5D69A

Human calpain pef(s) with (2z,2z')-2,2'-disulfanediylbis(3-(6-iodoindol-3-yl)acrylic acid) bound
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
173
structure length
173
Chain Sequence
EEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calpain small subunit 1
publication title Conformationally restricted calpain inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 61
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5d69A00
4PHNA 1GGWA 3JTDB 3OHMB 2F3YA 3CR2A 3OB1B 5K89A 2HQ8A 1BR1B 1V1GA 3A8RA 1E8AA 5CSFA 1YX7A 2IS9A 1IWQA 2JQ6A 2KAVA 1BU3A 1BODA 3RM1A 4PE1A 3D10A 2OTGB 1BLQA 1DJYA 3SIBA 1A03A 1B1GA 1R2UA 1KWOB 1ALVA 2EGDA 2WCBA 1AJ5A 1QX5B 3PFVA 1KFXL 3M0WA 2P6BB 1AHRA 1DF0A 3BYAA 2KBIA 3AAKA 1A4PA 1BT6A 1NP8A 1SL9A 2BL0C 2O60A 2K7CA 1FW4A 1S1EA 2LV7A 1QVIZ 4MLWA 2FJUB 2LCPA 1K93D 5ER5A 1S5GY 4WQ3A 1N2DA 3TS5C 1XYDA 1WDCB 1PSBA 4USLA 1IRJA 1Y0VH 1KSOA 2PMYA 1DJWA 1B7TY 2TN4A 3VRNA 3DVJA 3D0YA 1J7QA 2LUCA 4ZCUA 1L2OB 2V53A 1LA3A 1DT7B 1PULA 4ZCVA 3I5HB 3EKHA 1UHJA 1RJVA 3FS7A 3FWBA 1CDPA 1A2XA 1B4CA 1SW8A 2I18A 1U5IA 2KFFA 4I5NB 3BUNB 2KQ6A 5D69A 5DKQA 3KEVA 2CXJA 1YUSA 3WHTB 1MR8A 1UUSA 2E6WA 4NDBA 3CS1A 3VROA 5BPJA 4I5JA 4P2YB 5HLOA 2WC8A 1F4OA 1SRAA 3IF7A 5CSNA 4CFRA 1FF1A 1FBVA 2FCEA 2OPOA 5HYDA 1S3PA 1XO5A 2CBLA 1J55A 2EHBA 1ZACA 5J3XA 2LLSA 2AMIA 2F8PA 3BUMB 3K21A 1OE9B 1RTP1 2LVVA 4HSZA 1YTZC 1ODBA 1FPWA 1GQMA 2LC5A 4YRUA 2JTZA 2K8MB 2MHHA 1DTLA 2AUCA 2L0PA 5AFPA 3SG2A 1PSRA 2PASA 3BUWB 3EK8A 1N65A 2F2PA 2ZFDA 1EJ3A 1MQ1A 4MZLA 4WQ2A 1QX2A 2BCXA 3NSOA 1CNPA 1OZOA 2LMVA 4XJKA 1K2HA 1GJYA 1IGVA 3FIAA 1SK6D 1WLZA 1RWYA 4AQIA 1YX8A 1FI5A 1VRKA 3NSLA 1DJXA 3WXAA 2CCMA 2KOTA 1SCMB 1C7VA 3KF9A 2LVKA 3CTNA 2PRUA 1KK8C 5I2OA 1F71A 1QLKA 2M1UA 4PHKA 2KYCA 2BKHB 1XFZO 1PK0D 2VRGA 3BXKA 2WCEA 3I5FC 2B1UA 3LCPC 1AK8A 4YGAA 1F70A 1YVHA 3ZNIA 2BKIB 1IQ5A 2LAPA 2LE9B 2LUXA 1SL7A 3BQ3A 5KSZA 3CLNA 4YI8A 4NQGA 2KAYA 3FWCA 1RECA 1SR6C 1Y6WA 1RROA 2K7DA 2KFHA 1SCVA 1NCZA 2JZIA 5HLVA 3TDIA 3CZTX 3IQOA 5JOLA 4MVFA 1NCXA 2ZKMX 2L4IA 1KFUS 1A75B 4QJ3B 1CFPA 1CTRA 3LLEA 2L98A 5B8IB 4A4BA 2OS8C 3AAJA 5I2QA 2G2BA 1YUUA 2EC6B 3TUYB 5IBWA 2MLFC 5F6TA 4YGCB 4PE7A 2NLNA 2SASA 1KQMC 2AAOA 2BBNA 1AP4A 3GK1A 4QJ4B 1JFJA 1CB1A 1QIVA 1SMGA 1WRLA 2NXQA 2FOTA 2KFGA 3GK4X 3OX5A 3LK1A 1TNPA 5I8NA 1XK4C 1WRKA 2MAZA 5AANA 3IQQA 3OB2B 1YUTA 4MZKA 2CTNA 2KSPA 3JTDC 1TNQA 4PDZA 2LVJA 2NCOA 3AKAA 1EXRA 1RK9A 4JPZB 1SBJA 4GPLB 4OR9B 2ZNDA 1HQVA 1UHHA 1BG1A 1J7PA 2NCPA 1A29A 4YI9A 2BCAA 4M2QA 1PVBA 2HF5A 2I94A 4GFTA 4HREE 5CSJA 4DCKA 2OTGC 4ORCB 1J1EA 1F54A 1PALA 1CFFA 5I2LA 1M39A 2JTTA 3EVVA 2JXLA 2KYFA 4NDDA 1KWOC 2L4HA 2KGBC 3SG4A 1QJTA 1CMGA 1OMDA 1B7TZ 1SYMA 2LM5A 1B47A 2Q91A 3O4YA 4N5XA 4P5OE 4CIDA 4D1EA 2ZN9A 1OMRA 1NPQA 5GQQC 5AEQA 5DKRA 3DF0A 4C0JA 3PM8A 1XK4A 3MSEB 1QV0A 1KFXS 1IG5A 1QVIY 2HQWA 2KI4B 5CSIA 4GGNA 3BUOB 4YBHB 1CDMA 1XFWO 4PCWA 1ZUZA 3O2PA 4DRWA 2HPSA 2L51A 2Q4UA 1WDCC 1NCYA 2LLUA 3H4SE 1IJ5A 5HKWA 1BMOA 1JF0A 3PN7B 1XFUO 3I5IB 1DVIA 3LL8B 1L2OC 2KDHA 2KI6D 3F45A 5JJGA 4L9MA 1H4BA 2M1KB 4BY5A 2R2IA 1AJ4A 1CLBA 3I5HC 3DVKA 1ZFSA 1QATA 4A4CA 4PE4A 2JXCA 1X02A 3BUXB 4MRXA 1JWDA 1EG3A 1L7ZA 1K8UA 1JF2A 1OOJA 2GGMA 2ZRSA 1SKTA 1R6PA 1LVCD 2MLEC 2SCPA 2Y5IA 5KU1A 2ZRTA 2LP2A 1J7RA 5G08A 1AVSA 4I5LB 1QV1A 5DKNA 4ICBA 3ZWHA 1UHIA 1DGUA 4PE0A 2H61C 3BOWA 3VGOA 1M45A 4GBAA 1NX0A 2K2FA 2QACA 1YURA 2JU0A 1GGZA 1BR4B 2LVIA 5KTYA 2JNFA 1HT9A 1N0YA 1QLSA 1CFCA 1XA5A 2I2RE 1KSMA 2M3WA 3WNXB 3CR4X 1XFXO 1YR5A 4AQJA 2LHIA 2GV5A 1S26D 4C0LA 2ZNEA 3KHEA 1TOPA 3TZ1A 4MEWA 2FCDA 1K9KA 2HETA 1TRFA 2KNEA 2K7OA 4XYNA 1QXPA 2MJWB 2WOSA 3PLFB 1PRWA 2BE4A 1QASA 1B8LA 3JVTB 1IQ3A 3VRRA 1SCMC 2LP3A 3LK0A 1ZOTB 1B9AA 4FTGA 3I5GB 3QRXA 1F4QA 5AXIA 1DF0B 1TNXA 2I7AA 1CLLA 4JWQA 1SPYA 1XVJA 1M63B 5AERA 2L5XB 1KCYA 1K90D 1CM4A 1WRZA 1UP5A 1B8CA 4IL1A 3OP0A 1S36A 2BBMA 1KK7Y 4TNCA 4R1EA 3NSKA 1K95A 4U8DA 1EL4A 4YGDB 4YGEB 1D1OA 1UWOA 2M29A 1LKJA 4YGBB 3D0YB 4ETOA 1K96A 3PSRA 1DJIA 4F0ZB 1NYAA 1MXEA 2KI6C 2LHLA 1NUBA 1J7OA 1G4YR 1MF8B 1KQVA 1DMOA 1DJHA 1QS7A 4PALA 1DJZA 2L50A 3EK4A 1NIWA 2L2EA 3HX4A 3CWGA 1BJFA 2CT9A 2EC6C 3TUYC 1OZSA 1U5IB 2JT8A 1S6CA 1CDNA 1SNLA 2JULA 4N1GA 4PHJA 4UPGA 1DJGA 5HKZA 2JT3A 2WORA 3HCMA 1Y1AA 4AOMA 4GGFC 1W7JB 3RLZA 1QTXA 2BL0B 1M46A 1DGVA 1BF5A 2M97A 2MBXA 2KAXA 2K0JA 1MWNA 4CPVA 3TS5B 1PVAA 2F3ZA 1OSAA 1S5GZ 4ORBB 3SG7A 1JUOA 5TNCA 1K94A 3E3RA 2A4JA 1C07A 1G33A 2BE6A 1S6IA 4OKHA 3KO0A 2F33A 3GOFA 5ER4X 1A75A 1NX1A 1CFDA 1Y1UA 2JRFA 2M8UA 2M9GA 4MN0A 4XJKB 5PALA 4C0KA 3A4UB 4GAOA 1M31A 3BOWB 3DVMA 1JSAA 1QX7A 4CLNA 4OV2A 1IJ6A 2COLB 2M49B 2PVBA 2CNPA 3O6BA 3DVEA 3VRPA 1YRTB 4GGFA 1CM1A 1B8RA 1OMVA 2K7BA 1BOCA 4OCIA 2BCBA 1ALWA 2K61A 2ZN8A 1QIWA 1NX2A 2LMTA 2K2AA 4CFQA 1SY9A 2Y1MA 2BECA 1TN4A 1WY9A 2JT0A 2KI4C 3PALA 2KHNA 3NSIA 3EVRA 1K9PA 1F8HA 4HRHA 2LMUA 3O78A 3PATA 1F55A 3AKBA 2ISDA 3VRQA 1UHKA 2WCFA 4PHMA 4Q04A 4E68A 3PN7C 1CLMA 3I5IC 2RGIA 2LNKA 4MZJA 1IKUA 1NSHA 1ZMZA 2E30A 2H2KA 2JWWA 2WNDA 1J1DA 1MXLC 1JC2A 2MA2A 4N1FA 4BY4A 1W7IB 1EH2A 1EG4A 2Y4QA 4MRYA 4JQ0D 1KK8B 2KBMA 4HRGA 2LLTA 4QJ5B 4GUKA 2KQYA 1Y1XA 4WRIA 2PALA 1NWDA 3KPXA 2JPTA 3I5FB 5CPVA 2QPTA 2M0RA 1CMFA 3WHUB 1RFJA 4DS7A 3TDUA 1UHNA 2JC2A 2JNXA 1TCFA 1LA0A 2KGRA 1AUIB 2NZ0A 2MRDA 1MUXA 1SL8A 1YRUB 3EKJA 1LXFC 1G8IA 3DD4A 4DIRA 1V1FA 1KFUL 1SR6B 4FQOA 1OQPA 2D8NA 3C1VA 1CDLA 4MBEA 1IH0A 3SG5A 3CGAA 4I5KA 1LINA 1XFVO 1CKKA 4GNKB 2DOQA 1K9UA 2H61A 3OX6A 1TTXA 1TCOB 2F2OA 2OS8B 1MHOA 3CR5X 1XFYO 2PSRA 3SIAA 3EVUA 4DUQA 1TIZA 3GK2A 1KK7Z 4NDCA 1WLMA 4M2OA 1YVLA 1NX3A 3TDZA 1S6JA 3SJSA 1JBAA 2JOJA 1UURA 2G9BA 3ICBA 3JVTC 1H8BA 1FI6A 5D7FA 5FYXA 2LANA 4ORAB 1KQMB 1JFKA 2O5GA 3EK7A 3I5GC 1TNWA 1Q80A 1C7WA 3NXAA 2M7NA 3SG3A 4OVNF 2GGZA 5HKYA 3DF0B 2M7LA 3SG6A 2Y1NA 4M2PA 4MSPA
chains in the Genus database with same CATH superfamily
4PHNA 1GGWA 3JTDB 3OHMB 2F3YA 3CR2A 3OB1B 5K89A 2HQ8A 1BR1B 1V1GA 3Q8IA 3A8RA 1E8AA 5CSFA 1YX7A 2IS9A 1IWQA 2JQ6A 2KAVA 1BU3A 5EL2A 1BODA 3RM1A 4PE1A 3D10A 2OTGB 1BLQA 1DJYA 3SIBA 1A03A 4PT1A 1B1GA 1R2UA 3S0GA 1KWOB 1ALVA 2EGDA 2WCBA 1AJ5A 1QX5B 3PFVA 1KFXL 3M0WA 2P6BB 1AHRA 2QDIA 1DF0A 3BYAA 2KBIA 3AAKA 1A4PA 1BT6A 1OOGA 1NP8A 1SL9A 2BL0C 2O60A 2K7CA 1FW4A 1S1EA 2LV7A 3CZ0A 1QVIZ 4MLWA 2FJUB 2LCPA 1K93D 5ER5A 1S5GY 4WQ3A 1N2DA 3TS5C 1XYDA 1OOFA 1WDCB 1PSBA 4USLA 1IRJA 1T14A 1Y0VH 1KSOA 2PMYA 1DJWA 1B7TY 2TN4A 3VRNA 3DVJA 3D0YA 1J7QA 2LUCA 4ZCUA 1L2OB 1GM0A 2V53A 1LA3A 1DT7B 1PULA 1IIOA 1DEKA 3L47A 4ZCVA 3I5HB 2P70A 3EKHA 1UHJA 1RJVA 3FS7A 3FWBA 1CDPA 1A2XA 4KYNA 1B4CA 1SW8A 2I18A 1U5IA 2KFFA 4I5NB 3BUNB 2KQ6A 5D69A 5DKQA 3RZSA 3KEVA 2CXJA 4OZDA 1YUSA 3WHTB 1MR8A 1UUSA 2E6WA 4NDBA 3CS1A 3VROA 5BPJA 4I5JA 4P2YB 5HLOA 2WC8A 1F4OA 1SRAA 3IF7A 5CSNA 4CFRA 1FF1A 1FBVA 2FCEA 2OPOA 5HYDA 1S3PA 1XO5A 2CBLA 1J55A 2EHBA 1ZACA 5J3XA 3S0BA 2LLSA 2AMIA 2F8PA 3BUMB 3K21A 1OE9B 1RTP1 2LVVA 4HSZA 1YTZC 1ODBA 1FPWA 1GQMA 2LC5A 2PYQA 2JTZA 2K8MB 2MHHA 1DTLA 2AUCA 2L0PA 4YRUA 5AFPA 3SG2A 1PSRA 2PASA 3BUWB 3EK8A 1N65A 2F2PA 2ZFDA 1EJ3A 1MQ1A 4MZLA 4WQ2A 1QX2A 2BCXA 3S0EA 3NSOA 3D78A 1OOHA 1OZOA 2LMVA 1CNPA 4XJKA 1K2HA 1GJYA 1IGVA 2KLEA 2YGUA 3FIAA 1SK6D 1WLZA 1RWYA 4AQIA 1YX8A 1FI5A 1VRKA 3NSLA 1DJXA 4IJ7A 3WXAA 2QEHA 2CCMA 2KOTA 1SCMB 1C7VA 3KF9A 2LVKA 3CTNA 2PRUA 1KK8C 5I2OA 1F71A 1QLKA 2M1UA 4PHKA 2KYCA 3R72A 2BKHB 1XFZO 1PK0D 2VRGA 3BXKA 2WCEA 2KLDA 3I5FC 2B1UA 3LCPC 3PM2A 1AK8A 4YGAA 1F70A 1YVHA 3ZNIA 2PQLA 2BKIB 1IQ5A 2LAPA 2LE9B 2FJYA 2LUXA 1SL7A 3BQ3A 5KSZA 1DQEA 3CLNA 3VB1A 4YI8A 4F7FA 4NQGA 2KAYA 3FWCA 3S0FA 1RECA 1SR6C 1Y6WA 1RROA 2K7DA 2KFHA 1SCVA 1NCZA 2JZIA 5HLVA 3TDIA 3CZTX 3IQOA 5JOLA 4MVFA 1NCXA 2ZKMX 1XFRA 2L4IA 1KFUS 1A75B 4QJ3B 1CFPA 1CTRA 3LLEA 2WCLA 5FI2A 2L98A 2QEOA 3CABA 5B8IB 4A4BA 2OS8C 3AAJA 5I2QA 2G2BA 1YUUA 2EC6B 3TUYB 5IBWA 2MLFC 5F6TA 4YGCB 3UNWA 4JD9A 4PE7A 3B87A 2NLNA 3D77A 2SASA 1KQMC 2AAOA 2BBNA 1AP4A 3GK1A 4QJ4B 3BJHA 1CB1A 1JFJA 1QIVA 1SMGA 1WRLA 2NXQA 2FOTA 2KFGA 1P28A 3IVTA 3GK4X 3OX5A 3LK1A 1TNPA 5I8NA 1XK4C 1WRKA 2MAZA 3BFAA 5AANA 5I94A 3IQQA 3CDNA 3S0AA 1DELA 2KPHA 1YUTA 3OB2B 2CTNA 4MZKA 2KSPA 3JTDC 1TNQA 4PDZA 2LVJA 2NCOA 3AKAA 1EXRA 1RK9A 4JPZB 1SBJA 4GPLB 4OR9B 2ZNDA 5FI6A 1HQVA 1UHHA 1BG1A 1J7PA 2NCPA 1A29A 4YI9A 2BCAA 4M2QA 1PVBA 2HF5A 2I94A 4GFTA 4HREE 5CSJA 4DCKA 2OTGC 4ORCB 1J1EA 1F54A 1PALA 1CFFA 5I2LA 1M39A 2JTTA 1LS8A 3EVVA 2JXLA 2KYFA 2WCJA 4NDDA 1KWOC 2L4HA 2KGBC 3SG4A 1QJTA 1CMGA 1OMDA 1B7TZ 1SYMA 2LM5A 1B47A 2Q91A 3O4YA 4N5XA 4P5OE 4CIDA 4D1EA 2ZN9A 1OMRA 1NPQA 5GQQC 5AEQA 5DKRA 3DF0A 4C0JA 2JPOA 3PM8A 1XK4A 3DYEA 1Z2CB 3MSEB 1QV0A 1KFXS 1IG5A 1QVIY 1TUZA 2HQWA 2KI4B 5CSIA 4GGNA 3BUOB 4YBHB 5HL1A 1CDMA 1XFWO 3EG5B 4PCWA 1ZUZA 3O2PA 4DRWA 2HPSA 2L51A 2QEBA 2Q4UA 1WDCC 1NCYA 2LLUA 3H4SE 1IJ5A 5HKWA 1BMOA 1JF0A 3PN7B 3V2LA 1XFUO 3I5IB 1DVIA 3LL8B 3DY9A 1L2OC 2KDHA 2KI6D 3F45A 5JJGA 4L9MA 1H4BA 2M1KB 4BY5A 2R2IA 1AJ4A 1CLBA 3I5HC 3DVKA 1ZFSA 4FQTA 1QATA 4A4CA 4PE4A 2JXCA 1X02A 3BUXB 4MRXA 1W9ZA 2WCMA 1JWDA 1EG3A 1L7ZA 1K8UA 1JF2A 1OOJA 2GGMA 2ZRSA 1TUJA 1SKTA 1R6PA 1LVCD 2MLEC 2SCPA 2Y5IA 5KU1A 2ZRTA 2LP2A 1J7RA 5G08A 1AVSA 4I5LB 1QV1A 5DKNA 4ICBA 3ZWHA 1UHIA 1DGUA 4PE0A 2H61C 3BOWA 3VGOA 1C3YA 1M45A 4GBAA 2BNXA 1NX0A 1TWOA 2K2FA 2QACA 1YURA 2JU0A 1GGZA 1BR4B 2LVIA 5KTYA 2JNFA 1HT9A 1N0YA 1QLSA 1CFCA 1XA5A 2I2RE 1KSMA 2M3WA 3WNXB 3CR4X 1XFXO 1YR5A 2GTEA 4AQJA 2LHIA 2GV5A 3NHTA 1S26D 4C0LA 2ZNEA 3NHIA 3KHEA 1TOPA 3TZ1A 4MEWA 2H8VA 3N7HA 3D74A 2FCDA 1K9KA 2HETA 1TRFA 2KNEA 2K7OA 4XYNA 1QXPA 2MJWB 2WOSA 3PLFB 1PRWA 2BE4A 1QASA 1B8LA 3JVTB 1IQ3A 3L4LA 3CZ2A 1SCMC 2LP3A 3LK0A 3VRRA 1ZOTB 1B9AA 4FTGA 3I5GB 3QRXA 1F4QA 3SS5A 5AXIA 1DF0B 1TNXA 3O4XA 2I7AA 1ORGA 1CLLA 4JWQA 1SPYA 1XVJA 1M63B 5AERA 2L5XB 1KCYA 1K90D 1CM4A 1WRZA 1UP5A 1B8CA 4IL1A 3UO9A 3OP0A 1S36A 2BBMA 1KK7Y 2K60A 4TNCA 4R1EA 3NSKA 1K95A 4U8DA 1EL4A 4YGDB 4YGEB 1D1OA 1UWOA 2M29A 2L5YA 1LKJA 4YGBB 3D0YB 4ETOA 1K96A 3PSRA 1DJIA 4F0ZB 1OW4A 1NYAA 1MXEA 2KI6C 2LHLA 3BFHA 1NUBA 1J7OA 1G4YR 1MF8B 1KQVA 1DMOA 1DJHA 1QS7A 4PALA 1DJZA 2L50A 3EK4A 1NIWA 2L2EA 3HX4A 3CWGA 1BJFA 2CT9A 2EC6C 3FE9A 1OZSA 3TUYC 1U5IB 2JT8A 1S6CA 3BFBA 1SNLA 2JULA 4N1GA 1CDNA 4PHJA 4UPGA 1DJGA 5HKZA 3OBVA 2JT3A 2WORA 3HCMA 1Y1AA 4AOMA 4GGFC 1W7JB 3RLZA 1QTXA 2BL0B 1M46A 1DGVA 4INXA 1BF5A 2M97A 2MBXA 3CZ1A 2KAXA 2K0JA 1MWNA 4CPVA 3TS5B 1PVAA 2F3ZA 1OSAA 1S5GZ 4ORBB 3CYZA 1OOIX 1JUOA 3SG7A 5TNCA 1K94A 3D76A 3E3RA 2A4JA 1C07A 1G33A 2BE6A 3B7AA 1S6IA 4OKHA 3KO0A 2F33A 3DXLA 3GOFA 1A75A 1NX1A 5ER4X 1CFDA 1Y1UA 2JRFA 2M8UA 2M9GA 4MN0A 4XJKB 5PALA 4C0KA 3A4UB 1SSEB 1DC1A 4GAOA 2WC5A 1M31A 3OGNA 3R1OA 3BOWB 3DVMA 1JSAA 1QX7A 3B86A 2QEVA 2BAPA 4CLNA 4OV2A 1IJ6A 2COLB 2M49B 2PVBA 2CNPA 3L4AA 3DVEA 3O6BA 2WCKA 3FE8A 3PJIA 3VRPA 1YRTB 4GGFA 1CM1A 1B8RA 1OMVA 2K7BA 1BOCA 4OCIA 2BCBA 1ALWA 2K61A 2ZN8A 1QIWA 1NX2A 2LMTA 2K2AA 4CFQA 5DICA 1SY9A 2Y1MA 3K1EA 2BECA 2WCHA 1TN4A 1WY9A 2JT0A 2KI4C 2L2CA 3PALA 2KHNA 3NSIA 3EVRA 1K9PA 1F8HA 4HRHA 2LMUA 3O78A 3PATA 1F55A 3AKBA 2ISDA 3VRQA 1UHKA 2WCFA 4PHMA 4Q04A 4E68A 3PN7C 1CLMA 3I5IC 2RGIA 2LNKA 4MZJA 1IKUA 1NSHA 1ZMZA 2E30A 2H2KA 2JWWA 2WNDA 1J1DA 1MXLC 4JKTA 1JC2A 1QWVA 2MA2A 1Z4HA 4N1FA 5D3OA 4BY4A 1W7IB 1EH2A 1EG4A 3SS4A 2Y4QA 4MRYA 4JQ0D 1KK8B 2KBMA 3FE6A 4HRGA 2LLTA 4QJ5B 4GUKA 2KQYA 1Y1XA 4WRIA 2PALA 1NWDA 3KPXA 2JPTA 3I5FB 5CPVA 2QPTA 2M0RA 1CMFA 3WHUB 1RFJA 4DS7A 3TDUA 1UHNA 2JC2A 2JNXA 3S0DA 3D75A 1TCFA 1LA0A 2KGRA 1AUIB 2NZ0A 2MRDA 1MUXA 4INWA 1SL8A 1YRUB 3EKJA 1LXFC 1G8IA 3DD4A 4DIRA 1V1FA 3R1PA 1KFUL 1SR6B 3B6XA 4FQOA 1OQPA 2D8NA 3C1VA 1CDLA 4MBEA 1IH0A 3SG5A 3CGAA 4I5KA 1LINA 1XFVO 2ERBA 4GNKB 2DOQA 1K9UA 2H61A 1CKKA 3OX6A 3SS3A 1TTXA 1TCOB 3QMEA 2F2OA 3NGVA 2OS8B 1MHOA 3CR5X 1XFYO 2PSRA 3B88A 3EVUA 3SIAA 4DUQA 1TIZA 3GK2A 1KK7Z 4NDCA 1WLMA 4M2OA 1YVLA 1NX3A 3TDZA 1S6JA 3SJSA 1JBAA 2JOJA 1UURA 2G9BA 2P71A 3ICBA 3D73A 3JVTC 1FI6A 1H8BA 5D7FA 5FYXA 2LANA 4ORAB 1KQMB 1JFKA 2O5GA 3EK7A 3I5GC 1TNWA 1Q80A 1C7WA 3NXAA 2M7NA 3SG3A 2WC6A 4OVNF 2GGZA 5HKYA 3DF0B 2M7LA 3SG6A 2Y1NA 3DZTA 4M2PA 4MSPA 3R1VA 5FI7A 1C3ZA
chains in the Genus database with same CATH topology
4PHNA 1GGWA 3JTDB 3OHMB 2F3YA 3CR2A 3OB1B 5K89A 2HQ8A 1BR1B 1V1GA 3A8RA 1E8AA 5CSFA 1YX7A 2IS9A 1IWQA 2JQ6A 2KAVA 1BU3A 1BODA 3RM1A 4PE1A 3D10A 2OTGB 1BLQA 1DJYA 3SIBA 1A03A 1B1GA 1R2UA 1KWOB 1ALVA 2EGDA 2WCBA 1AJ5A 1QX5B 3PFVA 1KFXL 3M0WA 2P6BB 1AHRA 1DF0A 3BYAA 2KBIA 3AAKA 1A4PA 1BT6A 1NP8A 1SL9A 2BL0C 2O60A 2K7CA 1FW4A 1S1EA 2LV7A 1QVIZ 4MLWA 2FJUB 2LCPA 1K93D 5ER5A 1S5GY 4WQ3A 1N2DA 3TS5C 1XYDA 1WDCB 1PSBA 4USLA 1IRJA 1Y0VH 1KSOA 2PMYA 1DJWA 1B7TY 2TN4A 3VRNA 3DVJA 3D0YA 1J7QA 2LUCA 4ZCUA 1L2OB 2V53A 1LA3A 1DT7B 1PULA 4ZCVA 3I5HB 3EKHA 1UHJA 1RJVA 3FS7A 3FWBA 1CDPA 1A2XA 1B4CA 1SW8A 2I18A 1U5IA 2KFFA 4I5NB 3BUNB 2KQ6A 5D69A 5DKQA 3KEVA 2CXJA 1YUSA 3WHTB 1MR8A 1UUSA 2E6WA 4NDBA 3CS1A 3VROA 5BPJA 4I5JA 4P2YB 5HLOA 2WC8A 1F4OA 1SRAA 3IF7A 5CSNA 4CFRA 1FF1A 1FBVA 2FCEA 2OPOA 5HYDA 1S3PA 1XO5A 2CBLA 1J55A 2EHBA 1ZACA 5J3XA 2LLSA 2AMIA 2F8PA 3BUMB 3K21A 1OE9B 1RTP1 2LVVA 4HSZA 1YTZC 1ODBA 1FPWA 1GQMA 2LC5A 4YRUA 2JTZA 2K8MB 2MHHA 1DTLA 2AUCA 2L0PA 5AFPA 3SG2A 1PSRA 2PASA 3BUWB 3EK8A 1N65A 2F2PA 2ZFDA 1EJ3A 1MQ1A 4MZLA 4WQ2A 1QX2A 2BCXA 3NSOA 1CNPA 1OZOA 2LMVA 4XJKA 1K2HA 1GJYA 1IGVA 3FIAA 1SK6D 1WLZA 1RWYA 4AQIA 1YX8A 1FI5A 1VRKA 3NSLA 1DJXA 3WXAA 2CCMA 2KOTA 1SCMB 1C7VA 3KF9A 2LVKA 3CTNA 2PRUA 1KK8C 5I2OA 1F71A 1QLKA 2M1UA 4PHKA 2KYCA 2BKHB 1XFZO 1PK0D 2VRGA 3BXKA 2WCEA 3I5FC 2B1UA 3LCPC 1AK8A 4YGAA 1F70A 1YVHA 3ZNIA 2BKIB 1IQ5A 2LAPA 2LE9B 2LUXA 1SL7A 3BQ3A 5KSZA 3CLNA 4YI8A 4NQGA 2KAYA 3FWCA 1RECA 1SR6C 1Y6WA 1RROA 2K7DA 2KFHA 1SCVA 1NCZA 2JZIA 5HLVA 3TDIA 3CZTX 3IQOA 5JOLA 4MVFA 1NCXA 2ZKMX 2L4IA 1KFUS 1A75B 4QJ3B 1CFPA 1CTRA 3LLEA 2L98A 5B8IB 4A4BA 2OS8C 3AAJA 5I2QA 2G2BA 1YUUA 2EC6B 3TUYB 5IBWA 2MLFC 5F6TA 4YGCB 4PE7A 2NLNA 2SASA 1KQMC 2AAOA 2BBNA 1AP4A 3GK1A 4QJ4B 1JFJA 1CB1A 1QIVA 1SMGA 1WRLA 2NXQA 2FOTA 2KFGA 3GK4X 3OX5A 3LK1A 1TNPA 5I8NA 1XK4C 1WRKA 2MAZA 5AANA 3IQQA 3OB2B 1YUTA 4MZKA 2CTNA 2KSPA 3JTDC 1TNQA 4PDZA 2LVJA 2NCOA 3AKAA 1EXRA 1RK9A 4JPZB 1SBJA 4GPLB 4OR9B 2ZNDA 1HQVA 1UHHA 1BG1A 1J7PA 2NCPA 1A29A 4YI9A 2BCAA 4M2QA 1PVBA 2HF5A 2I94A 4GFTA 4HREE 5CSJA 4DCKA 2OTGC 4ORCB 1J1EA 1F54A 1PALA 1CFFA 5I2LA 1M39A 2JTTA 3EVVA 2JXLA 2KYFA 4NDDA 1KWOC 2L4HA 2KGBC 3SG4A 1QJTA 1CMGA 1OMDA 1B7TZ 1SYMA 2LM5A 1B47A 2Q91A 3O4YA 4N5XA 4P5OE 4CIDA 4D1EA 2ZN9A 1OMRA 1NPQA 5GQQC 5AEQA 5DKRA 3DF0A 4C0JA 3PM8A 1XK4A 3MSEB 1QV0A 1KFXS 1IG5A 1QVIY 2HQWA 2KI4B 5CSIA 4GGNA 3BUOB 4YBHB 1CDMA 1XFWO 4PCWA 1ZUZA 3O2PA 4DRWA 2HPSA 2L51A 2Q4UA 1WDCC 1NCYA 2LLUA 3H4SE 1IJ5A 5HKWA 1BMOA 1JF0A 3PN7B 1XFUO 3I5IB 1DVIA 3LL8B 1L2OC 2KDHA 2KI6D 3F45A 5JJGA 4L9MA 1H4BA 2M1KB 4BY5A 2R2IA 1AJ4A 1CLBA 3I5HC 3DVKA 1ZFSA 1QATA 4A4CA 4PE4A 2JXCA 1X02A 3BUXB 4MRXA 1JWDA 1EG3A 1L7ZA 1K8UA 1JF2A 1OOJA 2GGMA 2ZRSA 1SKTA 1R6PA 1LVCD 2MLEC 2SCPA 2Y5IA 5KU1A 2ZRTA 2LP2A 1J7RA 5G08A 1AVSA 4I5LB 1QV1A 5DKNA 4ICBA 3ZWHA 1UHIA 1DGUA 4PE0A 2H61C 3BOWA 3VGOA 1M45A 4GBAA 1NX0A 2K2FA 2QACA 1YURA 2JU0A 1GGZA 1BR4B 2LVIA 5KTYA 2JNFA 1HT9A 1N0YA 1QLSA 1CFCA 1XA5A 2I2RE 1KSMA 2M3WA 3WNXB 3CR4X 1XFXO 1YR5A 4AQJA 2LHIA 2GV5A 1S26D 4C0LA 2ZNEA 3KHEA 1TOPA 3TZ1A 4MEWA 2FCDA 1K9KA 2HETA 1TRFA 2KNEA 2K7OA 4XYNA 1QXPA 2MJWB 2WOSA 3PLFB 1PRWA 2BE4A 1QASA 1B8LA 3JVTB 1IQ3A 3VRRA 1SCMC 2LP3A 3LK0A 1ZOTB 1B9AA 4FTGA 3I5GB 3QRXA 1F4QA 5AXIA 1DF0B 1TNXA 2I7AA 1CLLA 4JWQA 1SPYA 1XVJA 1M63B 5AERA 2L5XB 1KCYA 1K90D 1CM4A 1WRZA 1UP5A 1B8CA 4IL1A 3OP0A 1S36A 2BBMA 1KK7Y 4TNCA 4R1EA 3NSKA 1K95A 4U8DA 1EL4A 4YGDB 4YGEB 1D1OA 1UWOA 2M29A 1LKJA 4YGBB 3D0YB 4ETOA 1K96A 3PSRA 1DJIA 4F0ZB 1NYAA 1MXEA 2KI6C 2LHLA 1NUBA 1J7OA 1G4YR 1MF8B 1KQVA 1DMOA 1DJHA 1QS7A 4PALA 1DJZA 2L50A 3EK4A 1NIWA 2L2EA 3HX4A 3CWGA 1BJFA 2CT9A 2EC6C 3TUYC 1OZSA 1U5IB 2JT8A 1S6CA 1CDNA 1SNLA 2JULA 4N1GA 4PHJA 4UPGA 1DJGA 5HKZA 2JT3A 2WORA 3HCMA 1Y1AA 4AOMA 4GGFC 1W7JB 3RLZA 1QTXA 2BL0B 1M46A 1DGVA 1BF5A 2M97A 2MBXA 2KAXA 2K0JA 1MWNA 4CPVA 3TS5B 1PVAA 2F3ZA 1OSAA 1S5GZ 4ORBB 3SG7A 1JUOA 5TNCA 1K94A 3E3RA 2A4JA 1C07A 1G33A 2BE6A 1S6IA 4OKHA 3KO0A 2F33A 3GOFA 5ER4X 1A75A 1NX1A 1CFDA 1Y1UA 2JRFA 2M8UA 2M9GA 4MN0A 4XJKB 5PALA 4C0KA 3A4UB 4GAOA 1M31A 3BOWB 3DVMA 1JSAA 1QX7A 4CLNA 4OV2A 1IJ6A 2COLB 2M49B 2PVBA 2CNPA 3O6BA 3DVEA 3VRPA 1YRTB 4GGFA 1CM1A 1B8RA 1OMVA 2K7BA 1BOCA 4OCIA 2BCBA 1ALWA 2K61A 2ZN8A 1QIWA 1NX2A 2LMTA 2K2AA 4CFQA 1SY9A 2Y1MA 2BECA 1TN4A 1WY9A 2JT0A 2KI4C 3PALA 2KHNA 3NSIA 3EVRA 1K9PA 1F8HA 4HRHA 2LMUA 3O78A 3PATA 1F55A 3AKBA 2ISDA 3VRQA 1UHKA 2WCFA 4PHMA 4Q04A 4E68A 3PN7C 1CLMA 3I5IC 2RGIA 2LNKA 4MZJA 1IKUA 1NSHA 1ZMZA 2E30A 2H2KA 2JWWA 2WNDA 1J1DA 1MXLC 1JC2A 2MA2A 4N1FA 4BY4A 1W7IB 1EH2A 1EG4A 2Y4QA 4MRYA 4JQ0D 1KK8B 2KBMA 4HRGA 2LLTA 4QJ5B 4GUKA 2KQYA 1Y1XA 4WRIA 2PALA 1NWDA 3KPXA 2JPTA 3I5FB 5CPVA 2QPTA 2M0RA 1CMFA 3WHUB 1RFJA 4DS7A 3TDUA 1UHNA 2JC2A 2JNXA 1TCFA 1LA0A 2KGRA 1AUIB 2NZ0A 2MRDA 1MUXA 1SL8A 1YRUB 3EKJA 1LXFC 1G8IA 3DD4A 4DIRA 1V1FA 1KFUL 1SR6B 4FQOA 1OQPA 2D8NA 3C1VA 1CDLA 4MBEA 1IH0A 3SG5A 3CGAA 4I5KA 1LINA 1XFVO 1CKKA 4GNKB 2DOQA 1K9UA 2H61A 3OX6A 1TTXA 1TCOB 2F2OA 2OS8B 1MHOA 3CR5X 1XFYO 2PSRA 3SIAA 3EVUA 4DUQA 1TIZA 3GK2A 1KK7Z 4NDCA 1WLMA 4M2OA 1YVLA 1NX3A 3TDZA 1S6JA 3SJSA 1JBAA 2JOJA 1UURA 2G9BA 3ICBA 3JVTC 1H8BA 1FI6A 5D7FA 5FYXA 2LANA 4ORAB 1KQMB 1JFKA 2O5GA 3EK7A 3I5GC 1TNWA 1Q80A 1C7WA 3NXAA 2M7NA 3SG3A 4OVNF 2GGZA 5HKYA 3DF0B 2M7LA 3SG6A 2Y1NA 4M2PA 4MSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PHN A;  1GGW A;  3JTD B;  3OHM B;  2F3Y A;  3CR2 A;  3OB1 B;  5K89 A;  2HQ8 A;  1BR1 B;  1V1G A;  3A8R A;  1E8A A;  5CSF A;  1YX7 A;  2IS9 A;  1IWQ A;  2JQ6 A;  2KAV A;  1BU3 A;  1BOD A;  3RM1 A;  4PE1 A;  3D10 A;  2OTG B;  1BLQ A;  1DJY A;  3SIB A;  1A03 A;  1B1G A;  1R2U A;  1KWO B;  1ALV A;  2EGD A;  2WCB A;  1AJ5 A;  1QX5 B;  3PFV A;  1KFX L;  3M0W A;  2P6B B;  1AHR A;  1DF0 A;  3BYA A;  2KBI A;  3AAK A;  1A4P A;  1BT6 A;  1NP8 A;  1SL9 A;  2BL0 C;  2O60 A;  2K7C A;  1FW4 A;  1S1E A;  2LV7 A;  1QVI Z;  4MLW A;  2FJU B;  2LCP A;  1K93 D;  5ER5 A;  1S5G Y;  4WQ3 A;  1N2D A;  3TS5 C;  1XYD A;  1WDC B;  1PSB A;  4USL A;  1IRJ A;  1Y0V H;  1KSO A;  2PMY A;  1DJW A;  1B7T Y;  2TN4 A;  3VRN A;  3DVJ A;  3D0Y A;  1J7Q A;  2LUC A;  4ZCU A;  1L2O B;  2V53 A;  1LA3 A;  1DT7 B;  1PUL A;  4ZCV A;  3I5H B;  3EKH A;  1UHJ A;  1RJV A;  3FS7 A;  3FWB A;  1CDP A;  1A2X A;  1B4C A;  1SW8 A;  2I18 A;  1U5I A;  2KFF A;  4I5N B;  3BUN B;  2KQ6 A;  5D69 A;  5DKQ A;  3KEV A;  2CXJ A;  1YUS A;  3WHT B;  1MR8 A;  1UUS A;  2E6W A;  4NDB A;  3CS1 A;  3VRO A;  5BPJ A;  4I5J A;  4P2Y B;  5HLO A;  2WC8 A;  1F4O A;  1SRA A;  3IF7 A;  5CSN A;  4CFR A;  1FF1 A;  1FBV A;  2FCE A;  2OPO A;  5HYD A;  1S3P A;  1XO5 A;  2CBL A;  1J55 A;  2EHB A;  1ZAC A;  5J3X A;  2LLS A;  2AMI A;  2F8P A;  3BUM B;  3K21 A;  1OE9 B;  1RTP 1;  2LVV A;  4HSZ A;  1YTZ C;  1ODB A;  1FPW A;  1GQM A;  2LC5 A;  4YRU A;  2JTZ A;  2K8M B;  2MHH A;  1DTL A;  2AUC A;  2L0P A;  5AFP A;  3SG2 A;  1PSR A;  2PAS A;  3BUW B;  3EK8 A;  1N65 A;  2F2P A;  2ZFD A;  1EJ3 A;  1MQ1 A;  4MZL A;  4WQ2 A;  1QX2 A;  2BCX A;  3NSO A;  1CNP A;  1OZO A;  2LMV A;  4XJK A;  1K2H A;  1GJY A;  1IGV A;  3FIA A;  1SK6 D;  1WLZ A;  1RWY A;  4AQI A;  1YX8 A;  1FI5 A;  1VRK A;  3NSL A;  1DJX A;  3WXA A;  2CCM A;  2KOT A;  1SCM B;  1C7V A;  3KF9 A;  2LVK A;  3CTN A;  2PRU A;  1KK8 C;  5I2O A;  1F71 A;  1QLK A;  2M1U A;  4PHK A;  2KYC A;  2BKH B;  1XFZ O;  1PK0 D;  2VRG A;  3BXK A;  2WCE A;  3I5F C;  2B1U A;  3LCP C;  1AK8 A;  4YGA A;  1F70 A;  1YVH A;  3ZNI A;  2BKI B;  1IQ5 A;  2LAP A;  2LE9 B;  2LUX A;  1SL7 A;  3BQ3 A;  5KSZ A;  3CLN A;  4YI8 A;  4NQG A;  2KAY A;  3FWC A;  1REC A;  1SR6 C;  1Y6W A;  1RRO A;  2K7D A;  2KFH A;  1SCV A;  1NCZ A;  2JZI A;  5HLV A;  3TDI A;  3CZT X;  3IQO A;  5JOL A;  4MVF A;  1NCX A;  2ZKM X;  2L4I A;  1KFU S;  1A75 B;  4QJ3 B;  1CFP A;  1CTR A;  3LLE A;  2L98 A;  5B8I B;  4A4B A;  2OS8 C;  3AAJ A;  5I2Q A;  2G2B A;  1YUU A;  2EC6 B;  3TUY B;  5IBW A;  2MLF C;  5F6T A;  4YGC B;  4PE7 A;  2NLN A;  2SAS A;  1KQM C;  2AAO A;  2BBN A;  1AP4 A;  3GK1 A;  4QJ4 B;  1JFJ A;  1CB1 A;  1QIV A;  1SMG A;  1WRL A;  2NXQ A;  2FOT A;  2KFG A;  3GK4 X;  3OX5 A;  3LK1 A;  1TNP A;  5I8N A;  1XK4 C;  1WRK A;  2MAZ A;  5AAN A;  3IQQ A;  3OB2 B;  1YUT A;  4MZK A;  2CTN A;  2KSP A;  3JTD C;  1TNQ A;  4PDZ A;  2LVJ A;  2NCO A;  3AKA A;  1EXR A;  1RK9 A;  4JPZ B;  1SBJ A;  4GPL B;  4OR9 B;  2ZND A;  1HQV A;  1UHH A;  1BG1 A;  1J7P A;  2NCP A;  1A29 A;  4YI9 A;  2BCA A;  4M2Q A;  1PVB A;  2HF5 A;  2I94 A;  4GFT A;  4HRE E;  5CSJ A;  4DCK A;  2OTG C;  4ORC B;  1J1E A;  1F54 A;  1PAL A;  1CFF A;  5I2L A;  1M39 A;  2JTT A;  3EVV A;  2JXL A;  2KYF A;  4NDD A;  1KWO C;  2L4H A;  2KGB C;  3SG4 A;  1QJT A;  1CMG A;  1OMD A;  1B7T Z;  1SYM A;  2LM5 A;  1B47 A;  2Q91 A;  3O4Y A;  4N5X A;  4P5O E;  4CID A;  4D1E A;  2ZN9 A;  1OMR A;  1NPQ A;  5GQQ C;  5AEQ A;  5DKR A;  3DF0 A;  4C0J A;  3PM8 A;  1XK4 A;  3MSE B;  1QV0 A;  1KFX S;  1IG5 A;  1QVI Y;  2HQW A;  2KI4 B;  5CSI A;  4GGN A;  3BUO B;  4YBH B;  1CDM A;  1XFW O;  4PCW A;  1ZUZ A;  3O2P A;  4DRW A;  2HPS A;  2L51 A;  2Q4U A;  1WDC C;  1NCY A;  2LLU A;  3H4S E;  1IJ5 A;  5HKW A;  1BMO A;  1JF0 A;  3PN7 B;  1XFU O;  3I5I B;  1DVI A;  3LL8 B;  1L2O C;  2KDH A;  2KI6 D;  3F45 A;  5JJG A;  4L9M A;  1H4B A;  2M1K B;  4BY5 A;  2R2I A;  1AJ4 A;  1CLB A;  3I5H C;  3DVK A;  1ZFS A;  1QAT A;  4A4C A;  4PE4 A;  2JXC A;  1X02 A;  3BUX B;  4MRX A;  1JWD A;  1EG3 A;  1L7Z A;  1K8U A;  1JF2 A;  1OOJ A;  2GGM A;  2ZRS A;  1SKT A;  1R6P A;  1LVC D;  2MLE C;  2SCP A;  2Y5I A;  5KU1 A;  2ZRT A;  2LP2 A;  1J7R A;  5G08 A;  1AVS A;  4I5L B;  1QV1 A;  5DKN A;  4ICB A;  3ZWH A;  1UHI A;  1DGU A;  4PE0 A;  2H61 C;  3BOW A;  3VGO A;  1M45 A;  4GBA A;  1NX0 A;  2K2F A;  2QAC A;  1YUR A;  2JU0 A;  1GGZ A;  1BR4 B;  2LVI A;  5KTY A;  2JNF A;  1HT9 A;  1N0Y A;  1QLS A;  1CFC A;  1XA5 A;  2I2R E;  1KSM A;  2M3W A;  3WNX B;  3CR4 X;  1XFX O;  1YR5 A;  4AQJ A;  2LHI A;  2GV5 A;  1S26 D;  4C0L A;  2ZNE A;  3KHE A;  1TOP A;  3TZ1 A;  4MEW A;  2FCD A;  1K9K A;  2HET A;  1TRF A;  2KNE A;  2K7O A;  4XYN A;  1QXP A;  2MJW B;  2WOS A;  3PLF B;  1PRW A;  2BE4 A;  1QAS A;  1B8L A;  3JVT B;  1IQ3 A;  3VRR A;  1SCM C;  2LP3 A;  3LK0 A;  1ZOT B;  1B9A A;  4FTG A;  3I5G B;  3QRX A;  1F4Q A;  5AXI A;  1DF0 B;  1TNX A;  2I7A A;  1CLL A;  4JWQ A;  1SPY A;  1XVJ A;  1M63 B;  5AER A;  2L5X B;  1KCY A;  1K90 D;  1CM4 A;  1WRZ A;  1UP5 A;  1B8C A;  4IL1 A;  3OP0 A;  1S36 A;  2BBM A;  1KK7 Y;  4TNC A;  4R1E A;  3NSK A;  1K95 A;  4U8D A;  1EL4 A;  4YGD B;  4YGE B;  1D1O A;  1UWO A;  2M29 A;  1LKJ A;  4YGB B;  3D0Y B;  4ETO A;  1K96 A;  3PSR A;  1DJI A;  4F0Z B;  1NYA A;  1MXE A;  2KI6 C;  2LHL A;  1NUB A;  1J7O A;  1G4Y R;  1MF8 B;  1KQV A;  1DMO A;  1DJH A;  1QS7 A;  4PAL A;  1DJZ A;  2L50 A;  3EK4 A;  1NIW A;  2L2E A;  3HX4 A;  3CWG A;  1BJF A;  2CT9 A;  2EC6 C;  3TUY C;  1OZS A;  1U5I B;  2JT8 A;  1S6C A;  1CDN A;  1SNL A;  2JUL A;  4N1G A;  4PHJ A;  4UPG A;  1DJG A;  5HKZ A;  2JT3 A;  2WOR A;  3HCM A;  1Y1A A;  4AOM A;  4GGF C;  1W7J B;  3RLZ A;  1QTX A;  2BL0 B;  1M46 A;  1DGV A;  1BF5 A;  2M97 A;  2MBX A;  2KAX A;  2K0J A;  1MWN A;  4CPV A;  3TS5 B;  1PVA A;  2F3Z A;  1OSA A;  1S5G Z;  4ORB B;  3SG7 A;  1JUO A;  5TNC A;  1K94 A;  3E3R A;  2A4J A;  1C07 A;  1G33 A;  2BE6 A;  1S6I A;  4OKH A;  3KO0 A;  2F33 A;  3GOF A;  5ER4 X;  1A75 A;  1NX1 A;  1CFD A;  1Y1U A;  2JRF A;  2M8U A;  2M9G A;  4MN0 A;  4XJK B;  5PAL A;  4C0K A;  3A4U B;  4GAO A;  1M31 A;  3BOW B;  3DVM A;  1JSA A;  1QX7 A;  4CLN A;  4OV2 A;  1IJ6 A;  2COL B;  2M49 B;  2PVB A;  2CNP A;  3O6B A;  3DVE A;  3VRP A;  1YRT B;  4GGF A;  1CM1 A;  1B8R A;  1OMV A;  2K7B A;  1BOC A;  4OCI A;  2BCB A;  1ALW A;  2K61 A;  2ZN8 A;  1QIW A;  1NX2 A;  2LMT A;  2K2A A;  4CFQ A;  1SY9 A;  2Y1M A;  2BEC A;  1TN4 A;  1WY9 A;  2JT0 A;  2KI4 C;  3PAL A;  2KHN A;  3NSI A;  3EVR A;  1K9P A;  1F8H A;  4HRH A;  2LMU A;  3O78 A;  3PAT A;  1F55 A;  3AKB A;  2ISD A;  3VRQ A;  1UHK A;  2WCF A;  4PHM A;  4Q04 A;  4E68 A;  3PN7 C;  1CLM A;  3I5I C;  2RGI A;  2LNK A;  4MZJ A;  1IKU A;  1NSH A;  1ZMZ A;  2E30 A;  2H2K A;  2JWW A;  2WND A;  1J1D A;  1MXL C;  1JC2 A;  2MA2 A;  4N1F A;  4BY4 A;  1W7I B;  1EH2 A;  1EG4 A;  2Y4Q A;  4MRY A;  4JQ0 D;  1KK8 B;  2KBM A;  4HRG A;  2LLT A;  4QJ5 B;  4GUK A;  2KQY A;  1Y1X A;  4WRI A;  2PAL A;  1NWD A;  3KPX A;  2JPT A;  3I5F B;  5CPV A;  2QPT A;  2M0R A;  1CMF A;  3WHU B;  1RFJ A;  4DS7 A;  3TDU A;  1UHN A;  2JC2 A;  2JNX A;  1TCF A;  1LA0 A;  2KGR A;  1AUI B;  2NZ0 A;  2MRD A;  1MUX A;  1SL8 A;  1YRU B;  3EKJ A;  1LXF C;  1G8I A;  3DD4 A;  4DIR A;  1V1F A;  1KFU L;  1SR6 B;  4FQO A;  1OQP A;  2D8N A;  3C1V A;  1CDL A;  4MBE A;  1IH0 A;  3SG5 A;  3CGA A;  4I5K A;  1LIN A;  1XFV O;  1CKK A;  4GNK B;  2DOQ A;  1K9U A;  2H61 A;  3OX6 A;  1TTX A;  1TCO B;  2F2O A;  2OS8 B;  1MHO A;  3CR5 X;  1XFY O;  2PSR A;  3SIA A;  3EVU A;  4DUQ A;  1TIZ A;  3GK2 A;  1KK7 Z;  4NDC A;  1WLM A;  4M2O A;  1YVL A;  1NX3 A;  3TDZ A;  1S6J A;  3SJS A;  1JBA A;  2JOJ A;  1UUR A;  2G9B A;  3ICB A;  3JVT C;  1H8B A;  1FI6 A;  5D7F A;  5FYX A;  2LAN A;  4ORA B;  1KQM B;  1JFK A;  2O5G A;  3EK7 A;  3I5G C;  1TNW A;  1Q80 A;  1C7W A;  3NXA A;  2M7N A;  3SG3 A;  4OVN F;  2GGZ A;  5HKY A;  3DF0 B;  2M7L A;  3SG6 A;  2Y1N A;  4M2P A;  4MSP A; 
#chains in the Genus database with same CATH topology
 4PHN A;  1GGW A;  3JTD B;  3OHM B;  2F3Y A;  3CR2 A;  3OB1 B;  5K89 A;  2HQ8 A;  1BR1 B;  1V1G A;  3Q8I A;  3A8R A;  1E8A A;  5CSF A;  1YX7 A;  2IS9 A;  1IWQ A;  2JQ6 A;  2KAV A;  1BU3 A;  5EL2 A;  1BOD A;  3RM1 A;  4PE1 A;  3D10 A;  2OTG B;  1BLQ A;  1DJY A;  3SIB A;  1A03 A;  4PT1 A;  1B1G A;  1R2U A;  3S0G A;  1KWO B;  1ALV A;  2EGD A;  2WCB A;  1AJ5 A;  1QX5 B;  3PFV A;  1KFX L;  3M0W A;  2P6B B;  1AHR A;  2QDI A;  1DF0 A;  3BYA A;  2KBI A;  3AAK A;  1A4P A;  1BT6 A;  1OOG A;  1NP8 A;  1SL9 A;  2BL0 C;  2O60 A;  2K7C A;  1FW4 A;  1S1E A;  2LV7 A;  3CZ0 A;  1QVI Z;  4MLW A;  2FJU B;  2LCP A;  1K93 D;  5ER5 A;  1S5G Y;  4WQ3 A;  1N2D A;  3TS5 C;  1XYD A;  1OOF A;  1WDC B;  1PSB A;  4USL A;  1IRJ A;  1T14 A;  1Y0V H;  1KSO A;  2PMY A;  1DJW A;  1B7T Y;  2TN4 A;  3VRN A;  3DVJ A;  3D0Y A;  1J7Q A;  2LUC A;  4ZCU A;  1L2O B;  1GM0 A;  2V53 A;  1LA3 A;  1DT7 B;  1PUL A;  1IIO A;  1DEK A;  3L47 A;  4ZCV A;  3I5H B;  2P70 A;  3EKH A;  1UHJ A;  1RJV A;  3FS7 A;  3FWB A;  1CDP A;  1A2X A;  4KYN A;  1B4C A;  1SW8 A;  2I18 A;  1U5I A;  2KFF A;  4I5N B;  3BUN B;  2KQ6 A;  5D69 A;  5DKQ A;  3RZS A;  3KEV A;  2CXJ A;  4OZD A;  1YUS A;  3WHT B;  1MR8 A;  1UUS A;  2E6W A;  4NDB A;  3CS1 A;  3VRO A;  5BPJ A;  4I5J A;  4P2Y B;  5HLO A;  2WC8 A;  1F4O A;  1SRA A;  3IF7 A;  5CSN A;  4CFR A;  1FF1 A;  1FBV A;  2FCE A;  2OPO A;  5HYD A;  1S3P A;  1XO5 A;  2CBL A;  1J55 A;  2EHB A;  1ZAC A;  5J3X A;  3S0B A;  2LLS A;  2AMI A;  2F8P A;  3BUM B;  3K21 A;  1OE9 B;  1RTP 1;  2LVV A;  4HSZ A;  1YTZ C;  1ODB A;  1FPW A;  1GQM A;  2LC5 A;  2PYQ A;  2JTZ A;  2K8M B;  2MHH A;  1DTL A;  2AUC A;  2L0P A;  4YRU A;  5AFP A;  3SG2 A;  1PSR A;  2PAS A;  3BUW B;  3EK8 A;  1N65 A;  2F2P A;  2ZFD A;  1EJ3 A;  1MQ1 A;  4MZL A;  4WQ2 A;  1QX2 A;  2BCX A;  3S0E A;  3NSO A;  3D78 A;  1OOH A;  1OZO A;  2LMV A;  1CNP A;  4XJK A;  1K2H A;  1GJY A;  1IGV A;  2KLE A;  2YGU A;  3FIA A;  1SK6 D;  1WLZ A;  1RWY A;  4AQI A;  1YX8 A;  1FI5 A;  1VRK A;  3NSL A;  1DJX A;  4IJ7 A;  3WXA A;  2QEH A;  2CCM A;  2KOT A;  1SCM B;  1C7V A;  3KF9 A;  2LVK A;  3CTN A;  2PRU A;  1KK8 C;  5I2O A;  1F71 A;  1QLK A;  2M1U A;  4PHK A;  2KYC A;  3R72 A;  2BKH B;  1XFZ O;  1PK0 D;  2VRG A;  3BXK A;  2WCE A;  2KLD A;  3I5F C;  2B1U A;  3LCP C;  3PM2 A;  1AK8 A;  4YGA A;  1F70 A;  1YVH A;  3ZNI A;  2PQL A;  2BKI B;  1IQ5 A;  2LAP A;  2LE9 B;  2FJY A;  2LUX A;  1SL7 A;  3BQ3 A;  5KSZ A;  1DQE A;  3CLN A;  3VB1 A;  4YI8 A;  4F7F A;  4NQG A;  2KAY A;  3FWC A;  3S0F A;  1REC A;  1SR6 C;  1Y6W A;  1RRO A;  2K7D A;  2KFH A;  1SCV A;  1NCZ A;  2JZI A;  5HLV A;  3TDI A;  3CZT X;  3IQO A;  5JOL A;  4MVF A;  1NCX A;  2ZKM X;  1XFR A;  2L4I A;  1KFU S;  1A75 B;  4QJ3 B;  1CFP A;  1CTR A;  3LLE A;  2WCL A;  5FI2 A;  2L98 A;  2QEO A;  3CAB A;  5B8I B;  4A4B A;  2OS8 C;  3AAJ A;  5I2Q A;  2G2B A;  1YUU A;  2EC6 B;  3TUY B;  5IBW A;  2MLF C;  5F6T A;  4YGC B;  3UNW A;  4JD9 A;  4PE7 A;  3B87 A;  2NLN A;  3D77 A;  2SAS A;  1KQM C;  2AAO A;  2BBN A;  1AP4 A;  3GK1 A;  4QJ4 B;  3BJH A;  1CB1 A;  1JFJ A;  1QIV A;  1SMG A;  1WRL A;  2NXQ A;  2FOT A;  2KFG A;  1P28 A;  3IVT A;  3GK4 X;  3OX5 A;  3LK1 A;  1TNP A;  5I8N A;  1XK4 C;  1WRK A;  2MAZ A;  3BFA A;  5AAN A;  5I94 A;  3IQQ A;  3CDN A;  3S0A A;  1DEL A;  2KPH A;  1YUT A;  3OB2 B;  2CTN A;  4MZK A;  2KSP A;  3JTD C;  1TNQ A;  4PDZ A;  2LVJ A;  2NCO A;  3AKA A;  1EXR A;  1RK9 A;  4JPZ B;  1SBJ A;  4GPL B;  4OR9 B;  2ZND A;  5FI6 A;  1HQV A;  1UHH A;  1BG1 A;  1J7P A;  2NCP A;  1A29 A;  4YI9 A;  2BCA A;  4M2Q A;  1PVB A;  2HF5 A;  2I94 A;  4GFT A;  4HRE E;  5CSJ A;  4DCK A;  2OTG C;  4ORC B;  1J1E A;  1F54 A;  1PAL A;  1CFF A;  5I2L A;  1M39 A;  2JTT A;  1LS8 A;  3EVV A;  2JXL A;  2KYF A;  2WCJ A;  4NDD A;  1KWO C;  2L4H A;  2KGB C;  3SG4 A;  1QJT A;  1CMG A;  1OMD A;  1B7T Z;  1SYM A;  2LM5 A;  1B47 A;  2Q91 A;  3O4Y A;  4N5X A;  4P5O E;  4CID A;  4D1E A;  2ZN9 A;  1OMR A;  1NPQ A;  5GQQ C;  5AEQ A;  5DKR A;  3DF0 A;  4C0J A;  2JPO A;  3PM8 A;  1XK4 A;  3DYE A;  1Z2C B;  3MSE B;  1QV0 A;  1KFX S;  1IG5 A;  1QVI Y;  1TUZ A;  2HQW A;  2KI4 B;  5CSI A;  4GGN A;  3BUO B;  4YBH B;  5HL1 A;  1CDM A;  1XFW O;  3EG5 B;  4PCW A;  1ZUZ A;  3O2P A;  4DRW A;  2HPS A;  2L51 A;  2QEB A;  2Q4U A;  1WDC C;  1NCY A;  2LLU A;  3H4S E;  1IJ5 A;  5HKW A;  1BMO A;  1JF0 A;  3PN7 B;  3V2L A;  1XFU O;  3I5I B;  1DVI A;  3LL8 B;  3DY9 A;  1L2O C;  2KDH A;  2KI6 D;  3F45 A;  5JJG A;  4L9M A;  1H4B A;  2M1K B;  4BY5 A;  2R2I A;  1AJ4 A;  1CLB A;  3I5H C;  3DVK A;  1ZFS A;  4FQT A;  1QAT A;  4A4C A;  4PE4 A;  2JXC A;  1X02 A;  3BUX B;  4MRX A;  1W9Z A;  2WCM A;  1JWD A;  1EG3 A;  1L7Z A;  1K8U A;  1JF2 A;  1OOJ A;  2GGM A;  2ZRS A;  1TUJ A;  1SKT A;  1R6P A;  1LVC D;  2MLE C;  2SCP A;  2Y5I A;  5KU1 A;  2ZRT A;  2LP2 A;  1J7R A;  5G08 A;  1AVS A;  4I5L B;  1QV1 A;  5DKN A;  4ICB A;  3ZWH A;  1UHI A;  1DGU A;  4PE0 A;  2H61 C;  3BOW A;  3VGO A;  1C3Y A;  1M45 A;  4GBA A;  2BNX A;  1NX0 A;  1TWO A;  2K2F A;  2QAC A;  1YUR A;  2JU0 A;  1GGZ A;  1BR4 B;  2LVI A;  5KTY A;  2JNF A;  1HT9 A;  1N0Y A;  1QLS A;  1CFC A;  1XA5 A;  2I2R E;  1KSM A;  2M3W A;  3WNX B;  3CR4 X;  1XFX O;  1YR5 A;  2GTE A;  4AQJ A;  2LHI A;  2GV5 A;  3NHT A;  1S26 D;  4C0L A;  2ZNE A;  3NHI A;  3KHE A;  1TOP A;  3TZ1 A;  4MEW A;  2H8V A;  3N7H A;  3D74 A;  2FCD A;  1K9K A;  2HET A;  1TRF A;  2KNE A;  2K7O A;  4XYN A;  1QXP A;  2MJW B;  2WOS A;  3PLF B;  1PRW A;  2BE4 A;  1QAS A;  1B8L A;  3JVT B;  1IQ3 A;  3L4L A;  3CZ2 A;  1SCM C;  2LP3 A;  3LK0 A;  3VRR A;  1ZOT B;  1B9A A;  4FTG A;  3I5G B;  3QRX A;  1F4Q A;  3SS5 A;  5AXI A;  1DF0 B;  1TNX A;  3O4X A;  2I7A A;  1ORG A;  1CLL A;  4JWQ A;  1SPY A;  1XVJ A;  1M63 B;  5AER A;  2L5X B;  1KCY A;  1K90 D;  1CM4 A;  1WRZ A;  1UP5 A;  1B8C A;  4IL1 A;  3UO9 A;  3OP0 A;  1S36 A;  2BBM A;  1KK7 Y;  2K60 A;  4TNC A;  4R1E A;  3NSK A;  1K95 A;  4U8D A;  1EL4 A;  4YGD B;  4YGE B;  1D1O A;  1UWO A;  2M29 A;  2L5Y A;  1LKJ A;  4YGB B;  3D0Y B;  4ETO A;  1K96 A;  3PSR A;  1DJI A;  4F0Z B;  1OW4 A;  1NYA A;  1MXE A;  2KI6 C;  2LHL A;  3BFH A;  1NUB A;  1J7O A;  1G4Y R;  1MF8 B;  1KQV A;  1DMO A;  1DJH A;  1QS7 A;  4PAL A;  1DJZ A;  2L50 A;  3EK4 A;  1NIW A;  2L2E A;  3HX4 A;  3CWG A;  1BJF A;  2CT9 A;  2EC6 C;  3FE9 A;  1OZS A;  3TUY C;  1U5I B;  2JT8 A;  1S6C A;  3BFB A;  1SNL A;  2JUL A;  4N1G A;  1CDN A;  4PHJ A;  4UPG A;  1DJG A;  5HKZ A;  3OBV A;  2JT3 A;  2WOR A;  3HCM A;  1Y1A A;  4AOM A;  4GGF C;  1W7J B;  3RLZ A;  1QTX A;  2BL0 B;  1M46 A;  1DGV A;  4INX A;  1BF5 A;  2M97 A;  2MBX A;  3CZ1 A;  2KAX A;  2K0J A;  1MWN A;  4CPV A;  3TS5 B;  1PVA A;  2F3Z A;  1OSA A;  1S5G Z;  4ORB B;  3CYZ A;  1OOI X;  1JUO A;  3SG7 A;  5TNC A;  1K94 A;  3D76 A;  3E3R A;  2A4J A;  1C07 A;  1G33 A;  2BE6 A;  3B7A A;  1S6I A;  4OKH A;  3KO0 A;  2F33 A;  3DXL A;  3GOF A;  1A75 A;  1NX1 A;  5ER4 X;  1CFD A;  1Y1U A;  2JRF A;  2M8U A;  2M9G A;  4MN0 A;  4XJK B;  5PAL A;  4C0K A;  3A4U B;  1SSE B;  1DC1 A;  4GAO A;  2WC5 A;  1M31 A;  3OGN A;  3R1O A;  3BOW B;  3DVM A;  1JSA A;  1QX7 A;  3B86 A;  2QEV A;  2BAP A;  4CLN A;  4OV2 A;  1IJ6 A;  2COL B;  2M49 B;  2PVB A;  2CNP A;  3L4A A;  3DVE A;  3O6B A;  2WCK A;  3FE8 A;  3PJI A;  3VRP A;  1YRT B;  4GGF A;  1CM1 A;  1B8R A;  1OMV A;  2K7B A;  1BOC A;  4OCI A;  2BCB A;  1ALW A;  2K61 A;  2ZN8 A;  1QIW A;  1NX2 A;  2LMT A;  2K2A A;  4CFQ A;  5DIC A;  1SY9 A;  2Y1M A;  3K1E A;  2BEC A;  2WCH A;  1TN4 A;  1WY9 A;  2JT0 A;  2KI4 C;  2L2C A;  3PAL A;  2KHN A;  3NSI A;  3EVR A;  1K9P A;  1F8H A;  4HRH A;  2LMU A;  3O78 A;  3PAT A;  1F55 A;  3AKB A;  2ISD A;  3VRQ A;  1UHK A;  2WCF A;  4PHM A;  4Q04 A;  4E68 A;  3PN7 C;  1CLM A;  3I5I C;  2RGI A;  2LNK A;  4MZJ A;  1IKU A;  1NSH A;  1ZMZ A;  2E30 A;  2H2K A;  2JWW A;  2WND A;  1J1D A;  1MXL C;  4JKT A;  1JC2 A;  1QWV A;  2MA2 A;  1Z4H A;  4N1F A;  5D3O A;  4BY4 A;  1W7I B;  1EH2 A;  1EG4 A;  3SS4 A;  2Y4Q A;  4MRY A;  4JQ0 D;  1KK8 B;  2KBM A;  3FE6 A;  4HRG A;  2LLT A;  4QJ5 B;  4GUK A;  2KQY A;  1Y1X A;  4WRI A;  2PAL A;  1NWD A;  3KPX A;  2JPT A;  3I5F B;  5CPV A;  2QPT A;  2M0R A;  1CMF A;  3WHU B;  1RFJ A;  4DS7 A;  3TDU A;  1UHN A;  2JC2 A;  2JNX A;  3S0D A;  3D75 A;  1TCF A;  1LA0 A;  2KGR A;  1AUI B;  2NZ0 A;  2MRD A;  1MUX A;  4INW A;  1SL8 A;  1YRU B;  3EKJ A;  1LXF C;  1G8I A;  3DD4 A;  4DIR A;  1V1F A;  3R1P A;  1KFU L;  1SR6 B;  3B6X A;  4FQO A;  1OQP A;  2D8N A;  3C1V A;  1CDL A;  4MBE A;  1IH0 A;  3SG5 A;  3CGA A;  4I5K A;  1LIN A;  1XFV O;  2ERB A;  4GNK B;  2DOQ A;  1K9U A;  2H61 A;  1CKK A;  3OX6 A;  3SS3 A;  1TTX A;  1TCO B;  3QME A;  2F2O A;  3NGV A;  2OS8 B;  1MHO A;  3CR5 X;  1XFY O;  2PSR A;  3B88 A;  3EVU A;  3SIA A;  4DUQ A;  1TIZ A;  3GK2 A;  1KK7 Z;  4NDC A;  1WLM A;  4M2O A;  1YVL A;  1NX3 A;  3TDZ A;  1S6J A;  3SJS A;  1JBA A;  2JOJ A;  1UUR A;  2G9B A;  2P71 A;  3ICB A;  3D73 A;  3JVT C;  1FI6 A;  1H8B A;  5D7F A;  5FYX A;  2LAN A;  4ORA B;  1KQM B;  1JFK A;  2O5G A;  3EK7 A;  3I5G C;  1TNW A;  1Q80 A;  1C7W A;  3NXA A;  2M7N A;  3SG3 A;  2WC6 A;  4OVN F;  2GGZ A;  5HKY A;  3DF0 B;  2M7L A;  3SG6 A;  2Y1N A;  3DZT A;  4M2P A;  4MSP A;  3R1V A;  5FI7 A;  1C3Z A; 
#chains in the Genus database with same CATH homology
 4PHN A;  1GGW A;  3JTD B;  3OHM B;  2F3Y A;  3CR2 A;  3OB1 B;  5K89 A;  2HQ8 A;  1BR1 B;  1V1G A;  3A8R A;  1E8A A;  5CSF A;  1YX7 A;  2IS9 A;  1IWQ A;  2JQ6 A;  2KAV A;  1BU3 A;  1BOD A;  3RM1 A;  4PE1 A;  3D10 A;  2OTG B;  1BLQ A;  1DJY A;  3SIB A;  1A03 A;  1B1G A;  1R2U A;  1KWO B;  1ALV A;  2EGD A;  2WCB A;  1AJ5 A;  1QX5 B;  3PFV A;  1KFX L;  3M0W A;  2P6B B;  1AHR A;  1DF0 A;  3BYA A;  2KBI A;  3AAK A;  1A4P A;  1BT6 A;  1NP8 A;  1SL9 A;  2BL0 C;  2O60 A;  2K7C A;  1FW4 A;  1S1E A;  2LV7 A;  1QVI Z;  4MLW A;  2FJU B;  2LCP A;  1K93 D;  5ER5 A;  1S5G Y;  4WQ3 A;  1N2D A;  3TS5 C;  1XYD A;  1WDC B;  1PSB A;  4USL A;  1IRJ A;  1Y0V H;  1KSO A;  2PMY A;  1DJW A;  1B7T Y;  2TN4 A;  3VRN A;  3DVJ A;  3D0Y A;  1J7Q A;  2LUC A;  4ZCU A;  1L2O B;  2V53 A;  1LA3 A;  1DT7 B;  1PUL A;  4ZCV A;  3I5H B;  3EKH A;  1UHJ A;  1RJV A;  3FS7 A;  3FWB A;  1CDP A;  1A2X A;  1B4C A;  1SW8 A;  2I18 A;  1U5I A;  2KFF A;  4I5N B;  3BUN B;  2KQ6 A;  5D69 A;  5DKQ A;  3KEV A;  2CXJ A;  1YUS A;  3WHT B;  1MR8 A;  1UUS A;  2E6W A;  4NDB A;  3CS1 A;  3VRO A;  5BPJ A;  4I5J A;  4P2Y B;  5HLO A;  2WC8 A;  1F4O A;  1SRA A;  3IF7 A;  5CSN A;  4CFR A;  1FF1 A;  1FBV A;  2FCE A;  2OPO A;  5HYD A;  1S3P A;  1XO5 A;  2CBL A;  1J55 A;  2EHB A;  1ZAC A;  5J3X A;  2LLS A;  2AMI A;  2F8P A;  3BUM B;  3K21 A;  1OE9 B;  1RTP 1;  2LVV A;  4HSZ A;  1YTZ C;  1ODB A;  1FPW A;  1GQM A;  2LC5 A;  4YRU A;  2JTZ A;  2K8M B;  2MHH A;  1DTL A;  2AUC A;  2L0P A;  5AFP A;  3SG2 A;  1PSR A;  2PAS A;  3BUW B;  3EK8 A;  1N65 A;  2F2P A;  2ZFD A;  1EJ3 A;  1MQ1 A;  4MZL A;  4WQ2 A;  1QX2 A;  2BCX A;  3NSO A;  1CNP A;  1OZO A;  2LMV A;  4XJK A;  1K2H A;  1GJY A;  1IGV A;  3FIA A;  1SK6 D;  1WLZ A;  1RWY A;  4AQI A;  1YX8 A;  1FI5 A;  1VRK A;  3NSL A;  1DJX A;  3WXA A;  2CCM A;  2KOT A;  1SCM B;  1C7V A;  3KF9 A;  2LVK A;  3CTN A;  2PRU A;  1KK8 C;  5I2O A;  1F71 A;  1QLK A;  2M1U A;  4PHK A;  2KYC A;  2BKH B;  1XFZ O;  1PK0 D;  2VRG A;  3BXK A;  2WCE A;  3I5F C;  2B1U A;  3LCP C;  1AK8 A;  4YGA A;  1F70 A;  1YVH A;  3ZNI A;  2BKI B;  1IQ5 A;  2LAP A;  2LE9 B;  2LUX A;  1SL7 A;  3BQ3 A;  5KSZ A;  3CLN A;  4YI8 A;  4NQG A;  2KAY A;  3FWC A;  1REC A;  1SR6 C;  1Y6W A;  1RRO A;  2K7D A;  2KFH A;  1SCV A;  1NCZ A;  2JZI A;  5HLV A;  3TDI A;  3CZT X;  3IQO A;  5JOL A;  4MVF A;  1NCX A;  2ZKM X;  2L4I A;  1KFU S;  1A75 B;  4QJ3 B;  1CFP A;  1CTR A;  3LLE A;  2L98 A;  5B8I B;  4A4B A;  2OS8 C;  3AAJ A;  5I2Q A;  2G2B A;  1YUU A;  2EC6 B;  3TUY B;  5IBW A;  2MLF C;  5F6T A;  4YGC B;  4PE7 A;  2NLN A;  2SAS A;  1KQM C;  2AAO A;  2BBN A;  1AP4 A;  3GK1 A;  4QJ4 B;  1JFJ A;  1CB1 A;  1QIV A;  1SMG A;  1WRL A;  2NXQ A;  2FOT A;  2KFG A;  3GK4 X;  3OX5 A;  3LK1 A;  1TNP A;  5I8N A;  1XK4 C;  1WRK A;  2MAZ A;  5AAN A;  3IQQ A;  3OB2 B;  1YUT A;  4MZK A;  2CTN A;  2KSP A;  3JTD C;  1TNQ A;  4PDZ A;  2LVJ A;  2NCO A;  3AKA A;  1EXR A;  1RK9 A;  4JPZ B;  1SBJ A;  4GPL B;  4OR9 B;  2ZND A;  1HQV A;  1UHH A;  1BG1 A;  1J7P A;  2NCP A;  1A29 A;  4YI9 A;  2BCA A;  4M2Q A;  1PVB A;  2HF5 A;  2I94 A;  4GFT A;  4HRE E;  5CSJ A;  4DCK A;  2OTG C;  4ORC B;  1J1E A;  1F54 A;  1PAL A;  1CFF A;  5I2L A;  1M39 A;  2JTT A;  3EVV A;  2JXL A;  2KYF A;  4NDD A;  1KWO C;  2L4H A;  2KGB C;  3SG4 A;  1QJT A;  1CMG A;  1OMD A;  1B7T Z;  1SYM A;  2LM5 A;  1B47 A;  2Q91 A;  3O4Y A;  4N5X A;  4P5O E;  4CID A;  4D1E A;  2ZN9 A;  1OMR A;  1NPQ A;  5GQQ C;  5AEQ A;  5DKR A;  3DF0 A;  4C0J A;  3PM8 A;  1XK4 A;  3MSE B;  1QV0 A;  1KFX S;  1IG5 A;  1QVI Y;  2HQW A;  2KI4 B;  5CSI A;  4GGN A;  3BUO B;  4YBH B;  1CDM A;  1XFW O;  4PCW A;  1ZUZ A;  3O2P A;  4DRW A;  2HPS A;  2L51 A;  2Q4U A;  1WDC C;  1NCY A;  2LLU A;  3H4S E;  1IJ5 A;  5HKW A;  1BMO A;  1JF0 A;  3PN7 B;  1XFU O;  3I5I B;  1DVI A;  3LL8 B;  1L2O C;  2KDH A;  2KI6 D;  3F45 A;  5JJG A;  4L9M A;  1H4B A;  2M1K B;  4BY5 A;  2R2I A;  1AJ4 A;  1CLB A;  3I5H C;  3DVK A;  1ZFS A;  1QAT A;  4A4C A;  4PE4 A;  2JXC A;  1X02 A;  3BUX B;  4MRX A;  1JWD A;  1EG3 A;  1L7Z A;  1K8U A;  1JF2 A;  1OOJ A;  2GGM A;  2ZRS A;  1SKT A;  1R6P A;  1LVC D;  2MLE C;  2SCP A;  2Y5I A;  5KU1 A;  2ZRT A;  2LP2 A;  1J7R A;  5G08 A;  1AVS A;  4I5L B;  1QV1 A;  5DKN A;  4ICB A;  3ZWH A;  1UHI A;  1DGU A;  4PE0 A;  2H61 C;  3BOW A;  3VGO A;  1M45 A;  4GBA A;  1NX0 A;  2K2F A;  2QAC A;  1YUR A;  2JU0 A;  1GGZ A;  1BR4 B;  2LVI A;  5KTY A;  2JNF A;  1HT9 A;  1N0Y A;  1QLS A;  1CFC A;  1XA5 A;  2I2R E;  1KSM A;  2M3W A;  3WNX B;  3CR4 X;  1XFX O;  1YR5 A;  4AQJ A;  2LHI A;  2GV5 A;  1S26 D;  4C0L A;  2ZNE A;  3KHE A;  1TOP A;  3TZ1 A;  4MEW A;  2FCD A;  1K9K A;  2HET A;  1TRF A;  2KNE A;  2K7O A;  4XYN A;  1QXP A;  2MJW B;  2WOS A;  3PLF B;  1PRW A;  2BE4 A;  1QAS A;  1B8L A;  3JVT B;  1IQ3 A;  3VRR A;  1SCM C;  2LP3 A;  3LK0 A;  1ZOT B;  1B9A A;  4FTG A;  3I5G B;  3QRX A;  1F4Q A;  5AXI A;  1DF0 B;  1TNX A;  2I7A A;  1CLL A;  4JWQ A;  1SPY A;  1XVJ A;  1M63 B;  5AER A;  2L5X B;  1KCY A;  1K90 D;  1CM4 A;  1WRZ A;  1UP5 A;  1B8C A;  4IL1 A;  3OP0 A;  1S36 A;  2BBM A;  1KK7 Y;  4TNC A;  4R1E A;  3NSK A;  1K95 A;  4U8D A;  1EL4 A;  4YGD B;  4YGE B;  1D1O A;  1UWO A;  2M29 A;  1LKJ A;  4YGB B;  3D0Y B;  4ETO A;  1K96 A;  3PSR A;  1DJI A;  4F0Z B;  1NYA A;  1MXE A;  2KI6 C;  2LHL A;  1NUB A;  1J7O A;  1G4Y R;  1MF8 B;  1KQV A;  1DMO A;  1DJH A;  1QS7 A;  4PAL A;  1DJZ A;  2L50 A;  3EK4 A;  1NIW A;  2L2E A;  3HX4 A;  3CWG A;  1BJF A;  2CT9 A;  2EC6 C;  3TUY C;  1OZS A;  1U5I B;  2JT8 A;  1S6C A;  1CDN A;  1SNL A;  2JUL A;  4N1G A;  4PHJ A;  4UPG A;  1DJG A;  5HKZ A;  2JT3 A;  2WOR A;  3HCM A;  1Y1A A;  4AOM A;  4GGF C;  1W7J B;  3RLZ A;  1QTX A;  2BL0 B;  1M46 A;  1DGV A;  1BF5 A;  2M97 A;  2MBX A;  2KAX A;  2K0J A;  1MWN A;  4CPV A;  3TS5 B;  1PVA A;  2F3Z A;  1OSA A;  1S5G Z;  4ORB B;  3SG7 A;  1JUO A;  5TNC A;  1K94 A;  3E3R A;  2A4J A;  1C07 A;  1G33 A;  2BE6 A;  1S6I A;  4OKH A;  3KO0 A;  2F33 A;  3GOF A;  5ER4 X;  1A75 A;  1NX1 A;  1CFD A;  1Y1U A;  2JRF A;  2M8U A;  2M9G A;  4MN0 A;  4XJK B;  5PAL A;  4C0K A;  3A4U B;  4GAO A;  1M31 A;  3BOW B;  3DVM A;  1JSA A;  1QX7 A;  4CLN A;  4OV2 A;  1IJ6 A;  2COL B;  2M49 B;  2PVB A;  2CNP A;  3O6B A;  3DVE A;  3VRP A;  1YRT B;  4GGF A;  1CM1 A;  1B8R A;  1OMV A;  2K7B A;  1BOC A;  4OCI A;  2BCB A;  1ALW A;  2K61 A;  2ZN8 A;  1QIW A;  1NX2 A;  2LMT A;  2K2A A;  4CFQ A;  1SY9 A;  2Y1M A;  2BEC A;  1TN4 A;  1WY9 A;  2JT0 A;  2KI4 C;  3PAL A;  2KHN A;  3NSI A;  3EVR A;  1K9P A;  1F8H A;  4HRH A;  2LMU A;  3O78 A;  3PAT A;  1F55 A;  3AKB A;  2ISD A;  3VRQ A;  1UHK A;  2WCF A;  4PHM A;  4Q04 A;  4E68 A;  3PN7 C;  1CLM A;  3I5I C;  2RGI A;  2LNK A;  4MZJ A;  1IKU A;  1NSH A;  1ZMZ A;  2E30 A;  2H2K A;  2JWW A;  2WND A;  1J1D A;  1MXL C;  1JC2 A;  2MA2 A;  4N1F A;  4BY4 A;  1W7I B;  1EH2 A;  1EG4 A;  2Y4Q A;  4MRY A;  4JQ0 D;  1KK8 B;  2KBM A;  4HRG A;  2LLT A;  4QJ5 B;  4GUK A;  2KQY A;  1Y1X A;  4WRI A;  2PAL A;  1NWD A;  3KPX A;  2JPT A;  3I5F B;  5CPV A;  2QPT A;  2M0R A;  1CMF A;  3WHU B;  1RFJ A;  4DS7 A;  3TDU A;  1UHN A;  2JC2 A;  2JNX A;  1TCF A;  1LA0 A;  2KGR A;  1AUI B;  2NZ0 A;  2MRD A;  1MUX A;  1SL8 A;  1YRU B;  3EKJ A;  1LXF C;  1G8I A;  3DD4 A;  4DIR A;  1V1F A;  1KFU L;  1SR6 B;  4FQO A;  1OQP A;  2D8N A;  3C1V A;  1CDL A;  4MBE A;  1IH0 A;  3SG5 A;  3CGA A;  4I5K A;  1LIN A;  1XFV O;  1CKK A;  4GNK B;  2DOQ A;  1K9U A;  2H61 A;  3OX6 A;  1TTX A;  1TCO B;  2F2O A;  2OS8 B;  1MHO A;  3CR5 X;  1XFY O;  2PSR A;  3SIA A;  3EVU A;  4DUQ A;  1TIZ A;  3GK2 A;  1KK7 Z;  4NDC A;  1WLM A;  4M2O A;  1YVL A;  1NX3 A;  3TDZ A;  1S6J A;  3SJS A;  1JBA A;  2JOJ A;  1UUR A;  2G9B A;  3ICB A;  3JVT C;  1H8B A;  1FI6 A;  5D7F A;  5FYX A;  2LAN A;  4ORA B;  1KQM B;  1JFK A;  2O5G A;  3EK7 A;  3I5G C;  1TNW A;  1Q80 A;  1C7W A;  3NXA A;  2M7N A;  3SG3 A;  4OVN F;  2GGZ A;  5HKY A;  3DF0 B;  2M7L A;  3SG6 A;  2Y1N A;  4M2P A;  4MSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...