5D69A

Human calpain pef(s) with (2z,2z')-2,2'-disulfanediylbis(3-(6-iodoindol-3-yl)acrylic acid) bound
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
173
structure length
173
Chain Sequence
b'EEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calpain small subunit 1
publication title Conformationally restricted calpain inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 61
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5d69A00
1K2HA 1YX7A 2MAZA 5CSJA 4GGFC 1QV0A 4PHMA 4L9MA 3O2PA 4YI8A 3TUYB 3F45A 2JC2A 2WNDA 2BKHB 2ISDA 1XO5A 3TS5C 1A75B 4BY5A 2LVKA 1NX1A 2G9BA 3OB2B 2K7BA 3PALA 4YBHB 1TNWA 2D8NA 2TN4A 3EVVA 2KGRA 3CR5X 2LV7A 4PHKA 4C0JA 1F71A 1S6CA 3LK0A 3NSOA 1A03A 1M63B 2AAOA 3JTDC 1S5GY 1NWDA 1CMFA 3SJSA 1FF1A 1B9AA 3FS7A 2F2OA 1FI6A 1DTLA 1ALVA 1OZSA 3PSRA 5G08A 4A4BA 3RM1A 1C7WA 2OTGB 3SG6A 4XJKA 1NX3A 2KBIA 2K61A 1F4OA 5KTYA 1Y0VH 1GGWA 4ETOA 2MLEC 1S6JA 2LC5A 3IQOA 2NXQA 2LVJA 3NXAA 4ORAB 4YRUA 3E3RA 3AKBA 1QATA 4IL1A 5AFPA 3FWCA 1ALWA 3A8RA 2V53A 3AKAA 1JSAA 1OQPA 1OMDA 1QX7A 1KK7Z 1JBAA 1CDNA 2MA2A 1DT7B 1F54A 3PFVA 2CCMA 1WDCC 1CLMA 2JXLA 2JTTA 3OB1B 1QIWA 4A4CA 2FJUB 3O6BA 3SG2A 1CLBA 1XA5A 2JT0A 2MRDA 3DD4A 2F8PA 3DVKA 1EG3A 1PALA 4I5NB 4NDBA 1F8HA 2ZRSA 3K21A 2EC6C 5KSZA 5DKQA 1TNPA 1QTXA 2NCPA 5PALA 2OS8C 2E6WA 2ZFDA 1YRTB 1UUSA 1SYMA 2I18A 4DIRA 3ZNIA 2CBLA 2JXCA 4WQ3A 1WY9A 1MXLC 1CFCA 2G2BA 1VRKA 3OP0A 1KK7Y 1S3PA 1ZACA 2L50A 3PN7C 4HREE 3CWGA 4HRGA 2M1KB 1F4QA 2FOTA 3PM8A 4MEWA 4YGDB 5HLVA 2BCAA 2M0RA 1DGUA 2DOQA 4U8DA 1B1GA 1IGVA 3CLNA 2HPSA 2M7LA 1K94A 3D0YB 2JTZA 3EKJA 2A4JA 4GUKA 2LMTA 3VRNA 3WXAA 1CMGA 1ZMZA 3DVMA 2LUXA 2BCXA 1WLMA 3BQ3A 2WORA 4USLA 1CKKA 1TCOB 1C07A 3I5IB 1KFUS 2VRGA 4FQOA 4P2YB 1MHOA 5CSNA 2F33A 5ER4X 1FPWA 4TNCA 5AEQA 1YX8A 4PCWA 1QLSA 1EG4A 2LP3A 4D1EA 1UHKA 2SASA 1IRJA 1OMRA 2KNEA 5B8IB 4CIDA 3WNXB 2GV5A 3SG3A 2PMYA 3I5GB 3RLZA 1KQMB 2MLFC 5HKZA 3AAKA 2Y4QA 4YGCB 1B47A 1Q80A 3CR4X 1KQVA 2I94A 2QPTA 2WCFA 1U5IB 4XJKB 1N0YA 4CLNA 1YUTA 5AXIA 2LVIA 1UP5A 3IQQA 3TS5B 2JOJA 2IS9A 2K7OA 1CDMA 1WRKA 1QX2A 3HCMA 5HLOA 4F0ZB 1SW8A 1CLLA 2JULA 2Y1MA 2KFFA 3GK1A 1DVIA 2ZKMX 3BXKA 1NSHA 1OMVA 1XFVO 2O60A 3A4UB 1CM1A 5J3XA 3BYAA 2K0JA 5D7FA 1FBVA 3I5FC 4XYNA 1MXEA 1GJYA 1NYAA 3D10A 2O5GA 1SY9A 5F6TA 2L98A 2LAPA 2AUCA 1BR1B 2M1UA 2NLNA 1G33A 3M0WA 3KO0A 3BUNB 2BBMA 4YGBB 1B8LA 2L5XB 1J7PA 2Y1NA 2L4IA 3VRQA 1PSRA 2LLSA 3OHMB 4E68A 2KI6C 1F55A 1N2DA 1L2OB 2MHHA 4AQJA 1SPYA 2H61C 2R2IA 2M7NA 1S1EA 1DJYA 1M31A 2JT3A 1JFKA 4WRIA 3BOWA 2Y5IA 2F3ZA 1DGVA 2K7DA 4GAOA 2KI6D 3C1VA 1LVCD 1UURA 2JZIA 2ZN8A 1K8UA 3DF0A 3TDUA 1AHRA 1XFYO 1RTP1 1EJ3A 2BBNA 3LLEA 1IJ6A 1IKUA 3BUOB 2JU0A 1QVIZ 5AERA 2PASA 5ER5A 2L2EA 4DUQA 5BPJA 1SL9A 2E30A 2M29A 1L7ZA 1SMGA 3EVRA 1WDCB 5TNCA 4N1FA 2KHNA 3LCPC 4AOMA 3AAJA 4PE0A 2KDHA 2L0PA 1SL8A 4WQ2A 1XK4C 1XVJA 3IF7A 3JVTC 1ODBA 1IJ5A 1XFZO 2KI4B 2EC6B 2H61A 2JWWA 3EK7A 1SCMC 2OS8B 1C7VA 1CFFA 1KWOC 1YUUA 1DMOA 1BU3A 1K9UA 4PE4A 1JWDA 3SIAA 1HQVA 4YI9A 1QIVA 5AANA 4OV2A 5JJGA 1QVIY 1JUOA 2LP2A 1YRUB 3PN7B 4P5OE 1IG5A 1NCZA 3CTNA 3DVJA 5I2QA 3NSKA 1A29A 2F2PA 4ICBA 3KHEA 2I7AA 1PVBA 1KFUL 2HF5A 2I2RE 4MZKA 2HQ8A 1OE9B 3SG5A 3VRPA 2ZNEA 2LE9B 1KK8C 5HKWA 2JPTA 2BE6A 1K93D 2HETA 1ZUZA 1V1FA 1IWQA 4FTGA 1XK4A 4NDDA 1CDPA 2JQ6A 3CZTX 2KOTA 1K95A 4PALA 2WC8A 1IH0A 1MR8A 1EL4A 3BUWB 1M39A 1EXRA 5HYDA 3BUMB 2JT8A 1NX0A 2PRUA 4M2PA 2FCDA 2LVVA 4PHJA 1S36A 4NQGA 3OX5A 5I8NA 5HKYA 1SCVA 3FWBA 4OCIA 5I2LA 3WHUB 1CNPA 2M8UA 1Y6WA 1RK9A 1TIZA 1DJWA 5K89A 1JC2A 1BR4B 4C0LA 1MF8B 4M2QA 2K7CA 2ZNDA 5FYXA 3TDIA 1QASA 1W7JB 3CGAA 1MWNA 1SKTA 2KFHA 1J7RA 1XYDA 1DF0A 1RFJA 3BOWB 4CFRA 1NUBA 2ZN9A 1YR5A 1DJIA 1NX2A 4DRWA 4M2OA 4ZCVA 3PATA 4PDZA 4GPLB 1CFPA 1OSAA 2WCEA 1CM4A 1AJ5A 1YVLA 4MVFA 1LINA 3I5HC 4MSPA 2KQYA 1FI5A 1KFXS 3I5FB 2LCPA 4HSZA 1Y1UA 2BL0C 1BG1A 2L4HA 3ICBA 1KSMA 1QJTA 1SR6C 4BY4A 1AUIB 4C0KA 3KEVA 1HT9A 3SG7A 3JTDB 2COLB 2KBMA 2LHIA 4MRYA 1J7OA 4PE7A 4MBEA 2EGDA 2CXJA 3WHTB 4GBAA 4I5LB 2Q4UA 3LK1A 1GQMA 3VGOA 1LA0A 1XFXO 1A2XA 1CFDA 2LMVA 1GGZA 1IQ3A 4JQ0D 2LNKA 3CR2A 3D0YA 1YURA 1S26D 1TNXA 2AMIA 4AQIA 5IBWA 4ORBB 2M3WA 1JF0A 1SBJA 2SCPA 2KAXA 3EKHA 1DJZA 1JFJA 3ZWHA 4I5KA 3TUYC 3NSLA 1G8IA 1TNQA 4DCKA 5D69A 1K96A 1MQ1A 1J7QA 2PVBA 1BOCA 2KAVA 2LANA 2M49B 2KGBC 3HX4A 1Y1AA 2JRFA 1Y1XA 2LMUA 2KQ6A 3GK2A 1KCYA 1TTXA 1J1EA 3EK4A 3JVTB 4HRHA 2MJWB 1BT6A 1UHNA 1N65A 2Q91A 2CTNA 5CPVA 1SCMB 1K9PA 1KWOB 1DJGA 1NPQA 1DJXA 2KYCA 3EVUA 4GGFA 1PULA 1U5IA 2GGMA 2GGZA 3EK8A 2WCBA 1YUSA 1X02A 4ORCB 1L2OC 2WOSA 4OVNF 2LLUA 1CDLA 4OKHA 1R6PA 1J55A 2BE4A 1TRFA 2OTGC 1F70A 2MBXA 2KAYA 1V1GA 1B8RA 2HQWA 1KSOA 4PE1A 1YTZC 5GQQC 3SIBA 2LLTA 1ZFSA 4YGEB 1KK8B 2K2AA 1A75A 2K2FA 1K90D 1PSBA 4NDCA 1UWOA 2FCEA 4N5XA 1DF0B 1TCFA 4GGNA 2KFGA 1SNLA 4I5JA 2JNXA 4MRXA 1H8BA 2CT9A 3BUXB 2LUCA 2BECA 3DVEA 3TDZA 1RECA 2LM5A 3NSIA 5CSIA 3QRXA 2ZRTA 1M46A 2F3YA 2EHBA 2L51A 4N1GA 1BODA 1W7IB 4JWQA 1PK0D 1JF2A 5CSFA 1EH2A 1IQ5A 4PHNA 4UPGA 1NIWA 2KI4C 1PRWA 1B7TZ 5KU1A 2M9GA 1AJ4A 1RWYA 2PSRA 1B8CA 2LHLA 2PALA 3O78A 1QLKA 2H2KA 4ZCUA 2CNPA 2RGIA 1AP4A 4MN0A 1RJVA 1TOPA 3GK4X 4R1EA 1CTRA 1D1OA 1KFXL 2M97A 2KSPA 1MUXA 1YVHA 1ZOTB 3CS1A 1SRAA 3KPXA 1WRLA 1QV1A 4GFTA 1J1DA 1BLQA 5JOLA 4DS7A 1H4BA 1CB1A 3SG4A 1FW4A 3TZ1A 1LXFC 4OR9B 1M45A 1NCYA 4QJ5B 3O4YA 3GOFA 3KF9A 3I5HB 1XFWO 4JPZB 3VRRA 1S6IA 2BL0B 2JNFA 1BMOA 4MLWA 1B7TY 1DJHA 4Q04A 4YGAA 1RROA 5DKNA 4CFQA 1XFUO 3LL8B 1TN4A 1E8AA 3DF0B 1SR6B 3VROA 3OX6A 1NP8A 1SK6D 1SL7A 1AK8A 2P6BB 4MZLA 1QX5B 1A4PA 5I2OA 1UHIA 1BF5A 1OZOA 1UHJA 1NCXA 1WLZA 2QACA 3I5IC 3FIAA 2NZ0A 1UHHA 1WRZA 1AVSA 3MSEB 4GNKB 2K8MB 4QJ3B 1K9KA 1BJFA 1PVAA 2B1UA 1B4CA 1OOJA 2BKIB 1LA3A 3H4SE 1G4YR 2OPOA 1QS7A 5DKRA 1R2UA 2NCOA 1S5GZ 2KYFA 4QJ4B 3I5GC 1LKJA 1QXPA 1KQMC 3PLFB 4CPVA 2BCBA 4MZJA
chains in the Genus database with same CATH superfamily
1K2HA 1YX7A 2MAZA 5CSJA 4GGFC 1QV0A 4PHMA 4L9MA 3O2PA 4YI8A 3TUYB 3F45A 2JC2A 2WCMA 2WNDA 2BKHB 2ISDA 1XO5A 3TS5C 1A75B 4BY5A 2LVKA 1NX1A 2G9BA 3OB2B 2K7BA 3CYZA 3PALA 4YBHB 1TNWA 2D8NA 2TN4A 2QDIA 3EVVA 2KGRA 3CR5X 2LV7A 1QWVA 4PHKA 4C0JA 1F71A 1S6CA 3LK0A 3NSOA 1A03A 1M63B 1DQEA 2AAOA 3JTDC 1XFRA 1S5GY 1NWDA 1CMFA 3SJSA 1FF1A 1B9AA 3FS7A 2F2OA 1FI6A 1DTLA 2KPHA 1ALVA 1OZSA 3PSRA 5G08A 4A4BA 3RM1A 1C7WA 2OTGB 1DELA 3S0BA 3SG6A 4XJKA 1NX3A 2KBIA 2K61A 3EG5B 1F4OA 5KTYA 1Y0VH 1GGWA 4ETOA 2MLEC 1S6JA 2LC5A 3IQOA 2NXQA 2LVJA 3NXAA 4ORAB 4YRUA 2QEVA 3E3RA 3AKBA 1QATA 4IL1A 5AFPA 2P71A 3CZ0A 3FWCA 1ALWA 1GM0A 3A8RA 2V53A 3AKAA 1P28A 3R1VA 1OQPA 1OMDA 1QX7A 1JSAA 1KK7Z 1JBAA 1CDNA 2MA2A 1DT7B 1F54A 3PFVA 2CCMA 1WDCC 1CLMA 2JXLA 2JTTA 3OB1B 1QIWA 3D75A 2FJUB 4A4CA 3O6BA 3SG2A 2K60A 1CLBA 1XA5A 2JT0A 2MRDA 3DD4A 2F8PA 3DVKA 1EG3A 1OOIX 1PALA 4I5NB 3CZ2A 3B7AA 4NDBA 3DYEA 1F8HA 2ZRSA 3K21A 2EC6C 5KSZA 3BFAA 5DKQA 1TNPA 1QTXA 2NCPA 3NHTA 2OS8C 2E6WA 5PALA 2ZFDA 1YRTB 1UUSA 1SYMA 2I18A 4DIRA 3ZNIA 2CBLA 2JXCA 4WQ3A 1WY9A 1MXLC 1CFCA 2G2BA 1VRKA 3OP0A 1KK7Y 1S3PA 1ZACA 2L50A 3FE8A 3PN7C 3CWGA 4HRGA 4HREE 2M1KB 1F4QA 2FOTA 2KLEA 3PM8A 4MEWA 4YGDB 5HLVA 2BCAA 2M0RA 1DGUA 2DOQA 4U8DA 1B1GA 1IGVA 3CLNA 4INXA 2HPSA 2M7LA 1K94A 3D0YB 2JTZA 3EKJA 2A4JA 4GUKA 2LMTA 3VRNA 3WXAA 1CMGA 1ZMZA 3DVMA 2LUXA 2BCXA 1WLMA 2H8VA 3BQ3A 2WORA 4USLA 1CKKA 1TCOB 1C07A 3I5IB 1KFUS 2VRGA 4FQOA 4P2YB 1MHOA 5CSNA 2F33A 3DY9A 5ER4X 1FPWA 4TNCA 1SSEB 5AEQA 1YX8A 4PCWA 1QLSA 1EG4A 2LP3A 4D1EA 1UHKA 2SASA 1IRJA 1OMRA 3QMEA 2KNEA 5B8IB 1IIOA 4CIDA 3WNXB 2GV5A 3SG3A 2PMYA 3I5GB 3RLZA 1KQMB 2MLFC 5HKZA 3AAKA 2Y4QA 4YGCB 2WCJA 3B87A 1B47A 1Q80A 3CR4X 1KQVA 2I94A 2QPTA 2WCFA 1U5IB 4XJKB 1N0YA 4CLNA 1YUTA 5AXIA 2QEHA 3IVTA 2LVIA 1UP5A 3IQQA 3TS5B 2JOJA 2IS9A 2K7OA 1CDMA 2ERBA 1WRKA 1QX2A 3HCMA 5HLOA 3FE9A 4F0ZB 1SW8A 1CLLA 2JULA 2Y1MA 3L47A 2KFFA 3GK1A 1DVIA 2ZKMX 3BXKA 1NSHA 1OMVA 1XFVO 2O60A 3A4UB 1CM1A 2WCKA 5J3XA 3BYAA 1Z4HA 2K0JA 5D7FA 1FBVA 3I5FC 4XYNA 3R1OA 1MXEA 1GJYA 1NYAA 3D10A 2O5GA 1SY9A 5F6TA 2L98A 2LAPA 1OOHA 2AUCA 1BR1B 2M1UA 2WC5A 3Q8IA 2NLNA 1G33A 3M0WA 3KO0A 3BUNB 2BBMA 3O4XA 4YGBB 1B8LA 2L5XB 1ORGA 1J7PA 2Y1NA 2L4IA 3VRQA 1PSRA 2LLSA 3OHMB 4E68A 2KI6C 1F55A 1N2DA 2L5YA 1L2OB 2MHHA 4AQJA 1SPYA 2H61C 2R2IA 2M7NA 1S1EA 1DJYA 1M31A 2JT3A 1JFKA 4WRIA 3BOWA 2Y5IA 2F3ZA 1DGVA 1C3ZA 2K7DA 4GAOA 2KI6D 3C1VA 1LVCD 1UURA 3SS3A 2JZIA 2P70A 2ZN8A 1K8UA 3DF0A 3TDUA 1AHRA 1XFYO 5D3OA 1RTP1 1EJ3A 2BBNA 3B88A 1IJ6A 3LLEA 1IKUA 5EL2A 3BUOB 2JU0A 1QVIZ 5AERA 2PASA 5ER5A 2L2EA 4DUQA 5BPJA 1SL9A 2E30A 2M29A 1L7ZA 1SMGA 3EVRA 1WDCB 5TNCA 4N1FA 2KHNA 3LCPC 4AOMA 3AAJA 4PE0A 2KDHA 2L0PA 1SL8A 4WQ2A 1XK4C 3UNWA 1XVJA 3IF7A 3JVTC 3V2LA 1ODBA 1IJ5A 1XFZO 2KI4B 2EC6B 2H61A 2JWWA 3CDNA 1DC1A 3EK7A 1SCMC 2OS8B 1C7VA 1CFFA 1KWOC 1YUUA 1DMOA 1BU3A 1K9UA 4PE4A 1JWDA 3SIAA 3UO9A 1HQVA 4JKTA 4YI9A 3VB1A 1QIVA 5AANA 4OV2A 5JJGA 1QVIY 1JUOA 2LP2A 1YRUB 3PN7B 4P5OE 1IG5A 2GTEA 1NCZA 3CTNA 3DVJA 5I2QA 3NSKA 1A29A 4IJ7A 2F2PA 4ICBA 4OZDA 4FQTA 3KHEA 2I7AA 1PVBA 1KFUL 2HF5A 2I2RE 3R72A 2HQ8A 1OE9B 4MZKA 3SG5A 3VRPA 2ZNEA 2LE9B 1KK8C 5HKWA 2JPTA 2BE6A 3D76A 1K93D 2HETA 1ZUZA 1V1FA 1IWQA 2WCLA 4FTGA 1XK4A 4NDDA 1CDPA 2JQ6A 3CZTX 2KOTA 1K95A 4PALA 2WC8A 1IH0A 1MR8A 1EL4A 3BUWB 3DZTA 1M39A 1EXRA 5HYDA 3BUMB 2JT8A 1NX0A 2PRUA 4M2PA 2FCDA 2LVVA 4PHJA 1S36A 3K1EA 3OX5A 4NQGA 5I8NA 5HKYA 1SCVA 3FWBA 4OCIA 3S0GA 5I2LA 3WHUB 1CNPA 2M8UA 1Y6WA 1RK9A 3BJHA 1TIZA 1DJWA 3R1PA 5K89A 1JC2A 1BR4B 4C0LA 1MF8B 4M2QA 2K7CA 2ZNDA 5FYXA 3L4LA 3TDIA 1QASA 3OGNA 1W7JB 3VROA 3CGAA 2L2CA 1MWNA 1SKTA 3D73A 2KFHA 1OW4A 1J7RA 3B6XA 1XYDA 1DF0A 1RFJA 3BOWB 4CFRA 1NUBA 2ZN9A 1YR5A 1DJIA 1NX2A 4DRWA 4M2OA 5I94A 2BNXA 3D78A 3DXLA 4ZCVA 3PATA 4PDZA 4GPLB 1CFPA 1OSAA 2PQLA 2WCEA 1CM4A 1AJ5A 1YVLA 3D74A 1LINA 3I5HC 4MSPA 2KQYA 1TUZA 4MVFA 5DICA 1FI5A 1KFXS 3I5FB 2LCPA 4HSZA 1Y1UA 2BL0C 1BG1A 2L4HA 3ICBA 1KSMA 1QJTA 1SR6C 3S0FA 4BY4A 1AUIB 4C0KA 3KEVA 1HT9A 3SG7A 3JTDB 2COLB 2KBMA 2LHIA 4MRYA 1J7OA 4PE7A 4MBEA 2EGDA 2CXJA 3WHTB 4GBAA 4I5LB 2Q4UA 1OOGA 1GQMA 3LK1A 3VGOA 1LA0A 1XFXO 1A2XA 1CFDA 2LMVA 1GGZA 1IQ3A 4JQ0D 2LNKA 3CR2A 3D0YA 4KYNA 1YURA 1S26D 1TNXA 2AMIA 4AQIA 5IBWA 4ORBB 2M3WA 1JF0A 1SBJA 2SCPA 2KAXA 3EKHA 1DJZA 1JFJA 3ZWHA 4I5KA 3TUYC 3L4AA 3NSLA 1G8IA 1TNQA 4DCKA 5D69A 1K96A 1BOCA 1MQ1A 1J7QA 1OOFA 2PVBA 2KAVA 2LANA 2M49B 2KGBC 3HX4A 1Y1AA 2JRFA 1Y1XA 2LMUA 2KQ6A 3GK2A 1Z2CB 3OBVA 1KCYA 1TTXA 1J1EA 3EK4A 3JVTB 4HRHA 2MJWB 1BT6A 1TWOA 1N65A 1UHNA 2CTNA 2Q91A 5CPVA 1SCMB 1K9PA 1KWOB 1DJGA 1NPQA 1DJXA 2KYCA 3EVUA 4GGFA 1PULA 1U5IA 2GGMA 2GGZA 3EK8A 2WCBA 3NGVA 1YUSA 1X02A 3BFBA 1L2OC 4ORCB 2WOSA 2YGUA 3BFHA 4OVNF 2LLUA 3SS4A 1CDLA 4PT1A 4OKHA 3NHIA 1R6PA 1J55A 2BE4A 1TRFA 2OTGC 1F70A 2MBXA 3CABA 2KAYA 4F7FA 1V1GA 1B8RA 2HQWA 1KSOA 4PE1A 1YTZC 5GQQC 3SIBA 2LLTA 1ZFSA 4YGEB 3S0EA 1KK8B 2K2AA 2JPOA 1A75A 2K2FA 1K90D 1PSBA 4NDCA 1UWOA 2FCEA 4N5XA 1DF0B 1TCFA 4GGNA 2KFGA 1SNLA 4I5JA 2JNXA 1LS8A 4MRXA 1H8BA 2CT9A 3BUXB 3PJIA 2LUCA 2BECA 3DVEA 3TDZA 1RECA 3RZSA 2LM5A 3NSIA 5CSIA 3QRXA 2ZRTA 1M46A 2F3YA 3D77A 2EHBA 2L51A 4N1GA 1BODA 1W7IB 4JWQA 1PK0D 1JF2A 5CSFA 1EH2A 2BAPA 1IQ5A 4PHNA 4UPGA 5FI6A 2WCHA 1NIWA 2KI4C 1PRWA 4JD9A 5FI7A 1B7TZ 5KU1A 1C3YA 2M9GA 1AJ4A 1RWYA 2PSRA 1B8CA 2LHLA 2PALA 3O78A 1QLKA 2H2KA 4ZCUA 2CNPA 2RGIA 2KLDA 1AP4A 4MN0A 1RJVA 1TOPA 1W9ZA 3GK4X 4R1EA 1CTRA 1D1OA 1KFXL 2M97A 2KSPA 1MUXA 1YVHA 1ZOTB 3CS1A 3PM2A 1SRAA 3KPXA 1WRLA 1QV1A 1T14A 1J1DA 4GFTA 1BLQA 5JOLA 4DS7A 1H4BA 1CB1A 3SG4A 1FW4A 3TZ1A 1LXFC 4OR9B 1M45A 1NCYA 2FJYA 3O4YA 3GOFA 3KF9A 3I5HB 2QEOA 4QJ5B 1XFWO 4JPZB 3VRRA 3CZ1A 2QEBA 1S6IA 2BL0B 2JNFA 5FI2A 1BMOA 4MLWA 1B7TY 1DJHA 1TUJA 4Q04A 4YGAA 1RROA 5DKNA 2PYQA 4CFQA 1XFUO 3S0DA 3LL8B 1TN4A 1E8AA 3DF0B 1SR6B 2WC6A 3OX6A 1DEKA 1NP8A 1SK6D 1SL7A 3FE6A 3SS5A 1AK8A 2P6BB 4MZLA 1QX5B 1A4PA 3S0AA 5I2OA 1UHIA 1BF5A 1OZOA 1UHJA 1NCXA 1WLZA 2QACA 3I5IC 3FIAA 2NZ0A 1UHHA 1WRZA 1AVSA 3MSEB 4GNKB 5HL1A 2K8MB 4QJ3B 1K9KA 1BJFA 1PVAA 2B1UA 3B86A 1B4CA 1OOJA 2BKIB 1LA3A 3H4SE 1G4YR 2OPOA 1QS7A 5DKRA 1R2UA 2NCOA 1S5GZ 2KYFA 4QJ4B 3I5GC 4INWA 1LKJA 1QXPA 1KQMC 3PLFB 3N7HA 4CPVA 2BCBA 4MZJA
chains in the Genus database with same CATH topology
1K2HA 1YX7A 2MAZA 5CSJA 4GGFC 1QV0A 4PHMA 4L9MA 3O2PA 4YI8A 3TUYB 3F45A 2JC2A 2WNDA 2BKHB 2ISDA 1XO5A 3TS5C 1A75B 4BY5A 2LVKA 1NX1A 2G9BA 3OB2B 2K7BA 3PALA 4YBHB 1TNWA 2D8NA 2TN4A 3EVVA 2KGRA 3CR5X 2LV7A 4PHKA 4C0JA 1F71A 1S6CA 3LK0A 3NSOA 1A03A 1M63B 2AAOA 3JTDC 1S5GY 1NWDA 1CMFA 3SJSA 1FF1A 1B9AA 3FS7A 2F2OA 1FI6A 1DTLA 1ALVA 1OZSA 3PSRA 5G08A 4A4BA 3RM1A 1C7WA 2OTGB 3SG6A 4XJKA 1NX3A 2KBIA 2K61A 1F4OA 5KTYA 1Y0VH 1GGWA 4ETOA 2MLEC 1S6JA 2LC5A 3IQOA 2NXQA 2LVJA 3NXAA 4ORAB 4YRUA 3E3RA 3AKBA 1QATA 4IL1A 5AFPA 3FWCA 1ALWA 3A8RA 2V53A 3AKAA 1JSAA 1OQPA 1OMDA 1QX7A 1KK7Z 1JBAA 1CDNA 2MA2A 1DT7B 1F54A 3PFVA 2CCMA 1WDCC 1CLMA 2JXLA 2JTTA 3OB1B 1QIWA 4A4CA 2FJUB 3O6BA 3SG2A 1CLBA 1XA5A 2JT0A 2MRDA 3DD4A 2F8PA 3DVKA 1EG3A 1PALA 4I5NB 4NDBA 1F8HA 2ZRSA 3K21A 2EC6C 5KSZA 5DKQA 1TNPA 1QTXA 2NCPA 5PALA 2OS8C 2E6WA 2ZFDA 1YRTB 1UUSA 1SYMA 2I18A 4DIRA 3ZNIA 2CBLA 2JXCA 4WQ3A 1WY9A 1MXLC 1CFCA 2G2BA 1VRKA 3OP0A 1KK7Y 1S3PA 1ZACA 2L50A 3PN7C 4HREE 3CWGA 4HRGA 2M1KB 1F4QA 2FOTA 3PM8A 4MEWA 4YGDB 5HLVA 2BCAA 2M0RA 1DGUA 2DOQA 4U8DA 1B1GA 1IGVA 3CLNA 2HPSA 2M7LA 1K94A 3D0YB 2JTZA 3EKJA 2A4JA 4GUKA 2LMTA 3VRNA 3WXAA 1CMGA 1ZMZA 3DVMA 2LUXA 2BCXA 1WLMA 3BQ3A 2WORA 4USLA 1CKKA 1TCOB 1C07A 3I5IB 1KFUS 2VRGA 4FQOA 4P2YB 1MHOA 5CSNA 2F33A 5ER4X 1FPWA 4TNCA 5AEQA 1YX8A 4PCWA 1QLSA 1EG4A 2LP3A 4D1EA 1UHKA 2SASA 1IRJA 1OMRA 2KNEA 5B8IB 4CIDA 3WNXB 2GV5A 3SG3A 2PMYA 3I5GB 3RLZA 1KQMB 2MLFC 5HKZA 3AAKA 2Y4QA 4YGCB 1B47A 1Q80A 3CR4X 1KQVA 2I94A 2QPTA 2WCFA 1U5IB 4XJKB 1N0YA 4CLNA 1YUTA 5AXIA 2LVIA 1UP5A 3IQQA 3TS5B 2JOJA 2IS9A 2K7OA 1CDMA 1WRKA 1QX2A 3HCMA 5HLOA 4F0ZB 1SW8A 1CLLA 2JULA 2Y1MA 2KFFA 3GK1A 1DVIA 2ZKMX 3BXKA 1NSHA 1OMVA 1XFVO 2O60A 3A4UB 1CM1A 5J3XA 3BYAA 2K0JA 5D7FA 1FBVA 3I5FC 4XYNA 1MXEA 1GJYA 1NYAA 3D10A 2O5GA 1SY9A 5F6TA 2L98A 2LAPA 2AUCA 1BR1B 2M1UA 2NLNA 1G33A 3M0WA 3KO0A 3BUNB 2BBMA 4YGBB 1B8LA 2L5XB 1J7PA 2Y1NA 2L4IA 3VRQA 1PSRA 2LLSA 3OHMB 4E68A 2KI6C 1F55A 1N2DA 1L2OB 2MHHA 4AQJA 1SPYA 2H61C 2R2IA 2M7NA 1S1EA 1DJYA 1M31A 2JT3A 1JFKA 4WRIA 3BOWA 2Y5IA 2F3ZA 1DGVA 2K7DA 4GAOA 2KI6D 3C1VA 1LVCD 1UURA 2JZIA 2ZN8A 1K8UA 3DF0A 3TDUA 1AHRA 1XFYO 1RTP1 1EJ3A 2BBNA 3LLEA 1IJ6A 1IKUA 3BUOB 2JU0A 1QVIZ 5AERA 2PASA 5ER5A 2L2EA 4DUQA 5BPJA 1SL9A 2E30A 2M29A 1L7ZA 1SMGA 3EVRA 1WDCB 5TNCA 4N1FA 2KHNA 3LCPC 4AOMA 3AAJA 4PE0A 2KDHA 2L0PA 1SL8A 4WQ2A 1XK4C 1XVJA 3IF7A 3JVTC 1ODBA 1IJ5A 1XFZO 2KI4B 2EC6B 2H61A 2JWWA 3EK7A 1SCMC 2OS8B 1C7VA 1CFFA 1KWOC 1YUUA 1DMOA 1BU3A 1K9UA 4PE4A 1JWDA 3SIAA 1HQVA 4YI9A 1QIVA 5AANA 4OV2A 5JJGA 1QVIY 1JUOA 2LP2A 1YRUB 3PN7B 4P5OE 1IG5A 1NCZA 3CTNA 3DVJA 5I2QA 3NSKA 1A29A 2F2PA 4ICBA 3KHEA 2I7AA 1PVBA 1KFUL 2HF5A 2I2RE 4MZKA 2HQ8A 1OE9B 3SG5A 3VRPA 2ZNEA 2LE9B 1KK8C 5HKWA 2JPTA 2BE6A 1K93D 2HETA 1ZUZA 1V1FA 1IWQA 4FTGA 1XK4A 4NDDA 1CDPA 2JQ6A 3CZTX 2KOTA 1K95A 4PALA 2WC8A 1IH0A 1MR8A 1EL4A 3BUWB 1M39A 1EXRA 5HYDA 3BUMB 2JT8A 1NX0A 2PRUA 4M2PA 2FCDA 2LVVA 4PHJA 1S36A 4NQGA 3OX5A 5I8NA 5HKYA 1SCVA 3FWBA 4OCIA 5I2LA 3WHUB 1CNPA 2M8UA 1Y6WA 1RK9A 1TIZA 1DJWA 5K89A 1JC2A 1BR4B 4C0LA 1MF8B 4M2QA 2K7CA 2ZNDA 5FYXA 3TDIA 1QASA 1W7JB 3CGAA 1MWNA 1SKTA 2KFHA 1J7RA 1XYDA 1DF0A 1RFJA 3BOWB 4CFRA 1NUBA 2ZN9A 1YR5A 1DJIA 1NX2A 4DRWA 4M2OA 4ZCVA 3PATA 4PDZA 4GPLB 1CFPA 1OSAA 2WCEA 1CM4A 1AJ5A 1YVLA 4MVFA 1LINA 3I5HC 4MSPA 2KQYA 1FI5A 1KFXS 3I5FB 2LCPA 4HSZA 1Y1UA 2BL0C 1BG1A 2L4HA 3ICBA 1KSMA 1QJTA 1SR6C 4BY4A 1AUIB 4C0KA 3KEVA 1HT9A 3SG7A 3JTDB 2COLB 2KBMA 2LHIA 4MRYA 1J7OA 4PE7A 4MBEA 2EGDA 2CXJA 3WHTB 4GBAA 4I5LB 2Q4UA 3LK1A 1GQMA 3VGOA 1LA0A 1XFXO 1A2XA 1CFDA 2LMVA 1GGZA 1IQ3A 4JQ0D 2LNKA 3CR2A 3D0YA 1YURA 1S26D 1TNXA 2AMIA 4AQIA 5IBWA 4ORBB 2M3WA 1JF0A 1SBJA 2SCPA 2KAXA 3EKHA 1DJZA 1JFJA 3ZWHA 4I5KA 3TUYC 3NSLA 1G8IA 1TNQA 4DCKA 5D69A 1K96A 1MQ1A 1J7QA 2PVBA 1BOCA 2KAVA 2LANA 2M49B 2KGBC 3HX4A 1Y1AA 2JRFA 1Y1XA 2LMUA 2KQ6A 3GK2A 1KCYA 1TTXA 1J1EA 3EK4A 3JVTB 4HRHA 2MJWB 1BT6A 1UHNA 1N65A 2Q91A 2CTNA 5CPVA 1SCMB 1K9PA 1KWOB 1DJGA 1NPQA 1DJXA 2KYCA 3EVUA 4GGFA 1PULA 1U5IA 2GGMA 2GGZA 3EK8A 2WCBA 1YUSA 1X02A 4ORCB 1L2OC 2WOSA 4OVNF 2LLUA 1CDLA 4OKHA 1R6PA 1J55A 2BE4A 1TRFA 2OTGC 1F70A 2MBXA 2KAYA 1V1GA 1B8RA 2HQWA 1KSOA 4PE1A 1YTZC 5GQQC 3SIBA 2LLTA 1ZFSA 4YGEB 1KK8B 2K2AA 1A75A 2K2FA 1K90D 1PSBA 4NDCA 1UWOA 2FCEA 4N5XA 1DF0B 1TCFA 4GGNA 2KFGA 1SNLA 4I5JA 2JNXA 4MRXA 1H8BA 2CT9A 3BUXB 2LUCA 2BECA 3DVEA 3TDZA 1RECA 2LM5A 3NSIA 5CSIA 3QRXA 2ZRTA 1M46A 2F3YA 2EHBA 2L51A 4N1GA 1BODA 1W7IB 4JWQA 1PK0D 1JF2A 5CSFA 1EH2A 1IQ5A 4PHNA 4UPGA 1NIWA 2KI4C 1PRWA 1B7TZ 5KU1A 2M9GA 1AJ4A 1RWYA 2PSRA 1B8CA 2LHLA 2PALA 3O78A 1QLKA 2H2KA 4ZCUA 2CNPA 2RGIA 1AP4A 4MN0A 1RJVA 1TOPA 3GK4X 4R1EA 1CTRA 1D1OA 1KFXL 2M97A 2KSPA 1MUXA 1YVHA 1ZOTB 3CS1A 1SRAA 3KPXA 1WRLA 1QV1A 4GFTA 1J1DA 1BLQA 5JOLA 4DS7A 1H4BA 1CB1A 3SG4A 1FW4A 3TZ1A 1LXFC 4OR9B 1M45A 1NCYA 4QJ5B 3O4YA 3GOFA 3KF9A 3I5HB 1XFWO 4JPZB 3VRRA 1S6IA 2BL0B 2JNFA 1BMOA 4MLWA 1B7TY 1DJHA 4Q04A 4YGAA 1RROA 5DKNA 4CFQA 1XFUO 3LL8B 1TN4A 1E8AA 3DF0B 1SR6B 3VROA 3OX6A 1NP8A 1SK6D 1SL7A 1AK8A 2P6BB 4MZLA 1QX5B 1A4PA 5I2OA 1UHIA 1BF5A 1OZOA 1UHJA 1NCXA 1WLZA 2QACA 3I5IC 3FIAA 2NZ0A 1UHHA 1WRZA 1AVSA 3MSEB 4GNKB 2K8MB 4QJ3B 1K9KA 1BJFA 1PVAA 2B1UA 1B4CA 1OOJA 2BKIB 1LA3A 3H4SE 1G4YR 2OPOA 1QS7A 5DKRA 1R2UA 2NCOA 1S5GZ 2KYFA 4QJ4B 3I5GC 1LKJA 1QXPA 1KQMC 3PLFB 4CPVA 2BCBA 4MZJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K2H A;  1YX7 A;  2MAZ A;  5CSJ A;  4GGF C;  1QV0 A;  4PHM A;  4L9M A;  3O2P A;  4YI8 A;  3TUY B;  3F45 A;  2JC2 A;  2WND A;  2BKH B;  2ISD A;  1XO5 A;  3TS5 C;  1A75 B;  4BY5 A;  2LVK A;  1NX1 A;  2G9B A;  3OB2 B;  2K7B A;  3PAL A;  4YBH B;  1TNW A;  2D8N A;  2TN4 A;  3EVV A;  2KGR A;  3CR5 X;  2LV7 A;  4PHK A;  4C0J A;  1F71 A;  1S6C A;  3LK0 A;  3NSO A;  1A03 A;  1M63 B;  2AAO A;  3JTD C;  1S5G Y;  1NWD A;  1CMF A;  3SJS A;  1FF1 A;  1B9A A;  3FS7 A;  2F2O A;  1FI6 A;  1DTL A;  1ALV A;  1OZS A;  3PSR A;  5G08 A;  4A4B A;  3RM1 A;  1C7W A;  2OTG B;  3SG6 A;  4XJK A;  1NX3 A;  2KBI A;  2K61 A;  1F4O A;  5KTY A;  1Y0V H;  1GGW A;  4ETO A;  2MLE C;  1S6J A;  2LC5 A;  3IQO A;  2NXQ A;  2LVJ A;  3NXA A;  4ORA B;  4YRU A;  3E3R A;  3AKB A;  1QAT A;  4IL1 A;  5AFP A;  3FWC A;  1ALW A;  3A8R A;  2V53 A;  3AKA A;  1JSA A;  1OQP A;  1OMD A;  1QX7 A;  1KK7 Z;  1JBA A;  1CDN A;  2MA2 A;  1DT7 B;  1F54 A;  3PFV A;  2CCM A;  1WDC C;  1CLM A;  2JXL A;  2JTT A;  3OB1 B;  1QIW A;  4A4C A;  2FJU B;  3O6B A;  3SG2 A;  1CLB A;  1XA5 A;  2JT0 A;  2MRD A;  3DD4 A;  2F8P A;  3DVK A;  1EG3 A;  1PAL A;  4I5N B;  4NDB A;  1F8H A;  2ZRS A;  3K21 A;  2EC6 C;  5KSZ A;  5DKQ A;  1TNP A;  1QTX A;  2NCP A;  5PAL A;  2OS8 C;  2E6W A;  2ZFD A;  1YRT B;  1UUS A;  1SYM A;  2I18 A;  4DIR A;  3ZNI A;  2CBL A;  2JXC A;  4WQ3 A;  1WY9 A;  1MXL C;  1CFC A;  2G2B A;  1VRK A;  3OP0 A;  1KK7 Y;  1S3P A;  1ZAC A;  2L50 A;  3PN7 C;  4HRE E;  3CWG A;  4HRG A;  2M1K B;  1F4Q A;  2FOT A;  3PM8 A;  4MEW A;  4YGD B;  5HLV A;  2BCA A;  2M0R A;  1DGU A;  2DOQ A;  4U8D A;  1B1G A;  1IGV A;  3CLN A;  2HPS A;  2M7L A;  1K94 A;  3D0Y B;  2JTZ A;  3EKJ A;  2A4J A;  4GUK A;  2LMT A;  3VRN A;  3WXA A;  1CMG A;  1ZMZ A;  3DVM A;  2LUX A;  2BCX A;  1WLM A;  3BQ3 A;  2WOR A;  4USL A;  1CKK A;  1TCO B;  1C07 A;  3I5I B;  1KFU S;  2VRG A;  4FQO A;  4P2Y B;  1MHO A;  5CSN A;  2F33 A;  5ER4 X;  1FPW A;  4TNC A;  5AEQ A;  1YX8 A;  4PCW A;  1QLS A;  1EG4 A;  2LP3 A;  4D1E A;  1UHK A;  2SAS A;  1IRJ A;  1OMR A;  2KNE A;  5B8I B;  4CID A;  3WNX B;  2GV5 A;  3SG3 A;  2PMY A;  3I5G B;  3RLZ A;  1KQM B;  2MLF C;  5HKZ A;  3AAK A;  2Y4Q A;  4YGC B;  1B47 A;  1Q80 A;  3CR4 X;  1KQV A;  2I94 A;  2QPT A;  2WCF A;  1U5I B;  4XJK B;  1N0Y A;  4CLN A;  1YUT A;  5AXI A;  2LVI A;  1UP5 A;  3IQQ A;  3TS5 B;  2JOJ A;  2IS9 A;  2K7O A;  1CDM A;  1WRK A;  1QX2 A;  3HCM A;  5HLO A;  4F0Z B;  1SW8 A;  1CLL A;  2JUL A;  2Y1M A;  2KFF A;  3GK1 A;  1DVI A;  2ZKM X;  3BXK A;  1NSH A;  1OMV A;  1XFV O;  2O60 A;  3A4U B;  1CM1 A;  5J3X A;  3BYA A;  2K0J A;  5D7F A;  1FBV A;  3I5F C;  4XYN A;  1MXE A;  1GJY A;  1NYA A;  3D10 A;  2O5G A;  1SY9 A;  5F6T A;  2L98 A;  2LAP A;  2AUC A;  1BR1 B;  2M1U A;  2NLN A;  1G33 A;  3M0W A;  3KO0 A;  3BUN B;  2BBM A;  4YGB B;  1B8L A;  2L5X B;  1J7P A;  2Y1N A;  2L4I A;  3VRQ A;  1PSR A;  2LLS A;  3OHM B;  4E68 A;  2KI6 C;  1F55 A;  1N2D A;  1L2O B;  2MHH A;  4AQJ A;  1SPY A;  2H61 C;  2R2I A;  2M7N A;  1S1E A;  1DJY A;  1M31 A;  2JT3 A;  1JFK A;  4WRI A;  3BOW A;  2Y5I A;  2F3Z A;  1DGV A;  2K7D A;  4GAO A;  2KI6 D;  3C1V A;  1LVC D;  1UUR A;  2JZI A;  2ZN8 A;  1K8U A;  3DF0 A;  3TDU A;  1AHR A;  1XFY O;  1RTP 1;  1EJ3 A;  2BBN A;  3LLE A;  1IJ6 A;  1IKU A;  3BUO B;  2JU0 A;  1QVI Z;  5AER A;  2PAS A;  5ER5 A;  2L2E A;  4DUQ A;  5BPJ A;  1SL9 A;  2E30 A;  2M29 A;  1L7Z A;  1SMG A;  3EVR A;  1WDC B;  5TNC A;  4N1F A;  2KHN A;  3LCP C;  4AOM A;  3AAJ A;  4PE0 A;  2KDH A;  2L0P A;  1SL8 A;  4WQ2 A;  1XK4 C;  1XVJ A;  3IF7 A;  3JVT C;  1ODB A;  1IJ5 A;  1XFZ O;  2KI4 B;  2EC6 B;  2H61 A;  2JWW A;  3EK7 A;  1SCM C;  2OS8 B;  1C7V A;  1CFF A;  1KWO C;  1YUU A;  1DMO A;  1BU3 A;  1K9U A;  4PE4 A;  1JWD A;  3SIA A;  1HQV A;  4YI9 A;  1QIV A;  5AAN A;  4OV2 A;  5JJG A;  1QVI Y;  1JUO A;  2LP2 A;  1YRU B;  3PN7 B;  4P5O E;  1IG5 A;  1NCZ A;  3CTN A;  3DVJ A;  5I2Q A;  3NSK A;  1A29 A;  2F2P A;  4ICB A;  3KHE A;  2I7A A;  1PVB A;  1KFU L;  2HF5 A;  2I2R E;  4MZK A;  2HQ8 A;  1OE9 B;  3SG5 A;  3VRP A;  2ZNE A;  2LE9 B;  1KK8 C;  5HKW A;  2JPT A;  2BE6 A;  1K93 D;  2HET A;  1ZUZ A;  1V1F A;  1IWQ A;  4FTG A;  1XK4 A;  4NDD A;  1CDP A;  2JQ6 A;  3CZT X;  2KOT A;  1K95 A;  4PAL A;  2WC8 A;  1IH0 A;  1MR8 A;  1EL4 A;  3BUW B;  1M39 A;  1EXR A;  5HYD A;  3BUM B;  2JT8 A;  1NX0 A;  2PRU A;  4M2P A;  2FCD A;  2LVV A;  4PHJ A;  1S36 A;  4NQG A;  3OX5 A;  5I8N A;  5HKY A;  1SCV A;  3FWB A;  4OCI A;  5I2L A;  3WHU B;  1CNP A;  2M8U A;  1Y6W A;  1RK9 A;  1TIZ A;  1DJW A;  5K89 A;  1JC2 A;  1BR4 B;  4C0L A;  1MF8 B;  4M2Q A;  2K7C A;  2ZND A;  5FYX A;  3TDI A;  1QAS A;  1W7J B;  3CGA A;  1MWN A;  1SKT A;  2KFH A;  1J7R A;  1XYD A;  1DF0 A;  1RFJ A;  3BOW B;  4CFR A;  1NUB A;  2ZN9 A;  1YR5 A;  1DJI A;  1NX2 A;  4DRW A;  4M2O A;  4ZCV A;  3PAT A;  4PDZ A;  4GPL B;  1CFP A;  1OSA A;  2WCE A;  1CM4 A;  1AJ5 A;  1YVL A;  4MVF A;  1LIN A;  3I5H C;  4MSP A;  2KQY A;  1FI5 A;  1KFX S;  3I5F B;  2LCP A;  4HSZ A;  1Y1U A;  2BL0 C;  1BG1 A;  2L4H A;  3ICB A;  1KSM A;  1QJT A;  1SR6 C;  4BY4 A;  1AUI B;  4C0K A;  3KEV A;  1HT9 A;  3SG7 A;  3JTD B;  2COL B;  2KBM A;  2LHI A;  4MRY A;  1J7O A;  4PE7 A;  4MBE A;  2EGD A;  2CXJ A;  3WHT B;  4GBA A;  4I5L B;  2Q4U A;  3LK1 A;  1GQM A;  3VGO A;  1LA0 A;  1XFX O;  1A2X A;  1CFD A;  2LMV A;  1GGZ A;  1IQ3 A;  4JQ0 D;  2LNK A;  3CR2 A;  3D0Y A;  1YUR A;  1S26 D;  1TNX A;  2AMI A;  4AQI A;  5IBW A;  4ORB B;  2M3W A;  1JF0 A;  1SBJ A;  2SCP A;  2KAX A;  3EKH A;  1DJZ A;  1JFJ A;  3ZWH A;  4I5K A;  3TUY C;  3NSL A;  1G8I A;  1TNQ A;  4DCK A;  5D69 A;  1K96 A;  1MQ1 A;  1J7Q A;  2PVB A;  1BOC A;  2KAV A;  2LAN A;  2M49 B;  2KGB C;  3HX4 A;  1Y1A A;  2JRF A;  1Y1X A;  2LMU A;  2KQ6 A;  3GK2 A;  1KCY A;  1TTX A;  1J1E A;  3EK4 A;  3JVT B;  4HRH A;  2MJW B;  1BT6 A;  1UHN A;  1N65 A;  2Q91 A;  2CTN A;  5CPV A;  1SCM B;  1K9P A;  1KWO B;  1DJG A;  1NPQ A;  1DJX A;  2KYC A;  3EVU A;  4GGF A;  1PUL A;  1U5I A;  2GGM A;  2GGZ A;  3EK8 A;  2WCB A;  1YUS A;  1X02 A;  4ORC B;  1L2O C;  2WOS A;  4OVN F;  2LLU A;  1CDL A;  4OKH A;  1R6P A;  1J55 A;  2BE4 A;  1TRF A;  2OTG C;  1F70 A;  2MBX A;  2KAY A;  1V1G A;  1B8R A;  2HQW A;  1KSO A;  4PE1 A;  1YTZ C;  5GQQ C;  3SIB A;  2LLT A;  1ZFS A;  4YGE B;  1KK8 B;  2K2A A;  1A75 A;  2K2F A;  1K90 D;  1PSB A;  4NDC A;  1UWO A;  2FCE A;  4N5X A;  1DF0 B;  1TCF A;  4GGN A;  2KFG A;  1SNL A;  4I5J A;  2JNX A;  4MRX A;  1H8B A;  2CT9 A;  3BUX B;  2LUC A;  2BEC A;  3DVE A;  3TDZ A;  1REC A;  2LM5 A;  3NSI A;  5CSI A;  3QRX A;  2ZRT A;  1M46 A;  2F3Y A;  2EHB A;  2L51 A;  4N1G A;  1BOD A;  1W7I B;  4JWQ A;  1PK0 D;  1JF2 A;  5CSF A;  1EH2 A;  1IQ5 A;  4PHN A;  4UPG A;  1NIW A;  2KI4 C;  1PRW A;  1B7T Z;  5KU1 A;  2M9G A;  1AJ4 A;  1RWY A;  2PSR A;  1B8C A;  2LHL A;  2PAL A;  3O78 A;  1QLK A;  2H2K A;  4ZCU A;  2CNP A;  2RGI A;  1AP4 A;  4MN0 A;  1RJV A;  1TOP A;  3GK4 X;  4R1E A;  1CTR A;  1D1O A;  1KFX L;  2M97 A;  2KSP A;  1MUX A;  1YVH A;  1ZOT B;  3CS1 A;  1SRA A;  3KPX A;  1WRL A;  1QV1 A;  4GFT A;  1J1D A;  1BLQ A;  5JOL A;  4DS7 A;  1H4B A;  1CB1 A;  3SG4 A;  1FW4 A;  3TZ1 A;  1LXF C;  4OR9 B;  1M45 A;  1NCY A;  4QJ5 B;  3O4Y A;  3GOF A;  3KF9 A;  3I5H B;  1XFW O;  4JPZ B;  3VRR A;  1S6I A;  2BL0 B;  2JNF A;  1BMO A;  4MLW A;  1B7T Y;  1DJH A;  4Q04 A;  4YGA A;  1RRO A;  5DKN A;  4CFQ A;  1XFU O;  3LL8 B;  1TN4 A;  1E8A A;  3DF0 B;  1SR6 B;  3VRO A;  3OX6 A;  1NP8 A;  1SK6 D;  1SL7 A;  1AK8 A;  2P6B B;  4MZL A;  1QX5 B;  1A4P A;  5I2O A;  1UHI A;  1BF5 A;  1OZO A;  1UHJ A;  1NCX A;  1WLZ A;  2QAC A;  3I5I C;  3FIA A;  2NZ0 A;  1UHH A;  1WRZ A;  1AVS A;  3MSE B;  4GNK B;  2K8M B;  4QJ3 B;  1K9K A;  1BJF A;  1PVA A;  2B1U A;  1B4C A;  1OOJ A;  2BKI B;  1LA3 A;  3H4S E;  1G4Y R;  2OPO A;  1QS7 A;  5DKR A;  1R2U A;  2NCO A;  1S5G Z;  2KYF A;  4QJ4 B;  3I5G C;  1LKJ A;  1QXP A;  1KQM C;  3PLF B;  4CPV A;  2BCB A;  4MZJ A; 
#chains in the Genus database with same CATH topology
 1K2H A;  1YX7 A;  2MAZ A;  5CSJ A;  4GGF C;  1QV0 A;  4PHM A;  4L9M A;  3O2P A;  4YI8 A;  3TUY B;  3F45 A;  2JC2 A;  2WCM A;  2WND A;  2BKH B;  2ISD A;  1XO5 A;  3TS5 C;  1A75 B;  4BY5 A;  2LVK A;  1NX1 A;  2G9B A;  3OB2 B;  2K7B A;  3CYZ A;  3PAL A;  4YBH B;  1TNW A;  2D8N A;  2TN4 A;  2QDI A;  3EVV A;  2KGR A;  3CR5 X;  2LV7 A;  1QWV A;  4PHK A;  4C0J A;  1F71 A;  1S6C A;  3LK0 A;  3NSO A;  1A03 A;  1M63 B;  1DQE A;  2AAO A;  3JTD C;  1XFR A;  1S5G Y;  1NWD A;  1CMF A;  3SJS A;  1FF1 A;  1B9A A;  3FS7 A;  2F2O A;  1FI6 A;  1DTL A;  2KPH A;  1ALV A;  1OZS A;  3PSR A;  5G08 A;  4A4B A;  3RM1 A;  1C7W A;  2OTG B;  1DEL A;  3S0B A;  3SG6 A;  4XJK A;  1NX3 A;  2KBI A;  2K61 A;  3EG5 B;  1F4O A;  5KTY A;  1Y0V H;  1GGW A;  4ETO A;  2MLE C;  1S6J A;  2LC5 A;  3IQO A;  2NXQ A;  2LVJ A;  3NXA A;  4ORA B;  4YRU A;  2QEV A;  3E3R A;  3AKB A;  1QAT A;  4IL1 A;  5AFP A;  2P71 A;  3CZ0 A;  3FWC A;  1ALW A;  1GM0 A;  3A8R A;  2V53 A;  3AKA A;  1P28 A;  3R1V A;  1OQP A;  1OMD A;  1QX7 A;  1JSA A;  1KK7 Z;  1JBA A;  1CDN A;  2MA2 A;  1DT7 B;  1F54 A;  3PFV A;  2CCM A;  1WDC C;  1CLM A;  2JXL A;  2JTT A;  3OB1 B;  1QIW A;  3D75 A;  2FJU B;  4A4C A;  3O6B A;  3SG2 A;  2K60 A;  1CLB A;  1XA5 A;  2JT0 A;  2MRD A;  3DD4 A;  2F8P A;  3DVK A;  1EG3 A;  1OOI X;  1PAL A;  4I5N B;  3CZ2 A;  3B7A A;  4NDB A;  3DYE A;  1F8H A;  2ZRS A;  3K21 A;  2EC6 C;  5KSZ A;  3BFA A;  5DKQ A;  1TNP A;  1QTX A;  2NCP A;  3NHT A;  2OS8 C;  2E6W A;  5PAL A;  2ZFD A;  1YRT B;  1UUS A;  1SYM A;  2I18 A;  4DIR A;  3ZNI A;  2CBL A;  2JXC A;  4WQ3 A;  1WY9 A;  1MXL C;  1CFC A;  2G2B A;  1VRK A;  3OP0 A;  1KK7 Y;  1S3P A;  1ZAC A;  2L50 A;  3FE8 A;  3PN7 C;  3CWG A;  4HRG A;  4HRE E;  2M1K B;  1F4Q A;  2FOT A;  2KLE A;  3PM8 A;  4MEW A;  4YGD B;  5HLV A;  2BCA A;  2M0R A;  1DGU A;  2DOQ A;  4U8D A;  1B1G A;  1IGV A;  3CLN A;  4INX A;  2HPS A;  2M7L A;  1K94 A;  3D0Y B;  2JTZ A;  3EKJ A;  2A4J A;  4GUK A;  2LMT A;  3VRN A;  3WXA A;  1CMG A;  1ZMZ A;  3DVM A;  2LUX A;  2BCX A;  1WLM A;  2H8V A;  3BQ3 A;  2WOR A;  4USL A;  1CKK A;  1TCO B;  1C07 A;  3I5I B;  1KFU S;  2VRG A;  4FQO A;  4P2Y B;  1MHO A;  5CSN A;  2F33 A;  3DY9 A;  5ER4 X;  1FPW A;  4TNC A;  1SSE B;  5AEQ A;  1YX8 A;  4PCW A;  1QLS A;  1EG4 A;  2LP3 A;  4D1E A;  1UHK A;  2SAS A;  1IRJ A;  1OMR A;  3QME A;  2KNE A;  5B8I B;  1IIO A;  4CID A;  3WNX B;  2GV5 A;  3SG3 A;  2PMY A;  3I5G B;  3RLZ A;  1KQM B;  2MLF C;  5HKZ A;  3AAK A;  2Y4Q A;  4YGC B;  2WCJ A;  3B87 A;  1B47 A;  1Q80 A;  3CR4 X;  1KQV A;  2I94 A;  2QPT A;  2WCF A;  1U5I B;  4XJK B;  1N0Y A;  4CLN A;  1YUT A;  5AXI A;  2QEH A;  3IVT A;  2LVI A;  1UP5 A;  3IQQ A;  3TS5 B;  2JOJ A;  2IS9 A;  2K7O A;  1CDM A;  2ERB A;  1WRK A;  1QX2 A;  3HCM A;  5HLO A;  3FE9 A;  4F0Z B;  1SW8 A;  1CLL A;  2JUL A;  2Y1M A;  3L47 A;  2KFF A;  3GK1 A;  1DVI A;  2ZKM X;  3BXK A;  1NSH A;  1OMV A;  1XFV O;  2O60 A;  3A4U B;  1CM1 A;  2WCK A;  5J3X A;  3BYA A;  1Z4H A;  2K0J A;  5D7F A;  1FBV A;  3I5F C;  4XYN A;  3R1O A;  1MXE A;  1GJY A;  1NYA A;  3D10 A;  2O5G A;  1SY9 A;  5F6T A;  2L98 A;  2LAP A;  1OOH A;  2AUC A;  1BR1 B;  2M1U A;  2WC5 A;  3Q8I A;  2NLN A;  1G33 A;  3M0W A;  3KO0 A;  3BUN B;  2BBM A;  3O4X A;  4YGB B;  1B8L A;  2L5X B;  1ORG A;  1J7P A;  2Y1N A;  2L4I A;  3VRQ A;  1PSR A;  2LLS A;  3OHM B;  4E68 A;  2KI6 C;  1F55 A;  1N2D A;  2L5Y A;  1L2O B;  2MHH A;  4AQJ A;  1SPY A;  2H61 C;  2R2I A;  2M7N A;  1S1E A;  1DJY A;  1M31 A;  2JT3 A;  1JFK A;  4WRI A;  3BOW A;  2Y5I A;  2F3Z A;  1DGV A;  1C3Z A;  2K7D A;  4GAO A;  2KI6 D;  3C1V A;  1LVC D;  1UUR A;  3SS3 A;  2JZI A;  2P70 A;  2ZN8 A;  1K8U A;  3DF0 A;  3TDU A;  1AHR A;  1XFY O;  5D3O A;  1RTP 1;  1EJ3 A;  2BBN A;  3B88 A;  1IJ6 A;  3LLE A;  1IKU A;  5EL2 A;  3BUO B;  2JU0 A;  1QVI Z;  5AER A;  2PAS A;  5ER5 A;  2L2E A;  4DUQ A;  5BPJ A;  1SL9 A;  2E30 A;  2M29 A;  1L7Z A;  1SMG A;  3EVR A;  1WDC B;  5TNC A;  4N1F A;  2KHN A;  3LCP C;  4AOM A;  3AAJ A;  4PE0 A;  2KDH A;  2L0P A;  1SL8 A;  4WQ2 A;  1XK4 C;  3UNW A;  1XVJ A;  3IF7 A;  3JVT C;  3V2L A;  1ODB A;  1IJ5 A;  1XFZ O;  2KI4 B;  2EC6 B;  2H61 A;  2JWW A;  3CDN A;  1DC1 A;  3EK7 A;  1SCM C;  2OS8 B;  1C7V A;  1CFF A;  1KWO C;  1YUU A;  1DMO A;  1BU3 A;  1K9U A;  4PE4 A;  1JWD A;  3SIA A;  3UO9 A;  1HQV A;  4JKT A;  4YI9 A;  3VB1 A;  1QIV A;  5AAN A;  4OV2 A;  5JJG A;  1QVI Y;  1JUO A;  2LP2 A;  1YRU B;  3PN7 B;  4P5O E;  1IG5 A;  2GTE A;  1NCZ A;  3CTN A;  3DVJ A;  5I2Q A;  3NSK A;  1A29 A;  4IJ7 A;  2F2P A;  4ICB A;  4OZD A;  4FQT A;  3KHE A;  2I7A A;  1PVB A;  1KFU L;  2HF5 A;  2I2R E;  3R72 A;  2HQ8 A;  1OE9 B;  4MZK A;  3SG5 A;  3VRP A;  2ZNE A;  2LE9 B;  1KK8 C;  5HKW A;  2JPT A;  2BE6 A;  3D76 A;  1K93 D;  2HET A;  1ZUZ A;  1V1F A;  1IWQ A;  2WCL A;  4FTG A;  1XK4 A;  4NDD A;  1CDP A;  2JQ6 A;  3CZT X;  2KOT A;  1K95 A;  4PAL A;  2WC8 A;  1IH0 A;  1MR8 A;  1EL4 A;  3BUW B;  3DZT A;  1M39 A;  1EXR A;  5HYD A;  3BUM B;  2JT8 A;  1NX0 A;  2PRU A;  4M2P A;  2FCD A;  2LVV A;  4PHJ A;  1S36 A;  3K1E A;  3OX5 A;  4NQG A;  5I8N A;  5HKY A;  1SCV A;  3FWB A;  4OCI A;  3S0G A;  5I2L A;  3WHU B;  1CNP A;  2M8U A;  1Y6W A;  1RK9 A;  3BJH A;  1TIZ A;  1DJW A;  3R1P A;  5K89 A;  1JC2 A;  1BR4 B;  4C0L A;  1MF8 B;  4M2Q A;  2K7C A;  2ZND A;  5FYX A;  3L4L A;  3TDI A;  1QAS A;  3OGN A;  1W7J B;  3VRO A;  3CGA A;  2L2C A;  1MWN A;  1SKT A;  3D73 A;  2KFH A;  1OW4 A;  1J7R A;  3B6X A;  1XYD A;  1DF0 A;  1RFJ A;  3BOW B;  4CFR A;  1NUB A;  2ZN9 A;  1YR5 A;  1DJI A;  1NX2 A;  4DRW A;  4M2O A;  5I94 A;  2BNX A;  3D78 A;  3DXL A;  4ZCV A;  3PAT A;  4PDZ A;  4GPL B;  1CFP A;  1OSA A;  2PQL A;  2WCE A;  1CM4 A;  1AJ5 A;  1YVL A;  3D74 A;  1LIN A;  3I5H C;  4MSP A;  2KQY A;  1TUZ A;  4MVF A;  5DIC A;  1FI5 A;  1KFX S;  3I5F B;  2LCP A;  4HSZ A;  1Y1U A;  2BL0 C;  1BG1 A;  2L4H A;  3ICB A;  1KSM A;  1QJT A;  1SR6 C;  3S0F A;  4BY4 A;  1AUI B;  4C0K A;  3KEV A;  1HT9 A;  3SG7 A;  3JTD B;  2COL B;  2KBM A;  2LHI A;  4MRY A;  1J7O A;  4PE7 A;  4MBE A;  2EGD A;  2CXJ A;  3WHT B;  4GBA A;  4I5L B;  2Q4U A;  1OOG A;  1GQM A;  3LK1 A;  3VGO A;  1LA0 A;  1XFX O;  1A2X A;  1CFD A;  2LMV A;  1GGZ A;  1IQ3 A;  4JQ0 D;  2LNK A;  3CR2 A;  3D0Y A;  4KYN A;  1YUR A;  1S26 D;  1TNX A;  2AMI A;  4AQI A;  5IBW A;  4ORB B;  2M3W A;  1JF0 A;  1SBJ A;  2SCP A;  2KAX A;  3EKH A;  1DJZ A;  1JFJ A;  3ZWH A;  4I5K A;  3TUY C;  3L4A A;  3NSL A;  1G8I A;  1TNQ A;  4DCK A;  5D69 A;  1K96 A;  1BOC A;  1MQ1 A;  1J7Q A;  1OOF A;  2PVB A;  2KAV A;  2LAN A;  2M49 B;  2KGB C;  3HX4 A;  1Y1A A;  2JRF A;  1Y1X A;  2LMU A;  2KQ6 A;  3GK2 A;  1Z2C B;  3OBV A;  1KCY A;  1TTX A;  1J1E A;  3EK4 A;  3JVT B;  4HRH A;  2MJW B;  1BT6 A;  1TWO A;  1N65 A;  1UHN A;  2CTN A;  2Q91 A;  5CPV A;  1SCM B;  1K9P A;  1KWO B;  1DJG A;  1NPQ A;  1DJX A;  2KYC A;  3EVU A;  4GGF A;  1PUL A;  1U5I A;  2GGM A;  2GGZ A;  3EK8 A;  2WCB A;  3NGV A;  1YUS A;  1X02 A;  3BFB A;  1L2O C;  4ORC B;  2WOS A;  2YGU A;  3BFH A;  4OVN F;  2LLU A;  3SS4 A;  1CDL A;  4PT1 A;  4OKH A;  3NHI A;  1R6P A;  1J55 A;  2BE4 A;  1TRF A;  2OTG C;  1F70 A;  2MBX A;  3CAB A;  2KAY A;  4F7F A;  1V1G A;  1B8R A;  2HQW A;  1KSO A;  4PE1 A;  1YTZ C;  5GQQ C;  3SIB A;  2LLT A;  1ZFS A;  4YGE B;  3S0E A;  1KK8 B;  2K2A A;  2JPO A;  1A75 A;  2K2F A;  1K90 D;  1PSB A;  4NDC A;  1UWO A;  2FCE A;  4N5X A;  1DF0 B;  1TCF A;  4GGN A;  2KFG A;  1SNL A;  4I5J A;  2JNX A;  1LS8 A;  4MRX A;  1H8B A;  2CT9 A;  3BUX B;  3PJI A;  2LUC A;  2BEC A;  3DVE A;  3TDZ A;  1REC A;  3RZS A;  2LM5 A;  3NSI A;  5CSI A;  3QRX A;  2ZRT A;  1M46 A;  2F3Y A;  3D77 A;  2EHB A;  2L51 A;  4N1G A;  1BOD A;  1W7I B;  4JWQ A;  1PK0 D;  1JF2 A;  5CSF A;  1EH2 A;  2BAP A;  1IQ5 A;  4PHN A;  4UPG A;  5FI6 A;  2WCH A;  1NIW A;  2KI4 C;  1PRW A;  4JD9 A;  5FI7 A;  1B7T Z;  5KU1 A;  1C3Y A;  2M9G A;  1AJ4 A;  1RWY A;  2PSR A;  1B8C A;  2LHL A;  2PAL A;  3O78 A;  1QLK A;  2H2K A;  4ZCU A;  2CNP A;  2RGI A;  2KLD A;  1AP4 A;  4MN0 A;  1RJV A;  1TOP A;  1W9Z A;  3GK4 X;  4R1E A;  1CTR A;  1D1O A;  1KFX L;  2M97 A;  2KSP A;  1MUX A;  1YVH A;  1ZOT B;  3CS1 A;  3PM2 A;  1SRA A;  3KPX A;  1WRL A;  1QV1 A;  1T14 A;  1J1D A;  4GFT A;  1BLQ A;  5JOL A;  4DS7 A;  1H4B A;  1CB1 A;  3SG4 A;  1FW4 A;  3TZ1 A;  1LXF C;  4OR9 B;  1M45 A;  1NCY A;  2FJY A;  3O4Y A;  3GOF A;  3KF9 A;  3I5H B;  2QEO A;  4QJ5 B;  1XFW O;  4JPZ B;  3VRR A;  3CZ1 A;  2QEB A;  1S6I A;  2BL0 B;  2JNF A;  5FI2 A;  1BMO A;  4MLW A;  1B7T Y;  1DJH A;  1TUJ A;  4Q04 A;  4YGA A;  1RRO A;  5DKN A;  2PYQ A;  4CFQ A;  1XFU O;  3S0D A;  3LL8 B;  1TN4 A;  1E8A A;  3DF0 B;  1SR6 B;  2WC6 A;  3OX6 A;  1DEK A;  1NP8 A;  1SK6 D;  1SL7 A;  3FE6 A;  3SS5 A;  1AK8 A;  2P6B B;  4MZL A;  1QX5 B;  1A4P A;  3S0A A;  5I2O A;  1UHI A;  1BF5 A;  1OZO A;  1UHJ A;  1NCX A;  1WLZ A;  2QAC A;  3I5I C;  3FIA A;  2NZ0 A;  1UHH A;  1WRZ A;  1AVS A;  3MSE B;  4GNK B;  5HL1 A;  2K8M B;  4QJ3 B;  1K9K A;  1BJF A;  1PVA A;  2B1U A;  3B86 A;  1B4C A;  1OOJ A;  2BKI B;  1LA3 A;  3H4S E;  1G4Y R;  2OPO A;  1QS7 A;  5DKR A;  1R2U A;  2NCO A;  1S5G Z;  2KYF A;  4QJ4 B;  3I5G C;  4INW A;  1LKJ A;  1QXP A;  1KQM C;  3PLF B;  3N7H A;  4CPV A;  2BCB A;  4MZJ A; 
#chains in the Genus database with same CATH homology
 1K2H A;  1YX7 A;  2MAZ A;  5CSJ A;  4GGF C;  1QV0 A;  4PHM A;  4L9M A;  3O2P A;  4YI8 A;  3TUY B;  3F45 A;  2JC2 A;  2WND A;  2BKH B;  2ISD A;  1XO5 A;  3TS5 C;  1A75 B;  4BY5 A;  2LVK A;  1NX1 A;  2G9B A;  3OB2 B;  2K7B A;  3PAL A;  4YBH B;  1TNW A;  2D8N A;  2TN4 A;  3EVV A;  2KGR A;  3CR5 X;  2LV7 A;  4PHK A;  4C0J A;  1F71 A;  1S6C A;  3LK0 A;  3NSO A;  1A03 A;  1M63 B;  2AAO A;  3JTD C;  1S5G Y;  1NWD A;  1CMF A;  3SJS A;  1FF1 A;  1B9A A;  3FS7 A;  2F2O A;  1FI6 A;  1DTL A;  1ALV A;  1OZS A;  3PSR A;  5G08 A;  4A4B A;  3RM1 A;  1C7W A;  2OTG B;  3SG6 A;  4XJK A;  1NX3 A;  2KBI A;  2K61 A;  1F4O A;  5KTY A;  1Y0V H;  1GGW A;  4ETO A;  2MLE C;  1S6J A;  2LC5 A;  3IQO A;  2NXQ A;  2LVJ A;  3NXA A;  4ORA B;  4YRU A;  3E3R A;  3AKB A;  1QAT A;  4IL1 A;  5AFP A;  3FWC A;  1ALW A;  3A8R A;  2V53 A;  3AKA A;  1JSA A;  1OQP A;  1OMD A;  1QX7 A;  1KK7 Z;  1JBA A;  1CDN A;  2MA2 A;  1DT7 B;  1F54 A;  3PFV A;  2CCM A;  1WDC C;  1CLM A;  2JXL A;  2JTT A;  3OB1 B;  1QIW A;  4A4C A;  2FJU B;  3O6B A;  3SG2 A;  1CLB A;  1XA5 A;  2JT0 A;  2MRD A;  3DD4 A;  2F8P A;  3DVK A;  1EG3 A;  1PAL A;  4I5N B;  4NDB A;  1F8H A;  2ZRS A;  3K21 A;  2EC6 C;  5KSZ A;  5DKQ A;  1TNP A;  1QTX A;  2NCP A;  5PAL A;  2OS8 C;  2E6W A;  2ZFD A;  1YRT B;  1UUS A;  1SYM A;  2I18 A;  4DIR A;  3ZNI A;  2CBL A;  2JXC A;  4WQ3 A;  1WY9 A;  1MXL C;  1CFC A;  2G2B A;  1VRK A;  3OP0 A;  1KK7 Y;  1S3P A;  1ZAC A;  2L50 A;  3PN7 C;  4HRE E;  3CWG A;  4HRG A;  2M1K B;  1F4Q A;  2FOT A;  3PM8 A;  4MEW A;  4YGD B;  5HLV A;  2BCA A;  2M0R A;  1DGU A;  2DOQ A;  4U8D A;  1B1G A;  1IGV A;  3CLN A;  2HPS A;  2M7L A;  1K94 A;  3D0Y B;  2JTZ A;  3EKJ A;  2A4J A;  4GUK A;  2LMT A;  3VRN A;  3WXA A;  1CMG A;  1ZMZ A;  3DVM A;  2LUX A;  2BCX A;  1WLM A;  3BQ3 A;  2WOR A;  4USL A;  1CKK A;  1TCO B;  1C07 A;  3I5I B;  1KFU S;  2VRG A;  4FQO A;  4P2Y B;  1MHO A;  5CSN A;  2F33 A;  5ER4 X;  1FPW A;  4TNC A;  5AEQ A;  1YX8 A;  4PCW A;  1QLS A;  1EG4 A;  2LP3 A;  4D1E A;  1UHK A;  2SAS A;  1IRJ A;  1OMR A;  2KNE A;  5B8I B;  4CID A;  3WNX B;  2GV5 A;  3SG3 A;  2PMY A;  3I5G B;  3RLZ A;  1KQM B;  2MLF C;  5HKZ A;  3AAK A;  2Y4Q A;  4YGC B;  1B47 A;  1Q80 A;  3CR4 X;  1KQV A;  2I94 A;  2QPT A;  2WCF A;  1U5I B;  4XJK B;  1N0Y A;  4CLN A;  1YUT A;  5AXI A;  2LVI A;  1UP5 A;  3IQQ A;  3TS5 B;  2JOJ A;  2IS9 A;  2K7O A;  1CDM A;  1WRK A;  1QX2 A;  3HCM A;  5HLO A;  4F0Z B;  1SW8 A;  1CLL A;  2JUL A;  2Y1M A;  2KFF A;  3GK1 A;  1DVI A;  2ZKM X;  3BXK A;  1NSH A;  1OMV A;  1XFV O;  2O60 A;  3A4U B;  1CM1 A;  5J3X A;  3BYA A;  2K0J A;  5D7F A;  1FBV A;  3I5F C;  4XYN A;  1MXE A;  1GJY A;  1NYA A;  3D10 A;  2O5G A;  1SY9 A;  5F6T A;  2L98 A;  2LAP A;  2AUC A;  1BR1 B;  2M1U A;  2NLN A;  1G33 A;  3M0W A;  3KO0 A;  3BUN B;  2BBM A;  4YGB B;  1B8L A;  2L5X B;  1J7P A;  2Y1N A;  2L4I A;  3VRQ A;  1PSR A;  2LLS A;  3OHM B;  4E68 A;  2KI6 C;  1F55 A;  1N2D A;  1L2O B;  2MHH A;  4AQJ A;  1SPY A;  2H61 C;  2R2I A;  2M7N A;  1S1E A;  1DJY A;  1M31 A;  2JT3 A;  1JFK A;  4WRI A;  3BOW A;  2Y5I A;  2F3Z A;  1DGV A;  2K7D A;  4GAO A;  2KI6 D;  3C1V A;  1LVC D;  1UUR A;  2JZI A;  2ZN8 A;  1K8U A;  3DF0 A;  3TDU A;  1AHR A;  1XFY O;  1RTP 1;  1EJ3 A;  2BBN A;  3LLE A;  1IJ6 A;  1IKU A;  3BUO B;  2JU0 A;  1QVI Z;  5AER A;  2PAS A;  5ER5 A;  2L2E A;  4DUQ A;  5BPJ A;  1SL9 A;  2E30 A;  2M29 A;  1L7Z A;  1SMG A;  3EVR A;  1WDC B;  5TNC A;  4N1F A;  2KHN A;  3LCP C;  4AOM A;  3AAJ A;  4PE0 A;  2KDH A;  2L0P A;  1SL8 A;  4WQ2 A;  1XK4 C;  1XVJ A;  3IF7 A;  3JVT C;  1ODB A;  1IJ5 A;  1XFZ O;  2KI4 B;  2EC6 B;  2H61 A;  2JWW A;  3EK7 A;  1SCM C;  2OS8 B;  1C7V A;  1CFF A;  1KWO C;  1YUU A;  1DMO A;  1BU3 A;  1K9U A;  4PE4 A;  1JWD A;  3SIA A;  1HQV A;  4YI9 A;  1QIV A;  5AAN A;  4OV2 A;  5JJG A;  1QVI Y;  1JUO A;  2LP2 A;  1YRU B;  3PN7 B;  4P5O E;  1IG5 A;  1NCZ A;  3CTN A;  3DVJ A;  5I2Q A;  3NSK A;  1A29 A;  2F2P A;  4ICB A;  3KHE A;  2I7A A;  1PVB A;  1KFU L;  2HF5 A;  2I2R E;  4MZK A;  2HQ8 A;  1OE9 B;  3SG5 A;  3VRP A;  2ZNE A;  2LE9 B;  1KK8 C;  5HKW A;  2JPT A;  2BE6 A;  1K93 D;  2HET A;  1ZUZ A;  1V1F A;  1IWQ A;  4FTG A;  1XK4 A;  4NDD A;  1CDP A;  2JQ6 A;  3CZT X;  2KOT A;  1K95 A;  4PAL A;  2WC8 A;  1IH0 A;  1MR8 A;  1EL4 A;  3BUW B;  1M39 A;  1EXR A;  5HYD A;  3BUM B;  2JT8 A;  1NX0 A;  2PRU A;  4M2P A;  2FCD A;  2LVV A;  4PHJ A;  1S36 A;  4NQG A;  3OX5 A;  5I8N A;  5HKY A;  1SCV A;  3FWB A;  4OCI A;  5I2L A;  3WHU B;  1CNP A;  2M8U A;  1Y6W A;  1RK9 A;  1TIZ A;  1DJW A;  5K89 A;  1JC2 A;  1BR4 B;  4C0L A;  1MF8 B;  4M2Q A;  2K7C A;  2ZND A;  5FYX A;  3TDI A;  1QAS A;  1W7J B;  3CGA A;  1MWN A;  1SKT A;  2KFH A;  1J7R A;  1XYD A;  1DF0 A;  1RFJ A;  3BOW B;  4CFR A;  1NUB A;  2ZN9 A;  1YR5 A;  1DJI A;  1NX2 A;  4DRW A;  4M2O A;  4ZCV A;  3PAT A;  4PDZ A;  4GPL B;  1CFP A;  1OSA A;  2WCE A;  1CM4 A;  1AJ5 A;  1YVL A;  4MVF A;  1LIN A;  3I5H C;  4MSP A;  2KQY A;  1FI5 A;  1KFX S;  3I5F B;  2LCP A;  4HSZ A;  1Y1U A;  2BL0 C;  1BG1 A;  2L4H A;  3ICB A;  1KSM A;  1QJT A;  1SR6 C;  4BY4 A;  1AUI B;  4C0K A;  3KEV A;  1HT9 A;  3SG7 A;  3JTD B;  2COL B;  2KBM A;  2LHI A;  4MRY A;  1J7O A;  4PE7 A;  4MBE A;  2EGD A;  2CXJ A;  3WHT B;  4GBA A;  4I5L B;  2Q4U A;  3LK1 A;  1GQM A;  3VGO A;  1LA0 A;  1XFX O;  1A2X A;  1CFD A;  2LMV A;  1GGZ A;  1IQ3 A;  4JQ0 D;  2LNK A;  3CR2 A;  3D0Y A;  1YUR A;  1S26 D;  1TNX A;  2AMI A;  4AQI A;  5IBW A;  4ORB B;  2M3W A;  1JF0 A;  1SBJ A;  2SCP A;  2KAX A;  3EKH A;  1DJZ A;  1JFJ A;  3ZWH A;  4I5K A;  3TUY C;  3NSL A;  1G8I A;  1TNQ A;  4DCK A;  5D69 A;  1K96 A;  1MQ1 A;  1J7Q A;  2PVB A;  1BOC A;  2KAV A;  2LAN A;  2M49 B;  2KGB C;  3HX4 A;  1Y1A A;  2JRF A;  1Y1X A;  2LMU A;  2KQ6 A;  3GK2 A;  1KCY A;  1TTX A;  1J1E A;  3EK4 A;  3JVT B;  4HRH A;  2MJW B;  1BT6 A;  1UHN A;  1N65 A;  2Q91 A;  2CTN A;  5CPV A;  1SCM B;  1K9P A;  1KWO B;  1DJG A;  1NPQ A;  1DJX A;  2KYC A;  3EVU A;  4GGF A;  1PUL A;  1U5I A;  2GGM A;  2GGZ A;  3EK8 A;  2WCB A;  1YUS A;  1X02 A;  4ORC B;  1L2O C;  2WOS A;  4OVN F;  2LLU A;  1CDL A;  4OKH A;  1R6P A;  1J55 A;  2BE4 A;  1TRF A;  2OTG C;  1F70 A;  2MBX A;  2KAY A;  1V1G A;  1B8R A;  2HQW A;  1KSO A;  4PE1 A;  1YTZ C;  5GQQ C;  3SIB A;  2LLT A;  1ZFS A;  4YGE B;  1KK8 B;  2K2A A;  1A75 A;  2K2F A;  1K90 D;  1PSB A;  4NDC A;  1UWO A;  2FCE A;  4N5X A;  1DF0 B;  1TCF A;  4GGN A;  2KFG A;  1SNL A;  4I5J A;  2JNX A;  4MRX A;  1H8B A;  2CT9 A;  3BUX B;  2LUC A;  2BEC A;  3DVE A;  3TDZ A;  1REC A;  2LM5 A;  3NSI A;  5CSI A;  3QRX A;  2ZRT A;  1M46 A;  2F3Y A;  2EHB A;  2L51 A;  4N1G A;  1BOD A;  1W7I B;  4JWQ A;  1PK0 D;  1JF2 A;  5CSF A;  1EH2 A;  1IQ5 A;  4PHN A;  4UPG A;  1NIW A;  2KI4 C;  1PRW A;  1B7T Z;  5KU1 A;  2M9G A;  1AJ4 A;  1RWY A;  2PSR A;  1B8C A;  2LHL A;  2PAL A;  3O78 A;  1QLK A;  2H2K A;  4ZCU A;  2CNP A;  2RGI A;  1AP4 A;  4MN0 A;  1RJV A;  1TOP A;  3GK4 X;  4R1E A;  1CTR A;  1D1O A;  1KFX L;  2M97 A;  2KSP A;  1MUX A;  1YVH A;  1ZOT B;  3CS1 A;  1SRA A;  3KPX A;  1WRL A;  1QV1 A;  4GFT A;  1J1D A;  1BLQ A;  5JOL A;  4DS7 A;  1H4B A;  1CB1 A;  3SG4 A;  1FW4 A;  3TZ1 A;  1LXF C;  4OR9 B;  1M45 A;  1NCY A;  4QJ5 B;  3O4Y A;  3GOF A;  3KF9 A;  3I5H B;  1XFW O;  4JPZ B;  3VRR A;  1S6I A;  2BL0 B;  2JNF A;  1BMO A;  4MLW A;  1B7T Y;  1DJH A;  4Q04 A;  4YGA A;  1RRO A;  5DKN A;  4CFQ A;  1XFU O;  3LL8 B;  1TN4 A;  1E8A A;  3DF0 B;  1SR6 B;  3VRO A;  3OX6 A;  1NP8 A;  1SK6 D;  1SL7 A;  1AK8 A;  2P6B B;  4MZL A;  1QX5 B;  1A4P A;  5I2O A;  1UHI A;  1BF5 A;  1OZO A;  1UHJ A;  1NCX A;  1WLZ A;  2QAC A;  3I5I C;  3FIA A;  2NZ0 A;  1UHH A;  1WRZ A;  1AVS A;  3MSE B;  4GNK B;  2K8M B;  4QJ3 B;  1K9K A;  1BJF A;  1PVA A;  2B1U A;  1B4C A;  1OOJ A;  2BKI B;  1LA3 A;  3H4S E;  1G4Y R;  2OPO A;  1QS7 A;  5DKR A;  1R2U A;  2NCO A;  1S5G Z;  2KYF A;  4QJ4 B;  3I5G C;  1LKJ A;  1QXP A;  1KQM C;  3PLF B;  4CPV A;  2BCB A;  4MZJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...