2PVBA

Pike parvalbumin (pi 4.10) at low temperature (100k) and atomic resolution (0.91 a).
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
107
structure length
107
Chain Sequence
SFAGLKDADVAAALAACSAADSFKHKEFFAKVGLASKSLDDVKKAFYVIDQDKSGFIEEDELKLFLQNFSPSARALTDAETKAFLADGDKDGDGMIGVDEFAAMIKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the EF-hand parvalbumin at atomic resolution (0.91 A) and at low temperature (100 K). Evidence for conformational multistates within the hydrophobic core.
pubmed rcsb
molecule tags Metal binding protein
molecule keywords PROTEIN (PARVALBUMIN)
total genus 40
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 1998-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2pvbA00
1CFPA 4JQ0D 2JQ6A 1DF0B 1Y1XA 2MA2A 2ZFDA 4PE0A 1SL7A 3O6BA 3RLZA 3TS5B 2WNDA 3LK1A 2RGIA 1MHOA 1DJHA 1SCMB 1K9UA 1XO5A 3LL8B 1RJVA 2ZNEA 4N5XA 2PRUA 4MZJA 2L5XB 3BXKA 4HSZA 2BCAA 3PM8A 1QX2A 2QPTA 5CSFA 1SR6B 2F2PA 3OX5A 4FTGA 3DF0B 1MUXA 2JXCA 1RK9A 1YX8A 4JPZB 5PALA 3E3RA 4MRXA 2EGDA 1MXEA 2WCBA 1A4PA 1KFXL 2KI6C 3I5IB 3KO0A 4BY5A 1S1EA 4OCIA 2ZNDA 3BUNB 4Q04A 4YI9A 1X02A 2O60A 2JTTA 2CCMA 2HF5A 1RFJA 1PRWA 5DKRA 5D7FA 4GBAA 1SNLA 2Q91A 1YRUB 3EKJA 3OHMB 1CLMA 2M97A 2WOSA 3VRNA 1C7WA 2JZIA 3I5HC 1F8HA 1RROA 2M7NA 3KHEA 3SG3A 1CMFA 2NZ0A 1F70A 3I5GC 1SL9A 1TN4A 1UUSA 4C0LA 2LC5A 1B9AA 1PVBA 1SW8A 3BUXB 1DJYA 2B1UA 4ETOA 1Y1AA 1BJFA 1EG4A 2LUXA 3BUOB 4DRWA 3A4UB 3SG7A 1IJ6A 4P2YB 4R1EA 3NSIA 3OX6A 2M7LA 1G8IA 2KDHA 2LCPA 1CDMA 1IQ5A 5CSJA 1QV1A 1BR4B 1ZOTB 1QX7A 5I2LA 1ZACA 5AERA 1B1GA 3BOWA 2H61A 2MHHA 4JWQA 1CFCA 1CKKA 2WORA 4CPVA 1JFJA 2FCDA 5DKNA 5KU1A 1YVHA 2ISDA 2F3ZA 3SG5A 1JWDA 3WHUB 4USLA 2MLFC 2QACA 1S26D 3OB1B 1PSBA 3K21A 3KF9A 2WCFA 3PATA 3PFVA 5HKWA 3RM1A 2BL0B 1OMVA 1S3PA 1TRFA 1A75A 1OQPA 2JT3A 2KQ6A 3EK7A 3I5IC 3TDUA 1UHJA 3TDZA 1OZOA 4AQJA 1YRTB 4HRGA 1SYMA 1QXPA 1UHHA 2L51A 1KK7Y 1WRKA 1MWNA 2CXJA 1WDCB 2WC8A 2LMVA 1AP4A 2KQYA 1SRAA 1J55A 1KK8C 3BUMB 2G9BA 1LA3A 5I8NA 1SKTA 1RWYA 5ER4X 3ZNIA 5HKZA 1A03A 1QLKA 1CDNA 1M39A 3ICBA 1SY9A 3NSKA 1KSOA 1NUBA 4CIDA 2KFGA 2K7DA 2OTGB 1OMRA 1PVAA 1NIWA 1K94A 4M2PA 2SCPA 1CMGA 1J7PA 3KPXA 1S5GZ 5KTYA 2ZRSA 4PDZA 1XK4A 1ZUZA 1BR1B 2P6BB 3VRRA 1JSAA 2I7AA 1SL8A 5CSIA 2JU0A 3O78A 1NX2A 2NCPA 1TNWA 4DIRA 5HLOA 1B8LA 1SCVA 3DF0A 3IF7A 4MSPA 1TNPA 3GOFA 3GK2A 2K0JA 1KWOB 3SG4A 1K96A 3CR5X 1SCMC 1S36A 1WY9A 4GGNA 1FI5A 3CLNA 1XK4C 3CTNA 2L4IA 3NSOA 3OP0A 4I5JA 2A4JA 1NP8A 1A2XA 2KI4B 1B47A 3NSLA 3CS1A 1K93D 2PSRA 1E8AA 1JC2A 3H4SE 2LVJA 3BOWB 2CTNA 2KGBC 1C07A 5TNCA 1FPWA 1AVSA 2PVBA 3AAJA 2D8NA 3CGAA 1IRJA 2LANA 1JUOA 1L2OB 3VRQA 2MLEC 2MJWB 1V1FA 1SR6C 4QJ4B 2H2KA 1L2OC 3AKAA 2BECA 2VRGA 2ZRTA 4GPLB 1KFXS 4MZLA 3D0YB 5D69A 2BCBA 1QTXA 1UWOA 1H4BA 4CFQA 1JFKA 1YUUA 4WRIA 2M49B 1D1OA 1A29A 1YTZC 1IJ5A 2OPOA 3AKBA 1KWOC 2LMTA 2KHNA 4QJ3B 1K9KA 2M1KB 1QIVA 2GGZA 4C0KA 4PCWA 1OE9B 2KYCA 1GGWA 2CT9A 2EHBA 4A4CA 1DJZA 2BE4A 4IL1A 3FS7A 4YGCB 1YVLA 1UHIA 2JWWA 1EJ3A 1QX5B 1B4CA 1NCXA 1QV0A 1B7TZ 2KGRA 1CB1A 1LXFC 2R2IA 3DVJA 1NX3A 2FCEA 1ZMZA 1G33A 1W7IB 4DS7A 3GK1A 4GFTA 4YRUA 4CLNA 4U8DA 3I5FB 2AAOA 1AK8A 1K2HA 1B8RA 2KOTA 2KFHA 4I5NB 4YGEB 1FW4A 2KSPA 4OV2A 1G4YR 4MN0A 4I5KA 1UHNA 1JBAA 2OS8B 4AQIA 3O4YA 5I2QA 3FWCA 1CM1A 2JT8A 1XFYO 2LLSA 2G2BA 2Y1NA 1LKJA 1SBJA 1QVIY 2H61C 2ZKMX 1CNPA 3EVRA 1B7TY 4ICBA 3BYAA 5FYXA 5AFPA 3VGOA 3SIAA 1BLQA 1J1DA 1S6JA 1SPYA 1KQVA 2COLB 2LVVA 1M63B 5AEQA 1LVCD 1J7RA 5CPVA 3QRXA 4PE7A 3TUYC 2KNEA 4PALA 3TZ1A 1N0YA 1DJGA 3O2PA 1EXRA 3JVTB 1WLZA 1FBVA 1Q80A 3DD4A 3C1VA 1XA5A 2FJUB 2LAPA 1RTP1 3SG6A 1AHRA 4PHJA 3SIBA 1DF0A 2BKHB 1KCYA 1GJYA 4N1GA 4ZCVA 3D0YA 2K61A 1YUSA 1PALA 1KK7Z 2SASA 4M2QA 2HETA 4PHMA 2LE9B 2L0PA 2M29A 1A75B 4MBEA 2F3YA 1W7JB 1DJIA 1TTXA 3F45A 1TNQA 1YR5A 2BBMA 2KAYA 4MZKA 2LHIA 4I5LB 3PN7B 2HQ8A 1NX0A 3WNXB 3GK4X 3IQQA 3KEVA 5HYDA 1UHKA 3ZWHA 3JVTC 4MVFA 2PMYA 3PSRA 4GUKA 4NQGA 3TUYB 4E68A 1NPQA 4GGFC 1M31A 3EKHA 3LK0A 1EG3A 3OB2B 2K7CA 1QS7A 4YGAA 3I5FC 4XJKA 4PE1A 3BQ3A 4P5OE 3TS5C 2K2AA 1DT7B 2F2OA 1FI6A 1HT9A 1K95A 4GNKB 1DMOA 4NDCA 2KYFA 2LV7A 1IKUA 4DCKA 1C7VA 2JULA 1NCZA 3DVEA 1IG5A 3JTDB 2LM5A 1BG1A 4XJKB 1BF5A 1TCOB 2EC6B 3IQOA 1H8BA 1XYDA 2KBMA 2I18A 2LLTA 3LCPC 2FOTA 1F71A 2BBNA 1AUIB 2I2RE 1RECA 4F0ZB 1R6PA 1DJXA 1JF2A 2JOJA 1VRKA 3CZTX 1GGZA 5AANA 1ALVA 1MQ1A 1AJ5A 4CFRA 4YBHB 1YUTA 1FF1A 2L4HA 2CBLA 1QASA 2BCXA 1CLLA 1DVIA 2LVIA 1NSHA 2Y1MA 1QJTA 1UP5A 1YX7A 4MRYA 2Y4QA 2BE6A 2TN4A 2MBXA 3EVVA 1K8UA 2LUCA 4GGFA 1OSAA 1JF0A 1NWDA 3I5GB 2L98A 1L7ZA 3WHTB 1PSRA 1V1GA 4OR9B 1QLSA 2L2EA 2K7OA 2M8UA 4A4BA 1IQ3A 2OTGC 2E30A 3FIAA 3HCMA 5B8IB 2KBIA 2CNPA 1LA0A 3MSEB 5F6TA 3HX4A 1BT6A 3CR4X 1PULA 4NDDA 4YGDB 2Q4UA 1F55A 1KFUS 2LNKA 2LLUA 1F54A 1CM4A 4ORAB 1SMGA 4WQ3A 1PK0D 4HRHA 1XFZO 5IBWA 2AUCA 1ZFSA 2LP2A 4C0JA 1XFVO 4PHKA 1WDCC 4QJ5B 2V53A 5KSZA 3EK8A 2KI6D 2M0RA 1TCFA 4NDBA 1TIZA 2LVKA 3VRPA 3PALA 2ZN8A 3SG2A 1DTLA 3JTDC 2OS8C 2AMIA 4M2OA 2MRDA 4XYNA 2JNXA 3DVMA 2HPSA 5K89A 5GQQC 1J7OA 2JPTA 4MLWA 1J1EA 1KSMA 1ALWA 1K9PA 1UURA 2IS9A 2JT0A 5I2OA 2M1UA 1HQVA 5ER5A 1NCYA 4L9MA 1OMDA 1YURA 1BOCA 1S6CA 2ZN9A 2M9GA 3M0WA 1CFDA 4TNCA 1WRLA 1QVIZ 4ZCUA 1N65A 1M46A 1KK8B 1M45A 2LMUA 2PASA 1BMOA 3PLFB 4DUQA 1WRZA 2NXQA 4PE4A 2KFFA 2JC2A 3I5HB 1CTRA 2L50A 1XFXO 2Y5IA 1CDLA 4HREE 2MAZA 1OOJA 1OZSA 1DGVA 4OKHA 1ODBA 4AOMA 1K90D 1AJ4A 2NCOA 2JXLA 2KAVA 2KI4C 1LINA 1EL4A 5J3XA 3A8RA 1KQMB 2BKIB 2F8PA 1MR8A 5DKQA 1GQMA 1QIWA 1SK6D 3FWBA 1CLBA 1MF8B 2BL0C 4UPGA 1S6IA 1NX1A 3AAKA 4OVNF 3CWGA 4FQOA 1N2DA 4D1EA 1CFFA 1EH2A 4WQ2A 1IWQA 2JRFA 1IGVA 1S5GY 2I94A 3EK4A 4GAOA 4MEWA 5CSNA 1U5IB 4PHNA 2HQWA 1R2UA 3LLEA 2GGMA 3PN7C 2WCEA 3CR2A 4N1FA 1Y6WA 5G08A 2LHLA 4ORCB 4BY4A 1KFUL 1NYAA 4ORBB 1DGUA 1XFWO 3EVUA 2K2FA 5JJGA 2O5GA 2E6WA 3BUWB 5HLVA 3D10A 5AXIA 2K7BA 1CDPA 1U5IA 2NLNA 4YI8A 1DJWA 1MXLC 2K8MB 1QATA 2GV5A 2JTZA 1XFUO 3VROA 5BPJA 1KQMC 1J7QA 5JOLA 1WLMA 4YGBB 1XVJA 2F33A 3NXAA 1B8CA 2LP3A 2DOQA 2PALA 3TDIA 1F4QA 3WXAA 1F4OA 1TNXA 2M3WA 1Y1UA 1BU3A 3DVKA 3SJSA 2EC6C 1IH0A 1BODA 5HKYA 2JNFA 2KAXA 1Y0VH 1TOPA
chains in the Genus database with same CATH superfamily
1CFPA 4JQ0D 2JQ6A 1DF0B 1Y1XA 2MA2A 2ZFDA 4PE0A 1SL7A 3O6BA 3RLZA 3TS5B 2PYQA 2WNDA 3LK1A 2RGIA 3SS3A 3DXLA 1MHOA 1SSEB 3FE6A 1DJHA 1SCMB 1K9UA 1XO5A 3LL8B 1RJVA 2ZNEA 4N5XA 2PRUA 3B88A 4PT1A 4MZJA 2L5XB 3BXKA 2K60A 4HSZA 2BCAA 3PM8A 1QX2A 3CZ2A 2QPTA 5CSFA 1SR6B 2F2PA 3OX5A 4FTGA 3DF0B 1MUXA 2JXCA 2QEHA 1RK9A 1YX8A 4JPZB 5PALA 3E3RA 4MRXA 2EGDA 1MXEA 2WCBA 1A4PA 1KFXL 2KI6C 3I5IB 3KO0A 3R1PA 4BY5A 1S1EA 4OCIA 2ZNDA 3BUNB 4Q04A 4YI9A 1X02A 2O60A 2JTTA 3NHTA 2CCMA 2HF5A 1OOHA 1RFJA 5DICA 1PRWA 5DKRA 5D7FA 4GBAA 1SNLA 2Q91A 1YRUB 3EKJA 3OHMB 1CLMA 2M97A 2WOSA 3VRNA 1C7WA 2JZIA 3I5HC 1F8HA 1RROA 2M7NA 3KHEA 3SG3A 1CMFA 2NZ0A 1F70A 3I5GC 1SL9A 1TN4A 1W9ZA 3V2LA 1UUSA 4C0LA 2LC5A 1B9AA 1PVBA 1SW8A 3BUXB 1DJYA 2B1UA 4ETOA 2WC6A 1Y1AA 1BJFA 1OOIX 1EG4A 2LUXA 3BUOB 4DRWA 3FE9A 3A4UB 3SG7A 1IJ6A 2YGUA 4P2YB 4R1EA 3NSIA 3OX6A 2M7LA 1G8IA 2KDHA 2LCPA 3B7AA 3Q8IA 1CDMA 1IQ5A 5CSJA 1C3ZA 1QV1A 1BR4B 1ZOTB 1QX7A 5I2LA 1ZACA 5AERA 1B1GA 1OOGA 3BOWA 2H61A 3UO9A 2MHHA 4JWQA 1CFCA 1CKKA 3BFAA 2WORA 4CPVA 1JFJA 2FCDA 5DKNA 5KU1A 1YVHA 3B86A 2ISDA 2F3ZA 3SG5A 1JWDA 3WHUB 4USLA 2MLFC 2QACA 1S26D 3OB1B 2PQLA 1DELA 1PSBA 2KLEA 3K21A 3KF9A 2WCJA 2H8VA 3S0FA 2WCFA 3PATA 3PFVA 5HKWA 3RM1A 2BL0B 1OMVA 1S3PA 1TRFA 1A75A 1OQPA 2JT3A 2KQ6A 3EK7A 3I5IC 3TDUA 1UHJA 3TDZA 1TUJA 1Z2CB 1OZOA 4AQJA 1YRTB 4HRGA 1SYMA 5HL1A 3B87A 1QXPA 1UHHA 2L51A 1KK7Y 1WRKA 1MWNA 2CXJA 1WDCB 2WC8A 2LMVA 1AP4A 2KQYA 3CDNA 1SRAA 1J55A 3SS4A 1KK8C 3BUMB 2G9BA 1LA3A 5I8NA 1SKTA 1RWYA 5ER4X 3ZNIA 5HKZA 3S0AA 1A03A 1T14A 1QLKA 1CDNA 1M39A 3ICBA 1SY9A 3NSKA 1KSOA 1NUBA 3FE8A 4CIDA 2KFGA 2K7DA 2OTGB 1OMRA 1PVAA 1NIWA 1K94A 3L4LA 4M2PA 2SCPA 1CMGA 1J7PA 4INWA 3KPXA 1S5GZ 5KTYA 2ZRSA 4PDZA 1XK4A 1ZUZA 1BR1B 2P6BB 3VRRA 3IVTA 2I7AA 1JSAA 1SL8A 5CSIA 2JU0A 5FI2A 3S0BA 3O78A 1NX2A 2NCPA 1TNWA 4DIRA 5HLOA 1B8LA 1SCVA 3BJHA 3DF0A 3IF7A 1TNPA 3GOFA 4MSPA 3GK2A 2K0JA 2KPHA 1KWOB 3SG4A 1K96A 3CR5X 3DY9A 1SCMC 1S36A 3D73A 1WY9A 4GGNA 1FI5A 3D77A 3CLNA 1XK4C 3CTNA 2L4IA 3NSOA 3OP0A 4I5JA 2A4JA 1NP8A 1A2XA 2KI4B 1B47A 3NSLA 3CS1A 1K93D 2PSRA 1E8AA 1JC2A 3H4SE 2LVJA 3BOWB 2CTNA 2KGBC 1C07A 5TNCA 1FPWA 1AVSA 2PVBA 3AAJA 2D8NA 3CGAA 1IRJA 2LANA 1JUOA 1L2OB 3VRQA 2MLEC 2MJWB 1V1FA 1SR6C 4QJ4B 2H2KA 4INXA 5FI7A 1L2OC 3AKAA 2BECA 2VRGA 2ZRTA 4GPLB 2QEVA 3D76A 1KFXS 4MZLA 3D0YB 5D69A 2BCBA 1QTXA 1UWOA 1H4BA 4CFQA 1JFKA 1YUUA 4WRIA 2L2CA 2M49B 1D1OA 1A29A 3R72A 3O4XA 1YTZC 1IJ5A 2OPOA 3AKBA 1KWOC 2WCKA 2LMTA 2KHNA 4QJ3B 1K9KA 2M1KB 1QIVA 2GGZA 4C0KA 4PCWA 1OE9B 2KYCA 1GGWA 2CT9A 2EHBA 4A4CA 3VB1A 3B6XA 1DJZA 1C3YA 2BE4A 4IL1A 3FS7A 2WCMA 4YGCB 1YVLA 1UHIA 2JWWA 1EJ3A 1QX5B 3L4AA 1NCXA 1QV0A 1B7TZ 2KGRA 1B4CA 1LXFC 1CB1A 2R2IA 3DVJA 1NX3A 2FCEA 1ZMZA 1G33A 3D78A 1W7IB 4DS7A 3GK1A 4GFTA 4YRUA 4CLNA 2P71A 4U8DA 3I5FB 2AAOA 1AK8A 1K2HA 1B8RA 2KOTA 2KFHA 4I5NB 4YGEB 1FW4A 2KSPA 4OV2A 3DZTA 1G4YR 4MN0A 2QEOA 1DC1A 4I5KA 1UHNA 1JBAA 2OS8B 4AQIA 3O4YA 4FQTA 5I2QA 3FWCA 3RZSA 1CM1A 2JT8A 1XFYO 2LLSA 2G2BA 2Y1NA 1LKJA 1SBJA 1QVIY 2H61C 2ZKMX 1CNPA 3EVRA 1B7TY 4ICBA 3BYAA 5FYXA 5AFPA 3VGOA 3SIAA 1BLQA 1J1DA 1S6JA 3CZ0A 1SPYA 1KQVA 2COLB 2LVVA 1M63B 5AEQA 2WCHA 1LVCD 1J7RA 5CPVA 2JPOA 3QRXA 2BNXA 4PE7A 3TUYC 2KNEA 4PALA 3TZ1A 1N0YA 1DJGA 3O2PA 1EXRA 3JVTB 1WLZA 1FBVA 1Q80A 3DD4A 1GM0A 3C1VA 1XA5A 2FJUB 2LAPA 1RTP1 2FJYA 3EG5B 3OBVA 3SG6A 3SS5A 1AHRA 3L47A 3NHIA 4PHJA 3SIBA 1DF0A 2BKHB 1KCYA 1TUZA 1GJYA 4N1GA 4ZCVA 3D0YA 2K61A 1YUSA 1PALA 1KK7Z 2SASA 3S0GA 2QEBA 4JKTA 4M2QA 2HETA 4PHMA 2LE9B 2L0PA 2M29A 1A75B 4MBEA 1W7JB 2F3YA 1DJIA 1TTXA 3F45A 3S0DA 3R1VA 1TNQA 1YR5A 2BBMA 2KAYA 4MZKA 2LHIA 4I5LB 3PN7B 2HQ8A 1NX0A 3WNXB 3D74A 3GK4X 1LS8A 2L5YA 1UHKA 3IQQA 3KEVA 3CYZA 3JVTC 3ZWHA 5HYDA 4MVFA 2PMYA 3PSRA 4GUKA 4NQGA 3TUYB 4E68A 1NPQA 4GGFC 1M31A 3CABA 3EKHA 3LK0A 1EG3A 3OB2B 2K7CA 1QS7A 3K1EA 3I5FC 4XJKA 4YGAA 4PE1A 3BQ3A 4P5OE 3TS5C 2K2AA 1DT7B 5FI6A 2F2OA 1FI6A 1HT9A 1K95A 4GNKB 1DMOA 4NDCA 2KYFA 2LV7A 1IKUA 4DCKA 1C7VA 2JULA 1NCZA 3DVEA 1IG5A 3JTDB 2LM5A 1BG1A 4KYNA 4XJKB 1BF5A 1TCOB 2EC6B 3IQOA 1H8BA 1XYDA 2KBMA 2I18A 2LLTA 3BFHA 3LCPC 2FOTA 1F71A 2BBNA 1AUIB 5D3OA 2I2RE 1RECA 4F0ZB 1R6PA 3S0EA 1DJXA 1JF2A 2JOJA 1VRKA 3CZTX 1GGZA 4IJ7A 5AANA 3NGVA 1ALVA 1MQ1A 3CZ1A 1AJ5A 4CFRA 4YBHB 1YUTA 1OW4A 2L4HA 2CBLA 1FF1A 1QASA 2BCXA 1CLLA 2WC5A 1DVIA 2LVIA 1NSHA 2Y1MA 4F7FA 1QJTA 1UP5A 1YX7A 4MRYA 2Y4QA 2BE6A 2TN4A 1QWVA 2MBXA 3EVVA 1K8UA 2LUCA 4GGFA 1OSAA 1JF0A 1NWDA 2KLDA 1P28A 3I5GB 2L98A 1L7ZA 3WHTB 1PSRA 1V1GA 4OR9B 1QLSA 2L2EA 2K7OA 2M8UA 1TWOA 4A4BA 1IQ3A 2OTGC 2E30A 3FIAA 2BAPA 3HCMA 2KBIA 4JD9A 5B8IB 2CNPA 1LA0A 3MSEB 5F6TA 3HX4A 1BT6A 3CR4X 1PULA 4NDDA 4YGDB 2Q4UA 1F55A 1ORGA 1KFUS 2LNKA 2LLUA 1F54A 1CM4A 4ORAB 1SMGA 4WQ3A 1PK0D 4HRHA 1XFZO 5IBWA 2AUCA 1ZFSA 2LP2A 4C0JA 1XFVO 4PHKA 1WDCC 4QJ5B 2V53A 5KSZA 1DEKA 3EK8A 3R1OA 2KI6D 2M0RA 1TCFA 4NDBA 1TIZA 2LVKA 3VRPA 3PALA 2ZN8A 3SG2A 1DTLA 3JTDC 2OS8C 1Z4HA 2AMIA 2GTEA 2MRDA 4M2OA 2JNXA 2P70A 2HPSA 3DVMA 4XYNA 5GQQC 5K89A 1J7OA 2JPTA 4MLWA 1J1EA 1KSMA 1ALWA 1K9PA 1UURA 2IS9A 2JT0A 5I2OA 3OGNA 2M1UA 1HQVA 5ER5A 1NCYA 4L9MA 1YURA 1OMDA 3D75A 2ERBA 1S6CA 2ZN9A 2M9GA 3M0WA 1CFDA 4TNCA 1BOCA 1WRLA 1QVIZ 4ZCUA 1N65A 1M46A 1KK8B 1M45A 2LMUA 2PASA 1BMOA 3PLFB 4DUQA 3PM2A 1WRZA 2NXQA 4PE4A 2KFFA 2JC2A 3I5HB 1CTRA 2L50A 1XFXO 2WCLA 2Y5IA 1CDLA 4HREE 2MAZA 1OOJA 1OZSA 1DGVA 4OKHA 1ODBA 5EL2A 4AOMA 1K90D 5I94A 1AJ4A 2NCOA 2JXLA 2KAVA 2KI4C 1LINA 1EL4A 5J3XA 3A8RA 1KQMB 2QDIA 2BKIB 2F8PA 1MR8A 5DKQA 1GQMA 1QIWA 1SK6D 3FWBA 1CLBA 1MF8B 2BL0C 4UPGA 3QMEA 1S6IA 1NX1A 3AAKA 4OVNF 3CWGA 4FQOA 1N2DA 4D1EA 1CFFA 1EH2A 4WQ2A 1IWQA 2JRFA 1IGVA 1S5GY 2I94A 3EK4A 4GAOA 4MEWA 4OZDA 5CSNA 3BFBA 1U5IB 4PHNA 2HQWA 1R2UA 3LLEA 2GGMA 3PN7C 2WCEA 3CR2A 4N1FA 1Y6WA 3N7HA 3PJIA 5G08A 2LHLA 4ORCB 4BY4A 1KFUL 1NYAA 1IIOA 4ORBB 1DGUA 1XFWO 3EVUA 2K2FA 5JJGA 2O5GA 2E6WA 3BUWB 5HLVA 3D10A 3UNWA 5AXIA 2K7BA 1CDPA 1U5IA 2NLNA 4YI8A 1DJWA 1MXLC 2K8MB 1QATA 2GV5A 2JTZA 1XFUO 3DYEA 3VROA 5BPJA 1KQMC 1J7QA 5JOLA 1WLMA 1DQEA 4YGBB 1XVJA 2F33A 3NXAA 1B8CA 2LP3A 2DOQA 2PALA 3TDIA 1F4QA 3WXAA 1F4OA 1TNXA 2M3WA 1Y1UA 1BU3A 1OOFA 3DVKA 3SJSA 2EC6C 1IH0A 1BODA 5HKYA 2JNFA 2KAXA 1Y0VH 1TOPA 1XFRA
chains in the Genus database with same CATH topology
1CFPA 4JQ0D 2JQ6A 1DF0B 1Y1XA 2MA2A 2ZFDA 4PE0A 1SL7A 3O6BA 3RLZA 3TS5B 2WNDA 3LK1A 2RGIA 1MHOA 1DJHA 1SCMB 1K9UA 1XO5A 3LL8B 1RJVA 2ZNEA 4N5XA 2PRUA 4MZJA 2L5XB 3BXKA 4HSZA 2BCAA 3PM8A 1QX2A 2QPTA 5CSFA 1SR6B 2F2PA 3OX5A 4FTGA 3DF0B 1MUXA 2JXCA 1RK9A 1YX8A 4JPZB 5PALA 3E3RA 4MRXA 2EGDA 1MXEA 2WCBA 1A4PA 1KFXL 2KI6C 3I5IB 3KO0A 4BY5A 1S1EA 4OCIA 2ZNDA 3BUNB 4Q04A 4YI9A 1X02A 2O60A 2JTTA 2CCMA 2HF5A 1RFJA 1PRWA 5DKRA 5D7FA 4GBAA 1SNLA 2Q91A 1YRUB 3EKJA 3OHMB 1CLMA 2M97A 2WOSA 3VRNA 1C7WA 2JZIA 3I5HC 1F8HA 1RROA 2M7NA 3KHEA 3SG3A 1CMFA 2NZ0A 1F70A 3I5GC 1SL9A 1TN4A 1UUSA 4C0LA 2LC5A 1B9AA 1PVBA 1SW8A 3BUXB 1DJYA 2B1UA 4ETOA 1Y1AA 1BJFA 1EG4A 2LUXA 3BUOB 4DRWA 3A4UB 3SG7A 1IJ6A 4P2YB 4R1EA 3NSIA 3OX6A 2M7LA 1G8IA 2KDHA 2LCPA 1CDMA 1IQ5A 5CSJA 1QV1A 1BR4B 1ZOTB 1QX7A 5I2LA 1ZACA 5AERA 1B1GA 3BOWA 2H61A 2MHHA 4JWQA 1CFCA 1CKKA 2WORA 4CPVA 1JFJA 2FCDA 5DKNA 5KU1A 1YVHA 2ISDA 2F3ZA 3SG5A 1JWDA 3WHUB 4USLA 2MLFC 2QACA 1S26D 3OB1B 1PSBA 3K21A 3KF9A 2WCFA 3PATA 3PFVA 5HKWA 3RM1A 2BL0B 1OMVA 1S3PA 1TRFA 1A75A 1OQPA 2JT3A 2KQ6A 3EK7A 3I5IC 3TDUA 1UHJA 3TDZA 1OZOA 4AQJA 1YRTB 4HRGA 1SYMA 1QXPA 1UHHA 2L51A 1KK7Y 1WRKA 1MWNA 2CXJA 1WDCB 2WC8A 2LMVA 1AP4A 2KQYA 1SRAA 1J55A 1KK8C 3BUMB 2G9BA 1LA3A 5I8NA 1SKTA 1RWYA 5ER4X 3ZNIA 5HKZA 1A03A 1QLKA 1CDNA 1M39A 3ICBA 1SY9A 3NSKA 1KSOA 1NUBA 4CIDA 2KFGA 2K7DA 2OTGB 1OMRA 1PVAA 1NIWA 1K94A 4M2PA 2SCPA 1CMGA 1J7PA 3KPXA 1S5GZ 5KTYA 2ZRSA 4PDZA 1XK4A 1ZUZA 1BR1B 2P6BB 3VRRA 1JSAA 2I7AA 1SL8A 5CSIA 2JU0A 3O78A 1NX2A 2NCPA 1TNWA 4DIRA 5HLOA 1B8LA 1SCVA 3DF0A 3IF7A 4MSPA 1TNPA 3GOFA 3GK2A 2K0JA 1KWOB 3SG4A 1K96A 3CR5X 1SCMC 1S36A 1WY9A 4GGNA 1FI5A 3CLNA 1XK4C 3CTNA 2L4IA 3NSOA 3OP0A 4I5JA 2A4JA 1NP8A 1A2XA 2KI4B 1B47A 3NSLA 3CS1A 1K93D 2PSRA 1E8AA 1JC2A 3H4SE 2LVJA 3BOWB 2CTNA 2KGBC 1C07A 5TNCA 1FPWA 1AVSA 2PVBA 3AAJA 2D8NA 3CGAA 1IRJA 2LANA 1JUOA 1L2OB 3VRQA 2MLEC 2MJWB 1V1FA 1SR6C 4QJ4B 2H2KA 1L2OC 3AKAA 2BECA 2VRGA 2ZRTA 4GPLB 1KFXS 4MZLA 3D0YB 5D69A 2BCBA 1QTXA 1UWOA 1H4BA 4CFQA 1JFKA 1YUUA 4WRIA 2M49B 1D1OA 1A29A 1YTZC 1IJ5A 2OPOA 3AKBA 1KWOC 2LMTA 2KHNA 4QJ3B 1K9KA 2M1KB 1QIVA 2GGZA 4C0KA 4PCWA 1OE9B 2KYCA 1GGWA 2CT9A 2EHBA 4A4CA 1DJZA 2BE4A 4IL1A 3FS7A 4YGCB 1YVLA 1UHIA 2JWWA 1EJ3A 1QX5B 1B4CA 1NCXA 1QV0A 1B7TZ 2KGRA 1CB1A 1LXFC 2R2IA 3DVJA 1NX3A 2FCEA 1ZMZA 1G33A 1W7IB 4DS7A 3GK1A 4GFTA 4YRUA 4CLNA 4U8DA 3I5FB 2AAOA 1AK8A 1K2HA 1B8RA 2KOTA 2KFHA 4I5NB 4YGEB 1FW4A 2KSPA 4OV2A 1G4YR 4MN0A 4I5KA 1UHNA 1JBAA 2OS8B 4AQIA 3O4YA 5I2QA 3FWCA 1CM1A 2JT8A 1XFYO 2LLSA 2G2BA 2Y1NA 1LKJA 1SBJA 1QVIY 2H61C 2ZKMX 1CNPA 3EVRA 1B7TY 4ICBA 3BYAA 5FYXA 5AFPA 3VGOA 3SIAA 1BLQA 1J1DA 1S6JA 1SPYA 1KQVA 2COLB 2LVVA 1M63B 5AEQA 1LVCD 1J7RA 5CPVA 3QRXA 4PE7A 3TUYC 2KNEA 4PALA 3TZ1A 1N0YA 1DJGA 3O2PA 1EXRA 3JVTB 1WLZA 1FBVA 1Q80A 3DD4A 3C1VA 1XA5A 2FJUB 2LAPA 1RTP1 3SG6A 1AHRA 4PHJA 3SIBA 1DF0A 2BKHB 1KCYA 1GJYA 4N1GA 4ZCVA 3D0YA 2K61A 1YUSA 1PALA 1KK7Z 2SASA 4M2QA 2HETA 4PHMA 2LE9B 2L0PA 2M29A 1A75B 4MBEA 2F3YA 1W7JB 1DJIA 1TTXA 3F45A 1TNQA 1YR5A 2BBMA 2KAYA 4MZKA 2LHIA 4I5LB 3PN7B 2HQ8A 1NX0A 3WNXB 3GK4X 3IQQA 3KEVA 5HYDA 1UHKA 3ZWHA 3JVTC 4MVFA 2PMYA 3PSRA 4GUKA 4NQGA 3TUYB 4E68A 1NPQA 4GGFC 1M31A 3EKHA 3LK0A 1EG3A 3OB2B 2K7CA 1QS7A 4YGAA 3I5FC 4XJKA 4PE1A 3BQ3A 4P5OE 3TS5C 2K2AA 1DT7B 2F2OA 1FI6A 1HT9A 1K95A 4GNKB 1DMOA 4NDCA 2KYFA 2LV7A 1IKUA 4DCKA 1C7VA 2JULA 1NCZA 3DVEA 1IG5A 3JTDB 2LM5A 1BG1A 4XJKB 1BF5A 1TCOB 2EC6B 3IQOA 1H8BA 1XYDA 2KBMA 2I18A 2LLTA 3LCPC 2FOTA 1F71A 2BBNA 1AUIB 2I2RE 1RECA 4F0ZB 1R6PA 1DJXA 1JF2A 2JOJA 1VRKA 3CZTX 1GGZA 5AANA 1ALVA 1MQ1A 1AJ5A 4CFRA 4YBHB 1YUTA 1FF1A 2L4HA 2CBLA 1QASA 2BCXA 1CLLA 1DVIA 2LVIA 1NSHA 2Y1MA 1QJTA 1UP5A 1YX7A 4MRYA 2Y4QA 2BE6A 2TN4A 2MBXA 3EVVA 1K8UA 2LUCA 4GGFA 1OSAA 1JF0A 1NWDA 3I5GB 2L98A 1L7ZA 3WHTB 1PSRA 1V1GA 4OR9B 1QLSA 2L2EA 2K7OA 2M8UA 4A4BA 1IQ3A 2OTGC 2E30A 3FIAA 3HCMA 5B8IB 2KBIA 2CNPA 1LA0A 3MSEB 5F6TA 3HX4A 1BT6A 3CR4X 1PULA 4NDDA 4YGDB 2Q4UA 1F55A 1KFUS 2LNKA 2LLUA 1F54A 1CM4A 4ORAB 1SMGA 4WQ3A 1PK0D 4HRHA 1XFZO 5IBWA 2AUCA 1ZFSA 2LP2A 4C0JA 1XFVO 4PHKA 1WDCC 4QJ5B 2V53A 5KSZA 3EK8A 2KI6D 2M0RA 1TCFA 4NDBA 1TIZA 2LVKA 3VRPA 3PALA 2ZN8A 3SG2A 1DTLA 3JTDC 2OS8C 2AMIA 4M2OA 2MRDA 4XYNA 2JNXA 3DVMA 2HPSA 5K89A 5GQQC 1J7OA 2JPTA 4MLWA 1J1EA 1KSMA 1ALWA 1K9PA 1UURA 2IS9A 2JT0A 5I2OA 2M1UA 1HQVA 5ER5A 1NCYA 4L9MA 1OMDA 1YURA 1BOCA 1S6CA 2ZN9A 2M9GA 3M0WA 1CFDA 4TNCA 1WRLA 1QVIZ 4ZCUA 1N65A 1M46A 1KK8B 1M45A 2LMUA 2PASA 1BMOA 3PLFB 4DUQA 1WRZA 2NXQA 4PE4A 2KFFA 2JC2A 3I5HB 1CTRA 2L50A 1XFXO 2Y5IA 1CDLA 4HREE 2MAZA 1OOJA 1OZSA 1DGVA 4OKHA 1ODBA 4AOMA 1K90D 1AJ4A 2NCOA 2JXLA 2KAVA 2KI4C 1LINA 1EL4A 5J3XA 3A8RA 1KQMB 2BKIB 2F8PA 1MR8A 5DKQA 1GQMA 1QIWA 1SK6D 3FWBA 1CLBA 1MF8B 2BL0C 4UPGA 1S6IA 1NX1A 3AAKA 4OVNF 3CWGA 4FQOA 1N2DA 4D1EA 1CFFA 1EH2A 4WQ2A 1IWQA 2JRFA 1IGVA 1S5GY 2I94A 3EK4A 4GAOA 4MEWA 5CSNA 1U5IB 4PHNA 2HQWA 1R2UA 3LLEA 2GGMA 3PN7C 2WCEA 3CR2A 4N1FA 1Y6WA 5G08A 2LHLA 4ORCB 4BY4A 1KFUL 1NYAA 4ORBB 1DGUA 1XFWO 3EVUA 2K2FA 5JJGA 2O5GA 2E6WA 3BUWB 5HLVA 3D10A 5AXIA 2K7BA 1CDPA 1U5IA 2NLNA 4YI8A 1DJWA 1MXLC 2K8MB 1QATA 2GV5A 2JTZA 1XFUO 3VROA 5BPJA 1KQMC 1J7QA 5JOLA 1WLMA 4YGBB 1XVJA 2F33A 3NXAA 1B8CA 2LP3A 2DOQA 2PALA 3TDIA 1F4QA 3WXAA 1F4OA 1TNXA 2M3WA 1Y1UA 1BU3A 3DVKA 3SJSA 2EC6C 1IH0A 1BODA 5HKYA 2JNFA 2KAXA 1Y0VH 1TOPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CFP A;  4JQ0 D;  2JQ6 A;  1DF0 B;  1Y1X A;  2MA2 A;  2ZFD A;  4PE0 A;  1SL7 A;  3O6B A;  3RLZ A;  3TS5 B;  2WND A;  3LK1 A;  2RGI A;  1MHO A;  1DJH A;  1SCM B;  1K9U A;  1XO5 A;  3LL8 B;  1RJV A;  2ZNE A;  4N5X A;  2PRU A;  4MZJ A;  2L5X B;  3BXK A;  4HSZ A;  2BCA A;  3PM8 A;  1QX2 A;  2QPT A;  5CSF A;  1SR6 B;  2F2P A;  3OX5 A;  4FTG A;  3DF0 B;  1MUX A;  2JXC A;  1RK9 A;  1YX8 A;  4JPZ B;  5PAL A;  3E3R A;  4MRX A;  2EGD A;  1MXE A;  2WCB A;  1A4P A;  1KFX L;  2KI6 C;  3I5I B;  3KO0 A;  4BY5 A;  1S1E A;  4OCI A;  2ZND A;  3BUN B;  4Q04 A;  4YI9 A;  1X02 A;  2O60 A;  2JTT A;  2CCM A;  2HF5 A;  1RFJ A;  1PRW A;  5DKR A;  5D7F A;  4GBA A;  1SNL A;  2Q91 A;  1YRU B;  3EKJ A;  3OHM B;  1CLM A;  2M97 A;  2WOS A;  3VRN A;  1C7W A;  2JZI A;  3I5H C;  1F8H A;  1RRO A;  2M7N A;  3KHE A;  3SG3 A;  1CMF A;  2NZ0 A;  1F70 A;  3I5G C;  1SL9 A;  1TN4 A;  1UUS A;  4C0L A;  2LC5 A;  1B9A A;  1PVB A;  1SW8 A;  3BUX B;  1DJY A;  2B1U A;  4ETO A;  1Y1A A;  1BJF A;  1EG4 A;  2LUX A;  3BUO B;  4DRW A;  3A4U B;  3SG7 A;  1IJ6 A;  4P2Y B;  4R1E A;  3NSI A;  3OX6 A;  2M7L A;  1G8I A;  2KDH A;  2LCP A;  1CDM A;  1IQ5 A;  5CSJ A;  1QV1 A;  1BR4 B;  1ZOT B;  1QX7 A;  5I2L A;  1ZAC A;  5AER A;  1B1G A;  3BOW A;  2H61 A;  2MHH A;  4JWQ A;  1CFC A;  1CKK A;  2WOR A;  4CPV A;  1JFJ A;  2FCD A;  5DKN A;  5KU1 A;  1YVH A;  2ISD A;  2F3Z A;  3SG5 A;  1JWD A;  3WHU B;  4USL A;  2MLF C;  2QAC A;  1S26 D;  3OB1 B;  1PSB A;  3K21 A;  3KF9 A;  2WCF A;  3PAT A;  3PFV A;  5HKW A;  3RM1 A;  2BL0 B;  1OMV A;  1S3P A;  1TRF A;  1A75 A;  1OQP A;  2JT3 A;  2KQ6 A;  3EK7 A;  3I5I C;  3TDU A;  1UHJ A;  3TDZ A;  1OZO A;  4AQJ A;  1YRT B;  4HRG A;  1SYM A;  1QXP A;  1UHH A;  2L51 A;  1KK7 Y;  1WRK A;  1MWN A;  2CXJ A;  1WDC B;  2WC8 A;  2LMV A;  1AP4 A;  2KQY A;  1SRA A;  1J55 A;  1KK8 C;  3BUM B;  2G9B A;  1LA3 A;  5I8N A;  1SKT A;  1RWY A;  5ER4 X;  3ZNI A;  5HKZ A;  1A03 A;  1QLK A;  1CDN A;  1M39 A;  3ICB A;  1SY9 A;  3NSK A;  1KSO A;  1NUB A;  4CID A;  2KFG A;  2K7D A;  2OTG B;  1OMR A;  1PVA A;  1NIW A;  1K94 A;  4M2P A;  2SCP A;  1CMG A;  1J7P A;  3KPX A;  1S5G Z;  5KTY A;  2ZRS A;  4PDZ A;  1XK4 A;  1ZUZ A;  1BR1 B;  2P6B B;  3VRR A;  1JSA A;  2I7A A;  1SL8 A;  5CSI A;  2JU0 A;  3O78 A;  1NX2 A;  2NCP A;  1TNW A;  4DIR A;  5HLO A;  1B8L A;  1SCV A;  3DF0 A;  3IF7 A;  4MSP A;  1TNP A;  3GOF A;  3GK2 A;  2K0J A;  1KWO B;  3SG4 A;  1K96 A;  3CR5 X;  1SCM C;  1S36 A;  1WY9 A;  4GGN A;  1FI5 A;  3CLN A;  1XK4 C;  3CTN A;  2L4I A;  3NSO A;  3OP0 A;  4I5J A;  2A4J A;  1NP8 A;  1A2X A;  2KI4 B;  1B47 A;  3NSL A;  3CS1 A;  1K93 D;  2PSR A;  1E8A A;  1JC2 A;  3H4S E;  2LVJ A;  3BOW B;  2CTN A;  2KGB C;  1C07 A;  5TNC A;  1FPW A;  1AVS A;  2PVB A;  3AAJ A;  2D8N A;  3CGA A;  1IRJ A;  2LAN A;  1JUO A;  1L2O B;  3VRQ A;  2MLE C;  2MJW B;  1V1F A;  1SR6 C;  4QJ4 B;  2H2K A;  1L2O C;  3AKA A;  2BEC A;  2VRG A;  2ZRT A;  4GPL B;  1KFX S;  4MZL A;  3D0Y B;  5D69 A;  2BCB A;  1QTX A;  1UWO A;  1H4B A;  4CFQ A;  1JFK A;  1YUU A;  4WRI A;  2M49 B;  1D1O A;  1A29 A;  1YTZ C;  1IJ5 A;  2OPO A;  3AKB A;  1KWO C;  2LMT A;  2KHN A;  4QJ3 B;  1K9K A;  2M1K B;  1QIV A;  2GGZ A;  4C0K A;  4PCW A;  1OE9 B;  2KYC A;  1GGW A;  2CT9 A;  2EHB A;  4A4C A;  1DJZ A;  2BE4 A;  4IL1 A;  3FS7 A;  4YGC B;  1YVL A;  1UHI A;  2JWW A;  1EJ3 A;  1QX5 B;  1B4C A;  1NCX A;  1QV0 A;  1B7T Z;  2KGR A;  1CB1 A;  1LXF C;  2R2I A;  3DVJ A;  1NX3 A;  2FCE A;  1ZMZ A;  1G33 A;  1W7I B;  4DS7 A;  3GK1 A;  4GFT A;  4YRU A;  4CLN A;  4U8D A;  3I5F B;  2AAO A;  1AK8 A;  1K2H A;  1B8R A;  2KOT A;  2KFH A;  4I5N B;  4YGE B;  1FW4 A;  2KSP A;  4OV2 A;  1G4Y R;  4MN0 A;  4I5K A;  1UHN A;  1JBA A;  2OS8 B;  4AQI A;  3O4Y A;  5I2Q A;  3FWC A;  1CM1 A;  2JT8 A;  1XFY O;  2LLS A;  2G2B A;  2Y1N A;  1LKJ A;  1SBJ A;  1QVI Y;  2H61 C;  2ZKM X;  1CNP A;  3EVR A;  1B7T Y;  4ICB A;  3BYA A;  5FYX A;  5AFP A;  3VGO A;  3SIA A;  1BLQ A;  1J1D A;  1S6J A;  1SPY A;  1KQV A;  2COL B;  2LVV A;  1M63 B;  5AEQ A;  1LVC D;  1J7R A;  5CPV A;  3QRX A;  4PE7 A;  3TUY C;  2KNE A;  4PAL A;  3TZ1 A;  1N0Y A;  1DJG A;  3O2P A;  1EXR A;  3JVT B;  1WLZ A;  1FBV A;  1Q80 A;  3DD4 A;  3C1V A;  1XA5 A;  2FJU B;  2LAP A;  1RTP 1;  3SG6 A;  1AHR A;  4PHJ A;  3SIB A;  1DF0 A;  2BKH B;  1KCY A;  1GJY A;  4N1G A;  4ZCV A;  3D0Y A;  2K61 A;  1YUS A;  1PAL A;  1KK7 Z;  2SAS A;  4M2Q A;  2HET A;  4PHM A;  2LE9 B;  2L0P A;  2M29 A;  1A75 B;  4MBE A;  2F3Y A;  1W7J B;  1DJI A;  1TTX A;  3F45 A;  1TNQ A;  1YR5 A;  2BBM A;  2KAY A;  4MZK A;  2LHI A;  4I5L B;  3PN7 B;  2HQ8 A;  1NX0 A;  3WNX B;  3GK4 X;  3IQQ A;  3KEV A;  5HYD A;  1UHK A;  3ZWH A;  3JVT C;  4MVF A;  2PMY A;  3PSR A;  4GUK A;  4NQG A;  3TUY B;  4E68 A;  1NPQ A;  4GGF C;  1M31 A;  3EKH A;  3LK0 A;  1EG3 A;  3OB2 B;  2K7C A;  1QS7 A;  4YGA A;  3I5F C;  4XJK A;  4PE1 A;  3BQ3 A;  4P5O E;  3TS5 C;  2K2A A;  1DT7 B;  2F2O A;  1FI6 A;  1HT9 A;  1K95 A;  4GNK B;  1DMO A;  4NDC A;  2KYF A;  2LV7 A;  1IKU A;  4DCK A;  1C7V A;  2JUL A;  1NCZ A;  3DVE A;  1IG5 A;  3JTD B;  2LM5 A;  1BG1 A;  4XJK B;  1BF5 A;  1TCO B;  2EC6 B;  3IQO A;  1H8B A;  1XYD A;  2KBM A;  2I18 A;  2LLT A;  3LCP C;  2FOT A;  1F71 A;  2BBN A;  1AUI B;  2I2R E;  1REC A;  4F0Z B;  1R6P A;  1DJX A;  1JF2 A;  2JOJ A;  1VRK A;  3CZT X;  1GGZ A;  5AAN A;  1ALV A;  1MQ1 A;  1AJ5 A;  4CFR A;  4YBH B;  1YUT A;  1FF1 A;  2L4H A;  2CBL A;  1QAS A;  2BCX A;  1CLL A;  1DVI A;  2LVI A;  1NSH A;  2Y1M A;  1QJT A;  1UP5 A;  1YX7 A;  4MRY A;  2Y4Q A;  2BE6 A;  2TN4 A;  2MBX A;  3EVV A;  1K8U A;  2LUC A;  4GGF A;  1OSA A;  1JF0 A;  1NWD A;  3I5G B;  2L98 A;  1L7Z A;  3WHT B;  1PSR A;  1V1G A;  4OR9 B;  1QLS A;  2L2E A;  2K7O A;  2M8U A;  4A4B A;  1IQ3 A;  2OTG C;  2E30 A;  3FIA A;  3HCM A;  5B8I B;  2KBI A;  2CNP A;  1LA0 A;  3MSE B;  5F6T A;  3HX4 A;  1BT6 A;  3CR4 X;  1PUL A;  4NDD A;  4YGD B;  2Q4U A;  1F55 A;  1KFU S;  2LNK A;  2LLU A;  1F54 A;  1CM4 A;  4ORA B;  1SMG A;  4WQ3 A;  1PK0 D;  4HRH A;  1XFZ O;  5IBW A;  2AUC A;  1ZFS A;  2LP2 A;  4C0J A;  1XFV O;  4PHK A;  1WDC C;  4QJ5 B;  2V53 A;  5KSZ A;  3EK8 A;  2KI6 D;  2M0R A;  1TCF A;  4NDB A;  1TIZ A;  2LVK A;  3VRP A;  3PAL A;  2ZN8 A;  3SG2 A;  1DTL A;  3JTD C;  2OS8 C;  2AMI A;  4M2O A;  2MRD A;  4XYN A;  2JNX A;  3DVM A;  2HPS A;  5K89 A;  5GQQ C;  1J7O A;  2JPT A;  4MLW A;  1J1E A;  1KSM A;  1ALW A;  1K9P A;  1UUR A;  2IS9 A;  2JT0 A;  5I2O A;  2M1U A;  1HQV A;  5ER5 A;  1NCY A;  4L9M A;  1OMD A;  1YUR A;  1BOC A;  1S6C A;  2ZN9 A;  2M9G A;  3M0W A;  1CFD A;  4TNC A;  1WRL A;  1QVI Z;  4ZCU A;  1N65 A;  1M46 A;  1KK8 B;  1M45 A;  2LMU A;  2PAS A;  1BMO A;  3PLF B;  4DUQ A;  1WRZ A;  2NXQ A;  4PE4 A;  2KFF A;  2JC2 A;  3I5H B;  1CTR A;  2L50 A;  1XFX O;  2Y5I A;  1CDL A;  4HRE E;  2MAZ A;  1OOJ A;  1OZS A;  1DGV A;  4OKH A;  1ODB A;  4AOM A;  1K90 D;  1AJ4 A;  2NCO A;  2JXL A;  2KAV A;  2KI4 C;  1LIN A;  1EL4 A;  5J3X A;  3A8R A;  1KQM B;  2BKI B;  2F8P A;  1MR8 A;  5DKQ A;  1GQM A;  1QIW A;  1SK6 D;  3FWB A;  1CLB A;  1MF8 B;  2BL0 C;  4UPG A;  1S6I A;  1NX1 A;  3AAK A;  4OVN F;  3CWG A;  4FQO A;  1N2D A;  4D1E A;  1CFF A;  1EH2 A;  4WQ2 A;  1IWQ A;  2JRF A;  1IGV A;  1S5G Y;  2I94 A;  3EK4 A;  4GAO A;  4MEW A;  5CSN A;  1U5I B;  4PHN A;  2HQW A;  1R2U A;  3LLE A;  2GGM A;  3PN7 C;  2WCE A;  3CR2 A;  4N1F A;  1Y6W A;  5G08 A;  2LHL A;  4ORC B;  4BY4 A;  1KFU L;  1NYA A;  4ORB B;  1DGU A;  1XFW O;  3EVU A;  2K2F A;  5JJG A;  2O5G A;  2E6W A;  3BUW B;  5HLV A;  3D10 A;  5AXI A;  2K7B A;  1CDP A;  1U5I A;  2NLN A;  4YI8 A;  1DJW A;  1MXL C;  2K8M B;  1QAT A;  2GV5 A;  2JTZ A;  1XFU O;  3VRO A;  5BPJ A;  1KQM C;  1J7Q A;  5JOL A;  1WLM A;  4YGB B;  1XVJ A;  2F33 A;  3NXA A;  1B8C A;  2LP3 A;  2DOQ A;  2PAL A;  3TDI A;  1F4Q A;  3WXA A;  1F4O A;  1TNX A;  2M3W A;  1Y1U A;  1BU3 A;  3DVK A;  3SJS A;  2EC6 C;  1IH0 A;  1BOD A;  5HKY A;  2JNF A;  2KAX A;  1Y0V H;  1TOP A; 
#chains in the Genus database with same CATH topology
 1CFP A;  4JQ0 D;  2JQ6 A;  1DF0 B;  1Y1X A;  2MA2 A;  2ZFD A;  4PE0 A;  1SL7 A;  3O6B A;  3RLZ A;  3TS5 B;  2PYQ A;  2WND A;  3LK1 A;  2RGI A;  3SS3 A;  3DXL A;  1MHO A;  1SSE B;  3FE6 A;  1DJH A;  1SCM B;  1K9U A;  1XO5 A;  3LL8 B;  1RJV A;  2ZNE A;  4N5X A;  2PRU A;  3B88 A;  4PT1 A;  4MZJ A;  2L5X B;  3BXK A;  2K60 A;  4HSZ A;  2BCA A;  3PM8 A;  1QX2 A;  3CZ2 A;  2QPT A;  5CSF A;  1SR6 B;  2F2P A;  3OX5 A;  4FTG A;  3DF0 B;  1MUX A;  2JXC A;  2QEH A;  1RK9 A;  1YX8 A;  4JPZ B;  5PAL A;  3E3R A;  4MRX A;  2EGD A;  1MXE A;  2WCB A;  1A4P A;  1KFX L;  2KI6 C;  3I5I B;  3KO0 A;  3R1P A;  4BY5 A;  1S1E A;  4OCI A;  2ZND A;  3BUN B;  4Q04 A;  4YI9 A;  1X02 A;  2O60 A;  2JTT A;  3NHT A;  2CCM A;  2HF5 A;  1OOH A;  1RFJ A;  5DIC A;  1PRW A;  5DKR A;  5D7F A;  4GBA A;  1SNL A;  2Q91 A;  1YRU B;  3EKJ A;  3OHM B;  1CLM A;  2M97 A;  2WOS A;  3VRN A;  1C7W A;  2JZI A;  3I5H C;  1F8H A;  1RRO A;  2M7N A;  3KHE A;  3SG3 A;  1CMF A;  2NZ0 A;  1F70 A;  3I5G C;  1SL9 A;  1TN4 A;  1W9Z A;  3V2L A;  1UUS A;  4C0L A;  2LC5 A;  1B9A A;  1PVB A;  1SW8 A;  3BUX B;  1DJY A;  2B1U A;  4ETO A;  2WC6 A;  1Y1A A;  1BJF A;  1OOI X;  1EG4 A;  2LUX A;  3BUO B;  4DRW A;  3FE9 A;  3A4U B;  3SG7 A;  1IJ6 A;  2YGU A;  4P2Y B;  4R1E A;  3NSI A;  3OX6 A;  2M7L A;  1G8I A;  2KDH A;  2LCP A;  3B7A A;  3Q8I A;  1CDM A;  1IQ5 A;  5CSJ A;  1C3Z A;  1QV1 A;  1BR4 B;  1ZOT B;  1QX7 A;  5I2L A;  1ZAC A;  5AER A;  1B1G A;  1OOG A;  3BOW A;  2H61 A;  3UO9 A;  2MHH A;  4JWQ A;  1CFC A;  1CKK A;  3BFA A;  2WOR A;  4CPV A;  1JFJ A;  2FCD A;  5DKN A;  5KU1 A;  1YVH A;  3B86 A;  2ISD A;  2F3Z A;  3SG5 A;  1JWD A;  3WHU B;  4USL A;  2MLF C;  2QAC A;  1S26 D;  3OB1 B;  2PQL A;  1DEL A;  1PSB A;  2KLE A;  3K21 A;  3KF9 A;  2WCJ A;  2H8V A;  3S0F A;  2WCF A;  3PAT A;  3PFV A;  5HKW A;  3RM1 A;  2BL0 B;  1OMV A;  1S3P A;  1TRF A;  1A75 A;  1OQP A;  2JT3 A;  2KQ6 A;  3EK7 A;  3I5I C;  3TDU A;  1UHJ A;  3TDZ A;  1TUJ A;  1Z2C B;  1OZO A;  4AQJ A;  1YRT B;  4HRG A;  1SYM A;  5HL1 A;  3B87 A;  1QXP A;  1UHH A;  2L51 A;  1KK7 Y;  1WRK A;  1MWN A;  2CXJ A;  1WDC B;  2WC8 A;  2LMV A;  1AP4 A;  2KQY A;  3CDN A;  1SRA A;  1J55 A;  3SS4 A;  1KK8 C;  3BUM B;  2G9B A;  1LA3 A;  5I8N A;  1SKT A;  1RWY A;  5ER4 X;  3ZNI A;  5HKZ A;  3S0A A;  1A03 A;  1T14 A;  1QLK A;  1CDN A;  1M39 A;  3ICB A;  1SY9 A;  3NSK A;  1KSO A;  1NUB A;  3FE8 A;  4CID A;  2KFG A;  2K7D A;  2OTG B;  1OMR A;  1PVA A;  1NIW A;  1K94 A;  3L4L A;  4M2P A;  2SCP A;  1CMG A;  1J7P A;  4INW A;  3KPX A;  1S5G Z;  5KTY A;  2ZRS A;  4PDZ A;  1XK4 A;  1ZUZ A;  1BR1 B;  2P6B B;  3VRR A;  3IVT A;  2I7A A;  1JSA A;  1SL8 A;  5CSI A;  2JU0 A;  5FI2 A;  3S0B A;  3O78 A;  1NX2 A;  2NCP A;  1TNW A;  4DIR A;  5HLO A;  1B8L A;  1SCV A;  3BJH A;  3DF0 A;  3IF7 A;  1TNP A;  3GOF A;  4MSP A;  3GK2 A;  2K0J A;  2KPH A;  1KWO B;  3SG4 A;  1K96 A;  3CR5 X;  3DY9 A;  1SCM C;  1S36 A;  3D73 A;  1WY9 A;  4GGN A;  1FI5 A;  3D77 A;  3CLN A;  1XK4 C;  3CTN A;  2L4I A;  3NSO A;  3OP0 A;  4I5J A;  2A4J A;  1NP8 A;  1A2X A;  2KI4 B;  1B47 A;  3NSL A;  3CS1 A;  1K93 D;  2PSR A;  1E8A A;  1JC2 A;  3H4S E;  2LVJ A;  3BOW B;  2CTN A;  2KGB C;  1C07 A;  5TNC A;  1FPW A;  1AVS A;  2PVB A;  3AAJ A;  2D8N A;  3CGA A;  1IRJ A;  2LAN A;  1JUO A;  1L2O B;  3VRQ A;  2MLE C;  2MJW B;  1V1F A;  1SR6 C;  4QJ4 B;  2H2K A;  4INX A;  5FI7 A;  1L2O C;  3AKA A;  2BEC A;  2VRG A;  2ZRT A;  4GPL B;  2QEV A;  3D76 A;  1KFX S;  4MZL A;  3D0Y B;  5D69 A;  2BCB A;  1QTX A;  1UWO A;  1H4B A;  4CFQ A;  1JFK A;  1YUU A;  4WRI A;  2L2C A;  2M49 B;  1D1O A;  1A29 A;  3R72 A;  3O4X A;  1YTZ C;  1IJ5 A;  2OPO A;  3AKB A;  1KWO C;  2WCK A;  2LMT A;  2KHN A;  4QJ3 B;  1K9K A;  2M1K B;  1QIV A;  2GGZ A;  4C0K A;  4PCW A;  1OE9 B;  2KYC A;  1GGW A;  2CT9 A;  2EHB A;  4A4C A;  3VB1 A;  3B6X A;  1DJZ A;  1C3Y A;  2BE4 A;  4IL1 A;  3FS7 A;  2WCM A;  4YGC B;  1YVL A;  1UHI A;  2JWW A;  1EJ3 A;  1QX5 B;  3L4A A;  1NCX A;  1QV0 A;  1B7T Z;  2KGR A;  1B4C A;  1LXF C;  1CB1 A;  2R2I A;  3DVJ A;  1NX3 A;  2FCE A;  1ZMZ A;  1G33 A;  3D78 A;  1W7I B;  4DS7 A;  3GK1 A;  4GFT A;  4YRU A;  4CLN A;  2P71 A;  4U8D A;  3I5F B;  2AAO A;  1AK8 A;  1K2H A;  1B8R A;  2KOT A;  2KFH A;  4I5N B;  4YGE B;  1FW4 A;  2KSP A;  4OV2 A;  3DZT A;  1G4Y R;  4MN0 A;  2QEO A;  1DC1 A;  4I5K A;  1UHN A;  1JBA A;  2OS8 B;  4AQI A;  3O4Y A;  4FQT A;  5I2Q A;  3FWC A;  3RZS A;  1CM1 A;  2JT8 A;  1XFY O;  2LLS A;  2G2B A;  2Y1N A;  1LKJ A;  1SBJ A;  1QVI Y;  2H61 C;  2ZKM X;  1CNP A;  3EVR A;  1B7T Y;  4ICB A;  3BYA A;  5FYX A;  5AFP A;  3VGO A;  3SIA A;  1BLQ A;  1J1D A;  1S6J A;  3CZ0 A;  1SPY A;  1KQV A;  2COL B;  2LVV A;  1M63 B;  5AEQ A;  2WCH A;  1LVC D;  1J7R A;  5CPV A;  2JPO A;  3QRX A;  2BNX A;  4PE7 A;  3TUY C;  2KNE A;  4PAL A;  3TZ1 A;  1N0Y A;  1DJG A;  3O2P A;  1EXR A;  3JVT B;  1WLZ A;  1FBV A;  1Q80 A;  3DD4 A;  1GM0 A;  3C1V A;  1XA5 A;  2FJU B;  2LAP A;  1RTP 1;  2FJY A;  3EG5 B;  3OBV A;  3SG6 A;  3SS5 A;  1AHR A;  3L47 A;  3NHI A;  4PHJ A;  3SIB A;  1DF0 A;  2BKH B;  1KCY A;  1TUZ A;  1GJY A;  4N1G A;  4ZCV A;  3D0Y A;  2K61 A;  1YUS A;  1PAL A;  1KK7 Z;  2SAS A;  3S0G A;  2QEB A;  4JKT A;  4M2Q A;  2HET A;  4PHM A;  2LE9 B;  2L0P A;  2M29 A;  1A75 B;  4MBE A;  1W7J B;  2F3Y A;  1DJI A;  1TTX A;  3F45 A;  3S0D A;  3R1V A;  1TNQ A;  1YR5 A;  2BBM A;  2KAY A;  4MZK A;  2LHI A;  4I5L B;  3PN7 B;  2HQ8 A;  1NX0 A;  3WNX B;  3D74 A;  3GK4 X;  1LS8 A;  2L5Y A;  1UHK A;  3IQQ A;  3KEV A;  3CYZ A;  3JVT C;  3ZWH A;  5HYD A;  4MVF A;  2PMY A;  3PSR A;  4GUK A;  4NQG A;  3TUY B;  4E68 A;  1NPQ A;  4GGF C;  1M31 A;  3CAB A;  3EKH A;  3LK0 A;  1EG3 A;  3OB2 B;  2K7C A;  1QS7 A;  3K1E A;  3I5F C;  4XJK A;  4YGA A;  4PE1 A;  3BQ3 A;  4P5O E;  3TS5 C;  2K2A A;  1DT7 B;  5FI6 A;  2F2O A;  1FI6 A;  1HT9 A;  1K95 A;  4GNK B;  1DMO A;  4NDC A;  2KYF A;  2LV7 A;  1IKU A;  4DCK A;  1C7V A;  2JUL A;  1NCZ A;  3DVE A;  1IG5 A;  3JTD B;  2LM5 A;  1BG1 A;  4KYN A;  4XJK B;  1BF5 A;  1TCO B;  2EC6 B;  3IQO A;  1H8B A;  1XYD A;  2KBM A;  2I18 A;  2LLT A;  3BFH A;  3LCP C;  2FOT A;  1F71 A;  2BBN A;  1AUI B;  5D3O A;  2I2R E;  1REC A;  4F0Z B;  1R6P A;  3S0E A;  1DJX A;  1JF2 A;  2JOJ A;  1VRK A;  3CZT X;  1GGZ A;  4IJ7 A;  5AAN A;  3NGV A;  1ALV A;  1MQ1 A;  3CZ1 A;  1AJ5 A;  4CFR A;  4YBH B;  1YUT A;  1OW4 A;  2L4H A;  2CBL A;  1FF1 A;  1QAS A;  2BCX A;  1CLL A;  2WC5 A;  1DVI A;  2LVI A;  1NSH A;  2Y1M A;  4F7F A;  1QJT A;  1UP5 A;  1YX7 A;  4MRY A;  2Y4Q A;  2BE6 A;  2TN4 A;  1QWV A;  2MBX A;  3EVV A;  1K8U A;  2LUC A;  4GGF A;  1OSA A;  1JF0 A;  1NWD A;  2KLD A;  1P28 A;  3I5G B;  2L98 A;  1L7Z A;  3WHT B;  1PSR A;  1V1G A;  4OR9 B;  1QLS A;  2L2E A;  2K7O A;  2M8U A;  1TWO A;  4A4B A;  1IQ3 A;  2OTG C;  2E30 A;  3FIA A;  2BAP A;  3HCM A;  2KBI A;  4JD9 A;  5B8I B;  2CNP A;  1LA0 A;  3MSE B;  5F6T A;  3HX4 A;  1BT6 A;  3CR4 X;  1PUL A;  4NDD A;  4YGD B;  2Q4U A;  1F55 A;  1ORG A;  1KFU S;  2LNK A;  2LLU A;  1F54 A;  1CM4 A;  4ORA B;  1SMG A;  4WQ3 A;  1PK0 D;  4HRH A;  1XFZ O;  5IBW A;  2AUC A;  1ZFS A;  2LP2 A;  4C0J A;  1XFV O;  4PHK A;  1WDC C;  4QJ5 B;  2V53 A;  5KSZ A;  1DEK A;  3EK8 A;  3R1O A;  2KI6 D;  2M0R A;  1TCF A;  4NDB A;  1TIZ A;  2LVK A;  3VRP A;  3PAL A;  2ZN8 A;  3SG2 A;  1DTL A;  3JTD C;  2OS8 C;  1Z4H A;  2AMI A;  2GTE A;  2MRD A;  4M2O A;  2JNX A;  2P70 A;  2HPS A;  3DVM A;  4XYN A;  5GQQ C;  5K89 A;  1J7O A;  2JPT A;  4MLW A;  1J1E A;  1KSM A;  1ALW A;  1K9P A;  1UUR A;  2IS9 A;  2JT0 A;  5I2O A;  3OGN A;  2M1U A;  1HQV A;  5ER5 A;  1NCY A;  4L9M A;  1YUR A;  1OMD A;  3D75 A;  2ERB A;  1S6C A;  2ZN9 A;  2M9G A;  3M0W A;  1CFD A;  4TNC A;  1BOC A;  1WRL A;  1QVI Z;  4ZCU A;  1N65 A;  1M46 A;  1KK8 B;  1M45 A;  2LMU A;  2PAS A;  1BMO A;  3PLF B;  4DUQ A;  3PM2 A;  1WRZ A;  2NXQ A;  4PE4 A;  2KFF A;  2JC2 A;  3I5H B;  1CTR A;  2L50 A;  1XFX O;  2WCL A;  2Y5I A;  1CDL A;  4HRE E;  2MAZ A;  1OOJ A;  1OZS A;  1DGV A;  4OKH A;  1ODB A;  5EL2 A;  4AOM A;  1K90 D;  5I94 A;  1AJ4 A;  2NCO A;  2JXL A;  2KAV A;  2KI4 C;  1LIN A;  1EL4 A;  5J3X A;  3A8R A;  1KQM B;  2QDI A;  2BKI B;  2F8P A;  1MR8 A;  5DKQ A;  1GQM A;  1QIW A;  1SK6 D;  3FWB A;  1CLB A;  1MF8 B;  2BL0 C;  4UPG A;  3QME A;  1S6I A;  1NX1 A;  3AAK A;  4OVN F;  3CWG A;  4FQO A;  1N2D A;  4D1E A;  1CFF A;  1EH2 A;  4WQ2 A;  1IWQ A;  2JRF A;  1IGV A;  1S5G Y;  2I94 A;  3EK4 A;  4GAO A;  4MEW A;  4OZD A;  5CSN A;  3BFB A;  1U5I B;  4PHN A;  2HQW A;  1R2U A;  3LLE A;  2GGM A;  3PN7 C;  2WCE A;  3CR2 A;  4N1F A;  1Y6W A;  3N7H A;  3PJI A;  5G08 A;  2LHL A;  4ORC B;  4BY4 A;  1KFU L;  1NYA A;  1IIO A;  4ORB B;  1DGU A;  1XFW O;  3EVU A;  2K2F A;  5JJG A;  2O5G A;  2E6W A;  3BUW B;  5HLV A;  3D10 A;  3UNW A;  5AXI A;  2K7B A;  1CDP A;  1U5I A;  2NLN A;  4YI8 A;  1DJW A;  1MXL C;  2K8M B;  1QAT A;  2GV5 A;  2JTZ A;  1XFU O;  3DYE A;  3VRO A;  5BPJ A;  1KQM C;  1J7Q A;  5JOL A;  1WLM A;  1DQE A;  4YGB B;  1XVJ A;  2F33 A;  3NXA A;  1B8C A;  2LP3 A;  2DOQ A;  2PAL A;  3TDI A;  1F4Q A;  3WXA A;  1F4O A;  1TNX A;  2M3W A;  1Y1U A;  1BU3 A;  1OOF A;  3DVK A;  3SJS A;  2EC6 C;  1IH0 A;  1BOD A;  5HKY A;  2JNF A;  2KAX A;  1Y0V H;  1TOP A;  1XFR A; 
#chains in the Genus database with same CATH homology
 1CFP A;  4JQ0 D;  2JQ6 A;  1DF0 B;  1Y1X A;  2MA2 A;  2ZFD A;  4PE0 A;  1SL7 A;  3O6B A;  3RLZ A;  3TS5 B;  2WND A;  3LK1 A;  2RGI A;  1MHO A;  1DJH A;  1SCM B;  1K9U A;  1XO5 A;  3LL8 B;  1RJV A;  2ZNE A;  4N5X A;  2PRU A;  4MZJ A;  2L5X B;  3BXK A;  4HSZ A;  2BCA A;  3PM8 A;  1QX2 A;  2QPT A;  5CSF A;  1SR6 B;  2F2P A;  3OX5 A;  4FTG A;  3DF0 B;  1MUX A;  2JXC A;  1RK9 A;  1YX8 A;  4JPZ B;  5PAL A;  3E3R A;  4MRX A;  2EGD A;  1MXE A;  2WCB A;  1A4P A;  1KFX L;  2KI6 C;  3I5I B;  3KO0 A;  4BY5 A;  1S1E A;  4OCI A;  2ZND A;  3BUN B;  4Q04 A;  4YI9 A;  1X02 A;  2O60 A;  2JTT A;  2CCM A;  2HF5 A;  1RFJ A;  1PRW A;  5DKR A;  5D7F A;  4GBA A;  1SNL A;  2Q91 A;  1YRU B;  3EKJ A;  3OHM B;  1CLM A;  2M97 A;  2WOS A;  3VRN A;  1C7W A;  2JZI A;  3I5H C;  1F8H A;  1RRO A;  2M7N A;  3KHE A;  3SG3 A;  1CMF A;  2NZ0 A;  1F70 A;  3I5G C;  1SL9 A;  1TN4 A;  1UUS A;  4C0L A;  2LC5 A;  1B9A A;  1PVB A;  1SW8 A;  3BUX B;  1DJY A;  2B1U A;  4ETO A;  1Y1A A;  1BJF A;  1EG4 A;  2LUX A;  3BUO B;  4DRW A;  3A4U B;  3SG7 A;  1IJ6 A;  4P2Y B;  4R1E A;  3NSI A;  3OX6 A;  2M7L A;  1G8I A;  2KDH A;  2LCP A;  1CDM A;  1IQ5 A;  5CSJ A;  1QV1 A;  1BR4 B;  1ZOT B;  1QX7 A;  5I2L A;  1ZAC A;  5AER A;  1B1G A;  3BOW A;  2H61 A;  2MHH A;  4JWQ A;  1CFC A;  1CKK A;  2WOR A;  4CPV A;  1JFJ A;  2FCD A;  5DKN A;  5KU1 A;  1YVH A;  2ISD A;  2F3Z A;  3SG5 A;  1JWD A;  3WHU B;  4USL A;  2MLF C;  2QAC A;  1S26 D;  3OB1 B;  1PSB A;  3K21 A;  3KF9 A;  2WCF A;  3PAT A;  3PFV A;  5HKW A;  3RM1 A;  2BL0 B;  1OMV A;  1S3P A;  1TRF A;  1A75 A;  1OQP A;  2JT3 A;  2KQ6 A;  3EK7 A;  3I5I C;  3TDU A;  1UHJ A;  3TDZ A;  1OZO A;  4AQJ A;  1YRT B;  4HRG A;  1SYM A;  1QXP A;  1UHH A;  2L51 A;  1KK7 Y;  1WRK A;  1MWN A;  2CXJ A;  1WDC B;  2WC8 A;  2LMV A;  1AP4 A;  2KQY A;  1SRA A;  1J55 A;  1KK8 C;  3BUM B;  2G9B A;  1LA3 A;  5I8N A;  1SKT A;  1RWY A;  5ER4 X;  3ZNI A;  5HKZ A;  1A03 A;  1QLK A;  1CDN A;  1M39 A;  3ICB A;  1SY9 A;  3NSK A;  1KSO A;  1NUB A;  4CID A;  2KFG A;  2K7D A;  2OTG B;  1OMR A;  1PVA A;  1NIW A;  1K94 A;  4M2P A;  2SCP A;  1CMG A;  1J7P A;  3KPX A;  1S5G Z;  5KTY A;  2ZRS A;  4PDZ A;  1XK4 A;  1ZUZ A;  1BR1 B;  2P6B B;  3VRR A;  1JSA A;  2I7A A;  1SL8 A;  5CSI A;  2JU0 A;  3O78 A;  1NX2 A;  2NCP A;  1TNW A;  4DIR A;  5HLO A;  1B8L A;  1SCV A;  3DF0 A;  3IF7 A;  4MSP A;  1TNP A;  3GOF A;  3GK2 A;  2K0J A;  1KWO B;  3SG4 A;  1K96 A;  3CR5 X;  1SCM C;  1S36 A;  1WY9 A;  4GGN A;  1FI5 A;  3CLN A;  1XK4 C;  3CTN A;  2L4I A;  3NSO A;  3OP0 A;  4I5J A;  2A4J A;  1NP8 A;  1A2X A;  2KI4 B;  1B47 A;  3NSL A;  3CS1 A;  1K93 D;  2PSR A;  1E8A A;  1JC2 A;  3H4S E;  2LVJ A;  3BOW B;  2CTN A;  2KGB C;  1C07 A;  5TNC A;  1FPW A;  1AVS A;  2PVB A;  3AAJ A;  2D8N A;  3CGA A;  1IRJ A;  2LAN A;  1JUO A;  1L2O B;  3VRQ A;  2MLE C;  2MJW B;  1V1F A;  1SR6 C;  4QJ4 B;  2H2K A;  1L2O C;  3AKA A;  2BEC A;  2VRG A;  2ZRT A;  4GPL B;  1KFX S;  4MZL A;  3D0Y B;  5D69 A;  2BCB A;  1QTX A;  1UWO A;  1H4B A;  4CFQ A;  1JFK A;  1YUU A;  4WRI A;  2M49 B;  1D1O A;  1A29 A;  1YTZ C;  1IJ5 A;  2OPO A;  3AKB A;  1KWO C;  2LMT A;  2KHN A;  4QJ3 B;  1K9K A;  2M1K B;  1QIV A;  2GGZ A;  4C0K A;  4PCW A;  1OE9 B;  2KYC A;  1GGW A;  2CT9 A;  2EHB A;  4A4C A;  1DJZ A;  2BE4 A;  4IL1 A;  3FS7 A;  4YGC B;  1YVL A;  1UHI A;  2JWW A;  1EJ3 A;  1QX5 B;  1B4C A;  1NCX A;  1QV0 A;  1B7T Z;  2KGR A;  1CB1 A;  1LXF C;  2R2I A;  3DVJ A;  1NX3 A;  2FCE A;  1ZMZ A;  1G33 A;  1W7I B;  4DS7 A;  3GK1 A;  4GFT A;  4YRU A;  4CLN A;  4U8D A;  3I5F B;  2AAO A;  1AK8 A;  1K2H A;  1B8R A;  2KOT A;  2KFH A;  4I5N B;  4YGE B;  1FW4 A;  2KSP A;  4OV2 A;  1G4Y R;  4MN0 A;  4I5K A;  1UHN A;  1JBA A;  2OS8 B;  4AQI A;  3O4Y A;  5I2Q A;  3FWC A;  1CM1 A;  2JT8 A;  1XFY O;  2LLS A;  2G2B A;  2Y1N A;  1LKJ A;  1SBJ A;  1QVI Y;  2H61 C;  2ZKM X;  1CNP A;  3EVR A;  1B7T Y;  4ICB A;  3BYA A;  5FYX A;  5AFP A;  3VGO A;  3SIA A;  1BLQ A;  1J1D A;  1S6J A;  1SPY A;  1KQV A;  2COL B;  2LVV A;  1M63 B;  5AEQ A;  1LVC D;  1J7R A;  5CPV A;  3QRX A;  4PE7 A;  3TUY C;  2KNE A;  4PAL A;  3TZ1 A;  1N0Y A;  1DJG A;  3O2P A;  1EXR A;  3JVT B;  1WLZ A;  1FBV A;  1Q80 A;  3DD4 A;  3C1V A;  1XA5 A;  2FJU B;  2LAP A;  1RTP 1;  3SG6 A;  1AHR A;  4PHJ A;  3SIB A;  1DF0 A;  2BKH B;  1KCY A;  1GJY A;  4N1G A;  4ZCV A;  3D0Y A;  2K61 A;  1YUS A;  1PAL A;  1KK7 Z;  2SAS A;  4M2Q A;  2HET A;  4PHM A;  2LE9 B;  2L0P A;  2M29 A;  1A75 B;  4MBE A;  2F3Y A;  1W7J B;  1DJI A;  1TTX A;  3F45 A;  1TNQ A;  1YR5 A;  2BBM A;  2KAY A;  4MZK A;  2LHI A;  4I5L B;  3PN7 B;  2HQ8 A;  1NX0 A;  3WNX B;  3GK4 X;  3IQQ A;  3KEV A;  5HYD A;  1UHK A;  3ZWH A;  3JVT C;  4MVF A;  2PMY A;  3PSR A;  4GUK A;  4NQG A;  3TUY B;  4E68 A;  1NPQ A;  4GGF C;  1M31 A;  3EKH A;  3LK0 A;  1EG3 A;  3OB2 B;  2K7C A;  1QS7 A;  4YGA A;  3I5F C;  4XJK A;  4PE1 A;  3BQ3 A;  4P5O E;  3TS5 C;  2K2A A;  1DT7 B;  2F2O A;  1FI6 A;  1HT9 A;  1K95 A;  4GNK B;  1DMO A;  4NDC A;  2KYF A;  2LV7 A;  1IKU A;  4DCK A;  1C7V A;  2JUL A;  1NCZ A;  3DVE A;  1IG5 A;  3JTD B;  2LM5 A;  1BG1 A;  4XJK B;  1BF5 A;  1TCO B;  2EC6 B;  3IQO A;  1H8B A;  1XYD A;  2KBM A;  2I18 A;  2LLT A;  3LCP C;  2FOT A;  1F71 A;  2BBN A;  1AUI B;  2I2R E;  1REC A;  4F0Z B;  1R6P A;  1DJX A;  1JF2 A;  2JOJ A;  1VRK A;  3CZT X;  1GGZ A;  5AAN A;  1ALV A;  1MQ1 A;  1AJ5 A;  4CFR A;  4YBH B;  1YUT A;  1FF1 A;  2L4H A;  2CBL A;  1QAS A;  2BCX A;  1CLL A;  1DVI A;  2LVI A;  1NSH A;  2Y1M A;  1QJT A;  1UP5 A;  1YX7 A;  4MRY A;  2Y4Q A;  2BE6 A;  2TN4 A;  2MBX A;  3EVV A;  1K8U A;  2LUC A;  4GGF A;  1OSA A;  1JF0 A;  1NWD A;  3I5G B;  2L98 A;  1L7Z A;  3WHT B;  1PSR A;  1V1G A;  4OR9 B;  1QLS A;  2L2E A;  2K7O A;  2M8U A;  4A4B A;  1IQ3 A;  2OTG C;  2E30 A;  3FIA A;  3HCM A;  5B8I B;  2KBI A;  2CNP A;  1LA0 A;  3MSE B;  5F6T A;  3HX4 A;  1BT6 A;  3CR4 X;  1PUL A;  4NDD A;  4YGD B;  2Q4U A;  1F55 A;  1KFU S;  2LNK A;  2LLU A;  1F54 A;  1CM4 A;  4ORA B;  1SMG A;  4WQ3 A;  1PK0 D;  4HRH A;  1XFZ O;  5IBW A;  2AUC A;  1ZFS A;  2LP2 A;  4C0J A;  1XFV O;  4PHK A;  1WDC C;  4QJ5 B;  2V53 A;  5KSZ A;  3EK8 A;  2KI6 D;  2M0R A;  1TCF A;  4NDB A;  1TIZ A;  2LVK A;  3VRP A;  3PAL A;  2ZN8 A;  3SG2 A;  1DTL A;  3JTD C;  2OS8 C;  2AMI A;  4M2O A;  2MRD A;  4XYN A;  2JNX A;  3DVM A;  2HPS A;  5K89 A;  5GQQ C;  1J7O A;  2JPT A;  4MLW A;  1J1E A;  1KSM A;  1ALW A;  1K9P A;  1UUR A;  2IS9 A;  2JT0 A;  5I2O A;  2M1U A;  1HQV A;  5ER5 A;  1NCY A;  4L9M A;  1OMD A;  1YUR A;  1BOC A;  1S6C A;  2ZN9 A;  2M9G A;  3M0W A;  1CFD A;  4TNC A;  1WRL A;  1QVI Z;  4ZCU A;  1N65 A;  1M46 A;  1KK8 B;  1M45 A;  2LMU A;  2PAS A;  1BMO A;  3PLF B;  4DUQ A;  1WRZ A;  2NXQ A;  4PE4 A;  2KFF A;  2JC2 A;  3I5H B;  1CTR A;  2L50 A;  1XFX O;  2Y5I A;  1CDL A;  4HRE E;  2MAZ A;  1OOJ A;  1OZS A;  1DGV A;  4OKH A;  1ODB A;  4AOM A;  1K90 D;  1AJ4 A;  2NCO A;  2JXL A;  2KAV A;  2KI4 C;  1LIN A;  1EL4 A;  5J3X A;  3A8R A;  1KQM B;  2BKI B;  2F8P A;  1MR8 A;  5DKQ A;  1GQM A;  1QIW A;  1SK6 D;  3FWB A;  1CLB A;  1MF8 B;  2BL0 C;  4UPG A;  1S6I A;  1NX1 A;  3AAK A;  4OVN F;  3CWG A;  4FQO A;  1N2D A;  4D1E A;  1CFF A;  1EH2 A;  4WQ2 A;  1IWQ A;  2JRF A;  1IGV A;  1S5G Y;  2I94 A;  3EK4 A;  4GAO A;  4MEW A;  5CSN A;  1U5I B;  4PHN A;  2HQW A;  1R2U A;  3LLE A;  2GGM A;  3PN7 C;  2WCE A;  3CR2 A;  4N1F A;  1Y6W A;  5G08 A;  2LHL A;  4ORC B;  4BY4 A;  1KFU L;  1NYA A;  4ORB B;  1DGU A;  1XFW O;  3EVU A;  2K2F A;  5JJG A;  2O5G A;  2E6W A;  3BUW B;  5HLV A;  3D10 A;  5AXI A;  2K7B A;  1CDP A;  1U5I A;  2NLN A;  4YI8 A;  1DJW A;  1MXL C;  2K8M B;  1QAT A;  2GV5 A;  2JTZ A;  1XFU O;  3VRO A;  5BPJ A;  1KQM C;  1J7Q A;  5JOL A;  1WLM A;  4YGB B;  1XVJ A;  2F33 A;  3NXA A;  1B8C A;  2LP3 A;  2DOQ A;  2PAL A;  3TDI A;  1F4Q A;  3WXA A;  1F4O A;  1TNX A;  2M3W A;  1Y1U A;  1BU3 A;  3DVK A;  3SJS A;  2EC6 C;  1IH0 A;  1BOD A;  5HKY A;  2JNF A;  2KAX A;  1Y0V H;  1TOP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...