5D69A

Human calpain pef(s) with (2z,2z')-2,2'-disulfanediylbis(3-(6-iodoindol-3-yl)acrylic acid) bound
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
173
structure length
173
Chain Sequence
EEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformationally restricted calpain inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Calpain small subunit 1
total genus 61
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5d69A00
2F3YA 3PLFB 2I2RE 1NCZA 3MSEB 2L98A 1S1EA 3E3RA 1E8AA 1UHKA 1SY9A 4MEWA 3PALA 4HREE 2M29A 2MHHA 4MRYA 4OCIA 1SPYA 2HF5A 2KFGA 1JF0A 2Y1NA 1JF2A 5I2OA 1BG1A 2Q4UA 3NSLA 2JXLA 4OV2A 1S3PA 4YRUA 1K90D 2LP2A 2LUXA 1QX7A 1M45A 1RK9A 1XK4A 2AUCA 3BYAA 4PE1A 2G9BA 4HSZA 1F4QA 2BKHB 1LVCD 1QIWA 3LK0A 1F54A 1UP5A 2H2KA 2E6WA 2L4IA 2KYCA 2LVKA 1UHHA 1C7VA 1B9AA 1XFYO 1KWOB 2F2OA 2OS8C 1DT7B 1Q80A 1A2XA 5CSFA 3DVMA 2PALA 1L2OC 1CFDA 3TS5B 4ZCVA 1DJHA 3WHUB 1JFKA 5ER4X 3CWGA 3O6BA 3PFVA 5HLOA 1CFCA 1GGZA 1SR6B 5CSNA 1XVJA 2SCPA 2ZFDA 1SBJA 1X02A 4MBEA 1M46A 1B8CA 2LC5A 1WDCB 1WRZA 5GQQC 3CGAA 1ZACA 2D8NA 5BPJA 2K2FA 1QXPA 2WC8A 2BE4A 1XFZO 5DKQA 2LAPA 1RWYA 2WOSA 4U8DA 5HYDA 1TTXA 2JULA 1V1GA 2KQYA 4IL1A 4BY5A 1CDNA 1QV0A 1XFXO 4P5OE 3I5IC 3HCMA 1M39A 1XFWO 3TUYC 1MUXA 2GV5A 1TCFA 1B7TZ 2GGMA 3NSOA 1MHOA 1B4CA 1LINA 3JTDC 1A4PA 3EVVA 1A75B 1XO5A 2M3WA 1CLBA 1ZOTB 2CCMA 3DD4A 1BODA 2LV7A 2LLSA 2LHLA 3LCPC 2EC6B 4GAOA 1K9PA 1WY9A 2PMYA 4NDDA 1QV1A 4ORBB 1CMGA 4DCKA 1J7RA 2ZRTA 4PCWA 1IWQA 2A4JA 1S6CA 4Q04A 1U5IB 2Y5IA 1JUOA 3EKHA 4M2PA 3SG4A 1QIVA 1KK7Y 2F2PA 3JVTB 1JBAA 3VGOA 2LCPA 2KAVA 4CIDA 1IJ6A 2K61A 4ZCUA 1IRJA 4JWQA 1L7ZA 1WDCC 1QLSA 3WNXB 3VRNA 1PRWA 3TDZA 1DF0B 2PSRA 2JNXA 1DTLA 4WQ3A 2LP3A 1SMGA 2KBMA 4I5JA 1YUSA 2BCBA 1G8IA 1NX3A 3DF0B 1YX8A 1K95A 1ALWA 2H61A 1YX7A 1K94A 1TNXA 2M49B 1QX5B 1CLLA 2Y1MA 2LE9B 4PE7A 2M1KB 3F45A 4PHJA 4A4BA 1NCXA 2LVJA 4N1GA 3PATA 1OMDA 2K8MB 1OZOA 2HQWA 2M1UA 5K89A 1RJVA 2L51A 2WCEA 4MZJA 5F6TA 1G33A 1IG5A 1CDPA 1KFUS 1TIZA 2QPTA 4XYNA 4YI9A 5AANA 2KOTA 2WNDA 3I5FB 3K21A 2O5GA 1C7WA 1S6IA 5I2QA 3DVJA 1OSAA 2KFHA 3GOFA 3KPXA 1IH0A 2OTGC 3DVEA 3BXKA 3IF7A 1EL4A 1KK7Z 1KK8B 2KYFA 1KCYA 1KQVA 2ZNEA 1SCMB 1J7QA 2WCBA 1H4BA 1HQVA 1EJ3A 4AQIA 1AJ5A 1YTZC 5KU1A 1B47A 1B8RA 3EK4A 5AERA 2OS8B 2LLUA 3SG5A 1M31A 4UPGA 1F70A 3LL8B 1S6JA 1YRUB 1BJFA 1TNWA 1XA5A 2EGDA 1SL7A 3TZ1A 2TN4A 4QJ5B 1F55A 1K93D 2OPOA 3ICBA 4DUQA 1NUBA 3A8RA 3GK4X 2L5XB 3JVTC 1FBVA 1FW4A 1CDMA 2BKIB 2JPTA 2M7LA 4DRWA 1H8BA 2F3ZA 2FCEA 3D0YA 1CM1A 3I5GC 3BOWA 4FQOA 1KQMC 1IQ5A 1UURA 3CR4X 5D69A 2KI6C 2QACA 1JSAA 1NP8A 3OB2B 2AAOA 1WLZA 1DGUA 3KO0A 2BL0C 2F33A 2K2AA 2MLFC 4C0LA 2DOQA 1EH2A 1CMFA 3I5HB 1NCYA 2JT0A 2JTZA 1KQMB 5I8NA 1LKJA 3WHTB 1SCMC 1PVAA 4I5KA 1A75A 2K7BA 1SCVA 2LLTA 5J3XA 2M8UA 1IQ3A 1TOPA 3SG2A 3EVUA 3SG3A 1OE9B 4GUKA 2ZKMX 1OZSA 1K96A 2B1UA 2SASA 4A4CA 1FF1A 1IGVA 4P2YB 3DVKA 1QTXA 4PALA 3BUXB 4NQGA 4E68A 3CLNA 4MRXA 2WORA 1ALVA 2KI4B 4MZKA 1IKUA 3EKJA 5KTYA 3VROA 1A29A 1CDLA 4CPVA 1Y1AA 2OTGB 1Y6WA 3NXAA 1SW8A 4AQJA 3TS5C 2KQ6A 3BQ3A 2M97A 4OVNF 2KFFA 5I2LA 1FPWA 2I7AA 2KHNA 3PM8A 4BY4A 1FI6A 2K7CA 1GJYA 1OQPA 2KGRA 2K7OA 2LHIA 2LMVA 4PHKA 3FS7A 2LNKA 1DJZA 4YBHB 5CSJA 1CLMA 1OMRA 4DS7A 3DF0A 3KF9A 1KFUL 1N0YA 3O78A 4GGFA 1YVLA 4R1EA 2K7DA 1W7IB 4YGDB 4WQ2A 2BL0B 2V53A 1MXEA 1B7TY 4HRHA 2JQ6A 4PHNA 3EK8A 4PDZA 3FWCA 5CSIA 1SL8A 1TN4A 1GGWA 3EVRA 1J1DA 3TDIA 1D1OA 1SRAA 5JJGA 1XFUO 5AFPA 1EXRA 1G4YR 1S5GZ 2Y4QA 1TNQA 1YRTB 1WLMA 1TCOB 3O4YA 1NPQA 4C0JA 2EHBA 1R6PA 2NLNA 4OKHA 5DKRA 1RROA 2KGBC 1GQMA 5HKZA 1S5GY 1CFFA 2MA2A 1LA3A 2NZ0A 3H4SE 3IQQA 1JWDA 2L50A 1RFJA 1PALA 3AKAA 2CT9A 3SG6A 2K0JA 2MLEC 4YI8A 2JNFA 2L0PA 2I94A 1NX0A 4USLA 1DGVA 1R2UA 2IS9A 3RLZA 5JOLA 3LLEA 2F8PA 1BT6A 4DIRA 1BR4B 1UHJA 2BECA 2MJWB 1WRKA 2KSPA 4D1EA 1FI5A 4QJ4B 2LUCA 3OB1B 2KI6D 1J55A 1KSMA 2H61C 4OR9B 4TNCA 1J1EA 1MQ1A 2KI4C 1BMOA 4XJKB 1U5IA 2P6BB 1DJGA 5B8IB 1DJIA 2PVBA 4QJ3B 1DJWA 1RECA 3O2PA 4YGAA 1DJYA 1VRKA 3GK2A 4JPZB 4CLNA 3OX6A 1OOJA 2JC2A 5HKYA 2MRDA 1SL9A 1UWOA 2JWWA 2E30A 4CFRA 2M9GA 5AEQA 3EK7A 1OMVA 4N5XA 4JQ0D 1PVBA 3FIAA 4GFTA 2JU0A 1CFPA 2LM5A 1CNPA 2FOTA 2O60A 3OHMB 1A03A 3ZNIA 4ORAB 2NCPA 1S36A 4MN0A 3PSRA 2FJUB 1CB1A 1QVIY 1NX2A 4MSPA 3KEVA 3JTDB 1BU3A 2RGIA 1KWOC 5G08A 1F8HA 2LMTA 4YGBB 2KBIA 5AXIA 1NYAA 5CPVA 1QLKA 2BE6A 1YUTA 3SG7A 1W7JB 4FTGA 5IBWA 1N2DA 1MR8A 2LVVA 4L9MA 5D7FA 5PALA 1Y1XA 3RM1A 2NCOA 1BLQA 1SKTA 5HLVA 1IJ5A 1K8UA 3I5GB 3I5HC 2HETA 2BBNA 2LANA 1F71A 2M7NA 2L2EA 1PK0D 3PN7C 1EG4A 2JRFA 1WRLA 1XK4C 4GGFC 4HRGA 4WRIA 1KFXL 2I18A 1UUSA 2JXCA 3GK1A 2KAXA 2KAYA 3SIBA 3CS1A 4CFQA 2ZN8A 4MZLA 4AOMA 1SNLA 3SJSA 1L2OB 2R2IA 2L4HA 1CTRA 3D10A 3LK1A 4GBAA 3ZWHA 1K9UA 3FWBA 3AAKA 1HT9A 1JC2A 1DVIA 2G2BA 1ODBA 2NXQA 1AUIB 3CTNA 1UHIA 2JOJA 1BF5A 1NSHA 1QX2A 2CTNA 1YURA 2M0RA 3CZTX 1DJXA 1MXLC 1J7PA 1ZMZA 4ICBA 1ZFSA 3OP0A 5HKWA 4YGCB 3NSIA 3M0WA 2ZN9A 2BCXA 1J7OA 1LXFC 1DF0A 2JZIA 3WXAA 4F0ZB 1PSBA 2ISDA 3SIAA 1SK6D 1KSOA 2PRUA 2JTTA 1V1FA 4YGEB 3I5IB 3C1VA 1C07A 1AHRA 1S26D 3D0YB 1PSRA 3AKBA 4NDBA 4M2QA 3BUMB 3VRRA 3NSKA 2HQ8A 1QATA 1AP4A 1BOCA 1YVHA 1MF8B 1KK8C 3BUWB 1UHNA 3QRXA 3BUOB 2GGZA 1QJTA 4NDCA 2EC6C 1NIWA 3CR5X 1NX1A 3PN7B 1DMOA 3OX5A 1SR6C 1TRFA 2FCDA 2WCFA 1QVIZ 4I5LB 1RTP1 1YR5A 1AJ4A 4GNKB 4ETOA 3KHEA 2LMUA 1LA0A 5TNCA 1AK8A 1CM4A 2KNEA 2BCAA 3VRQA 2JT3A 4GPLB 4MLWA 2MBXA 2VRGA 2ZRSA 1F4OA 1YUUA 3VRPA 1KFXS 1XYDA 4MVFA 3I5FC 1Y1UA 1B1GA 1K2HA 1TNPA 2LVIA 2BBMA 3BOWB 4PHMA 3HX4A 3A4UB 4XJKA 1ZUZA 5DKNA 5KSZA 1Y0VH 2CBLA 1JFJA 1N65A 2COLB 4GGNA 4C0KA 1XFVO 3CR2A 2Q91A 2PASA 4I5NB 1MWNA 1NWDA 2AMIA 5ER5A 3TUYB 1CKKA 1K9KA 3TDUA 3AAJA 4PE0A 1QASA 4M2OA 1SYMA 2MAZA 2CXJA 4N1FA 3BUNB 2CNPA 1PULA 1EG3A 1QS7A 1BR1B 1B8LA 2HPSA 2KDHA 5FYXA 4PE4A 1AVSA 4ORCB 1M63B 2ZNDA 3IQOA 2JT8A
chains in the Genus database with same CATH superfamily
2F3YA 3B88A 2I2RE 3PLFB 1NCZA 3MSEB 2L5YA 3R1VA 2L98A 1S1EA 3E3RA 1E8AA 1UHKA 1SY9A 4MEWA 3PALA 4HREE 2M29A 2MHHA 4MRYA 4OCIA 1SPYA 2HF5A 2KFGA 1JF0A 2Y1NA 1JF2A 5I2OA 1BG1A 2Q4UA 3SS5A 3NSLA 2JXLA 4OV2A 1S3PA 4YRUA 1K90D 2LP2A 2LUXA 4INXA 1QX7A 1M45A 1RK9A 1XK4A 2AUCA 3BYAA 4PE1A 2G9BA 4HSZA 3EG5B 1JFJA 1F4QA 2BKHB 3D78A 1LVCD 1QIWA 3LK0A 1F54A 4INWA 1UP5A 2H2KA 2E6WA 1C3ZA 2L4IA 2KYCA 2LVKA 1UHHA 1C7VA 1B9AA 1XFYO 1KWOB 2F2OA 2OS8C 1DT7B 1Q80A 1A2XA 5CSFA 3DVMA 2PALA 1L2OC 1CFDA 4OZDA 4ZCVA 1DJHA 3TS5B 3WHUB 1JFKA 2FJYA 5ER4X 3CWGA 3O6BA 3PFVA 5HLOA 1CFCA 1GGZA 1SR6B 5CSNA 1XVJA 2SCPA 2ZFDA 1SBJA 1X02A 4MBEA 1M46A 1B8CA 2LC5A 1WDCB 1WRZA 5FI2A 3CGAA 1ZACA 2D8NA 5GQQC 5BPJA 2K2FA 1QXPA 3FE6A 2WC8A 2BE4A 3UNWA 1XFZO 5DKQA 2LAPA 2QEOA 4JD9A 1RWYA 2WOSA 4IJ7A 4U8DA 5HYDA 1OW4A 1TTXA 2JULA 1V1GA 2KQYA 4IL1A 4BY5A 1CDNA 1QV0A 1XFXO 4P5OE 3I5IC 3HCMA 2WCJA 1M39A 1XFWO 3TUYC 1MUXA 2GV5A 1TCFA 1OOFA 5EL2A 1B7TZ 2GGMA 3NSOA 1MHOA 1B4CA 1LINA 3JTDC 5I94A 1A4PA 3EVVA 1A75B 1XO5A 2M3WA 3CDNA 1CLBA 1ZOTB 2CCMA 3DD4A 1BODA 2LV7A 2LLSA 2LHLA 3LCPC 2EC6B 4GAOA 1K9PA 1WY9A 2PMYA 4NDDA 1QV1A 4ORBB 1CMGA 4DCKA 3SS4A 1J7RA 2ZRTA 4PCWA 1IWQA 2A4JA 1S6CA 4Q04A 1U5IB 2Y5IA 1JUOA 3EKHA 4M2PA 3SG4A 1QIVA 1KK7Y 2F2PA 3Q8IA 3JVTB 1JBAA 3VGOA 2LCPA 2KAVA 4CIDA 1IJ6A 2K61A 4ZCUA 1IRJA 4JWQA 1L7ZA 1WDCC 1QLSA 3DYEA 3WNXB 3BJHA 1OOGA 3VRNA 1PRWA 3TDZA 1TUZA 1DF0B 2PSRA 2JNXA 1DTLA 4WQ3A 2LP3A 1SMGA 2KBMA 2P70A 1YUSA 2BCBA 1G8IA 1NX3A 3B6XA 4I5JA 1T14A 3DF0B 2KLDA 1YX8A 1K95A 1ALWA 2H61A 1YX7A 1K94A 1TNXA 2M49B 1QX5B 1CLLA 2Y1MA 2LE9B 4PE7A 2M1KB 3F45A 4PHJA 4A4BA 1NCXA 2K60A 2LVJA 2PYQA 4N1GA 3PATA 1OMDA 2K8MB 1OZOA 2BAPA 2HQWA 2M1UA 5K89A 1RJVA 2L51A 2WCEA 4MZJA 1OOHA 5F6TA 1G33A 1IG5A 1CDPA 1KFUS 1TIZA 2QPTA 4XYNA 4YI9A 5AANA 2KOTA 2WNDA 3I5FB 3K21A 2O5GA 1C7WA 1S6IA 5I2QA 3DVJA 1OSAA 2KFHA 3GOFA 1W9ZA 1ORGA 2OTGC 3KPXA 1IH0A 3CZ2A 3DVEA 3BXKA 3IF7A 5D3OA 1EL4A 1KK7Z 1KK8B 3BFBA 3S0BA 2KYFA 1KCYA 2BNXA 1KQVA 2ZNEA 1SCMB 1J7QA 2WCBA 1H4BA 3DXLA 3NHTA 1HQVA 1EJ3A 4AQIA 4PT1A 1AJ5A 2WC6A 1YTZC 2KLEA 5KU1A 1B47A 1LS8A 1B8RA 3EK4A 5AERA 2OS8B 2LLUA 3V2LA 3VB1A 3B7AA 3SG5A 1M31A 4UPGA 1F70A 3DY9A 3LL8B 1S6JA 1YRUB 1BJFA 3OGNA 1TNWA 1XA5A 2EGDA 3B86A 3K1EA 1SL7A 3CYZA 3TZ1A 2TN4A 4QJ5B 1F55A 1K93D 2OPOA 3ICBA 4DUQA 1NUBA 3A8RA 3GK4X 2L5XB 3JVTC 1FBVA 1FW4A 1CDMA 2BKIB 2JPTA 3L4LA 2M7LA 4DRWA 1H8BA 2F3ZA 2P71A 2FCEA 3D0YA 1CM1A 3I5GC 3B87A 3BOWA 4FQOA 1KQMC 1IQ5A 1UURA 3CR4X 5D69A 2KI6C 2QACA 1JSAA 1NP8A 3OB2B 2AAOA 2WCLA 1WLZA 1DGUA 3KO0A 2BL0C 2F33A 2K2AA 2MLFC 4C0LA 2DOQA 1EH2A 1CMFA 3I5HB 1NCYA 2JT0A 1GM0A 2JTZA 1KQMB 5I8NA 1LKJA 3WHTB 1SCMC 1PVAA 4I5KA 1A75A 2K7BA 1SCVA 2LLTA 5J3XA 2M8UA 1IQ3A 3BFAA 1TOPA 3SG2A 3EVUA 3SG3A 1OE9B 2QDIA 2ZKMX 4GUKA 3OBVA 1OZSA 1K96A 2B1UA 2SASA 4A4CA 1FF1A 1IGVA 4P2YB 3DVKA 1QTXA 4PALA 3BUXB 4NQGA 4E68A 3CLNA 4MRXA 2WORA 1ALVA 2KI4B 4MZKA 3D76A 1IKUA 3R1OA 2JPOA 3EKJA 1XFRA 5KTYA 3VROA 1A29A 1CDLA 4CPVA 1Y1AA 2OTGB 1Y6WA 3NXAA 1SW8A 4AQJA 3TS5C 2KQ6A 3S0FA 3BQ3A 2M97A 3N7HA 4OVNF 2KFFA 5I2LA 2YGUA 1FPWA 2I7AA 2KHNA 3PM8A 4BY4A 1FI6A 2K7CA 1GJYA 1OQPA 2KGRA 2K7OA 2LHIA 2LMVA 4PHKA 3FS7A 2LNKA 1DJZA 4YBHB 5CSJA 1CLMA 1OMRA 4DS7A 3DF0A 3KF9A 1KFUL 1N0YA 3O78A 4GGFA 1YVLA 2WCKA 4R1EA 2K7DA 1W7IB 4YGDB 4WQ2A 2BL0B 2V53A 3S0AA 1MXEA 1B7TY 4HRHA 3NGVA 2JQ6A 3PJIA 4JKTA 4PHNA 5FI6A 3EK8A 4PDZA 1OOIX 1C3YA 3FWCA 5CSIA 1SL8A 1TN4A 3D75A 1GGWA 3EVRA 1J1DA 3TDIA 1D1OA 1SRAA 2QEHA 3L4AA 5JJGA 1XFUO 2H8VA 5AFPA 3SS3A 1EXRA 1G4YR 1S5GZ 2Y4QA 1TNQA 1YRTB 1WLMA 1TCOB 3O4YA 2QEBA 1NPQA 4C0JA 2EHBA 3S0GA 1R6PA 2NLNA 4OKHA 5DKRA 1RROA 2KGBC 1GQMA 5HKZA 1S5GY 1CFFA 2MA2A 1LA3A 2NZ0A 3H4SE 3IQQA 1JWDA 2L50A 1RFJA 3CZ0A 1PALA 3AKAA 2CT9A 5HL1A 3SG6A 2K0JA 1DELA 2MLEC 2JNFA 2L0PA 2I94A 3PM2A 4YI8A 1NX0A 3S0DA 4USLA 1DGVA 1R2UA 3QMEA 2IS9A 3RLZA 3BFHA 5JOLA 2WCHA 3LLEA 1QWVA 2F8PA 1BT6A 4DIRA 1BR4B 1UHJA 2BECA 2MJWB 1WRKA 2KSPA 4D1EA 1FI5A 4QJ4B 2LUCA 3L47A 3OB1B 2KI6D 1J55A 1KSMA 2H61C 4OR9B 4TNCA 1J1EA 4FQTA 1MQ1A 2KI4C 1BMOA 4XJKB 1U5IA 2P6BB 1DJGA 4KYNA 5B8IB 1DJIA 2PVBA 4QJ3B 1DJWA 1RECA 3O2PA 4YGAA 1DJYA 1VRKA 3GK2A 4JPZB 4CLNA 3OX6A 1OOJA 2JC2A 5HKYA 2MRDA 1SL9A 1UWOA 2JWWA 2E30A 4CFRA 2M9GA 3CZ1A 5AEQA 3EK7A 1OMVA 4N5XA 4JQ0D 1PVBA 3FIAA 4GFTA 2JU0A 1CFPA 2LM5A 1CNPA 2FOTA 4F7FA 2O60A 3NHIA 3OHMB 3UO9A 3ZNIA 1A03A 4ORAB 2NCPA 1S36A 1DQEA 4MN0A 2WCMA 3PSRA 2FJUB 1CB1A 1QVIY 1NX2A 4MSPA 3KEVA 3JTDB 1BU3A 2RGIA 1KWOC 5G08A 1F8HA 2LMTA 4YGBB 2KBIA 5AXIA 1NYAA 5CPVA 1QLKA 1TWOA 3D73A 1SSEB 2BE6A 1YUTA 3SG7A 1W7JB 4FTGA 5IBWA 1N2DA 1MR8A 2LVVA 4L9MA 5D7FA 1Z2CB 5PALA 1Y1XA 3RM1A 2NCOA 1BLQA 1SKTA 5HLVA 1IJ5A 1K8UA 2ERBA 3I5GB 3I5HC 2HETA 2BBNA 2LANA 1F71A 2M7NA 2L2EA 1PK0D 3PN7C 1EG4A 2JRFA 1WRLA 1XK4C 3IVTA 4GGFC 4HRGA 3CABA 4WRIA 1KFXL 2I18A 1UUSA 2JXCA 3GK1A 2KAXA 2KAYA 2L2CA 3CS1A 3SIBA 4CFQA 2ZN8A 4MZLA 4AOMA 1SNLA 3SJSA 1L2OB 2R2IA 2L4HA 1CTRA 3D10A 3LK1A 4GBAA 3ZWHA 1K9UA 3FWBA 3AAKA 1HT9A 2QEVA 1DVIA 2G2BA 1JC2A 1ODBA 2NXQA 5DICA 1AUIB 3CTNA 1UHIA 2GTEA 2JOJA 3FE9A 1BF5A 1NSHA 1QX2A 2CTNA 1YURA 2M0RA 3CZTX 1DJXA 1MXLC 1J7PA 1ZMZA 4ICBA 1ZFSA 3OP0A 5HKWA 4YGCB 3NSIA 3M0WA 2ZN9A 2BCXA 1J7OA 1LXFC 1DF0A 2JZIA 3WXAA 4F0ZB 1TUJA 1PSBA 2ISDA 3RZSA 3SIAA 1SK6D 1KSOA 1Z4HA 2PRUA 2JTTA 1V1FA 4YGEB 3I5IB 3C1VA 1C07A 1AHRA 1S26D 3D0YB 1PSRA 3AKBA 4NDBA 4M2QA 3BUMB 3VRRA 3O4XA 3FE8A 3NSKA 2HQ8A 1QATA 1AP4A 1BOCA 1YVHA 1MF8B 1KK8C 3BUWB 1UHNA 3QRXA 3BUOB 2GGZA 1QJTA 4NDCA 2EC6C 1NIWA 3CR5X 1NX1A 3D77A 3PN7B 1DMOA 3OX5A 1SR6C 1TRFA 2FCDA 2WCFA 1QVIZ 1IIOA 4I5LB 1RTP1 1YR5A 5FI7A 1AJ4A 4GNKB 4ETOA 3KHEA 2LMUA 1LA0A 5TNCA 1AK8A 1CM4A 2KNEA 1DC1A 2BCAA 3VRQA 2JT3A 4GPLB 3D74A 4MLWA 2VRGA 2MBXA 2ZRSA 2KPHA 1P28A 1F4OA 1YUUA 3VRPA 1KFXS 1XYDA 4MVFA 3I5FC 1Y1UA 1B1GA 1K2HA 1TNPA 2LVIA 2BBMA 3BOWB 2WC5A 4PHMA 3HX4A 3R72A 1DEKA 3A4UB 1ZUZA 3DZTA 4XJKA 1Y0VH 2CBLA 5DKNA 1N65A 2COLB 4GGNA 5KSZA 4C0KA 1XFVO 3CR2A 2Q91A 2PASA 4I5NB 1MWNA 1NWDA 2AMIA 5ER5A 3TUYB 1CKKA 1K9KA 3R1PA 3TDUA 3AAJA 4PE0A 1QASA 4M2OA 1SYMA 2MAZA 2CXJA 2PQLA 4N1FA 3BUNB 2CNPA 1PULA 1EG3A 1QS7A 1BR1B 1B8LA 2HPSA 2KDHA 5FYXA 4PE4A 1AVSA 4ORCB 3S0EA 1M63B 2ZNDA 3IQOA 2JT8A
chains in the Genus database with same CATH topology
2F3YA 3PLFB 2I2RE 1NCZA 3MSEB 2L98A 1S1EA 3E3RA 1E8AA 1UHKA 1SY9A 4MEWA 3PALA 4HREE 2M29A 2MHHA 4MRYA 4OCIA 1SPYA 2HF5A 2KFGA 1JF0A 2Y1NA 1JF2A 5I2OA 1BG1A 2Q4UA 3NSLA 2JXLA 4OV2A 1S3PA 4YRUA 1K90D 2LP2A 2LUXA 1QX7A 1M45A 1RK9A 1XK4A 2AUCA 3BYAA 4PE1A 2G9BA 4HSZA 1F4QA 2BKHB 1LVCD 1QIWA 3LK0A 1F54A 1UP5A 2H2KA 2E6WA 2L4IA 2KYCA 2LVKA 1UHHA 1C7VA 1B9AA 1XFYO 1KWOB 2F2OA 2OS8C 1DT7B 1Q80A 1A2XA 5CSFA 3DVMA 2PALA 1L2OC 1CFDA 3TS5B 4ZCVA 1DJHA 3WHUB 1JFKA 5ER4X 3CWGA 3O6BA 3PFVA 5HLOA 1CFCA 1GGZA 1SR6B 5CSNA 1XVJA 2SCPA 2ZFDA 1SBJA 1X02A 4MBEA 1M46A 1B8CA 2LC5A 1WDCB 1WRZA 5GQQC 3CGAA 1ZACA 2D8NA 5BPJA 2K2FA 1QXPA 2WC8A 2BE4A 1XFZO 5DKQA 2LAPA 1RWYA 2WOSA 4U8DA 5HYDA 1TTXA 2JULA 1V1GA 2KQYA 4IL1A 4BY5A 1CDNA 1QV0A 1XFXO 4P5OE 3I5IC 3HCMA 1M39A 1XFWO 3TUYC 1MUXA 2GV5A 1TCFA 1B7TZ 2GGMA 3NSOA 1MHOA 1B4CA 1LINA 3JTDC 1A4PA 3EVVA 1A75B 1XO5A 2M3WA 1CLBA 1ZOTB 2CCMA 3DD4A 1BODA 2LV7A 2LLSA 2LHLA 3LCPC 2EC6B 4GAOA 1K9PA 1WY9A 2PMYA 4NDDA 1QV1A 4ORBB 1CMGA 4DCKA 1J7RA 2ZRTA 4PCWA 1IWQA 2A4JA 1S6CA 4Q04A 1U5IB 2Y5IA 1JUOA 3EKHA 4M2PA 3SG4A 1QIVA 1KK7Y 2F2PA 3JVTB 1JBAA 3VGOA 2LCPA 2KAVA 4CIDA 1IJ6A 2K61A 4ZCUA 1IRJA 4JWQA 1L7ZA 1WDCC 1QLSA 3WNXB 3VRNA 1PRWA 3TDZA 1DF0B 2PSRA 2JNXA 1DTLA 4WQ3A 2LP3A 1SMGA 2KBMA 4I5JA 1YUSA 2BCBA 1G8IA 1NX3A 3DF0B 1YX8A 1K95A 1ALWA 2H61A 1YX7A 1K94A 1TNXA 2M49B 1QX5B 1CLLA 2Y1MA 2LE9B 4PE7A 2M1KB 3F45A 4PHJA 4A4BA 1NCXA 2LVJA 4N1GA 3PATA 1OMDA 2K8MB 1OZOA 2HQWA 2M1UA 5K89A 1RJVA 2L51A 2WCEA 4MZJA 5F6TA 1G33A 1IG5A 1CDPA 1KFUS 1TIZA 2QPTA 4XYNA 4YI9A 5AANA 2KOTA 2WNDA 3I5FB 3K21A 2O5GA 1C7WA 1S6IA 5I2QA 3DVJA 1OSAA 2KFHA 3GOFA 3KPXA 1IH0A 2OTGC 3DVEA 3BXKA 3IF7A 1EL4A 1KK7Z 1KK8B 2KYFA 1KCYA 1KQVA 2ZNEA 1SCMB 1J7QA 2WCBA 1H4BA 1HQVA 1EJ3A 4AQIA 1AJ5A 1YTZC 5KU1A 1B47A 1B8RA 3EK4A 5AERA 2OS8B 2LLUA 3SG5A 1M31A 4UPGA 1F70A 3LL8B 1S6JA 1YRUB 1BJFA 1TNWA 1XA5A 2EGDA 1SL7A 3TZ1A 2TN4A 4QJ5B 1F55A 1K93D 2OPOA 3ICBA 4DUQA 1NUBA 3A8RA 3GK4X 2L5XB 3JVTC 1FBVA 1FW4A 1CDMA 2BKIB 2JPTA 2M7LA 4DRWA 1H8BA 2F3ZA 2FCEA 3D0YA 1CM1A 3I5GC 3BOWA 4FQOA 1KQMC 1IQ5A 1UURA 3CR4X 5D69A 2KI6C 2QACA 1JSAA 1NP8A 3OB2B 2AAOA 1WLZA 1DGUA 3KO0A 2BL0C 2F33A 2K2AA 2MLFC 4C0LA 2DOQA 1EH2A 1CMFA 3I5HB 1NCYA 2JT0A 2JTZA 1KQMB 5I8NA 1LKJA 3WHTB 1SCMC 1PVAA 4I5KA 1A75A 2K7BA 1SCVA 2LLTA 5J3XA 2M8UA 1IQ3A 1TOPA 3SG2A 3EVUA 3SG3A 1OE9B 4GUKA 2ZKMX 1OZSA 1K96A 2B1UA 2SASA 4A4CA 1FF1A 1IGVA 4P2YB 3DVKA 1QTXA 4PALA 3BUXB 4NQGA 4E68A 3CLNA 4MRXA 2WORA 1ALVA 2KI4B 4MZKA 1IKUA 3EKJA 5KTYA 3VROA 1A29A 1CDLA 4CPVA 1Y1AA 2OTGB 1Y6WA 3NXAA 1SW8A 4AQJA 3TS5C 2KQ6A 3BQ3A 2M97A 4OVNF 2KFFA 5I2LA 1FPWA 2I7AA 2KHNA 3PM8A 4BY4A 1FI6A 2K7CA 1GJYA 1OQPA 2KGRA 2K7OA 2LHIA 2LMVA 4PHKA 3FS7A 2LNKA 1DJZA 4YBHB 5CSJA 1CLMA 1OMRA 4DS7A 3DF0A 3KF9A 1KFUL 1N0YA 3O78A 4GGFA 1YVLA 4R1EA 2K7DA 1W7IB 4YGDB 4WQ2A 2BL0B 2V53A 1MXEA 1B7TY 4HRHA 2JQ6A 4PHNA 3EK8A 4PDZA 3FWCA 5CSIA 1SL8A 1TN4A 1GGWA 3EVRA 1J1DA 3TDIA 1D1OA 1SRAA 5JJGA 1XFUO 5AFPA 1EXRA 1G4YR 1S5GZ 2Y4QA 1TNQA 1YRTB 1WLMA 1TCOB 3O4YA 1NPQA 4C0JA 2EHBA 1R6PA 2NLNA 4OKHA 5DKRA 1RROA 2KGBC 1GQMA 5HKZA 1S5GY 1CFFA 2MA2A 1LA3A 2NZ0A 3H4SE 3IQQA 1JWDA 2L50A 1RFJA 1PALA 3AKAA 2CT9A 3SG6A 2K0JA 2MLEC 4YI8A 2JNFA 2L0PA 2I94A 1NX0A 4USLA 1DGVA 1R2UA 2IS9A 3RLZA 5JOLA 3LLEA 2F8PA 1BT6A 4DIRA 1BR4B 1UHJA 2BECA 2MJWB 1WRKA 2KSPA 4D1EA 1FI5A 4QJ4B 2LUCA 3OB1B 2KI6D 1J55A 1KSMA 2H61C 4OR9B 4TNCA 1J1EA 1MQ1A 2KI4C 1BMOA 4XJKB 1U5IA 2P6BB 1DJGA 5B8IB 1DJIA 2PVBA 4QJ3B 1DJWA 1RECA 3O2PA 4YGAA 1DJYA 1VRKA 3GK2A 4JPZB 4CLNA 3OX6A 1OOJA 2JC2A 5HKYA 2MRDA 1SL9A 1UWOA 2JWWA 2E30A 4CFRA 2M9GA 5AEQA 3EK7A 1OMVA 4N5XA 4JQ0D 1PVBA 3FIAA 4GFTA 2JU0A 1CFPA 2LM5A 1CNPA 2FOTA 2O60A 3OHMB 1A03A 3ZNIA 4ORAB 2NCPA 1S36A 4MN0A 3PSRA 2FJUB 1CB1A 1QVIY 1NX2A 4MSPA 3KEVA 3JTDB 1BU3A 2RGIA 1KWOC 5G08A 1F8HA 2LMTA 4YGBB 2KBIA 5AXIA 1NYAA 5CPVA 1QLKA 2BE6A 1YUTA 3SG7A 1W7JB 4FTGA 5IBWA 1N2DA 1MR8A 2LVVA 4L9MA 5D7FA 5PALA 1Y1XA 3RM1A 2NCOA 1BLQA 1SKTA 5HLVA 1IJ5A 1K8UA 3I5GB 3I5HC 2HETA 2BBNA 2LANA 1F71A 2M7NA 2L2EA 1PK0D 3PN7C 1EG4A 2JRFA 1WRLA 1XK4C 4GGFC 4HRGA 4WRIA 1KFXL 2I18A 1UUSA 2JXCA 3GK1A 2KAXA 2KAYA 3SIBA 3CS1A 4CFQA 2ZN8A 4MZLA 4AOMA 1SNLA 3SJSA 1L2OB 2R2IA 2L4HA 1CTRA 3D10A 3LK1A 4GBAA 3ZWHA 1K9UA 3FWBA 3AAKA 1HT9A 1JC2A 1DVIA 2G2BA 1ODBA 2NXQA 1AUIB 3CTNA 1UHIA 2JOJA 1BF5A 1NSHA 1QX2A 2CTNA 1YURA 2M0RA 3CZTX 1DJXA 1MXLC 1J7PA 1ZMZA 4ICBA 1ZFSA 3OP0A 5HKWA 4YGCB 3NSIA 3M0WA 2ZN9A 2BCXA 1J7OA 1LXFC 1DF0A 2JZIA 3WXAA 4F0ZB 1PSBA 2ISDA 3SIAA 1SK6D 1KSOA 2PRUA 2JTTA 1V1FA 4YGEB 3I5IB 3C1VA 1C07A 1AHRA 1S26D 3D0YB 1PSRA 3AKBA 4NDBA 4M2QA 3BUMB 3VRRA 3NSKA 2HQ8A 1QATA 1AP4A 1BOCA 1YVHA 1MF8B 1KK8C 3BUWB 1UHNA 3QRXA 3BUOB 2GGZA 1QJTA 4NDCA 2EC6C 1NIWA 3CR5X 1NX1A 3PN7B 1DMOA 3OX5A 1SR6C 1TRFA 2FCDA 2WCFA 1QVIZ 4I5LB 1RTP1 1YR5A 1AJ4A 4GNKB 4ETOA 3KHEA 2LMUA 1LA0A 5TNCA 1AK8A 1CM4A 2KNEA 2BCAA 3VRQA 2JT3A 4GPLB 4MLWA 2MBXA 2VRGA 2ZRSA 1F4OA 1YUUA 3VRPA 1KFXS 1XYDA 4MVFA 3I5FC 1Y1UA 1B1GA 1K2HA 1TNPA 2LVIA 2BBMA 3BOWB 4PHMA 3HX4A 3A4UB 4XJKA 1ZUZA 5DKNA 5KSZA 1Y0VH 2CBLA 1JFJA 1N65A 2COLB 4GGNA 4C0KA 1XFVO 3CR2A 2Q91A 2PASA 4I5NB 1MWNA 1NWDA 2AMIA 5ER5A 3TUYB 1CKKA 1K9KA 3TDUA 3AAJA 4PE0A 1QASA 4M2OA 1SYMA 2MAZA 2CXJA 4N1FA 3BUNB 2CNPA 1PULA 1EG3A 1QS7A 1BR1B 1B8LA 2HPSA 2KDHA 5FYXA 4PE4A 1AVSA 4ORCB 1M63B 2ZNDA 3IQOA 2JT8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F3Y A;  3PLF B;  2I2R E;  1NCZ A;  3MSE B;  2L98 A;  1S1E A;  3E3R A;  1E8A A;  1UHK A;  1SY9 A;  4MEW A;  3PAL A;  4HRE E;  2M29 A;  2MHH A;  4MRY A;  4OCI A;  1SPY A;  2HF5 A;  2KFG A;  1JF0 A;  2Y1N A;  1JF2 A;  5I2O A;  1BG1 A;  2Q4U A;  3NSL A;  2JXL A;  4OV2 A;  1S3P A;  4YRU A;  1K90 D;  2LP2 A;  2LUX A;  1QX7 A;  1M45 A;  1RK9 A;  1XK4 A;  2AUC A;  3BYA A;  4PE1 A;  2G9B A;  4HSZ A;  1F4Q A;  2BKH B;  1LVC D;  1QIW A;  3LK0 A;  1F54 A;  1UP5 A;  2H2K A;  2E6W A;  2L4I A;  2KYC A;  2LVK A;  1UHH A;  1C7V A;  1B9A A;  1XFY O;  1KWO B;  2F2O A;  2OS8 C;  1DT7 B;  1Q80 A;  1A2X A;  5CSF A;  3DVM A;  2PAL A;  1L2O C;  1CFD A;  3TS5 B;  4ZCV A;  1DJH A;  3WHU B;  1JFK A;  5ER4 X;  3CWG A;  3O6B A;  3PFV A;  5HLO A;  1CFC A;  1GGZ A;  1SR6 B;  5CSN A;  1XVJ A;  2SCP A;  2ZFD A;  1SBJ A;  1X02 A;  4MBE A;  1M46 A;  1B8C A;  2LC5 A;  1WDC B;  1WRZ A;  5GQQ C;  3CGA A;  1ZAC A;  2D8N A;  5BPJ A;  2K2F A;  1QXP A;  2WC8 A;  2BE4 A;  1XFZ O;  5DKQ A;  2LAP A;  1RWY A;  2WOS A;  4U8D A;  5HYD A;  1TTX A;  2JUL A;  1V1G A;  2KQY A;  4IL1 A;  4BY5 A;  1CDN A;  1QV0 A;  1XFX O;  4P5O E;  3I5I C;  3HCM A;  1M39 A;  1XFW O;  3TUY C;  1MUX A;  2GV5 A;  1TCF A;  1B7T Z;  2GGM A;  3NSO A;  1MHO A;  1B4C A;  1LIN A;  3JTD C;  1A4P A;  3EVV A;  1A75 B;  1XO5 A;  2M3W A;  1CLB A;  1ZOT B;  2CCM A;  3DD4 A;  1BOD A;  2LV7 A;  2LLS A;  2LHL A;  3LCP C;  2EC6 B;  4GAO A;  1K9P A;  1WY9 A;  2PMY A;  4NDD A;  1QV1 A;  4ORB B;  1CMG A;  4DCK A;  1J7R A;  2ZRT A;  4PCW A;  1IWQ A;  2A4J A;  1S6C A;  4Q04 A;  1U5I B;  2Y5I A;  1JUO A;  3EKH A;  4M2P A;  3SG4 A;  1QIV A;  1KK7 Y;  2F2P A;  3JVT B;  1JBA A;  3VGO A;  2LCP A;  2KAV A;  4CID A;  1IJ6 A;  2K61 A;  4ZCU A;  1IRJ A;  4JWQ A;  1L7Z A;  1WDC C;  1QLS A;  3WNX B;  3VRN A;  1PRW A;  3TDZ A;  1DF0 B;  2PSR A;  2JNX A;  1DTL A;  4WQ3 A;  2LP3 A;  1SMG A;  2KBM A;  4I5J A;  1YUS A;  2BCB A;  1G8I A;  1NX3 A;  3DF0 B;  1YX8 A;  1K95 A;  1ALW A;  2H61 A;  1YX7 A;  1K94 A;  1TNX A;  2M49 B;  1QX5 B;  1CLL A;  2Y1M A;  2LE9 B;  4PE7 A;  2M1K B;  3F45 A;  4PHJ A;  4A4B A;  1NCX A;  2LVJ A;  4N1G A;  3PAT A;  1OMD A;  2K8M B;  1OZO A;  2HQW A;  2M1U A;  5K89 A;  1RJV A;  2L51 A;  2WCE A;  4MZJ A;  5F6T A;  1G33 A;  1IG5 A;  1CDP A;  1KFU S;  1TIZ A;  2QPT A;  4XYN A;  4YI9 A;  5AAN A;  2KOT A;  2WND A;  3I5F B;  3K21 A;  2O5G A;  1C7W A;  1S6I A;  5I2Q A;  3DVJ A;  1OSA A;  2KFH A;  3GOF A;  3KPX A;  1IH0 A;  2OTG C;  3DVE A;  3BXK A;  3IF7 A;  1EL4 A;  1KK7 Z;  1KK8 B;  2KYF A;  1KCY A;  1KQV A;  2ZNE A;  1SCM B;  1J7Q A;  2WCB A;  1H4B A;  1HQV A;  1EJ3 A;  4AQI A;  1AJ5 A;  1YTZ C;  5KU1 A;  1B47 A;  1B8R A;  3EK4 A;  5AER A;  2OS8 B;  2LLU A;  3SG5 A;  1M31 A;  4UPG A;  1F70 A;  3LL8 B;  1S6J A;  1YRU B;  1BJF A;  1TNW A;  1XA5 A;  2EGD A;  1SL7 A;  3TZ1 A;  2TN4 A;  4QJ5 B;  1F55 A;  1K93 D;  2OPO A;  3ICB A;  4DUQ A;  1NUB A;  3A8R A;  3GK4 X;  2L5X B;  3JVT C;  1FBV A;  1FW4 A;  1CDM A;  2BKI B;  2JPT A;  2M7L A;  4DRW A;  1H8B A;  2F3Z A;  2FCE A;  3D0Y A;  1CM1 A;  3I5G C;  3BOW A;  4FQO A;  1KQM C;  1IQ5 A;  1UUR A;  3CR4 X;  5D69 A;  2KI6 C;  2QAC A;  1JSA A;  1NP8 A;  3OB2 B;  2AAO A;  1WLZ A;  1DGU A;  3KO0 A;  2BL0 C;  2F33 A;  2K2A A;  2MLF C;  4C0L A;  2DOQ A;  1EH2 A;  1CMF A;  3I5H B;  1NCY A;  2JT0 A;  2JTZ A;  1KQM B;  5I8N A;  1LKJ A;  3WHT B;  1SCM C;  1PVA A;  4I5K A;  1A75 A;  2K7B A;  1SCV A;  2LLT A;  5J3X A;  2M8U A;  1IQ3 A;  1TOP A;  3SG2 A;  3EVU A;  3SG3 A;  1OE9 B;  4GUK A;  2ZKM X;  1OZS A;  1K96 A;  2B1U A;  2SAS A;  4A4C A;  1FF1 A;  1IGV A;  4P2Y B;  3DVK A;  1QTX A;  4PAL A;  3BUX B;  4NQG A;  4E68 A;  3CLN A;  4MRX A;  2WOR A;  1ALV A;  2KI4 B;  4MZK A;  1IKU A;  3EKJ A;  5KTY A;  3VRO A;  1A29 A;  1CDL A;  4CPV A;  1Y1A A;  2OTG B;  1Y6W A;  3NXA A;  1SW8 A;  4AQJ A;  3TS5 C;  2KQ6 A;  3BQ3 A;  2M97 A;  4OVN F;  2KFF A;  5I2L A;  1FPW A;  2I7A A;  2KHN A;  3PM8 A;  4BY4 A;  1FI6 A;  2K7C A;  1GJY A;  1OQP A;  2KGR A;  2K7O A;  2LHI A;  2LMV A;  4PHK A;  3FS7 A;  2LNK A;  1DJZ A;  4YBH B;  5CSJ A;  1CLM A;  1OMR A;  4DS7 A;  3DF0 A;  3KF9 A;  1KFU L;  1N0Y A;  3O78 A;  4GGF A;  1YVL A;  4R1E A;  2K7D A;  1W7I B;  4YGD B;  4WQ2 A;  2BL0 B;  2V53 A;  1MXE A;  1B7T Y;  4HRH A;  2JQ6 A;  4PHN A;  3EK8 A;  4PDZ A;  3FWC A;  5CSI A;  1SL8 A;  1TN4 A;  1GGW A;  3EVR A;  1J1D A;  3TDI A;  1D1O A;  1SRA A;  5JJG A;  1XFU O;  5AFP A;  1EXR A;  1G4Y R;  1S5G Z;  2Y4Q A;  1TNQ A;  1YRT B;  1WLM A;  1TCO B;  3O4Y A;  1NPQ A;  4C0J A;  2EHB A;  1R6P A;  2NLN A;  4OKH A;  5DKR A;  1RRO A;  2KGB C;  1GQM A;  5HKZ A;  1S5G Y;  1CFF A;  2MA2 A;  1LA3 A;  2NZ0 A;  3H4S E;  3IQQ A;  1JWD A;  2L50 A;  1RFJ A;  1PAL A;  3AKA A;  2CT9 A;  3SG6 A;  2K0J A;  2MLE C;  4YI8 A;  2JNF A;  2L0P A;  2I94 A;  1NX0 A;  4USL A;  1DGV A;  1R2U A;  2IS9 A;  3RLZ A;  5JOL A;  3LLE A;  2F8P A;  1BT6 A;  4DIR A;  1BR4 B;  1UHJ A;  2BEC A;  2MJW B;  1WRK A;  2KSP A;  4D1E A;  1FI5 A;  4QJ4 B;  2LUC A;  3OB1 B;  2KI6 D;  1J55 A;  1KSM A;  2H61 C;  4OR9 B;  4TNC A;  1J1E A;  1MQ1 A;  2KI4 C;  1BMO A;  4XJK B;  1U5I A;  2P6B B;  1DJG A;  5B8I B;  1DJI A;  2PVB A;  4QJ3 B;  1DJW A;  1REC A;  3O2P A;  4YGA A;  1DJY A;  1VRK A;  3GK2 A;  4JPZ B;  4CLN A;  3OX6 A;  1OOJ A;  2JC2 A;  5HKY A;  2MRD A;  1SL9 A;  1UWO A;  2JWW A;  2E30 A;  4CFR A;  2M9G A;  5AEQ A;  3EK7 A;  1OMV A;  4N5X A;  4JQ0 D;  1PVB A;  3FIA A;  4GFT A;  2JU0 A;  1CFP A;  2LM5 A;  1CNP A;  2FOT A;  2O60 A;  3OHM B;  1A03 A;  3ZNI A;  4ORA B;  2NCP A;  1S36 A;  4MN0 A;  3PSR A;  2FJU B;  1CB1 A;  1QVI Y;  1NX2 A;  4MSP A;  3KEV A;  3JTD B;  1BU3 A;  2RGI A;  1KWO C;  5G08 A;  1F8H A;  2LMT A;  4YGB B;  2KBI A;  5AXI A;  1NYA A;  5CPV A;  1QLK A;  2BE6 A;  1YUT A;  3SG7 A;  1W7J B;  4FTG A;  5IBW A;  1N2D A;  1MR8 A;  2LVV A;  4L9M A;  5D7F A;  5PAL A;  1Y1X A;  3RM1 A;  2NCO A;  1BLQ A;  1SKT A;  5HLV A;  1IJ5 A;  1K8U A;  3I5G B;  3I5H C;  2HET A;  2BBN A;  2LAN A;  1F71 A;  2M7N A;  2L2E A;  1PK0 D;  3PN7 C;  1EG4 A;  2JRF A;  1WRL A;  1XK4 C;  4GGF C;  4HRG A;  4WRI A;  1KFX L;  2I18 A;  1UUS A;  2JXC A;  3GK1 A;  2KAX A;  2KAY A;  3SIB A;  3CS1 A;  4CFQ A;  2ZN8 A;  4MZL A;  4AOM A;  1SNL A;  3SJS A;  1L2O B;  2R2I A;  2L4H A;  1CTR A;  3D10 A;  3LK1 A;  4GBA A;  3ZWH A;  1K9U A;  3FWB A;  3AAK A;  1HT9 A;  1JC2 A;  1DVI A;  2G2B A;  1ODB A;  2NXQ A;  1AUI B;  3CTN A;  1UHI A;  2JOJ A;  1BF5 A;  1NSH A;  1QX2 A;  2CTN A;  1YUR A;  2M0R A;  3CZT X;  1DJX A;  1MXL C;  1J7P A;  1ZMZ A;  4ICB A;  1ZFS A;  3OP0 A;  5HKW A;  4YGC B;  3NSI A;  3M0W A;  2ZN9 A;  2BCX A;  1J7O A;  1LXF C;  1DF0 A;  2JZI A;  3WXA A;  4F0Z B;  1PSB A;  2ISD A;  3SIA A;  1SK6 D;  1KSO A;  2PRU A;  2JTT A;  1V1F A;  4YGE B;  3I5I B;  3C1V A;  1C07 A;  1AHR A;  1S26 D;  3D0Y B;  1PSR A;  3AKB A;  4NDB A;  4M2Q A;  3BUM B;  3VRR A;  3NSK A;  2HQ8 A;  1QAT A;  1AP4 A;  1BOC A;  1YVH A;  1MF8 B;  1KK8 C;  3BUW B;  1UHN A;  3QRX A;  3BUO B;  2GGZ A;  1QJT A;  4NDC A;  2EC6 C;  1NIW A;  3CR5 X;  1NX1 A;  3PN7 B;  1DMO A;  3OX5 A;  1SR6 C;  1TRF A;  2FCD A;  2WCF A;  1QVI Z;  4I5L B;  1RTP 1;  1YR5 A;  1AJ4 A;  4GNK B;  4ETO A;  3KHE A;  2LMU A;  1LA0 A;  5TNC A;  1AK8 A;  1CM4 A;  2KNE A;  2BCA A;  3VRQ A;  2JT3 A;  4GPL B;  4MLW A;  2MBX A;  2VRG A;  2ZRS A;  1F4O A;  1YUU A;  3VRP A;  1KFX S;  1XYD A;  4MVF A;  3I5F C;  1Y1U A;  1B1G A;  1K2H A;  1TNP A;  2LVI A;  2BBM A;  3BOW B;  4PHM A;  3HX4 A;  3A4U B;  4XJK A;  1ZUZ A;  5DKN A;  5KSZ A;  1Y0V H;  2CBL A;  1JFJ A;  1N65 A;  2COL B;  4GGN A;  4C0K A;  1XFV O;  3CR2 A;  2Q91 A;  2PAS A;  4I5N B;  1MWN A;  1NWD A;  2AMI A;  5ER5 A;  3TUY B;  1CKK A;  1K9K A;  3TDU A;  3AAJ A;  4PE0 A;  1QAS A;  4M2O A;  1SYM A;  2MAZ A;  2CXJ A;  4N1F A;  3BUN B;  2CNP A;  1PUL A;  1EG3 A;  1QS7 A;  1BR1 B;  1B8L A;  2HPS A;  2KDH A;  5FYX A;  4PE4 A;  1AVS A;  4ORC B;  1M63 B;  2ZND A;  3IQO A;  2JT8 A; 
#chains in the Genus database with same CATH topology
 2F3Y A;  3B88 A;  2I2R E;  3PLF B;  1NCZ A;  3MSE B;  2L5Y A;  3R1V A;  2L98 A;  1S1E A;  3E3R A;  1E8A A;  1UHK A;  1SY9 A;  4MEW A;  3PAL A;  4HRE E;  2M29 A;  2MHH A;  4MRY A;  4OCI A;  1SPY A;  2HF5 A;  2KFG A;  1JF0 A;  2Y1N A;  1JF2 A;  5I2O A;  1BG1 A;  2Q4U A;  3SS5 A;  3NSL A;  2JXL A;  4OV2 A;  1S3P A;  4YRU A;  1K90 D;  2LP2 A;  2LUX A;  4INX A;  1QX7 A;  1M45 A;  1RK9 A;  1XK4 A;  2AUC A;  3BYA A;  4PE1 A;  2G9B A;  4HSZ A;  3EG5 B;  1JFJ A;  1F4Q A;  2BKH B;  3D78 A;  1LVC D;  1QIW A;  3LK0 A;  1F54 A;  4INW A;  1UP5 A;  2H2K A;  2E6W A;  1C3Z A;  2L4I A;  2KYC A;  2LVK A;  1UHH A;  1C7V A;  1B9A A;  1XFY O;  1KWO B;  2F2O A;  2OS8 C;  1DT7 B;  1Q80 A;  1A2X A;  5CSF A;  3DVM A;  2PAL A;  1L2O C;  1CFD A;  4OZD A;  4ZCV A;  1DJH A;  3TS5 B;  3WHU B;  1JFK A;  2FJY A;  5ER4 X;  3CWG A;  3O6B A;  3PFV A;  5HLO A;  1CFC A;  1GGZ A;  1SR6 B;  5CSN A;  1XVJ A;  2SCP A;  2ZFD A;  1SBJ A;  1X02 A;  4MBE A;  1M46 A;  1B8C A;  2LC5 A;  1WDC B;  1WRZ A;  5FI2 A;  3CGA A;  1ZAC A;  2D8N A;  5GQQ C;  5BPJ A;  2K2F A;  1QXP A;  3FE6 A;  2WC8 A;  2BE4 A;  3UNW A;  1XFZ O;  5DKQ A;  2LAP A;  2QEO A;  4JD9 A;  1RWY A;  2WOS A;  4IJ7 A;  4U8D A;  5HYD A;  1OW4 A;  1TTX A;  2JUL A;  1V1G A;  2KQY A;  4IL1 A;  4BY5 A;  1CDN A;  1QV0 A;  1XFX O;  4P5O E;  3I5I C;  3HCM A;  2WCJ A;  1M39 A;  1XFW O;  3TUY C;  1MUX A;  2GV5 A;  1TCF A;  1OOF A;  5EL2 A;  1B7T Z;  2GGM A;  3NSO A;  1MHO A;  1B4C A;  1LIN A;  3JTD C;  5I94 A;  1A4P A;  3EVV A;  1A75 B;  1XO5 A;  2M3W A;  3CDN A;  1CLB A;  1ZOT B;  2CCM A;  3DD4 A;  1BOD A;  2LV7 A;  2LLS A;  2LHL A;  3LCP C;  2EC6 B;  4GAO A;  1K9P A;  1WY9 A;  2PMY A;  4NDD A;  1QV1 A;  4ORB B;  1CMG A;  4DCK A;  3SS4 A;  1J7R A;  2ZRT A;  4PCW A;  1IWQ A;  2A4J A;  1S6C A;  4Q04 A;  1U5I B;  2Y5I A;  1JUO A;  3EKH A;  4M2P A;  3SG4 A;  1QIV A;  1KK7 Y;  2F2P A;  3Q8I A;  3JVT B;  1JBA A;  3VGO A;  2LCP A;  2KAV A;  4CID A;  1IJ6 A;  2K61 A;  4ZCU A;  1IRJ A;  4JWQ A;  1L7Z A;  1WDC C;  1QLS A;  3DYE A;  3WNX B;  3BJH A;  1OOG A;  3VRN A;  1PRW A;  3TDZ A;  1TUZ A;  1DF0 B;  2PSR A;  2JNX A;  1DTL A;  4WQ3 A;  2LP3 A;  1SMG A;  2KBM A;  2P70 A;  1YUS A;  2BCB A;  1G8I A;  1NX3 A;  3B6X A;  4I5J A;  1T14 A;  3DF0 B;  2KLD A;  1YX8 A;  1K95 A;  1ALW A;  2H61 A;  1YX7 A;  1K94 A;  1TNX A;  2M49 B;  1QX5 B;  1CLL A;  2Y1M A;  2LE9 B;  4PE7 A;  2M1K B;  3F45 A;  4PHJ A;  4A4B A;  1NCX A;  2K60 A;  2LVJ A;  2PYQ A;  4N1G A;  3PAT A;  1OMD A;  2K8M B;  1OZO A;  2BAP A;  2HQW A;  2M1U A;  5K89 A;  1RJV A;  2L51 A;  2WCE A;  4MZJ A;  1OOH A;  5F6T A;  1G33 A;  1IG5 A;  1CDP A;  1KFU S;  1TIZ A;  2QPT A;  4XYN A;  4YI9 A;  5AAN A;  2KOT A;  2WND A;  3I5F B;  3K21 A;  2O5G A;  1C7W A;  1S6I A;  5I2Q A;  3DVJ A;  1OSA A;  2KFH A;  3GOF A;  1W9Z A;  1ORG A;  2OTG C;  3KPX A;  1IH0 A;  3CZ2 A;  3DVE A;  3BXK A;  3IF7 A;  5D3O A;  1EL4 A;  1KK7 Z;  1KK8 B;  3BFB A;  3S0B A;  2KYF A;  1KCY A;  2BNX A;  1KQV A;  2ZNE A;  1SCM B;  1J7Q A;  2WCB A;  1H4B A;  3DXL A;  3NHT A;  1HQV A;  1EJ3 A;  4AQI A;  4PT1 A;  1AJ5 A;  2WC6 A;  1YTZ C;  2KLE A;  5KU1 A;  1B47 A;  1LS8 A;  1B8R A;  3EK4 A;  5AER A;  2OS8 B;  2LLU A;  3V2L A;  3VB1 A;  3B7A A;  3SG5 A;  1M31 A;  4UPG A;  1F70 A;  3DY9 A;  3LL8 B;  1S6J A;  1YRU B;  1BJF A;  3OGN A;  1TNW A;  1XA5 A;  2EGD A;  3B86 A;  3K1E A;  1SL7 A;  3CYZ A;  3TZ1 A;  2TN4 A;  4QJ5 B;  1F55 A;  1K93 D;  2OPO A;  3ICB A;  4DUQ A;  1NUB A;  3A8R A;  3GK4 X;  2L5X B;  3JVT C;  1FBV A;  1FW4 A;  1CDM A;  2BKI B;  2JPT A;  3L4L A;  2M7L A;  4DRW A;  1H8B A;  2F3Z A;  2P71 A;  2FCE A;  3D0Y A;  1CM1 A;  3I5G C;  3B87 A;  3BOW A;  4FQO A;  1KQM C;  1IQ5 A;  1UUR A;  3CR4 X;  5D69 A;  2KI6 C;  2QAC A;  1JSA A;  1NP8 A;  3OB2 B;  2AAO A;  2WCL A;  1WLZ A;  1DGU A;  3KO0 A;  2BL0 C;  2F33 A;  2K2A A;  2MLF C;  4C0L A;  2DOQ A;  1EH2 A;  1CMF A;  3I5H B;  1NCY A;  2JT0 A;  1GM0 A;  2JTZ A;  1KQM B;  5I8N A;  1LKJ A;  3WHT B;  1SCM C;  1PVA A;  4I5K A;  1A75 A;  2K7B A;  1SCV A;  2LLT A;  5J3X A;  2M8U A;  1IQ3 A;  3BFA A;  1TOP A;  3SG2 A;  3EVU A;  3SG3 A;  1OE9 B;  2QDI A;  2ZKM X;  4GUK A;  3OBV A;  1OZS A;  1K96 A;  2B1U A;  2SAS A;  4A4C A;  1FF1 A;  1IGV A;  4P2Y B;  3DVK A;  1QTX A;  4PAL A;  3BUX B;  4NQG A;  4E68 A;  3CLN A;  4MRX A;  2WOR A;  1ALV A;  2KI4 B;  4MZK A;  3D76 A;  1IKU A;  3R1O A;  2JPO A;  3EKJ A;  1XFR A;  5KTY A;  3VRO A;  1A29 A;  1CDL A;  4CPV A;  1Y1A A;  2OTG B;  1Y6W A;  3NXA A;  1SW8 A;  4AQJ A;  3TS5 C;  2KQ6 A;  3S0F A;  3BQ3 A;  2M97 A;  3N7H A;  4OVN F;  2KFF A;  5I2L A;  2YGU A;  1FPW A;  2I7A A;  2KHN A;  3PM8 A;  4BY4 A;  1FI6 A;  2K7C A;  1GJY A;  1OQP A;  2KGR A;  2K7O A;  2LHI A;  2LMV A;  4PHK A;  3FS7 A;  2LNK A;  1DJZ A;  4YBH B;  5CSJ A;  1CLM A;  1OMR A;  4DS7 A;  3DF0 A;  3KF9 A;  1KFU L;  1N0Y A;  3O78 A;  4GGF A;  1YVL A;  2WCK A;  4R1E A;  2K7D A;  1W7I B;  4YGD B;  4WQ2 A;  2BL0 B;  2V53 A;  3S0A A;  1MXE A;  1B7T Y;  4HRH A;  3NGV A;  2JQ6 A;  3PJI A;  4JKT A;  4PHN A;  5FI6 A;  3EK8 A;  4PDZ A;  1OOI X;  1C3Y A;  3FWC A;  5CSI A;  1SL8 A;  1TN4 A;  3D75 A;  1GGW A;  3EVR A;  1J1D A;  3TDI A;  1D1O A;  1SRA A;  2QEH A;  3L4A A;  5JJG A;  1XFU O;  2H8V A;  5AFP A;  3SS3 A;  1EXR A;  1G4Y R;  1S5G Z;  2Y4Q A;  1TNQ A;  1YRT B;  1WLM A;  1TCO B;  3O4Y A;  2QEB A;  1NPQ A;  4C0J A;  2EHB A;  3S0G A;  1R6P A;  2NLN A;  4OKH A;  5DKR A;  1RRO A;  2KGB C;  1GQM A;  5HKZ A;  1S5G Y;  1CFF A;  2MA2 A;  1LA3 A;  2NZ0 A;  3H4S E;  3IQQ A;  1JWD A;  2L50 A;  1RFJ A;  3CZ0 A;  1PAL A;  3AKA A;  2CT9 A;  5HL1 A;  3SG6 A;  2K0J A;  1DEL A;  2MLE C;  2JNF A;  2L0P A;  2I94 A;  3PM2 A;  4YI8 A;  1NX0 A;  3S0D A;  4USL A;  1DGV A;  1R2U A;  3QME A;  2IS9 A;  3RLZ A;  3BFH A;  5JOL A;  2WCH A;  3LLE A;  1QWV A;  2F8P A;  1BT6 A;  4DIR A;  1BR4 B;  1UHJ A;  2BEC A;  2MJW B;  1WRK A;  2KSP A;  4D1E A;  1FI5 A;  4QJ4 B;  2LUC A;  3L47 A;  3OB1 B;  2KI6 D;  1J55 A;  1KSM A;  2H61 C;  4OR9 B;  4TNC A;  1J1E A;  4FQT A;  1MQ1 A;  2KI4 C;  1BMO A;  4XJK B;  1U5I A;  2P6B B;  1DJG A;  4KYN A;  5B8I B;  1DJI A;  2PVB A;  4QJ3 B;  1DJW A;  1REC A;  3O2P A;  4YGA A;  1DJY A;  1VRK A;  3GK2 A;  4JPZ B;  4CLN A;  3OX6 A;  1OOJ A;  2JC2 A;  5HKY A;  2MRD A;  1SL9 A;  1UWO A;  2JWW A;  2E30 A;  4CFR A;  2M9G A;  3CZ1 A;  5AEQ A;  3EK7 A;  1OMV A;  4N5X A;  4JQ0 D;  1PVB A;  3FIA A;  4GFT A;  2JU0 A;  1CFP A;  2LM5 A;  1CNP A;  2FOT A;  4F7F A;  2O60 A;  3NHI A;  3OHM B;  3UO9 A;  3ZNI A;  1A03 A;  4ORA B;  2NCP A;  1S36 A;  1DQE A;  4MN0 A;  2WCM A;  3PSR A;  2FJU B;  1CB1 A;  1QVI Y;  1NX2 A;  4MSP A;  3KEV A;  3JTD B;  1BU3 A;  2RGI A;  1KWO C;  5G08 A;  1F8H A;  2LMT A;  4YGB B;  2KBI A;  5AXI A;  1NYA A;  5CPV A;  1QLK A;  1TWO A;  3D73 A;  1SSE B;  2BE6 A;  1YUT A;  3SG7 A;  1W7J B;  4FTG A;  5IBW A;  1N2D A;  1MR8 A;  2LVV A;  4L9M A;  5D7F A;  1Z2C B;  5PAL A;  1Y1X A;  3RM1 A;  2NCO A;  1BLQ A;  1SKT A;  5HLV A;  1IJ5 A;  1K8U A;  2ERB A;  3I5G B;  3I5H C;  2HET A;  2BBN A;  2LAN A;  1F71 A;  2M7N A;  2L2E A;  1PK0 D;  3PN7 C;  1EG4 A;  2JRF A;  1WRL A;  1XK4 C;  3IVT A;  4GGF C;  4HRG A;  3CAB A;  4WRI A;  1KFX L;  2I18 A;  1UUS A;  2JXC A;  3GK1 A;  2KAX A;  2KAY A;  2L2C A;  3CS1 A;  3SIB A;  4CFQ A;  2ZN8 A;  4MZL A;  4AOM A;  1SNL A;  3SJS A;  1L2O B;  2R2I A;  2L4H A;  1CTR A;  3D10 A;  3LK1 A;  4GBA A;  3ZWH A;  1K9U A;  3FWB A;  3AAK A;  1HT9 A;  2QEV A;  1DVI A;  2G2B A;  1JC2 A;  1ODB A;  2NXQ A;  5DIC A;  1AUI B;  3CTN A;  1UHI A;  2GTE A;  2JOJ A;  3FE9 A;  1BF5 A;  1NSH A;  1QX2 A;  2CTN A;  1YUR A;  2M0R A;  3CZT X;  1DJX A;  1MXL C;  1J7P A;  1ZMZ A;  4ICB A;  1ZFS A;  3OP0 A;  5HKW A;  4YGC B;  3NSI A;  3M0W A;  2ZN9 A;  2BCX A;  1J7O A;  1LXF C;  1DF0 A;  2JZI A;  3WXA A;  4F0Z B;  1TUJ A;  1PSB A;  2ISD A;  3RZS A;  3SIA A;  1SK6 D;  1KSO A;  1Z4H A;  2PRU A;  2JTT A;  1V1F A;  4YGE B;  3I5I B;  3C1V A;  1C07 A;  1AHR A;  1S26 D;  3D0Y B;  1PSR A;  3AKB A;  4NDB A;  4M2Q A;  3BUM B;  3VRR A;  3O4X A;  3FE8 A;  3NSK A;  2HQ8 A;  1QAT A;  1AP4 A;  1BOC A;  1YVH A;  1MF8 B;  1KK8 C;  3BUW B;  1UHN A;  3QRX A;  3BUO B;  2GGZ A;  1QJT A;  4NDC A;  2EC6 C;  1NIW A;  3CR5 X;  1NX1 A;  3D77 A;  3PN7 B;  1DMO A;  3OX5 A;  1SR6 C;  1TRF A;  2FCD A;  2WCF A;  1QVI Z;  1IIO A;  4I5L B;  1RTP 1;  1YR5 A;  5FI7 A;  1AJ4 A;  4GNK B;  4ETO A;  3KHE A;  2LMU A;  1LA0 A;  5TNC A;  1AK8 A;  1CM4 A;  2KNE A;  1DC1 A;  2BCA A;  3VRQ A;  2JT3 A;  4GPL B;  3D74 A;  4MLW A;  2VRG A;  2MBX A;  2ZRS A;  2KPH A;  1P28 A;  1F4O A;  1YUU A;  3VRP A;  1KFX S;  1XYD A;  4MVF A;  3I5F C;  1Y1U A;  1B1G A;  1K2H A;  1TNP A;  2LVI A;  2BBM A;  3BOW B;  2WC5 A;  4PHM A;  3HX4 A;  3R72 A;  1DEK A;  3A4U B;  1ZUZ A;  3DZT A;  4XJK A;  1Y0V H;  2CBL A;  5DKN A;  1N65 A;  2COL B;  4GGN A;  5KSZ A;  4C0K A;  1XFV O;  3CR2 A;  2Q91 A;  2PAS A;  4I5N B;  1MWN A;  1NWD A;  2AMI A;  5ER5 A;  3TUY B;  1CKK A;  1K9K A;  3R1P A;  3TDU A;  3AAJ A;  4PE0 A;  1QAS A;  4M2O A;  1SYM A;  2MAZ A;  2CXJ A;  2PQL A;  4N1F A;  3BUN B;  2CNP A;  1PUL A;  1EG3 A;  1QS7 A;  1BR1 B;  1B8L A;  2HPS A;  2KDH A;  5FYX A;  4PE4 A;  1AVS A;  4ORC B;  3S0E A;  1M63 B;  2ZND A;  3IQO A;  2JT8 A; 
#chains in the Genus database with same CATH homology
 2F3Y A;  3PLF B;  2I2R E;  1NCZ A;  3MSE B;  2L98 A;  1S1E A;  3E3R A;  1E8A A;  1UHK A;  1SY9 A;  4MEW A;  3PAL A;  4HRE E;  2M29 A;  2MHH A;  4MRY A;  4OCI A;  1SPY A;  2HF5 A;  2KFG A;  1JF0 A;  2Y1N A;  1JF2 A;  5I2O A;  1BG1 A;  2Q4U A;  3NSL A;  2JXL A;  4OV2 A;  1S3P A;  4YRU A;  1K90 D;  2LP2 A;  2LUX A;  1QX7 A;  1M45 A;  1RK9 A;  1XK4 A;  2AUC A;  3BYA A;  4PE1 A;  2G9B A;  4HSZ A;  1F4Q A;  2BKH B;  1LVC D;  1QIW A;  3LK0 A;  1F54 A;  1UP5 A;  2H2K A;  2E6W A;  2L4I A;  2KYC A;  2LVK A;  1UHH A;  1C7V A;  1B9A A;  1XFY O;  1KWO B;  2F2O A;  2OS8 C;  1DT7 B;  1Q80 A;  1A2X A;  5CSF A;  3DVM A;  2PAL A;  1L2O C;  1CFD A;  3TS5 B;  4ZCV A;  1DJH A;  3WHU B;  1JFK A;  5ER4 X;  3CWG A;  3O6B A;  3PFV A;  5HLO A;  1CFC A;  1GGZ A;  1SR6 B;  5CSN A;  1XVJ A;  2SCP A;  2ZFD A;  1SBJ A;  1X02 A;  4MBE A;  1M46 A;  1B8C A;  2LC5 A;  1WDC B;  1WRZ A;  5GQQ C;  3CGA A;  1ZAC A;  2D8N A;  5BPJ A;  2K2F A;  1QXP A;  2WC8 A;  2BE4 A;  1XFZ O;  5DKQ A;  2LAP A;  1RWY A;  2WOS A;  4U8D A;  5HYD A;  1TTX A;  2JUL A;  1V1G A;  2KQY A;  4IL1 A;  4BY5 A;  1CDN A;  1QV0 A;  1XFX O;  4P5O E;  3I5I C;  3HCM A;  1M39 A;  1XFW O;  3TUY C;  1MUX A;  2GV5 A;  1TCF A;  1B7T Z;  2GGM A;  3NSO A;  1MHO A;  1B4C A;  1LIN A;  3JTD C;  1A4P A;  3EVV A;  1A75 B;  1XO5 A;  2M3W A;  1CLB A;  1ZOT B;  2CCM A;  3DD4 A;  1BOD A;  2LV7 A;  2LLS A;  2LHL A;  3LCP C;  2EC6 B;  4GAO A;  1K9P A;  1WY9 A;  2PMY A;  4NDD A;  1QV1 A;  4ORB B;  1CMG A;  4DCK A;  1J7R A;  2ZRT A;  4PCW A;  1IWQ A;  2A4J A;  1S6C A;  4Q04 A;  1U5I B;  2Y5I A;  1JUO A;  3EKH A;  4M2P A;  3SG4 A;  1QIV A;  1KK7 Y;  2F2P A;  3JVT B;  1JBA A;  3VGO A;  2LCP A;  2KAV A;  4CID A;  1IJ6 A;  2K61 A;  4ZCU A;  1IRJ A;  4JWQ A;  1L7Z A;  1WDC C;  1QLS A;  3WNX B;  3VRN A;  1PRW A;  3TDZ A;  1DF0 B;  2PSR A;  2JNX A;  1DTL A;  4WQ3 A;  2LP3 A;  1SMG A;  2KBM A;  4I5J A;  1YUS A;  2BCB A;  1G8I A;  1NX3 A;  3DF0 B;  1YX8 A;  1K95 A;  1ALW A;  2H61 A;  1YX7 A;  1K94 A;  1TNX A;  2M49 B;  1QX5 B;  1CLL A;  2Y1M A;  2LE9 B;  4PE7 A;  2M1K B;  3F45 A;  4PHJ A;  4A4B A;  1NCX A;  2LVJ A;  4N1G A;  3PAT A;  1OMD A;  2K8M B;  1OZO A;  2HQW A;  2M1U A;  5K89 A;  1RJV A;  2L51 A;  2WCE A;  4MZJ A;  5F6T A;  1G33 A;  1IG5 A;  1CDP A;  1KFU S;  1TIZ A;  2QPT A;  4XYN A;  4YI9 A;  5AAN A;  2KOT A;  2WND A;  3I5F B;  3K21 A;  2O5G A;  1C7W A;  1S6I A;  5I2Q A;  3DVJ A;  1OSA A;  2KFH A;  3GOF A;  3KPX A;  1IH0 A;  2OTG C;  3DVE A;  3BXK A;  3IF7 A;  1EL4 A;  1KK7 Z;  1KK8 B;  2KYF A;  1KCY A;  1KQV A;  2ZNE A;  1SCM B;  1J7Q A;  2WCB A;  1H4B A;  1HQV A;  1EJ3 A;  4AQI A;  1AJ5 A;  1YTZ C;  5KU1 A;  1B47 A;  1B8R A;  3EK4 A;  5AER A;  2OS8 B;  2LLU A;  3SG5 A;  1M31 A;  4UPG A;  1F70 A;  3LL8 B;  1S6J A;  1YRU B;  1BJF A;  1TNW A;  1XA5 A;  2EGD A;  1SL7 A;  3TZ1 A;  2TN4 A;  4QJ5 B;  1F55 A;  1K93 D;  2OPO A;  3ICB A;  4DUQ A;  1NUB A;  3A8R A;  3GK4 X;  2L5X B;  3JVT C;  1FBV A;  1FW4 A;  1CDM A;  2BKI B;  2JPT A;  2M7L A;  4DRW A;  1H8B A;  2F3Z A;  2FCE A;  3D0Y A;  1CM1 A;  3I5G C;  3BOW A;  4FQO A;  1KQM C;  1IQ5 A;  1UUR A;  3CR4 X;  5D69 A;  2KI6 C;  2QAC A;  1JSA A;  1NP8 A;  3OB2 B;  2AAO A;  1WLZ A;  1DGU A;  3KO0 A;  2BL0 C;  2F33 A;  2K2A A;  2MLF C;  4C0L A;  2DOQ A;  1EH2 A;  1CMF A;  3I5H B;  1NCY A;  2JT0 A;  2JTZ A;  1KQM B;  5I8N A;  1LKJ A;  3WHT B;  1SCM C;  1PVA A;  4I5K A;  1A75 A;  2K7B A;  1SCV A;  2LLT A;  5J3X A;  2M8U A;  1IQ3 A;  1TOP A;  3SG2 A;  3EVU A;  3SG3 A;  1OE9 B;  4GUK A;  2ZKM X;  1OZS A;  1K96 A;  2B1U A;  2SAS A;  4A4C A;  1FF1 A;  1IGV A;  4P2Y B;  3DVK A;  1QTX A;  4PAL A;  3BUX B;  4NQG A;  4E68 A;  3CLN A;  4MRX A;  2WOR A;  1ALV A;  2KI4 B;  4MZK A;  1IKU A;  3EKJ A;  5KTY A;  3VRO A;  1A29 A;  1CDL A;  4CPV A;  1Y1A A;  2OTG B;  1Y6W A;  3NXA A;  1SW8 A;  4AQJ A;  3TS5 C;  2KQ6 A;  3BQ3 A;  2M97 A;  4OVN F;  2KFF A;  5I2L A;  1FPW A;  2I7A A;  2KHN A;  3PM8 A;  4BY4 A;  1FI6 A;  2K7C A;  1GJY A;  1OQP A;  2KGR A;  2K7O A;  2LHI A;  2LMV A;  4PHK A;  3FS7 A;  2LNK A;  1DJZ A;  4YBH B;  5CSJ A;  1CLM A;  1OMR A;  4DS7 A;  3DF0 A;  3KF9 A;  1KFU L;  1N0Y A;  3O78 A;  4GGF A;  1YVL A;  4R1E A;  2K7D A;  1W7I B;  4YGD B;  4WQ2 A;  2BL0 B;  2V53 A;  1MXE A;  1B7T Y;  4HRH A;  2JQ6 A;  4PHN A;  3EK8 A;  4PDZ A;  3FWC A;  5CSI A;  1SL8 A;  1TN4 A;  1GGW A;  3EVR A;  1J1D A;  3TDI A;  1D1O A;  1SRA A;  5JJG A;  1XFU O;  5AFP A;  1EXR A;  1G4Y R;  1S5G Z;  2Y4Q A;  1TNQ A;  1YRT B;  1WLM A;  1TCO B;  3O4Y A;  1NPQ A;  4C0J A;  2EHB A;  1R6P A;  2NLN A;  4OKH A;  5DKR A;  1RRO A;  2KGB C;  1GQM A;  5HKZ A;  1S5G Y;  1CFF A;  2MA2 A;  1LA3 A;  2NZ0 A;  3H4S E;  3IQQ A;  1JWD A;  2L50 A;  1RFJ A;  1PAL A;  3AKA A;  2CT9 A;  3SG6 A;  2K0J A;  2MLE C;  4YI8 A;  2JNF A;  2L0P A;  2I94 A;  1NX0 A;  4USL A;  1DGV A;  1R2U A;  2IS9 A;  3RLZ A;  5JOL A;  3LLE A;  2F8P A;  1BT6 A;  4DIR A;  1BR4 B;  1UHJ A;  2BEC A;  2MJW B;  1WRK A;  2KSP A;  4D1E A;  1FI5 A;  4QJ4 B;  2LUC A;  3OB1 B;  2KI6 D;  1J55 A;  1KSM A;  2H61 C;  4OR9 B;  4TNC A;  1J1E A;  1MQ1 A;  2KI4 C;  1BMO A;  4XJK B;  1U5I A;  2P6B B;  1DJG A;  5B8I B;  1DJI A;  2PVB A;  4QJ3 B;  1DJW A;  1REC A;  3O2P A;  4YGA A;  1DJY A;  1VRK A;  3GK2 A;  4JPZ B;  4CLN A;  3OX6 A;  1OOJ A;  2JC2 A;  5HKY A;  2MRD A;  1SL9 A;  1UWO A;  2JWW A;  2E30 A;  4CFR A;  2M9G A;  5AEQ A;  3EK7 A;  1OMV A;  4N5X A;  4JQ0 D;  1PVB A;  3FIA A;  4GFT A;  2JU0 A;  1CFP A;  2LM5 A;  1CNP A;  2FOT A;  2O60 A;  3OHM B;  1A03 A;  3ZNI A;  4ORA B;  2NCP A;  1S36 A;  4MN0 A;  3PSR A;  2FJU B;  1CB1 A;  1QVI Y;  1NX2 A;  4MSP A;  3KEV A;  3JTD B;  1BU3 A;  2RGI A;  1KWO C;  5G08 A;  1F8H A;  2LMT A;  4YGB B;  2KBI A;  5AXI A;  1NYA A;  5CPV A;  1QLK A;  2BE6 A;  1YUT A;  3SG7 A;  1W7J B;  4FTG A;  5IBW A;  1N2D A;  1MR8 A;  2LVV A;  4L9M A;  5D7F A;  5PAL A;  1Y1X A;  3RM1 A;  2NCO A;  1BLQ A;  1SKT A;  5HLV A;  1IJ5 A;  1K8U A;  3I5G B;  3I5H C;  2HET A;  2BBN A;  2LAN A;  1F71 A;  2M7N A;  2L2E A;  1PK0 D;  3PN7 C;  1EG4 A;  2JRF A;  1WRL A;  1XK4 C;  4GGF C;  4HRG A;  4WRI A;  1KFX L;  2I18 A;  1UUS A;  2JXC A;  3GK1 A;  2KAX A;  2KAY A;  3SIB A;  3CS1 A;  4CFQ A;  2ZN8 A;  4MZL A;  4AOM A;  1SNL A;  3SJS A;  1L2O B;  2R2I A;  2L4H A;  1CTR A;  3D10 A;  3LK1 A;  4GBA A;  3ZWH A;  1K9U A;  3FWB A;  3AAK A;  1HT9 A;  1JC2 A;  1DVI A;  2G2B A;  1ODB A;  2NXQ A;  1AUI B;  3CTN A;  1UHI A;  2JOJ A;  1BF5 A;  1NSH A;  1QX2 A;  2CTN A;  1YUR A;  2M0R A;  3CZT X;  1DJX A;  1MXL C;  1J7P A;  1ZMZ A;  4ICB A;  1ZFS A;  3OP0 A;  5HKW A;  4YGC B;  3NSI A;  3M0W A;  2ZN9 A;  2BCX A;  1J7O A;  1LXF C;  1DF0 A;  2JZI A;  3WXA A;  4F0Z B;  1PSB A;  2ISD A;  3SIA A;  1SK6 D;  1KSO A;  2PRU A;  2JTT A;  1V1F A;  4YGE B;  3I5I B;  3C1V A;  1C07 A;  1AHR A;  1S26 D;  3D0Y B;  1PSR A;  3AKB A;  4NDB A;  4M2Q A;  3BUM B;  3VRR A;  3NSK A;  2HQ8 A;  1QAT A;  1AP4 A;  1BOC A;  1YVH A;  1MF8 B;  1KK8 C;  3BUW B;  1UHN A;  3QRX A;  3BUO B;  2GGZ A;  1QJT A;  4NDC A;  2EC6 C;  1NIW A;  3CR5 X;  1NX1 A;  3PN7 B;  1DMO A;  3OX5 A;  1SR6 C;  1TRF A;  2FCD A;  2WCF A;  1QVI Z;  4I5L B;  1RTP 1;  1YR5 A;  1AJ4 A;  4GNK B;  4ETO A;  3KHE A;  2LMU A;  1LA0 A;  5TNC A;  1AK8 A;  1CM4 A;  2KNE A;  2BCA A;  3VRQ A;  2JT3 A;  4GPL B;  4MLW A;  2MBX A;  2VRG A;  2ZRS A;  1F4O A;  1YUU A;  3VRP A;  1KFX S;  1XYD A;  4MVF A;  3I5F C;  1Y1U A;  1B1G A;  1K2H A;  1TNP A;  2LVI A;  2BBM A;  3BOW B;  4PHM A;  3HX4 A;  3A4U B;  4XJK A;  1ZUZ A;  5DKN A;  5KSZ A;  1Y0V H;  2CBL A;  1JFJ A;  1N65 A;  2COL B;  4GGN A;  4C0K A;  1XFV O;  3CR2 A;  2Q91 A;  2PAS A;  4I5N B;  1MWN A;  1NWD A;  2AMI A;  5ER5 A;  3TUY B;  1CKK A;  1K9K A;  3TDU A;  3AAJ A;  4PE0 A;  1QAS A;  4M2O A;  1SYM A;  2MAZ A;  2CXJ A;  4N1F A;  3BUN B;  2CNP A;  1PUL A;  1EG3 A;  1QS7 A;  1BR1 B;  1B8L A;  2HPS A;  2KDH A;  5FYX A;  4PE4 A;  1AVS A;  4ORC B;  1M63 B;  2ZND A;  3IQO A;  2JT8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...