2CTN A;  3KEV A;  3L47 A;  1A29 A;  1KCY A;  3TS5 B;  4INW A;  2BCX A;  3O4Y A;  1K93 D;  2F2P A;  2FCD A;  1FI5 A;  3EK8 A;  4ICB A;  2KQ6 A;  3AKA A;  1QVI Z;  1UWO A;  1T14 A;  3IVT A;  2JRF A;  1J7P A;  1QTX A;  3OB1 B;  4DS7 A;  1FF1 A;  1X02 A;  2PMY A;  1MUX A;  2Y4Q A;  2FCE A;  2F33 A;  1SL9 A;  1XK4 C;  1TIZ A;  1KK8 B;  2KGB C;  1NX2 A;  2KSP A;  1OOF A;  1S3P A;  2P71 A;  2LCP A;  2K8M B;  3FIA A;  4YBH B;  5CPV A;  3S0G A;  3SJS A;  4GGN A;  1W7I B;  1RTP 1;  1FBV A;  1SL7 A;  3LK0 A;  1DVI A;  1DJZ A;  3SIA A;  2KFF A;  2LM5 A;  1KSO A;  1J7Q A;  2A4J A;  1U5I B;  1U5I A;  4WQ2 A;  3VRN A;  4MRX A;  2WCB A;  5I8N A;  2ZKM X;  4NDD A;  1QJT A;  1PUL A;  3I5H B;  1L2O B;  2BBM A;  3BFH A;  3HCM A;  2WND A;  5HLO A;  1F4O A;  5DKN A;  5D69 A;  2FJY A;  1KQM B;  2ERB A;  1J1E A;  2LMV A;  1TUZ A;  1WDC B;  2MRD A;  2ZRS A;  3EK4 A;  4PE1 A;  5JOL A;  2WC8 A;  1NX1 A;  1YUR A;  4C0L A;  1C3Z A;  2BCB A;  3ICB A;  1S36 A;  3TZ1 A;  2JNF A;  1DT7 B;  3DVK A;  1XFX O;  2L98 A;  2GGZ A;  2ZN8 A;  1BJF A;  1DJI A;  3FWC A;  1AJ5 A;  1A2X A;  2KYC A;  5DKQ A;  4HRH A;  2MA2 A;  1WLZ A;  3CTN A;  4PE0 A;  1K94 A;  4MN0 A;  1C07 A;  1F8H A;  1A75 B;  1BOC A;  3NSK A;  1A75 A;  4I5L B;  1QX2 A;  3RM1 A;  1DJH A;  2KYF A; 
#chains in the Genus database with same CATH homology
 2ZFD A;  2KAY A;  2BCA A;  1L2O C;  2JUL A;  1M46 A;  4YRU A;  1Y1U A;  3I5F B;  2QAC A;  4M2P A;  2LLS A;  3BXK A;  1S1E A;  1OZS A;  1NCY A;  1SCV A;  3EK7 A;  1JWD A;  4OR9 B;  1YVH A;  1R2U A;  1G8I A;  1BLQ A;  1NWD A;  1TNP A;  1NX0 A;  2JNX A;  4MSP A;  4PCW A;  2EGD A;  4AQJ A;  1LA3 A;  4GBA A;  1R6P A;  2HQW A;  1UUS A;  3HX4 A;  4CFQ A;  3KPX A;  4DUQ A;  3D0Y A;  1S6C A;  2AUC A;  3AAJ A;  5CSJ A;  2L0P A;  1BG1 A;  4PE7 A;  1JUO A;  1PVB A;  1TTX A;  2CXJ A;  2LVJ A;  1RK9 A;  1DGU A;  1K90 D;  2JT0 A;  3SG3 A;  2V53 A;  3SG4 A;  1MF8 B;  4I5J A;  1WRK A;  2KI4 C;  2KNE A;  2EC6 B;  1Y6W A;  2OTG C;  3I5G B;  1HT9 A;  2I18 A;  2M7N A;  1K9K A;  1IWQ A;  1DJY A;  1BF5 A;  1KFX S;  1SCM C;  1M63 B;  1JF2 A;  5GQQ C;  3TUY C;  1ZOT B;  2CT9 A;  2KI6 C;  3IF7 A;  3PN7 C;  1B8R A;  4P5O E;  2K7D A;  2BE6 A;  2KI6 D;  2LHL A;  1YRU B;  2RGI A;  5HYD A;  4ZCV A;  4I5N B;  1OZO A;  1REC A;  1S5G Y;  2SAS A;  4JWQ A;  4E68 A;  3SG2 A;  1F55 A;  1CDP A;  1AK8 A;  1CDM A;  1MHO A;  3JTD C;  1JC2 A;  3KF9 A;  2PSR A;  1B8L A;  1CTR A;  3NSL A;  1J7R A;  2PVB A;  1UHN A;  1Y1X A;  3GOF A;  2JT3 A;  4GUK A;  1KK7 Z;  1UUR A;  1TRF A;  1F70 A;  1B47 A;  2FJU B;  2F3Z A;  1DJX A;  1CM4 A;  1SMG A;  1Y1A A;  3O6B A;  1CDN A;  1AUI B;  4OV2 A;  3GK1 A;  2M1K B;  4GGF A;  2NZ0 A;  1HQV A;  1JF0 A;  1SRA A;  4YI8 A;  5CPV A;  1K9P A;  2KGR A;  1M31 A;  1LVC D;  2GGM A;  3IQQ A;  5HKW A;  1GQM A;  5AAN A;  2OS8 B;  1QX5 B;  1KSM A;  2BBN A;  3EKH A;  2LC5 A;  4HRE E;  2JPT A;  4MRY A;  2K61 A;  5TNC A;  2JZI A;  4R1E A;  1PK0 D;  1ALV A;  2JC2 A;  2D8N A;  4FTG A;  2R2I A;  2KAV A;  5IBW A;  1CNP A;  4M2O A;  1IGV A;  2BL0 B;  1BR4 B;  2HF5 A;  1NCZ A;  2ZN9 A;  1IJ5 A;  4ORC B;  2LUX A;  3SIB A;  1CFF A;  1K9U A;  1TOP A;  1NUB A;  1ZAC A;  1DF0 B;  1DF0 A;  3NSO A;  1RFJ A;  2O60 A;  2NCP A;  1S26 D;  1EH2 A;  2OPO A;  4MZL A;  1SR6 B;  2JTZ A;  4WQ3 A;  5ER4 X;  1QS7 A;  2MBX A;  4CID A;  4ETO A;  4AOM A;  1K2H A;  3VRO A;  4HRG A;  2B1U A;  4M2Q A;  1E8A A;  4A4C A;  2Y1N A;  4FQO A;  1BU3 A;  1SYM A;  2WCF A;  4L9M A;  3TS5 C;  4BY4 A;  5AFP A;  1GGW A;  3BOW A;  4AQI A;  2E6W A;  2G9B A;  1N0Y A;  1IQ5 A;  3VRQ A;  2LUC A;  1SL8 A;  3LCP C;  1SK6 D;  1CLB A;  1EXR A;  2COL B;  1KK8 C;  3JVT B;  4MLW A;  1OMV A;  3BYA A;  1CMG A;  1JBA A;  1GJY A;  3SG7 A;  3IQO A;  1CB1 A;  2CCM A;  4YGA A;  2EHB A;  1N2D A;  3PM8 A;  4YGB B;  1F54 A;  3OP0 A;  3I5H C;  1S6J A;  1UHH A;  1IQ3 A;  4XJK B;  4XJK A;  1M39 A;  2I94 A;  2K7B A;  1YRT B;  1KQM C;  3I5I B;  1WDC C;  3AKB A;  4MZJ A;  2MLE C;  5D7F A;  1G33 A;  1PSR A;  2CNP A;  3C1V A;  3OB2 B;  1A03 A;  4N5X A;  5J3X A;  3BUN B;  3SG5 A;  5KTY A;  2M3W A;  3D0Y B;  2BE4 A;  2E30 A;  1B1G A;  4CLN A;  4DIR A;  2LMT A;  3CR2 A;  1CM1 A;  2H2K A;  2H61 A;  2VRG A;  3EVU A;  1NSH A;  2K7C A;  4TNC A;  4CPV A;  1S5G Z;  1SY9 A;  1TCO B;  2KBI A;  4GNK B;  1XFZ O;  1ZFS A;  1BMO A;  3I5F C;  4QJ5 B;  2JTT A;  1NYA A;  3OHM B;  4Q04 A;  1SPY A;  4BY5 A;  3DVE A;  1CFC A;  4MZK A;  1XFV O;  3PFV A;  4GPL B;  1PVA A;  1MXE A;  1XFW O;  1QAS A;  1ZUZ A;  2L4H A;  2WOS A;  3SG6 A;  2BKH B;  5AEQ A;  1AP4 A;  2LE9 B;  1CDL A;  1YX7 A;  3RLZ A;  2M29 A;  2PAL A;  1CFD A;  3CLN A;  2JOJ A;  5ER5 A;  1QV1 A;  2LAN A;  1TNW A;  3BUX B;  1XVJ A;  1LKJ A;  3DVM A;  3VRP A;  5BPJ A;  1QAT A;  1MWN A;  3LL8 B;  2Y1M A;  1DJW A;  4PDZ A;  1G4Y R;  3TDI A;  4JQ0 D;  2GV5 A;  1WRZ A;  1ALW A;  1H4B A;  2LVK A;  2NXQ A;  1IKU A;  2EC6 C;  2LHI A;  1DMO A;  3I5G C;  1KFU L;  1JFJ A;  1TNQ A;  4I5K A;  2ISD A;  2IS9 A;  1CMF A;  1SW8 A;  1JFK A;  2CBL A;  2M7L A;  1B7T Y;  4A4B A;  1BT6 A;  2KHN A;  3GK4 X;  1UHJ A;  2F2O A;  2NLN A;  3KO0 A;  1JSA A;  2TN4 A;  3WNX B;  2HET A;  4F0Z B;  4D1E A;  1KWO B;  1BOD A;  1QLS A;  1GGZ A;  1QLK A;  3CR5 X;  4MVF A;  4PHK A;  1YVL A;  3CGA A;  3BQ3 A;  1NCX A;  2LVI A;  5CSN A;  1V1G A;  3OX6 A;  4USL A;  3A8R A;  2MJW B;  1K8U A;  1B8C A;  4PHN A;  3K21 A;  2F3Y A;  4GGF C;  4YGE B;  3WXA A;  2QPT A;  3WHT B;  1J7O A;  2WCE A;  3FS7 A;  3DD4 A;  1K95 A;  4GAO A;  4OCI A;  1XFU O;  1RJV A;  1EG4 A;  1WY9 A;  1XK4 A;  2OS8 C;  2ZNE A;  2ZRT A;  2JQ6 A;  1QV0 A;  3ZWH A;  1EJ3 A;  2K0J A;  2JWW A;  2L4I A;  1VRK A;  3DVJ A;  2FOT A;  2HQ8 A;  4NDC A;  1LIN A;  1NPQ A;  3QRX A;  2BL0 C;  3A4U B;  5DKR A;  1QX7 A;  1C7V A;  4PE4 A;  1YUS A;  3TDZ A;  1KFU S;  1PSB A;  1YUT A;  1C07 A;  2PRU A;  2LMU A;  2M97 A;  2AAO A;  3BOW B;  3D10 A;  4MEW A;  2LNK A;  2L51 A;  4WRI A;  1Y0V H;  2L5X B;  4PAL A;  4YGD B;  4C0J A;  1AJ4 A;  4U8D A;  5B8I B;  2LVV A;  4NDB A;  1XFY O;  2LLU A;  1SR6 C;  4MBE A;  1NIW A;  1D1O A;  2M8U A;  1CKK A;  1MQ1 A;  2BKI B;  3LLE A;  3DF0 B;  3DF0 A;  3CR4 X;  2LP2 A;  1SNL A;  2Y5I A;  3H4S E;  3BUM B;  3CS1 A;  2AMI A;  3O2P A;  4DCK A;  1N65 A;  4DRW A;  4IL1 A;  1OSA A;  1UHI A;  2MHH A;  3LK1 A;  3VGO A;  1QVI Y;  3GK2 A;  5G08 A;  1TCF A;  4OKH A;  5F6T A;  4N1F A;  1FI6 A;  2MLF C;  2BEC A;  1TN4 A;  4NQG A;  1F4Q A;  2JXC A;  1OMR A;  5HLV A;  4UPG A;  3EVR A;  1YX8 A;  2M9G A;  3BUO B;  3VRR A;  1UP5 A;  5I2Q A;  3M0W A;  5I2O A;  1FW4 A;  3JVT C;  2KFH A;  1IG5 A;  3OX5 A;  1KFX L;  3WHU B;  1OMD A;  2LV7 A;  1QXP A;  1SKT A;  1DGV A;  4OVN F;  4N1G A;  2JT8 A;  4PHM A;  4YI9 A;  5PAL A;  4QJ4 B;  1ZMZ A;  3TDU A;  1M45 A;  1KQV A;  2Q4U A;  4JPZ B;  1SBJ A;  1YR5 A;  2KQY A;  5FYX A;  3PLF B;  1PRW A;  1XA5 A;  1MR8 A;  1Q80 A;  1DJG A;  3I5I C;  2KI4 B;  3PSR A;  2OTG B;  5HKY A;  1ODB A;  4HSZ A;  2F8P A;  5CSI A;  1SCM B;  3TUY B;  1EL4 A;  1FPW A;  3PN7 B;  2PAS A;  1NP8 A;  2LP3 A;  2MAZ A;  5KU1 A;  4YGC B;  2H61 C;  2KDH A;  1B7T Z;  2DOQ A;  3KHE A;  1WRL A;  5AER A;  4QJ3 B;  3JTD B;  4XYN A;  1XYD A;  3E3R A;  3EVV A;  2L50 A;  5AXI A;  1CFP A;  1OQP A;  2G2B A;  2WOR A;  2M49 B;  3BUW B;  3PAT A;  3NXA A;  5JJG A;  3MSE B;  1BR1 B;  2NCO A;  1C7W A;  3NSI A;  2M0R A;  2LLT A;  1LXF C;  1QIV A;  2L2E A;  4C0K A;  1RRO A;  2KOT A;  3AAK A;  5KSZ A;  1B4C A;  1V1F A;  2SCP A;  1AVS A;  5CSF A;  1UHK A;  2P6B B;  3PAL A;  3CWG A;  2ZND A;  5K89 A;  1LA0 A;  1MXL C;  1AHR A;  2M1U A;  3O78 A;  5I2L A;  1L7Z A;  2Q91 A;  2HPS A;  1J1D A;  1J55 A;  4PHJ A;  4GFT A;  2I7A A;  2LAP A;  1CLL A;  3ZNI A;  1IH0 A;  1PAL A;  1H8B A;  1K96 A;  1YUU A;  2KAX A;  2I2R E;  1IJ6 A;  1IRJ A;  1B9A A;  1RWY A;  2K2F A;  2O5G A;  3F45 A;  4ZCU A;  1DTL A;  2JXL A;  4P2Y B;  2K7O A;  1WLM A;  1A4P A;  1F71 A;  3CZT X;  2KFG A;  2KBM A;  1CLM A;  1NX3 A;  4CFR A;  1YTZ C;  1OOJ A;  3FWB A;  1KWO C;  2JU0 A;  1KK7 Y;  1TNX A;  1W7J B;  4ORB B;  4ORA B;  1EG3 A;  5HKZ A;  1S6I A;  1XO5 A;  1OE9 B;  2K2A A;  1QIW A;  2CTN A;  3KEV A;  1KCY A;  1A29 A;  3TS5 B;  2BCX A;  3O4Y A;  1K93 D;  2F2P A;  2FCD A;  1FI5 A;  3EK8 A;  4ICB A;  2KQ6 A;  3AKA A;  1QVI Z;  1UWO A;  2JRF A;  1J7P A;  1QTX A;  3OB1 B;  4DS7 A;  1FF1 A;  1X02 A;  2PMY A;  1MUX A;  2Y4Q A;  2FCE A;  2F33 A;  1SL9 A;  1XK4 C;  1TIZ A;  1KK8 B;  2KGB C;  1NX2 A;  2KSP A;  1S3P A;  3EKJ A;  3FIA A;  2LCP A;  2K8M B;  4YBH B;  3SJS A;  4GGN A;  1W7I B;  1RTP 1;  1FBV A;  1SL7 A;  3LK0 A;  1DVI A;  1DJZ A;  3SIA A;  2KFF A;  2LM5 A;  1KSO A;  1J7Q A;  2A4J A;  1U5I B;  1U5I A;  4WQ2 A;  3VRN A;  4MRX A;  2WCB A;  5I8N A;  2ZKM X;  4NDD A;  1QJT A;  1PUL A;  3I5H B;  1L2O B;  2BBM A;  3HCM A;  5HLO A;  2WND A;  1F4O A;  5DKN A;  5D69 A;  1KQM B;  1J1E A;  2LMV A;  2MRD A;  1WDC B;  2ZRS A;  3EK4 A;  4PE1 A;  5JOL A;  2WC8 A;  1NX1 A;  1YUR A;  4C0L A;  3ICB A;  2BCB A;  1S36 A;  3TZ1 A;  2JNF A;  1DT7 B;  3DVK A;  1XFX O;  2L98 A;  2GGZ A;  2ZN8 A;  1BJF A;  1DJI A;  3FWC A;  1AJ5 A;  1A2X A;  2KYC A;  5DKQ A;  4HRH A;  2MA2 A;  1WLZ A;  3CTN A;  4PE0 A;  1K94 A;  4MN0 A;  1F8H A;  1A75 B;  1BOC A;  3NSK A;  1A75 A;  4I5L B;  1QX2 A;  3RM1 A;  1DJH A;  2KYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...