4PHJA

The structural basis of differential inhibition of human calpain by indole and phenyl alpha-mercaptoacrylic acids: human unliganded protein
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
173
structure length
173
Chain Sequence
EEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calpain small subunit 1
publication title The structural basis of differential inhibition of human calpain by indole and phenyl alpha-mercaptoacrylic acids.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 66
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4phjA00
1B8LA 1V1GA 3VRQA 1UP5A 1IRJA 2TN4A 4MSPA 1DGUA 1E8AA 2LLTA 4XJKA 2JT8A 2HPSA 3OHMB 3MSEB 2GGMA 4PE0A 3LK0A 1WLMA 4AQIA 2FCDA 1BG1A 1F55A 1G4YR 1FI5A 5D7FA 1QLSA 1CKKA 1YRUB 1S3PA 4U8DA 1KFUS 2KDHA 4NDCA 1CLLA 4C0KA 4CLNA 4CPVA 1M39A 1AJ5A 1EXRA 1K90D 5AXIA 3TS5B 2JU0A 2COLB 1CM1A 4MRXA 1S26D 1DJHA 2CT9A 4GUKA 1J1EA 1JFKA 1TNPA 2KI4B 1K96A 1BOCA 4DRWA 2ZRSA 3LCPC 1EG3A 1IGVA 1QX2A 2SCPA 1WDCB 2BL0C 1MR8A 2L2EA 2MLFC 2SASA 3OB2B 3I5FB 5HKYA 4YI9A 3EVUA 1QX5B 2OPOA 1CDNA 1FF1A 1PALA 2EC6B 3O6BA 3CR4X 5CSJA 2L98A 1N65A 2KYCA 1DMOA 4CFQA 2NXQA 1PULA 4MZLA 3VROA 5I8NA 2OTGC 4BY5A 1GGZA 2K2AA 4MVFA 2KHNA 4PALA 1DGVA 1YVLA 1SL7A 5CPVA 1WRZA 4DIRA 1CLMA 1RFJA 1D1OA 5IBWA 4PHMA 1DJWA 4GGFC 5DKQA 4DCKA 1CB1A 2O5GA 1AK8A 2KBIA 3M0WA 2EGDA 2WCFA 2BE6A 1J55A 1M63B 3VRPA 3AKAA 2PMYA 1OE9B 2EHBA 4NDDA 1IKUA 2MAZA 4AOMA 5I2QA 2FCEA 1KWOB 1YX7A 1XA5A 1CMGA 1UHHA 4OCIA 3DF0B 3PLFB 2MRDA 3PN7C 3QRXA 5HLVA 1N2DA 1M45A 1ALWA 2KNEA 1QS7A 2NZ0A 2P6BB 2F2PA 5DKRA 4FQOA 1OOJA 2JTZA 5I2OA 2BKHB 5DKNA 1MHOA 2KSPA 2PASA 3CR5X 1GJYA 3GOFA 4MN0A 2LHIA 2M97A 2A4JA 3KPXA 1TCFA 1UHJA 1WLZA 4N1FA 2KFFA 3OX5A 4UPGA 1MQ1A 1DJIA 1PSRA 3RM1A 3NSIA 2K7OA 3OX6A 1M46A 2L51A 2ZKMX 4M2QA 4MZJA 1SCMC 2M0RA 1FPWA 5AEQA 1BR4B 3BUWB 1B9AA 3WXAA 2Y4QA 1SNLA 2AAOA 2LANA 3DVEA 3JVTC 1LXFC 1LA0A 3KF9A 2MJWB 4I5NB 1QLKA 2GV5A 4MZKA 3TDUA 3WHTB 4MBEA 1EL4A 3KO0A 1KCYA 3DD4A 1BF5A 1KQMC 1TNWA 5ER4X 5AERA 3A4UB 1S6IA 1RROA 2LC5A 1IJ5A 3PN7B 1SYMA 1A29A 3AKBA 2JNFA 1IH0A 2LMVA 1NCYA 1NYAA 1UHKA 4C0LA 2LP2A 3DVMA 3DF0A 1OZOA 5KTYA 2Y5IA 2V53A 2DOQA 2HETA 1R2UA 1TRFA 2KAXA 2KAYA 5K89A 2L4IA 2ZN9A 2HQ8A 3RLZA 1YRTB 1YUTA 1EG4A 1XFUO 2Y1NA 2ZFDA 3SG4A 1BLQA 3FWCA 3BXKA 4PE7A 2H61A 2LV7A 3NSKA 1IG5A 1SR6C 1XYDA 4P5OE 2LCPA 1B47A 2LP3A 1JSAA 4QJ4B 2JULA 2ZN8A 4I5KA 2LVJA 2F2OA 1H4BA 2I94A 3JVTB 4GFTA 1AUIB 1AJ4A 2WCEA 1DF0B 4YGCB 4PHNA 1NCZA 3ZNIA 1Y0VH 2JXLA 2M7LA 1JF0A 1KQMB 2WCBA 4BY4A 2M1UA 1JBAA 4I5LB 1XFVO 4PCWA 4OVNF 4JPZB 5CSNA 3VRRA 2K7DA 4IL1A 3I5HC 2R2IA 2L0PA 2LAPA 1PVBA 4GNKB 3NXAA 2BBMA 1CM4A 3BUMB 2KYFA 4JWQA 2OS8C 1ZMZA 2LUCA 3FWBA 4C0JA 4ETOA 1Y1UA 2K7CA 1F4OA 1OZSA 4HRHA 1YR5A 1SPYA 2BKIB 1SL9A 2LE9B 3CS1A 3D10A 3NSOA 3WHUB 2CBLA 1CFDA 1QIVA 1QXPA 2E30A 5KSZA 1SMGA 1RWYA 3AAKA 1PRWA 3D0YB 3BUOB 1J1DA 1ODBA 3SIBA 4P2YB 1M31A 3I5IC 1RK9A 2JT3A 2Q91A 2E6WA 4ZCVA 4GPLB 1PK0D 1ALVA 3BQ3A 3CWGA 1K9PA 3PSRA 1EH2A 1IWQA 3SG7A 2VRGA 1WRLA 1L2OC 3EK8A 5FYXA 4QJ5B 3F45A 1IJ6A 1CFFA 1ZACA 5PALA 2LM5A 2KI6D 1LVCD 4TNCA 1A75B 1R6PA 1RTP1 2BL0B 2LLSA 3LK1A 1IQ3A 2ZRTA 4D1EA 2FJUB 2JQ6A 2K0JA 2H2KA 2LVVA 5F6TA 1OQPA 1UUSA 2LVIA 2MBXA 1QX7A 4YGDB 3ICBA 2KOTA 2JRFA 2WNDA 1KK8C 3O4YA 3EK7A 2BECA 1JF2A 2IS9A 2LLUA 3LLEA 2JPTA 1WRKA 2PVBA 4CFRA 2K2FA 2OTGB 4ORAB 1YUSA 2KGBC 1DVIA 3WNXB 1N0YA 2NCOA 3DVKA 3I5IB 1W7IB 2MHHA 5KU1A 1J7OA 1XFXO 3D0YA 2ISDA 3LL8B 2F3YA 3KEVA 2PALA 1KSOA 4GAOA 2MA2A 5HKZA 4WQ3A 1DTLA 4PHJA 4WQ2A 1KQVA 1S6JA 1L2OB 4NDBA 3E3RA 1NX2A 1CDLA 1FW4A 1CFCA 2CXJA 1AVSA 2KQ6A 3BYAA 1TN4A 1KFXL 1SRAA 1QASA 4I5JA 1S5GY 3CGAA 1S5GZ 1HT9A 1GQMA 1B7TY 1X02A 1B4CA 4AQJA 1XVJA 3TUYC 3OP0A 3EKJA 1B7TZ 4PDZA 1WY9A 1TNQA 1ZFSA 1DT7B 2G9BA 3GK4X 2I2RE 2JNXA 2KFGA 1A75A 1KK8B 2I18A 5JJGA 2JC2A 3CTNA 4F0ZB 1NWDA 3SJSA 4A4CA 3DVJA 5AANA 1SKTA 1CLBA 3C1VA 4HREE 4MRYA 1K94A 1SCMB 2D8NA 4WRIA 1F8HA 1J7PA 4MEWA 1B8RA 4QJ3B 2KI4C 1DJXA 1DJZA 3FIAA 4PE1A 1KFUL 2BE4A 1OMVA 4ORBB 1NUBA 2PRUA 4OR9B 1WDCC 3SG2A 1TOPA 1TNXA 1K9KA 5J3XA 3BUNB 4YGEB 1XO5A 1HQVA 4GGFA 1XFZO 3CLNA 3A8RA 1JWDA 4M2PA 3NSLA 1C07A 4R1EA 3EK4A 1LKJA 1NX1A 3EVVA 2G2BA 3AAJA 2ZNDA 2JWWA 2LHLA 2I7AA 3PFVA 1RECA 1G33A 1W7JB 1FI6A 1K93D 1SCVA 1F4QA 1YX8A 2BCBA 4PHKA 2LNKA 5JOLA 1IQ5A 1Y6WA 4CIDA 2BBNA 3FS7A 3BOWB 1TIZA 4GBAA 2JT0A 5B8IB 2KQYA 1SR6B 1LINA 1EJ3A 5HKWA 1AHRA 5G08A 1SBJA 1TTXA 2K61A 2HQWA 3O2PA 1KWOC 3H4SE 2Y1MA 4JQ0D 5TNCA 2LUXA 1MWNA 4M2OA 1NX0A 2CNPA 4YBHB 3EVRA 3K21A 2NLNA 3O78A 3VGOA 5BPJA 1OMDA 2KFHA 1CDMA 2CCMA 2JTTA 1UWOA 4OKHA 4USLA 1NSHA 1B8CA 2LMUA 1NCXA 5AFPA 1XK4C 2H61C 4ORCB 4YGAA 3ZWHA 2LMTA 1MUXA 1QATA 1DF0A 4HRGA 1V1FA 4L9MA 1K8UA 2BCAA 1SW8A 1BR1B 3I5HB 1SY9A 4ICBA 1CTRA 1K9UA 1PSBA 1SK6D 1K95A 2K7BA 4GGNA 3SG6A 1U5IB 4HSZA 1YURA 1JUOA 3SG3A 2OS8B 3KHEA 4A4BA 4Q04A 5CSFA 4YGBB 2F3ZA 5GQQC 1NP8A 1F71A 3TDZA 1Q80A 1ZOTB 2Q4UA 2WC8A 1L7ZA 1XFWO 2GGZA 1QVIY 2KBMA 2NCPA 1OSAA 1QJTA 2RGIA 2WOSA 1JFJA 1BMOA 1QVIZ 1QV1A 1QV0A 2KGRA 3I5GC 2O60A 1AP4A 3IQQA 1A03A 1BODA 1F54A 1MXLC 3CR2A 3TDIA 2M7NA 2HF5A 1A4PA 3OB1B 1NX3A 2F33A 4OV2A 3BOWA 3SG5A 1YUUA 1PVAA 2B1UA 3GK2A 1KSMA 1Y1AA 2PSRA 1KK7Y 3JTDC 2ZNEA 2CTNA 4XYNA 2M29A 4YRUA 1KK7Z 1S36A 2KI6C 3GK1A 3TZ1A 2M8UA 4DUQA 1CDPA 1YVHA 1G8IA 4E68A 1CNPA 5HYDA 1CMFA 1BJFA 1S1EA 3IQOA 2QACA 1Y1XA 4XJKB 5D69A 4N5XA 1NIWA 5HLOA 1LA3A 1JC2A 1XFYO 2F8PA 1MF8B 2FOTA 3PATA 4ZCUA 1K2HA 1U5IA 1CFPA 1MXEA 3VRNA 3BUXB 5CSIA 1DJGA 3I5GB 4NQGA 1F70A 1UHIA 2WORA 3HCMA 4YI8A 1NPQA 1FBVA 2AUCA 1UHNA 2QPTA 3SIAA 2MLEC 1DJYA 3EKHA 1TCOB 1QIWA 2JOJA 4MLWA 4DS7A 1SL8A 1VRKA 3HX4A 3TS5C 3PM8A 1C7WA 1GGWA 2AMIA 1C7VA 3JTDB 1BU3A 1KFXS 3IF7A 1UURA 2M1KB 2L4HA 2M49B 2JXCA 3I5FC 3CZTX 1BT6A 1QTXA 4N1GA 5ER5A 1A2XA 1RJVA 2L5XB 2M3WA 1B1GA 2EC6C 2BCXA 1J7RA 2JZIA 2KAVA 3PALA 1YTZC 4PE4A 1H8BA 2LVKA 4FTGA 1XK4A 2M9GA 1S6CA 1J7QA 5I2LA 2K8MB 2L50A 1ZUZA 1OMRA 3TUYB
chains in the Genus database with same CATH superfamily
1B8LA 1V1GA 5EL2A 1UP5A 1IRJA 2TN4A 4MSPA 1DGUA 1E8AA 2LLTA 4XJKA 2JT8A 2HPSA 3OHMB 3MSEB 2GGMA 4JD9A 2BNXA 1WLMA 3LK0A 2FCDA 4PE0A 4AQIA 1F55A 1G4YR 1FI5A 5D7FA 1QLSA 5FI7A 1CKKA 2K60A 1YRUB 1S3PA 4U8DA 1KFUS 2KDHA 2KLDA 1CLLA 4NDCA 4C0KA 4CLNA 4CPVA 1M39A 1AJ5A 1EXRA 1K90D 5AXIA 3TS5B 2JU0A 2COLB 1CM1A 4MRXA 1S26D 1DJHA 2CT9A 2L5YA 4GUKA 1J1EA 1JFKA 1TNPA 2KI4B 3B87A 1K96A 1BOCA 4DRWA 2ZRSA 3LCPC 1EG3A 1IGVA 1QX2A 2SCPA 1WDCB 2BL0C 1MR8A 2L2EA 2MLFC 2SASA 2WCLA 3DXLA 3B6XA 3I5FB 3OB2B 5HKYA 4YI9A 3EVUA 1QX5B 2OPOA 1CDNA 1FF1A 1PALA 2EC6B 3O6BA 3CR4X 5CSJA 3CZ2A 2L98A 1N65A 2KYCA 3DY9A 4CFQA 1DMOA 2NXQA 1PULA 4MZLA 5HL1A 2P71A 3VROA 5I8NA 2OTGC 2QEOA 4BY5A 1GGZA 2K2AA 4MVFA 2KHNA 1GM0A 4PALA 1DGVA 1Z4HA 2WC5A 3R1VA 3SS4A 1YVLA 1SL7A 3FE6A 1WRZA 5CPVA 4DIRA 1OOIX 3BFAA 1CLMA 1RFJA 1D1OA 5IBWA 4PHMA 1DJWA 4GGFC 5DKQA 4DCKA 1CB1A 2P70A 2O5GA 1AK8A 2KBIA 3M0WA 2EGDA 2WCFA 2BE6A 1J55A 1M63B 3VRPA 3AKAA 2PMYA 1OE9B 2EHBA 4NDDA 1IKUA 2MAZA 4AOMA 5I2QA 2FCEA 1KWOB 1YX7A 1XA5A 1CMGA 1UHHA 4OCIA 3DF0B 3PLFB 2MRDA 3DZTA 3PN7C 3QRXA 5HLVA 1N2DA 1M45A 5FI2A 1ALWA 2KNEA 1QS7A 2NZ0A 2P6BB 2F2PA 5DKRA 4FQOA 1OOJA 2JTZA 5I2OA 2BKHB 5DKNA 1MHOA 2KSPA 2PASA 3CR5X 1GJYA 3GOFA 3L4AA 4MN0A 2LHIA 2M97A 2A4JA 3KPXA 1TCFA 3D76A 3S0EA 1UHJA 1WLZA 4N1FA 2KFFA 3OX5A 4UPGA 1MQ1A 1DJIA 1PSRA 3RM1A 3NSIA 2K7OA 3OX6A 1M46A 2L51A 2ZKMX 4M2QA 4MZJA 1SCMC 2M0RA 4OZDA 1DELA 1FPWA 5AEQA 3SS5A 1BR4B 3BUWB 3IVTA 1B9AA 3WXAA 2Y4QA 1SNLA 2AAOA 2LANA 3DVEA 3JVTC 3QMEA 1LXFC 1LA0A 3KF9A 2MJWB 4I5NB 1QLKA 2GV5A 2WCHA 4MZKA 2KLEA 3TDUA 3WHTB 4MBEA 1EL4A 2JPOA 3KO0A 1KCYA 3DD4A 3EG5B 1BF5A 1KQMC 1TNWA 5ER4X 5DICA 3B88A 5AERA 3A4UB 1S6IA 1RROA 2LC5A 1IJ5A 3PN7B 1SYMA 1A29A 3AKBA 2JNFA 1IH0A 2LMVA 1NCYA 1NYAA 1IIOA 1UHKA 3B86A 4C0LA 2LP2A 3DVMA 3DF0A 1OZOA 5KTYA 2Y5IA 4FQTA 2V53A 2DOQA 2HETA 1R2UA 1TRFA 2KAXA 2KAYA 5K89A 2L4IA 2ZN9A 2HQ8A 3RLZA 1YRTB 1YUTA 1EG4A 1XFUO 2Y1NA 2ZFDA 3SG4A 1BLQA 3FWCA 3BXKA 4PE7A 2H61A 2LV7A 3NSKA 1IG5A 1SR6C 1XYDA 4P5OE 3BFBA 2LCPA 1B47A 2LP3A 3S0AA 1DQEA 1JSAA 3D77A 4QJ4B 2JULA 2ZN8A 4I5KA 2QEHA 2LVJA 2F2OA 1H4BA 2I94A 1OW4A 3JVTB 1AUIB 1AJ4A 4GFTA 2WCEA 1DF0B 4YGCB 4PHNA 1NCZA 3ZNIA 1Y0VH 2JXLA 1BG1A 2M7LA 1JF0A 1KQMB 2WCBA 4BY4A 2M1UA 1JBAA 4I5LB 1XFVO 4PCWA 4OVNF 4JPZB 5CSNA 3VRRA 2K7DA 3DYEA 4IL1A 3I5HC 2R2IA 2L0PA 2LAPA 1PVBA 4GNKB 3NXAA 2BBMA 1CM4A 3BUMB 2QDIA 2FJYA 2KYFA 4JWQA 2OS8C 1ZMZA 2LUCA 3FWBA 4C0JA 4ETOA 1Y1UA 2K7CA 1F4OA 1OZSA 4HRHA 1YR5A 1SPYA 2BKIB 1SL9A 2LE9B 3CS1A 3D10A 2GTEA 3NSOA 3WHUB 1Z2CB 1CFDA 2CBLA 1QIVA 1QXPA 2E30A 3CDNA 5KSZA 1SMGA 1RWYA 3AAKA 3L47A 1PRWA 3D0YB 3BUOB 3D78A 1J1DA 1ODBA 4IJ7A 3SIBA 4P2YB 1M31A 3D74A 3I5IC 1RK9A 2JT3A 2Q91A 2E6WA 2PYQA 4ZCVA 4GPLB 1PK0D 1ALVA 3BQ3A 3CWGA 1K9PA 3PSRA 3CZ1A 1EH2A 1IWQA 3SG7A 2VRGA 1WRLA 1L2OC 3EK8A 5FYXA 4QJ5B 5I94A 3F45A 1IJ6A 1CFFA 1ZACA 5PALA 5D3OA 2LM5A 2KI6D 1LVCD 3S0BA 3UNWA 3S0FA 3S0DA 4TNCA 1A75B 1R6PA 1RTP1 2BL0B 2LLSA 3LK1A 1IQ3A 2ZRTA 4D1EA 2FJUB 2JQ6A 2K0JA 2H2KA 2LVVA 5F6TA 1OQPA 1UUSA 2LVIA 2MBXA 1QX7A 4YGDB 3ICBA 2KOTA 2JRFA 2WNDA 1KK8C 3O4YA 3EK7A 2BECA 1JF2A 2IS9A 2LLUA 3NHTA 3LLEA 2JPTA 1WRKA 2PVBA 4CFRA 1W9ZA 2K2FA 2OTGB 4ORAB 1YUSA 2KGBC 1QWVA 1DVIA 3WNXB 1N0YA 2NCOA 1TWOA 3DVKA 3I5IB 1W7IB 2MHHA 3L4LA 5KU1A 1J7OA 1XFXO 3D0YA 2ISDA 3LL8B 2F3YA 3KEVA 2PALA 1KSOA 4GAOA 2MA2A 1LS8A 5HKZA 4WQ3A 1DTLA 4PHJA 4WQ2A 1KQVA 1S6JA 3BFHA 1L2OB 4NDBA 3E3RA 1NX2A 1CDLA 1FW4A 1CFCA 2CXJA 1AVSA 2KQ6A 3BYAA 1TN4A 1KFXL 1SRAA 1QASA 4I5JA 1S5GY 3CGAA 1S5GZ 1HT9A 1GQMA 1B7TY 1X02A 3CYZA 3R1PA 4AQJA 1XVJA 1B4CA 3TUYC 3OP0A 3EKJA 1B7TZ 4PDZA 1WY9A 1TNQA 1ZFSA 1DT7B 2G9BA 3GK4X 2I2RE 2JNXA 2L2CA 4INWA 2KFGA 1A75A 1KK8B 1T14A 2I18A 1TUZA 5JJGA 2JC2A 3BJHA 3CTNA 4F0ZB 1NWDA 3SJSA 3OGNA 4A4CA 4INXA 3DVJA 5AANA 1SKTA 3R1OA 1CLBA 3C1VA 3FE9A 4HREE 4MRYA 1K94A 1SCMB 2D8NA 4WRIA 1F8HA 1J7PA 4MEWA 1B8RA 4QJ3B 2KI4C 1DJXA 1DJZA 3FIAA 4PE1A 1KFUL 2BE4A 3VB1A 1OMVA 4ORBB 1NUBA 2PRUA 4OR9B 1WDCC 3SG2A 1TOPA 1TNXA 1K9KA 5J3XA 3PJIA 3BUNB 1C3YA 4YGEB 1XO5A 1HQVA 2KPHA 1XFZO 3CLNA 3A8RA 4GGFA 1JWDA 1DEKA 4M2PA 3NSLA 1C07A 4R1EA 4KYNA 3EK4A 1LKJA 1NX1A 3EVVA 2G2BA 3AAJA 2ZNDA 2JWWA 2LHLA 2I7AA 4PT1A 3PFVA 1RECA 1G33A 1W7JB 1FI6A 1K93D 1SCVA 3VRQA 1F4QA 1YX8A 2BCBA 4PHKA 2LNKA 5JOLA 2WC6A 1IQ5A 1Y6WA 4CIDA 2BBNA 3B7AA 3BOWB 1TIZA 3FE8A 2JT0A 3FS7A 2KQYA 1SR6B 4GBAA 1LINA 5B8IB 1EJ3A 5HKWA 1AHRA 5G08A 1SBJA 1TTXA 2K61A 2HQWA 1OOFA 3O2PA 1SSEB 1KWOC 3H4SE 2Y1MA 4JQ0D 5TNCA 2LUXA 1MWNA 3PM2A 1NX0A 4M2OA 2CNPA 4YBHB 3EVRA 3K21A 2NLNA 3O78A 3VGOA 5BPJA 1OMDA 2KFHA 1CDMA 2CCMA 2JTTA 3NHIA 4F7FA 1UWOA 3CABA 4OKHA 2WCKA 1NSHA 4USLA 1B8CA 2LMUA 1NCXA 5AFPA 1XK4C 2H61C 1XFRA 3R72A 4ORCB 4YGAA 2LMTA 3ZWHA 1MUXA 1QATA 1DF0A 4HRGA 1V1FA 4L9MA 1K8UA 2BCAA 1SW8A 1BR1B 3I5HB 1SY9A 4ICBA 1CTRA 1K9UA 1PSBA 1SK6D 1K95A 2K7BA 4GGNA 3SG6A 1U5IB 4HSZA 1YURA 3SS3A 1OOHA 1JUOA 3SG3A 2OS8B 3KHEA 1ORGA 4A4BA 4JKTA 4Q04A 5CSFA 4YGBB 2F3ZA 5GQQC 1NP8A 1F71A 3TDZA 1Q80A 1ZOTB 2Q4UA 2WC8A 1L7ZA 1XFWO 2GGZA 1QVIY 2KBMA 2NCPA 1OSAA 1QJTA 2QEBA 2RGIA 2WOSA 1JFJA 1BMOA 1QVIZ 1QV1A 1QV0A 2KGRA 3N7HA 3I5GC 2O60A 1AP4A 3IQQA 1A03A 1BODA 1F54A 1MXLC 3CR2A 1P28A 3UO9A 3TDIA 2M7NA 2HF5A 1A4PA 3OB1B 3K1EA 1NX3A 2F33A 4OV2A 3D73A 3BOWA 3Q8IA 3SG5A 1YUUA 1PVAA 2B1UA 3GK2A 1KSMA 1Y1AA 2PSRA 1KK7Y 3JTDC 2ZNEA 2CTNA 4XYNA 2M29A 4YRUA 1KK7Z 1S36A 2KI6C 3GK1A 3TZ1A 2M8UA 4DUQA 1CDPA 1YVHA 1G8IA 4E68A 1CNPA 5HYDA 1TUJA 3OBVA 1CMFA 1BJFA 1S1EA 3IQOA 2QACA 1Y1XA 4XJKB 5D69A 4N5XA 1NIWA 5HLOA 1LA3A 1JC2A 1XFYO 2ERBA 2F8PA 1MF8B 2FOTA 3PATA 4ZCUA 1DC1A 5FI6A 2WCJA 1K2HA 3V2LA 1U5IA 1CFPA 1MXEA 3VRNA 3BUXB 3D75A 5CSIA 1DJGA 3I5GB 4NQGA 3S0GA 1F70A 1UHIA 2WCMA 2WORA 3CZ0A 3HCMA 1NPQA 2YGUA 1FBVA 2AUCA 4YI8A 1UHNA 2PQLA 2QPTA 3SIAA 2MLEC 1DJYA 1C3ZA 3EKHA 1TCOB 1QIWA 2JOJA 4MLWA 4DS7A 1SL8A 1VRKA 2H8VA 3HX4A 3TS5C 2BAPA 3PM8A 1C7WA 1GGWA 2AMIA 1C7VA 3JTDB 1BU3A 1KFXS 3IF7A 1UURA 2M1KB 2L4HA 2M49B 2JXCA 3I5FC 3CZTX 1BT6A 1QTXA 4N1GA 5ER5A 1A2XA 1RJVA 2L5XB 2M3WA 1B1GA 2QEVA 2EC6C 2BCXA 1J7RA 2JZIA 2KAVA 3NGVA 3PALA 1YTZC 4PE4A 1H8BA 2LVKA 4FTGA 1XK4A 2M9GA 1S6CA 1J7QA 5I2LA 3RZSA 1OOGA 2K8MB 2L50A 3O4XA 1ZUZA 1OMRA 3TUYB
chains in the Genus database with same CATH topology
1B8LA 1V1GA 3VRQA 1UP5A 1IRJA 2TN4A 4MSPA 1DGUA 1E8AA 2LLTA 4XJKA 2JT8A 2HPSA 3OHMB 3MSEB 2GGMA 4PE0A 3LK0A 1WLMA 4AQIA 2FCDA 1BG1A 1F55A 1G4YR 1FI5A 5D7FA 1QLSA 1CKKA 1YRUB 1S3PA 4U8DA 1KFUS 2KDHA 4NDCA 1CLLA 4C0KA 4CLNA 4CPVA 1M39A 1AJ5A 1EXRA 1K90D 5AXIA 3TS5B 2JU0A 2COLB 1CM1A 4MRXA 1S26D 1DJHA 2CT9A 4GUKA 1J1EA 1JFKA 1TNPA 2KI4B 1K96A 1BOCA 4DRWA 2ZRSA 3LCPC 1EG3A 1IGVA 1QX2A 2SCPA 1WDCB 2BL0C 1MR8A 2L2EA 2MLFC 2SASA 3OB2B 3I5FB 5HKYA 4YI9A 3EVUA 1QX5B 2OPOA 1CDNA 1FF1A 1PALA 2EC6B 3O6BA 3CR4X 5CSJA 2L98A 1N65A 2KYCA 1DMOA 4CFQA 2NXQA 1PULA 4MZLA 3VROA 5I8NA 2OTGC 4BY5A 1GGZA 2K2AA 4MVFA 2KHNA 4PALA 1DGVA 1YVLA 1SL7A 5CPVA 1WRZA 4DIRA 1CLMA 1RFJA 1D1OA 5IBWA 4PHMA 1DJWA 4GGFC 5DKQA 4DCKA 1CB1A 2O5GA 1AK8A 2KBIA 3M0WA 2EGDA 2WCFA 2BE6A 1J55A 1M63B 3VRPA 3AKAA 2PMYA 1OE9B 2EHBA 4NDDA 1IKUA 2MAZA 4AOMA 5I2QA 2FCEA 1KWOB 1YX7A 1XA5A 1CMGA 1UHHA 4OCIA 3DF0B 3PLFB 2MRDA 3PN7C 3QRXA 5HLVA 1N2DA 1M45A 1ALWA 2KNEA 1QS7A 2NZ0A 2P6BB 2F2PA 5DKRA 4FQOA 1OOJA 2JTZA 5I2OA 2BKHB 5DKNA 1MHOA 2KSPA 2PASA 3CR5X 1GJYA 3GOFA 4MN0A 2LHIA 2M97A 2A4JA 3KPXA 1TCFA 1UHJA 1WLZA 4N1FA 2KFFA 3OX5A 4UPGA 1MQ1A 1DJIA 1PSRA 3RM1A 3NSIA 2K7OA 3OX6A 1M46A 2L51A 2ZKMX 4M2QA 4MZJA 1SCMC 2M0RA 1FPWA 5AEQA 1BR4B 3BUWB 1B9AA 3WXAA 2Y4QA 1SNLA 2AAOA 2LANA 3DVEA 3JVTC 1LXFC 1LA0A 3KF9A 2MJWB 4I5NB 1QLKA 2GV5A 4MZKA 3TDUA 3WHTB 4MBEA 1EL4A 3KO0A 1KCYA 3DD4A 1BF5A 1KQMC 1TNWA 5ER4X 5AERA 3A4UB 1S6IA 1RROA 2LC5A 1IJ5A 3PN7B 1SYMA 1A29A 3AKBA 2JNFA 1IH0A 2LMVA 1NCYA 1NYAA 1UHKA 4C0LA 2LP2A 3DVMA 3DF0A 1OZOA 5KTYA 2Y5IA 2V53A 2DOQA 2HETA 1R2UA 1TRFA 2KAXA 2KAYA 5K89A 2L4IA 2ZN9A 2HQ8A 3RLZA 1YRTB 1YUTA 1EG4A 1XFUO 2Y1NA 2ZFDA 3SG4A 1BLQA 3FWCA 3BXKA 4PE7A 2H61A 2LV7A 3NSKA 1IG5A 1SR6C 1XYDA 4P5OE 2LCPA 1B47A 2LP3A 1JSAA 4QJ4B 2JULA 2ZN8A 4I5KA 2LVJA 2F2OA 1H4BA 2I94A 3JVTB 4GFTA 1AUIB 1AJ4A 2WCEA 1DF0B 4YGCB 4PHNA 1NCZA 3ZNIA 1Y0VH 2JXLA 2M7LA 1JF0A 1KQMB 2WCBA 4BY4A 2M1UA 1JBAA 4I5LB 1XFVO 4PCWA 4OVNF 4JPZB 5CSNA 3VRRA 2K7DA 4IL1A 3I5HC 2R2IA 2L0PA 2LAPA 1PVBA 4GNKB 3NXAA 2BBMA 1CM4A 3BUMB 2KYFA 4JWQA 2OS8C 1ZMZA 2LUCA 3FWBA 4C0JA 4ETOA 1Y1UA 2K7CA 1F4OA 1OZSA 4HRHA 1YR5A 1SPYA 2BKIB 1SL9A 2LE9B 3CS1A 3D10A 3NSOA 3WHUB 2CBLA 1CFDA 1QIVA 1QXPA 2E30A 5KSZA 1SMGA 1RWYA 3AAKA 1PRWA 3D0YB 3BUOB 1J1DA 1ODBA 3SIBA 4P2YB 1M31A 3I5IC 1RK9A 2JT3A 2Q91A 2E6WA 4ZCVA 4GPLB 1PK0D 1ALVA 3BQ3A 3CWGA 1K9PA 3PSRA 1EH2A 1IWQA 3SG7A 2VRGA 1WRLA 1L2OC 3EK8A 5FYXA 4QJ5B 3F45A 1IJ6A 1CFFA 1ZACA 5PALA 2LM5A 2KI6D 1LVCD 4TNCA 1A75B 1R6PA 1RTP1 2BL0B 2LLSA 3LK1A 1IQ3A 2ZRTA 4D1EA 2FJUB 2JQ6A 2K0JA 2H2KA 2LVVA 5F6TA 1OQPA 1UUSA 2LVIA 2MBXA 1QX7A 4YGDB 3ICBA 2KOTA 2JRFA 2WNDA 1KK8C 3O4YA 3EK7A 2BECA 1JF2A 2IS9A 2LLUA 3LLEA 2JPTA 1WRKA 2PVBA 4CFRA 2K2FA 2OTGB 4ORAB 1YUSA 2KGBC 1DVIA 3WNXB 1N0YA 2NCOA 3DVKA 3I5IB 1W7IB 2MHHA 5KU1A 1J7OA 1XFXO 3D0YA 2ISDA 3LL8B 2F3YA 3KEVA 2PALA 1KSOA 4GAOA 2MA2A 5HKZA 4WQ3A 1DTLA 4PHJA 4WQ2A 1KQVA 1S6JA 1L2OB 4NDBA 3E3RA 1NX2A 1CDLA 1FW4A 1CFCA 2CXJA 1AVSA 2KQ6A 3BYAA 1TN4A 1KFXL 1SRAA 1QASA 4I5JA 1S5GY 3CGAA 1S5GZ 1HT9A 1GQMA 1B7TY 1X02A 1B4CA 4AQJA 1XVJA 3TUYC 3OP0A 3EKJA 1B7TZ 4PDZA 1WY9A 1TNQA 1ZFSA 1DT7B 2G9BA 3GK4X 2I2RE 2JNXA 2KFGA 1A75A 1KK8B 2I18A 5JJGA 2JC2A 3CTNA 4F0ZB 1NWDA 3SJSA 4A4CA 3DVJA 5AANA 1SKTA 1CLBA 3C1VA 4HREE 4MRYA 1K94A 1SCMB 2D8NA 4WRIA 1F8HA 1J7PA 4MEWA 1B8RA 4QJ3B 2KI4C 1DJXA 1DJZA 3FIAA 4PE1A 1KFUL 2BE4A 1OMVA 4ORBB 1NUBA 2PRUA 4OR9B 1WDCC 3SG2A 1TOPA 1TNXA 1K9KA 5J3XA 3BUNB 4YGEB 1XO5A 1HQVA 4GGFA 1XFZO 3CLNA 3A8RA 1JWDA 4M2PA 3NSLA 1C07A 4R1EA 3EK4A 1LKJA 1NX1A 3EVVA 2G2BA 3AAJA 2ZNDA 2JWWA 2LHLA 2I7AA 3PFVA 1RECA 1G33A 1W7JB 1FI6A 1K93D 1SCVA 1F4QA 1YX8A 2BCBA 4PHKA 2LNKA 5JOLA 1IQ5A 1Y6WA 4CIDA 2BBNA 3FS7A 3BOWB 1TIZA 4GBAA 2JT0A 5B8IB 2KQYA 1SR6B 1LINA 1EJ3A 5HKWA 1AHRA 5G08A 1SBJA 1TTXA 2K61A 2HQWA 3O2PA 1KWOC 3H4SE 2Y1MA 4JQ0D 5TNCA 2LUXA 1MWNA 4M2OA 1NX0A 2CNPA 4YBHB 3EVRA 3K21A 2NLNA 3O78A 3VGOA 5BPJA 1OMDA 2KFHA 1CDMA 2CCMA 2JTTA 1UWOA 4OKHA 4USLA 1NSHA 1B8CA 2LMUA 1NCXA 5AFPA 1XK4C 2H61C 4ORCB 4YGAA 3ZWHA 2LMTA 1MUXA 1QATA 1DF0A 4HRGA 1V1FA 4L9MA 1K8UA 2BCAA 1SW8A 1BR1B 3I5HB 1SY9A 4ICBA 1CTRA 1K9UA 1PSBA 1SK6D 1K95A 2K7BA 4GGNA 3SG6A 1U5IB 4HSZA 1YURA 1JUOA 3SG3A 2OS8B 3KHEA 4A4BA 4Q04A 5CSFA 4YGBB 2F3ZA 5GQQC 1NP8A 1F71A 3TDZA 1Q80A 1ZOTB 2Q4UA 2WC8A 1L7ZA 1XFWO 2GGZA 1QVIY 2KBMA 2NCPA 1OSAA 1QJTA 2RGIA 2WOSA 1JFJA 1BMOA 1QVIZ 1QV1A 1QV0A 2KGRA 3I5GC 2O60A 1AP4A 3IQQA 1A03A 1BODA 1F54A 1MXLC 3CR2A 3TDIA 2M7NA 2HF5A 1A4PA 3OB1B 1NX3A 2F33A 4OV2A 3BOWA 3SG5A 1YUUA 1PVAA 2B1UA 3GK2A 1KSMA 1Y1AA 2PSRA 1KK7Y 3JTDC 2ZNEA 2CTNA 4XYNA 2M29A 4YRUA 1KK7Z 1S36A 2KI6C 3GK1A 3TZ1A 2M8UA 4DUQA 1CDPA 1YVHA 1G8IA 4E68A 1CNPA 5HYDA 1CMFA 1BJFA 1S1EA 3IQOA 2QACA 1Y1XA 4XJKB 5D69A 4N5XA 1NIWA 5HLOA 1LA3A 1JC2A 1XFYO 2F8PA 1MF8B 2FOTA 3PATA 4ZCUA 1K2HA 1U5IA 1CFPA 1MXEA 3VRNA 3BUXB 5CSIA 1DJGA 3I5GB 4NQGA 1F70A 1UHIA 2WORA 3HCMA 4YI8A 1NPQA 1FBVA 2AUCA 1UHNA 2QPTA 3SIAA 2MLEC 1DJYA 3EKHA 1TCOB 1QIWA 2JOJA 4MLWA 4DS7A 1SL8A 1VRKA 3HX4A 3TS5C 3PM8A 1C7WA 1GGWA 2AMIA 1C7VA 3JTDB 1BU3A 1KFXS 3IF7A 1UURA 2M1KB 2L4HA 2M49B 2JXCA 3I5FC 3CZTX 1BT6A 1QTXA 4N1GA 5ER5A 1A2XA 1RJVA 2L5XB 2M3WA 1B1GA 2EC6C 2BCXA 1J7RA 2JZIA 2KAVA 3PALA 1YTZC 4PE4A 1H8BA 2LVKA 4FTGA 1XK4A 2M9GA 1S6CA 1J7QA 5I2LA 2K8MB 2L50A 1ZUZA 1OMRA 3TUYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B8L A;  1V1G A;  3VRQ A;  1UP5 A;  1IRJ A;  2TN4 A;  4MSP A;  1DGU A;  1E8A A;  2LLT A;  4XJK A;  2JT8 A;  2HPS A;  3OHM B;  3MSE B;  2GGM A;  4PE0 A;  3LK0 A;  1WLM A;  4AQI A;  2FCD A;  1BG1 A;  1F55 A;  1G4Y R;  1FI5 A;  5D7F A;  1QLS A;  1CKK A;  1YRU B;  1S3P A;  4U8D A;  1KFU S;  2KDH A;  4NDC A;  1CLL A;  4C0K A;  4CLN A;  4CPV A;  1M39 A;  1AJ5 A;  1EXR A;  1K90 D;  5AXI A;  3TS5 B;  2JU0 A;  2COL B;  1CM1 A;  4MRX A;  1S26 D;  1DJH A;  2CT9 A;  4GUK A;  1J1E A;  1JFK A;  1TNP A;  2KI4 B;  1K96 A;  1BOC A;  4DRW A;  2ZRS A;  3LCP C;  1EG3 A;  1IGV A;  1QX2 A;  2SCP A;  1WDC B;  2BL0 C;  1MR8 A;  2L2E A;  2MLF C;  2SAS A;  3OB2 B;  3I5F B;  5HKY A;  4YI9 A;  3EVU A;  1QX5 B;  2OPO A;  1CDN A;  1FF1 A;  1PAL A;  2EC6 B;  3O6B A;  3CR4 X;  5CSJ A;  2L98 A;  1N65 A;  2KYC A;  1DMO A;  4CFQ A;  2NXQ A;  1PUL A;  4MZL A;  3VRO A;  5I8N A;  2OTG C;  4BY5 A;  1GGZ A;  2K2A A;  4MVF A;  2KHN A;  4PAL A;  1DGV A;  1YVL A;  1SL7 A;  5CPV A;  1WRZ A;  4DIR A;  1CLM A;  1RFJ A;  1D1O A;  5IBW A;  4PHM A;  1DJW A;  4GGF C;  5DKQ A;  4DCK A;  1CB1 A;  2O5G A;  1AK8 A;  2KBI A;  3M0W A;  2EGD A;  2WCF A;  2BE6 A;  1J55 A;  1M63 B;  3VRP A;  3AKA A;  2PMY A;  1OE9 B;  2EHB A;  4NDD A;  1IKU A;  2MAZ A;  4AOM A;  5I2Q A;  2FCE A;  1KWO B;  1YX7 A;  1XA5 A;  1CMG A;  1UHH A;  4OCI A;  3DF0 B;  3PLF B;  2MRD A;  3PN7 C;  3QRX A;  5HLV A;  1N2D A;  1M45 A;  1ALW A;  2KNE A;  1QS7 A;  2NZ0 A;  2P6B B;  2F2P A;  5DKR A;  4FQO A;  1OOJ A;  2JTZ A;  5I2O A;  2BKH B;  5DKN A;  1MHO A;  2KSP A;  2PAS A;  3CR5 X;  1GJY A;  3GOF A;  4MN0 A;  2LHI A;  2M97 A;  2A4J A;  3KPX A;  1TCF A;  1UHJ A;  1WLZ A;  4N1F A;  2KFF A;  3OX5 A;  4UPG A;  1MQ1 A;  1DJI A;  1PSR A;  3RM1 A;  3NSI A;  2K7O A;  3OX6 A;  1M46 A;  2L51 A;  2ZKM X;  4M2Q A;  4MZJ A;  1SCM C;  2M0R A;  1FPW A;  5AEQ A;  1BR4 B;  3BUW B;  1B9A A;  3WXA A;  2Y4Q A;  1SNL A;  2AAO A;  2LAN A;  3DVE A;  3JVT C;  1LXF C;  1LA0 A;  3KF9 A;  2MJW B;  4I5N B;  1QLK A;  2GV5 A;  4MZK A;  3TDU A;  3WHT B;  4MBE A;  1EL4 A;  3KO0 A;  1KCY A;  3DD4 A;  1BF5 A;  1KQM C;  1TNW A;  5ER4 X;  5AER A;  3A4U B;  1S6I A;  1RRO A;  2LC5 A;  1IJ5 A;  3PN7 B;  1SYM A;  1A29 A;  3AKB A;  2JNF A;  1IH0 A;  2LMV A;  1NCY A;  1NYA A;  1UHK A;  4C0L A;  2LP2 A;  3DVM A;  3DF0 A;  1OZO A;  5KTY A;  2Y5I A;  2V53 A;  2DOQ A;  2HET A;  1R2U A;  1TRF A;  2KAX A;  2KAY A;  5K89 A;  2L4I A;  2ZN9 A;  2HQ8 A;  3RLZ A;  1YRT B;  1YUT A;  1EG4 A;  1XFU O;  2Y1N A;  2ZFD A;  3SG4 A;  1BLQ A;  3FWC A;  3BXK A;  4PE7 A;  2H61 A;  2LV7 A;  3NSK A;  1IG5 A;  1SR6 C;  1XYD A;  4P5O E;  2LCP A;  1B47 A;  2LP3 A;  1JSA A;  4QJ4 B;  2JUL A;  2ZN8 A;  4I5K A;  2LVJ A;  2F2O A;  1H4B A;  2I94 A;  3JVT B;  4GFT A;  1AUI B;  1AJ4 A;  2WCE A;  1DF0 B;  4YGC B;  4PHN A;  1NCZ A;  3ZNI A;  1Y0V H;  2JXL A;  2M7L A;  1JF0 A;  1KQM B;  2WCB A;  4BY4 A;  2M1U A;  1JBA A;  4I5L B;  1XFV O;  4PCW A;  4OVN F;  4JPZ B;  5CSN A;  3VRR A;  2K7D A;  4IL1 A;  3I5H C;  2R2I A;  2L0P A;  2LAP A;  1PVB A;  4GNK B;  3NXA A;  2BBM A;  1CM4 A;  3BUM B;  2KYF A;  4JWQ A;  2OS8 C;  1ZMZ A;  2LUC A;  3FWB A;  4C0J A;  4ETO A;  1Y1U A;  2K7C A;  1F4O A;  1OZS A;  4HRH A;  1YR5 A;  1SPY A;  2BKI B;  1SL9 A;  2LE9 B;  3CS1 A;  3D10 A;  3NSO A;  3WHU B;  2CBL A;  1CFD A;  1QIV A;  1QXP A;  2E30 A;  5KSZ A;  1SMG A;  1RWY A;  3AAK A;  1PRW A;  3D0Y B;  3BUO B;  1J1D A;  1ODB A;  3SIB A;  4P2Y B;  1M31 A;  3I5I C;  1RK9 A;  2JT3 A;  2Q91 A;  2E6W A;  4ZCV A;  4GPL B;  1PK0 D;  1ALV A;  3BQ3 A;  3CWG A;  1K9P A;  3PSR A;  1EH2 A;  1IWQ A;  3SG7 A;  2VRG A;  1WRL A;  1L2O C;  3EK8 A;  5FYX A;  4QJ5 B;  3F45 A;  1IJ6 A;  1CFF A;  1ZAC A;  5PAL A;  2LM5 A;  2KI6 D;  1LVC D;  4TNC A;  1A75 B;  1R6P A;  1RTP 1;  2BL0 B;  2LLS A;  3LK1 A;  1IQ3 A;  2ZRT A;  4D1E A;  2FJU B;  2JQ6 A;  2K0J A;  2H2K A;  2LVV A;  5F6T A;  1OQP A;  1UUS A;  2LVI A;  2MBX A;  1QX7 A;  4YGD B;  3ICB A;  2KOT A;  2JRF A;  2WND A;  1KK8 C;  3O4Y A;  3EK7 A;  2BEC A;  1JF2 A;  2IS9 A;  2LLU A;  3LLE A;  2JPT A;  1WRK A;  2PVB A;  4CFR A;  2K2F A;  2OTG B;  4ORA B;  1YUS A;  2KGB C;  1DVI A;  3WNX B;  1N0Y A;  2NCO A;  3DVK A;  3I5I B;  1W7I B;  2MHH A;  5KU1 A;  1J7O A;  1XFX O;  3D0Y A;  2ISD A;  3LL8 B;  2F3Y A;  3KEV A;  2PAL A;  1KSO A;  4GAO A;  2MA2 A;  5HKZ A;  4WQ3 A;  1DTL A;  4PHJ A;  4WQ2 A;  1KQV A;  1S6J A;  1L2O B;  4NDB A;  3E3R A;  1NX2 A;  1CDL A;  1FW4 A;  1CFC A;  2CXJ A;  1AVS A;  2KQ6 A;  3BYA A;  1TN4 A;  1KFX L;  1SRA A;  1QAS A;  4I5J A;  1S5G Y;  3CGA A;  1S5G Z;  1HT9 A;  1GQM A;  1B7T Y;  1X02 A;  1B4C A;  4AQJ A;  1XVJ A;  3TUY C;  3OP0 A;  3EKJ A;  1B7T Z;  4PDZ A;  1WY9 A;  1TNQ A;  1ZFS A;  1DT7 B;  2G9B A;  3GK4 X;  2I2R E;  2JNX A;  2KFG A;  1A75 A;  1KK8 B;  2I18 A;  5JJG A;  2JC2 A;  3CTN A;  4F0Z B;  1NWD A;  3SJS A;  4A4C A;  3DVJ A;  5AAN A;  1SKT A;  1CLB A;  3C1V A;  4HRE E;  4MRY A;  1K94 A;  1SCM B;  2D8N A;  4WRI A;  1F8H A;  1J7P A;  4MEW A;  1B8R A;  4QJ3 B;  2KI4 C;  1DJX A;  1DJZ A;  3FIA A;  4PE1 A;  1KFU L;  2BE4 A;  1OMV A;  4ORB B;  1NUB A;  2PRU A;  4OR9 B;  1WDC C;  3SG2 A;  1TOP A;  1TNX A;  1K9K A;  5J3X A;  3BUN B;  4YGE B;  1XO5 A;  1HQV A;  4GGF A;  1XFZ O;  3CLN A;  3A8R A;  1JWD A;  4M2P A;  3NSL A;  1C07 A;  4R1E A;  3EK4 A;  1LKJ A;  1NX1 A;  3EVV A;  2G2B A;  3AAJ A;  2ZND A;  2JWW A;  2LHL A;  2I7A A;  3PFV A;  1REC A;  1G33 A;  1W7J B;  1FI6 A;  1K93 D;  1SCV A;  1F4Q A;  1YX8 A;  2BCB A;  4PHK A;  2LNK A;  5JOL A;  1IQ5 A;  1Y6W A;  4CID A;  2BBN A;  3FS7 A;  3BOW B;  1TIZ A;  4GBA A;  2JT0 A;  5B8I B;  2KQY A;  1SR6 B;  1LIN A;  1EJ3 A;  5HKW A;  1AHR A;  5G08 A;  1SBJ A;  1TTX A;  2K61 A;  2HQW A;  3O2P A;  1KWO C;  3H4S E;  2Y1M A;  4JQ0 D;  5TNC A;  2LUX A;  1MWN A;  4M2O A;  1NX0 A;  2CNP A;  4YBH B;  3EVR A;  3K21 A;  2NLN A;  3O78 A;  3VGO A;  5BPJ A;  1OMD A;  2KFH A;  1CDM A;  2CCM A;  2JTT A;  1UWO A;  4OKH A;  4USL A;  1NSH A;  1B8C A;  2LMU A;  1NCX A;  5AFP A;  1XK4 C;  2H61 C;  4ORC B;  4YGA A;  3ZWH A;  2LMT A;  1MUX A;  1QAT A;  1DF0 A;  4HRG A;  1V1F A;  4L9M A;  1K8U A;  2BCA A;  1SW8 A;  1BR1 B;  3I5H B;  1SY9 A;  4ICB A;  1CTR A;  1K9U A;  1PSB A;  1SK6 D;  1K95 A;  2K7B A;  4GGN A;  3SG6 A;  1U5I B;  4HSZ A;  1YUR A;  1JUO A;  3SG3 A;  2OS8 B;  3KHE A;  4A4B A;  4Q04 A;  5CSF A;  4YGB B;  2F3Z A;  5GQQ C;  1NP8 A;  1F71 A;  3TDZ A;  1Q80 A;  1ZOT B;  2Q4U A;  2WC8 A;  1L7Z A;  1XFW O;  2GGZ A;  1QVI Y;  2KBM A;  2NCP A;  1OSA A;  1QJT A;  2RGI A;  2WOS A;  1JFJ A;  1BMO A;  1QVI Z;  1QV1 A;  1QV0 A;  2KGR A;  3I5G C;  2O60 A;  1AP4 A;  3IQQ A;  1A03 A;  1BOD A;  1F54 A;  1MXL C;  3CR2 A;  3TDI A;  2M7N A;  2HF5 A;  1A4P A;  3OB1 B;  1NX3 A;  2F33 A;  4OV2 A;  3BOW A;  3SG5 A;  1YUU A;  1PVA A;  2B1U A;  3GK2 A;  1KSM A;  1Y1A A;  2PSR A;  1KK7 Y;  3JTD C;  2ZNE A;  2CTN A;  4XYN A;  2M29 A;  4YRU A;  1KK7 Z;  1S36 A;  2KI6 C;  3GK1 A;  3TZ1 A;  2M8U A;  4DUQ A;  1CDP A;  1YVH A;  1G8I A;  4E68 A;  1CNP A;  5HYD A;  1CMF A;  1BJF A;  1S1E A;  3IQO A;  2QAC A;  1Y1X A;  4XJK B;  5D69 A;  4N5X A;  1NIW A;  5HLO A;  1LA3 A;  1JC2 A;  1XFY O;  2F8P A;  1MF8 B;  2FOT A;  3PAT A;  4ZCU A;  1K2H A;  1U5I A;  1CFP A;  1MXE A;  3VRN A;  3BUX B;  5CSI A;  1DJG A;  3I5G B;  4NQG A;  1F70 A;  1UHI A;  2WOR A;  3HCM A;  4YI8 A;  1NPQ A;  1FBV A;  2AUC A;  1UHN A;  2QPT A;  3SIA A;  2MLE C;  1DJY A;  3EKH A;  1TCO B;  1QIW A;  2JOJ A;  4MLW A;  4DS7 A;  1SL8 A;  1VRK A;  3HX4 A;  3TS5 C;  3PM8 A;  1C7W A;  1GGW A;  2AMI A;  1C7V A;  3JTD B;  1BU3 A;  1KFX S;  3IF7 A;  1UUR A;  2M1K B;  2L4H A;  2M49 B;  2JXC A;  3I5F C;  3CZT X;  1BT6 A;  1QTX A;  4N1G A;  5ER5 A;  1A2X A;  1RJV A;  2L5X B;  2M3W A;  1B1G A;  2EC6 C;  2BCX A;  1J7R A;  2JZI A;  2KAV A;  3PAL A;  1YTZ C;  4PE4 A;  1H8B A;  2LVK A;  4FTG A;  1XK4 A;  2M9G A;  1S6C A;  1J7Q A;  5I2L A;  2K8M B;  2L50 A;  1ZUZ A;  1OMR A;  3TUY B; 
#chains in the Genus database with same CATH topology
 1B8L A;  1V1G A;  5EL2 A;  1UP5 A;  1IRJ A;  2TN4 A;  4MSP A;  1DGU A;  1E8A A;  2LLT A;  4XJK A;  2JT8 A;  2HPS A;  3OHM B;  3MSE B;  2GGM A;  4JD9 A;  2BNX A;  1WLM A;  3LK0 A;  2FCD A;  4PE0 A;  4AQI A;  1F55 A;  1G4Y R;  1FI5 A;  5D7F A;  1QLS A;  5FI7 A;  1CKK A;  2K60 A;  1YRU B;  1S3P A;  4U8D A;  1KFU S;  2KDH A;  2KLD A;  1CLL A;  4NDC A;  4C0K A;  4CLN A;  4CPV A;  1M39 A;  1AJ5 A;  1EXR A;  1K90 D;  5AXI A;  3TS5 B;  2JU0 A;  2COL B;  1CM1 A;  4MRX A;  1S26 D;  1DJH A;  2CT9 A;  2L5Y A;  4GUK A;  1J1E A;  1JFK A;  1TNP A;  2KI4 B;  3B87 A;  1K96 A;  1BOC A;  4DRW A;  2ZRS A;  3LCP C;  1EG3 A;  1IGV A;  1QX2 A;  2SCP A;  1WDC B;  2BL0 C;  1MR8 A;  2L2E A;  2MLF C;  2SAS A;  2WCL A;  3DXL A;  3B6X A;  3I5F B;  3OB2 B;  5HKY A;  4YI9 A;  3EVU A;  1QX5 B;  2OPO A;  1CDN A;  1FF1 A;  1PAL A;  2EC6 B;  3O6B A;  3CR4 X;  5CSJ A;  3CZ2 A;  2L98 A;  1N65 A;  2KYC A;  3DY9 A;  4CFQ A;  1DMO A;  2NXQ A;  1PUL A;  4MZL A;  5HL1 A;  2P71 A;  3VRO A;  5I8N A;  2OTG C;  2QEO A;  4BY5 A;  1GGZ A;  2K2A A;  4MVF A;  2KHN A;  1GM0 A;  4PAL A;  1DGV A;  1Z4H A;  2WC5 A;  3R1V A;  3SS4 A;  1YVL A;  1SL7 A;  3FE6 A;  1WRZ A;  5CPV A;  4DIR A;  1OOI X;  3BFA A;  1CLM A;  1RFJ A;  1D1O A;  5IBW A;  4PHM A;  1DJW A;  4GGF C;  5DKQ A;  4DCK A;  1CB1 A;  2P70 A;  2O5G A;  1AK8 A;  2KBI A;  3M0W A;  2EGD A;  2WCF A;  2BE6 A;  1J55 A;  1M63 B;  3VRP A;  3AKA A;  2PMY A;  1OE9 B;  2EHB A;  4NDD A;  1IKU A;  2MAZ A;  4AOM A;  5I2Q A;  2FCE A;  1KWO B;  1YX7 A;  1XA5 A;  1CMG A;  1UHH A;  4OCI A;  3DF0 B;  3PLF B;  2MRD A;  3DZT A;  3PN7 C;  3QRX A;  5HLV A;  1N2D A;  1M45 A;  5FI2 A;  1ALW A;  2KNE A;  1QS7 A;  2NZ0 A;  2P6B B;  2F2P A;  5DKR A;  4FQO A;  1OOJ A;  2JTZ A;  5I2O A;  2BKH B;  5DKN A;  1MHO A;  2KSP A;  2PAS A;  3CR5 X;  1GJY A;  3GOF A;  3L4A A;  4MN0 A;  2LHI A;  2M97 A;  2A4J A;  3KPX A;  1TCF A;  3D76 A;  3S0E A;  1UHJ A;  1WLZ A;  4N1F A;  2KFF A;  3OX5 A;  4UPG A;  1MQ1 A;  1DJI A;  1PSR A;  3RM1 A;  3NSI A;  2K7O A;  3OX6 A;  1M46 A;  2L51 A;  2ZKM X;  4M2Q A;  4MZJ A;  1SCM C;  2M0R A;  4OZD A;  1DEL A;  1FPW A;  5AEQ A;  3SS5 A;  1BR4 B;  3BUW B;  3IVT A;  1B9A A;  3WXA A;  2Y4Q A;  1SNL A;  2AAO A;  2LAN A;  3DVE A;  3JVT C;  3QME A;  1LXF C;  1LA0 A;  3KF9 A;  2MJW B;  4I5N B;  1QLK A;  2GV5 A;  2WCH A;  4MZK A;  2KLE A;  3TDU A;  3WHT B;  4MBE A;  1EL4 A;  2JPO A;  3KO0 A;  1KCY A;  3DD4 A;  3EG5 B;  1BF5 A;  1KQM C;  1TNW A;  5ER4 X;  5DIC A;  3B88 A;  5AER A;  3A4U B;  1S6I A;  1RRO A;  2LC5 A;  1IJ5 A;  3PN7 B;  1SYM A;  1A29 A;  3AKB A;  2JNF A;  1IH0 A;  2LMV A;  1NCY A;  1NYA A;  1IIO A;  1UHK A;  3B86 A;  4C0L A;  2LP2 A;  3DVM A;  3DF0 A;  1OZO A;  5KTY A;  2Y5I A;  4FQT A;  2V53 A;  2DOQ A;  2HET A;  1R2U A;  1TRF A;  2KAX A;  2KAY A;  5K89 A;  2L4I A;  2ZN9 A;  2HQ8 A;  3RLZ A;  1YRT B;  1YUT A;  1EG4 A;  1XFU O;  2Y1N A;  2ZFD A;  3SG4 A;  1BLQ A;  3FWC A;  3BXK A;  4PE7 A;  2H61 A;  2LV7 A;  3NSK A;  1IG5 A;  1SR6 C;  1XYD A;  4P5O E;  3BFB A;  2LCP A;  1B47 A;  2LP3 A;  3S0A A;  1DQE A;  1JSA A;  3D77 A;  4QJ4 B;  2JUL A;  2ZN8 A;  4I5K A;  2QEH A;  2LVJ A;  2F2O A;  1H4B A;  2I94 A;  1OW4 A;  3JVT B;  1AUI B;  1AJ4 A;  4GFT A;  2WCE A;  1DF0 B;  4YGC B;  4PHN A;  1NCZ A;  3ZNI A;  1Y0V H;  2JXL A;  1BG1 A;  2M7L A;  1JF0 A;  1KQM B;  2WCB A;  4BY4 A;  2M1U A;  1JBA A;  4I5L B;  1XFV O;  4PCW A;  4OVN F;  4JPZ B;  5CSN A;  3VRR A;  2K7D A;  3DYE A;  4IL1 A;  3I5H C;  2R2I A;  2L0P A;  2LAP A;  1PVB A;  4GNK B;  3NXA A;  2BBM A;  1CM4 A;  3BUM B;  2QDI A;  2FJY A;  2KYF A;  4JWQ A;  2OS8 C;  1ZMZ A;  2LUC A;  3FWB A;  4C0J A;  4ETO A;  1Y1U A;  2K7C A;  1F4O A;  1OZS A;  4HRH A;  1YR5 A;  1SPY A;  2BKI B;  1SL9 A;  2LE9 B;  3CS1 A;  3D10 A;  2GTE A;  3NSO A;  3WHU B;  1Z2C B;  1CFD A;  2CBL A;  1QIV A;  1QXP A;  2E30 A;  3CDN A;  5KSZ A;  1SMG A;  1RWY A;  3AAK A;  3L47 A;  1PRW A;  3D0Y B;  3BUO B;  3D78 A;  1J1D A;  1ODB A;  4IJ7 A;  3SIB A;  4P2Y B;  1M31 A;  3D74 A;  3I5I C;  1RK9 A;  2JT3 A;  2Q91 A;  2E6W A;  2PYQ A;  4ZCV A;  4GPL B;  1PK0 D;  1ALV A;  3BQ3 A;  3CWG A;  1K9P A;  3PSR A;  3CZ1 A;  1EH2 A;  1IWQ A;  3SG7 A;  2VRG A;  1WRL A;  1L2O C;  3EK8 A;  5FYX A;  4QJ5 B;  5I94 A;  3F45 A;  1IJ6 A;  1CFF A;  1ZAC A;  5PAL A;  5D3O A;  2LM5 A;  2KI6 D;  1LVC D;  3S0B A;  3UNW A;  3S0F A;  3S0D A;  4TNC A;  1A75 B;  1R6P A;  1RTP 1;  2BL0 B;  2LLS A;  3LK1 A;  1IQ3 A;  2ZRT A;  4D1E A;  2FJU B;  2JQ6 A;  2K0J A;  2H2K A;  2LVV A;  5F6T A;  1OQP A;  1UUS A;  2LVI A;  2MBX A;  1QX7 A;  4YGD B;  3ICB A;  2KOT A;  2JRF A;  2WND A;  1KK8 C;  3O4Y A;  3EK7 A;  2BEC A;  1JF2 A;  2IS9 A;  2LLU A;  3NHT A;  3LLE A;  2JPT A;  1WRK A;  2PVB A;  4CFR A;  1W9Z A;  2K2F A;  2OTG B;  4ORA B;  1YUS A;  2KGB C;  1QWV A;  1DVI A;  3WNX B;  1N0Y A;  2NCO A;  1TWO A;  3DVK A;  3I5I B;  1W7I B;  2MHH A;  3L4L A;  5KU1 A;  1J7O A;  1XFX O;  3D0Y A;  2ISD A;  3LL8 B;  2F3Y A;  3KEV A;  2PAL A;  1KSO A;  4GAO A;  2MA2 A;  1LS8 A;  5HKZ A;  4WQ3 A;  1DTL A;  4PHJ A;  4WQ2 A;  1KQV A;  1S6J A;  3BFH A;  1L2O B;  4NDB A;  3E3R A;  1NX2 A;  1CDL A;  1FW4 A;  1CFC A;  2CXJ A;  1AVS A;  2KQ6 A;  3BYA A;  1TN4 A;  1KFX L;  1SRA A;  1QAS A;  4I5J A;  1S5G Y;  3CGA A;  1S5G Z;  1HT9 A;  1GQM A;  1B7T Y;  1X02 A;  3CYZ A;  3R1P A;  4AQJ A;  1XVJ A;  1B4C A;  3TUY C;  3OP0 A;  3EKJ A;  1B7T Z;  4PDZ A;  1WY9 A;  1TNQ A;  1ZFS A;  1DT7 B;  2G9B A;  3GK4 X;  2I2R E;  2JNX A;  2L2C A;  4INW A;  2KFG A;  1A75 A;  1KK8 B;  1T14 A;  2I18 A;  1TUZ A;  5JJG A;  2JC2 A;  3BJH A;  3CTN A;  4F0Z B;  1NWD A;  3SJS A;  3OGN A;  4A4C A;  4INX A;  3DVJ A;  5AAN A;  1SKT A;  3R1O A;  1CLB A;  3C1V A;  3FE9 A;  4HRE E;  4MRY A;  1K94 A;  1SCM B;  2D8N A;  4WRI A;  1F8H A;  1J7P A;  4MEW A;  1B8R A;  4QJ3 B;  2KI4 C;  1DJX A;  1DJZ A;  3FIA A;  4PE1 A;  1KFU L;  2BE4 A;  3VB1 A;  1OMV A;  4ORB B;  1NUB A;  2PRU A;  4OR9 B;  1WDC C;  3SG2 A;  1TOP A;  1TNX A;  1K9K A;  5J3X A;  3PJI A;  3BUN B;  1C3Y A;  4YGE B;  1XO5 A;  1HQV A;  2KPH A;  1XFZ O;  3CLN A;  3A8R A;  4GGF A;  1JWD A;  1DEK A;  4M2P A;  3NSL A;  1C07 A;  4R1E A;  4KYN A;  3EK4 A;  1LKJ A;  1NX1 A;  3EVV A;  2G2B A;  3AAJ A;  2ZND A;  2JWW A;  2LHL A;  2I7A A;  4PT1 A;  3PFV A;  1REC A;  1G33 A;  1W7J B;  1FI6 A;  1K93 D;  1SCV A;  3VRQ A;  1F4Q A;  1YX8 A;  2BCB A;  4PHK A;  2LNK A;  5JOL A;  2WC6 A;  1IQ5 A;  1Y6W A;  4CID A;  2BBN A;  3B7A A;  3BOW B;  1TIZ A;  3FE8 A;  2JT0 A;  3FS7 A;  2KQY A;  1SR6 B;  4GBA A;  1LIN A;  5B8I B;  1EJ3 A;  5HKW A;  1AHR A;  5G08 A;  1SBJ A;  1TTX A;  2K61 A;  2HQW A;  1OOF A;  3O2P A;  1SSE B;  1KWO C;  3H4S E;  2Y1M A;  4JQ0 D;  5TNC A;  2LUX A;  1MWN A;  3PM2 A;  1NX0 A;  4M2O A;  2CNP A;  4YBH B;  3EVR A;  3K21 A;  2NLN A;  3O78 A;  3VGO A;  5BPJ A;  1OMD A;  2KFH A;  1CDM A;  2CCM A;  2JTT A;  3NHI A;  4F7F A;  1UWO A;  3CAB A;  4OKH A;  2WCK A;  1NSH A;  4USL A;  1B8C A;  2LMU A;  1NCX A;  5AFP A;  1XK4 C;  2H61 C;  1XFR A;  3R72 A;  4ORC B;  4YGA A;  2LMT A;  3ZWH A;  1MUX A;  1QAT A;  1DF0 A;  4HRG A;  1V1F A;  4L9M A;  1K8U A;  2BCA A;  1SW8 A;  1BR1 B;  3I5H B;  1SY9 A;  4ICB A;  1CTR A;  1K9U A;  1PSB A;  1SK6 D;  1K95 A;  2K7B A;  4GGN A;  3SG6 A;  1U5I B;  4HSZ A;  1YUR A;  3SS3 A;  1OOH A;  1JUO A;  3SG3 A;  2OS8 B;  3KHE A;  1ORG A;  4A4B A;  4JKT A;  4Q04 A;  5CSF A;  4YGB B;  2F3Z A;  5GQQ C;  1NP8 A;  1F71 A;  3TDZ A;  1Q80 A;  1ZOT B;  2Q4U A;  2WC8 A;  1L7Z A;  1XFW O;  2GGZ A;  1QVI Y;  2KBM A;  2NCP A;  1OSA A;  1QJT A;  2QEB A;  2RGI A;  2WOS A;  1JFJ A;  1BMO A;  1QVI Z;  1QV1 A;  1QV0 A;  2KGR A;  3N7H A;  3I5G C;  2O60 A;  1AP4 A;  3IQQ A;  1A03 A;  1BOD A;  1F54 A;  1MXL C;  3CR2 A;  1P28 A;  3UO9 A;  3TDI A;  2M7N A;  2HF5 A;  1A4P A;  3OB1 B;  3K1E A;  1NX3 A;  2F33 A;  4OV2 A;  3D73 A;  3BOW A;  3Q8I A;  3SG5 A;  1YUU A;  1PVA A;  2B1U A;  3GK2 A;  1KSM A;  1Y1A A;  2PSR A;  1KK7 Y;  3JTD C;  2ZNE A;  2CTN A;  4XYN A;  2M29 A;  4YRU A;  1KK7 Z;  1S36 A;  2KI6 C;  3GK1 A;  3TZ1 A;  2M8U A;  4DUQ A;  1CDP A;  1YVH A;  1G8I A;  4E68 A;  1CNP A;  5HYD A;  1TUJ A;  3OBV A;  1CMF A;  1BJF A;  1S1E A;  3IQO A;  2QAC A;  1Y1X A;  4XJK B;  5D69 A;  4N5X A;  1NIW A;  5HLO A;  1LA3 A;  1JC2 A;  1XFY O;  2ERB A;  2F8P A;  1MF8 B;  2FOT A;  3PAT A;  4ZCU A;  1DC1 A;  5FI6 A;  2WCJ A;  1K2H A;  3V2L A;  1U5I A;  1CFP A;  1MXE A;  3VRN A;  3BUX B;  3D75 A;  5CSI A;  1DJG A;  3I5G B;  4NQG A;  3S0G A;  1F70 A;  1UHI A;  2WCM A;  2WOR A;  3CZ0 A;  3HCM A;  1NPQ A;  2YGU A;  1FBV A;  2AUC A;  4YI8 A;  1UHN A;  2PQL A;  2QPT A;  3SIA A;  2MLE C;  1DJY A;  1C3Z A;  3EKH A;  1TCO B;  1QIW A;  2JOJ A;  4MLW A;  4DS7 A;  1SL8 A;  1VRK A;  2H8V A;  3HX4 A;  3TS5 C;  2BAP A;  3PM8 A;  1C7W A;  1GGW A;  2AMI A;  1C7V A;  3JTD B;  1BU3 A;  1KFX S;  3IF7 A;  1UUR A;  2M1K B;  2L4H A;  2M49 B;  2JXC A;  3I5F C;  3CZT X;  1BT6 A;  1QTX A;  4N1G A;  5ER5 A;  1A2X A;  1RJV A;  2L5X B;  2M3W A;  1B1G A;  2QEV A;  2EC6 C;  2BCX A;  1J7R A;  2JZI A;  2KAV A;  3NGV A;  3PAL A;  1YTZ C;  4PE4 A;  1H8B A;  2LVK A;  4FTG A;  1XK4 A;  2M9G A;  1S6C A;  1J7Q A;  5I2L A;  3RZS A;  1OOG A;  2K8M B;  2L50 A;  3O4X A;  1ZUZ A;  1OMR A;  3TUY B; 
#chains in the Genus database with same CATH homology
 1B8L A;  1V1G A;  3VRQ A;  1UP5 A;  1IRJ A;  2TN4 A;  4MSP A;  1DGU A;  1E8A A;  2LLT A;  4XJK A;  2JT8 A;  2HPS A;  3OHM B;  3MSE B;  2GGM A;  4PE0 A;  3LK0 A;  1WLM A;  4AQI A;  2FCD A;  1BG1 A;  1F55 A;  1G4Y R;  1FI5 A;  5D7F A;  1QLS A;  1CKK A;  1YRU B;  1S3P A;  4U8D A;  1KFU S;  2KDH A;  4NDC A;  1CLL A;  4C0K A;  4CLN A;  4CPV A;  1M39 A;  1AJ5 A;  1EXR A;  1K90 D;  5AXI A;  3TS5 B;  2JU0 A;  2COL B;  1CM1 A;  4MRX A;  1S26 D;  1DJH A;  2CT9 A;  4GUK A;  1J1E A;  1JFK A;  1TNP A;  2KI4 B;  1K96 A;  1BOC A;  4DRW A;  2ZRS A;  3LCP C;  1EG3 A;  1IGV A;  1QX2 A;  2SCP A;  1WDC B;  2BL0 C;  1MR8 A;  2L2E A;  2MLF C;  2SAS A;  3OB2 B;  3I5F B;  5HKY A;  4YI9 A;  3EVU A;  1QX5 B;  2OPO A;  1CDN A;  1FF1 A;  1PAL A;  2EC6 B;  3O6B A;  3CR4 X;  5CSJ A;  2L98 A;  1N65 A;  2KYC A;  1DMO A;  4CFQ A;  2NXQ A;  1PUL A;  4MZL A;  3VRO A;  5I8N A;  2OTG C;  4BY5 A;  1GGZ A;  2K2A A;  4MVF A;  2KHN A;  4PAL A;  1DGV A;  1YVL A;  1SL7 A;  5CPV A;  1WRZ A;  4DIR A;  1CLM A;  1RFJ A;  1D1O A;  5IBW A;  4PHM A;  1DJW A;  4GGF C;  5DKQ A;  4DCK A;  1CB1 A;  2O5G A;  1AK8 A;  2KBI A;  3M0W A;  2EGD A;  2WCF A;  2BE6 A;  1J55 A;  1M63 B;  3VRP A;  3AKA A;  2PMY A;  1OE9 B;  2EHB A;  4NDD A;  1IKU A;  2MAZ A;  4AOM A;  5I2Q A;  2FCE A;  1KWO B;  1YX7 A;  1XA5 A;  1CMG A;  1UHH A;  4OCI A;  3DF0 B;  3PLF B;  2MRD A;  3PN7 C;  3QRX A;  5HLV A;  1N2D A;  1M45 A;  1ALW A;  2KNE A;  1QS7 A;  2NZ0 A;  2P6B B;  2F2P A;  5DKR A;  4FQO A;  1OOJ A;  2JTZ A;  5I2O A;  2BKH B;  5DKN A;  1MHO A;  2KSP A;  2PAS A;  3CR5 X;  1GJY A;  3GOF A;  4MN0 A;  2LHI A;  2M97 A;  2A4J A;  3KPX A;  1TCF A;  1UHJ A;  1WLZ A;  4N1F A;  2KFF A;  3OX5 A;  4UPG A;  1MQ1 A;  1DJI A;  1PSR A;  3RM1 A;  3NSI A;  2K7O A;  3OX6 A;  1M46 A;  2L51 A;  2ZKM X;  4M2Q A;  4MZJ A;  1SCM C;  2M0R A;  1FPW A;  5AEQ A;  1BR4 B;  3BUW B;  1B9A A;  3WXA A;  2Y4Q A;  1SNL A;  2AAO A;  2LAN A;  3DVE A;  3JVT C;  1LXF C;  1LA0 A;  3KF9 A;  2MJW B;  4I5N B;  1QLK A;  2GV5 A;  4MZK A;  3TDU A;  3WHT B;  4MBE A;  1EL4 A;  3KO0 A;  1KCY A;  3DD4 A;  1BF5 A;  1KQM C;  1TNW A;  5ER4 X;  5AER A;  3A4U B;  1S6I A;  1RRO A;  2LC5 A;  1IJ5 A;  3PN7 B;  1SYM A;  1A29 A;  3AKB A;  2JNF A;  1IH0 A;  2LMV A;  1NCY A;  1NYA A;  1UHK A;  4C0L A;  2LP2 A;  3DVM A;  3DF0 A;  1OZO A;  5KTY A;  2Y5I A;  2V53 A;  2DOQ A;  2HET A;  1R2U A;  1TRF A;  2KAX A;  2KAY A;  5K89 A;  2L4I A;  2ZN9 A;  2HQ8 A;  3RLZ A;  1YRT B;  1YUT A;  1EG4 A;  1XFU O;  2Y1N A;  2ZFD A;  3SG4 A;  1BLQ A;  3FWC A;  3BXK A;  4PE7 A;  2H61 A;  2LV7 A;  3NSK A;  1IG5 A;  1SR6 C;  1XYD A;  4P5O E;  2LCP A;  1B47 A;  2LP3 A;  1JSA A;  4QJ4 B;  2JUL A;  2ZN8 A;  4I5K A;  2LVJ A;  2F2O A;  1H4B A;  2I94 A;  3JVT B;  4GFT A;  1AUI B;  1AJ4 A;  2WCE A;  1DF0 B;  4YGC B;  4PHN A;  1NCZ A;  3ZNI A;  1Y0V H;  2JXL A;  2M7L A;  1JF0 A;  1KQM B;  2WCB A;  4BY4 A;  2M1U A;  1JBA A;  4I5L B;  1XFV O;  4PCW A;  4OVN F;  4JPZ B;  5CSN A;  3VRR A;  2K7D A;  4IL1 A;  3I5H C;  2R2I A;  2L0P A;  2LAP A;  1PVB A;  4GNK B;  3NXA A;  2BBM A;  1CM4 A;  3BUM B;  2KYF A;  4JWQ A;  2OS8 C;  1ZMZ A;  2LUC A;  3FWB A;  4C0J A;  4ETO A;  1Y1U A;  2K7C A;  1F4O A;  1OZS A;  4HRH A;  1YR5 A;  1SPY A;  2BKI B;  1SL9 A;  2LE9 B;  3CS1 A;  3D10 A;  3NSO A;  3WHU B;  2CBL A;  1CFD A;  1QIV A;  1QXP A;  2E30 A;  5KSZ A;  1SMG A;  1RWY A;  3AAK A;  1PRW A;  3D0Y B;  3BUO B;  1J1D A;  1ODB A;  3SIB A;  4P2Y B;  1M31 A;  3I5I C;  1RK9 A;  2JT3 A;  2Q91 A;  2E6W A;  4ZCV A;  4GPL B;  1PK0 D;  1ALV A;  3BQ3 A;  3CWG A;  1K9P A;  3PSR A;  1EH2 A;  1IWQ A;  3SG7 A;  2VRG A;  1WRL A;  1L2O C;  3EK8 A;  5FYX A;  4QJ5 B;  3F45 A;  1IJ6 A;  1CFF A;  1ZAC A;  5PAL A;  2LM5 A;  2KI6 D;  1LVC D;  4TNC A;  1A75 B;  1R6P A;  1RTP 1;  2BL0 B;  2LLS A;  3LK1 A;  1IQ3 A;  2ZRT A;  4D1E A;  2FJU B;  2JQ6 A;  2K0J A;  2H2K A;  2LVV A;  5F6T A;  1OQP A;  1UUS A;  2LVI A;  2MBX A;  1QX7 A;  4YGD B;  3ICB A;  2KOT A;  2JRF A;  2WND A;  1KK8 C;  3O4Y A;  3EK7 A;  2BEC A;  1JF2 A;  2IS9 A;  2LLU A;  3LLE A;  2JPT A;  1WRK A;  2PVB A;  4CFR A;  2K2F A;  2OTG B;  4ORA B;  1YUS A;  2KGB C;  1DVI A;  3WNX B;  1N0Y A;  2NCO A;  3DVK A;  3I5I B;  1W7I B;  2MHH A;  5KU1 A;  1J7O A;  1XFX O;  3D0Y A;  2ISD A;  3LL8 B;  2F3Y A;  3KEV A;  2PAL A;  1KSO A;  4GAO A;  2MA2 A;  5HKZ A;  4WQ3 A;  1DTL A;  4PHJ A;  4WQ2 A;  1KQV A;  1S6J A;  1L2O B;  4NDB A;  3E3R A;  1NX2 A;  1CDL A;  1FW4 A;  1CFC A;  2CXJ A;  1AVS A;  2KQ6 A;  3BYA A;  1TN4 A;  1KFX L;  1SRA A;  1QAS A;  4I5J A;  1S5G Y;  3CGA A;  1S5G Z;  1HT9 A;  1GQM A;  1B7T Y;  1X02 A;  1B4C A;  4AQJ A;  1XVJ A;  3TUY C;  3OP0 A;  3EKJ A;  1B7T Z;  4PDZ A;  1WY9 A;  1TNQ A;  1ZFS A;  1DT7 B;  2G9B A;  3GK4 X;  2I2R E;  2JNX A;  2KFG A;  1A75 A;  1KK8 B;  2I18 A;  5JJG A;  2JC2 A;  3CTN A;  4F0Z B;  1NWD A;  3SJS A;  4A4C A;  3DVJ A;  5AAN A;  1SKT A;  1CLB A;  3C1V A;  4HRE E;  4MRY A;  1K94 A;  1SCM B;  2D8N A;  4WRI A;  1F8H A;  1J7P A;  4MEW A;  1B8R A;  4QJ3 B;  2KI4 C;  1DJX A;  1DJZ A;  3FIA A;  4PE1 A;  1KFU L;  2BE4 A;  1OMV A;  4ORB B;  1NUB A;  2PRU A;  4OR9 B;  1WDC C;  3SG2 A;  1TOP A;  1TNX A;  1K9K A;  5J3X A;  3BUN B;  4YGE B;  1XO5 A;  1HQV A;  4GGF A;  1XFZ O;  3CLN A;  3A8R A;  1JWD A;  4M2P A;  3NSL A;  1C07 A;  4R1E A;  3EK4 A;  1LKJ A;  1NX1 A;  3EVV A;  2G2B A;  3AAJ A;  2ZND A;  2JWW A;  2LHL A;  2I7A A;  3PFV A;  1REC A;  1G33 A;  1W7J B;  1FI6 A;  1K93 D;  1SCV A;  1F4Q A;  1YX8 A;  2BCB A;  4PHK A;  2LNK A;  5JOL A;  1IQ5 A;  1Y6W A;  4CID A;  2BBN A;  3FS7 A;  3BOW B;  1TIZ A;  4GBA A;  2JT0 A;  5B8I B;  2KQY A;  1SR6 B;  1LIN A;  1EJ3 A;  5HKW A;  1AHR A;  5G08 A;  1SBJ A;  1TTX A;  2K61 A;  2HQW A;  3O2P A;  1KWO C;  3H4S E;  2Y1M A;  4JQ0 D;  5TNC A;  2LUX A;  1MWN A;  4M2O A;  1NX0 A;  2CNP A;  4YBH B;  3EVR A;  3K21 A;  2NLN A;  3O78 A;  3VGO A;  5BPJ A;  1OMD A;  2KFH A;  1CDM A;  2CCM A;  2JTT A;  1UWO A;  4OKH A;  4USL A;  1NSH A;  1B8C A;  2LMU A;  1NCX A;  5AFP A;  1XK4 C;  2H61 C;  4ORC B;  4YGA A;  3ZWH A;  2LMT A;  1MUX A;  1QAT A;  1DF0 A;  4HRG A;  1V1F A;  4L9M A;  1K8U A;  2BCA A;  1SW8 A;  1BR1 B;  3I5H B;  1SY9 A;  4ICB A;  1CTR A;  1K9U A;  1PSB A;  1SK6 D;  1K95 A;  2K7B A;  4GGN A;  3SG6 A;  1U5I B;  4HSZ A;  1YUR A;  1JUO A;  3SG3 A;  2OS8 B;  3KHE A;  4A4B A;  4Q04 A;  5CSF A;  4YGB B;  2F3Z A;  5GQQ C;  1NP8 A;  1F71 A;  3TDZ A;  1Q80 A;  1ZOT B;  2Q4U A;  2WC8 A;  1L7Z A;  1XFW O;  2GGZ A;  1QVI Y;  2KBM A;  2NCP A;  1OSA A;  1QJT A;  2RGI A;  2WOS A;  1JFJ A;  1BMO A;  1QVI Z;  1QV1 A;  1QV0 A;  2KGR A;  3I5G C;  2O60 A;  1AP4 A;  3IQQ A;  1A03 A;  1BOD A;  1F54 A;  1MXL C;  3CR2 A;  3TDI A;  2M7N A;  2HF5 A;  1A4P A;  3OB1 B;  1NX3 A;  2F33 A;  4OV2 A;  3BOW A;  3SG5 A;  1YUU A;  1PVA A;  2B1U A;  3GK2 A;  1KSM A;  1Y1A A;  2PSR A;  1KK7 Y;  3JTD C;  2ZNE A;  2CTN A;  4XYN A;  2M29 A;  4YRU A;  1KK7 Z;  1S36 A;  2KI6 C;  3GK1 A;  3TZ1 A;  2M8U A;  4DUQ A;  1CDP A;  1YVH A;  1G8I A;  4E68 A;  1CNP A;  5HYD A;  1CMF A;  1BJF A;  1S1E A;  3IQO A;  2QAC A;  1Y1X A;  4XJK B;  5D69 A;  4N5X A;  1NIW A;  5HLO A;  1LA3 A;  1JC2 A;  1XFY O;  2F8P A;  1MF8 B;  2FOT A;  3PAT A;  4ZCU A;  1K2H A;  1U5I A;  1CFP A;  1MXE A;  3VRN A;  3BUX B;  5CSI A;  1DJG A;  3I5G B;  4NQG A;  1F70 A;  1UHI A;  2WOR A;  3HCM A;  4YI8 A;  1NPQ A;  1FBV A;  2AUC A;  1UHN A;  2QPT A;  3SIA A;  2MLE C;  1DJY A;  3EKH A;  1TCO B;  1QIW A;  2JOJ A;  4MLW A;  4DS7 A;  1SL8 A;  1VRK A;  3HX4 A;  3TS5 C;  3PM8 A;  1C7W A;  1GGW A;  2AMI A;  1C7V A;  3JTD B;  1BU3 A;  1KFX S;  3IF7 A;  1UUR A;  2M1K B;  2L4H A;  2M49 B;  2JXC A;  3I5F C;  3CZT X;  1BT6 A;  1QTX A;  4N1G A;  5ER5 A;  1A2X A;  1RJV A;  2L5X B;  2M3W A;  1B1G A;  2EC6 C;  2BCX A;  1J7R A;  2JZI A;  2KAV A;  3PAL A;  1YTZ C;  4PE4 A;  1H8B A;  2LVK A;  4FTG A;  1XK4 A;  2M9G A;  1S6C A;  1J7Q A;  5I2L A;  2K8M B;  2L50 A;  1ZUZ A;  1OMR A;  3TUY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...