5D69A

Human calpain pef(s) with (2z,2z')-2,2'-disulfanediylbis(3-(6-iodoindol-3-yl)acrylic acid) bound
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
173
structure length
173
Chain Sequence
EEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Calpain small subunit 1
publication title Conformationally restricted calpain inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 61
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5d69A00
1KFUL 2KSPA 1C7VA 5AEQA 2LC5A 1EJ3A 2F33A 3VRRA 1HQVA 1DF0A 3VRNA 5BPJA 1AJ4A 1NCZA 3SG3A 1JF0A 4PE4A 2BECA 2OTGB 3ZNIA 1PSRA 4YGDB 2F3YA 2M7NA 2ISDA 3O6BA 4MSPA 1SCVA 2ZN8A 1U5IA 1QVIY 5ER4X 4YI9A 2KFHA 1C7WA 1B4CA 3DVMA 1XO5A 2Y4QA 2JU0A 2KHNA 2CCMA 1XK4C 3NSLA 1HT9A 3SG6A 1JF2A 2K0JA 3BUOB 3SIAA 3TDIA 4DUQA 1QX5B 2JC2A 1DTLA 2QPTA 4FQOA 2Q4UA 1RTP1 2M29A 1PULA 4NQGA 1K9KA 2MJWB 2COLB 2KOTA 4ZCUA 1S6JA 2AMIA 2JT3A 2EC6C 1LA3A 1AP4A 1F8HA 2Q91A 4I5LB 5AXIA 1CTRA 1K8UA 2LCPA 3I5GC 3CTNA 4MZLA 3I5FB 1PALA 2I7AA 2HETA 1UHKA 2NCOA 3EKHA 3VGOA 4JWQA 3JVTC 1OE9B 1VRKA 2Y5IA 4AQJA 2GGMA 1ZACA 2P6BB 4OCIA 4CFQA 3EVVA 2LANA 1GQMA 1IJ6A 1CKKA 3D0YA 1IGVA 3FWCA 2MLEC 3CWGA 3TDUA 1CDPA 4GAOA 3SJSA 4YGAA 1QS7A 1OOJA 2JTTA 4E68A 1UHJA 1FI6A 4ORCB 2PRUA 4XJKB 1EG4A 1SRAA 2HQWA 2M8UA 3WNXB 1F55A 1N0YA 3BQ3A 2I2RE 2E30A 4GGFA 2F8PA 3EK7A 1YUSA 3PM8A 1F70A 2CT9A 1KK7Y 2K2AA 3DVJA 5B8IB 1NX1A 1JWDA 3DVKA 4YGEB 1IKUA 1NCYA 1QASA 1R6PA 1TCFA 2MA2A 1CFDA 1K9UA 1A75A 1LINA 1YX8A 1JFKA 3H4SE 2VRGA 1M39A 1LA0A 5AERA 1W7JB 1XYDA 2WORA 1B7TZ 2KAVA 3WHUB 1OSAA 1EH2A 4MLWA 2JZIA 2BCAA 2LUXA 4IL1A 2MHHA 4NDBA 1MUXA 2K7DA 4GBAA 1L2OC 3AKBA 3RM1A 1H8BA 4PCWA 5D7FA 5HKYA 2K61A 1B1GA 5DKRA 5DKNA 1BT6A 2WCFA 1GGWA 1XA5A 1QX2A 5HKWA 4CLNA 1TRFA 1NIWA 2OS8C 3DF0B 3K21A 2FJUB 1K96A 1KFXL 1WDCC 2IS9A 3HX4A 1BR4B 3O4YA 4OVNF 1NP8A 5I2LA 1J7QA 2H2KA 2AUCA 4F0ZB 2JXCA 2JT8A 3ICBA 1EXRA 1IG5A 4C0JA 1CB1A 2KI6C 4Q04A 1WRLA 2M0RA 3OHMB 1OMDA 1IWQA 4D1EA 4QJ3B 4CFRA 1FW4A 1XVJA 4GGFC 2CXJA 1EG3A 1WLZA 3GK1A 5KU1A 1QIVA 2AAOA 3BOWB 1QVIZ 3TS5C 4QJ5B 1DJGA 3PSRA 2L2EA 2O5GA 3NSKA 3PFVA 2KYFA 3SG5A 3TUYC 1JSAA 1JUOA 2ZNEA 1PVAA 1S3PA 2JNFA 4GGNA 1V1GA 1XFWO 2L0PA 3I5IC 3EK4A 3AAKA 1BODA 4OV2A 3VRQA 1KK8C 2K7OA 2L4IA 2ZFDA 4HRHA 4ZCVA 4ETOA 2JNXA 1TIZA 1NCXA 1A4PA 4XJKA 3VROA 1XFVO 1ZFSA 2LAPA 3WXAA 2LVKA 1QIWA 1SKTA 2FCEA 1UP5A 3DD4A 4TNCA 1M31A 1ALVA 1D1OA 4I5JA 2NXQA 4PE0A 2KYCA 2L98A 3FS7A 1YUUA 2I18A 1Y0VH 1SCMB 2PMYA 1Y1XA 3BUXB 2PSRA 1BG1A 2HQ8A 2LVJA 2KBIA 1J1EA 3KF9A 4M2QA 2LE9B 1W7IB 2LLTA 2KI6D 3JTDB 1SL9A 4M2OA 1PRWA 2KI4C 3CLNA 5IBWA 1A03A 1F54A 1ZMZA 1CLMA 3KEVA 4AOMA 1SBJA 3OX5A 2BE6A 1IRJA 1SL7A 1UHHA 1F4QA 1YX7A 1K2HA 2A4JA 1IH0A 2LHIA 4A4CA 3EVRA 1PK0D 2KDHA 5DKQA 2ZKMX 2LMVA 4PE7A 4NDDA 1MXEA 4OKHA 4MBEA 4YBHB 4MVFA 4PHNA 1BR1B 3TZ1A 4A4BA 3I5GB 3WHTB 1B8CA 4HREE 3I5HB 2ZNDA 1QV1A 1CDMA 4CIDA 1B9AA 3LK0A 5TNCA 4YI8A 2K7BA 3AKAA 1TN4A 1NX3A 5I2OA 2KBMA 3OX6A 3NSOA 1KQMB 1Q80A 1UHIA 3GOFA 2M49B 1NX2A 1S6CA 1SK6D 2SASA 2WNDA 1K94A 1IQ5A 1WY9A 2M1UA 2MAZA 1S5GZ 1Y1UA 1ALWA 1S36A 5HKZA 1CFPA 1NSHA 3SIBA 3EKJA 1BMOA 1B8RA 1E8AA 1YUTA 3A8RA 4YGCB 1BJFA 1B47A 2F2OA 2JOJA 3AAJA 3FIAA 4GNKB 4PHKA 1OQPA 3MSEB 2BL0C 1YVLA 2LLSA 2LP3A 1J7OA 1RFJA 3BUMB 1SYMA 3PN7C 2BKIB 1DT7B 3GK2A 5FYXA 2V53A 1UUSA 5AANA 1A29A 1SR6B 2O60A 2KGBC 2L51A 1R2UA 5K89A 1UURA 2JRFA 1BU3A 2KFFA 2ZRSA 1DMOA 1RECA 1LXFC 1BF5A 1G4YR 3SG4A 5G08A 1N2DA 1WRKA 1KWOC 4DCKA 1GJYA 3KHEA 2KQYA 3BXKA 3LLEA 1L2OB 4PHMA 1SNLA 2F2PA 4GFTA 5I2QA 2WCEA 4HRGA 5KSZA 1M46A 1CDLA 1MWNA 3ZWHA 4AQIA 1QTXA 3CS1A 3KO0A 1SW8A 1CNPA 4U8DA 1JFJA 1SPYA 1V1FA 1XFUO 3DVEA 2GGZA 3LL8B 1TNPA 1JBAA 1RWYA 2LLUA 4R1EA 1SL8A 1NPQA 3LCPC 4PE1A 2MBXA 3BUNB 2ZRTA 4N1GA 1B7TY 2JT0A 1S6IA 1FBVA 1OMRA 1ZUZA 1RJVA 1QATA 4JQ0D 4WRIA 1RROA 3D10A 2JWWA 3EK8A 2CBLA 2LM5A 2LNKA 2WCBA 1DJXA 1B8LA 1LVCD 1TTXA 1KQVA 1J1DA 3GK4X 4MRYA 1SMGA 2M7LA 1NWDA 2G9BA 3CGAA 3TUYB 1G33A 2Y1MA 4YGBB 2F3ZA 2LP2A 4QJ4B 4YRUA 2LVVA 4I5KA 4FTGA 5CSNA 2PASA 4I5NB 4MZJA 2OTGC 2JQ6A 2L4HA 1ZOTB 1DJYA 4WQ2A 1PVBA 4PHJA 1YRTB 5HLOA 2LHLA 3LK1A 3E3RA 4CPVA 3BYAA 5F6TA 4ICBA 1FPWA 2G2BA 3PALA 4DRWA 2MLFC 1Y1AA 2KGRA 2SCPA 5HLVA 1CM4A 3M0WA 2BCXA 1DGUA 5I8NA 1WRZA 2BKHB 1SCMC 1QXPA 2TN4A 1F71A 1IJ5A 2K2FA 4OR9B 2ZN9A 5CSJA 1NUBA 4JPZB 4MZKA 2KAYA 4USLA 3VRPA 1DJHA 1LKJA 1KSMA 1DJWA 2EGDA 3NXAA 1S26D 2WOSA 4BY4A 4DIRA 1GGZA 3JTDC 2MRDA 5CSFA 5PALA 1M63B 2KI4B 3KPXA 5CPVA 1JC2A 5D69A 1EL4A 5J3XA 1AVSA 1KK7Z 2JULA 2QACA 1K93D 2EC6B 2K8MB 4ORAB 4C0KA 3OB1B 3I5FC 1MR8A 3DF0A 1XFZO 1BLQA 2M1KB 2BCBA 3CR2A 3JVTB 2KNEA 1J7PA 2CNPA 1G8IA 1DJIA 3A4UB 4MN0A 3I5HC 2KAXA 2D8NA 2KQ6A 2LMUA 1L7ZA 2H61A 4P2YB 4MEWA 1K95A 2M3WA 2E6WA 4PALA 1AJ5A 4L9MA 2BE4A 1DJZA 2I94A 1DF0B 1TCOB 1PSBA 5JJGA 1QLKA 3BUWB 1XFYO 5HYDA 1OZSA 1YRUB 2M97A 1KQMC 1YTZC 3CR4X 2NLNA 1KSOA 2L50A 2LVIA 3BOWA 1OZOA 3IQQA 1TNQA 1CLLA 2NZ0A 3QRXA 1K9PA 4C0LA 3CR5X 2CTNA 1U5IB 1CLBA 4WQ3A 3IF7A 1QV0A 1CFFA 1CDNA 4P5OE 2B1UA 3OB2B 1YVHA 4GUKA 1DGVA 2M9GA 1FF1A 3TDZA 1KFXS 1AHRA 4HSZA 3RLZA 2PVBA 2BL0B 4MRXA 1N65A 2HF5A 1QLSA 1XFXO 3PN7B 1SR6C 2Y1NA 1H4BA 1YR5A 1QX7A 3C1VA 4M2PA 2R2IA 1CMFA 3SG7A 2HPSA 1MQ1A 1UHNA 1SY9A 2RGIA 1FI5A 1A2XA 3FWBA 1CMGA 2DOQA 1YURA 1TNWA 4UPGA 3PATA 2GV5A 2JTZA 1CFCA 1RK9A 3OP0A 1M45A 1K90D 2BBMA 4DS7A 4PDZA 3EVUA 2K7CA 4GPLB 1ODBA 2OS8B 1J55A 1KWOB 1S5GY 1XK4A 2WC8A 4N5XA 4NDCA 4N1FA 1WDCB 3IQOA 2KFGA 1KFUS 3O78A 5KTYA 2LUCA 3D0YB 1F4OA 2LMTA 4XYNA 1IQ3A 1CM1A 1Y6WA 2H61C 2FOTA 1MXLC 3PLFB 1BOCA 1OMVA 1WLMA 2LV7A 5GQQC 1KCYA 3NSIA 1C07A 1MHOA 1X02A 1TNXA 2OPOA 3O2PA 5ER5A 2FCDA 1AK8A 3CZTX 2NCPA 1NYAA 3TS5B 1TOPA 2JPTA 2JXLA 2BBNA 1AUIB 2L5XB 1S1EA 1UWOA 1NX0A 1MF8B 2EHBA 3I5IB 5CSIA 5JOLA 4BY5A 2PALA 1A75B 4ORBB 3SG2A 1DVIA 1J7RA 1QJTA 1KK8B 3F45A 5AFPA 3HCMA
chains in the Genus database with same CATH superfamily
1KFUL 2KSPA 1C7VA 5AEQA 2LC5A 1EJ3A 2F33A 2WCKA 3VRRA 1HQVA 1DF0A 3L4AA 3VRNA 5BPJA 1AJ4A 1SSEB 1NCZA 2WCHA 2YGUA 3SG3A 1JF0A 4PE4A 2BECA 2OTGB 3ZNIA 1PSRA 4YGDB 2F3YA 2M7NA 5D69A 3O6BA 4MSPA 1SCVA 2ZN8A 2ISDA 5HL1A 1U5IA 1QVIY 5ER4X 4YI9A 2KFHA 1C7WA 1B4CA 3DVMA 1XO5A 2Y4QA 2JU0A 2KHNA 2CCMA 1XK4C 3NSLA 1HT9A 3SG6A 1JF2A 2K0JA 3BUOB 3SIAA 3TDIA 4DUQA 1QX5B 2JC2A 1DTLA 2QPTA 4FQOA 2Q4UA 1RTP1 2M29A 1PULA 4NQGA 1K9KA 2MJWB 2COLB 2KOTA 4ZCUA 1S6JA 2AMIA 2JT3A 2EC6C 1LA3A 1AP4A 1F8HA 2Q91A 4I5LB 5AXIA 1CTRA 1K8UA 2LCPA 3I5GC 3CTNA 4MZLA 3I5FB 1PALA 2I7AA 2QEHA 2HETA 1UHKA 2NCOA 3EKHA 3VGOA 4JWQA 3JVTC 1OE9B 1VRKA 2Y5IA 4AQJA 2GGMA 1ZACA 2P6BB 4OCIA 4CFQA 2KLEA 2LANA 1GQMA 1IJ6A 3EVVA 1CKKA 3D0YA 2P70A 1IGVA 3R1VA 3FWCA 2MLEC 1LS8A 3CWGA 3IVTA 1CDPA 3TDUA 4GAOA 3SJSA 4GGNA 2GTEA 4YGAA 3QMEA 1QS7A 1OOJA 2JTTA 4E68A 1UHJA 2P71A 4ORCB 1FI6A 2PRUA 4XJKB 5D3OA 1EG4A 1SRAA 2HQWA 2M8UA 2WCLA 3WNXB 1F55A 1N0YA 3BQ3A 1OOIX 2E30A 2I2RE 4GGFA 2F8PA 3EK7A 1YUSA 3PM8A 1F70A 2CT9A 1KK7Y 2K2AA 3DVJA 5B8IB 1NX1A 1JWDA 3DVKA 3S0BA 4YGEB 1IKUA 1NCYA 1QASA 1R6PA 1TCFA 2MA2A 3R72A 1CFDA 1K9UA 1A75A 1LINA 1YX8A 4F7FA 1JFKA 3H4SE 4OZDA 3DZTA 2WCMA 2VRGA 1M39A 1LA0A 5AERA 1W7JB 1XYDA 2WORA 1B7TZ 4INWA 2KAVA 3WHUB 1OSAA 1EH2A 1P28A 4MLWA 1GM0A 2JZIA 2WCJA 2BCAA 2LUXA 4IL1A 2MHHA 4NDBA 1MUXA 2K7DA 4GBAA 1L2OC 3AKBA 3RM1A 1H8BA 4PCWA 5D7FA 3NGVA 2K61A 5FI6A 5HKYA 1B1GA 5DKRA 5DKNA 1BT6A 2WCFA 1GGWA 1XA5A 1QX2A 5HKWA 1DELA 4CLNA 1TRFA 1NIWA 2OS8C 3DF0B 3K21A 2FJUB 1OOGA 1K96A 1KFXL 1WDCC 2IS9A 3HX4A 1BR4B 3O4YA 4OVNF 1NP8A 5I2LA 1J7QA 2H2KA 2AUCA 4F0ZB 2JXCA 2JT8A 3ICBA 1EXRA 1IG5A 4C0JA 1CB1A 2KI6C 4Q04A 1WRLA 2M0RA 3Q8IA 4BY5A 3OHMB 1OMDA 1IWQA 4D1EA 4QJ3B 4CFRA 3S0DA 1FW4A 1XVJA 1IIOA 3CABA 2CXJA 1EG3A 1WLZA 3GK1A 4GGFC 5KU1A 1QIVA 2AAOA 3BOWB 1QVIZ 3TS5C 4QJ5B 1DJGA 3PSRA 2L2EA 2O5GA 3NSKA 3PFVA 2KYFA 3SG5A 3TUYC 1JSAA 1JUOA 2ZNEA 1PVAA 1S3PA 2JNFA 3O4XA 1V1GA 1XFWO 2L0PA 3I5IC 3EK4A 3AAKA 1BODA 3B88A 4OV2A 3VRQA 1KK8C 2K7OA 2L4IA 2ZFDA 4HRHA 4ZCVA 4ETOA 2WC5A 2JNXA 1TIZA 1NCXA 1A4PA 4XJKA 3VROA 1XFVO 1ZFSA 2LAPA 3WXAA 2LVKA 1QIWA 1SKTA 2FCEA 1UP5A 3DD4A 4TNCA 3S0GA 1M31A 1ALVA 1D1OA 4I5JA 2NXQA 3L4LA 2KYCA 4PE0A 2L98A 3FS7A 1YUUA 2I18A 1Y0VH 4PT1A 1SCMB 2PMYA 1Y1XA 3BUXB 2PSRA 1BG1A 2HQ8A 2LVJA 2KBIA 1J1EA 3KF9A 4M2QA 2LE9B 1W7IB 2LLTA 2KI6D 3JTDB 1SL9A 4M2OA 1PRWA 2KI4C 3CLNA 5IBWA 1A03A 1F54A 1ZMZA 1CLMA 3CZ1A 3KEVA 4AOMA 1SBJA 3OX5A 2BE6A 1IRJA 1SL7A 1UHHA 1F4QA 1YX7A 3L47A 1K2HA 2A4JA 1IH0A 2PYQA 2LHIA 4A4CA 1DEKA 3EVRA 1PK0D 2KDHA 5DKQA 2ZKMX 3D77A 2LMVA 4PE7A 4NDDA 1MXEA 4OKHA 4MBEA 3EG5B 4YBHB 4MVFA 4PHNA 1BR1B 3TZ1A 4A4BA 3I5GB 3WHTB 1OW4A 1B8CA 4HREE 1C3ZA 3I5HB 2ZNDA 2QEBA 1QV1A 1CDMA 4CIDA 1B9AA 3LK0A 5TNCA 4YI8A 2K7BA 3AKAA 1TN4A 1NX3A 5I2OA 2KBMA 2H8VA 3OX6A 3NSOA 1KQMB 1Q80A 1UHIA 3GOFA 1C3YA 2M49B 3VB1A 1NX2A 1S6CA 1SK6D 2SASA 2WNDA 1K94A 3CDNA 4JKTA 1OOHA 1IQ5A 1WY9A 2M1UA 2MAZA 1S5GZ 3FE9A 1Y1UA 1ALWA 1S36A 2FJYA 5HKZA 1CFPA 1NSHA 3SIBA 3EKJA 1BMOA 1B8RA 1E8AA 1YUTA 3A8RA 4YGCB 1BJFA 1B47A 2F2OA 2JOJA 3AAJA 3FIAA 4GNKB 4PHKA 1OQPA 3MSEB 2BL0C 1YVLA 2LLSA 2LP3A 1J7OA 1RFJA 3BUMB 1SYMA 3PN7C 2BKIB 3R1PA 3GK2A 3SS5A 1DT7B 5FYXA 2V53A 1UUSA 5AANA 1A29A 1SR6B 2O60A 2KGBC 2L51A 1R2UA 5K89A 1UURA 2JRFA 1BU3A 2KFFA 2ZRSA 1DMOA 1RECA 1LXFC 1BF5A 1G4YR 3S0EA 3SG4A 5G08A 1N2DA 1WRKA 3DXLA 1KWOC 4DCKA 1GJYA 3KHEA 2KQYA 3B7AA 3BXKA 3LLEA 1L2OB 4PHMA 1SNLA 2F2PA 4GFTA 5I2QA 2WCEA 4HRGA 5KSZA 1M46A 1CDLA 1MWNA 3ZWHA 4AQIA 1QTXA 3CS1A 3KO0A 1SW8A 1CNPA 4U8DA 1JFJA 3OBVA 1SPYA 3B86A 1V1FA 1XFUO 1XFRA 3DVEA 3DY9A 4KYNA 2GGZA 3LL8B 1TNPA 1JBAA 1RWYA 2LLUA 4INXA 4R1EA 1SL8A 1NPQA 3LCPC 4PE1A 2MBXA 3BUNB 2ZRTA 4N1GA 1B7TY 2JT0A 1S6IA 1FBVA 3V2LA 1OMRA 1ZUZA 1RJVA 1QATA 4JQ0D 4WRIA 1RROA 3D10A 2JWWA 3EK8A 2CBLA 2LM5A 1T14A 1TWOA 2LNKA 2WCBA 1DJXA 1B8LA 1LVCD 1TTXA 1KQVA 4JD9A 1J1DA 3GK4X 4MRYA 1SMGA 2M7LA 2QDIA 1NWDA 2G9BA 3CGAA 3TUYB 2L2CA 2BNXA 1G33A 2Y1MA 3PJIA 2BAPA 2F3ZA 2LP2A 4YGBB 4QJ4B 4YRUA 5EL2A 2LVVA 4I5KA 4FTGA 5CSNA 2PASA 4I5NB 4MZJA 2OTGC 2JQ6A 2L4HA 1ZOTB 1DJYA 4WQ2A 1PVBA 4PHJA 1YRTB 5HLOA 2LHLA 3LK1A 3E3RA 4CPVA 3BYAA 5F6TA 4ICBA 3S0FA 1FPWA 2G2BA 3PALA 4DRWA 2MLFC 3CZ0A 1Y1AA 2KGRA 2SCPA 3BJHA 5HLVA 1CM4A 3M0WA 2BCXA 1DGUA 5DICA 5I8NA 1WRZA 2BKHB 3PM2A 1SCMC 1QXPA 2TN4A 1F71A 1IJ5A 2K2FA 4OR9B 2ZN9A 5CSJA 1NUBA 4JPZB 4MZKA 3S0AA 2KAYA 4USLA 3VRPA 3D74A 1DJHA 1LKJA 1KSMA 1DJWA 2EGDA 3UO9A 3NXAA 1S26D 2WOSA 1TUZA 4BY4A 4DIRA 1GGZA 3JTDC 2MRDA 5CSFA 5PALA 1M63B 2KI4B 3KPXA 5CPVA 1JC2A 3D78A 3B87A 1EL4A 3OGNA 1AVSA 1KK7Z 2JULA 2QACA 1K93D 2EC6B 2K8MB 4ORAB 3NHIA 5FI7A 4C0KA 3OB1B 3I5FC 1MR8A 3DF0A 1XFZO 1BLQA 3B6XA 2QEOA 2M1KB 2BCBA 3CR2A 2PQLA 3JVTB 3SS3A 2KNEA 1J7PA 2CNPA 1G8IA 4IJ7A 1DJIA 3A4UB 4MN0A 1QWVA 3I5HC 1DQEA 2KAXA 2D8NA 2KQ6A 2WC6A 2LMUA 1L7ZA 2H61A 4P2YB 4MEWA 1K95A 2KPHA 2M3WA 2E6WA 5I94A 4PALA 1AJ5A 4L9MA 2BE4A 1DJZA 2I94A 1DF0B 1TCOB 1PSBA 5JJGA 1QLKA 3BUWB 1XFYO 5HYDA 1OZSA 1YRUB 1Z2CB 1KQMC 1YTZC 2M97A 3CR4X 2NLNA 1KSOA 2L50A 2LVIA 3CYZA 3BOWA 3UNWA 1OZOA 3IQQA 3NHTA 3BFBA 1TNQA 1CLLA 2NZ0A 3QRXA 2K60A 1K9PA 4C0LA 1Z4HA 3SS4A 3CR5X 2CTNA 1U5IB 1CLBA 3R1OA 4WQ3A 3IF7A 1QV0A 1CFFA 1CDNA 4P5OE 2B1UA 3OB2B 1YVHA 2JPOA 4GUKA 1DGVA 3K1EA 2M9GA 1FF1A 2KLDA 1TUJA 1KFXS 3TDZA 1AHRA 4HSZA 3RLZA 2PVBA 2BL0B 4MRXA 1N65A 2HF5A 1QLSA 1XFXO 3PN7B 1SR6C 2Y1NA 1H4BA 1YR5A 1QX7A 3C1VA 5J3XA 4M2PA 2R2IA 1CMFA 3SG7A 2HPSA 1MQ1A 1UHNA 1SY9A 2RGIA 1DC1A 1A2XA 3FWBA 3N7HA 1FI5A 1CMGA 2DOQA 1YURA 1TNWA 1W9ZA 4UPGA 3PATA 2GV5A 2JTZA 1CFCA 1RK9A 3OP0A 1M45A 1K90D 2BBMA 3FE6A 4DS7A 4PDZA 3EVUA 2K7CA 4GPLB 1ODBA 2OS8B 1J55A 1KWOB 1S5GY 1XK4A 2WC8A 1OOFA 4N5XA 4NDCA 4N1FA 1WDCB 3IQOA 2KFGA 1KFUS 3O78A 5KTYA 3D73A 2LUCA 3D0YB 1F4OA 2LMTA 4XYNA 1IQ3A 2ERBA 3CZ2A 1CM1A 1Y6WA 4FQTA 2H61C 2FOTA 3DYEA 1MXLC 3PLFB 1BOCA 1OMVA 1WLMA 2LV7A 5GQQC 1KCYA 3NSIA 1C07A 1MHOA 1X02A 1TNXA 2OPOA 3O2PA 5ER5A 5FI2A 3BFAA 2FCDA 1AK8A 3CZTX 2NCPA 1ORGA 1NYAA 3TS5B 1TOPA 2JPTA 2JXLA 2BBNA 2L5YA 3D76A 3FE8A 1AUIB 2L5XB 1S1EA 1UWOA 1NX0A 1MF8B 2EHBA 2QEVA 3D75A 3I5IB 5CSIA 5JOLA 2PALA 1A75B 3BFHA 4ORBB 3SG2A 1DVIA 1J7RA 1QJTA 1KK8B 3F45A 3RZSA 5AFPA 3HCMA
chains in the Genus database with same CATH topology
1KFUL 2KSPA 1C7VA 5AEQA 2LC5A 1EJ3A 2F33A 3VRRA 1HQVA 1DF0A 3VRNA 5BPJA 1AJ4A 1NCZA 3SG3A 1JF0A 4PE4A 2BECA 2OTGB 3ZNIA 1PSRA 4YGDB 2F3YA 2M7NA 2ISDA 3O6BA 4MSPA 1SCVA 2ZN8A 1U5IA 1QVIY 5ER4X 4YI9A 2KFHA 1C7WA 1B4CA 3DVMA 1XO5A 2Y4QA 2JU0A 2KHNA 2CCMA 1XK4C 3NSLA 1HT9A 3SG6A 1JF2A 2K0JA 3BUOB 3SIAA 3TDIA 4DUQA 1QX5B 2JC2A 1DTLA 2QPTA 4FQOA 2Q4UA 1RTP1 2M29A 1PULA 4NQGA 1K9KA 2MJWB 2COLB 2KOTA 4ZCUA 1S6JA 2AMIA 2JT3A 2EC6C 1LA3A 1AP4A 1F8HA 2Q91A 4I5LB 5AXIA 1CTRA 1K8UA 2LCPA 3I5GC 3CTNA 4MZLA 3I5FB 1PALA 2I7AA 2HETA 1UHKA 2NCOA 3EKHA 3VGOA 4JWQA 3JVTC 1OE9B 1VRKA 2Y5IA 4AQJA 2GGMA 1ZACA 2P6BB 4OCIA 4CFQA 3EVVA 2LANA 1GQMA 1IJ6A 1CKKA 3D0YA 1IGVA 3FWCA 2MLEC 3CWGA 3TDUA 1CDPA 4GAOA 3SJSA 4YGAA 1QS7A 1OOJA 2JTTA 4E68A 1UHJA 1FI6A 4ORCB 2PRUA 4XJKB 1EG4A 1SRAA 2HQWA 2M8UA 3WNXB 1F55A 1N0YA 3BQ3A 2I2RE 2E30A 4GGFA 2F8PA 3EK7A 1YUSA 3PM8A 1F70A 2CT9A 1KK7Y 2K2AA 3DVJA 5B8IB 1NX1A 1JWDA 3DVKA 4YGEB 1IKUA 1NCYA 1QASA 1R6PA 1TCFA 2MA2A 1CFDA 1K9UA 1A75A 1LINA 1YX8A 1JFKA 3H4SE 2VRGA 1M39A 1LA0A 5AERA 1W7JB 1XYDA 2WORA 1B7TZ 2KAVA 3WHUB 1OSAA 1EH2A 4MLWA 2JZIA 2BCAA 2LUXA 4IL1A 2MHHA 4NDBA 1MUXA 2K7DA 4GBAA 1L2OC 3AKBA 3RM1A 1H8BA 4PCWA 5D7FA 5HKYA 2K61A 1B1GA 5DKRA 5DKNA 1BT6A 2WCFA 1GGWA 1XA5A 1QX2A 5HKWA 4CLNA 1TRFA 1NIWA 2OS8C 3DF0B 3K21A 2FJUB 1K96A 1KFXL 1WDCC 2IS9A 3HX4A 1BR4B 3O4YA 4OVNF 1NP8A 5I2LA 1J7QA 2H2KA 2AUCA 4F0ZB 2JXCA 2JT8A 3ICBA 1EXRA 1IG5A 4C0JA 1CB1A 2KI6C 4Q04A 1WRLA 2M0RA 3OHMB 1OMDA 1IWQA 4D1EA 4QJ3B 4CFRA 1FW4A 1XVJA 4GGFC 2CXJA 1EG3A 1WLZA 3GK1A 5KU1A 1QIVA 2AAOA 3BOWB 1QVIZ 3TS5C 4QJ5B 1DJGA 3PSRA 2L2EA 2O5GA 3NSKA 3PFVA 2KYFA 3SG5A 3TUYC 1JSAA 1JUOA 2ZNEA 1PVAA 1S3PA 2JNFA 4GGNA 1V1GA 1XFWO 2L0PA 3I5IC 3EK4A 3AAKA 1BODA 4OV2A 3VRQA 1KK8C 2K7OA 2L4IA 2ZFDA 4HRHA 4ZCVA 4ETOA 2JNXA 1TIZA 1NCXA 1A4PA 4XJKA 3VROA 1XFVO 1ZFSA 2LAPA 3WXAA 2LVKA 1QIWA 1SKTA 2FCEA 1UP5A 3DD4A 4TNCA 1M31A 1ALVA 1D1OA 4I5JA 2NXQA 4PE0A 2KYCA 2L98A 3FS7A 1YUUA 2I18A 1Y0VH 1SCMB 2PMYA 1Y1XA 3BUXB 2PSRA 1BG1A 2HQ8A 2LVJA 2KBIA 1J1EA 3KF9A 4M2QA 2LE9B 1W7IB 2LLTA 2KI6D 3JTDB 1SL9A 4M2OA 1PRWA 2KI4C 3CLNA 5IBWA 1A03A 1F54A 1ZMZA 1CLMA 3KEVA 4AOMA 1SBJA 3OX5A 2BE6A 1IRJA 1SL7A 1UHHA 1F4QA 1YX7A 1K2HA 2A4JA 1IH0A 2LHIA 4A4CA 3EVRA 1PK0D 2KDHA 5DKQA 2ZKMX 2LMVA 4PE7A 4NDDA 1MXEA 4OKHA 4MBEA 4YBHB 4MVFA 4PHNA 1BR1B 3TZ1A 4A4BA 3I5GB 3WHTB 1B8CA 4HREE 3I5HB 2ZNDA 1QV1A 1CDMA 4CIDA 1B9AA 3LK0A 5TNCA 4YI8A 2K7BA 3AKAA 1TN4A 1NX3A 5I2OA 2KBMA 3OX6A 3NSOA 1KQMB 1Q80A 1UHIA 3GOFA 2M49B 1NX2A 1S6CA 1SK6D 2SASA 2WNDA 1K94A 1IQ5A 1WY9A 2M1UA 2MAZA 1S5GZ 1Y1UA 1ALWA 1S36A 5HKZA 1CFPA 1NSHA 3SIBA 3EKJA 1BMOA 1B8RA 1E8AA 1YUTA 3A8RA 4YGCB 1BJFA 1B47A 2F2OA 2JOJA 3AAJA 3FIAA 4GNKB 4PHKA 1OQPA 3MSEB 2BL0C 1YVLA 2LLSA 2LP3A 1J7OA 1RFJA 3BUMB 1SYMA 3PN7C 2BKIB 1DT7B 3GK2A 5FYXA 2V53A 1UUSA 5AANA 1A29A 1SR6B 2O60A 2KGBC 2L51A 1R2UA 5K89A 1UURA 2JRFA 1BU3A 2KFFA 2ZRSA 1DMOA 1RECA 1LXFC 1BF5A 1G4YR 3SG4A 5G08A 1N2DA 1WRKA 1KWOC 4DCKA 1GJYA 3KHEA 2KQYA 3BXKA 3LLEA 1L2OB 4PHMA 1SNLA 2F2PA 4GFTA 5I2QA 2WCEA 4HRGA 5KSZA 1M46A 1CDLA 1MWNA 3ZWHA 4AQIA 1QTXA 3CS1A 3KO0A 1SW8A 1CNPA 4U8DA 1JFJA 1SPYA 1V1FA 1XFUO 3DVEA 2GGZA 3LL8B 1TNPA 1JBAA 1RWYA 2LLUA 4R1EA 1SL8A 1NPQA 3LCPC 4PE1A 2MBXA 3BUNB 2ZRTA 4N1GA 1B7TY 2JT0A 1S6IA 1FBVA 1OMRA 1ZUZA 1RJVA 1QATA 4JQ0D 4WRIA 1RROA 3D10A 2JWWA 3EK8A 2CBLA 2LM5A 2LNKA 2WCBA 1DJXA 1B8LA 1LVCD 1TTXA 1KQVA 1J1DA 3GK4X 4MRYA 1SMGA 2M7LA 1NWDA 2G9BA 3CGAA 3TUYB 1G33A 2Y1MA 4YGBB 2F3ZA 2LP2A 4QJ4B 4YRUA 2LVVA 4I5KA 4FTGA 5CSNA 2PASA 4I5NB 4MZJA 2OTGC 2JQ6A 2L4HA 1ZOTB 1DJYA 4WQ2A 1PVBA 4PHJA 1YRTB 5HLOA 2LHLA 3LK1A 3E3RA 4CPVA 3BYAA 5F6TA 4ICBA 1FPWA 2G2BA 3PALA 4DRWA 2MLFC 1Y1AA 2KGRA 2SCPA 5HLVA 1CM4A 3M0WA 2BCXA 1DGUA 5I8NA 1WRZA 2BKHB 1SCMC 1QXPA 2TN4A 1F71A 1IJ5A 2K2FA 4OR9B 2ZN9A 5CSJA 1NUBA 4JPZB 4MZKA 2KAYA 4USLA 3VRPA 1DJHA 1LKJA 1KSMA 1DJWA 2EGDA 3NXAA 1S26D 2WOSA 4BY4A 4DIRA 1GGZA 3JTDC 2MRDA 5CSFA 5PALA 1M63B 2KI4B 3KPXA 5CPVA 1JC2A 5D69A 1EL4A 5J3XA 1AVSA 1KK7Z 2JULA 2QACA 1K93D 2EC6B 2K8MB 4ORAB 4C0KA 3OB1B 3I5FC 1MR8A 3DF0A 1XFZO 1BLQA 2M1KB 2BCBA 3CR2A 3JVTB 2KNEA 1J7PA 2CNPA 1G8IA 1DJIA 3A4UB 4MN0A 3I5HC 2KAXA 2D8NA 2KQ6A 2LMUA 1L7ZA 2H61A 4P2YB 4MEWA 1K95A 2M3WA 2E6WA 4PALA 1AJ5A 4L9MA 2BE4A 1DJZA 2I94A 1DF0B 1TCOB 1PSBA 5JJGA 1QLKA 3BUWB 1XFYO 5HYDA 1OZSA 1YRUB 2M97A 1KQMC 1YTZC 3CR4X 2NLNA 1KSOA 2L50A 2LVIA 3BOWA 1OZOA 3IQQA 1TNQA 1CLLA 2NZ0A 3QRXA 1K9PA 4C0LA 3CR5X 2CTNA 1U5IB 1CLBA 4WQ3A 3IF7A 1QV0A 1CFFA 1CDNA 4P5OE 2B1UA 3OB2B 1YVHA 4GUKA 1DGVA 2M9GA 1FF1A 3TDZA 1KFXS 1AHRA 4HSZA 3RLZA 2PVBA 2BL0B 4MRXA 1N65A 2HF5A 1QLSA 1XFXO 3PN7B 1SR6C 2Y1NA 1H4BA 1YR5A 1QX7A 3C1VA 4M2PA 2R2IA 1CMFA 3SG7A 2HPSA 1MQ1A 1UHNA 1SY9A 2RGIA 1FI5A 1A2XA 3FWBA 1CMGA 2DOQA 1YURA 1TNWA 4UPGA 3PATA 2GV5A 2JTZA 1CFCA 1RK9A 3OP0A 1M45A 1K90D 2BBMA 4DS7A 4PDZA 3EVUA 2K7CA 4GPLB 1ODBA 2OS8B 1J55A 1KWOB 1S5GY 1XK4A 2WC8A 4N5XA 4NDCA 4N1FA 1WDCB 3IQOA 2KFGA 1KFUS 3O78A 5KTYA 2LUCA 3D0YB 1F4OA 2LMTA 4XYNA 1IQ3A 1CM1A 1Y6WA 2H61C 2FOTA 1MXLC 3PLFB 1BOCA 1OMVA 1WLMA 2LV7A 5GQQC 1KCYA 3NSIA 1C07A 1MHOA 1X02A 1TNXA 2OPOA 3O2PA 5ER5A 2FCDA 1AK8A 3CZTX 2NCPA 1NYAA 3TS5B 1TOPA 2JPTA 2JXLA 2BBNA 1AUIB 2L5XB 1S1EA 1UWOA 1NX0A 1MF8B 2EHBA 3I5IB 5CSIA 5JOLA 4BY5A 2PALA 1A75B 4ORBB 3SG2A 1DVIA 1J7RA 1QJTA 1KK8B 3F45A 5AFPA 3HCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KFU L;  2KSP A;  1C7V A;  5AEQ A;  2LC5 A;  1EJ3 A;  2F33 A;  3VRR A;  1HQV A;  1DF0 A;  3VRN A;  5BPJ A;  1AJ4 A;  1NCZ A;  3SG3 A;  1JF0 A;  4PE4 A;  2BEC A;  2OTG B;  3ZNI A;  1PSR A;  4YGD B;  2F3Y A;  2M7N A;  2ISD A;  3O6B A;  4MSP A;  1SCV A;  2ZN8 A;  1U5I A;  1QVI Y;  5ER4 X;  4YI9 A;  2KFH A;  1C7W A;  1B4C A;  3DVM A;  1XO5 A;  2Y4Q A;  2JU0 A;  2KHN A;  2CCM A;  1XK4 C;  3NSL A;  1HT9 A;  3SG6 A;  1JF2 A;  2K0J A;  3BUO B;  3SIA A;  3TDI A;  4DUQ A;  1QX5 B;  2JC2 A;  1DTL A;  2QPT A;  4FQO A;  2Q4U A;  1RTP 1;  2M29 A;  1PUL A;  4NQG A;  1K9K A;  2MJW B;  2COL B;  2KOT A;  4ZCU A;  1S6J A;  2AMI A;  2JT3 A;  2EC6 C;  1LA3 A;  1AP4 A;  1F8H A;  2Q91 A;  4I5L B;  5AXI A;  1CTR A;  1K8U A;  2LCP A;  3I5G C;  3CTN A;  4MZL A;  3I5F B;  1PAL A;  2I7A A;  2HET A;  1UHK A;  2NCO A;  3EKH A;  3VGO A;  4JWQ A;  3JVT C;  1OE9 B;  1VRK A;  2Y5I A;  4AQJ A;  2GGM A;  1ZAC A;  2P6B B;  4OCI A;  4CFQ A;  3EVV A;  2LAN A;  1GQM A;  1IJ6 A;  1CKK A;  3D0Y A;  1IGV A;  3FWC A;  2MLE C;  3CWG A;  3TDU A;  1CDP A;  4GAO A;  3SJS A;  4YGA A;  1QS7 A;  1OOJ A;  2JTT A;  4E68 A;  1UHJ A;  1FI6 A;  4ORC B;  2PRU A;  4XJK B;  1EG4 A;  1SRA A;  2HQW A;  2M8U A;  3WNX B;  1F55 A;  1N0Y A;  3BQ3 A;  2I2R E;  2E30 A;  4GGF A;  2F8P A;  3EK7 A;  1YUS A;  3PM8 A;  1F70 A;  2CT9 A;  1KK7 Y;  2K2A A;  3DVJ A;  5B8I B;  1NX1 A;  1JWD A;  3DVK A;  4YGE B;  1IKU A;  1NCY A;  1QAS A;  1R6P A;  1TCF A;  2MA2 A;  1CFD A;  1K9U A;  1A75 A;  1LIN A;  1YX8 A;  1JFK A;  3H4S E;  2VRG A;  1M39 A;  1LA0 A;  5AER A;  1W7J B;  1XYD A;  2WOR A;  1B7T Z;  2KAV A;  3WHU B;  1OSA A;  1EH2 A;  4MLW A;  2JZI A;  2BCA A;  2LUX A;  4IL1 A;  2MHH A;  4NDB A;  1MUX A;  2K7D A;  4GBA A;  1L2O C;  3AKB A;  3RM1 A;  1H8B A;  4PCW A;  5D7F A;  5HKY A;  2K61 A;  1B1G A;  5DKR A;  5DKN A;  1BT6 A;  2WCF A;  1GGW A;  1XA5 A;  1QX2 A;  5HKW A;  4CLN A;  1TRF A;  1NIW A;  2OS8 C;  3DF0 B;  3K21 A;  2FJU B;  1K96 A;  1KFX L;  1WDC C;  2IS9 A;  3HX4 A;  1BR4 B;  3O4Y A;  4OVN F;  1NP8 A;  5I2L A;  1J7Q A;  2H2K A;  2AUC A;  4F0Z B;  2JXC A;  2JT8 A;  3ICB A;  1EXR A;  1IG5 A;  4C0J A;  1CB1 A;  2KI6 C;  4Q04 A;  1WRL A;  2M0R A;  3OHM B;  1OMD A;  1IWQ A;  4D1E A;  4QJ3 B;  4CFR A;  1FW4 A;  1XVJ A;  4GGF C;  2CXJ A;  1EG3 A;  1WLZ A;  3GK1 A;  5KU1 A;  1QIV A;  2AAO A;  3BOW B;  1QVI Z;  3TS5 C;  4QJ5 B;  1DJG A;  3PSR A;  2L2E A;  2O5G A;  3NSK A;  3PFV A;  2KYF A;  3SG5 A;  3TUY C;  1JSA A;  1JUO A;  2ZNE A;  1PVA A;  1S3P A;  2JNF A;  4GGN A;  1V1G A;  1XFW O;  2L0P A;  3I5I C;  3EK4 A;  3AAK A;  1BOD A;  4OV2 A;  3VRQ A;  1KK8 C;  2K7O A;  2L4I A;  2ZFD A;  4HRH A;  4ZCV A;  4ETO A;  2JNX A;  1TIZ A;  1NCX A;  1A4P A;  4XJK A;  3VRO A;  1XFV O;  1ZFS A;  2LAP A;  3WXA A;  2LVK A;  1QIW A;  1SKT A;  2FCE A;  1UP5 A;  3DD4 A;  4TNC A;  1M31 A;  1ALV A;  1D1O A;  4I5J A;  2NXQ A;  4PE0 A;  2KYC A;  2L98 A;  3FS7 A;  1YUU A;  2I18 A;  1Y0V H;  1SCM B;  2PMY A;  1Y1X A;  3BUX B;  2PSR A;  1BG1 A;  2HQ8 A;  2LVJ A;  2KBI A;  1J1E A;  3KF9 A;  4M2Q A;  2LE9 B;  1W7I B;  2LLT A;  2KI6 D;  3JTD B;  1SL9 A;  4M2O A;  1PRW A;  2KI4 C;  3CLN A;  5IBW A;  1A03 A;  1F54 A;  1ZMZ A;  1CLM A;  3KEV A;  4AOM A;  1SBJ A;  3OX5 A;  2BE6 A;  1IRJ A;  1SL7 A;  1UHH A;  1F4Q A;  1YX7 A;  1K2H A;  2A4J A;  1IH0 A;  2LHI A;  4A4C A;  3EVR A;  1PK0 D;  2KDH A;  5DKQ A;  2ZKM X;  2LMV A;  4PE7 A;  4NDD A;  1MXE A;  4OKH A;  4MBE A;  4YBH B;  4MVF A;  4PHN A;  1BR1 B;  3TZ1 A;  4A4B A;  3I5G B;  3WHT B;  1B8C A;  4HRE E;  3I5H B;  2ZND A;  1QV1 A;  1CDM A;  4CID A;  1B9A A;  3LK0 A;  5TNC A;  4YI8 A;  2K7B A;  3AKA A;  1TN4 A;  1NX3 A;  5I2O A;  2KBM A;  3OX6 A;  3NSO A;  1KQM B;  1Q80 A;  1UHI A;  3GOF A;  2M49 B;  1NX2 A;  1S6C A;  1SK6 D;  2SAS A;  2WND A;  1K94 A;  1IQ5 A;  1WY9 A;  2M1U A;  2MAZ A;  1S5G Z;  1Y1U A;  1ALW A;  1S36 A;  5HKZ A;  1CFP A;  1NSH A;  3SIB A;  3EKJ A;  1BMO A;  1B8R A;  1E8A A;  1YUT A;  3A8R A;  4YGC B;  1BJF A;  1B47 A;  2F2O A;  2JOJ A;  3AAJ A;  3FIA A;  4GNK B;  4PHK A;  1OQP A;  3MSE B;  2BL0 C;  1YVL A;  2LLS A;  2LP3 A;  1J7O A;  1RFJ A;  3BUM B;  1SYM A;  3PN7 C;  2BKI B;  1DT7 B;  3GK2 A;  5FYX A;  2V53 A;  1UUS A;  5AAN A;  1A29 A;  1SR6 B;  2O60 A;  2KGB C;  2L51 A;  1R2U A;  5K89 A;  1UUR A;  2JRF A;  1BU3 A;  2KFF A;  2ZRS A;  1DMO A;  1REC A;  1LXF C;  1BF5 A;  1G4Y R;  3SG4 A;  5G08 A;  1N2D A;  1WRK A;  1KWO C;  4DCK A;  1GJY A;  3KHE A;  2KQY A;  3BXK A;  3LLE A;  1L2O B;  4PHM A;  1SNL A;  2F2P A;  4GFT A;  5I2Q A;  2WCE A;  4HRG A;  5KSZ A;  1M46 A;  1CDL A;  1MWN A;  3ZWH A;  4AQI A;  1QTX A;  3CS1 A;  3KO0 A;  1SW8 A;  1CNP A;  4U8D A;  1JFJ A;  1SPY A;  1V1F A;  1XFU O;  3DVE A;  2GGZ A;  3LL8 B;  1TNP A;  1JBA A;  1RWY A;  2LLU A;  4R1E A;  1SL8 A;  1NPQ A;  3LCP C;  4PE1 A;  2MBX A;  3BUN B;  2ZRT A;  4N1G A;  1B7T Y;  2JT0 A;  1S6I A;  1FBV A;  1OMR A;  1ZUZ A;  1RJV A;  1QAT A;  4JQ0 D;  4WRI A;  1RRO A;  3D10 A;  2JWW A;  3EK8 A;  2CBL A;  2LM5 A;  2LNK A;  2WCB A;  1DJX A;  1B8L A;  1LVC D;  1TTX A;  1KQV A;  1J1D A;  3GK4 X;  4MRY A;  1SMG A;  2M7L A;  1NWD A;  2G9B A;  3CGA A;  3TUY B;  1G33 A;  2Y1M A;  4YGB B;  2F3Z A;  2LP2 A;  4QJ4 B;  4YRU A;  2LVV A;  4I5K A;  4FTG A;  5CSN A;  2PAS A;  4I5N B;  4MZJ A;  2OTG C;  2JQ6 A;  2L4H A;  1ZOT B;  1DJY A;  4WQ2 A;  1PVB A;  4PHJ A;  1YRT B;  5HLO A;  2LHL A;  3LK1 A;  3E3R A;  4CPV A;  3BYA A;  5F6T A;  4ICB A;  1FPW A;  2G2B A;  3PAL A;  4DRW A;  2MLF C;  1Y1A A;  2KGR A;  2SCP A;  5HLV A;  1CM4 A;  3M0W A;  2BCX A;  1DGU A;  5I8N A;  1WRZ A;  2BKH B;  1SCM C;  1QXP A;  2TN4 A;  1F71 A;  1IJ5 A;  2K2F A;  4OR9 B;  2ZN9 A;  5CSJ A;  1NUB A;  4JPZ B;  4MZK A;  2KAY A;  4USL A;  3VRP A;  1DJH A;  1LKJ A;  1KSM A;  1DJW A;  2EGD A;  3NXA A;  1S26 D;  2WOS A;  4BY4 A;  4DIR A;  1GGZ A;  3JTD C;  2MRD A;  5CSF A;  5PAL A;  1M63 B;  2KI4 B;  3KPX A;  5CPV A;  1JC2 A;  5D69 A;  1EL4 A;  5J3X A;  1AVS A;  1KK7 Z;  2JUL A;  2QAC A;  1K93 D;  2EC6 B;  2K8M B;  4ORA B;  4C0K A;  3OB1 B;  3I5F C;  1MR8 A;  3DF0 A;  1XFZ O;  1BLQ A;  2M1K B;  2BCB A;  3CR2 A;  3JVT B;  2KNE A;  1J7P A;  2CNP A;  1G8I A;  1DJI A;  3A4U B;  4MN0 A;  3I5H C;  2KAX A;  2D8N A;  2KQ6 A;  2LMU A;  1L7Z A;  2H61 A;  4P2Y B;  4MEW A;  1K95 A;  2M3W A;  2E6W A;  4PAL A;  1AJ5 A;  4L9M A;  2BE4 A;  1DJZ A;  2I94 A;  1DF0 B;  1TCO B;  1PSB A;  5JJG A;  1QLK A;  3BUW B;  1XFY O;  5HYD A;  1OZS A;  1YRU B;  2M97 A;  1KQM C;  1YTZ C;  3CR4 X;  2NLN A;  1KSO A;  2L50 A;  2LVI A;  3BOW A;  1OZO A;  3IQQ A;  1TNQ A;  1CLL A;  2NZ0 A;  3QRX A;  1K9P A;  4C0L A;  3CR5 X;  2CTN A;  1U5I B;  1CLB A;  4WQ3 A;  3IF7 A;  1QV0 A;  1CFF A;  1CDN A;  4P5O E;  2B1U A;  3OB2 B;  1YVH A;  4GUK A;  1DGV A;  2M9G A;  1FF1 A;  3TDZ A;  1KFX S;  1AHR A;  4HSZ A;  3RLZ A;  2PVB A;  2BL0 B;  4MRX A;  1N65 A;  2HF5 A;  1QLS A;  1XFX O;  3PN7 B;  1SR6 C;  2Y1N A;  1H4B A;  1YR5 A;  1QX7 A;  3C1V A;  4M2P A;  2R2I A;  1CMF A;  3SG7 A;  2HPS A;  1MQ1 A;  1UHN A;  1SY9 A;  2RGI A;  1FI5 A;  1A2X A;  3FWB A;  1CMG A;  2DOQ A;  1YUR A;  1TNW A;  4UPG A;  3PAT A;  2GV5 A;  2JTZ A;  1CFC A;  1RK9 A;  3OP0 A;  1M45 A;  1K90 D;  2BBM A;  4DS7 A;  4PDZ A;  3EVU A;  2K7C A;  4GPL B;  1ODB A;  2OS8 B;  1J55 A;  1KWO B;  1S5G Y;  1XK4 A;  2WC8 A;  4N5X A;  4NDC A;  4N1F A;  1WDC B;  3IQO A;  2KFG A;  1KFU S;  3O78 A;  5KTY A;  2LUC A;  3D0Y B;  1F4O A;  2LMT A;  4XYN A;  1IQ3 A;  1CM1 A;  1Y6W A;  2H61 C;  2FOT A;  1MXL C;  3PLF B;  1BOC A;  1OMV A;  1WLM A;  2LV7 A;  5GQQ C;  1KCY A;  3NSI A;  1C07 A;  1MHO A;  1X02 A;  1TNX A;  2OPO A;  3O2P A;  5ER5 A;  2FCD A;  1AK8 A;  3CZT X;  2NCP A;  1NYA A;  3TS5 B;  1TOP A;  2JPT A;  2JXL A;  2BBN A;  1AUI B;  2L5X B;  1S1E A;  1UWO A;  1NX0 A;  1MF8 B;  2EHB A;  3I5I B;  5CSI A;  5JOL A;  4BY5 A;  2PAL A;  1A75 B;  4ORB B;  3SG2 A;  1DVI A;  1J7R A;  1QJT A;  1KK8 B;  3F45 A;  5AFP A;  3HCM A; 
#chains in the Genus database with same CATH topology
 1KFU L;  2KSP A;  1C7V A;  5AEQ A;  2LC5 A;  1EJ3 A;  2F33 A;  2WCK A;  3VRR A;  1HQV A;  1DF0 A;  3L4A A;  3VRN A;  5BPJ A;  1AJ4 A;  1SSE B;  1NCZ A;  2WCH A;  2YGU A;  3SG3 A;  1JF0 A;  4PE4 A;  2BEC A;  2OTG B;  3ZNI A;  1PSR A;  4YGD B;  2F3Y A;  2M7N A;  5D69 A;  3O6B A;  4MSP A;  1SCV A;  2ZN8 A;  2ISD A;  5HL1 A;  1U5I A;  1QVI Y;  5ER4 X;  4YI9 A;  2KFH A;  1C7W A;  1B4C A;  3DVM A;  1XO5 A;  2Y4Q A;  2JU0 A;  2KHN A;  2CCM A;  1XK4 C;  3NSL A;  1HT9 A;  3SG6 A;  1JF2 A;  2K0J A;  3BUO B;  3SIA A;  3TDI A;  4DUQ A;  1QX5 B;  2JC2 A;  1DTL A;  2QPT A;  4FQO A;  2Q4U A;  1RTP 1;  2M29 A;  1PUL A;  4NQG A;  1K9K A;  2MJW B;  2COL B;  2KOT A;  4ZCU A;  1S6J A;  2AMI A;  2JT3 A;  2EC6 C;  1LA3 A;  1AP4 A;  1F8H A;  2Q91 A;  4I5L B;  5AXI A;  1CTR A;  1K8U A;  2LCP A;  3I5G C;  3CTN A;  4MZL A;  3I5F B;  1PAL A;  2I7A A;  2QEH A;  2HET A;  1UHK A;  2NCO A;  3EKH A;  3VGO A;  4JWQ A;  3JVT C;  1OE9 B;  1VRK A;  2Y5I A;  4AQJ A;  2GGM A;  1ZAC A;  2P6B B;  4OCI A;  4CFQ A;  2KLE A;  2LAN A;  1GQM A;  1IJ6 A;  3EVV A;  1CKK A;  3D0Y A;  2P70 A;  1IGV A;  3R1V A;  3FWC A;  2MLE C;  1LS8 A;  3CWG A;  3IVT A;  1CDP A;  3TDU A;  4GAO A;  3SJS A;  4GGN A;  2GTE A;  4YGA A;  3QME A;  1QS7 A;  1OOJ A;  2JTT A;  4E68 A;  1UHJ A;  2P71 A;  4ORC B;  1FI6 A;  2PRU A;  4XJK B;  5D3O A;  1EG4 A;  1SRA A;  2HQW A;  2M8U A;  2WCL A;  3WNX B;  1F55 A;  1N0Y A;  3BQ3 A;  1OOI X;  2E30 A;  2I2R E;  4GGF A;  2F8P A;  3EK7 A;  1YUS A;  3PM8 A;  1F70 A;  2CT9 A;  1KK7 Y;  2K2A A;  3DVJ A;  5B8I B;  1NX1 A;  1JWD A;  3DVK A;  3S0B A;  4YGE B;  1IKU A;  1NCY A;  1QAS A;  1R6P A;  1TCF A;  2MA2 A;  3R72 A;  1CFD A;  1K9U A;  1A75 A;  1LIN A;  1YX8 A;  4F7F A;  1JFK A;  3H4S E;  4OZD A;  3DZT A;  2WCM A;  2VRG A;  1M39 A;  1LA0 A;  5AER A;  1W7J B;  1XYD A;  2WOR A;  1B7T Z;  4INW A;  2KAV A;  3WHU B;  1OSA A;  1EH2 A;  1P28 A;  4MLW A;  1GM0 A;  2JZI A;  2WCJ A;  2BCA A;  2LUX A;  4IL1 A;  2MHH A;  4NDB A;  1MUX A;  2K7D A;  4GBA A;  1L2O C;  3AKB A;  3RM1 A;  1H8B A;  4PCW A;  5D7F A;  3NGV A;  2K61 A;  5FI6 A;  5HKY A;  1B1G A;  5DKR A;  5DKN A;  1BT6 A;  2WCF A;  1GGW A;  1XA5 A;  1QX2 A;  5HKW A;  1DEL A;  4CLN A;  1TRF A;  1NIW A;  2OS8 C;  3DF0 B;  3K21 A;  2FJU B;  1OOG A;  1K96 A;  1KFX L;  1WDC C;  2IS9 A;  3HX4 A;  1BR4 B;  3O4Y A;  4OVN F;  1NP8 A;  5I2L A;  1J7Q A;  2H2K A;  2AUC A;  4F0Z B;  2JXC A;  2JT8 A;  3ICB A;  1EXR A;  1IG5 A;  4C0J A;  1CB1 A;  2KI6 C;  4Q04 A;  1WRL A;  2M0R A;  3Q8I A;  4BY5 A;  3OHM B;  1OMD A;  1IWQ A;  4D1E A;  4QJ3 B;  4CFR A;  3S0D A;  1FW4 A;  1XVJ A;  1IIO A;  3CAB A;  2CXJ A;  1EG3 A;  1WLZ A;  3GK1 A;  4GGF C;  5KU1 A;  1QIV A;  2AAO A;  3BOW B;  1QVI Z;  3TS5 C;  4QJ5 B;  1DJG A;  3PSR A;  2L2E A;  2O5G A;  3NSK A;  3PFV A;  2KYF A;  3SG5 A;  3TUY C;  1JSA A;  1JUO A;  2ZNE A;  1PVA A;  1S3P A;  2JNF A;  3O4X A;  1V1G A;  1XFW O;  2L0P A;  3I5I C;  3EK4 A;  3AAK A;  1BOD A;  3B88 A;  4OV2 A;  3VRQ A;  1KK8 C;  2K7O A;  2L4I A;  2ZFD A;  4HRH A;  4ZCV A;  4ETO A;  2WC5 A;  2JNX A;  1TIZ A;  1NCX A;  1A4P A;  4XJK A;  3VRO A;  1XFV O;  1ZFS A;  2LAP A;  3WXA A;  2LVK A;  1QIW A;  1SKT A;  2FCE A;  1UP5 A;  3DD4 A;  4TNC A;  3S0G A;  1M31 A;  1ALV A;  1D1O A;  4I5J A;  2NXQ A;  3L4L A;  2KYC A;  4PE0 A;  2L98 A;  3FS7 A;  1YUU A;  2I18 A;  1Y0V H;  4PT1 A;  1SCM B;  2PMY A;  1Y1X A;  3BUX B;  2PSR A;  1BG1 A;  2HQ8 A;  2LVJ A;  2KBI A;  1J1E A;  3KF9 A;  4M2Q A;  2LE9 B;  1W7I B;  2LLT A;  2KI6 D;  3JTD B;  1SL9 A;  4M2O A;  1PRW A;  2KI4 C;  3CLN A;  5IBW A;  1A03 A;  1F54 A;  1ZMZ A;  1CLM A;  3CZ1 A;  3KEV A;  4AOM A;  1SBJ A;  3OX5 A;  2BE6 A;  1IRJ A;  1SL7 A;  1UHH A;  1F4Q A;  1YX7 A;  3L47 A;  1K2H A;  2A4J A;  1IH0 A;  2PYQ A;  2LHI A;  4A4C A;  1DEK A;  3EVR A;  1PK0 D;  2KDH A;  5DKQ A;  2ZKM X;  3D77 A;  2LMV A;  4PE7 A;  4NDD A;  1MXE A;  4OKH A;  4MBE A;  3EG5 B;  4YBH B;  4MVF A;  4PHN A;  1BR1 B;  3TZ1 A;  4A4B A;  3I5G B;  3WHT B;  1OW4 A;  1B8C A;  4HRE E;  1C3Z A;  3I5H B;  2ZND A;  2QEB A;  1QV1 A;  1CDM A;  4CID A;  1B9A A;  3LK0 A;  5TNC A;  4YI8 A;  2K7B A;  3AKA A;  1TN4 A;  1NX3 A;  5I2O A;  2KBM A;  2H8V A;  3OX6 A;  3NSO A;  1KQM B;  1Q80 A;  1UHI A;  3GOF A;  1C3Y A;  2M49 B;  3VB1 A;  1NX2 A;  1S6C A;  1SK6 D;  2SAS A;  2WND A;  1K94 A;  3CDN A;  4JKT A;  1OOH A;  1IQ5 A;  1WY9 A;  2M1U A;  2MAZ A;  1S5G Z;  3FE9 A;  1Y1U A;  1ALW A;  1S36 A;  2FJY A;  5HKZ A;  1CFP A;  1NSH A;  3SIB A;  3EKJ A;  1BMO A;  1B8R A;  1E8A A;  1YUT A;  3A8R A;  4YGC B;  1BJF A;  1B47 A;  2F2O A;  2JOJ A;  3AAJ A;  3FIA A;  4GNK B;  4PHK A;  1OQP A;  3MSE B;  2BL0 C;  1YVL A;  2LLS A;  2LP3 A;  1J7O A;  1RFJ A;  3BUM B;  1SYM A;  3PN7 C;  2BKI B;  3R1P A;  3GK2 A;  3SS5 A;  1DT7 B;  5FYX A;  2V53 A;  1UUS A;  5AAN A;  1A29 A;  1SR6 B;  2O60 A;  2KGB C;  2L51 A;  1R2U A;  5K89 A;  1UUR A;  2JRF A;  1BU3 A;  2KFF A;  2ZRS A;  1DMO A;  1REC A;  1LXF C;  1BF5 A;  1G4Y R;  3S0E A;  3SG4 A;  5G08 A;  1N2D A;  1WRK A;  3DXL A;  1KWO C;  4DCK A;  1GJY A;  3KHE A;  2KQY A;  3B7A A;  3BXK A;  3LLE A;  1L2O B;  4PHM A;  1SNL A;  2F2P A;  4GFT A;  5I2Q A;  2WCE A;  4HRG A;  5KSZ A;  1M46 A;  1CDL A;  1MWN A;  3ZWH A;  4AQI A;  1QTX A;  3CS1 A;  3KO0 A;  1SW8 A;  1CNP A;  4U8D A;  1JFJ A;  3OBV A;  1SPY A;  3B86 A;  1V1F A;  1XFU O;  1XFR A;  3DVE A;  3DY9 A;  4KYN A;  2GGZ A;  3LL8 B;  1TNP A;  1JBA A;  1RWY A;  2LLU A;  4INX A;  4R1E A;  1SL8 A;  1NPQ A;  3LCP C;  4PE1 A;  2MBX A;  3BUN B;  2ZRT A;  4N1G A;  1B7T Y;  2JT0 A;  1S6I A;  1FBV A;  3V2L A;  1OMR A;  1ZUZ A;  1RJV A;  1QAT A;  4JQ0 D;  4WRI A;  1RRO A;  3D10 A;  2JWW A;  3EK8 A;  2CBL A;  2LM5 A;  1T14 A;  1TWO A;  2LNK A;  2WCB A;  1DJX A;  1B8L A;  1LVC D;  1TTX A;  1KQV A;  4JD9 A;  1J1D A;  3GK4 X;  4MRY A;  1SMG A;  2M7L A;  2QDI A;  1NWD A;  2G9B A;  3CGA A;  3TUY B;  2L2C A;  2BNX A;  1G33 A;  2Y1M A;  3PJI A;  2BAP A;  2F3Z A;  2LP2 A;  4YGB B;  4QJ4 B;  4YRU A;  5EL2 A;  2LVV A;  4I5K A;  4FTG A;  5CSN A;  2PAS A;  4I5N B;  4MZJ A;  2OTG C;  2JQ6 A;  2L4H A;  1ZOT B;  1DJY A;  4WQ2 A;  1PVB A;  4PHJ A;  1YRT B;  5HLO A;  2LHL A;  3LK1 A;  3E3R A;  4CPV A;  3BYA A;  5F6T A;  4ICB A;  3S0F A;  1FPW A;  2G2B A;  3PAL A;  4DRW A;  2MLF C;  3CZ0 A;  1Y1A A;  2KGR A;  2SCP A;  3BJH A;  5HLV A;  1CM4 A;  3M0W A;  2BCX A;  1DGU A;  5DIC A;  5I8N A;  1WRZ A;  2BKH B;  3PM2 A;  1SCM C;  1QXP A;  2TN4 A;  1F71 A;  1IJ5 A;  2K2F A;  4OR9 B;  2ZN9 A;  5CSJ A;  1NUB A;  4JPZ B;  4MZK A;  3S0A A;  2KAY A;  4USL A;  3VRP A;  3D74 A;  1DJH A;  1LKJ A;  1KSM A;  1DJW A;  2EGD A;  3UO9 A;  3NXA A;  1S26 D;  2WOS A;  1TUZ A;  4BY4 A;  4DIR A;  1GGZ A;  3JTD C;  2MRD A;  5CSF A;  5PAL A;  1M63 B;  2KI4 B;  3KPX A;  5CPV A;  1JC2 A;  3D78 A;  3B87 A;  1EL4 A;  3OGN A;  1AVS A;  1KK7 Z;  2JUL A;  2QAC A;  1K93 D;  2EC6 B;  2K8M B;  4ORA B;  3NHI A;  5FI7 A;  4C0K A;  3OB1 B;  3I5F C;  1MR8 A;  3DF0 A;  1XFZ O;  1BLQ A;  3B6X A;  2QEO A;  2M1K B;  2BCB A;  3CR2 A;  2PQL A;  3JVT B;  3SS3 A;  2KNE A;  1J7P A;  2CNP A;  1G8I A;  4IJ7 A;  1DJI A;  3A4U B;  4MN0 A;  1QWV A;  3I5H C;  1DQE A;  2KAX A;  2D8N A;  2KQ6 A;  2WC6 A;  2LMU A;  1L7Z A;  2H61 A;  4P2Y B;  4MEW A;  1K95 A;  2KPH A;  2M3W A;  2E6W A;  5I94 A;  4PAL A;  1AJ5 A;  4L9M A;  2BE4 A;  1DJZ A;  2I94 A;  1DF0 B;  1TCO B;  1PSB A;  5JJG A;  1QLK A;  3BUW B;  1XFY O;  5HYD A;  1OZS A;  1YRU B;  1Z2C B;  1KQM C;  1YTZ C;  2M97 A;  3CR4 X;  2NLN A;  1KSO A;  2L50 A;  2LVI A;  3CYZ A;  3BOW A;  3UNW A;  1OZO A;  3IQQ A;  3NHT A;  3BFB A;  1TNQ A;  1CLL A;  2NZ0 A;  3QRX A;  2K60 A;  1K9P A;  4C0L A;  1Z4H A;  3SS4 A;  3CR5 X;  2CTN A;  1U5I B;  1CLB A;  3R1O A;  4WQ3 A;  3IF7 A;  1QV0 A;  1CFF A;  1CDN A;  4P5O E;  2B1U A;  3OB2 B;  1YVH A;  2JPO A;  4GUK A;  1DGV A;  3K1E A;  2M9G A;  1FF1 A;  2KLD A;  1TUJ A;  1KFX S;  3TDZ A;  1AHR A;  4HSZ A;  3RLZ A;  2PVB A;  2BL0 B;  4MRX A;  1N65 A;  2HF5 A;  1QLS A;  1XFX O;  3PN7 B;  1SR6 C;  2Y1N A;  1H4B A;  1YR5 A;  1QX7 A;  3C1V A;  5J3X A;  4M2P A;  2R2I A;  1CMF A;  3SG7 A;  2HPS A;  1MQ1 A;  1UHN A;  1SY9 A;  2RGI A;  1DC1 A;  1A2X A;  3FWB A;  3N7H A;  1FI5 A;  1CMG A;  2DOQ A;  1YUR A;  1TNW A;  1W9Z A;  4UPG A;  3PAT A;  2GV5 A;  2JTZ A;  1CFC A;  1RK9 A;  3OP0 A;  1M45 A;  1K90 D;  2BBM A;  3FE6 A;  4DS7 A;  4PDZ A;  3EVU A;  2K7C A;  4GPL B;  1ODB A;  2OS8 B;  1J55 A;  1KWO B;  1S5G Y;  1XK4 A;  2WC8 A;  1OOF A;  4N5X A;  4NDC A;  4N1F A;  1WDC B;  3IQO A;  2KFG A;  1KFU S;  3O78 A;  5KTY A;  3D73 A;  2LUC A;  3D0Y B;  1F4O A;  2LMT A;  4XYN A;  1IQ3 A;  2ERB A;  3CZ2 A;  1CM1 A;  1Y6W A;  4FQT A;  2H61 C;  2FOT A;  3DYE A;  1MXL C;  3PLF B;  1BOC A;  1OMV A;  1WLM A;  2LV7 A;  5GQQ C;  1KCY A;  3NSI A;  1C07 A;  1MHO A;  1X02 A;  1TNX A;  2OPO A;  3O2P A;  5ER5 A;  5FI2 A;  3BFA A;  2FCD A;  1AK8 A;  3CZT X;  2NCP A;  1ORG A;  1NYA A;  3TS5 B;  1TOP A;  2JPT A;  2JXL A;  2BBN A;  2L5Y A;  3D76 A;  3FE8 A;  1AUI B;  2L5X B;  1S1E A;  1UWO A;  1NX0 A;  1MF8 B;  2EHB A;  2QEV A;  3D75 A;  3I5I B;  5CSI A;  5JOL A;  2PAL A;  1A75 B;  3BFH A;  4ORB B;  3SG2 A;  1DVI A;  1J7R A;  1QJT A;  1KK8 B;  3F45 A;  3RZS A;  5AFP A;  3HCM A; 
#chains in the Genus database with same CATH homology
 1KFU L;  2KSP A;  1C7V A;  5AEQ A;  2LC5 A;  1EJ3 A;  2F33 A;  3VRR A;  1HQV A;  1DF0 A;  3VRN A;  5BPJ A;  1AJ4 A;  1NCZ A;  3SG3 A;  1JF0 A;  4PE4 A;  2BEC A;  2OTG B;  3ZNI A;  1PSR A;  4YGD B;  2F3Y A;  2M7N A;  2ISD A;  3O6B A;  4MSP A;  1SCV A;  2ZN8 A;  1U5I A;  1QVI Y;  5ER4 X;  4YI9 A;  2KFH A;  1C7W A;  1B4C A;  3DVM A;  1XO5 A;  2Y4Q A;  2JU0 A;  2KHN A;  2CCM A;  1XK4 C;  3NSL A;  1HT9 A;  3SG6 A;  1JF2 A;  2K0J A;  3BUO B;  3SIA A;  3TDI A;  4DUQ A;  1QX5 B;  2JC2 A;  1DTL A;  2QPT A;  4FQO A;  2Q4U A;  1RTP 1;  2M29 A;  1PUL A;  4NQG A;  1K9K A;  2MJW B;  2COL B;  2KOT A;  4ZCU A;  1S6J A;  2AMI A;  2JT3 A;  2EC6 C;  1LA3 A;  1AP4 A;  1F8H A;  2Q91 A;  4I5L B;  5AXI A;  1CTR A;  1K8U A;  2LCP A;  3I5G C;  3CTN A;  4MZL A;  3I5F B;  1PAL A;  2I7A A;  2HET A;  1UHK A;  2NCO A;  3EKH A;  3VGO A;  4JWQ A;  3JVT C;  1OE9 B;  1VRK A;  2Y5I A;  4AQJ A;  2GGM A;  1ZAC A;  2P6B B;  4OCI A;  4CFQ A;  3EVV A;  2LAN A;  1GQM A;  1IJ6 A;  1CKK A;  3D0Y A;  1IGV A;  3FWC A;  2MLE C;  3CWG A;  3TDU A;  1CDP A;  4GAO A;  3SJS A;  4YGA A;  1QS7 A;  1OOJ A;  2JTT A;  4E68 A;  1UHJ A;  1FI6 A;  4ORC B;  2PRU A;  4XJK B;  1EG4 A;  1SRA A;  2HQW A;  2M8U A;  3WNX B;  1F55 A;  1N0Y A;  3BQ3 A;  2I2R E;  2E30 A;  4GGF A;  2F8P A;  3EK7 A;  1YUS A;  3PM8 A;  1F70 A;  2CT9 A;  1KK7 Y;  2K2A A;  3DVJ A;  5B8I B;  1NX1 A;  1JWD A;  3DVK A;  4YGE B;  1IKU A;  1NCY A;  1QAS A;  1R6P A;  1TCF A;  2MA2 A;  1CFD A;  1K9U A;  1A75 A;  1LIN A;  1YX8 A;  1JFK A;  3H4S E;  2VRG A;  1M39 A;  1LA0 A;  5AER A;  1W7J B;  1XYD A;  2WOR A;  1B7T Z;  2KAV A;  3WHU B;  1OSA A;  1EH2 A;  4MLW A;  2JZI A;  2BCA A;  2LUX A;  4IL1 A;  2MHH A;  4NDB A;  1MUX A;  2K7D A;  4GBA A;  1L2O C;  3AKB A;  3RM1 A;  1H8B A;  4PCW A;  5D7F A;  5HKY A;  2K61 A;  1B1G A;  5DKR A;  5DKN A;  1BT6 A;  2WCF A;  1GGW A;  1XA5 A;  1QX2 A;  5HKW A;  4CLN A;  1TRF A;  1NIW A;  2OS8 C;  3DF0 B;  3K21 A;  2FJU B;  1K96 A;  1KFX L;  1WDC C;  2IS9 A;  3HX4 A;  1BR4 B;  3O4Y A;  4OVN F;  1NP8 A;  5I2L A;  1J7Q A;  2H2K A;  2AUC A;  4F0Z B;  2JXC A;  2JT8 A;  3ICB A;  1EXR A;  1IG5 A;  4C0J A;  1CB1 A;  2KI6 C;  4Q04 A;  1WRL A;  2M0R A;  3OHM B;  1OMD A;  1IWQ A;  4D1E A;  4QJ3 B;  4CFR A;  1FW4 A;  1XVJ A;  4GGF C;  2CXJ A;  1EG3 A;  1WLZ A;  3GK1 A;  5KU1 A;  1QIV A;  2AAO A;  3BOW B;  1QVI Z;  3TS5 C;  4QJ5 B;  1DJG A;  3PSR A;  2L2E A;  2O5G A;  3NSK A;  3PFV A;  2KYF A;  3SG5 A;  3TUY C;  1JSA A;  1JUO A;  2ZNE A;  1PVA A;  1S3P A;  2JNF A;  4GGN A;  1V1G A;  1XFW O;  2L0P A;  3I5I C;  3EK4 A;  3AAK A;  1BOD A;  4OV2 A;  3VRQ A;  1KK8 C;  2K7O A;  2L4I A;  2ZFD A;  4HRH A;  4ZCV A;  4ETO A;  2JNX A;  1TIZ A;  1NCX A;  1A4P A;  4XJK A;  3VRO A;  1XFV O;  1ZFS A;  2LAP A;  3WXA A;  2LVK A;  1QIW A;  1SKT A;  2FCE A;  1UP5 A;  3DD4 A;  4TNC A;  1M31 A;  1ALV A;  1D1O A;  4I5J A;  2NXQ A;  4PE0 A;  2KYC A;  2L98 A;  3FS7 A;  1YUU A;  2I18 A;  1Y0V H;  1SCM B;  2PMY A;  1Y1X A;  3BUX B;  2PSR A;  1BG1 A;  2HQ8 A;  2LVJ A;  2KBI A;  1J1E A;  3KF9 A;  4M2Q A;  2LE9 B;  1W7I B;  2LLT A;  2KI6 D;  3JTD B;  1SL9 A;  4M2O A;  1PRW A;  2KI4 C;  3CLN A;  5IBW A;  1A03 A;  1F54 A;  1ZMZ A;  1CLM A;  3KEV A;  4AOM A;  1SBJ A;  3OX5 A;  2BE6 A;  1IRJ A;  1SL7 A;  1UHH A;  1F4Q A;  1YX7 A;  1K2H A;  2A4J A;  1IH0 A;  2LHI A;  4A4C A;  3EVR A;  1PK0 D;  2KDH A;  5DKQ A;  2ZKM X;  2LMV A;  4PE7 A;  4NDD A;  1MXE A;  4OKH A;  4MBE A;  4YBH B;  4MVF A;  4PHN A;  1BR1 B;  3TZ1 A;  4A4B A;  3I5G B;  3WHT B;  1B8C A;  4HRE E;  3I5H B;  2ZND A;  1QV1 A;  1CDM A;  4CID A;  1B9A A;  3LK0 A;  5TNC A;  4YI8 A;  2K7B A;  3AKA A;  1TN4 A;  1NX3 A;  5I2O A;  2KBM A;  3OX6 A;  3NSO A;  1KQM B;  1Q80 A;  1UHI A;  3GOF A;  2M49 B;  1NX2 A;  1S6C A;  1SK6 D;  2SAS A;  2WND A;  1K94 A;  1IQ5 A;  1WY9 A;  2M1U A;  2MAZ A;  1S5G Z;  1Y1U A;  1ALW A;  1S36 A;  5HKZ A;  1CFP A;  1NSH A;  3SIB A;  3EKJ A;  1BMO A;  1B8R A;  1E8A A;  1YUT A;  3A8R A;  4YGC B;  1BJF A;  1B47 A;  2F2O A;  2JOJ A;  3AAJ A;  3FIA A;  4GNK B;  4PHK A;  1OQP A;  3MSE B;  2BL0 C;  1YVL A;  2LLS A;  2LP3 A;  1J7O A;  1RFJ A;  3BUM B;  1SYM A;  3PN7 C;  2BKI B;  1DT7 B;  3GK2 A;  5FYX A;  2V53 A;  1UUS A;  5AAN A;  1A29 A;  1SR6 B;  2O60 A;  2KGB C;  2L51 A;  1R2U A;  5K89 A;  1UUR A;  2JRF A;  1BU3 A;  2KFF A;  2ZRS A;  1DMO A;  1REC A;  1LXF C;  1BF5 A;  1G4Y R;  3SG4 A;  5G08 A;  1N2D A;  1WRK A;  1KWO C;  4DCK A;  1GJY A;  3KHE A;  2KQY A;  3BXK A;  3LLE A;  1L2O B;  4PHM A;  1SNL A;  2F2P A;  4GFT A;  5I2Q A;  2WCE A;  4HRG A;  5KSZ A;  1M46 A;  1CDL A;  1MWN A;  3ZWH A;  4AQI A;  1QTX A;  3CS1 A;  3KO0 A;  1SW8 A;  1CNP A;  4U8D A;  1JFJ A;  1SPY A;  1V1F A;  1XFU O;  3DVE A;  2GGZ A;  3LL8 B;  1TNP A;  1JBA A;  1RWY A;  2LLU A;  4R1E A;  1SL8 A;  1NPQ A;  3LCP C;  4PE1 A;  2MBX A;  3BUN B;  2ZRT A;  4N1G A;  1B7T Y;  2JT0 A;  1S6I A;  1FBV A;  1OMR A;  1ZUZ A;  1RJV A;  1QAT A;  4JQ0 D;  4WRI A;  1RRO A;  3D10 A;  2JWW A;  3EK8 A;  2CBL A;  2LM5 A;  2LNK A;  2WCB A;  1DJX A;  1B8L A;  1LVC D;  1TTX A;  1KQV A;  1J1D A;  3GK4 X;  4MRY A;  1SMG A;  2M7L A;  1NWD A;  2G9B A;  3CGA A;  3TUY B;  1G33 A;  2Y1M A;  4YGB B;  2F3Z A;  2LP2 A;  4QJ4 B;  4YRU A;  2LVV A;  4I5K A;  4FTG A;  5CSN A;  2PAS A;  4I5N B;  4MZJ A;  2OTG C;  2JQ6 A;  2L4H A;  1ZOT B;  1DJY A;  4WQ2 A;  1PVB A;  4PHJ A;  1YRT B;  5HLO A;  2LHL A;  3LK1 A;  3E3R A;  4CPV A;  3BYA A;  5F6T A;  4ICB A;  1FPW A;  2G2B A;  3PAL A;  4DRW A;  2MLF C;  1Y1A A;  2KGR A;  2SCP A;  5HLV A;  1CM4 A;  3M0W A;  2BCX A;  1DGU A;  5I8N A;  1WRZ A;  2BKH B;  1SCM C;  1QXP A;  2TN4 A;  1F71 A;  1IJ5 A;  2K2F A;  4OR9 B;  2ZN9 A;  5CSJ A;  1NUB A;  4JPZ B;  4MZK A;  2KAY A;  4USL A;  3VRP A;  1DJH A;  1LKJ A;  1KSM A;  1DJW A;  2EGD A;  3NXA A;  1S26 D;  2WOS A;  4BY4 A;  4DIR A;  1GGZ A;  3JTD C;  2MRD A;  5CSF A;  5PAL A;  1M63 B;  2KI4 B;  3KPX A;  5CPV A;  1JC2 A;  5D69 A;  1EL4 A;  5J3X A;  1AVS A;  1KK7 Z;  2JUL A;  2QAC A;  1K93 D;  2EC6 B;  2K8M B;  4ORA B;  4C0K A;  3OB1 B;  3I5F C;  1MR8 A;  3DF0 A;  1XFZ O;  1BLQ A;  2M1K B;  2BCB A;  3CR2 A;  3JVT B;  2KNE A;  1J7P A;  2CNP A;  1G8I A;  1DJI A;  3A4U B;  4MN0 A;  3I5H C;  2KAX A;  2D8N A;  2KQ6 A;  2LMU A;  1L7Z A;  2H61 A;  4P2Y B;  4MEW A;  1K95 A;  2M3W A;  2E6W A;  4PAL A;  1AJ5 A;  4L9M A;  2BE4 A;  1DJZ A;  2I94 A;  1DF0 B;  1TCO B;  1PSB A;  5JJG A;  1QLK A;  3BUW B;  1XFY O;  5HYD A;  1OZS A;  1YRU B;  2M97 A;  1KQM C;  1YTZ C;  3CR4 X;  2NLN A;  1KSO A;  2L50 A;  2LVI A;  3BOW A;  1OZO A;  3IQQ A;  1TNQ A;  1CLL A;  2NZ0 A;  3QRX A;  1K9P A;  4C0L A;  3CR5 X;  2CTN A;  1U5I B;  1CLB A;  4WQ3 A;  3IF7 A;  1QV0 A;  1CFF A;  1CDN A;  4P5O E;  2B1U A;  3OB2 B;  1YVH A;  4GUK A;  1DGV A;  2M9G A;  1FF1 A;  3TDZ A;  1KFX S;  1AHR A;  4HSZ A;  3RLZ A;  2PVB A;  2BL0 B;  4MRX A;  1N65 A;  2HF5 A;  1QLS A;  1XFX O;  3PN7 B;  1SR6 C;  2Y1N A;  1H4B A;  1YR5 A;  1QX7 A;  3C1V A;  4M2P A;  2R2I A;  1CMF A;  3SG7 A;  2HPS A;  1MQ1 A;  1UHN A;  1SY9 A;  2RGI A;  1FI5 A;  1A2X A;  3FWB A;  1CMG A;  2DOQ A;  1YUR A;  1TNW A;  4UPG A;  3PAT A;  2GV5 A;  2JTZ A;  1CFC A;  1RK9 A;  3OP0 A;  1M45 A;  1K90 D;  2BBM A;  4DS7 A;  4PDZ A;  3EVU A;  2K7C A;  4GPL B;  1ODB A;  2OS8 B;  1J55 A;  1KWO B;  1S5G Y;  1XK4 A;  2WC8 A;  4N5X A;  4NDC A;  4N1F A;  1WDC B;  3IQO A;  2KFG A;  1KFU S;  3O78 A;  5KTY A;  2LUC A;  3D0Y B;  1F4O A;  2LMT A;  4XYN A;  1IQ3 A;  1CM1 A;  1Y6W A;  2H61 C;  2FOT A;  1MXL C;  3PLF B;  1BOC A;  1OMV A;  1WLM A;  2LV7 A;  5GQQ C;  1KCY A;  3NSI A;  1C07 A;  1MHO A;  1X02 A;  1TNX A;  2OPO A;  3O2P A;  5ER5 A;  2FCD A;  1AK8 A;  3CZT X;  2NCP A;  1NYA A;  3TS5 B;  1TOP A;  2JPT A;  2JXL A;  2BBN A;  1AUI B;  2L5X B;  1S1E A;  1UWO A;  1NX0 A;  1MF8 B;  2EHB A;  3I5I B;  5CSI A;  5JOL A;  4BY5 A;  2PAL A;  1A75 B;  4ORB B;  3SG2 A;  1DVI A;  1J7R A;  1QJT A;  1KK8 B;  3F45 A;  5AFP A;  3HCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...