2PVBA

Pike parvalbumin (pi 4.10) at low temperature (100k) and atomic resolution (0.91 a).
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
107
structure length
107
Chain Sequence
b'SFAGLKDADVAAALAACSAADSFKHKEFFAKVGLASKSLDDVKKAFYVIDQDKSGFIEEDELKLFLQNFSPSARALTDAETKAFLADGDKDGDGMIGVDEFAAMIKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (PARVALBUMIN)
publication title Crystal structure of the EF-hand parvalbumin at atomic resolution (0.91 A) and at low temperature (100 K). Evidence for conformational multistates within the hydrophobic core.
pubmed rcsb
molecule tags Metal binding protein
total genus 40
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 1998-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2pvbA00
3SG3A 3VRNA 4DUQA 1XFXO 2KAXA 2K2AA 1IWQA 2LCPA 4A4BA 1CLMA 4GFTA 4I5LB 3EKHA 1QATA 1BMOA 2LUXA 3K21A 2KQYA 1G8IA 1LVCD 1K9UA 1OMRA 2MLFC 1J1EA 3TUYB 1NYAA 1DGVA 1OMVA 5D7FA 1RECA 1S26D 3OB1B 1XFWO 2LVVA 4I5NB 4PE7A 3CLNA 1J1DA 2HQWA 3AAKA 4PHMA 5DKRA 3TS5B 1DJXA 3I5FB 5I8NA 1NUBA 1YX7A 2HF5A 2LP3A 3D10A 1B9AA 1JFKA 1TIZA 4PHJA 1ZACA 3LL8B 1HQVA 1YX8A 4ORBB 2BKHB 3BUWB 1PVAA 3NSOA 5CSJA 1BJFA 4PE4A 1MF8B 2WC8A 1SR6B 1UHNA 4M2QA 4YI9A 1SNLA 3A4UB 1CKKA 1IG5A 1DF0A 1WRKA 1SL9A 1PVBA 1F4QA 1KQMC 3BUOB 5I2QA 1QVIZ 1SW8A 4GBAA 2NCOA 2H61A 1S6IA 1AVSA 3CS1A 1K9PA 4D1EA 1AP4A 1MR8A 4C0JA 1DJZA 2MAZA 4I5KA 1YUUA 1RJVA 1NX0A 2CCMA 1SKTA 1TNQA 2NZ0A 1SY9A 1EL4A 1GQMA 2P6BB 3WHTB 2LVJA 1QX5B 2K7BA 1DT7B 2L4IA 1A2XA 1JSAA 4YRUA 2G9BA 1SCMB 1LXFC 2KQ6A 4C0LA 1B8LA 4N1FA 1XFVO 3GK2A 4M2OA 2RGIA 3TDIA 1DTLA 3KHEA 1A03A 3VGOA 1FF1A 1N2DA 5FYXA 1K9KA 4MEWA 1D1OA 2LE9B 3HCMA 3DF0B 1J7QA 2F3YA 3JTDB 4JQ0D 2ZRSA 2BE4A 5CSNA 4E68A 2JTZA 3EK7A 1DJYA 3GOFA 2L0PA 3IQQA 3DVMA 3PATA 3SG6A 1AJ4A 2H61C 2CXJA 2NLNA 2CNPA 2LVIA 1JC2A 4ICBA 2BL0B 1CFFA 1CDLA 3EK8A 1OSAA 2E6WA 4PE1A 4A4CA 1LA3A 2K2FA 2LP2A 1YRUB 1CLBA 2DOQA 3VRRA 3BXKA 3O2PA 1NPQA 5B8IB 1HT9A 4ORAB 2WORA 3TUYC 1YR5A 4MLWA 1F55A 1CM4A 3TDZA 3KEVA 3O78A 2JULA 1KK7Z 3M0WA 2Q91A 1C07A 5CPVA 2KGRA 1KK7Y 2F33A 2M1UA 2KYFA 1XO5A 2HPSA 1TOPA 2L5XB 1C7WA 4GGFA 2G2BA 1IGVA 4XJKB 1H4BA 4NDDA 1YUTA 1S5GZ 2M3WA 1GGWA 3SG4A 3GK4X 1SYMA 5AXIA 1G33A 2D8NA 2EGDA 2K8MB 1WDCB 3DVJA 2E30A 1BR1B 3VROA 2COLB 2KNEA 1K94A 1QS7A 2LLUA 1GGZA 1M45A 2WOSA 2LV7A 1LKJA 2PALA 2PMYA 1KSOA 2KSPA 3PALA 1QV0A 1IQ3A 4YGDB 4QJ4B 3OB2B 4GGNA 2JRFA 2AMIA 4NDBA 1DF0B 1MUXA 1F70A 4GNKB 2KFFA 2M1KB 2M7NA 1FI5A 2PRUA 3GK1A 4CFRA 1NWDA 1CB1A 2HQ8A 1UHIA 2LUCA 3SIBA 2KBMA 1MXEA 1K93D 2JPTA 3TZ1A 4BY4A 3F45A 4YI8A 1AHRA 2ZRTA 5HLOA 3SJSA 1MHOA 1XYDA 5HKYA 3AAJA 1F54A 4R1EA 1M31A 3I5GB 4GGFC 4DIRA 3I5IB 1SCMC 1NP8A 2A4JA 3CR5X 1EXRA 3FWCA 3PLFB 4OR9B 1QLKA 5HKWA 1XFZO 1WRLA 1SCVA 2WCEA 1Y0VH 4XJKA 2LMUA 1QXPA 5DKNA 2K7DA 2WCBA 3JTDC 1S36A 2JQ6A 2KI6C 1H8BA 4QJ3B 2GV5A 1IJ5A 1B8RA 2FCDA 1K95A 1NCXA 2Y1MA 4OVNF 2BBMA 4BY5A 2BBNA 2M0RA 2BL0C 1WLZA 1J7RA 2JT0A 2MBXA 2QACA 1F4OA 2KI4B 4CPVA 5PALA 1Q80A 4XYNA 1YVHA 1CTRA 4PALA 1W7JB 2LHLA 3KPXA 5AERA 1TRFA 4M2PA 2JXLA 1QASA 2JZIA 1QVIY 3IF7A 2LLSA 1BODA 4ZCUA 2F3ZA 1BLQA 5JJGA 1OOJA 3D0YB 4MN0A 3CZTX 1RROA 4AQJA 1TNWA 5TNCA 1B1GA 4HRGA 1M63B 1E8AA 1UURA 3OHMB 4FTGA 2K7CA 2F8PA 1S6JA 1C7VA 1IKUA 2LAPA 1TTXA 1A75A 2M7LA 4PHNA 3FS7A 3VRPA 1QTXA 2LC5A 1KFUL 5GQQC 4L9MA 1YVLA 1WDCC 2MJWB 2F2PA 1K96A 1IQ5A 1FBVA 1S1EA 1CDNA 2LNKA 3BUXB 2JT8A 4F0ZB 5AEQA 5ER4X 4UPGA 2KFGA 1YURA 1BT6A 1FI6A 1BU3A 1UHJA 2F2OA 2I2RE 1J7OA 2GGZA 1UUSA 3PFVA 4AOMA 4Q04A 3NSIA 1J7PA 1SL7A 1CDPA 1QJTA 2OPOA 3FIAA 1M39A 1FW4A 2JWWA 4GPLB 1EG3A 5JOLA 3EKJA 1CFDA 3ZNIA 4JWQA 1PRWA 2HETA 3D0YA 3I5GC 1OQPA 2L2EA 1PK0D 5AFPA 2M49B 3DVEA 2LMTA 3I5IC 4OV2A 4YGCB 1QLSA 2CBLA 2ZKMX 1KWOC 4DCKA 1B4CA 1DJIA 2K7OA 2JOJA 4AQIA 1PULA 1PALA 2LHIA 1V1FA 1SK6D 2O5GA 1KFUS 2L4HA 1EG4A 2LVKA 4MZLA 5CSIA 4CLNA 1DGUA 1PSRA 2KI6D 2K61A 2SCPA 3HX4A 4YGEB 1LA0A 1S5GY 1DJGA 2KBIA 2K0JA 1UWOA 4YGBB 4USLA 2L50A 2KAYA 5D69A 1CMGA 1RK9A 1SRAA 1YTZC 1BR4B 2EHBA 2L51A 2MHHA 1SL8A 1MWNA 2KI4C 3LK1A 1JWDA 1JF2A 1FPWA 1Y1AA 1B47A 3LLEA 1CFPA 3BQ3A 1QIVA 4ORCB 1TCFA 3BUMB 1DVIA 1B7TZ 5I2LA 1K8UA 3LCPC 1YRTB 2NXQA 1B7TY 1CM1A 2LMVA 3OX6A 2ISDA 4DS7A 2MLEC 4HSZA 5ER5A 3WNXB 1MQ1A 1EJ3A 4MRXA 3NXAA 1PSBA 1ZUZA 1M46A 2GGMA 1R2UA 2KFHA 3NSLA 1ODBA 3PN7B 3ICBA 1BF5A 3JVTB 2FCEA 4CFQA 2R2IA 1A75B 5DKQA 1XK4A 1KWOB 1R6PA 2AAOA 2KHNA 2ZNDA 1V1GA 3VRQA 2KOTA 5F6TA 1WLMA 2VRGA 1NSHA 2Q4UA 1X02A 2ZN8A 1MXLC 3EVUA 5I2OA 1QX7A 3CWGA 4C0KA 2OS8B 5KU1A 3NSKA 1ZOTB 2CTNA 2KAVA 1AUIB 5G08A 1NX3A 4WRIA 1WRZA 3I5HC 4I5JA 2EC6B 2ZNEA 1U5IA 3BOWB 1JBAA 1AJ5A 1NX2A 1G4YR 1YUSA 2TN4A 1SPYA 2JTTA 1N65A 5KSZA 1B8CA 3AKBA 5BPJA 3DD4A 1QV1A 1JF0A 1XFYO 2KGBC 1DJWA 3OP0A 1J55A 3IQOA 4JPZB 1AK8A 1K2HA 1OZOA 1XA5A 2V53A 1L7ZA 3MSEB 2BCXA 4TNCA 1RFJA 3O6BA 4PHKA 1XK4C 1L2OC 2KDHA 2H2KA 2B1UA 3WHUB 3ZWHA 3SIAA 4HRHA 2O60A 1KFXS 1VRKA 1Y1XA 3EVRA 4WQ2A 4QJ5B 1CLLA 1A4PA 1CDMA 2I18A 2M29A 5KTYA 2Y1NA 4P2YB 1IJ6A 3A8RA 1CFCA 1LINA 2LLTA 4NDCA 4HREE 1OMDA 2OTGC 4MBEA 4DRWA 1ZMZA 4N1GA 1KCYA 2PASA 1UHKA 2M97A 1XVJA 1N0YA 1IH0A 3EK4A 2JNFA 1NIWA 1TCOB 4PDZA 1IRJA 4YBHB 3SG7A 5IBWA 1KSMA 3BUNB 1SBJA 2JT3A 3BOWA 4FQOA 1DJHA 2BCBA 2NCPA 3I5HB 4U8DA 4ETOA 5J3XA 5AANA 4MRYA 2BECA 3KO0A 2KYCA 1RWYA 5HKZA 3C1VA 2JC2A 2LM5A 3QRXA 2BE6A 3O4YA 3SG2A 3OX5A 4MSPA 2WNDA 3BYAA 2AUCA 3PN7C 1KQVA 2JNXA 1CMFA 1S6CA 3AKAA 3RLZA 3JVTC 4MZKA 3CGAA 4N5XA 3TDUA 3LK0A 2WCFA 3DVKA 1KK8C 1BOCA 2MA2A 3CR4X 1L2OB 3FWBA 2CT9A 1GJYA 4PCWA 1K90D 2LANA 2FJUB 2JXCA 1TN4A 3PM8A 1OE9B 4YGAA 1NCZA 1KQMB 1WY9A 2OS8C 3E3RA 1TNXA 1Y1UA 2QPTA 2BCAA 1TNPA 1JUOA 2FOTA 2OTGB 2EC6C 2L98A 1CNPA 2PSRA 4MZJA 1BG1A 1QIWA 2SASA 4ZCVA 5HLVA 1ALWA 2Y5IA 3TS5C 1U5IB 5K89A 3I5FC 4GAOA 1DMOA 5CSFA 3RM1A 1W7IB 2I94A 3CR2A 1RTP1 2I7AA 4MVFA 4P5OE 2IS9A 4PE0A 1QX2A 4WQ3A 4NQGA 1ALVA 4IL1A 2PVBA 2M8UA 3EVVA 1UHHA 2M9GA 4GUKA 2MRDA 3WXAA 3DF0A 1ZFSA 1F71A 3PSRA 2BKIB 1JFJA 1SR6C 2ZFDA 1OZSA 3CTNA 2JU0A 4OKHA 1EH2A 1F8HA 5HYDA 2Y4QA 1S3PA 1UP5A 1NX1A 1Y6WA 2ZN9A 3H4SE 4CIDA 1SMGA 1KFXL 1A29A 3SG5A 3KF9A 1NCYA 1XFUO 1KK8B 4OCIA
chains in the Genus database with same CATH superfamily
3SG3A 3VRNA 4DUQA 1XFXO 2KAXA 2K2AA 1IWQA 2LCPA 4A4BA 1CLMA 4GFTA 3S0GA 4I5LB 3EKHA 1QATA 1BMOA 2LUXA 3K21A 2KQYA 1W9ZA 1G8IA 1LVCD 1K9UA 1OMRA 2MLFC 1J1EA 3TUYB 1NYAA 1DGVA 1OMVA 5D7FA 1RECA 1S26D 3OB1B 1XFWO 2LVVA 4I5NB 4PE7A 3CLNA 1J1DA 2BAPA 2HQWA 3AAKA 4PHMA 5DKRA 3TS5B 1DJXA 3I5FB 5I8NA 1NUBA 1YX7A 2HF5A 2LP3A 3D10A 1B9AA 1P28A 1JFKA 1TIZA 4PHJA 3R1PA 1ZACA 1T14A 3LL8B 1HQVA 1YX8A 4ORBB 2BKHB 3BUWB 1PVAA 3NSOA 5CSJA 1BJFA 4PE4A 1MF8B 2WC8A 1SR6B 1UHNA 4FQTA 4IJ7A 3D74A 4M2QA 4YI9A 1SNLA 3A4UB 1TWOA 1IG5A 1CKKA 1DF0A 1WRKA 1SL9A 2H8VA 1PVBA 1F4QA 1KQMC 3BUOB 3D78A 1QVIZ 1SW8A 4GBAA 5I2QA 2NCOA 2H61A 1S6IA 3CABA 1AVSA 3CS1A 1K9PA 4D1EA 1LS8A 1AP4A 2ERBA 1MR8A 4C0JA 1DJZA 2KLEA 2MAZA 4I5KA 4PT1A 1YUUA 1RJVA 1NX0A 2CCMA 1SKTA 1TNQA 2NZ0A 1SY9A 1EL4A 1GQMA 2P6BB 3WHTB 2LVJA 1QX5B 2K7BA 1DT7B 2L4IA 1A2XA 1JSAA 4YRUA 2G9BA 1SCMB 1LXFC 2KQ6A 4C0LA 1B8LA 4N1FA 1XFVO 3GK2A 4M2OA 2RGIA 3TDIA 1DTLA 1ORGA 1SSEB 3KHEA 5FI7A 1N2DA 5FYXA 3VGOA 1K9KA 4MEWA 1D1OA 2LE9B 1FF1A 3HCMA 3DF0B 1J7QA 2F3YA 3JTDB 3PJIA 4JQ0D 2ZRSA 2BE4A 5CSNA 4E68A 2JTZA 3EK7A 1DJYA 3GOFA 2L0PA 3IQQA 3DVMA 3PATA 3SG6A 1AJ4A 2H61C 2CXJA 2NLNA 2CNPA 2LVIA 1JC2A 3D76A 2BL0B 4ICBA 1CDLA 1CFFA 5DICA 3EK8A 1OSAA 2E6WA 4PE1A 4A4CA 1LA3A 3RZSA 2K2FA 2LP2A 1OOIX 1YRUB 1CLBA 2DOQA 3VRRA 3BXKA 3O2PA 1NPQA 5B8IB 1HT9A 2WC6A 4ORAB 3CYZA 2WORA 2K60A 3TUYC 1YR5A 4MLWA 1Z4HA 1F55A 1CM4A 3TDZA 3KEVA 3O78A 3S0FA 2JULA 3CZ2A 1KK7Z 3M0WA 2Q91A 3D75A 1C07A 5CPVA 2KGRA 1KK7Y 2F33A 2M1UA 2KYFA 1XO5A 2HPSA 1TOPA 2L5XB 1C7WA 4GGFA 2G2BA 1IGVA 4XJKB 1H4BA 4NDDA 1YUTA 1S5GZ 3B7AA 2M3WA 3S0DA 1GGWA 3UNWA 3SG4A 3GK4X 1SYMA 3NGVA 5AXIA 5I94A 1G33A 2D8NA 2EGDA 2K8MB 1OOGA 1WDCB 1TUZA 2E30A 1BR1B 3DVJA 3VROA 2COLB 2FJYA 2KNEA 1K94A 1QS7A 2LLUA 1GGZA 1QWVA 1M45A 2WOSA 2LV7A 1LKJA 2PALA 2PMYA 1KSOA 2KSPA 3PALA 1QV0A 3S0EA 1IQ3A 4YGDB 3BJHA 3OB2B 4QJ4B 4GGNA 2JRFA 2AMIA 4NDBA 1DF0B 1MUXA 1F70A 4GNKB 2KFFA 2M1KB 2M7NA 3SS3A 1FI5A 2PRUA 4F7FA 2BNXA 3GK1A 3DXLA 4CFRA 1NWDA 1CB1A 2HQ8A 1UHIA 3DZTA 2LUCA 3SIBA 2KBMA 1MXEA 1K93D 2JPTA 3TZ1A 4BY4A 3F45A 4YI8A 1AHRA 2ZRTA 5HLOA 3SJSA 1MHOA 1XYDA 5HKYA 3AAJA 1F54A 4R1EA 1M31A 3I5GB 4GGFC 4DIRA 3O4XA 3I5IB 1SCMC 1NP8A 2A4JA 2QEOA 3CR5X 1EXRA 2WCMA 3FWCA 3PLFB 4OR9B 1QLKA 5HKWA 1XFZO 1WRLA 1DC1A 1SCVA 2WCEA 1Y0VH 4XJKA 2LMUA 3S0BA 1QXPA 5DKNA 2K7DA 2WCBA 3JTDC 2GTEA 1S36A 2JQ6A 2KI6C 1H8BA 4QJ3B 2GV5A 1IJ5A 1B8RA 1OOHA 2FCDA 1K95A 1NCXA 2Y1MA 4OVNF 2BBMA 3CDNA 4BY5A 2BBNA 3NHTA 2M0RA 2BL0C 1WLZA 1J7RA 2JT0A 2MBXA 2QACA 1F4OA 2KI4B 4CPVA 5PALA 1Q80A 4XYNA 1YVHA 1CTRA 3BFHA 4PALA 1W7JB 5HL1A 1DQEA 2LHLA 3KPXA 5AERA 1TRFA 4M2PA 2JXLA 1QASA 2JZIA 1QVIY 3IF7A 3Q8IA 2LLSA 1BODA 4ZCUA 2F3ZA 1BLQA 5JJGA 1OOJA 3D0YB 4MN0A 3CZTX 1RROA 4AQJA 1TNWA 5TNCA 1B1GA 4HRGA 3UO9A 1M63B 2WCJA 1E8AA 1UURA 3OHMB 4FTGA 2K7CA 2F8PA 1S6JA 1C7VA 1IKUA 2LAPA 1TTXA 2KLDA 1A75A 2M7LA 4PHNA 3FS7A 3VRPA 1QTXA 2LC5A 3FE8A 1KFUL 5GQQC 4L9MA 1YVLA 1WDCC 2MJWB 2F2PA 1K96A 1IQ5A 1FBVA 1S1EA 1CDNA 2LNKA 3BUXB 2JT8A 4F0ZB 5AEQA 5ER4X 4UPGA 2KFGA 1YURA 1BT6A 1FI6A 1BU3A 1UHJA 2F2OA 2I2RE 1J7OA 2GGZA 1UUSA 3PFVA 4AOMA 4Q04A 3NSIA 2P70A 1DEKA 1J7PA 1SL7A 3DY9A 1CDPA 1QJTA 2OPOA 3FIAA 1M39A 1FW4A 2JWWA 4GPLB 1EG3A 5JOLA 3EKJA 1CFDA 3ZNIA 4JWQA 1PRWA 2HETA 2QEBA 3D0YA 3I5GC 1OQPA 2L2EA 1PK0D 2WCHA 2M49B 3DVEA 2LMTA 3I5IC 5AFPA 4OV2A 4YGCB 1QLSA 2CBLA 2ZKMX 4JD9A 1KWOC 4DCKA 1B4CA 1DJIA 1C3ZA 2K7OA 2JOJA 4AQIA 1PULA 1PALA 2LHIA 3SS5A 1V1FA 1SK6D 2O5GA 1KFUS 3DYEA 1OOFA 2L4HA 1EG4A 2LVKA 4MZLA 5CSIA 4CLNA 1DGUA 1PSRA 2KI6D 2K61A 2SCPA 3HX4A 4YGEB 1LA0A 1S5GY 1DJGA 2KBIA 2K0JA 1UWOA 3OGNA 4YGBB 1A03A 4USLA 2L50A 2KAYA 5D69A 1CMGA 1RK9A 1SRAA 1YTZC 1BR4B 2EHBA 2L51A 2MHHA 1SL8A 1MWNA 2KI4C 3LK1A 1JWDA 1JF2A 1DELA 3QMEA 1FPWA 1Y1AA 1B47A 3D77A 3LLEA 3BQ3A 3N7HA 1CFPA 1QIVA 2QEHA 4ORCB 1TCFA 3BUMB 1DVIA 1B7TZ 5I2LA 1K8UA 3LCPC 1YRTB 2NXQA 1B7TY 3FE9A 5D3OA 1CM1A 2LMVA 3OX6A 2ISDA 4DS7A 2MLEC 4HSZA 5ER5A 3WNXB 1MQ1A 1EJ3A 3PM2A 3NXAA 4MRXA 1PSBA 1ZUZA 1M46A 2GGMA 4JKTA 1R2UA 2KFHA 3NSLA 1ODBA 3PN7B 3ICBA 1BF5A 3JVTB 2FCEA 4CFQA 2R2IA 1A75B 3B6XA 5DKQA 1XK4A 1KWOB 1R6PA 2AAOA 2KHNA 3B87A 2ZNDA 1V1GA 3VRQA 2KOTA 2L5YA 5F6TA 1WLMA 2VRGA 1NSHA 3R72A 2Q4UA 1X02A 2ZN8A 1MXLC 3EVUA 5I2OA 1QX7A 1OW4A 3CWGA 4C0KA 1Z2CB 2OS8B 5KU1A 3NSKA 1ZOTB 2CTNA 2KAVA 1AUIB 3EG5B 5G08A 1NX3A 4WRIA 1WRZA 3I5HC 1XFRA 3FE6A 4I5JA 2EC6B 2ZNEA 1U5IA 3BOWB 1JBAA 1AJ5A 3K1EA 1NX2A 1G4YR 1YUSA 2TN4A 1SPYA 2JTTA 1N65A 5KSZA 1B8CA 3AKBA 5BPJA 3DD4A 1QV1A 1JF0A 1XFYO 2KGBC 1DJWA 3OP0A 1J55A 3IQOA 2JPOA 4JPZB 1AK8A 1K2HA 1OZOA 3S0AA 1XA5A 2V53A 1L7ZA 3MSEB 2BCXA 3BFAA 4TNCA 1RFJA 3O6BA 1TUJA 4PHKA 1XK4C 1L2OC 2KDHA 2H2KA 2B1UA 3WHUB 3ZWHA 3SIAA 4HRHA 2O60A 1KFXS 1VRKA 1Y1XA 3EVRA 4WQ2A 4QJ5B 1CLLA 1A4PA 1CDMA 2I18A 2PYQA 2M29A 5KTYA 2Y1NA 3L4AA 4P2YB 1IJ6A 3A8RA 1CFCA 1LINA 3CZ0A 2LLTA 1GM0A 4NDCA 4HREE 1OMDA 2OTGC 4MBEA 4DRWA 1ZMZA 4KYNA 4N1GA 2PASA 1KCYA 3CZ1A 1UHKA 2M97A 1XVJA 1N0YA 1IH0A 3EK4A 2JNFA 1NIWA 1TCOB 4PDZA 1IRJA 4YBHB 3SG7A 5IBWA 1KSMA 3BUNB 1SBJA 3VB1A 2JT3A 3BOWA 4FQOA 1DJHA 2BCBA 2NCPA 3I5HB 4U8DA 4ETOA 5J3XA 5AANA 4MRYA 2BECA 3KO0A 2KPHA 2KYCA 1RWYA 5HKZA 3C1VA 2JC2A 3R1OA 2LM5A 3QRXA 2BE6A 3O4YA 3SG2A 3SS4A 3OX5A 5FI2A 4MSPA 2WNDA 3BYAA 2AUCA 3OBVA 3PN7C 2P71A 1KQVA 2JNXA 3B86A 1S6CA 3NHIA 1CMFA 4OZDA 3AKAA 3RLZA 3V2LA 3JVTC 4MZKA 3CGAA 4N5XA 3TDUA 2WC5A 2YGUA 3B88A 3LK0A 5FI6A 2WCFA 3DVKA 1KK8C 1BOCA 2MA2A 3CR4X 1IIOA 1L2OB 3FWBA 2CT9A 1GJYA 2QDIA 4PCWA 1K90D 2LANA 2FJUB 2JXCA 5EL2A 1TN4A 3PM8A 1OE9B 3L4LA 4YGAA 1NCZA 1KQMB 1WY9A 2OS8C 3E3RA 2QEVA 1TNXA 1Y1UA 2QPTA 2BCAA 1TNPA 1JUOA 2FOTA 2OTGB 2EC6C 2L2CA 2L98A 1CNPA 2PSRA 4MZJA 1BG1A 1QIWA 2SASA 4INXA 3R1VA 4ZCVA 1ALWA 3L47A 2Y5IA 5HLVA 3TS5C 1U5IB 5K89A 3I5FC 4GAOA 2WCKA 1DMOA 5CSFA 3RM1A 1W7IB 2I94A 3CR2A 1RTP1 2I7AA 4MVFA 4P5OE 2IS9A 4PE0A 1QX2A 3D73A 4WQ3A 4NQGA 1ALVA 4INWA 4IL1A 2PVBA 2M8UA 3EVVA 1UHHA 2M9GA 4GUKA 2MRDA 3WXAA 3DF0A 1ZFSA 1F71A 3PSRA 2BKIB 1JFJA 1SR6C 2ZFDA 1OZSA 3CTNA 2JU0A 4OKHA 1EH2A 1C3YA 3BFBA 3IVTA 1F8HA 5HYDA 2Y4QA 1S3PA 1UP5A 1NX1A 1Y6WA 2PQLA 2ZN9A 3H4SE 4CIDA 1SMGA 1KFXL 1A29A 2WCLA 3SG5A 3KF9A 1NCYA 1XFUO 1KK8B 4OCIA
chains in the Genus database with same CATH topology
3SG3A 3VRNA 4DUQA 1XFXO 2KAXA 2K2AA 1IWQA 2LCPA 4A4BA 1CLMA 4GFTA 4I5LB 3EKHA 1QATA 1BMOA 2LUXA 3K21A 2KQYA 1G8IA 1LVCD 1K9UA 1OMRA 2MLFC 1J1EA 3TUYB 1NYAA 1DGVA 1OMVA 5D7FA 1RECA 1S26D 3OB1B 1XFWO 2LVVA 4I5NB 4PE7A 3CLNA 1J1DA 2HQWA 3AAKA 4PHMA 5DKRA 3TS5B 1DJXA 3I5FB 5I8NA 1NUBA 1YX7A 2HF5A 2LP3A 3D10A 1B9AA 1JFKA 1TIZA 4PHJA 1ZACA 3LL8B 1HQVA 1YX8A 4ORBB 2BKHB 3BUWB 1PVAA 3NSOA 5CSJA 1BJFA 4PE4A 1MF8B 2WC8A 1SR6B 1UHNA 4M2QA 4YI9A 1SNLA 3A4UB 1CKKA 1IG5A 1DF0A 1WRKA 1SL9A 1PVBA 1F4QA 1KQMC 3BUOB 5I2QA 1QVIZ 1SW8A 4GBAA 2NCOA 2H61A 1S6IA 1AVSA 3CS1A 1K9PA 4D1EA 1AP4A 1MR8A 4C0JA 1DJZA 2MAZA 4I5KA 1YUUA 1RJVA 1NX0A 2CCMA 1SKTA 1TNQA 2NZ0A 1SY9A 1EL4A 1GQMA 2P6BB 3WHTB 2LVJA 1QX5B 2K7BA 1DT7B 2L4IA 1A2XA 1JSAA 4YRUA 2G9BA 1SCMB 1LXFC 2KQ6A 4C0LA 1B8LA 4N1FA 1XFVO 3GK2A 4M2OA 2RGIA 3TDIA 1DTLA 3KHEA 1A03A 3VGOA 1FF1A 1N2DA 5FYXA 1K9KA 4MEWA 1D1OA 2LE9B 3HCMA 3DF0B 1J7QA 2F3YA 3JTDB 4JQ0D 2ZRSA 2BE4A 5CSNA 4E68A 2JTZA 3EK7A 1DJYA 3GOFA 2L0PA 3IQQA 3DVMA 3PATA 3SG6A 1AJ4A 2H61C 2CXJA 2NLNA 2CNPA 2LVIA 1JC2A 4ICBA 2BL0B 1CFFA 1CDLA 3EK8A 1OSAA 2E6WA 4PE1A 4A4CA 1LA3A 2K2FA 2LP2A 1YRUB 1CLBA 2DOQA 3VRRA 3BXKA 3O2PA 1NPQA 5B8IB 1HT9A 4ORAB 2WORA 3TUYC 1YR5A 4MLWA 1F55A 1CM4A 3TDZA 3KEVA 3O78A 2JULA 1KK7Z 3M0WA 2Q91A 1C07A 5CPVA 2KGRA 1KK7Y 2F33A 2M1UA 2KYFA 1XO5A 2HPSA 1TOPA 2L5XB 1C7WA 4GGFA 2G2BA 1IGVA 4XJKB 1H4BA 4NDDA 1YUTA 1S5GZ 2M3WA 1GGWA 3SG4A 3GK4X 1SYMA 5AXIA 1G33A 2D8NA 2EGDA 2K8MB 1WDCB 3DVJA 2E30A 1BR1B 3VROA 2COLB 2KNEA 1K94A 1QS7A 2LLUA 1GGZA 1M45A 2WOSA 2LV7A 1LKJA 2PALA 2PMYA 1KSOA 2KSPA 3PALA 1QV0A 1IQ3A 4YGDB 4QJ4B 3OB2B 4GGNA 2JRFA 2AMIA 4NDBA 1DF0B 1MUXA 1F70A 4GNKB 2KFFA 2M1KB 2M7NA 1FI5A 2PRUA 3GK1A 4CFRA 1NWDA 1CB1A 2HQ8A 1UHIA 2LUCA 3SIBA 2KBMA 1MXEA 1K93D 2JPTA 3TZ1A 4BY4A 3F45A 4YI8A 1AHRA 2ZRTA 5HLOA 3SJSA 1MHOA 1XYDA 5HKYA 3AAJA 1F54A 4R1EA 1M31A 3I5GB 4GGFC 4DIRA 3I5IB 1SCMC 1NP8A 2A4JA 3CR5X 1EXRA 3FWCA 3PLFB 4OR9B 1QLKA 5HKWA 1XFZO 1WRLA 1SCVA 2WCEA 1Y0VH 4XJKA 2LMUA 1QXPA 5DKNA 2K7DA 2WCBA 3JTDC 1S36A 2JQ6A 2KI6C 1H8BA 4QJ3B 2GV5A 1IJ5A 1B8RA 2FCDA 1K95A 1NCXA 2Y1MA 4OVNF 2BBMA 4BY5A 2BBNA 2M0RA 2BL0C 1WLZA 1J7RA 2JT0A 2MBXA 2QACA 1F4OA 2KI4B 4CPVA 5PALA 1Q80A 4XYNA 1YVHA 1CTRA 4PALA 1W7JB 2LHLA 3KPXA 5AERA 1TRFA 4M2PA 2JXLA 1QASA 2JZIA 1QVIY 3IF7A 2LLSA 1BODA 4ZCUA 2F3ZA 1BLQA 5JJGA 1OOJA 3D0YB 4MN0A 3CZTX 1RROA 4AQJA 1TNWA 5TNCA 1B1GA 4HRGA 1M63B 1E8AA 1UURA 3OHMB 4FTGA 2K7CA 2F8PA 1S6JA 1C7VA 1IKUA 2LAPA 1TTXA 1A75A 2M7LA 4PHNA 3FS7A 3VRPA 1QTXA 2LC5A 1KFUL 5GQQC 4L9MA 1YVLA 1WDCC 2MJWB 2F2PA 1K96A 1IQ5A 1FBVA 1S1EA 1CDNA 2LNKA 3BUXB 2JT8A 4F0ZB 5AEQA 5ER4X 4UPGA 2KFGA 1YURA 1BT6A 1FI6A 1BU3A 1UHJA 2F2OA 2I2RE 1J7OA 2GGZA 1UUSA 3PFVA 4AOMA 4Q04A 3NSIA 1J7PA 1SL7A 1CDPA 1QJTA 2OPOA 3FIAA 1M39A 1FW4A 2JWWA 4GPLB 1EG3A 5JOLA 3EKJA 1CFDA 3ZNIA 4JWQA 1PRWA 2HETA 3D0YA 3I5GC 1OQPA 2L2EA 1PK0D 5AFPA 2M49B 3DVEA 2LMTA 3I5IC 4OV2A 4YGCB 1QLSA 2CBLA 2ZKMX 1KWOC 4DCKA 1B4CA 1DJIA 2K7OA 2JOJA 4AQIA 1PULA 1PALA 2LHIA 1V1FA 1SK6D 2O5GA 1KFUS 2L4HA 1EG4A 2LVKA 4MZLA 5CSIA 4CLNA 1DGUA 1PSRA 2KI6D 2K61A 2SCPA 3HX4A 4YGEB 1LA0A 1S5GY 1DJGA 2KBIA 2K0JA 1UWOA 4YGBB 4USLA 2L50A 2KAYA 5D69A 1CMGA 1RK9A 1SRAA 1YTZC 1BR4B 2EHBA 2L51A 2MHHA 1SL8A 1MWNA 2KI4C 3LK1A 1JWDA 1JF2A 1FPWA 1Y1AA 1B47A 3LLEA 1CFPA 3BQ3A 1QIVA 4ORCB 1TCFA 3BUMB 1DVIA 1B7TZ 5I2LA 1K8UA 3LCPC 1YRTB 2NXQA 1B7TY 1CM1A 2LMVA 3OX6A 2ISDA 4DS7A 2MLEC 4HSZA 5ER5A 3WNXB 1MQ1A 1EJ3A 4MRXA 3NXAA 1PSBA 1ZUZA 1M46A 2GGMA 1R2UA 2KFHA 3NSLA 1ODBA 3PN7B 3ICBA 1BF5A 3JVTB 2FCEA 4CFQA 2R2IA 1A75B 5DKQA 1XK4A 1KWOB 1R6PA 2AAOA 2KHNA 2ZNDA 1V1GA 3VRQA 2KOTA 5F6TA 1WLMA 2VRGA 1NSHA 2Q4UA 1X02A 2ZN8A 1MXLC 3EVUA 5I2OA 1QX7A 3CWGA 4C0KA 2OS8B 5KU1A 3NSKA 1ZOTB 2CTNA 2KAVA 1AUIB 5G08A 1NX3A 4WRIA 1WRZA 3I5HC 4I5JA 2EC6B 2ZNEA 1U5IA 3BOWB 1JBAA 1AJ5A 1NX2A 1G4YR 1YUSA 2TN4A 1SPYA 2JTTA 1N65A 5KSZA 1B8CA 3AKBA 5BPJA 3DD4A 1QV1A 1JF0A 1XFYO 2KGBC 1DJWA 3OP0A 1J55A 3IQOA 4JPZB 1AK8A 1K2HA 1OZOA 1XA5A 2V53A 1L7ZA 3MSEB 2BCXA 4TNCA 1RFJA 3O6BA 4PHKA 1XK4C 1L2OC 2KDHA 2H2KA 2B1UA 3WHUB 3ZWHA 3SIAA 4HRHA 2O60A 1KFXS 1VRKA 1Y1XA 3EVRA 4WQ2A 4QJ5B 1CLLA 1A4PA 1CDMA 2I18A 2M29A 5KTYA 2Y1NA 4P2YB 1IJ6A 3A8RA 1CFCA 1LINA 2LLTA 4NDCA 4HREE 1OMDA 2OTGC 4MBEA 4DRWA 1ZMZA 4N1GA 1KCYA 2PASA 1UHKA 2M97A 1XVJA 1N0YA 1IH0A 3EK4A 2JNFA 1NIWA 1TCOB 4PDZA 1IRJA 4YBHB 3SG7A 5IBWA 1KSMA 3BUNB 1SBJA 2JT3A 3BOWA 4FQOA 1DJHA 2BCBA 2NCPA 3I5HB 4U8DA 4ETOA 5J3XA 5AANA 4MRYA 2BECA 3KO0A 2KYCA 1RWYA 5HKZA 3C1VA 2JC2A 2LM5A 3QRXA 2BE6A 3O4YA 3SG2A 3OX5A 4MSPA 2WNDA 3BYAA 2AUCA 3PN7C 1KQVA 2JNXA 1CMFA 1S6CA 3AKAA 3RLZA 3JVTC 4MZKA 3CGAA 4N5XA 3TDUA 3LK0A 2WCFA 3DVKA 1KK8C 1BOCA 2MA2A 3CR4X 1L2OB 3FWBA 2CT9A 1GJYA 4PCWA 1K90D 2LANA 2FJUB 2JXCA 1TN4A 3PM8A 1OE9B 4YGAA 1NCZA 1KQMB 1WY9A 2OS8C 3E3RA 1TNXA 1Y1UA 2QPTA 2BCAA 1TNPA 1JUOA 2FOTA 2OTGB 2EC6C 2L98A 1CNPA 2PSRA 4MZJA 1BG1A 1QIWA 2SASA 4ZCVA 5HLVA 1ALWA 2Y5IA 3TS5C 1U5IB 5K89A 3I5FC 4GAOA 1DMOA 5CSFA 3RM1A 1W7IB 2I94A 3CR2A 1RTP1 2I7AA 4MVFA 4P5OE 2IS9A 4PE0A 1QX2A 4WQ3A 4NQGA 1ALVA 4IL1A 2PVBA 2M8UA 3EVVA 1UHHA 2M9GA 4GUKA 2MRDA 3WXAA 3DF0A 1ZFSA 1F71A 3PSRA 2BKIB 1JFJA 1SR6C 2ZFDA 1OZSA 3CTNA 2JU0A 4OKHA 1EH2A 1F8HA 5HYDA 2Y4QA 1S3PA 1UP5A 1NX1A 1Y6WA 2ZN9A 3H4SE 4CIDA 1SMGA 1KFXL 1A29A 3SG5A 3KF9A 1NCYA 1XFUO 1KK8B 4OCIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SG3 A;  3VRN A;  4DUQ A;  1XFX O;  2KAX A;  2K2A A;  1IWQ A;  2LCP A;  4A4B A;  1CLM A;  4GFT A;  4I5L B;  3EKH A;  1QAT A;  1BMO A;  2LUX A;  3K21 A;  2KQY A;  1G8I A;  1LVC D;  1K9U A;  1OMR A;  2MLF C;  1J1E A;  3TUY B;  1NYA A;  1DGV A;  1OMV A;  5D7F A;  1REC A;  1S26 D;  3OB1 B;  1XFW O;  2LVV A;  4I5N B;  4PE7 A;  3CLN A;  1J1D A;  2HQW A;  3AAK A;  4PHM A;  5DKR A;  3TS5 B;  1DJX A;  3I5F B;  5I8N A;  1NUB A;  1YX7 A;  2HF5 A;  2LP3 A;  3D10 A;  1B9A A;  1JFK A;  1TIZ A;  4PHJ A;  1ZAC A;  3LL8 B;  1HQV A;  1YX8 A;  4ORB B;  2BKH B;  3BUW B;  1PVA A;  3NSO A;  5CSJ A;  1BJF A;  4PE4 A;  1MF8 B;  2WC8 A;  1SR6 B;  1UHN A;  4M2Q A;  4YI9 A;  1SNL A;  3A4U B;  1CKK A;  1IG5 A;  1DF0 A;  1WRK A;  1SL9 A;  1PVB A;  1F4Q A;  1KQM C;  3BUO B;  5I2Q A;  1QVI Z;  1SW8 A;  4GBA A;  2NCO A;  2H61 A;  1S6I A;  1AVS A;  3CS1 A;  1K9P A;  4D1E A;  1AP4 A;  1MR8 A;  4C0J A;  1DJZ A;  2MAZ A;  4I5K A;  1YUU A;  1RJV A;  1NX0 A;  2CCM A;  1SKT A;  1TNQ A;  2NZ0 A;  1SY9 A;  1EL4 A;  1GQM A;  2P6B B;  3WHT B;  2LVJ A;  1QX5 B;  2K7B A;  1DT7 B;  2L4I A;  1A2X A;  1JSA A;  4YRU A;  2G9B A;  1SCM B;  1LXF C;  2KQ6 A;  4C0L A;  1B8L A;  4N1F A;  1XFV O;  3GK2 A;  4M2O A;  2RGI A;  3TDI A;  1DTL A;  3KHE A;  1A03 A;  3VGO A;  1FF1 A;  1N2D A;  5FYX A;  1K9K A;  4MEW A;  1D1O A;  2LE9 B;  3HCM A;  3DF0 B;  1J7Q A;  2F3Y A;  3JTD B;  4JQ0 D;  2ZRS A;  2BE4 A;  5CSN A;  4E68 A;  2JTZ A;  3EK7 A;  1DJY A;  3GOF A;  2L0P A;  3IQQ A;  3DVM A;  3PAT A;  3SG6 A;  1AJ4 A;  2H61 C;  2CXJ A;  2NLN A;  2CNP A;  2LVI A;  1JC2 A;  4ICB A;  2BL0 B;  1CFF A;  1CDL A;  3EK8 A;  1OSA A;  2E6W A;  4PE1 A;  4A4C A;  1LA3 A;  2K2F A;  2LP2 A;  1YRU B;  1CLB A;  2DOQ A;  3VRR A;  3BXK A;  3O2P A;  1NPQ A;  5B8I B;  1HT9 A;  4ORA B;  2WOR A;  3TUY C;  1YR5 A;  4MLW A;  1F55 A;  1CM4 A;  3TDZ A;  3KEV A;  3O78 A;  2JUL A;  1KK7 Z;  3M0W A;  2Q91 A;  1C07 A;  5CPV A;  2KGR A;  1KK7 Y;  2F33 A;  2M1U A;  2KYF A;  1XO5 A;  2HPS A;  1TOP A;  2L5X B;  1C7W A;  4GGF A;  2G2B A;  1IGV A;  4XJK B;  1H4B A;  4NDD A;  1YUT A;  1S5G Z;  2M3W A;  1GGW A;  3SG4 A;  3GK4 X;  1SYM A;  5AXI A;  1G33 A;  2D8N A;  2EGD A;  2K8M B;  1WDC B;  3DVJ A;  2E30 A;  1BR1 B;  3VRO A;  2COL B;  2KNE A;  1K94 A;  1QS7 A;  2LLU A;  1GGZ A;  1M45 A;  2WOS A;  2LV7 A;  1LKJ A;  2PAL A;  2PMY A;  1KSO A;  2KSP A;  3PAL A;  1QV0 A;  1IQ3 A;  4YGD B;  4QJ4 B;  3OB2 B;  4GGN A;  2JRF A;  2AMI A;  4NDB A;  1DF0 B;  1MUX A;  1F70 A;  4GNK B;  2KFF A;  2M1K B;  2M7N A;  1FI5 A;  2PRU A;  3GK1 A;  4CFR A;  1NWD A;  1CB1 A;  2HQ8 A;  1UHI A;  2LUC A;  3SIB A;  2KBM A;  1MXE A;  1K93 D;  2JPT A;  3TZ1 A;  4BY4 A;  3F45 A;  4YI8 A;  1AHR A;  2ZRT A;  5HLO A;  3SJS A;  1MHO A;  1XYD A;  5HKY A;  3AAJ A;  1F54 A;  4R1E A;  1M31 A;  3I5G B;  4GGF C;  4DIR A;  3I5I B;  1SCM C;  1NP8 A;  2A4J A;  3CR5 X;  1EXR A;  3FWC A;  3PLF B;  4OR9 B;  1QLK A;  5HKW A;  1XFZ O;  1WRL A;  1SCV A;  2WCE A;  1Y0V H;  4XJK A;  2LMU A;  1QXP A;  5DKN A;  2K7D A;  2WCB A;  3JTD C;  1S36 A;  2JQ6 A;  2KI6 C;  1H8B A;  4QJ3 B;  2GV5 A;  1IJ5 A;  1B8R A;  2FCD A;  1K95 A;  1NCX A;  2Y1M A;  4OVN F;  2BBM A;  4BY5 A;  2BBN A;  2M0R A;  2BL0 C;  1WLZ A;  1J7R A;  2JT0 A;  2MBX A;  2QAC A;  1F4O A;  2KI4 B;  4CPV A;  5PAL A;  1Q80 A;  4XYN A;  1YVH A;  1CTR A;  4PAL A;  1W7J B;  2LHL A;  3KPX A;  5AER A;  1TRF A;  4M2P A;  2JXL A;  1QAS A;  2JZI A;  1QVI Y;  3IF7 A;  2LLS A;  1BOD A;  4ZCU A;  2F3Z A;  1BLQ A;  5JJG A;  1OOJ A;  3D0Y B;  4MN0 A;  3CZT X;  1RRO A;  4AQJ A;  1TNW A;  5TNC A;  1B1G A;  4HRG A;  1M63 B;  1E8A A;  1UUR A;  3OHM B;  4FTG A;  2K7C A;  2F8P A;  1S6J A;  1C7V A;  1IKU A;  2LAP A;  1TTX A;  1A75 A;  2M7L A;  4PHN A;  3FS7 A;  3VRP A;  1QTX A;  2LC5 A;  1KFU L;  5GQQ C;  4L9M A;  1YVL A;  1WDC C;  2MJW B;  2F2P A;  1K96 A;  1IQ5 A;  1FBV A;  1S1E A;  1CDN A;  2LNK A;  3BUX B;  2JT8 A;  4F0Z B;  5AEQ A;  5ER4 X;  4UPG A;  2KFG A;  1YUR A;  1BT6 A;  1FI6 A;  1BU3 A;  1UHJ A;  2F2O A;  2I2R E;  1J7O A;  2GGZ A;  1UUS A;  3PFV A;  4AOM A;  4Q04 A;  3NSI A;  1J7P A;  1SL7 A;  1CDP A;  1QJT A;  2OPO A;  3FIA A;  1M39 A;  1FW4 A;  2JWW A;  4GPL B;  1EG3 A;  5JOL A;  3EKJ A;  1CFD A;  3ZNI A;  4JWQ A;  1PRW A;  2HET A;  3D0Y A;  3I5G C;  1OQP A;  2L2E A;  1PK0 D;  5AFP A;  2M49 B;  3DVE A;  2LMT A;  3I5I C;  4OV2 A;  4YGC B;  1QLS A;  2CBL A;  2ZKM X;  1KWO C;  4DCK A;  1B4C A;  1DJI A;  2K7O A;  2JOJ A;  4AQI A;  1PUL A;  1PAL A;  2LHI A;  1V1F A;  1SK6 D;  2O5G A;  1KFU S;  2L4H A;  1EG4 A;  2LVK A;  4MZL A;  5CSI A;  4CLN A;  1DGU A;  1PSR A;  2KI6 D;  2K61 A;  2SCP A;  3HX4 A;  4YGE B;  1LA0 A;  1S5G Y;  1DJG A;  2KBI A;  2K0J A;  1UWO A;  4YGB B;  4USL A;  2L50 A;  2KAY A;  5D69 A;  1CMG A;  1RK9 A;  1SRA A;  1YTZ C;  1BR4 B;  2EHB A;  2L51 A;  2MHH A;  1SL8 A;  1MWN A;  2KI4 C;  3LK1 A;  1JWD A;  1JF2 A;  1FPW A;  1Y1A A;  1B47 A;  3LLE A;  1CFP A;  3BQ3 A;  1QIV A;  4ORC B;  1TCF A;  3BUM B;  1DVI A;  1B7T Z;  5I2L A;  1K8U A;  3LCP C;  1YRT B;  2NXQ A;  1B7T Y;  1CM1 A;  2LMV A;  3OX6 A;  2ISD A;  4DS7 A;  2MLE C;  4HSZ A;  5ER5 A;  3WNX B;  1MQ1 A;  1EJ3 A;  4MRX A;  3NXA A;  1PSB A;  1ZUZ A;  1M46 A;  2GGM A;  1R2U A;  2KFH A;  3NSL A;  1ODB A;  3PN7 B;  3ICB A;  1BF5 A;  3JVT B;  2FCE A;  4CFQ A;  2R2I A;  1A75 B;  5DKQ A;  1XK4 A;  1KWO B;  1R6P A;  2AAO A;  2KHN A;  2ZND A;  1V1G A;  3VRQ A;  2KOT A;  5F6T A;  1WLM A;  2VRG A;  1NSH A;  2Q4U A;  1X02 A;  2ZN8 A;  1MXL C;  3EVU A;  5I2O A;  1QX7 A;  3CWG A;  4C0K A;  2OS8 B;  5KU1 A;  3NSK A;  1ZOT B;  2CTN A;  2KAV A;  1AUI B;  5G08 A;  1NX3 A;  4WRI A;  1WRZ A;  3I5H C;  4I5J A;  2EC6 B;  2ZNE A;  1U5I A;  3BOW B;  1JBA A;  1AJ5 A;  1NX2 A;  1G4Y R;  1YUS A;  2TN4 A;  1SPY A;  2JTT A;  1N65 A;  5KSZ A;  1B8C A;  3AKB A;  5BPJ A;  3DD4 A;  1QV1 A;  1JF0 A;  1XFY O;  2KGB C;  1DJW A;  3OP0 A;  1J55 A;  3IQO A;  4JPZ B;  1AK8 A;  1K2H A;  1OZO A;  1XA5 A;  2V53 A;  1L7Z A;  3MSE B;  2BCX A;  4TNC A;  1RFJ A;  3O6B A;  4PHK A;  1XK4 C;  1L2O C;  2KDH A;  2H2K A;  2B1U A;  3WHU B;  3ZWH A;  3SIA A;  4HRH A;  2O60 A;  1KFX S;  1VRK A;  1Y1X A;  3EVR A;  4WQ2 A;  4QJ5 B;  1CLL A;  1A4P A;  1CDM A;  2I18 A;  2M29 A;  5KTY A;  2Y1N A;  4P2Y B;  1IJ6 A;  3A8R A;  1CFC A;  1LIN A;  2LLT A;  4NDC A;  4HRE E;  1OMD A;  2OTG C;  4MBE A;  4DRW A;  1ZMZ A;  4N1G A;  1KCY A;  2PAS A;  1UHK A;  2M97 A;  1XVJ A;  1N0Y A;  1IH0 A;  3EK4 A;  2JNF A;  1NIW A;  1TCO B;  4PDZ A;  1IRJ A;  4YBH B;  3SG7 A;  5IBW A;  1KSM A;  3BUN B;  1SBJ A;  2JT3 A;  3BOW A;  4FQO A;  1DJH A;  2BCB A;  2NCP A;  3I5H B;  4U8D A;  4ETO A;  5J3X A;  5AAN A;  4MRY A;  2BEC A;  3KO0 A;  2KYC A;  1RWY A;  5HKZ A;  3C1V A;  2JC2 A;  2LM5 A;  3QRX A;  2BE6 A;  3O4Y A;  3SG2 A;  3OX5 A;  4MSP A;  2WND A;  3BYA A;  2AUC A;  3PN7 C;  1KQV A;  2JNX A;  1CMF A;  1S6C A;  3AKA A;  3RLZ A;  3JVT C;  4MZK A;  3CGA A;  4N5X A;  3TDU A;  3LK0 A;  2WCF A;  3DVK A;  1KK8 C;  1BOC A;  2MA2 A;  3CR4 X;  1L2O B;  3FWB A;  2CT9 A;  1GJY A;  4PCW A;  1K90 D;  2LAN A;  2FJU B;  2JXC A;  1TN4 A;  3PM8 A;  1OE9 B;  4YGA A;  1NCZ A;  1KQM B;  1WY9 A;  2OS8 C;  3E3R A;  1TNX A;  1Y1U A;  2QPT A;  2BCA A;  1TNP A;  1JUO A;  2FOT A;  2OTG B;  2EC6 C;  2L98 A;  1CNP A;  2PSR A;  4MZJ A;  1BG1 A;  1QIW A;  2SAS A;  4ZCV A;  5HLV A;  1ALW A;  2Y5I A;  3TS5 C;  1U5I B;  5K89 A;  3I5F C;  4GAO A;  1DMO A;  5CSF A;  3RM1 A;  1W7I B;  2I94 A;  3CR2 A;  1RTP 1;  2I7A A;  4MVF A;  4P5O E;  2IS9 A;  4PE0 A;  1QX2 A;  4WQ3 A;  4NQG A;  1ALV A;  4IL1 A;  2PVB A;  2M8U A;  3EVV A;  1UHH A;  2M9G A;  4GUK A;  2MRD A;  3WXA A;  3DF0 A;  1ZFS A;  1F71 A;  3PSR A;  2BKI B;  1JFJ A;  1SR6 C;  2ZFD A;  1OZS A;  3CTN A;  2JU0 A;  4OKH A;  1EH2 A;  1F8H A;  5HYD A;  2Y4Q A;  1S3P A;  1UP5 A;  1NX1 A;  1Y6W A;  2ZN9 A;  3H4S E;  4CID A;  1SMG A;  1KFX L;  1A29 A;  3SG5 A;  3KF9 A;  1NCY A;  1XFU O;  1KK8 B;  4OCI A; 
#chains in the Genus database with same CATH topology
 3SG3 A;  3VRN A;  4DUQ A;  1XFX O;  2KAX A;  2K2A A;  1IWQ A;  2LCP A;  4A4B A;  1CLM A;  4GFT A;  3S0G A;  4I5L B;  3EKH A;  1QAT A;  1BMO A;  2LUX A;  3K21 A;  2KQY A;  1W9Z A;  1G8I A;  1LVC D;  1K9U A;  1OMR A;  2MLF C;  1J1E A;  3TUY B;  1NYA A;  1DGV A;  1OMV A;  5D7F A;  1REC A;  1S26 D;  3OB1 B;  1XFW O;  2LVV A;  4I5N B;  4PE7 A;  3CLN A;  1J1D A;  2BAP A;  2HQW A;  3AAK A;  4PHM A;  5DKR A;  3TS5 B;  1DJX A;  3I5F B;  5I8N A;  1NUB A;  1YX7 A;  2HF5 A;  2LP3 A;  3D10 A;  1B9A A;  1P28 A;  1JFK A;  1TIZ A;  4PHJ A;  3R1P A;  1ZAC A;  1T14 A;  3LL8 B;  1HQV A;  1YX8 A;  4ORB B;  2BKH B;  3BUW B;  1PVA A;  3NSO A;  5CSJ A;  1BJF A;  4PE4 A;  1MF8 B;  2WC8 A;  1SR6 B;  1UHN A;  4FQT A;  4IJ7 A;  3D74 A;  4M2Q A;  4YI9 A;  1SNL A;  3A4U B;  1TWO A;  1IG5 A;  1CKK A;  1DF0 A;  1WRK A;  1SL9 A;  2H8V A;  1PVB A;  1F4Q A;  1KQM C;  3BUO B;  3D78 A;  1QVI Z;  1SW8 A;  4GBA A;  5I2Q A;  2NCO A;  2H61 A;  1S6I A;  3CAB A;  1AVS A;  3CS1 A;  1K9P A;  4D1E A;  1LS8 A;  1AP4 A;  2ERB A;  1MR8 A;  4C0J A;  1DJZ A;  2KLE A;  2MAZ A;  4I5K A;  4PT1 A;  1YUU A;  1RJV A;  1NX0 A;  2CCM A;  1SKT A;  1TNQ A;  2NZ0 A;  1SY9 A;  1EL4 A;  1GQM A;  2P6B B;  3WHT B;  2LVJ A;  1QX5 B;  2K7B A;  1DT7 B;  2L4I A;  1A2X A;  1JSA A;  4YRU A;  2G9B A;  1SCM B;  1LXF C;  2KQ6 A;  4C0L A;  1B8L A;  4N1F A;  1XFV O;  3GK2 A;  4M2O A;  2RGI A;  3TDI A;  1DTL A;  1ORG A;  1SSE B;  3KHE A;  5FI7 A;  1N2D A;  5FYX A;  3VGO A;  1K9K A;  4MEW A;  1D1O A;  2LE9 B;  1FF1 A;  3HCM A;  3DF0 B;  1J7Q A;  2F3Y A;  3JTD B;  3PJI A;  4JQ0 D;  2ZRS A;  2BE4 A;  5CSN A;  4E68 A;  2JTZ A;  3EK7 A;  1DJY A;  3GOF A;  2L0P A;  3IQQ A;  3DVM A;  3PAT A;  3SG6 A;  1AJ4 A;  2H61 C;  2CXJ A;  2NLN A;  2CNP A;  2LVI A;  1JC2 A;  3D76 A;  2BL0 B;  4ICB A;  1CDL A;  1CFF A;  5DIC A;  3EK8 A;  1OSA A;  2E6W A;  4PE1 A;  4A4C A;  1LA3 A;  3RZS A;  2K2F A;  2LP2 A;  1OOI X;  1YRU B;  1CLB A;  2DOQ A;  3VRR A;  3BXK A;  3O2P A;  1NPQ A;  5B8I B;  1HT9 A;  2WC6 A;  4ORA B;  3CYZ A;  2WOR A;  2K60 A;  3TUY C;  1YR5 A;  4MLW A;  1Z4H A;  1F55 A;  1CM4 A;  3TDZ A;  3KEV A;  3O78 A;  3S0F A;  2JUL A;  3CZ2 A;  1KK7 Z;  3M0W A;  2Q91 A;  3D75 A;  1C07 A;  5CPV A;  2KGR A;  1KK7 Y;  2F33 A;  2M1U A;  2KYF A;  1XO5 A;  2HPS A;  1TOP A;  2L5X B;  1C7W A;  4GGF A;  2G2B A;  1IGV A;  4XJK B;  1H4B A;  4NDD A;  1YUT A;  1S5G Z;  3B7A A;  2M3W A;  3S0D A;  1GGW A;  3UNW A;  3SG4 A;  3GK4 X;  1SYM A;  3NGV A;  5AXI A;  5I94 A;  1G33 A;  2D8N A;  2EGD A;  2K8M B;  1OOG A;  1WDC B;  1TUZ A;  2E30 A;  1BR1 B;  3DVJ A;  3VRO A;  2COL B;  2FJY A;  2KNE A;  1K94 A;  1QS7 A;  2LLU A;  1GGZ A;  1QWV A;  1M45 A;  2WOS A;  2LV7 A;  1LKJ A;  2PAL A;  2PMY A;  1KSO A;  2KSP A;  3PAL A;  1QV0 A;  3S0E A;  1IQ3 A;  4YGD B;  3BJH A;  3OB2 B;  4QJ4 B;  4GGN A;  2JRF A;  2AMI A;  4NDB A;  1DF0 B;  1MUX A;  1F70 A;  4GNK B;  2KFF A;  2M1K B;  2M7N A;  3SS3 A;  1FI5 A;  2PRU A;  4F7F A;  2BNX A;  3GK1 A;  3DXL A;  4CFR A;  1NWD A;  1CB1 A;  2HQ8 A;  1UHI A;  3DZT A;  2LUC A;  3SIB A;  2KBM A;  1MXE A;  1K93 D;  2JPT A;  3TZ1 A;  4BY4 A;  3F45 A;  4YI8 A;  1AHR A;  2ZRT A;  5HLO A;  3SJS A;  1MHO A;  1XYD A;  5HKY A;  3AAJ A;  1F54 A;  4R1E A;  1M31 A;  3I5G B;  4GGF C;  4DIR A;  3O4X A;  3I5I B;  1SCM C;  1NP8 A;  2A4J A;  2QEO A;  3CR5 X;  1EXR A;  2WCM A;  3FWC A;  3PLF B;  4OR9 B;  1QLK A;  5HKW A;  1XFZ O;  1WRL A;  1DC1 A;  1SCV A;  2WCE A;  1Y0V H;  4XJK A;  2LMU A;  3S0B A;  1QXP A;  5DKN A;  2K7D A;  2WCB A;  3JTD C;  2GTE A;  1S36 A;  2JQ6 A;  2KI6 C;  1H8B A;  4QJ3 B;  2GV5 A;  1IJ5 A;  1B8R A;  1OOH A;  2FCD A;  1K95 A;  1NCX A;  2Y1M A;  4OVN F;  2BBM A;  3CDN A;  4BY5 A;  2BBN A;  3NHT A;  2M0R A;  2BL0 C;  1WLZ A;  1J7R A;  2JT0 A;  2MBX A;  2QAC A;  1F4O A;  2KI4 B;  4CPV A;  5PAL A;  1Q80 A;  4XYN A;  1YVH A;  1CTR A;  3BFH A;  4PAL A;  1W7J B;  5HL1 A;  1DQE A;  2LHL A;  3KPX A;  5AER A;  1TRF A;  4M2P A;  2JXL A;  1QAS A;  2JZI A;  1QVI Y;  3IF7 A;  3Q8I A;  2LLS A;  1BOD A;  4ZCU A;  2F3Z A;  1BLQ A;  5JJG A;  1OOJ A;  3D0Y B;  4MN0 A;  3CZT X;  1RRO A;  4AQJ A;  1TNW A;  5TNC A;  1B1G A;  4HRG A;  3UO9 A;  1M63 B;  2WCJ A;  1E8A A;  1UUR A;  3OHM B;  4FTG A;  2K7C A;  2F8P A;  1S6J A;  1C7V A;  1IKU A;  2LAP A;  1TTX A;  2KLD A;  1A75 A;  2M7L A;  4PHN A;  3FS7 A;  3VRP A;  1QTX A;  2LC5 A;  3FE8 A;  1KFU L;  5GQQ C;  4L9M A;  1YVL A;  1WDC C;  2MJW B;  2F2P A;  1K96 A;  1IQ5 A;  1FBV A;  1S1E A;  1CDN A;  2LNK A;  3BUX B;  2JT8 A;  4F0Z B;  5AEQ A;  5ER4 X;  4UPG A;  2KFG A;  1YUR A;  1BT6 A;  1FI6 A;  1BU3 A;  1UHJ A;  2F2O A;  2I2R E;  1J7O A;  2GGZ A;  1UUS A;  3PFV A;  4AOM A;  4Q04 A;  3NSI A;  2P70 A;  1DEK A;  1J7P A;  1SL7 A;  3DY9 A;  1CDP A;  1QJT A;  2OPO A;  3FIA A;  1M39 A;  1FW4 A;  2JWW A;  4GPL B;  1EG3 A;  5JOL A;  3EKJ A;  1CFD A;  3ZNI A;  4JWQ A;  1PRW A;  2HET A;  2QEB A;  3D0Y A;  3I5G C;  1OQP A;  2L2E A;  1PK0 D;  2WCH A;  2M49 B;  3DVE A;  2LMT A;  3I5I C;  5AFP A;  4OV2 A;  4YGC B;  1QLS A;  2CBL A;  2ZKM X;  4JD9 A;  1KWO C;  4DCK A;  1B4C A;  1DJI A;  1C3Z A;  2K7O A;  2JOJ A;  4AQI A;  1PUL A;  1PAL A;  2LHI A;  3SS5 A;  1V1F A;  1SK6 D;  2O5G A;  1KFU S;  3DYE A;  1OOF A;  2L4H A;  1EG4 A;  2LVK A;  4MZL A;  5CSI A;  4CLN A;  1DGU A;  1PSR A;  2KI6 D;  2K61 A;  2SCP A;  3HX4 A;  4YGE B;  1LA0 A;  1S5G Y;  1DJG A;  2KBI A;  2K0J A;  1UWO A;  3OGN A;  4YGB B;  1A03 A;  4USL A;  2L50 A;  2KAY A;  5D69 A;  1CMG A;  1RK9 A;  1SRA A;  1YTZ C;  1BR4 B;  2EHB A;  2L51 A;  2MHH A;  1SL8 A;  1MWN A;  2KI4 C;  3LK1 A;  1JWD A;  1JF2 A;  1DEL A;  3QME A;  1FPW A;  1Y1A A;  1B47 A;  3D77 A;  3LLE A;  3BQ3 A;  3N7H A;  1CFP A;  1QIV A;  2QEH A;  4ORC B;  1TCF A;  3BUM B;  1DVI A;  1B7T Z;  5I2L A;  1K8U A;  3LCP C;  1YRT B;  2NXQ A;  1B7T Y;  3FE9 A;  5D3O A;  1CM1 A;  2LMV A;  3OX6 A;  2ISD A;  4DS7 A;  2MLE C;  4HSZ A;  5ER5 A;  3WNX B;  1MQ1 A;  1EJ3 A;  3PM2 A;  3NXA A;  4MRX A;  1PSB A;  1ZUZ A;  1M46 A;  2GGM A;  4JKT A;  1R2U A;  2KFH A;  3NSL A;  1ODB A;  3PN7 B;  3ICB A;  1BF5 A;  3JVT B;  2FCE A;  4CFQ A;  2R2I A;  1A75 B;  3B6X A;  5DKQ A;  1XK4 A;  1KWO B;  1R6P A;  2AAO A;  2KHN A;  3B87 A;  2ZND A;  1V1G A;  3VRQ A;  2KOT A;  2L5Y A;  5F6T A;  1WLM A;  2VRG A;  1NSH A;  3R72 A;  2Q4U A;  1X02 A;  2ZN8 A;  1MXL C;  3EVU A;  5I2O A;  1QX7 A;  1OW4 A;  3CWG A;  4C0K A;  1Z2C B;  2OS8 B;  5KU1 A;  3NSK A;  1ZOT B;  2CTN A;  2KAV A;  1AUI B;  3EG5 B;  5G08 A;  1NX3 A;  4WRI A;  1WRZ A;  3I5H C;  1XFR A;  3FE6 A;  4I5J A;  2EC6 B;  2ZNE A;  1U5I A;  3BOW B;  1JBA A;  1AJ5 A;  3K1E A;  1NX2 A;  1G4Y R;  1YUS A;  2TN4 A;  1SPY A;  2JTT A;  1N65 A;  5KSZ A;  1B8C A;  3AKB A;  5BPJ A;  3DD4 A;  1QV1 A;  1JF0 A;  1XFY O;  2KGB C;  1DJW A;  3OP0 A;  1J55 A;  3IQO A;  2JPO A;  4JPZ B;  1AK8 A;  1K2H A;  1OZO A;  3S0A A;  1XA5 A;  2V53 A;  1L7Z A;  3MSE B;  2BCX A;  3BFA A;  4TNC A;  1RFJ A;  3O6B A;  1TUJ A;  4PHK A;  1XK4 C;  1L2O C;  2KDH A;  2H2K A;  2B1U A;  3WHU B;  3ZWH A;  3SIA A;  4HRH A;  2O60 A;  1KFX S;  1VRK A;  1Y1X A;  3EVR A;  4WQ2 A;  4QJ5 B;  1CLL A;  1A4P A;  1CDM A;  2I18 A;  2PYQ A;  2M29 A;  5KTY A;  2Y1N A;  3L4A A;  4P2Y B;  1IJ6 A;  3A8R A;  1CFC A;  1LIN A;  3CZ0 A;  2LLT A;  1GM0 A;  4NDC A;  4HRE E;  1OMD A;  2OTG C;  4MBE A;  4DRW A;  1ZMZ A;  4KYN A;  4N1G A;  2PAS A;  1KCY A;  3CZ1 A;  1UHK A;  2M97 A;  1XVJ A;  1N0Y A;  1IH0 A;  3EK4 A;  2JNF A;  1NIW A;  1TCO B;  4PDZ A;  1IRJ A;  4YBH B;  3SG7 A;  5IBW A;  1KSM A;  3BUN B;  1SBJ A;  3VB1 A;  2JT3 A;  3BOW A;  4FQO A;  1DJH A;  2BCB A;  2NCP A;  3I5H B;  4U8D A;  4ETO A;  5J3X A;  5AAN A;  4MRY A;  2BEC A;  3KO0 A;  2KPH A;  2KYC A;  1RWY A;  5HKZ A;  3C1V A;  2JC2 A;  3R1O A;  2LM5 A;  3QRX A;  2BE6 A;  3O4Y A;  3SG2 A;  3SS4 A;  3OX5 A;  5FI2 A;  4MSP A;  2WND A;  3BYA A;  2AUC A;  3OBV A;  3PN7 C;  2P71 A;  1KQV A;  2JNX A;  3B86 A;  1S6C A;  3NHI A;  1CMF A;  4OZD A;  3AKA A;  3RLZ A;  3V2L A;  3JVT C;  4MZK A;  3CGA A;  4N5X A;  3TDU A;  2WC5 A;  2YGU A;  3B88 A;  3LK0 A;  5FI6 A;  2WCF A;  3DVK A;  1KK8 C;  1BOC A;  2MA2 A;  3CR4 X;  1IIO A;  1L2O B;  3FWB A;  2CT9 A;  1GJY A;  2QDI A;  4PCW A;  1K90 D;  2LAN A;  2FJU B;  2JXC A;  5EL2 A;  1TN4 A;  3PM8 A;  1OE9 B;  3L4L A;  4YGA A;  1NCZ A;  1KQM B;  1WY9 A;  2OS8 C;  3E3R A;  2QEV A;  1TNX A;  1Y1U A;  2QPT A;  2BCA A;  1TNP A;  1JUO A;  2FOT A;  2OTG B;  2EC6 C;  2L2C A;  2L98 A;  1CNP A;  2PSR A;  4MZJ A;  1BG1 A;  1QIW A;  2SAS A;  4INX A;  3R1V A;  4ZCV A;  1ALW A;  3L47 A;  2Y5I A;  5HLV A;  3TS5 C;  1U5I B;  5K89 A;  3I5F C;  4GAO A;  2WCK A;  1DMO A;  5CSF A;  3RM1 A;  1W7I B;  2I94 A;  3CR2 A;  1RTP 1;  2I7A A;  4MVF A;  4P5O E;  2IS9 A;  4PE0 A;  1QX2 A;  3D73 A;  4WQ3 A;  4NQG A;  1ALV A;  4INW A;  4IL1 A;  2PVB A;  2M8U A;  3EVV A;  1UHH A;  2M9G A;  4GUK A;  2MRD A;  3WXA A;  3DF0 A;  1ZFS A;  1F71 A;  3PSR A;  2BKI B;  1JFJ A;  1SR6 C;  2ZFD A;  1OZS A;  3CTN A;  2JU0 A;  4OKH A;  1EH2 A;  1C3Y A;  3BFB A;  3IVT A;  1F8H A;  5HYD A;  2Y4Q A;  1S3P A;  1UP5 A;  1NX1 A;  1Y6W A;  2PQL A;  2ZN9 A;  3H4S E;  4CID A;  1SMG A;  1KFX L;  1A29 A;  2WCL A;  3SG5 A;  3KF9 A;  1NCY A;  1XFU O;  1KK8 B;  4OCI A; 
#chains in the Genus database with same CATH homology
 3SG3 A;  3VRN A;  4DUQ A;  1XFX O;  2KAX A;  2K2A A;  1IWQ A;  2LCP A;  4A4B A;  1CLM A;  4GFT A;  4I5L B;  3EKH A;  1QAT A;  1BMO A;  2LUX A;  3K21 A;  2KQY A;  1G8I A;  1LVC D;  1K9U A;  1OMR A;  2MLF C;  1J1E A;  3TUY B;  1NYA A;  1DGV A;  1OMV A;  5D7F A;  1REC A;  1S26 D;  3OB1 B;  1XFW O;  2LVV A;  4I5N B;  4PE7 A;  3CLN A;  1J1D A;  2HQW A;  3AAK A;  4PHM A;  5DKR A;  3TS5 B;  1DJX A;  3I5F B;  5I8N A;  1NUB A;  1YX7 A;  2HF5 A;  2LP3 A;  3D10 A;  1B9A A;  1JFK A;  1TIZ A;  4PHJ A;  1ZAC A;  3LL8 B;  1HQV A;  1YX8 A;  4ORB B;  2BKH B;  3BUW B;  1PVA A;  3NSO A;  5CSJ A;  1BJF A;  4PE4 A;  1MF8 B;  2WC8 A;  1SR6 B;  1UHN A;  4M2Q A;  4YI9 A;  1SNL A;  3A4U B;  1CKK A;  1IG5 A;  1DF0 A;  1WRK A;  1SL9 A;  1PVB A;  1F4Q A;  1KQM C;  3BUO B;  5I2Q A;  1QVI Z;  1SW8 A;  4GBA A;  2NCO A;  2H61 A;  1S6I A;  1AVS A;  3CS1 A;  1K9P A;  4D1E A;  1AP4 A;  1MR8 A;  4C0J A;  1DJZ A;  2MAZ A;  4I5K A;  1YUU A;  1RJV A;  1NX0 A;  2CCM A;  1SKT A;  1TNQ A;  2NZ0 A;  1SY9 A;  1EL4 A;  1GQM A;  2P6B B;  3WHT B;  2LVJ A;  1QX5 B;  2K7B A;  1DT7 B;  2L4I A;  1A2X A;  1JSA A;  4YRU A;  2G9B A;  1SCM B;  1LXF C;  2KQ6 A;  4C0L A;  1B8L A;  4N1F A;  1XFV O;  3GK2 A;  4M2O A;  2RGI A;  3TDI A;  1DTL A;  3KHE A;  1A03 A;  3VGO A;  1FF1 A;  1N2D A;  5FYX A;  1K9K A;  4MEW A;  1D1O A;  2LE9 B;  3HCM A;  3DF0 B;  1J7Q A;  2F3Y A;  3JTD B;  4JQ0 D;  2ZRS A;  2BE4 A;  5CSN A;  4E68 A;  2JTZ A;  3EK7 A;  1DJY A;  3GOF A;  2L0P A;  3IQQ A;  3DVM A;  3PAT A;  3SG6 A;  1AJ4 A;  2H61 C;  2CXJ A;  2NLN A;  2CNP A;  2LVI A;  1JC2 A;  4ICB A;  2BL0 B;  1CFF A;  1CDL A;  3EK8 A;  1OSA A;  2E6W A;  4PE1 A;  4A4C A;  1LA3 A;  2K2F A;  2LP2 A;  1YRU B;  1CLB A;  2DOQ A;  3VRR A;  3BXK A;  3O2P A;  1NPQ A;  5B8I B;  1HT9 A;  4ORA B;  2WOR A;  3TUY C;  1YR5 A;  4MLW A;  1F55 A;  1CM4 A;  3TDZ A;  3KEV A;  3O78 A;  2JUL A;  1KK7 Z;  3M0W A;  2Q91 A;  1C07 A;  5CPV A;  2KGR A;  1KK7 Y;  2F33 A;  2M1U A;  2KYF A;  1XO5 A;  2HPS A;  1TOP A;  2L5X B;  1C7W A;  4GGF A;  2G2B A;  1IGV A;  4XJK B;  1H4B A;  4NDD A;  1YUT A;  1S5G Z;  2M3W A;  1GGW A;  3SG4 A;  3GK4 X;  1SYM A;  5AXI A;  1G33 A;  2D8N A;  2EGD A;  2K8M B;  1WDC B;  3DVJ A;  2E30 A;  1BR1 B;  3VRO A;  2COL B;  2KNE A;  1K94 A;  1QS7 A;  2LLU A;  1GGZ A;  1M45 A;  2WOS A;  2LV7 A;  1LKJ A;  2PAL A;  2PMY A;  1KSO A;  2KSP A;  3PAL A;  1QV0 A;  1IQ3 A;  4YGD B;  4QJ4 B;  3OB2 B;  4GGN A;  2JRF A;  2AMI A;  4NDB A;  1DF0 B;  1MUX A;  1F70 A;  4GNK B;  2KFF A;  2M1K B;  2M7N A;  1FI5 A;  2PRU A;  3GK1 A;  4CFR A;  1NWD A;  1CB1 A;  2HQ8 A;  1UHI A;  2LUC A;  3SIB A;  2KBM A;  1MXE A;  1K93 D;  2JPT A;  3TZ1 A;  4BY4 A;  3F45 A;  4YI8 A;  1AHR A;  2ZRT A;  5HLO A;  3SJS A;  1MHO A;  1XYD A;  5HKY A;  3AAJ A;  1F54 A;  4R1E A;  1M31 A;  3I5G B;  4GGF C;  4DIR A;  3I5I B;  1SCM C;  1NP8 A;  2A4J A;  3CR5 X;  1EXR A;  3FWC A;  3PLF B;  4OR9 B;  1QLK A;  5HKW A;  1XFZ O;  1WRL A;  1SCV A;  2WCE A;  1Y0V H;  4XJK A;  2LMU A;  1QXP A;  5DKN A;  2K7D A;  2WCB A;  3JTD C;  1S36 A;  2JQ6 A;  2KI6 C;  1H8B A;  4QJ3 B;  2GV5 A;  1IJ5 A;  1B8R A;  2FCD A;  1K95 A;  1NCX A;  2Y1M A;  4OVN F;  2BBM A;  4BY5 A;  2BBN A;  2M0R A;  2BL0 C;  1WLZ A;  1J7R A;  2JT0 A;  2MBX A;  2QAC A;  1F4O A;  2KI4 B;  4CPV A;  5PAL A;  1Q80 A;  4XYN A;  1YVH A;  1CTR A;  4PAL A;  1W7J B;  2LHL A;  3KPX A;  5AER A;  1TRF A;  4M2P A;  2JXL A;  1QAS A;  2JZI A;  1QVI Y;  3IF7 A;  2LLS A;  1BOD A;  4ZCU A;  2F3Z A;  1BLQ A;  5JJG A;  1OOJ A;  3D0Y B;  4MN0 A;  3CZT X;  1RRO A;  4AQJ A;  1TNW A;  5TNC A;  1B1G A;  4HRG A;  1M63 B;  1E8A A;  1UUR A;  3OHM B;  4FTG A;  2K7C A;  2F8P A;  1S6J A;  1C7V A;  1IKU A;  2LAP A;  1TTX A;  1A75 A;  2M7L A;  4PHN A;  3FS7 A;  3VRP A;  1QTX A;  2LC5 A;  1KFU L;  5GQQ C;  4L9M A;  1YVL A;  1WDC C;  2MJW B;  2F2P A;  1K96 A;  1IQ5 A;  1FBV A;  1S1E A;  1CDN A;  2LNK A;  3BUX B;  2JT8 A;  4F0Z B;  5AEQ A;  5ER4 X;  4UPG A;  2KFG A;  1YUR A;  1BT6 A;  1FI6 A;  1BU3 A;  1UHJ A;  2F2O A;  2I2R E;  1J7O A;  2GGZ A;  1UUS A;  3PFV A;  4AOM A;  4Q04 A;  3NSI A;  1J7P A;  1SL7 A;  1CDP A;  1QJT A;  2OPO A;  3FIA A;  1M39 A;  1FW4 A;  2JWW A;  4GPL B;  1EG3 A;  5JOL A;  3EKJ A;  1CFD A;  3ZNI A;  4JWQ A;  1PRW A;  2HET A;  3D0Y A;  3I5G C;  1OQP A;  2L2E A;  1PK0 D;  5AFP A;  2M49 B;  3DVE A;  2LMT A;  3I5I C;  4OV2 A;  4YGC B;  1QLS A;  2CBL A;  2ZKM X;  1KWO C;  4DCK A;  1B4C A;  1DJI A;  2K7O A;  2JOJ A;  4AQI A;  1PUL A;  1PAL A;  2LHI A;  1V1F A;  1SK6 D;  2O5G A;  1KFU S;  2L4H A;  1EG4 A;  2LVK A;  4MZL A;  5CSI A;  4CLN A;  1DGU A;  1PSR A;  2KI6 D;  2K61 A;  2SCP A;  3HX4 A;  4YGE B;  1LA0 A;  1S5G Y;  1DJG A;  2KBI A;  2K0J A;  1UWO A;  4YGB B;  4USL A;  2L50 A;  2KAY A;  5D69 A;  1CMG A;  1RK9 A;  1SRA A;  1YTZ C;  1BR4 B;  2EHB A;  2L51 A;  2MHH A;  1SL8 A;  1MWN A;  2KI4 C;  3LK1 A;  1JWD A;  1JF2 A;  1FPW A;  1Y1A A;  1B47 A;  3LLE A;  1CFP A;  3BQ3 A;  1QIV A;  4ORC B;  1TCF A;  3BUM B;  1DVI A;  1B7T Z;  5I2L A;  1K8U A;  3LCP C;  1YRT B;  2NXQ A;  1B7T Y;  1CM1 A;  2LMV A;  3OX6 A;  2ISD A;  4DS7 A;  2MLE C;  4HSZ A;  5ER5 A;  3WNX B;  1MQ1 A;  1EJ3 A;  4MRX A;  3NXA A;  1PSB A;  1ZUZ A;  1M46 A;  2GGM A;  1R2U A;  2KFH A;  3NSL A;  1ODB A;  3PN7 B;  3ICB A;  1BF5 A;  3JVT B;  2FCE A;  4CFQ A;  2R2I A;  1A75 B;  5DKQ A;  1XK4 A;  1KWO B;  1R6P A;  2AAO A;  2KHN A;  2ZND A;  1V1G A;  3VRQ A;  2KOT A;  5F6T A;  1WLM A;  2VRG A;  1NSH A;  2Q4U A;  1X02 A;  2ZN8 A;  1MXL C;  3EVU A;  5I2O A;  1QX7 A;  3CWG A;  4C0K A;  2OS8 B;  5KU1 A;  3NSK A;  1ZOT B;  2CTN A;  2KAV A;  1AUI B;  5G08 A;  1NX3 A;  4WRI A;  1WRZ A;  3I5H C;  4I5J A;  2EC6 B;  2ZNE A;  1U5I A;  3BOW B;  1JBA A;  1AJ5 A;  1NX2 A;  1G4Y R;  1YUS A;  2TN4 A;  1SPY A;  2JTT A;  1N65 A;  5KSZ A;  1B8C A;  3AKB A;  5BPJ A;  3DD4 A;  1QV1 A;  1JF0 A;  1XFY O;  2KGB C;  1DJW A;  3OP0 A;  1J55 A;  3IQO A;  4JPZ B;  1AK8 A;  1K2H A;  1OZO A;  1XA5 A;  2V53 A;  1L7Z A;  3MSE B;  2BCX A;  4TNC A;  1RFJ A;  3O6B A;  4PHK A;  1XK4 C;  1L2O C;  2KDH A;  2H2K A;  2B1U A;  3WHU B;  3ZWH A;  3SIA A;  4HRH A;  2O60 A;  1KFX S;  1VRK A;  1Y1X A;  3EVR A;  4WQ2 A;  4QJ5 B;  1CLL A;  1A4P A;  1CDM A;  2I18 A;  2M29 A;  5KTY A;  2Y1N A;  4P2Y B;  1IJ6 A;  3A8R A;  1CFC A;  1LIN A;  2LLT A;  4NDC A;  4HRE E;  1OMD A;  2OTG C;  4MBE A;  4DRW A;  1ZMZ A;  4N1G A;  1KCY A;  2PAS A;  1UHK A;  2M97 A;  1XVJ A;  1N0Y A;  1IH0 A;  3EK4 A;  2JNF A;  1NIW A;  1TCO B;  4PDZ A;  1IRJ A;  4YBH B;  3SG7 A;  5IBW A;  1KSM A;  3BUN B;  1SBJ A;  2JT3 A;  3BOW A;  4FQO A;  1DJH A;  2BCB A;  2NCP A;  3I5H B;  4U8D A;  4ETO A;  5J3X A;  5AAN A;  4MRY A;  2BEC A;  3KO0 A;  2KYC A;  1RWY A;  5HKZ A;  3C1V A;  2JC2 A;  2LM5 A;  3QRX A;  2BE6 A;  3O4Y A;  3SG2 A;  3OX5 A;  4MSP A;  2WND A;  3BYA A;  2AUC A;  3PN7 C;  1KQV A;  2JNX A;  1CMF A;  1S6C A;  3AKA A;  3RLZ A;  3JVT C;  4MZK A;  3CGA A;  4N5X A;  3TDU A;  3LK0 A;  2WCF A;  3DVK A;  1KK8 C;  1BOC A;  2MA2 A;  3CR4 X;  1L2O B;  3FWB A;  2CT9 A;  1GJY A;  4PCW A;  1K90 D;  2LAN A;  2FJU B;  2JXC A;  1TN4 A;  3PM8 A;  1OE9 B;  4YGA A;  1NCZ A;  1KQM B;  1WY9 A;  2OS8 C;  3E3R A;  1TNX A;  1Y1U A;  2QPT A;  2BCA A;  1TNP A;  1JUO A;  2FOT A;  2OTG B;  2EC6 C;  2L98 A;  1CNP A;  2PSR A;  4MZJ A;  1BG1 A;  1QIW A;  2SAS A;  4ZCV A;  5HLV A;  1ALW A;  2Y5I A;  3TS5 C;  1U5I B;  5K89 A;  3I5F C;  4GAO A;  1DMO A;  5CSF A;  3RM1 A;  1W7I B;  2I94 A;  3CR2 A;  1RTP 1;  2I7A A;  4MVF A;  4P5O E;  2IS9 A;  4PE0 A;  1QX2 A;  4WQ3 A;  4NQG A;  1ALV A;  4IL1 A;  2PVB A;  2M8U A;  3EVV A;  1UHH A;  2M9G A;  4GUK A;  2MRD A;  3WXA A;  3DF0 A;  1ZFS A;  1F71 A;  3PSR A;  2BKI B;  1JFJ A;  1SR6 C;  2ZFD A;  1OZS A;  3CTN A;  2JU0 A;  4OKH A;  1EH2 A;  1F8H A;  5HYD A;  2Y4Q A;  1S3P A;  1UP5 A;  1NX1 A;  1Y6W A;  2ZN9 A;  3H4S E;  4CID A;  1SMG A;  1KFX L;  1A29 A;  3SG5 A;  3KF9 A;  1NCY A;  1XFU O;  1KK8 B;  4OCI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...