4PHJA

The structural basis of differential inhibition of human calpain by indole and phenyl alpha-mercaptoacrylic acids: human unliganded protein
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
173
structure length
173
Chain Sequence
EEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calpain small subunit 1
publication title The structural basis of differential inhibition of human calpain by indole and phenyl alpha-mercaptoacrylic acids.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 66
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4phjA00
5DKRA 3SG5A 3DVKA 2KSPA 2QACA 2IS9A 1MWNA 5TNCA 3LCPC 3O6BA 2FCEA 1E8AA 3PN7C 3D10A 1B8RA 2CBLA 1TNWA 2JPTA 4PE1A 4XJKA 4MRXA 1YVHA 2O5GA 2CT9A 4CIDA 2LLTA 1JBAA 2GGZA 1DJHA 2I2RE 1RROA 1OZSA 1YR5A 2KAVA 2M1UA 3CR5X 1IQ3A 1MXLC 3EK4A 1HQVA 3AAJA 2L4HA 2LUCA 1ALWA 1KK7Y 2SASA 1XFUO 1RTP1 1M63B 3TUYC 1QVIY 4NDCA 2AUCA 2PSRA 5J3XA 1J55A 1DJWA 2JQ6A 3OB2B 1WRZA 2I94A 2LM5A 1M31A 1SW8A 1QIVA 1IQ5A 1WRLA 3HX4A 4PDZA 3VRRA 1SNLA 4GGFC 3I5HC 3PFVA 4DS7A 3DD4A 1XFYO 4YI9A 3F45A 2WC8A 2KI6D 3CWGA 2F3YA 2JRFA 2OTGC 1SL8A 1DGVA 2V53A 4YRUA 1GGZA 2JXCA 5D7FA 1K9UA 2LHLA 2LAPA 2H61C 2OS8B 1MUXA 2WCBA 2Y4QA 1KCYA 3KPXA 3FS7A 3TDIA 2SCPA 1YVLA 3BUXB 4DCKA 2LNKA 1J7QA 1FW4A 2K61A 2LP2A 2GV5A 1BF5A 1K2HA 1DJZA 1WRKA 4I5KA 1PALA 1A75A 1S5GZ 2LMUA 1SCMB 2NCPA 5K89A 1Y1AA 2K2FA 2LCPA 2HF5A 3BXKA 4GGNA 4CFRA 2BCXA 3K21A 3WHUB 4PHJA 4ZCUA 1DMOA 4NQGA 2LANA 4A4BA 1XK4C 1F4OA 2Y1NA 5AANA 1IRJA 5AEQA 1NSHA 2L5XB 4C0KA 1A29A 1OMVA 1V1FA 3SJSA 1ZUZA 1J1EA 1NP8A 4YGAA 4OKHA 2G2BA 2LLSA 1DTLA 1NIWA 1XFWO 2NCOA 2F2OA 1A4PA 2ZNEA 1J7RA 2ZN9A 2KQYA 1PVAA 1SR6B 1TCOB 4E68A 1JFJA 2BKHB 1KQMC 1Y1XA 2F8PA 1UP5A 2LMVA 3IF7A 3VROA 1S3PA 2Q4UA 1KQVA 3NSIA 3SG2A 1AVSA 2BCBA 4DRWA 1DT7B 5FYXA 2WNDA 3LK0A 1QS7A 3NXAA 4NDBA 1DF0A 2KHNA 1B1GA 1TOPA 4MSPA 2I7AA 1JFKA 4DUQA 2H61A 2KAYA 3MSEB 2MJWB 1M39A 1CDMA 2PASA 1IWQA 3SG3A 1UHHA 2JU0A 3CR2A 4BY4A 2JNXA 4AQIA 1K95A 3OX5A 5I2QA 1K96A 2LVKA 1EXRA 1UHNA 4UPGA 2BBMA 2LE9B 1JSAA 2M1KB 2KI4B 2JTZA 1PVBA 1FBVA 1XK4A 1AP4A 2FJUB 4YGBB 1KWOB 1DVIA 3D0YB 1BR1B 1QX5B 3O78A 4JQ0D 4ORAB 2LC5A 4ORBB 3TDUA 1RK9A 3SG6A 1SCMC 1FI6A 1CLMA 1SKTA 4JWQA 4MVFA 5I2LA 4YGEB 1A2XA 1MHOA 3JTDC 4PCWA 4MEWA 5CPVA 5CSJA 1XYDA 2ZKMX 1TIZA 3JVTC 4D1EA 5HLVA 3KHEA 2EHBA 5B8IB 1W7IB 2PVBA 1S6JA 2QPTA 1QLSA 1K94A 1LXFC 2LUXA 2ZRSA 2AAOA 5JJGA 3AAKA 1PULA 2WCEA 1TNPA 2M7NA 4GPLB 1TNXA 1YUUA 2JT3A 1BG1A 1XFZO 5AERA 3I5IB 1WLZA 1K9KA 3CR4X 1SPYA 2LVIA 1RECA 3DVJA 2HETA 1UHKA 2NXQA 1S6IA 1YX7A 2LV7A 2OPOA 1S5GY 2L50A 3I5FB 1CFFA 1M46A 3M0WA 1IH0A 2KBMA 1BLQA 1XVJA 5AFPA 2M8UA 1H4BA 3TS5B 1K93D 2E6WA 1QV1A 1CDPA 1OMDA 4C0JA 2O60A 5HLOA 1F71A 1S6CA 1VRKA 1N0YA 2M29A 3VRNA 1CB1A 3ZWHA 1CDLA 3EKJA 1HT9A 1QJTA 2I18A 1QLKA 2COLB 2JZIA 2BL0B 2KOTA 3BOWB 2MLFC 1KK8B 2MLEC 1M45A 1B8CA 1NUBA 4MRYA 4Q04A 4HRGA 2K7DA 1IKUA 1S1EA 3BUNB 1L2OB 3DF0B 2A4JA 1LA0A 2LVVA 3O2PA 3OB1B 3KF9A 1SCVA 1C7VA 2BE4A 1XFVO 2GGMA 1U5IB 2FCDA 1PSBA 3LLEA 2EC6B 1UUSA 2FOTA 3EVUA 1CFDA 3CS1A 1EG3A 2PALA 4BY5A 1PRWA 2CCMA 2KDHA 2ZNDA 3CGAA 1KK7Z 2AMIA 3CZTX 2JTTA 3CTNA 1Y6WA 1DGUA 1QVIZ 5KU1A 1LINA 2L4IA 2BKIB 1F4QA 1ODBA 1ZFSA 2F33A 2G9BA 1JC2A 1K90D 1QX7A 3I5GB 3PM8A 2HQWA 4PE4A 4OV2A 1FPWA 1F54A 2H2KA 4QJ4B 1QX2A 3EK8A 2MHHA 4GUKA 5HKYA 1B7TY 4AOMA 2M49B 1YUTA 3EKHA 3KO0A 3IQQA 3PN7B 4QJ3B 4YI8A 1NCYA 4I5JA 3VGOA 4CPVA 3PSRA 1YURA 4FTGA 3LK1A 2PRUA 4MLWA 1KSMA 3BUWB 1SL7A 3RLZA 1NCXA 3DVEA 1BOCA 2LVJA 3D0YA 1TTXA 1AJ5A 3SG7A 1MQ1A 2LP3A 1A03A 1QASA 4PHMA 5PALA 1OE9B 4GBAA 4M2OA 1WY9A 1OOJA 1B4CA 3SIAA 4ETOA 1SRAA 1QATA 4N1FA 2NLNA 2ISDA 2MAZA 1YX8A 3CLNA 5KSZA 5CSNA 2OS8C 1CNPA 5CSIA 1NX1A 1KK8C 1K9PA 3OHMB 1EL4A 1JWDA 1RJVA 4TNCA 4ORCB 3ZNIA 2LLUA 1BJFA 2JT8A 2RGIA 2KI6C 2ZRTA 1SBJA 2JWWA 3I5HB 4YGCB 2JC2A 3SG4A 4N5XA 1NPQA 1XA5A 1Q80A 1NCZA 3OX6A 2OTGB 2LHIA 3SIBA 4FQOA 2WCFA 5I8NA 1SY9A 3GK1A 2K0JA 1DJXA 1R6PA 3KEVA 3QRXA 1AK8A 1V1GA 3AKAA 1LA3A 1ZOTB 4WQ2A 3AKBA 4MN0A 3RM1A 1NX2A 4JPZB 5IBWA 2M0RA 4I5LB 1SR6C 4F0ZB 4YGDB 1UWOA 1BODA 3WXAA 1CMGA 4I5NB 1NX0A 1XFXO 2CTNA 2KFHA 1EJ3A 2F3ZA 5HKZA 3NSLA 1J1DA 1Y0VH 1TNQA 1B9AA 1KFXS 3A4UB 2LMTA 2L2EA 2R2IA 1Y1UA 1CFCA 2K2AA 2EGDA 1FF1A 1K8UA 3PALA 2P6BB 3FWBA 3WHTB 1QIWA 1S26D 2F2PA 1IGVA 3BOWA 4GAOA 4MBEA 1QXPA 2K7CA 3GOFA 2TN4A 1N2DA 3NSOA 1N65A 2KAXA 2BBNA 2CXJA 4R1EA 3WNXB 3LL8B 3NSKA 4A4CA 1KFXL 3DF0A 5HYDA 1KQMB 3BUMB 1TN4A 2BE6A 1KFUS 2JOJA 2L51A 1AJ4A 2MRDA 5ER5A 4XJKB 2KI4C 2M3WA 1U5IA 3BQ3A 1NX3A 2VRGA 1CLBA 1UURA 4WQ3A 1F55A 4MZKA 1G8IA 1KWOC 1ALVA 2NZ0A 4XYNA 1IJ6A 5HKWA 2MA2A 4PHKA 1BT6A 4CFQA 1SK6D 3VRPA 1WDCB 1CDNA 1YRUB 2DOQA 4HRHA 5ER4X 5DKNA 1KFUL 4ZCVA 1X02A 5BPJA 1CM1A 1MF8B 1SYMA 3DVMA 5I2OA 1DJIA 1QV0A 5DKQA 2Q91A 2D8NA 4PE7A 2L98A 4PHNA 3EK7A 1CM4A 1RFJA 2M97A 4GNKB 4P5OE 4C0LA 1G33A 4M2QA 4P2YB 1F70A 4PALA 4ICBA 1B8LA 2K8MB 1GJYA 3HCMA 3I5IC 1IG5A 2ZN8A 1OMRA 1UHIA 3JTDB 1DJYA 4IL1A 2JXLA 1CLLA 4MZJA 1D1OA 1XO5A 3JVTB 1GQMA 2KBIA 3TDZA 1FI5A 2ZFDA 1C7WA 3C1VA 2CNPA 1F8HA 4OR9B 3VRQA 4OVNF 4HREE 1PK0D 2L0PA 2M7LA 1CMFA 1J7OA 5G08A 3I5FC 1OZOA 1A75B 3H4SE 1YRTB 3GK2A 1J7PA 1NWDA 1JUOA 5AXIA 1BU3A 3E3RA 1IJ5A 1S36A 1UHJA 3EVRA 2KQ6A 1YUSA 3PATA 4MZLA 5CSFA 5F6TA 4M2PA 3TS5C 5JOLA 1RWYA 1BMOA 2K7BA 3BUOB 2JNFA 1LVCD 2JULA 2PMYA 2E30A 1CKKA 1EG4A 1OQPA 1W7JB 1GGWA 2HPSA 5KTYA 1G4YR 2B1UA 5D69A 4GGFA 1JF0A 2JT0A 2KFFA 1DJGA 1MR8A 3FIAA 4DIRA 1WLMA 1MXEA 1JF2A 2BL0C 2KYFA 2M9GA 2WORA 1R2UA 3PLFB 3TUYB 4N1GA 4HSZA 4PE0A 1QTXA 1NYAA 2BECA 1WDCC 2KNEA 3EVVA 1ZMZA 1L2OC 1PSRA 2WOSA 4WRIA 4QJ5B 2HQ8A 5GQQC 1EH2A 1KSOA 2KGBC 1AUIB 3IQOA 1LKJA 1YTZC 3O4YA 1SMGA 1AHRA 1B47A 2K7OA 1BR4B 2Y5IA 2BCAA 2MBXA 2KYCA 4AQJA 2EC6C 3OP0A 1C07A 3A8RA 1CTRA 3TZ1A 4NDDA 1DF0B 1ZACA 3GK4X 1SL9A 4CLNA 1B7TZ 1CFPA 2KGRA 4YBHB 1TCFA 4USLA 4OCIA 2Y1MA 2KFGA 3FWCA 4U8DA 4L9MA 1TRFA 3ICBA 1L7ZA 4GFTA 3BYAA 1OSAA 3I5GC 1H8BA
chains in the Genus database with same CATH superfamily
3DZTA 5DKRA 3DVKA 3SG5A 2KSPA 2QACA 2IS9A 1MWNA 5TNCA 3LCPC 3S0DA 3O6BA 2FCEA 1E8AA 3PN7C 3D10A 1B8RA 2CBLA 1TNWA 2JPTA 4PE1A 4XJKA 4MRXA 1YVHA 2O5GA 2CT9A 3D74A 2QEOA 4CIDA 2LLTA 1JBAA 3S0BA 2GGZA 1DJHA 2I2RE 1RROA 1OZSA 1DC1A 1YR5A 2H8VA 2KAVA 2M1UA 1SSEB 3CR5X 1MXLC 3EK4A 1IQ3A 1HQVA 1OOHA 2L4HA 3AAJA 2QEVA 4JD9A 3S0GA 2LUCA 1ALWA 1KK7Y 2SASA 1XFUO 1RTP1 2KLEA 1M63B 3TUYC 3CDNA 1QVIY 4NDCA 2AUCA 2PSRA 2BAPA 5J3XA 1J55A 1DJWA 3S0FA 2JQ6A 3OB2B 3B7AA 1WRZA 2I94A 2LM5A 3SS3A 1M31A 1SW8A 1QIVA 1IQ5A 1WRLA 2WCKA 3HX4A 4PDZA 3VRRA 1SNLA 4GGFC 3I5HC 3PFVA 4DS7A 3DD4A 1XFYO 1DELA 3F45A 2WC8A 4YI9A 2KI6D 3CWGA 2F3YA 2JRFA 2OTGC 1SL8A 1DGVA 2V53A 4YRUA 1OOIX 1GGZA 2JXCA 5D7FA 1K9UA 2LHLA 5FI7A 2LAPA 2H61C 2OS8B 1MUXA 2WCBA 2Y4QA 1KCYA 3KPXA 3FS7A 3TDIA 2SCPA 1YVLA 3BUXB 4DCKA 2LNKA 1J7QA 1FW4A 2K61A 2LP2A 2GV5A 1BF5A 1K2HA 1DJZA 1WRKA 5DICA 4I5KA 1PALA 1A75A 1S5GZ 2LMUA 1SCMB 2NCPA 5K89A 1TUZA 1ORGA 1Y1AA 2K2FA 2LCPA 2HF5A 3BXKA 4GGNA 4CFRA 1XFRA 2BCXA 3BFBA 3K21A 3S0AA 3WHUB 4PHJA 4ZCUA 3NHTA 1DMOA 4NQGA 2LANA 4A4BA 1XK4C 1F4OA 2Y1NA 5AANA 1IRJA 5AEQA 1NSHA 2L5XB 3VB1A 4C0KA 1A29A 1OMVA 1V1FA 4KYNA 3SJSA 1ZUZA 1J1EA 1NP8A 4YGAA 3BFHA 2G2BA 4OKHA 2LLSA 1DTLA 1NIWA 1XFWO 2NCOA 2F2OA 3D73A 1A4PA 2ZNEA 2ERBA 1J7RA 2WCMA 2ZN9A 2KQYA 1PVAA 1SR6B 1TCOB 4E68A 1JFJA 2BKHB 1KQMC 1Y1XA 2F8PA 1UP5A 2LMVA 3DXLA 3IF7A 3VROA 1S3PA 3V2LA 2Q4UA 1KQVA 3NSIA 3SG2A 1AVSA 2BCBA 4DRWA 1DT7B 5FYXA 2WNDA 3LK0A 1QS7A 3NXAA 4NDBA 3SS4A 1DF0A 2KHNA 4INWA 1B1GA 1TOPA 4MSPA 2I7AA 1JFKA 4DUQA 2H61A 2KAYA 3B87A 3MSEB 2MJWB 1M39A 1CDMA 2FJYA 2PASA 1IWQA 3SG3A 1UHHA 2JU0A 3CR2A 4BY4A 3NGVA 2JNXA 4AQIA 1K95A 3OX5A 5I2QA 1K96A 2LVKA 1EXRA 3EG5B 1UHNA 4UPGA 2BBMA 2LE9B 1JSAA 2M1KB 2WCHA 2KI4B 2JTZA 1PVBA 2L5YA 1FBVA 1W9ZA 1XK4A 1AP4A 2FJUB 4YGBB 1KWOB 1DVIA 3D0YB 1BR1B 1QX5B 3O78A 4JQ0D 4ORAB 2LC5A 4ORBB 5I94A 3TDUA 1RK9A 3SG6A 1SCMC 1FI6A 1CLMA 1SKTA 4JWQA 4MVFA 5I2LA 1OOFA 4YGEB 1A2XA 1C3ZA 3B88A 1MHOA 3JTDC 4PCWA 4MEWA 5CPVA 5CSJA 1XYDA 2ZKMX 1TIZA 3JVTC 4D1EA 3UNWA 3Q8IA 3BFAA 5HLVA 3KHEA 2EHBA 5B8IB 1W7IB 2PVBA 2KPHA 1TWOA 1TUJA 3CABA 1S6JA 1OOGA 2QPTA 1QLSA 1K94A 1LXFC 2LUXA 2ZRSA 2AAOA 5JJGA 3AAKA 1PULA 2WCEA 1TNPA 2M7NA 4GPLB 1TNXA 1YUUA 2JT3A 3CYZA 1XFZO 5AERA 1BG1A 3I5IB 1WLZA 1K9KA 3CR4X 1SPYA 2LVIA 1RECA 3DVJA 2HETA 1UHKA 3FE8A 3L47A 2NXQA 1S6IA 1YX7A 2LV7A 2OPOA 1S5GY 2L50A 3I5FB 1CFFA 1M46A 3M0WA 1IH0A 2KBMA 1BLQA 1XVJA 5AFPA 2M8UA 1H4BA 3TS5B 1K93D 2E6WA 3R1VA 1QV1A 1CDPA 1OMDA 4C0JA 2O60A 5HLOA 1F71A 3CZ1A 5D3OA 1S6CA 1VRKA 1N0YA 2M29A 3VRNA 1CB1A 3ZWHA 1CDLA 3NHIA 3EKJA 1HT9A 1QJTA 2I18A 1QLKA 2COLB 1T14A 2BL0B 2JZIA 2KOTA 3UO9A 3BOWB 2MLFC 1KK8B 2MLEC 1M45A 1B8CA 1NUBA 4MRYA 2GTEA 4Q04A 4HRGA 2K7DA 1IKUA 1S1EA 3BUNB 3OBVA 1L2OB 3DF0B 2A4JA 4OZDA 1LA0A 2LVVA 3O2PA 3OB1B 3KF9A 1Z2CB 1SCVA 1C7VA 2BE4A 1XFVO 2GGMA 1U5IB 3OGNA 2FCDA 3QMEA 1PSBA 3D77A 2EC6B 1UUSA 2FOTA 3LLEA 3EVUA 1CFDA 3CS1A 1EG3A 2PALA 4BY5A 1PRWA 2WC6A 2CCMA 2KDHA 2ZNDA 3CGAA 1KK7Z 2AMIA 3CZTX 2JTTA 3CTNA 1Y6WA 1DGUA 1QVIZ 5KU1A 1LINA 2L4IA 2BKIB 3N7HA 1F4QA 1ODBA 1ZFSA 2F33A 2G9BA 2WC5A 1K90D 1QX7A 1JC2A 3I5GB 3L4LA 3PM8A 2HQWA 2WCJA 4PE4A 4OV2A 1FPWA 1F54A 2H2KA 4QJ4B 1QX2A 3EK8A 2MHHA 4GUKA 5HKYA 1B7TY 4AOMA 2M49B 1YUTA 3EKHA 3KO0A 3IQQA 3PN7B 2YGUA 4QJ3B 1NCYA 4I5JA 4YI8A 3VGOA 4CPVA 3PSRA 1YURA 4FTGA 3LK1A 2PRUA 4MLWA 1KSMA 3BUWB 1SL7A 2BNXA 3RLZA 1NCXA 3DVEA 1BOCA 1LS8A 2LVJA 3D0YA 1TTXA 1AJ5A 3SG7A 1MQ1A 2LP3A 1A03A 1QASA 4PHMA 5PALA 1OE9B 4GBAA 4M2OA 1WY9A 1OOJA 1B4CA 3SIAA 4ETOA 1SRAA 1QATA 3D76A 4N1FA 2NLNA 2ISDA 2MAZA 1YX8A 3CLNA 5KSZA 5CSNA 2OS8C 1CNPA 1DQEA 5CSIA 1NX1A 1KK8C 1K9PA 3OHMB 1EL4A 1JWDA 5FI6A 3B6XA 1RJVA 4TNCA 4ORCB 4FQTA 5ER5A 3ZNIA 2LLUA 1BJFA 2JT8A 2RGIA 2KI6C 2ZRTA 1SBJA 2JWWA 3I5HB 4YGCB 2JC2A 3L4AA 4N5XA 3SG4A 1NPQA 1XA5A 1Q80A 1NCZA 3OX6A 2OTGB 2LHIA 3SIBA 4FQOA 2L2CA 2WCFA 1SY9A 5I8NA 3GK1A 2K0JA 3DYEA 1DJXA 1R6PA 3KEVA 3QRXA 1AK8A 1V1GA 3AKAA 3O4XA 1LA3A 1ZOTB 4WQ2A 3AKBA 4MN0A 3RM1A 1NX2A 4JPZB 5IBWA 2M0RA 4I5LB 4IJ7A 1SR6C 4F0ZB 4YGDB 1UWOA 1BODA 3WXAA 1CMGA 3DY9A 4I5NB 1NX0A 1XFXO 2CTNA 2KFHA 1EJ3A 2F3ZA 5HKZA 3NSLA 1J1DA 1Y0VH 2QDIA 1TNQA 1B9AA 1KFXS 3A4UB 2LMTA 2L2EA 3PM2A 2R2IA 1Y1UA 1CFCA 2K2AA 2EGDA 1FF1A 1K8UA 3PALA 2P6BB 3FWBA 3WHTB 1QIWA 1S26D 2F2PA 1IGVA 2PQLA 3BOWA 4GAOA 4MBEA 1QXPA 2K7CA 3GOFA 2TN4A 1N2DA 3NSOA 1N65A 3SS5A 2KAXA 2BBNA 2CXJA 3R72A 4R1EA 3WNXB 3LL8B 3FE6A 3NSKA 4A4CA 5HL1A 1KFXL 3CZ2A 3DF0A 5HYDA 1KQMB 1P28A 3BUMB 5EL2A 1TN4A 2BE6A 1KFUS 2JOJA 2L51A 1AJ4A 2MRDA 3FE9A 1QWVA 2KI4C 4JKTA 4XJKB 2M3WA 1U5IA 3BQ3A 1NX3A 3D78A 2VRGA 1CLBA 1UURA 4WQ3A 3R1PA 3B86A 4MZKA 1F55A 1G8IA 1KWOC 1ALVA 2NZ0A 4INXA 4XYNA 1IJ6A 5HKWA 2MA2A 2P71A 4PHKA 1BT6A 2QEHA 4CFQA 1SK6D 3VRPA 1WDCB 1CDNA 1YRUB 2DOQA 2K60A 4HRHA 5DKNA 5ER4X 5FI2A 1KFUL 4ZCVA 1X02A 5BPJA 1CM1A 1MF8B 1SYMA 3DVMA 5I2OA 1DJIA 1DEKA 1QV0A 5DKQA 2Q91A 2D8NA 4PE7A 2L98A 4PHNA 3BJHA 3EK7A 1CM4A 3RZSA 1RFJA 4PT1A 2M97A 1IIOA 4GNKB 4F7FA 4P5OE 4C0LA 1G33A 4M2QA 4P2YB 1F70A 4PALA 4ICBA 1B8LA 2K8MB 1GJYA 3HCMA 3I5IC 1IG5A 2ZN8A 1C3YA 1OMRA 1UHIA 3JTDB 1DJYA 4IL1A 3S0EA 3CZ0A 2JXLA 1CLLA 4MZJA 1D1OA 1XO5A 3D75A 3JVTB 1GQMA 2KBIA 3TDZA 1FI5A 2ZFDA 3IVTA 1C7WA 3C1VA 2CNPA 1F8HA 4OR9B 3VRQA 4OVNF 4HREE 1PK0D 2L0PA 2M7LA 1CMFA 1J7OA 5G08A 3I5FC 1OZOA 1A75B 3H4SE 1YRTB 3GK2A 1J7PA 1NWDA 3R1OA 1JUOA 5AXIA 1BU3A 3E3RA 1IJ5A 1S36A 1UHJA 3EVRA 2KQ6A 1YUSA 3PATA 4MZLA 5CSFA 5F6TA 4M2PA 3TS5C 5JOLA 1RWYA 1BMOA 2K7BA 3BUOB 2JNFA 1LVCD 2JULA 2PMYA 2E30A 3PJIA 1CKKA 1EG4A 1OQPA 1W7JB 2QEBA 1GGWA 2HPSA 5KTYA 2JPOA 1G4YR 2B1UA 5D69A 4GGFA 1JF0A 2JT0A 2KFFA 1DJGA 1MR8A 3FIAA 3K1EA 4DIRA 1WLMA 1MXEA 1JF2A 2BL0C 2KYFA 2M9GA 2WORA 1R2UA 3PLFB 3TUYB 4N1GA 4HSZA 4PE0A 1QTXA 1NYAA 1OW4A 1WDCC 2BECA 2KNEA 3EVVA 1ZMZA 1L2OC 2KLDA 1PSRA 2WOSA 4WRIA 4QJ5B 2HQ8A 5GQQC 1EH2A 1KSOA 2KGBC 1AUIB 3IQOA 1LKJA 1YTZC 3O4YA 1SMGA 1AHRA 1B47A 2K7OA 1BR4B 2Y5IA 2BCAA 2MBXA 2KYCA 4AQJA 2EC6C 3OP0A 1C07A 3A8RA 1CTRA 3TZ1A 4NDDA 1DF0B 1Z4HA 1ZACA 3GK4X 1SL9A 4CLNA 1B7TZ 1CFPA 2PYQA 2KGRA 2P70A 1TCFA 4YBHB 4USLA 1GM0A 4OCIA 2Y1MA 2WCLA 2KFGA 3FWCA 4U8DA 4L9MA 1TRFA 3ICBA 1L7ZA 4GFTA 3BYAA 1OSAA 3I5GC 1H8BA
chains in the Genus database with same CATH topology
5DKRA 3SG5A 3DVKA 2KSPA 2QACA 2IS9A 1MWNA 5TNCA 3LCPC 3O6BA 2FCEA 1E8AA 3PN7C 3D10A 1B8RA 2CBLA 1TNWA 2JPTA 4PE1A 4XJKA 4MRXA 1YVHA 2O5GA 2CT9A 4CIDA 2LLTA 1JBAA 2GGZA 1DJHA 2I2RE 1RROA 1OZSA 1YR5A 2KAVA 2M1UA 3CR5X 1IQ3A 1MXLC 3EK4A 1HQVA 3AAJA 2L4HA 2LUCA 1ALWA 1KK7Y 2SASA 1XFUO 1RTP1 1M63B 3TUYC 1QVIY 4NDCA 2AUCA 2PSRA 5J3XA 1J55A 1DJWA 2JQ6A 3OB2B 1WRZA 2I94A 2LM5A 1M31A 1SW8A 1QIVA 1IQ5A 1WRLA 3HX4A 4PDZA 3VRRA 1SNLA 4GGFC 3I5HC 3PFVA 4DS7A 3DD4A 1XFYO 4YI9A 3F45A 2WC8A 2KI6D 3CWGA 2F3YA 2JRFA 2OTGC 1SL8A 1DGVA 2V53A 4YRUA 1GGZA 2JXCA 5D7FA 1K9UA 2LHLA 2LAPA 2H61C 2OS8B 1MUXA 2WCBA 2Y4QA 1KCYA 3KPXA 3FS7A 3TDIA 2SCPA 1YVLA 3BUXB 4DCKA 2LNKA 1J7QA 1FW4A 2K61A 2LP2A 2GV5A 1BF5A 1K2HA 1DJZA 1WRKA 4I5KA 1PALA 1A75A 1S5GZ 2LMUA 1SCMB 2NCPA 5K89A 1Y1AA 2K2FA 2LCPA 2HF5A 3BXKA 4GGNA 4CFRA 2BCXA 3K21A 3WHUB 4PHJA 4ZCUA 1DMOA 4NQGA 2LANA 4A4BA 1XK4C 1F4OA 2Y1NA 5AANA 1IRJA 5AEQA 1NSHA 2L5XB 4C0KA 1A29A 1OMVA 1V1FA 3SJSA 1ZUZA 1J1EA 1NP8A 4YGAA 4OKHA 2G2BA 2LLSA 1DTLA 1NIWA 1XFWO 2NCOA 2F2OA 1A4PA 2ZNEA 1J7RA 2ZN9A 2KQYA 1PVAA 1SR6B 1TCOB 4E68A 1JFJA 2BKHB 1KQMC 1Y1XA 2F8PA 1UP5A 2LMVA 3IF7A 3VROA 1S3PA 2Q4UA 1KQVA 3NSIA 3SG2A 1AVSA 2BCBA 4DRWA 1DT7B 5FYXA 2WNDA 3LK0A 1QS7A 3NXAA 4NDBA 1DF0A 2KHNA 1B1GA 1TOPA 4MSPA 2I7AA 1JFKA 4DUQA 2H61A 2KAYA 3MSEB 2MJWB 1M39A 1CDMA 2PASA 1IWQA 3SG3A 1UHHA 2JU0A 3CR2A 4BY4A 2JNXA 4AQIA 1K95A 3OX5A 5I2QA 1K96A 2LVKA 1EXRA 1UHNA 4UPGA 2BBMA 2LE9B 1JSAA 2M1KB 2KI4B 2JTZA 1PVBA 1FBVA 1XK4A 1AP4A 2FJUB 4YGBB 1KWOB 1DVIA 3D0YB 1BR1B 1QX5B 3O78A 4JQ0D 4ORAB 2LC5A 4ORBB 3TDUA 1RK9A 3SG6A 1SCMC 1FI6A 1CLMA 1SKTA 4JWQA 4MVFA 5I2LA 4YGEB 1A2XA 1MHOA 3JTDC 4PCWA 4MEWA 5CPVA 5CSJA 1XYDA 2ZKMX 1TIZA 3JVTC 4D1EA 5HLVA 3KHEA 2EHBA 5B8IB 1W7IB 2PVBA 1S6JA 2QPTA 1QLSA 1K94A 1LXFC 2LUXA 2ZRSA 2AAOA 5JJGA 3AAKA 1PULA 2WCEA 1TNPA 2M7NA 4GPLB 1TNXA 1YUUA 2JT3A 1BG1A 1XFZO 5AERA 3I5IB 1WLZA 1K9KA 3CR4X 1SPYA 2LVIA 1RECA 3DVJA 2HETA 1UHKA 2NXQA 1S6IA 1YX7A 2LV7A 2OPOA 1S5GY 2L50A 3I5FB 1CFFA 1M46A 3M0WA 1IH0A 2KBMA 1BLQA 1XVJA 5AFPA 2M8UA 1H4BA 3TS5B 1K93D 2E6WA 1QV1A 1CDPA 1OMDA 4C0JA 2O60A 5HLOA 1F71A 1S6CA 1VRKA 1N0YA 2M29A 3VRNA 1CB1A 3ZWHA 1CDLA 3EKJA 1HT9A 1QJTA 2I18A 1QLKA 2COLB 2JZIA 2BL0B 2KOTA 3BOWB 2MLFC 1KK8B 2MLEC 1M45A 1B8CA 1NUBA 4MRYA 4Q04A 4HRGA 2K7DA 1IKUA 1S1EA 3BUNB 1L2OB 3DF0B 2A4JA 1LA0A 2LVVA 3O2PA 3OB1B 3KF9A 1SCVA 1C7VA 2BE4A 1XFVO 2GGMA 1U5IB 2FCDA 1PSBA 3LLEA 2EC6B 1UUSA 2FOTA 3EVUA 1CFDA 3CS1A 1EG3A 2PALA 4BY5A 1PRWA 2CCMA 2KDHA 2ZNDA 3CGAA 1KK7Z 2AMIA 3CZTX 2JTTA 3CTNA 1Y6WA 1DGUA 1QVIZ 5KU1A 1LINA 2L4IA 2BKIB 1F4QA 1ODBA 1ZFSA 2F33A 2G9BA 1JC2A 1K90D 1QX7A 3I5GB 3PM8A 2HQWA 4PE4A 4OV2A 1FPWA 1F54A 2H2KA 4QJ4B 1QX2A 3EK8A 2MHHA 4GUKA 5HKYA 1B7TY 4AOMA 2M49B 1YUTA 3EKHA 3KO0A 3IQQA 3PN7B 4QJ3B 4YI8A 1NCYA 4I5JA 3VGOA 4CPVA 3PSRA 1YURA 4FTGA 3LK1A 2PRUA 4MLWA 1KSMA 3BUWB 1SL7A 3RLZA 1NCXA 3DVEA 1BOCA 2LVJA 3D0YA 1TTXA 1AJ5A 3SG7A 1MQ1A 2LP3A 1A03A 1QASA 4PHMA 5PALA 1OE9B 4GBAA 4M2OA 1WY9A 1OOJA 1B4CA 3SIAA 4ETOA 1SRAA 1QATA 4N1FA 2NLNA 2ISDA 2MAZA 1YX8A 3CLNA 5KSZA 5CSNA 2OS8C 1CNPA 5CSIA 1NX1A 1KK8C 1K9PA 3OHMB 1EL4A 1JWDA 1RJVA 4TNCA 4ORCB 3ZNIA 2LLUA 1BJFA 2JT8A 2RGIA 2KI6C 2ZRTA 1SBJA 2JWWA 3I5HB 4YGCB 2JC2A 3SG4A 4N5XA 1NPQA 1XA5A 1Q80A 1NCZA 3OX6A 2OTGB 2LHIA 3SIBA 4FQOA 2WCFA 5I8NA 1SY9A 3GK1A 2K0JA 1DJXA 1R6PA 3KEVA 3QRXA 1AK8A 1V1GA 3AKAA 1LA3A 1ZOTB 4WQ2A 3AKBA 4MN0A 3RM1A 1NX2A 4JPZB 5IBWA 2M0RA 4I5LB 1SR6C 4F0ZB 4YGDB 1UWOA 1BODA 3WXAA 1CMGA 4I5NB 1NX0A 1XFXO 2CTNA 2KFHA 1EJ3A 2F3ZA 5HKZA 3NSLA 1J1DA 1Y0VH 1TNQA 1B9AA 1KFXS 3A4UB 2LMTA 2L2EA 2R2IA 1Y1UA 1CFCA 2K2AA 2EGDA 1FF1A 1K8UA 3PALA 2P6BB 3FWBA 3WHTB 1QIWA 1S26D 2F2PA 1IGVA 3BOWA 4GAOA 4MBEA 1QXPA 2K7CA 3GOFA 2TN4A 1N2DA 3NSOA 1N65A 2KAXA 2BBNA 2CXJA 4R1EA 3WNXB 3LL8B 3NSKA 4A4CA 1KFXL 3DF0A 5HYDA 1KQMB 3BUMB 1TN4A 2BE6A 1KFUS 2JOJA 2L51A 1AJ4A 2MRDA 5ER5A 4XJKB 2KI4C 2M3WA 1U5IA 3BQ3A 1NX3A 2VRGA 1CLBA 1UURA 4WQ3A 1F55A 4MZKA 1G8IA 1KWOC 1ALVA 2NZ0A 4XYNA 1IJ6A 5HKWA 2MA2A 4PHKA 1BT6A 4CFQA 1SK6D 3VRPA 1WDCB 1CDNA 1YRUB 2DOQA 4HRHA 5ER4X 5DKNA 1KFUL 4ZCVA 1X02A 5BPJA 1CM1A 1MF8B 1SYMA 3DVMA 5I2OA 1DJIA 1QV0A 5DKQA 2Q91A 2D8NA 4PE7A 2L98A 4PHNA 3EK7A 1CM4A 1RFJA 2M97A 4GNKB 4P5OE 4C0LA 1G33A 4M2QA 4P2YB 1F70A 4PALA 4ICBA 1B8LA 2K8MB 1GJYA 3HCMA 3I5IC 1IG5A 2ZN8A 1OMRA 1UHIA 3JTDB 1DJYA 4IL1A 2JXLA 1CLLA 4MZJA 1D1OA 1XO5A 3JVTB 1GQMA 2KBIA 3TDZA 1FI5A 2ZFDA 1C7WA 3C1VA 2CNPA 1F8HA 4OR9B 3VRQA 4OVNF 4HREE 1PK0D 2L0PA 2M7LA 1CMFA 1J7OA 5G08A 3I5FC 1OZOA 1A75B 3H4SE 1YRTB 3GK2A 1J7PA 1NWDA 1JUOA 5AXIA 1BU3A 3E3RA 1IJ5A 1S36A 1UHJA 3EVRA 2KQ6A 1YUSA 3PATA 4MZLA 5CSFA 5F6TA 4M2PA 3TS5C 5JOLA 1RWYA 1BMOA 2K7BA 3BUOB 2JNFA 1LVCD 2JULA 2PMYA 2E30A 1CKKA 1EG4A 1OQPA 1W7JB 1GGWA 2HPSA 5KTYA 1G4YR 2B1UA 5D69A 4GGFA 1JF0A 2JT0A 2KFFA 1DJGA 1MR8A 3FIAA 4DIRA 1WLMA 1MXEA 1JF2A 2BL0C 2KYFA 2M9GA 2WORA 1R2UA 3PLFB 3TUYB 4N1GA 4HSZA 4PE0A 1QTXA 1NYAA 2BECA 1WDCC 2KNEA 3EVVA 1ZMZA 1L2OC 1PSRA 2WOSA 4WRIA 4QJ5B 2HQ8A 5GQQC 1EH2A 1KSOA 2KGBC 1AUIB 3IQOA 1LKJA 1YTZC 3O4YA 1SMGA 1AHRA 1B47A 2K7OA 1BR4B 2Y5IA 2BCAA 2MBXA 2KYCA 4AQJA 2EC6C 3OP0A 1C07A 3A8RA 1CTRA 3TZ1A 4NDDA 1DF0B 1ZACA 3GK4X 1SL9A 4CLNA 1B7TZ 1CFPA 2KGRA 4YBHB 1TCFA 4USLA 4OCIA 2Y1MA 2KFGA 3FWCA 4U8DA 4L9MA 1TRFA 3ICBA 1L7ZA 4GFTA 3BYAA 1OSAA 3I5GC 1H8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DKR A;  3SG5 A;  3DVK A;  2KSP A;  2QAC A;  2IS9 A;  1MWN A;  5TNC A;  3LCP C;  3O6B A;  2FCE A;  1E8A A;  3PN7 C;  3D10 A;  1B8R A;  2CBL A;  1TNW A;  2JPT A;  4PE1 A;  4XJK A;  4MRX A;  1YVH A;  2O5G A;  2CT9 A;  4CID A;  2LLT A;  1JBA A;  2GGZ A;  1DJH A;  2I2R E;  1RRO A;  1OZS A;  1YR5 A;  2KAV A;  2M1U A;  3CR5 X;  1IQ3 A;  1MXL C;  3EK4 A;  1HQV A;  3AAJ A;  2L4H A;  2LUC A;  1ALW A;  1KK7 Y;  2SAS A;  1XFU O;  1RTP 1;  1M63 B;  3TUY C;  1QVI Y;  4NDC A;  2AUC A;  2PSR A;  5J3X A;  1J55 A;  1DJW A;  2JQ6 A;  3OB2 B;  1WRZ A;  2I94 A;  2LM5 A;  1M31 A;  1SW8 A;  1QIV A;  1IQ5 A;  1WRL A;  3HX4 A;  4PDZ A;  3VRR A;  1SNL A;  4GGF C;  3I5H C;  3PFV A;  4DS7 A;  3DD4 A;  1XFY O;  4YI9 A;  3F45 A;  2WC8 A;  2KI6 D;  3CWG A;  2F3Y A;  2JRF A;  2OTG C;  1SL8 A;  1DGV A;  2V53 A;  4YRU A;  1GGZ A;  2JXC A;  5D7F A;  1K9U A;  2LHL A;  2LAP A;  2H61 C;  2OS8 B;  1MUX A;  2WCB A;  2Y4Q A;  1KCY A;  3KPX A;  3FS7 A;  3TDI A;  2SCP A;  1YVL A;  3BUX B;  4DCK A;  2LNK A;  1J7Q A;  1FW4 A;  2K61 A;  2LP2 A;  2GV5 A;  1BF5 A;  1K2H A;  1DJZ A;  1WRK A;  4I5K A;  1PAL A;  1A75 A;  1S5G Z;  2LMU A;  1SCM B;  2NCP A;  5K89 A;  1Y1A A;  2K2F A;  2LCP A;  2HF5 A;  3BXK A;  4GGN A;  4CFR A;  2BCX A;  3K21 A;  3WHU B;  4PHJ A;  4ZCU A;  1DMO A;  4NQG A;  2LAN A;  4A4B A;  1XK4 C;  1F4O A;  2Y1N A;  5AAN A;  1IRJ A;  5AEQ A;  1NSH A;  2L5X B;  4C0K A;  1A29 A;  1OMV A;  1V1F A;  3SJS A;  1ZUZ A;  1J1E A;  1NP8 A;  4YGA A;  4OKH A;  2G2B A;  2LLS A;  1DTL A;  1NIW A;  1XFW O;  2NCO A;  2F2O A;  1A4P A;  2ZNE A;  1J7R A;  2ZN9 A;  2KQY A;  1PVA A;  1SR6 B;  1TCO B;  4E68 A;  1JFJ A;  2BKH B;  1KQM C;  1Y1X A;  2F8P A;  1UP5 A;  2LMV A;  3IF7 A;  3VRO A;  1S3P A;  2Q4U A;  1KQV A;  3NSI A;  3SG2 A;  1AVS A;  2BCB A;  4DRW A;  1DT7 B;  5FYX A;  2WND A;  3LK0 A;  1QS7 A;  3NXA A;  4NDB A;  1DF0 A;  2KHN A;  1B1G A;  1TOP A;  4MSP A;  2I7A A;  1JFK A;  4DUQ A;  2H61 A;  2KAY A;  3MSE B;  2MJW B;  1M39 A;  1CDM A;  2PAS A;  1IWQ A;  3SG3 A;  1UHH A;  2JU0 A;  3CR2 A;  4BY4 A;  2JNX A;  4AQI A;  1K95 A;  3OX5 A;  5I2Q A;  1K96 A;  2LVK A;  1EXR A;  1UHN A;  4UPG A;  2BBM A;  2LE9 B;  1JSA A;  2M1K B;  2KI4 B;  2JTZ A;  1PVB A;  1FBV A;  1XK4 A;  1AP4 A;  2FJU B;  4YGB B;  1KWO B;  1DVI A;  3D0Y B;  1BR1 B;  1QX5 B;  3O78 A;  4JQ0 D;  4ORA B;  2LC5 A;  4ORB B;  3TDU A;  1RK9 A;  3SG6 A;  1SCM C;  1FI6 A;  1CLM A;  1SKT A;  4JWQ A;  4MVF A;  5I2L A;  4YGE B;  1A2X A;  1MHO A;  3JTD C;  4PCW A;  4MEW A;  5CPV A;  5CSJ A;  1XYD A;  2ZKM X;  1TIZ A;  3JVT C;  4D1E A;  5HLV A;  3KHE A;  2EHB A;  5B8I B;  1W7I B;  2PVB A;  1S6J A;  2QPT A;  1QLS A;  1K94 A;  1LXF C;  2LUX A;  2ZRS A;  2AAO A;  5JJG A;  3AAK A;  1PUL A;  2WCE A;  1TNP A;  2M7N A;  4GPL B;  1TNX A;  1YUU A;  2JT3 A;  1BG1 A;  1XFZ O;  5AER A;  3I5I B;  1WLZ A;  1K9K A;  3CR4 X;  1SPY A;  2LVI A;  1REC A;  3DVJ A;  2HET A;  1UHK A;  2NXQ A;  1S6I A;  1YX7 A;  2LV7 A;  2OPO A;  1S5G Y;  2L50 A;  3I5F B;  1CFF A;  1M46 A;  3M0W A;  1IH0 A;  2KBM A;  1BLQ A;  1XVJ A;  5AFP A;  2M8U A;  1H4B A;  3TS5 B;  1K93 D;  2E6W A;  1QV1 A;  1CDP A;  1OMD A;  4C0J A;  2O60 A;  5HLO A;  1F71 A;  1S6C A;  1VRK A;  1N0Y A;  2M29 A;  3VRN A;  1CB1 A;  3ZWH A;  1CDL A;  3EKJ A;  1HT9 A;  1QJT A;  2I18 A;  1QLK A;  2COL B;  2JZI A;  2BL0 B;  2KOT A;  3BOW B;  2MLF C;  1KK8 B;  2MLE C;  1M45 A;  1B8C A;  1NUB A;  4MRY A;  4Q04 A;  4HRG A;  2K7D A;  1IKU A;  1S1E A;  3BUN B;  1L2O B;  3DF0 B;  2A4J A;  1LA0 A;  2LVV A;  3O2P A;  3OB1 B;  3KF9 A;  1SCV A;  1C7V A;  2BE4 A;  1XFV O;  2GGM A;  1U5I B;  2FCD A;  1PSB A;  3LLE A;  2EC6 B;  1UUS A;  2FOT A;  3EVU A;  1CFD A;  3CS1 A;  1EG3 A;  2PAL A;  4BY5 A;  1PRW A;  2CCM A;  2KDH A;  2ZND A;  3CGA A;  1KK7 Z;  2AMI A;  3CZT X;  2JTT A;  3CTN A;  1Y6W A;  1DGU A;  1QVI Z;  5KU1 A;  1LIN A;  2L4I A;  2BKI B;  1F4Q A;  1ODB A;  1ZFS A;  2F33 A;  2G9B A;  1JC2 A;  1K90 D;  1QX7 A;  3I5G B;  3PM8 A;  2HQW A;  4PE4 A;  4OV2 A;  1FPW A;  1F54 A;  2H2K A;  4QJ4 B;  1QX2 A;  3EK8 A;  2MHH A;  4GUK A;  5HKY A;  1B7T Y;  4AOM A;  2M49 B;  1YUT A;  3EKH A;  3KO0 A;  3IQQ A;  3PN7 B;  4QJ3 B;  4YI8 A;  1NCY A;  4I5J A;  3VGO A;  4CPV A;  3PSR A;  1YUR A;  4FTG A;  3LK1 A;  2PRU A;  4MLW A;  1KSM A;  3BUW B;  1SL7 A;  3RLZ A;  1NCX A;  3DVE A;  1BOC A;  2LVJ A;  3D0Y A;  1TTX A;  1AJ5 A;  3SG7 A;  1MQ1 A;  2LP3 A;  1A03 A;  1QAS A;  4PHM A;  5PAL A;  1OE9 B;  4GBA A;  4M2O A;  1WY9 A;  1OOJ A;  1B4C A;  3SIA A;  4ETO A;  1SRA A;  1QAT A;  4N1F A;  2NLN A;  2ISD A;  2MAZ A;  1YX8 A;  3CLN A;  5KSZ A;  5CSN A;  2OS8 C;  1CNP A;  5CSI A;  1NX1 A;  1KK8 C;  1K9P A;  3OHM B;  1EL4 A;  1JWD A;  1RJV A;  4TNC A;  4ORC B;  3ZNI A;  2LLU A;  1BJF A;  2JT8 A;  2RGI A;  2KI6 C;  2ZRT A;  1SBJ A;  2JWW A;  3I5H B;  4YGC B;  2JC2 A;  3SG4 A;  4N5X A;  1NPQ A;  1XA5 A;  1Q80 A;  1NCZ A;  3OX6 A;  2OTG B;  2LHI A;  3SIB A;  4FQO A;  2WCF A;  5I8N A;  1SY9 A;  3GK1 A;  2K0J A;  1DJX A;  1R6P A;  3KEV A;  3QRX A;  1AK8 A;  1V1G A;  3AKA A;  1LA3 A;  1ZOT B;  4WQ2 A;  3AKB A;  4MN0 A;  3RM1 A;  1NX2 A;  4JPZ B;  5IBW A;  2M0R A;  4I5L B;  1SR6 C;  4F0Z B;  4YGD B;  1UWO A;  1BOD A;  3WXA A;  1CMG A;  4I5N B;  1NX0 A;  1XFX O;  2CTN A;  2KFH A;  1EJ3 A;  2F3Z A;  5HKZ A;  3NSL A;  1J1D A;  1Y0V H;  1TNQ A;  1B9A A;  1KFX S;  3A4U B;  2LMT A;  2L2E A;  2R2I A;  1Y1U A;  1CFC A;  2K2A A;  2EGD A;  1FF1 A;  1K8U A;  3PAL A;  2P6B B;  3FWB A;  3WHT B;  1QIW A;  1S26 D;  2F2P A;  1IGV A;  3BOW A;  4GAO A;  4MBE A;  1QXP A;  2K7C A;  3GOF A;  2TN4 A;  1N2D A;  3NSO A;  1N65 A;  2KAX A;  2BBN A;  2CXJ A;  4R1E A;  3WNX B;  3LL8 B;  3NSK A;  4A4C A;  1KFX L;  3DF0 A;  5HYD A;  1KQM B;  3BUM B;  1TN4 A;  2BE6 A;  1KFU S;  2JOJ A;  2L51 A;  1AJ4 A;  2MRD A;  5ER5 A;  4XJK B;  2KI4 C;  2M3W A;  1U5I A;  3BQ3 A;  1NX3 A;  2VRG A;  1CLB A;  1UUR A;  4WQ3 A;  1F55 A;  4MZK A;  1G8I A;  1KWO C;  1ALV A;  2NZ0 A;  4XYN A;  1IJ6 A;  5HKW A;  2MA2 A;  4PHK A;  1BT6 A;  4CFQ A;  1SK6 D;  3VRP A;  1WDC B;  1CDN A;  1YRU B;  2DOQ A;  4HRH A;  5ER4 X;  5DKN A;  1KFU L;  4ZCV A;  1X02 A;  5BPJ A;  1CM1 A;  1MF8 B;  1SYM A;  3DVM A;  5I2O A;  1DJI A;  1QV0 A;  5DKQ A;  2Q91 A;  2D8N A;  4PE7 A;  2L98 A;  4PHN A;  3EK7 A;  1CM4 A;  1RFJ A;  2M97 A;  4GNK B;  4P5O E;  4C0L A;  1G33 A;  4M2Q A;  4P2Y B;  1F70 A;  4PAL A;  4ICB A;  1B8L A;  2K8M B;  1GJY A;  3HCM A;  3I5I C;  1IG5 A;  2ZN8 A;  1OMR A;  1UHI A;  3JTD B;  1DJY A;  4IL1 A;  2JXL A;  1CLL A;  4MZJ A;  1D1O A;  1XO5 A;  3JVT B;  1GQM A;  2KBI A;  3TDZ A;  1FI5 A;  2ZFD A;  1C7W A;  3C1V A;  2CNP A;  1F8H A;  4OR9 B;  3VRQ A;  4OVN F;  4HRE E;  1PK0 D;  2L0P A;  2M7L A;  1CMF A;  1J7O A;  5G08 A;  3I5F C;  1OZO A;  1A75 B;  3H4S E;  1YRT B;  3GK2 A;  1J7P A;  1NWD A;  1JUO A;  5AXI A;  1BU3 A;  3E3R A;  1IJ5 A;  1S36 A;  1UHJ A;  3EVR A;  2KQ6 A;  1YUS A;  3PAT A;  4MZL A;  5CSF A;  5F6T A;  4M2P A;  3TS5 C;  5JOL A;  1RWY A;  1BMO A;  2K7B A;  3BUO B;  2JNF A;  1LVC D;  2JUL A;  2PMY A;  2E30 A;  1CKK A;  1EG4 A;  1OQP A;  1W7J B;  1GGW A;  2HPS A;  5KTY A;  1G4Y R;  2B1U A;  5D69 A;  4GGF A;  1JF0 A;  2JT0 A;  2KFF A;  1DJG A;  1MR8 A;  3FIA A;  4DIR A;  1WLM A;  1MXE A;  1JF2 A;  2BL0 C;  2KYF A;  2M9G A;  2WOR A;  1R2U A;  3PLF B;  3TUY B;  4N1G A;  4HSZ A;  4PE0 A;  1QTX A;  1NYA A;  2BEC A;  1WDC C;  2KNE A;  3EVV A;  1ZMZ A;  1L2O C;  1PSR A;  2WOS A;  4WRI A;  4QJ5 B;  2HQ8 A;  5GQQ C;  1EH2 A;  1KSO A;  2KGB C;  1AUI B;  3IQO A;  1LKJ A;  1YTZ C;  3O4Y A;  1SMG A;  1AHR A;  1B47 A;  2K7O A;  1BR4 B;  2Y5I A;  2BCA A;  2MBX A;  2KYC A;  4AQJ A;  2EC6 C;  3OP0 A;  1C07 A;  3A8R A;  1CTR A;  3TZ1 A;  4NDD A;  1DF0 B;  1ZAC A;  3GK4 X;  1SL9 A;  4CLN A;  1B7T Z;  1CFP A;  2KGR A;  4YBH B;  1TCF A;  4USL A;  4OCI A;  2Y1M A;  2KFG A;  3FWC A;  4U8D A;  4L9M A;  1TRF A;  3ICB A;  1L7Z A;  4GFT A;  3BYA A;  1OSA A;  3I5G C;  1H8B A; 
#chains in the Genus database with same CATH topology
 3DZT A;  5DKR A;  3DVK A;  3SG5 A;  2KSP A;  2QAC A;  2IS9 A;  1MWN A;  5TNC A;  3LCP C;  3S0D A;  3O6B A;  2FCE A;  1E8A A;  3PN7 C;  3D10 A;  1B8R A;  2CBL A;  1TNW A;  2JPT A;  4PE1 A;  4XJK A;  4MRX A;  1YVH A;  2O5G A;  2CT9 A;  3D74 A;  2QEO A;  4CID A;  2LLT A;  1JBA A;  3S0B A;  2GGZ A;  1DJH A;  2I2R E;  1RRO A;  1OZS A;  1DC1 A;  1YR5 A;  2H8V A;  2KAV A;  2M1U A;  1SSE B;  3CR5 X;  1MXL C;  3EK4 A;  1IQ3 A;  1HQV A;  1OOH A;  2L4H A;  3AAJ A;  2QEV A;  4JD9 A;  3S0G A;  2LUC A;  1ALW A;  1KK7 Y;  2SAS A;  1XFU O;  1RTP 1;  2KLE A;  1M63 B;  3TUY C;  3CDN A;  1QVI Y;  4NDC A;  2AUC A;  2PSR A;  2BAP A;  5J3X A;  1J55 A;  1DJW A;  3S0F A;  2JQ6 A;  3OB2 B;  3B7A A;  1WRZ A;  2I94 A;  2LM5 A;  3SS3 A;  1M31 A;  1SW8 A;  1QIV A;  1IQ5 A;  1WRL A;  2WCK A;  3HX4 A;  4PDZ A;  3VRR A;  1SNL A;  4GGF C;  3I5H C;  3PFV A;  4DS7 A;  3DD4 A;  1XFY O;  1DEL A;  3F45 A;  2WC8 A;  4YI9 A;  2KI6 D;  3CWG A;  2F3Y A;  2JRF A;  2OTG C;  1SL8 A;  1DGV A;  2V53 A;  4YRU A;  1OOI X;  1GGZ A;  2JXC A;  5D7F A;  1K9U A;  2LHL A;  5FI7 A;  2LAP A;  2H61 C;  2OS8 B;  1MUX A;  2WCB A;  2Y4Q A;  1KCY A;  3KPX A;  3FS7 A;  3TDI A;  2SCP A;  1YVL A;  3BUX B;  4DCK A;  2LNK A;  1J7Q A;  1FW4 A;  2K61 A;  2LP2 A;  2GV5 A;  1BF5 A;  1K2H A;  1DJZ A;  1WRK A;  5DIC A;  4I5K A;  1PAL A;  1A75 A;  1S5G Z;  2LMU A;  1SCM B;  2NCP A;  5K89 A;  1TUZ A;  1ORG A;  1Y1A A;  2K2F A;  2LCP A;  2HF5 A;  3BXK A;  4GGN A;  4CFR A;  1XFR A;  2BCX A;  3BFB A;  3K21 A;  3S0A A;  3WHU B;  4PHJ A;  4ZCU A;  3NHT A;  1DMO A;  4NQG A;  2LAN A;  4A4B A;  1XK4 C;  1F4O A;  2Y1N A;  5AAN A;  1IRJ A;  5AEQ A;  1NSH A;  2L5X B;  3VB1 A;  4C0K A;  1A29 A;  1OMV A;  1V1F A;  4KYN A;  3SJS A;  1ZUZ A;  1J1E A;  1NP8 A;  4YGA A;  3BFH A;  2G2B A;  4OKH A;  2LLS A;  1DTL A;  1NIW A;  1XFW O;  2NCO A;  2F2O A;  3D73 A;  1A4P A;  2ZNE A;  2ERB A;  1J7R A;  2WCM A;  2ZN9 A;  2KQY A;  1PVA A;  1SR6 B;  1TCO B;  4E68 A;  1JFJ A;  2BKH B;  1KQM C;  1Y1X A;  2F8P A;  1UP5 A;  2LMV A;  3DXL A;  3IF7 A;  3VRO A;  1S3P A;  3V2L A;  2Q4U A;  1KQV A;  3NSI A;  3SG2 A;  1AVS A;  2BCB A;  4DRW A;  1DT7 B;  5FYX A;  2WND A;  3LK0 A;  1QS7 A;  3NXA A;  4NDB A;  3SS4 A;  1DF0 A;  2KHN A;  4INW A;  1B1G A;  1TOP A;  4MSP A;  2I7A A;  1JFK A;  4DUQ A;  2H61 A;  2KAY A;  3B87 A;  3MSE B;  2MJW B;  1M39 A;  1CDM A;  2FJY A;  2PAS A;  1IWQ A;  3SG3 A;  1UHH A;  2JU0 A;  3CR2 A;  4BY4 A;  3NGV A;  2JNX A;  4AQI A;  1K95 A;  3OX5 A;  5I2Q A;  1K96 A;  2LVK A;  1EXR A;  3EG5 B;  1UHN A;  4UPG A;  2BBM A;  2LE9 B;  1JSA A;  2M1K B;  2WCH A;  2KI4 B;  2JTZ A;  1PVB A;  2L5Y A;  1FBV A;  1W9Z A;  1XK4 A;  1AP4 A;  2FJU B;  4YGB B;  1KWO B;  1DVI A;  3D0Y B;  1BR1 B;  1QX5 B;  3O78 A;  4JQ0 D;  4ORA B;  2LC5 A;  4ORB B;  5I94 A;  3TDU A;  1RK9 A;  3SG6 A;  1SCM C;  1FI6 A;  1CLM A;  1SKT A;  4JWQ A;  4MVF A;  5I2L A;  1OOF A;  4YGE B;  1A2X A;  1C3Z A;  3B88 A;  1MHO A;  3JTD C;  4PCW A;  4MEW A;  5CPV A;  5CSJ A;  1XYD A;  2ZKM X;  1TIZ A;  3JVT C;  4D1E A;  3UNW A;  3Q8I A;  3BFA A;  5HLV A;  3KHE A;  2EHB A;  5B8I B;  1W7I B;  2PVB A;  2KPH A;  1TWO A;  1TUJ A;  3CAB A;  1S6J A;  1OOG A;  2QPT A;  1QLS A;  1K94 A;  1LXF C;  2LUX A;  2ZRS A;  2AAO A;  5JJG A;  3AAK A;  1PUL A;  2WCE A;  1TNP A;  2M7N A;  4GPL B;  1TNX A;  1YUU A;  2JT3 A;  3CYZ A;  1XFZ O;  5AER A;  1BG1 A;  3I5I B;  1WLZ A;  1K9K A;  3CR4 X;  1SPY A;  2LVI A;  1REC A;  3DVJ A;  2HET A;  1UHK A;  3FE8 A;  3L47 A;  2NXQ A;  1S6I A;  1YX7 A;  2LV7 A;  2OPO A;  1S5G Y;  2L50 A;  3I5F B;  1CFF A;  1M46 A;  3M0W A;  1IH0 A;  2KBM A;  1BLQ A;  1XVJ A;  5AFP A;  2M8U A;  1H4B A;  3TS5 B;  1K93 D;  2E6W A;  3R1V A;  1QV1 A;  1CDP A;  1OMD A;  4C0J A;  2O60 A;  5HLO A;  1F71 A;  3CZ1 A;  5D3O A;  1S6C A;  1VRK A;  1N0Y A;  2M29 A;  3VRN A;  1CB1 A;  3ZWH A;  1CDL A;  3NHI A;  3EKJ A;  1HT9 A;  1QJT A;  2I18 A;  1QLK A;  2COL B;  1T14 A;  2BL0 B;  2JZI A;  2KOT A;  3UO9 A;  3BOW B;  2MLF C;  1KK8 B;  2MLE C;  1M45 A;  1B8C A;  1NUB A;  4MRY A;  2GTE A;  4Q04 A;  4HRG A;  2K7D A;  1IKU A;  1S1E A;  3BUN B;  3OBV A;  1L2O B;  3DF0 B;  2A4J A;  4OZD A;  1LA0 A;  2LVV A;  3O2P A;  3OB1 B;  3KF9 A;  1Z2C B;  1SCV A;  1C7V A;  2BE4 A;  1XFV O;  2GGM A;  1U5I B;  3OGN A;  2FCD A;  3QME A;  1PSB A;  3D77 A;  2EC6 B;  1UUS A;  2FOT A;  3LLE A;  3EVU A;  1CFD A;  3CS1 A;  1EG3 A;  2PAL A;  4BY5 A;  1PRW A;  2WC6 A;  2CCM A;  2KDH A;  2ZND A;  3CGA A;  1KK7 Z;  2AMI A;  3CZT X;  2JTT A;  3CTN A;  1Y6W A;  1DGU A;  1QVI Z;  5KU1 A;  1LIN A;  2L4I A;  2BKI B;  3N7H A;  1F4Q A;  1ODB A;  1ZFS A;  2F33 A;  2G9B A;  2WC5 A;  1K90 D;  1QX7 A;  1JC2 A;  3I5G B;  3L4L A;  3PM8 A;  2HQW A;  2WCJ A;  4PE4 A;  4OV2 A;  1FPW A;  1F54 A;  2H2K A;  4QJ4 B;  1QX2 A;  3EK8 A;  2MHH A;  4GUK A;  5HKY A;  1B7T Y;  4AOM A;  2M49 B;  1YUT A;  3EKH A;  3KO0 A;  3IQQ A;  3PN7 B;  2YGU A;  4QJ3 B;  1NCY A;  4I5J A;  4YI8 A;  3VGO A;  4CPV A;  3PSR A;  1YUR A;  4FTG A;  3LK1 A;  2PRU A;  4MLW A;  1KSM A;  3BUW B;  1SL7 A;  2BNX A;  3RLZ A;  1NCX A;  3DVE A;  1BOC A;  1LS8 A;  2LVJ A;  3D0Y A;  1TTX A;  1AJ5 A;  3SG7 A;  1MQ1 A;  2LP3 A;  1A03 A;  1QAS A;  4PHM A;  5PAL A;  1OE9 B;  4GBA A;  4M2O A;  1WY9 A;  1OOJ A;  1B4C A;  3SIA A;  4ETO A;  1SRA A;  1QAT A;  3D76 A;  4N1F A;  2NLN A;  2ISD A;  2MAZ A;  1YX8 A;  3CLN A;  5KSZ A;  5CSN A;  2OS8 C;  1CNP A;  1DQE A;  5CSI A;  1NX1 A;  1KK8 C;  1K9P A;  3OHM B;  1EL4 A;  1JWD A;  5FI6 A;  3B6X A;  1RJV A;  4TNC A;  4ORC B;  4FQT A;  5ER5 A;  3ZNI A;  2LLU A;  1BJF A;  2JT8 A;  2RGI A;  2KI6 C;  2ZRT A;  1SBJ A;  2JWW A;  3I5H B;  4YGC B;  2JC2 A;  3L4A A;  4N5X A;  3SG4 A;  1NPQ A;  1XA5 A;  1Q80 A;  1NCZ A;  3OX6 A;  2OTG B;  2LHI A;  3SIB A;  4FQO A;  2L2C A;  2WCF A;  1SY9 A;  5I8N A;  3GK1 A;  2K0J A;  3DYE A;  1DJX A;  1R6P A;  3KEV A;  3QRX A;  1AK8 A;  1V1G A;  3AKA A;  3O4X A;  1LA3 A;  1ZOT B;  4WQ2 A;  3AKB A;  4MN0 A;  3RM1 A;  1NX2 A;  4JPZ B;  5IBW A;  2M0R A;  4I5L B;  4IJ7 A;  1SR6 C;  4F0Z B;  4YGD B;  1UWO A;  1BOD A;  3WXA A;  1CMG A;  3DY9 A;  4I5N B;  1NX0 A;  1XFX O;  2CTN A;  2KFH A;  1EJ3 A;  2F3Z A;  5HKZ A;  3NSL A;  1J1D A;  1Y0V H;  2QDI A;  1TNQ A;  1B9A A;  1KFX S;  3A4U B;  2LMT A;  2L2E A;  3PM2 A;  2R2I A;  1Y1U A;  1CFC A;  2K2A A;  2EGD A;  1FF1 A;  1K8U A;  3PAL A;  2P6B B;  3FWB A;  3WHT B;  1QIW A;  1S26 D;  2F2P A;  1IGV A;  2PQL A;  3BOW A;  4GAO A;  4MBE A;  1QXP A;  2K7C A;  3GOF A;  2TN4 A;  1N2D A;  3NSO A;  1N65 A;  3SS5 A;  2KAX A;  2BBN A;  2CXJ A;  3R72 A;  4R1E A;  3WNX B;  3LL8 B;  3FE6 A;  3NSK A;  4A4C A;  5HL1 A;  1KFX L;  3CZ2 A;  3DF0 A;  5HYD A;  1KQM B;  1P28 A;  3BUM B;  5EL2 A;  1TN4 A;  2BE6 A;  1KFU S;  2JOJ A;  2L51 A;  1AJ4 A;  2MRD A;  3FE9 A;  1QWV A;  2KI4 C;  4JKT A;  4XJK B;  2M3W A;  1U5I A;  3BQ3 A;  1NX3 A;  3D78 A;  2VRG A;  1CLB A;  1UUR A;  4WQ3 A;  3R1P A;  3B86 A;  4MZK A;  1F55 A;  1G8I A;  1KWO C;  1ALV A;  2NZ0 A;  4INX A;  4XYN A;  1IJ6 A;  5HKW A;  2MA2 A;  2P71 A;  4PHK A;  1BT6 A;  2QEH A;  4CFQ A;  1SK6 D;  3VRP A;  1WDC B;  1CDN A;  1YRU B;  2DOQ A;  2K60 A;  4HRH A;  5DKN A;  5ER4 X;  5FI2 A;  1KFU L;  4ZCV A;  1X02 A;  5BPJ A;  1CM1 A;  1MF8 B;  1SYM A;  3DVM A;  5I2O A;  1DJI A;  1DEK A;  1QV0 A;  5DKQ A;  2Q91 A;  2D8N A;  4PE7 A;  2L98 A;  4PHN A;  3BJH A;  3EK7 A;  1CM4 A;  3RZS A;  1RFJ A;  4PT1 A;  2M97 A;  1IIO A;  4GNK B;  4F7F A;  4P5O E;  4C0L A;  1G33 A;  4M2Q A;  4P2Y B;  1F70 A;  4PAL A;  4ICB A;  1B8L A;  2K8M B;  1GJY A;  3HCM A;  3I5I C;  1IG5 A;  2ZN8 A;  1C3Y A;  1OMR A;  1UHI A;  3JTD B;  1DJY A;  4IL1 A;  3S0E A;  3CZ0 A;  2JXL A;  1CLL A;  4MZJ A;  1D1O A;  1XO5 A;  3D75 A;  3JVT B;  1GQM A;  2KBI A;  3TDZ A;  1FI5 A;  2ZFD A;  3IVT A;  1C7W A;  3C1V A;  2CNP A;  1F8H A;  4OR9 B;  3VRQ A;  4OVN F;  4HRE E;  1PK0 D;  2L0P A;  2M7L A;  1CMF A;  1J7O A;  5G08 A;  3I5F C;  1OZO A;  1A75 B;  3H4S E;  1YRT B;  3GK2 A;  1J7P A;  1NWD A;  3R1O A;  1JUO A;  5AXI A;  1BU3 A;  3E3R A;  1IJ5 A;  1S36 A;  1UHJ A;  3EVR A;  2KQ6 A;  1YUS A;  3PAT A;  4MZL A;  5CSF A;  5F6T A;  4M2P A;  3TS5 C;  5JOL A;  1RWY A;  1BMO A;  2K7B A;  3BUO B;  2JNF A;  1LVC D;  2JUL A;  2PMY A;  2E30 A;  3PJI A;  1CKK A;  1EG4 A;  1OQP A;  1W7J B;  2QEB A;  1GGW A;  2HPS A;  5KTY A;  2JPO A;  1G4Y R;  2B1U A;  5D69 A;  4GGF A;  1JF0 A;  2JT0 A;  2KFF A;  1DJG A;  1MR8 A;  3FIA A;  3K1E A;  4DIR A;  1WLM A;  1MXE A;  1JF2 A;  2BL0 C;  2KYF A;  2M9G A;  2WOR A;  1R2U A;  3PLF B;  3TUY B;  4N1G A;  4HSZ A;  4PE0 A;  1QTX A;  1NYA A;  1OW4 A;  1WDC C;  2BEC A;  2KNE A;  3EVV A;  1ZMZ A;  1L2O C;  2KLD A;  1PSR A;  2WOS A;  4WRI A;  4QJ5 B;  2HQ8 A;  5GQQ C;  1EH2 A;  1KSO A;  2KGB C;  1AUI B;  3IQO A;  1LKJ A;  1YTZ C;  3O4Y A;  1SMG A;  1AHR A;  1B47 A;  2K7O A;  1BR4 B;  2Y5I A;  2BCA A;  2MBX A;  2KYC A;  4AQJ A;  2EC6 C;  3OP0 A;  1C07 A;  3A8R A;  1CTR A;  3TZ1 A;  4NDD A;  1DF0 B;  1Z4H A;  1ZAC A;  3GK4 X;  1SL9 A;  4CLN A;  1B7T Z;  1CFP A;  2PYQ A;  2KGR A;  2P70 A;  1TCF A;  4YBH B;  4USL A;  1GM0 A;  4OCI A;  2Y1M A;  2WCL A;  2KFG A;  3FWC A;  4U8D A;  4L9M A;  1TRF A;  3ICB A;  1L7Z A;  4GFT A;  3BYA A;  1OSA A;  3I5G C;  1H8B A; 
#chains in the Genus database with same CATH homology
 5DKR A;  3SG5 A;  3DVK A;  2KSP A;  2QAC A;  2IS9 A;  1MWN A;  5TNC A;  3LCP C;  3O6B A;  2FCE A;  1E8A A;  3PN7 C;  3D10 A;  1B8R A;  2CBL A;  1TNW A;  2JPT A;  4PE1 A;  4XJK A;  4MRX A;  1YVH A;  2O5G A;  2CT9 A;  4CID A;  2LLT A;  1JBA A;  2GGZ A;  1DJH A;  2I2R E;  1RRO A;  1OZS A;  1YR5 A;  2KAV A;  2M1U A;  3CR5 X;  1IQ3 A;  1MXL C;  3EK4 A;  1HQV A;  3AAJ A;  2L4H A;  2LUC A;  1ALW A;  1KK7 Y;  2SAS A;  1XFU O;  1RTP 1;  1M63 B;  3TUY C;  1QVI Y;  4NDC A;  2AUC A;  2PSR A;  5J3X A;  1J55 A;  1DJW A;  2JQ6 A;  3OB2 B;  1WRZ A;  2I94 A;  2LM5 A;  1M31 A;  1SW8 A;  1QIV A;  1IQ5 A;  1WRL A;  3HX4 A;  4PDZ A;  3VRR A;  1SNL A;  4GGF C;  3I5H C;  3PFV A;  4DS7 A;  3DD4 A;  1XFY O;  4YI9 A;  3F45 A;  2WC8 A;  2KI6 D;  3CWG A;  2F3Y A;  2JRF A;  2OTG C;  1SL8 A;  1DGV A;  2V53 A;  4YRU A;  1GGZ A;  2JXC A;  5D7F A;  1K9U A;  2LHL A;  2LAP A;  2H61 C;  2OS8 B;  1MUX A;  2WCB A;  2Y4Q A;  1KCY A;  3KPX A;  3FS7 A;  3TDI A;  2SCP A;  1YVL A;  3BUX B;  4DCK A;  2LNK A;  1J7Q A;  1FW4 A;  2K61 A;  2LP2 A;  2GV5 A;  1BF5 A;  1K2H A;  1DJZ A;  1WRK A;  4I5K A;  1PAL A;  1A75 A;  1S5G Z;  2LMU A;  1SCM B;  2NCP A;  5K89 A;  1Y1A A;  2K2F A;  2LCP A;  2HF5 A;  3BXK A;  4GGN A;  4CFR A;  2BCX A;  3K21 A;  3WHU B;  4PHJ A;  4ZCU A;  1DMO A;  4NQG A;  2LAN A;  4A4B A;  1XK4 C;  1F4O A;  2Y1N A;  5AAN A;  1IRJ A;  5AEQ A;  1NSH A;  2L5X B;  4C0K A;  1A29 A;  1OMV A;  1V1F A;  3SJS A;  1ZUZ A;  1J1E A;  1NP8 A;  4YGA A;  4OKH A;  2G2B A;  2LLS A;  1DTL A;  1NIW A;  1XFW O;  2NCO A;  2F2O A;  1A4P A;  2ZNE A;  1J7R A;  2ZN9 A;  2KQY A;  1PVA A;  1SR6 B;  1TCO B;  4E68 A;  1JFJ A;  2BKH B;  1KQM C;  1Y1X A;  2F8P A;  1UP5 A;  2LMV A;  3IF7 A;  3VRO A;  1S3P A;  2Q4U A;  1KQV A;  3NSI A;  3SG2 A;  1AVS A;  2BCB A;  4DRW A;  1DT7 B;  5FYX A;  2WND A;  3LK0 A;  1QS7 A;  3NXA A;  4NDB A;  1DF0 A;  2KHN A;  1B1G A;  1TOP A;  4MSP A;  2I7A A;  1JFK A;  4DUQ A;  2H61 A;  2KAY A;  3MSE B;  2MJW B;  1M39 A;  1CDM A;  2PAS A;  1IWQ A;  3SG3 A;  1UHH A;  2JU0 A;  3CR2 A;  4BY4 A;  2JNX A;  4AQI A;  1K95 A;  3OX5 A;  5I2Q A;  1K96 A;  2LVK A;  1EXR A;  1UHN A;  4UPG A;  2BBM A;  2LE9 B;  1JSA A;  2M1K B;  2KI4 B;  2JTZ A;  1PVB A;  1FBV A;  1XK4 A;  1AP4 A;  2FJU B;  4YGB B;  1KWO B;  1DVI A;  3D0Y B;  1BR1 B;  1QX5 B;  3O78 A;  4JQ0 D;  4ORA B;  2LC5 A;  4ORB B;  3TDU A;  1RK9 A;  3SG6 A;  1SCM C;  1FI6 A;  1CLM A;  1SKT A;  4JWQ A;  4MVF A;  5I2L A;  4YGE B;  1A2X A;  1MHO A;  3JTD C;  4PCW A;  4MEW A;  5CPV A;  5CSJ A;  1XYD A;  2ZKM X;  1TIZ A;  3JVT C;  4D1E A;  5HLV A;  3KHE A;  2EHB A;  5B8I B;  1W7I B;  2PVB A;  1S6J A;  2QPT A;  1QLS A;  1K94 A;  1LXF C;  2LUX A;  2ZRS A;  2AAO A;  5JJG A;  3AAK A;  1PUL A;  2WCE A;  1TNP A;  2M7N A;  4GPL B;  1TNX A;  1YUU A;  2JT3 A;  1BG1 A;  1XFZ O;  5AER A;  3I5I B;  1WLZ A;  1K9K A;  3CR4 X;  1SPY A;  2LVI A;  1REC A;  3DVJ A;  2HET A;  1UHK A;  2NXQ A;  1S6I A;  1YX7 A;  2LV7 A;  2OPO A;  1S5G Y;  2L50 A;  3I5F B;  1CFF A;  1M46 A;  3M0W A;  1IH0 A;  2KBM A;  1BLQ A;  1XVJ A;  5AFP A;  2M8U A;  1H4B A;  3TS5 B;  1K93 D;  2E6W A;  1QV1 A;  1CDP A;  1OMD A;  4C0J A;  2O60 A;  5HLO A;  1F71 A;  1S6C A;  1VRK A;  1N0Y A;  2M29 A;  3VRN A;  1CB1 A;  3ZWH A;  1CDL A;  3EKJ A;  1HT9 A;  1QJT A;  2I18 A;  1QLK A;  2COL B;  2JZI A;  2BL0 B;  2KOT A;  3BOW B;  2MLF C;  1KK8 B;  2MLE C;  1M45 A;  1B8C A;  1NUB A;  4MRY A;  4Q04 A;  4HRG A;  2K7D A;  1IKU A;  1S1E A;  3BUN B;  1L2O B;  3DF0 B;  2A4J A;  1LA0 A;  2LVV A;  3O2P A;  3OB1 B;  3KF9 A;  1SCV A;  1C7V A;  2BE4 A;  1XFV O;  2GGM A;  1U5I B;  2FCD A;  1PSB A;  3LLE A;  2EC6 B;  1UUS A;  2FOT A;  3EVU A;  1CFD A;  3CS1 A;  1EG3 A;  2PAL A;  4BY5 A;  1PRW A;  2CCM A;  2KDH A;  2ZND A;  3CGA A;  1KK7 Z;  2AMI A;  3CZT X;  2JTT A;  3CTN A;  1Y6W A;  1DGU A;  1QVI Z;  5KU1 A;  1LIN A;  2L4I A;  2BKI B;  1F4Q A;  1ODB A;  1ZFS A;  2F33 A;  2G9B A;  1JC2 A;  1K90 D;  1QX7 A;  3I5G B;  3PM8 A;  2HQW A;  4PE4 A;  4OV2 A;  1FPW A;  1F54 A;  2H2K A;  4QJ4 B;  1QX2 A;  3EK8 A;  2MHH A;  4GUK A;  5HKY A;  1B7T Y;  4AOM A;  2M49 B;  1YUT A;  3EKH A;  3KO0 A;  3IQQ A;  3PN7 B;  4QJ3 B;  4YI8 A;  1NCY A;  4I5J A;  3VGO A;  4CPV A;  3PSR A;  1YUR A;  4FTG A;  3LK1 A;  2PRU A;  4MLW A;  1KSM A;  3BUW B;  1SL7 A;  3RLZ A;  1NCX A;  3DVE A;  1BOC A;  2LVJ A;  3D0Y A;  1TTX A;  1AJ5 A;  3SG7 A;  1MQ1 A;  2LP3 A;  1A03 A;  1QAS A;  4PHM A;  5PAL A;  1OE9 B;  4GBA A;  4M2O A;  1WY9 A;  1OOJ A;  1B4C A;  3SIA A;  4ETO A;  1SRA A;  1QAT A;  4N1F A;  2NLN A;  2ISD A;  2MAZ A;  1YX8 A;  3CLN A;  5KSZ A;  5CSN A;  2OS8 C;  1CNP A;  5CSI A;  1NX1 A;  1KK8 C;  1K9P A;  3OHM B;  1EL4 A;  1JWD A;  1RJV A;  4TNC A;  4ORC B;  3ZNI A;  2LLU A;  1BJF A;  2JT8 A;  2RGI A;  2KI6 C;  2ZRT A;  1SBJ A;  2JWW A;  3I5H B;  4YGC B;  2JC2 A;  3SG4 A;  4N5X A;  1NPQ A;  1XA5 A;  1Q80 A;  1NCZ A;  3OX6 A;  2OTG B;  2LHI A;  3SIB A;  4FQO A;  2WCF A;  5I8N A;  1SY9 A;  3GK1 A;  2K0J A;  1DJX A;  1R6P A;  3KEV A;  3QRX A;  1AK8 A;  1V1G A;  3AKA A;  1LA3 A;  1ZOT B;  4WQ2 A;  3AKB A;  4MN0 A;  3RM1 A;  1NX2 A;  4JPZ B;  5IBW A;  2M0R A;  4I5L B;  1SR6 C;  4F0Z B;  4YGD B;  1UWO A;  1BOD A;  3WXA A;  1CMG A;  4I5N B;  1NX0 A;  1XFX O;  2CTN A;  2KFH A;  1EJ3 A;  2F3Z A;  5HKZ A;  3NSL A;  1J1D A;  1Y0V H;  1TNQ A;  1B9A A;  1KFX S;  3A4U B;  2LMT A;  2L2E A;  2R2I A;  1Y1U A;  1CFC A;  2K2A A;  2EGD A;  1FF1 A;  1K8U A;  3PAL A;  2P6B B;  3FWB A;  3WHT B;  1QIW A;  1S26 D;  2F2P A;  1IGV A;  3BOW A;  4GAO A;  4MBE A;  1QXP A;  2K7C A;  3GOF A;  2TN4 A;  1N2D A;  3NSO A;  1N65 A;  2KAX A;  2BBN A;  2CXJ A;  4R1E A;  3WNX B;  3LL8 B;  3NSK A;  4A4C A;  1KFX L;  3DF0 A;  5HYD A;  1KQM B;  3BUM B;  1TN4 A;  2BE6 A;  1KFU S;  2JOJ A;  2L51 A;  1AJ4 A;  2MRD A;  5ER5 A;  4XJK B;  2KI4 C;  2M3W A;  1U5I A;  3BQ3 A;  1NX3 A;  2VRG A;  1CLB A;  1UUR A;  4WQ3 A;  1F55 A;  4MZK A;  1G8I A;  1KWO C;  1ALV A;  2NZ0 A;  4XYN A;  1IJ6 A;  5HKW A;  2MA2 A;  4PHK A;  1BT6 A;  4CFQ A;  1SK6 D;  3VRP A;  1WDC B;  1CDN A;  1YRU B;  2DOQ A;  4HRH A;  5ER4 X;  5DKN A;  1KFU L;  4ZCV A;  1X02 A;  5BPJ A;  1CM1 A;  1MF8 B;  1SYM A;  3DVM A;  5I2O A;  1DJI A;  1QV0 A;  5DKQ A;  2Q91 A;  2D8N A;  4PE7 A;  2L98 A;  4PHN A;  3EK7 A;  1CM4 A;  1RFJ A;  2M97 A;  4GNK B;  4P5O E;  4C0L A;  1G33 A;  4M2Q A;  4P2Y B;  1F70 A;  4PAL A;  4ICB A;  1B8L A;  2K8M B;  1GJY A;  3HCM A;  3I5I C;  1IG5 A;  2ZN8 A;  1OMR A;  1UHI A;  3JTD B;  1DJY A;  4IL1 A;  2JXL A;  1CLL A;  4MZJ A;  1D1O A;  1XO5 A;  3JVT B;  1GQM A;  2KBI A;  3TDZ A;  1FI5 A;  2ZFD A;  1C7W A;  3C1V A;  2CNP A;  1F8H A;  4OR9 B;  3VRQ A;  4OVN F;  4HRE E;  1PK0 D;  2L0P A;  2M7L A;  1CMF A;  1J7O A;  5G08 A;  3I5F C;  1OZO A;  1A75 B;  3H4S E;  1YRT B;  3GK2 A;  1J7P A;  1NWD A;  1JUO A;  5AXI A;  1BU3 A;  3E3R A;  1IJ5 A;  1S36 A;  1UHJ A;  3EVR A;  2KQ6 A;  1YUS A;  3PAT A;  4MZL A;  5CSF A;  5F6T A;  4M2P A;  3TS5 C;  5JOL A;  1RWY A;  1BMO A;  2K7B A;  3BUO B;  2JNF A;  1LVC D;  2JUL A;  2PMY A;  2E30 A;  1CKK A;  1EG4 A;  1OQP A;  1W7J B;  1GGW A;  2HPS A;  5KTY A;  1G4Y R;  2B1U A;  5D69 A;  4GGF A;  1JF0 A;  2JT0 A;  2KFF A;  1DJG A;  1MR8 A;  3FIA A;  4DIR A;  1WLM A;  1MXE A;  1JF2 A;  2BL0 C;  2KYF A;  2M9G A;  2WOR A;  1R2U A;  3PLF B;  3TUY B;  4N1G A;  4HSZ A;  4PE0 A;  1QTX A;  1NYA A;  2BEC A;  1WDC C;  2KNE A;  3EVV A;  1ZMZ A;  1L2O C;  1PSR A;  2WOS A;  4WRI A;  4QJ5 B;  2HQ8 A;  5GQQ C;  1EH2 A;  1KSO A;  2KGB C;  1AUI B;  3IQO A;  1LKJ A;  1YTZ C;  3O4Y A;  1SMG A;  1AHR A;  1B47 A;  2K7O A;  1BR4 B;  2Y5I A;  2BCA A;  2MBX A;  2KYC A;  4AQJ A;  2EC6 C;  3OP0 A;  1C07 A;  3A8R A;  1CTR A;  3TZ1 A;  4NDD A;  1DF0 B;  1ZAC A;  3GK4 X;  1SL9 A;  4CLN A;  1B7T Z;  1CFP A;  2KGR A;  4YBH B;  1TCF A;  4USL A;  4OCI A;  2Y1M A;  2KFG A;  3FWC A;  4U8D A;  4L9M A;  1TRF A;  3ICB A;  1L7Z A;  4GFT A;  3BYA A;  1OSA A;  3I5G C;  1H8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...