4P2YB

Crystal structure of the human rage ectodomain (fragment vc1c2) in complex with mouse s100a6
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
88
structure length
88
Chain Sequence
ACPLDQAIGLLVAIFHKYSGKEGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMDDLDRNKDQEVNFQEYVAFLGALALIYNEALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the RAGE:S100A6 Complex Reveals a Unique Mode of Homodimerization for S100 Proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Advanced glycosylation end product-specific receptor
total genus 36
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2014-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4p2yB00
1OOJA 5I2LA 1BT6A 4NDDA 3FWBA 4USLA 1CTRA 4YI9A 4QJ3B 1G33A 2ZRSA 1ALVA 1SRAA 2EGDA 1QLKA 1MWNA 3I5FC 4XYNA 1GGWA 4HSZA 3JTDC 1K96A 3D10A 1S6IA 5F6TA 1XYDA 4JPZB 2F3YA 4YGCB 1FF1A 1NUBA 2E30A 4JWQA 1R6PA 4AOMA 4Q04A 1EJ3A 2KAYA 3A4UB 1RTP1 3PN7C 2ZKMX 4CFQA 3LK1A 2HQ8A 5CSFA 4GFTA 1IQ3A 2K2FA 1A2XA 2LM5A 1B47A 2Q91A 2CT9A 1OZOA 2PVBA 4WQ2A 1A29A 1PULA 3EK8A 2KQYA 1F54A 2LVVA 2JXCA 2HPSA 1QTXA 2SCPA 1N2DA 4PHJA 2BECA 2KSPA 3A8RA 3IQOA 4E68A 4I5KA 1HT9A 3NSKA 4A4CA 1TNQA 1QX7A 4BY4A 1RJVA 1KWOB 3E3RA 2BL0B 2L2EA 4NQGA 2BKIB 2LLTA 1SR6B 2JRFA 2LVIA 1CM4A 2LLUA 2LVKA 1WLMA 2Y4QA 4GUKA 2LUCA 1J7OA 4AQIA 1LA3A 2D8NA 2FJUB 2JULA 1EG4A 2JT8A 5JJGA 1NPQA 2CNPA 1GQMA 1BMOA 3HX4A 3OP0A 1M39A 2PASA 3KHEA 3OB1B 1BOCA 1YVLA 5AERA 1IKUA 4C0JA 1S26D 1B1GA 4MRYA 3TUYC 3KEVA 1RECA 3RLZA 1NWDA 5DKNA 1S6JA 1UP5A 1W7IB 2KYCA 1KQVA 2LUXA 4GGFC 1QVIZ 4ZCUA 2MRDA 1AUIB 2NCOA 2HQWA 3EK4A 5D69A 1SBJA 2KOTA 5HKZA 1YRUB 2BE6A 3DVKA 1GGZA 2NZ0A 1IGVA 3NSOA 2A4JA 3TUYB 2M49B 1SY9A 1Y6WA 2JOJA 1A75A 1XFWO 2LMVA 3CR2A 4GBAA 2KAVA 1QXPA 2QACA 4MZKA 1QATA 4WRIA 1AJ5A 1DJWA 2JU0A 1SL7A 2L4IA 2L51A 3KO0A 2L50A 3OX5A 4DIRA 1JSAA 2GGZA 2F2OA 1EG3A 1JWDA 4GGFA 1CFPA 3C1VA 4P2YB 1KSOA 1M63B 1MF8B 4OVNF 1JFJA 2Y5IA 4PE1A 3CR4X 3PLFB 3VRPA 2TN4A 2ZFDA 1LA0A 2JTZA 1WDCC 2L5XB 1B8RA 2JNFA 1CLMA 4M2QA 1NX0A 2LLSA 1TCFA 1DJHA 2ZNDA 1ZUZA 1CB1A 1QLSA 1XO5A 2LP3A 4MEWA 2KFFA 3SG7A 5HYDA 5AANA 3CR5X 1TTXA 3RM1A 2CXJA 1XA5A 5G08A 3LCPC 3TS5B 1U5IA 2OTGC 1B4CA 1J55A 1S36A 3BUOB 4PHNA 4ORBB 1CNPA 1XFVO 1XFZO 4UPGA 1TCOB 1PSBA 2G2BA 2NLNA 1IQ5A 2OS8C 1WRKA 3O4YA 5CSNA 3ZWHA 2KAXA 1A75B 2JTTA 3WHTB 1KFXS 2KFHA 1X02A 4HRGA 1QX5B 4MBEA 4C0LA 3I5GC 5PALA 2KQ6A 1CMFA 1QV1A 4I5JA 4CIDA 2MA2A 1KSMA 5CSIA 2MHHA 4PE7A 5HKWA 1DGVA 4DS7A 2ZN9A 4CFRA 2JNXA 2VRGA 3GK1A 3OHMB 2F3ZA 1LINA 1FBVA 1A03A 2WCBA 1YR5A 1B7TY 1XVJA 2AAOA 1EH2A 3KPXA 2CCMA 4MZJA 3M0WA 4P5OE 2PALA 2MLFC 1YURA 4TNCA 2JC2A 2GGMA 1YUUA 3LL8B 2E6WA 2M9GA 1XK4A 1S6CA 1SCMC 1IJ6A 3FWCA 1BR1B 3NSLA 1C7WA 1K94A 5KSZA 1SYMA 2K0JA 2M0RA 1RK9A 3SJSA 3BOWB 1N0YA 2JQ6A 2H2KA 1ZACA 1LVCD 3CTNA 1WY9A 2DOQA 2K7CA 3BYAA 3EVUA 5ER5A 2O60A 2QPTA 3BUWB 5KTYA 1TIZA 1JF2A 3F45A 4MN0A 1B9AA 4YGDB 1NP8A 1K2HA 5I2OA 1BU3A 1EXRA 4GPLB 2Y1MA 1PVBA 1S3PA 1YX7A 1IJ5A 2K61A 3BQ3A 3BUMB 1SCMB 3BXKA 1TN4A 1OZSA 4NDCA 3SG3A 2L98A 4NDBA 1KK7Z 4N5XA 3BOWA 1JFKA 1K95A 3NSIA 1OE9B 3MSEB 3OB2B 3BUXB 3DVMA 2LANA 1NX1A 1QVIY 1YRTB 1U5IB 3I5GB 3OX6A 1J1DA 1G8IA 4M2PA 2LV7A 1QV0A 1F70A 1L7ZA 1OMRA 2SASA 2CBLA 2H61A 1F71A 1CDNA 4L9MA 2ZN8A 1DT7B 2FCDA 1NIWA 5J3XA 4I5LB 4XJKB 3FIAA 4M2OA 5K89A 1WLZA 5JOLA 1XFYO 1DVIA 1YUSA 3EKHA 3TS5C 3SG2A 1CFFA 2OPOA 2HF5A 2ZNEA 1SR6C 2FCEA 3AAJA 3AKAA 1FW4A 1L2OB 1UHIA 1S5GY 4GNKB 1DJXA 1CM1A 4MZLA 2K7BA 5CSJA 1B7TZ 4DRWA 1HQVA 1DGUA 1YTZC 2OTGB 2M8UA 1MUXA 4A4BA 1MXLC 2I94A 1BLQA 4R1EA 2BE4A 4N1GA 2ZRTA 1JF0A 1NX3A 1VRKA 1GJYA 2LMTA 1ALWA 1SL8A 4PDZA 4YBHB 3PSRA 2H61C 2GV5A 2K2AA 4QJ5B 2KGRA 1KFUL 2L4HA 3CWGA 1DMOA 3CS1A 4YRUA 4OCIA 1Q80A 1YVHA 3IF7A 4YGEB 2M29A 1XFXO 3GOFA 3AKBA 1DJZA 2KNEA 1K9UA 1BJFA 1IWQA 1N65A 1UUSA 3IQQA 1J1EA 1Y1UA 1DF0A 4CLNA 5AFPA 1CLLA 1SKTA 1CDPA 2M1KB 3TZ1A 3ZNIA 4D1EA 3GK4X 1TRFA 1K93D 1UHJA 2KI6D 2EC6C 1A4PA 1FI6A 2KYFA 1LXFC 3I5HC 1CDLA 2RGIA 1Y1XA 1J7RA 2JPTA 2LHLA 3D0YB 3I5FB 2MAZA 1AJ4A 2KBMA 5HLVA 1QS7A 1EL4A 1RROA 4PE0A 4ICBA 1KFXL 1UWOA 2V53A 4PHMA 2JZIA 1DF0B 3VRNA 2MBXA 3PALA 2I18A 1QASA 5I2QA 4FQOA 1JUOA 1WDCB 2R2IA 4YI8A 2NXQA 2IS9A 3O6BA 4MRXA 1QIWA 2ISDA 3CZTX 3SG5A 4OKHA 3I5IC 1K9KA 4ORAB 1PALA 4HREE 1UURA 2MLEC 3O78A 3TDZA 1NSHA 1XK4C 1PVAA 2WC8A 3DD4A 1KCYA 5CPVA 4F0ZB 2KDHA 3LLEA 1K8UA 1JC2A 2O5GA 1UHNA 4PCWA 5AEQA 1M46A 3WXAA 5GQQC 1MQ1A 2LMUA 2NCPA 1CLBA 2OS8B 3SIBA 4C0KA 3DVEA 1C7VA 2M97A 1XFUO 2LHIA 1ZOTB 3ICBA 3VRQA 1MR8A 1AK8A 1YUTA 1LKJA 4GGNA 4MVFA 1MXEA 1IG5A 2PSRA 5HLOA 4BY5A 1FPWA 4JQ0D 1OSAA 2M1UA 3CLNA 3I5HB 5KU1A 2AUCA 4OR9B 1CDMA 2Q4UA 1TNXA 2LE9B 1BODA 4MSPA 1Y0VH 2LCPA 3EK7A 1H8BA 2I7AA 5TNCA 3SG6A 1CFDA 1JBAA 3FS7A 3JTDB 3VRRA 1CKKA 1RWYA 2Y1NA 5ER4X 1SMGA 1K90D 1IH0A 4FTGA 5D7FA 2KI6C 3DVJA 3DF0B 2COLB 4U8DA 4WQ3A 3BUNB 2M7NA 2BCAA 1NCYA 1V1FA 1ODBA 2KI4C 2BBMA 2G9BA 2KHNA 2BBNA 2JT3A 4YGBB 1DJYA 2KBIA 1BR4B 5BPJA 1TNPA 5DKRA 1CMGA 1M31A 1AVSA 1PSRA 1J7QA 1FI5A 4GAOA 1G4YR 2PRUA 3PM8A 3WHUB 3EVRA 5B8IB 1C07A 4ETOA 1OQPA 2BCBA 1W7JB 1K9PA 3TDUA 1SCVA 4XJKA 1OMDA 1KWOC 4IL1A 2PMYA 2KGBC 1B8CA 2K7OA 3O2PA 1AP4A 1AHRA 2AMIA 3JVTB 5HKYA 2JXLA 2B1UA 4DCKA 2EHBA 2BCXA 1F8HA 2JT0A 1D1OA 2M7LA 1QIVA 1KK8C 4PHKA 1YX8A 3KF9A 1NCZA 1NX2A 1SL9A 1TOPA 1SNLA 2F33A 2L0PA 5IBWA 4OV2A 1Y1AA 1IRJA 2WCEA 2KFGA 3SG4A 1KFUS 2K7DA 2JWWA 1KK7Y 1R2UA 5FYXA 1PRWA 1M45A 3K21A 3TDIA 1KK8B 1BF5A 5AXIA 1E8AA 1F4OA 3VROA 4ZCVA 3QRXA 1DTLA 1UHKA 3WNXB 4AQJA 4HRHA 1ZMZA 2K8MB 2F2PA 2CTNA 3PATA 3SIAA 3HCMA 1S1EA 1V1GA 2F8PA 3GK2A 5DKQA 1UHHA 3AAKA 2I2RE 1DJIA 2LNKA 2WCFA 1CFCA 2BKHB 1QJTA 3PN7B 1DJGA 4I5NB 3CGAA 2LVJA 1WRZA 3D0YA 2KI4B 3DF0A 4MLWA 1SK6D 1PK0D 3I5IB 4CPVA 1KQMC 1RFJA 3EVVA 1QX2A 2LAPA 4PE4A 3JVTC 1KQMB 3VGOA 2WOSA 1NCXA 3NXAA 2BL0C 1WRLA 1F4QA 2LP2A 1S5GZ 4ORCB 1L2OC 1J7PA 1SW8A 2EC6B 2LC5A 3LK0A 1B8LA 1BG1A 2WNDA 2WORA 1F55A 3H4SE 2HETA 4PALA 1ZFSA 1TNWA 1SPYA 2MJWB 2P6BB 5I8NA 1NYAA 1OMVA 3PFVA 4DUQA 4YGAA 1H4BA 4QJ4B 4N1FA 2FOTA 2M3WA 3EKJA 1MHOA
chains in the Genus database with same CATH superfamily
1OOJA 5I2LA 1BT6A 4NDDA 3FWBA 4USLA 1CTRA 4YI9A 4QJ3B 1G33A 2ZRSA 1ALVA 1SRAA 2EGDA 1QLKA 1MWNA 3I5FC 4XYNA 1GGWA 4HSZA 3JTDC 1K96A 3D10A 2YGUA 1S6IA 5F6TA 1XYDA 4JPZB 2F3YA 4YGCB 1FF1A 1NUBA 2E30A 4JWQA 1QWVA 1R6PA 2PQLA 4Q04A 5FI6A 4AOMA 1EJ3A 2KAYA 3A4UB 1RTP1 3PN7C 2ZKMX 4CFQA 3LK1A 3B6XA 1Z4HA 2HQ8A 5CSFA 4GFTA 1IQ3A 2K2FA 1A2XA 2LM5A 1B47A 2Q91A 2CT9A 1OZOA 2PVBA 4WQ2A 1A29A 1PULA 3EK8A 2KQYA 1F54A 2LVVA 2JXCA 2HPSA 1QTXA 2SCPA 1N2DA 4PHJA 2BECA 2KSPA 3A8RA 3IQOA 4E68A 4I5KA 1HT9A 3NSKA 4A4CA 1TNQA 1QX7A 4BY4A 1RJVA 1TUJA 1KWOB 3E3RA 2BL0B 2L2EA 3S0BA 2L5YA 4NQGA 2BKIB 2LLTA 2WCMA 1SR6B 2JRFA 3NHTA 2LVIA 1CM4A 2LLUA 2LVKA 1WLMA 2Y4QA 4GUKA 2LUCA 1J7OA 4AQIA 1LA3A 2D8NA 2FJUB 2JULA 3D74A 4IJ7A 1EG4A 2JT8A 5JJGA 3NGVA 1NPQA 2CNPA 1GQMA 1BMOA 3HX4A 3OP0A 1M39A 2PASA 3DY9A 3D78A 1P28A 1YVLA 3KHEA 3OB1B 5AERA 1IKUA 1BOCA 4C0JA 1S26D 1LS8A 1B1GA 4MRYA 3TUYC 3KEVA 1RECA 3RLZA 1NWDA 5DKNA 3BJHA 1C3YA 1S6JA 2ERBA 1UP5A 1W7IB 2KYCA 1KQVA 1OOHA 2LUXA 4GGFC 1QVIZ 4ZCUA 2MRDA 2WCHA 1AUIB 2NCOA 2HQWA 3EK4A 5D69A 1SBJA 2KOTA 5HKZA 1YRUB 2BE6A 3DVKA 1GGZA 2KPHA 1IIOA 2NZ0A 1IGVA 1T14A 3NSOA 2A4JA 2BNXA 3TUYB 2M49B 3L47A 1SY9A 1Y6WA 1TWOA 2JOJA 1A75A 1XFWO 2LMVA 2QDIA 3CR2A 4GBAA 2KAVA 1QXPA 2QACA 4MZKA 1QATA 4WRIA 1AJ5A 5HL1A 2QEBA 1DJWA 2JU0A 1SL7A 2L4IA 2L51A 3KO0A 2L50A 3OX5A 4DIRA 1JSAA 2F2OA 1EG3A 2GGZA 1JWDA 4GGFA 1CFPA 3C1VA 4P2YB 1KSOA 1M63B 1MF8B 4OVNF 1JFJA 2Y5IA 4INXA 4PE1A 3CR4X 3PLFB 3Q8IA 3SS3A 3VRPA 2TN4A 2ZFDA 1LA0A 2JTZA 3SS5A 1WDCC 2L5XB 2QEVA 1B8RA 2JNFA 1CLMA 4M2QA 1NX0A 1DC1A 2LLSA 1TCFA 1DJHA 2ZNDA 1ZUZA 1CB1A 2WCKA 1QLSA 1XO5A 2WCLA 2LP3A 4MEWA 2KFFA 3SG7A 5HYDA 5AANA 3CR5X 3PM2A 1TTXA 3RM1A 2CXJA 5FI2A 1XA5A 5G08A 3LCPC 3R1PA 1U5IA 2OTGC 3TS5B 1J55A 1S36A 3BUOB 3CDNA 4PHNA 4ORBB 1B4CA 1CNPA 1XFVO 1XFZO 4UPGA 1TCOB 1PSBA 2G2BA 2NLNA 1IQ5A 2OS8C 3UNWA 1WRKA 3DXLA 3O4YA 5CSNA 3ZWHA 3L4LA 2KAXA 1A75B 2JTTA 3WHTB 1KFXS 2KFHA 3IVTA 1X02A 4HRGA 1QX5B 4MBEA 4C0LA 3CZ0A 3I5GC 5PALA 2KQ6A 1CMFA 3FE6A 1QV1A 3B7AA 4I5JA 4CIDA 2MA2A 1KSMA 5CSIA 2MHHA 5FI7A 4PE7A 5HKWA 1C3ZA 1DGVA 1ORGA 4DS7A 2ZN9A 4CFRA 2JNXA 2VRGA 2WC5A 3GK1A 3OHMB 2F3ZA 1LINA 1FBVA 1A03A 2WCBA 1YR5A 1B7TY 1XVJA 2AAOA 5I94A 3B87A 1OOGA 3KPXA 2CCMA 4MZJA 3M0WA 4P5OE 1EH2A 2H8VA 2PALA 2MLFC 1YURA 4TNCA 2JC2A 2GGMA 1YUUA 3LL8B 3O4XA 3K1EA 1TUZA 2E6WA 2M9GA 1XK4A 1S6CA 1SCMC 1IJ6A 3FWCA 1BR1B 3NSLA 1C7WA 1K94A 5KSZA 1SYMA 2K0JA 2M0RA 1RK9A 3SJSA 3BOWB 1N0YA 3FE9A 2JQ6A 2H2KA 1ZACA 1LVCD 3CTNA 1WY9A 3N7HA 2DOQA 2K7CA 3BYAA 3EVUA 5ER5A 2O60A 2QPTA 3BUWB 5KTYA 1TIZA 1JF2A 3F45A 4MN0A 1B9AA 4YGDB 1NP8A 1K2HA 3D73A 5I2OA 1BU3A 1EXRA 4GPLB 2Y1MA 1PVBA 1S3PA 1YX7A 1IJ5A 2K61A 3BQ3A 3BUMB 1SCMB 3BXKA 1TN4A 1OZSA 4NDCA 3SG3A 2L98A 4NDBA 1KK7Z 4N5XA 3BOWA 1JFKA 1K95A 3NSIA 1OE9B 3MSEB 3OB2B 3BUXB 3RZSA 3DVMA 2LANA 1DELA 1NX1A 1QVIY 1YRTB 1U5IB 3I5GB 3OX6A 1J1DA 1G8IA 4M2PA 2LV7A 1QV0A 1F70A 1L7ZA 1OMRA 2SASA 2CBLA 2H61A 1F71A 1CDNA 5D3OA 4L9MA 3S0EA 2ZN8A 1DT7B 2FCDA 1NIWA 5J3XA 4I5LB 4XJKB 3FIAA 4M2OA 5K89A 1WLZA 5JOLA 1XFYO 1DVIA 1YUSA 3EKHA 3SS4A 3TS5C 3SG2A 1CFFA 3R1OA 2OPOA 2HF5A 2ZNEA 1SR6C 2FCEA 3AAJA 3AKAA 1SSEB 1FW4A 1L2OB 1UHIA 1S5GY 4GNKB 1DJXA 1CM1A 4MZLA 2K7BA 5CSJA 1B7TZ 4DRWA 1HQVA 1DGUA 1YTZC 2OTGB 2M8UA 1MUXA 4A4BA 1MXLC 2I94A 1BLQA 4R1EA 2BE4A 4N1GA 2ZRTA 3D77A 1JF0A 1NX3A 1VRKA 1GJYA 2LMTA 1ALWA 1SL8A 4PDZA 4YBHB 3PSRA 2H61C 2GV5A 2K2AA 4QJ5B 2KGRA 1KFUL 2L4HA 3CWGA 1OOIX 1DMOA 3CS1A 4YRUA 4OCIA 1Q80A 3UO9A 1YVHA 3IF7A 4YGEB 2M29A 1XFXO 3GOFA 3OBVA 3AKBA 1DJZA 2KNEA 3CZ1A 1K9UA 4INWA 1BJFA 1IWQA 1N65A 1UUSA 3IQQA 1J1EA 1Y1UA 1DF0A 2QEHA 4CLNA 5AFPA 1CLLA 1SKTA 1CDPA 4OZDA 2M1KB 3TZ1A 3ZNIA 4D1EA 3GK4X 1TRFA 1K93D 1UHJA 2KI6D 2EC6C 1A4PA 1FI6A 2KYFA 1LXFC 3I5HC 1CDLA 1XFRA 2RGIA 1Y1XA 1J7RA 2JPTA 2LHLA 3D0YB 3I5FB 2MAZA 1AJ4A 2KLEA 2KBMA 5HLVA 1QS7A 1EL4A 1RROA 4PE0A 4JKTA 3DZTA 3DYEA 4ICBA 1KFXL 1UWOA 2V53A 4PHMA 2FJYA 2JZIA 1DF0B 3VRNA 2MBXA 3PALA 2I18A 1QASA 5EL2A 3OGNA 1DEKA 5I2QA 4FQOA 1DQEA 1JUOA 1WDCB 2R2IA 4YI8A 4PT1A 2NXQA 2IS9A 3O6BA 4MRXA 1QIWA 2ISDA 3CZTX 3SG5A 4OKHA 3I5IC 1K9KA 4ORAB 1PALA 4HREE 1UURA 2MLEC 2WC6A 3O78A 1NSHA 3TDZA 1XK4C 1PVAA 2WC8A 3DD4A 1KCYA 5CPVA 4F0ZB 2KDHA 3LLEA 1K8UA 1JC2A 1GM0A 2O5GA 1UHNA 4PCWA 5AEQA 1M46A 3WXAA 5GQQC 1MQ1A 2LMUA 3V2LA 2NCPA 1CLBA 2OS8B 3SIBA 4C0KA 3DVEA 1OOFA 2P71A 1C7VA 2M97A 1XFUO 4JD9A 2LHIA 1ZOTB 3ICBA 3VRQA 1MR8A 1AK8A 1YUTA 1LKJA 4GGNA 4MVFA 1MXEA 1IG5A 2PSRA 5HLOA 4BY5A 1FPWA 4JQ0D 1OSAA 2M1UA 3CLNA 3I5HB 5KU1A 2AUCA 4OR9B 1CDMA 2Q4UA 3QMEA 2PYQA 1TNXA 2LE9B 1BODA 4MSPA 1Y0VH 2LCPA 3EK7A 1H8BA 2I7AA 5TNCA 3SG6A 1CFDA 1JBAA 3S0FA 3FS7A 3JTDB 3VRRA 1CKKA 1RWYA 2BAPA 4F7FA 2Y1NA 5ER4X 1SMGA 1K90D 1W9ZA 1IH0A 4FTGA 5D7FA 2KI6C 3DVJA 3DF0B 2COLB 2L2CA 4U8DA 4WQ3A 3BUNB 2M7NA 2BCAA 3CABA 1NCYA 2GTEA 1V1FA 1ODBA 2KI4C 2BBMA 2G9BA 2KHNA 2BBNA 2JT3A 4YGBB 1DJYA 2KBIA 1BR4B 5BPJA 1TNPA 5DKRA 1CMGA 1M31A 1AVSA 1PSRA 1J7QA 1FI5A 4GAOA 2QEOA 1G4YR 2PRUA 3PM8A 3BFHA 3WHUB 3EVRA 3L4AA 5B8IB 1C07A 4ETOA 1OQPA 2BCBA 1W7JB 1K9PA 3TDUA 1SCVA 4XJKA 1OMDA 1KWOC 2KLDA 4IL1A 2PMYA 2KGBC 1B8CA 2K7OA 3O2PA 1AP4A 1AHRA 2AMIA 3B86A 3JVTB 5HKYA 2JXLA 2B1UA 4DCKA 2EHBA 2BCXA 1F8HA 2JT0A 1D1OA 2M7LA 1QIVA 1KK8C 4PHKA 1YX8A 3KF9A 3S0GA 1NCZA 1NX2A 1SL9A 1TOPA 1SNLA 2F33A 2L0PA 3VB1A 5IBWA 4OV2A 2K60A 1Y1AA 3CZ2A 1IRJA 2WCEA 2KFGA 3SG4A 1KFUS 2K7DA 4FQTA 2JWWA 1KK7Y 1R2UA 5FYXA 1PRWA 1Z2CB 1M45A 3K21A 3S0AA 5DICA 1KK8B 3TDIA 1BF5A 5AXIA 1E8AA 1F4OA 3VROA 2JPOA 4ZCVA 3B88A 3QRXA 1DTLA 1UHKA 3WNXB 4AQJA 4HRHA 1ZMZA 2K8MB 2F2PA 2CTNA 3PATA 3SIAA 3HCMA 2P70A 1S1EA 1V1GA 2F8PA 3GK2A 5DKQA 1UHHA 3AAKA 2WCJA 3PJIA 2I2RE 3R1VA 1DJIA 2LNKA 2WCFA 1CFCA 2BKHB 1QJTA 3PN7B 1DJGA 4I5NB 3BFBA 3CGAA 2LVJA 1OW4A 3NHIA 1WRZA 3D0YA 2KI4B 3DF0A 4MLWA 1SK6D 1PK0D 3I5IB 4CPVA 3D76A 4KYNA 1KQMC 1RFJA 3D75A 3EVVA 1QX2A 2LAPA 4PE4A 3JVTC 1KQMB 3EG5B 3VGOA 2WOSA 1NCXA 3NXAA 2BL0C 1WRLA 1F4QA 2LP2A 1S5GZ 4ORCB 1L2OC 1J7PA 1SW8A 2EC6B 2LC5A 3LK0A 1B8LA 1BG1A 2WNDA 2WORA 3R72A 1F55A 3H4SE 2HETA 4PALA 3BFAA 1ZFSA 1TNWA 1SPYA 2MJWB 2P6BB 5I8NA 1NYAA 1OMVA 3PFVA 3S0DA 4DUQA 4YGAA 1H4BA 3CYZA 4QJ4B 3FE8A 4N1FA 2FOTA 2M3WA 3EKJA 1MHOA
chains in the Genus database with same CATH topology
1OOJA 5I2LA 1BT6A 4NDDA 3FWBA 4USLA 1CTRA 4YI9A 4QJ3B 1G33A 2ZRSA 1ALVA 1SRAA 2EGDA 1QLKA 1MWNA 3I5FC 4XYNA 1GGWA 4HSZA 3JTDC 1K96A 3D10A 1S6IA 5F6TA 1XYDA 4JPZB 2F3YA 4YGCB 1FF1A 1NUBA 2E30A 4JWQA 1R6PA 4AOMA 4Q04A 1EJ3A 2KAYA 3A4UB 1RTP1 3PN7C 2ZKMX 4CFQA 3LK1A 2HQ8A 5CSFA 4GFTA 1IQ3A 2K2FA 1A2XA 2LM5A 1B47A 2Q91A 2CT9A 1OZOA 2PVBA 4WQ2A 1A29A 1PULA 3EK8A 2KQYA 1F54A 2LVVA 2JXCA 2HPSA 1QTXA 2SCPA 1N2DA 4PHJA 2BECA 2KSPA 3A8RA 3IQOA 4E68A 4I5KA 1HT9A 3NSKA 4A4CA 1TNQA 1QX7A 4BY4A 1RJVA 1KWOB 3E3RA 2BL0B 2L2EA 4NQGA 2BKIB 2LLTA 1SR6B 2JRFA 2LVIA 1CM4A 2LLUA 2LVKA 1WLMA 2Y4QA 4GUKA 2LUCA 1J7OA 4AQIA 1LA3A 2D8NA 2FJUB 2JULA 1EG4A 2JT8A 5JJGA 1NPQA 2CNPA 1GQMA 1BMOA 3HX4A 3OP0A 1M39A 2PASA 3KHEA 3OB1B 1BOCA 1YVLA 5AERA 1IKUA 4C0JA 1S26D 1B1GA 4MRYA 3TUYC 3KEVA 1RECA 3RLZA 1NWDA 5DKNA 1S6JA 1UP5A 1W7IB 2KYCA 1KQVA 2LUXA 4GGFC 1QVIZ 4ZCUA 2MRDA 1AUIB 2NCOA 2HQWA 3EK4A 5D69A 1SBJA 2KOTA 5HKZA 1YRUB 2BE6A 3DVKA 1GGZA 2NZ0A 1IGVA 3NSOA 2A4JA 3TUYB 2M49B 1SY9A 1Y6WA 2JOJA 1A75A 1XFWO 2LMVA 3CR2A 4GBAA 2KAVA 1QXPA 2QACA 4MZKA 1QATA 4WRIA 1AJ5A 1DJWA 2JU0A 1SL7A 2L4IA 2L51A 3KO0A 2L50A 3OX5A 4DIRA 1JSAA 2GGZA 2F2OA 1EG3A 1JWDA 4GGFA 1CFPA 3C1VA 4P2YB 1KSOA 1M63B 1MF8B 4OVNF 1JFJA 2Y5IA 4PE1A 3CR4X 3PLFB 3VRPA 2TN4A 2ZFDA 1LA0A 2JTZA 1WDCC 2L5XB 1B8RA 2JNFA 1CLMA 4M2QA 1NX0A 2LLSA 1TCFA 1DJHA 2ZNDA 1ZUZA 1CB1A 1QLSA 1XO5A 2LP3A 4MEWA 2KFFA 3SG7A 5HYDA 5AANA 3CR5X 1TTXA 3RM1A 2CXJA 1XA5A 5G08A 3LCPC 3TS5B 1U5IA 2OTGC 1B4CA 1J55A 1S36A 3BUOB 4PHNA 4ORBB 1CNPA 1XFVO 1XFZO 4UPGA 1TCOB 1PSBA 2G2BA 2NLNA 1IQ5A 2OS8C 1WRKA 3O4YA 5CSNA 3ZWHA 2KAXA 1A75B 2JTTA 3WHTB 1KFXS 2KFHA 1X02A 4HRGA 1QX5B 4MBEA 4C0LA 3I5GC 5PALA 2KQ6A 1CMFA 1QV1A 4I5JA 4CIDA 2MA2A 1KSMA 5CSIA 2MHHA 4PE7A 5HKWA 1DGVA 4DS7A 2ZN9A 4CFRA 2JNXA 2VRGA 3GK1A 3OHMB 2F3ZA 1LINA 1FBVA 1A03A 2WCBA 1YR5A 1B7TY 1XVJA 2AAOA 1EH2A 3KPXA 2CCMA 4MZJA 3M0WA 4P5OE 2PALA 2MLFC 1YURA 4TNCA 2JC2A 2GGMA 1YUUA 3LL8B 2E6WA 2M9GA 1XK4A 1S6CA 1SCMC 1IJ6A 3FWCA 1BR1B 3NSLA 1C7WA 1K94A 5KSZA 1SYMA 2K0JA 2M0RA 1RK9A 3SJSA 3BOWB 1N0YA 2JQ6A 2H2KA 1ZACA 1LVCD 3CTNA 1WY9A 2DOQA 2K7CA 3BYAA 3EVUA 5ER5A 2O60A 2QPTA 3BUWB 5KTYA 1TIZA 1JF2A 3F45A 4MN0A 1B9AA 4YGDB 1NP8A 1K2HA 5I2OA 1BU3A 1EXRA 4GPLB 2Y1MA 1PVBA 1S3PA 1YX7A 1IJ5A 2K61A 3BQ3A 3BUMB 1SCMB 3BXKA 1TN4A 1OZSA 4NDCA 3SG3A 2L98A 4NDBA 1KK7Z 4N5XA 3BOWA 1JFKA 1K95A 3NSIA 1OE9B 3MSEB 3OB2B 3BUXB 3DVMA 2LANA 1NX1A 1QVIY 1YRTB 1U5IB 3I5GB 3OX6A 1J1DA 1G8IA 4M2PA 2LV7A 1QV0A 1F70A 1L7ZA 1OMRA 2SASA 2CBLA 2H61A 1F71A 1CDNA 4L9MA 2ZN8A 1DT7B 2FCDA 1NIWA 5J3XA 4I5LB 4XJKB 3FIAA 4M2OA 5K89A 1WLZA 5JOLA 1XFYO 1DVIA 1YUSA 3EKHA 3TS5C 3SG2A 1CFFA 2OPOA 2HF5A 2ZNEA 1SR6C 2FCEA 3AAJA 3AKAA 1FW4A 1L2OB 1UHIA 1S5GY 4GNKB 1DJXA 1CM1A 4MZLA 2K7BA 5CSJA 1B7TZ 4DRWA 1HQVA 1DGUA 1YTZC 2OTGB 2M8UA 1MUXA 4A4BA 1MXLC 2I94A 1BLQA 4R1EA 2BE4A 4N1GA 2ZRTA 1JF0A 1NX3A 1VRKA 1GJYA 2LMTA 1ALWA 1SL8A 4PDZA 4YBHB 3PSRA 2H61C 2GV5A 2K2AA 4QJ5B 2KGRA 1KFUL 2L4HA 3CWGA 1DMOA 3CS1A 4YRUA 4OCIA 1Q80A 1YVHA 3IF7A 4YGEB 2M29A 1XFXO 3GOFA 3AKBA 1DJZA 2KNEA 1K9UA 1BJFA 1IWQA 1N65A 1UUSA 3IQQA 1J1EA 1Y1UA 1DF0A 4CLNA 5AFPA 1CLLA 1SKTA 1CDPA 2M1KB 3TZ1A 3ZNIA 4D1EA 3GK4X 1TRFA 1K93D 1UHJA 2KI6D 2EC6C 1A4PA 1FI6A 2KYFA 1LXFC 3I5HC 1CDLA 2RGIA 1Y1XA 1J7RA 2JPTA 2LHLA 3D0YB 3I5FB 2MAZA 1AJ4A 2KBMA 5HLVA 1QS7A 1EL4A 1RROA 4PE0A 4ICBA 1KFXL 1UWOA 2V53A 4PHMA 2JZIA 1DF0B 3VRNA 2MBXA 3PALA 2I18A 1QASA 5I2QA 4FQOA 1JUOA 1WDCB 2R2IA 4YI8A 2NXQA 2IS9A 3O6BA 4MRXA 1QIWA 2ISDA 3CZTX 3SG5A 4OKHA 3I5IC 1K9KA 4ORAB 1PALA 4HREE 1UURA 2MLEC 3O78A 3TDZA 1NSHA 1XK4C 1PVAA 2WC8A 3DD4A 1KCYA 5CPVA 4F0ZB 2KDHA 3LLEA 1K8UA 1JC2A 2O5GA 1UHNA 4PCWA 5AEQA 1M46A 3WXAA 5GQQC 1MQ1A 2LMUA 2NCPA 1CLBA 2OS8B 3SIBA 4C0KA 3DVEA 1C7VA 2M97A 1XFUO 2LHIA 1ZOTB 3ICBA 3VRQA 1MR8A 1AK8A 1YUTA 1LKJA 4GGNA 4MVFA 1MXEA 1IG5A 2PSRA 5HLOA 4BY5A 1FPWA 4JQ0D 1OSAA 2M1UA 3CLNA 3I5HB 5KU1A 2AUCA 4OR9B 1CDMA 2Q4UA 1TNXA 2LE9B 1BODA 4MSPA 1Y0VH 2LCPA 3EK7A 1H8BA 2I7AA 5TNCA 3SG6A 1CFDA 1JBAA 3FS7A 3JTDB 3VRRA 1CKKA 1RWYA 2Y1NA 5ER4X 1SMGA 1K90D 1IH0A 4FTGA 5D7FA 2KI6C 3DVJA 3DF0B 2COLB 4U8DA 4WQ3A 3BUNB 2M7NA 2BCAA 1NCYA 1V1FA 1ODBA 2KI4C 2BBMA 2G9BA 2KHNA 2BBNA 2JT3A 4YGBB 1DJYA 2KBIA 1BR4B 5BPJA 1TNPA 5DKRA 1CMGA 1M31A 1AVSA 1PSRA 1J7QA 1FI5A 4GAOA 1G4YR 2PRUA 3PM8A 3WHUB 3EVRA 5B8IB 1C07A 4ETOA 1OQPA 2BCBA 1W7JB 1K9PA 3TDUA 1SCVA 4XJKA 1OMDA 1KWOC 4IL1A 2PMYA 2KGBC 1B8CA 2K7OA 3O2PA 1AP4A 1AHRA 2AMIA 3JVTB 5HKYA 2JXLA 2B1UA 4DCKA 2EHBA 2BCXA 1F8HA 2JT0A 1D1OA 2M7LA 1QIVA 1KK8C 4PHKA 1YX8A 3KF9A 1NCZA 1NX2A 1SL9A 1TOPA 1SNLA 2F33A 2L0PA 5IBWA 4OV2A 1Y1AA 1IRJA 2WCEA 2KFGA 3SG4A 1KFUS 2K7DA 2JWWA 1KK7Y 1R2UA 5FYXA 1PRWA 1M45A 3K21A 3TDIA 1KK8B 1BF5A 5AXIA 1E8AA 1F4OA 3VROA 4ZCVA 3QRXA 1DTLA 1UHKA 3WNXB 4AQJA 4HRHA 1ZMZA 2K8MB 2F2PA 2CTNA 3PATA 3SIAA 3HCMA 1S1EA 1V1GA 2F8PA 3GK2A 5DKQA 1UHHA 3AAKA 2I2RE 1DJIA 2LNKA 2WCFA 1CFCA 2BKHB 1QJTA 3PN7B 1DJGA 4I5NB 3CGAA 2LVJA 1WRZA 3D0YA 2KI4B 3DF0A 4MLWA 1SK6D 1PK0D 3I5IB 4CPVA 1KQMC 1RFJA 3EVVA 1QX2A 2LAPA 4PE4A 3JVTC 1KQMB 3VGOA 2WOSA 1NCXA 3NXAA 2BL0C 1WRLA 1F4QA 2LP2A 1S5GZ 4ORCB 1L2OC 1J7PA 1SW8A 2EC6B 2LC5A 3LK0A 1B8LA 1BG1A 2WNDA 2WORA 1F55A 3H4SE 2HETA 4PALA 1ZFSA 1TNWA 1SPYA 2MJWB 2P6BB 5I8NA 1NYAA 1OMVA 3PFVA 4DUQA 4YGAA 1H4BA 4QJ4B 4N1FA 2FOTA 2M3WA 3EKJA 1MHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OOJ A;  5I2L A;  1BT6 A;  4NDD A;  3FWB A;  4USL A;  1CTR A;  4YI9 A;  4QJ3 B;  1G33 A;  2ZRS A;  1ALV A;  1SRA A;  2EGD A;  1QLK A;  1MWN A;  3I5F C;  4XYN A;  1GGW A;  4HSZ A;  3JTD C;  1K96 A;  3D10 A;  1S6I A;  5F6T A;  1XYD A;  4JPZ B;  2F3Y A;  4YGC B;  1FF1 A;  1NUB A;  2E30 A;  4JWQ A;  1R6P A;  4AOM A;  4Q04 A;  1EJ3 A;  2KAY A;  3A4U B;  1RTP 1;  3PN7 C;  2ZKM X;  4CFQ A;  3LK1 A;  2HQ8 A;  5CSF A;  4GFT A;  1IQ3 A;  2K2F A;  1A2X A;  2LM5 A;  1B47 A;  2Q91 A;  2CT9 A;  1OZO A;  2PVB A;  4WQ2 A;  1A29 A;  1PUL A;  3EK8 A;  2KQY A;  1F54 A;  2LVV A;  2JXC A;  2HPS A;  1QTX A;  2SCP A;  1N2D A;  4PHJ A;  2BEC A;  2KSP A;  3A8R A;  3IQO A;  4E68 A;  4I5K A;  1HT9 A;  3NSK A;  4A4C A;  1TNQ A;  1QX7 A;  4BY4 A;  1RJV A;  1KWO B;  3E3R A;  2BL0 B;  2L2E A;  4NQG A;  2BKI B;  2LLT A;  1SR6 B;  2JRF A;  2LVI A;  1CM4 A;  2LLU A;  2LVK A;  1WLM A;  2Y4Q A;  4GUK A;  2LUC A;  1J7O A;  4AQI A;  1LA3 A;  2D8N A;  2FJU B;  2JUL A;  1EG4 A;  2JT8 A;  5JJG A;  1NPQ A;  2CNP A;  1GQM A;  1BMO A;  3HX4 A;  3OP0 A;  1M39 A;  2PAS A;  3KHE A;  3OB1 B;  1BOC A;  1YVL A;  5AER A;  1IKU A;  4C0J A;  1S26 D;  1B1G A;  4MRY A;  3TUY C;  3KEV A;  1REC A;  3RLZ A;  1NWD A;  5DKN A;  1S6J A;  1UP5 A;  1W7I B;  2KYC A;  1KQV A;  2LUX A;  4GGF C;  1QVI Z;  4ZCU A;  2MRD A;  1AUI B;  2NCO A;  2HQW A;  3EK4 A;  5D69 A;  1SBJ A;  2KOT A;  5HKZ A;  1YRU B;  2BE6 A;  3DVK A;  1GGZ A;  2NZ0 A;  1IGV A;  3NSO A;  2A4J A;  3TUY B;  2M49 B;  1SY9 A;  1Y6W A;  2JOJ A;  1A75 A;  1XFW O;  2LMV A;  3CR2 A;  4GBA A;  2KAV A;  1QXP A;  2QAC A;  4MZK A;  1QAT A;  4WRI A;  1AJ5 A;  1DJW A;  2JU0 A;  1SL7 A;  2L4I A;  2L51 A;  3KO0 A;  2L50 A;  3OX5 A;  4DIR A;  1JSA A;  2GGZ A;  2F2O A;  1EG3 A;  1JWD A;  4GGF A;  1CFP A;  3C1V A;  4P2Y B;  1KSO A;  1M63 B;  1MF8 B;  4OVN F;  1JFJ A;  2Y5I A;  4PE1 A;  3CR4 X;  3PLF B;  3VRP A;  2TN4 A;  2ZFD A;  1LA0 A;  2JTZ A;  1WDC C;  2L5X B;  1B8R A;  2JNF A;  1CLM A;  4M2Q A;  1NX0 A;  2LLS A;  1TCF A;  1DJH A;  2ZND A;  1ZUZ A;  1CB1 A;  1QLS A;  1XO5 A;  2LP3 A;  4MEW A;  2KFF A;  3SG7 A;  5HYD A;  5AAN A;  3CR5 X;  1TTX A;  3RM1 A;  2CXJ A;  1XA5 A;  5G08 A;  3LCP C;  3TS5 B;  1U5I A;  2OTG C;  1B4C A;  1J55 A;  1S36 A;  3BUO B;  4PHN A;  4ORB B;  1CNP A;  1XFV O;  1XFZ O;  4UPG A;  1TCO B;  1PSB A;  2G2B A;  2NLN A;  1IQ5 A;  2OS8 C;  1WRK A;  3O4Y A;  5CSN A;  3ZWH A;  2KAX A;  1A75 B;  2JTT A;  3WHT B;  1KFX S;  2KFH A;  1X02 A;  4HRG A;  1QX5 B;  4MBE A;  4C0L A;  3I5G C;  5PAL A;  2KQ6 A;  1CMF A;  1QV1 A;  4I5J A;  4CID A;  2MA2 A;  1KSM A;  5CSI A;  2MHH A;  4PE7 A;  5HKW A;  1DGV A;  4DS7 A;  2ZN9 A;  4CFR A;  2JNX A;  2VRG A;  3GK1 A;  3OHM B;  2F3Z A;  1LIN A;  1FBV A;  1A03 A;  2WCB A;  1YR5 A;  1B7T Y;  1XVJ A;  2AAO A;  1EH2 A;  3KPX A;  2CCM A;  4MZJ A;  3M0W A;  4P5O E;  2PAL A;  2MLF C;  1YUR A;  4TNC A;  2JC2 A;  2GGM A;  1YUU A;  3LL8 B;  2E6W A;  2M9G A;  1XK4 A;  1S6C A;  1SCM C;  1IJ6 A;  3FWC A;  1BR1 B;  3NSL A;  1C7W A;  1K94 A;  5KSZ A;  1SYM A;  2K0J A;  2M0R A;  1RK9 A;  3SJS A;  3BOW B;  1N0Y A;  2JQ6 A;  2H2K A;  1ZAC A;  1LVC D;  3CTN A;  1WY9 A;  2DOQ A;  2K7C A;  3BYA A;  3EVU A;  5ER5 A;  2O60 A;  2QPT A;  3BUW B;  5KTY A;  1TIZ A;  1JF2 A;  3F45 A;  4MN0 A;  1B9A A;  4YGD B;  1NP8 A;  1K2H A;  5I2O A;  1BU3 A;  1EXR A;  4GPL B;  2Y1M A;  1PVB A;  1S3P A;  1YX7 A;  1IJ5 A;  2K61 A;  3BQ3 A;  3BUM B;  1SCM B;  3BXK A;  1TN4 A;  1OZS A;  4NDC A;  3SG3 A;  2L98 A;  4NDB A;  1KK7 Z;  4N5X A;  3BOW A;  1JFK A;  1K95 A;  3NSI A;  1OE9 B;  3MSE B;  3OB2 B;  3BUX B;  3DVM A;  2LAN A;  1NX1 A;  1QVI Y;  1YRT B;  1U5I B;  3I5G B;  3OX6 A;  1J1D A;  1G8I A;  4M2P A;  2LV7 A;  1QV0 A;  1F70 A;  1L7Z A;  1OMR A;  2SAS A;  2CBL A;  2H61 A;  1F71 A;  1CDN A;  4L9M A;  2ZN8 A;  1DT7 B;  2FCD A;  1NIW A;  5J3X A;  4I5L B;  4XJK B;  3FIA A;  4M2O A;  5K89 A;  1WLZ A;  5JOL A;  1XFY O;  1DVI A;  1YUS A;  3EKH A;  3TS5 C;  3SG2 A;  1CFF A;  2OPO A;  2HF5 A;  2ZNE A;  1SR6 C;  2FCE A;  3AAJ A;  3AKA A;  1FW4 A;  1L2O B;  1UHI A;  1S5G Y;  4GNK B;  1DJX A;  1CM1 A;  4MZL A;  2K7B A;  5CSJ A;  1B7T Z;  4DRW A;  1HQV A;  1DGU A;  1YTZ C;  2OTG B;  2M8U A;  1MUX A;  4A4B A;  1MXL C;  2I94 A;  1BLQ A;  4R1E A;  2BE4 A;  4N1G A;  2ZRT A;  1JF0 A;  1NX3 A;  1VRK A;  1GJY A;  2LMT A;  1ALW A;  1SL8 A;  4PDZ A;  4YBH B;  3PSR A;  2H61 C;  2GV5 A;  2K2A A;  4QJ5 B;  2KGR A;  1KFU L;  2L4H A;  3CWG A;  1DMO A;  3CS1 A;  4YRU A;  4OCI A;  1Q80 A;  1YVH A;  3IF7 A;  4YGE B;  2M29 A;  1XFX O;  3GOF A;  3AKB A;  1DJZ A;  2KNE A;  1K9U A;  1BJF A;  1IWQ A;  1N65 A;  1UUS A;  3IQQ A;  1J1E A;  1Y1U A;  1DF0 A;  4CLN A;  5AFP A;  1CLL A;  1SKT A;  1CDP A;  2M1K B;  3TZ1 A;  3ZNI A;  4D1E A;  3GK4 X;  1TRF A;  1K93 D;  1UHJ A;  2KI6 D;  2EC6 C;  1A4P A;  1FI6 A;  2KYF A;  1LXF C;  3I5H C;  1CDL A;  2RGI A;  1Y1X A;  1J7R A;  2JPT A;  2LHL A;  3D0Y B;  3I5F B;  2MAZ A;  1AJ4 A;  2KBM A;  5HLV A;  1QS7 A;  1EL4 A;  1RRO A;  4PE0 A;  4ICB A;  1KFX L;  1UWO A;  2V53 A;  4PHM A;  2JZI A;  1DF0 B;  3VRN A;  2MBX A;  3PAL A;  2I18 A;  1QAS A;  5I2Q A;  4FQO A;  1JUO A;  1WDC B;  2R2I A;  4YI8 A;  2NXQ A;  2IS9 A;  3O6B A;  4MRX A;  1QIW A;  2ISD A;  3CZT X;  3SG5 A;  4OKH A;  3I5I C;  1K9K A;  4ORA B;  1PAL A;  4HRE E;  1UUR A;  2MLE C;  3O78 A;  3TDZ A;  1NSH A;  1XK4 C;  1PVA A;  2WC8 A;  3DD4 A;  1KCY A;  5CPV A;  4F0Z B;  2KDH A;  3LLE A;  1K8U A;  1JC2 A;  2O5G A;  1UHN A;  4PCW A;  5AEQ A;  1M46 A;  3WXA A;  5GQQ C;  1MQ1 A;  2LMU A;  2NCP A;  1CLB A;  2OS8 B;  3SIB A;  4C0K A;  3DVE A;  1C7V A;  2M97 A;  1XFU O;  2LHI A;  1ZOT B;  3ICB A;  3VRQ A;  1MR8 A;  1AK8 A;  1YUT A;  1LKJ A;  4GGN A;  4MVF A;  1MXE A;  1IG5 A;  2PSR A;  5HLO A;  4BY5 A;  1FPW A;  4JQ0 D;  1OSA A;  2M1U A;  3CLN A;  3I5H B;  5KU1 A;  2AUC A;  4OR9 B;  1CDM A;  2Q4U A;  1TNX A;  2LE9 B;  1BOD A;  4MSP A;  1Y0V H;  2LCP A;  3EK7 A;  1H8B A;  2I7A A;  5TNC A;  3SG6 A;  1CFD A;  1JBA A;  3FS7 A;  3JTD B;  3VRR A;  1CKK A;  1RWY A;  2Y1N A;  5ER4 X;  1SMG A;  1K90 D;  1IH0 A;  4FTG A;  5D7F A;  2KI6 C;  3DVJ A;  3DF0 B;  2COL B;  4U8D A;  4WQ3 A;  3BUN B;  2M7N A;  2BCA A;  1NCY A;  1V1F A;  1ODB A;  2KI4 C;  2BBM A;  2G9B A;  2KHN A;  2BBN A;  2JT3 A;  4YGB B;  1DJY A;  2KBI A;  1BR4 B;  5BPJ A;  1TNP A;  5DKR A;  1CMG A;  1M31 A;  1AVS A;  1PSR A;  1J7Q A;  1FI5 A;  4GAO A;  1G4Y R;  2PRU A;  3PM8 A;  3WHU B;  3EVR A;  5B8I B;  1C07 A;  4ETO A;  1OQP A;  2BCB A;  1W7J B;  1K9P A;  3TDU A;  1SCV A;  4XJK A;  1OMD A;  1KWO C;  4IL1 A;  2PMY A;  2KGB C;  1B8C A;  2K7O A;  3O2P A;  1AP4 A;  1AHR A;  2AMI A;  3JVT B;  5HKY A;  2JXL A;  2B1U A;  4DCK A;  2EHB A;  2BCX A;  1F8H A;  2JT0 A;  1D1O A;  2M7L A;  1QIV A;  1KK8 C;  4PHK A;  1YX8 A;  3KF9 A;  1NCZ A;  1NX2 A;  1SL9 A;  1TOP A;  1SNL A;  2F33 A;  2L0P A;  5IBW A;  4OV2 A;  1Y1A A;  1IRJ A;  2WCE A;  2KFG A;  3SG4 A;  1KFU S;  2K7D A;  2JWW A;  1KK7 Y;  1R2U A;  5FYX A;  1PRW A;  1M45 A;  3K21 A;  3TDI A;  1KK8 B;  1BF5 A;  5AXI A;  1E8A A;  1F4O A;  3VRO A;  4ZCV A;  3QRX A;  1DTL A;  1UHK A;  3WNX B;  4AQJ A;  4HRH A;  1ZMZ A;  2K8M B;  2F2P A;  2CTN A;  3PAT A;  3SIA A;  3HCM A;  1S1E A;  1V1G A;  2F8P A;  3GK2 A;  5DKQ A;  1UHH A;  3AAK A;  2I2R E;  1DJI A;  2LNK A;  2WCF A;  1CFC A;  2BKH B;  1QJT A;  3PN7 B;  1DJG A;  4I5N B;  3CGA A;  2LVJ A;  1WRZ A;  3D0Y A;  2KI4 B;  3DF0 A;  4MLW A;  1SK6 D;  1PK0 D;  3I5I B;  4CPV A;  1KQM C;  1RFJ A;  3EVV A;  1QX2 A;  2LAP A;  4PE4 A;  3JVT C;  1KQM B;  3VGO A;  2WOS A;  1NCX A;  3NXA A;  2BL0 C;  1WRL A;  1F4Q A;  2LP2 A;  1S5G Z;  4ORC B;  1L2O C;  1J7P A;  1SW8 A;  2EC6 B;  2LC5 A;  3LK0 A;  1B8L A;  1BG1 A;  2WND A;  2WOR A;  1F55 A;  3H4S E;  2HET A;  4PAL A;  1ZFS A;  1TNW A;  1SPY A;  2MJW B;  2P6B B;  5I8N A;  1NYA A;  1OMV A;  3PFV A;  4DUQ A;  4YGA A;  1H4B A;  4QJ4 B;  4N1F A;  2FOT A;  2M3W A;  3EKJ A;  1MHO A; 
#chains in the Genus database with same CATH topology
 1OOJ A;  5I2L A;  1BT6 A;  4NDD A;  3FWB A;  4USL A;  1CTR A;  4YI9 A;  4QJ3 B;  1G33 A;  2ZRS A;  1ALV A;  1SRA A;  2EGD A;  1QLK A;  1MWN A;  3I5F C;  4XYN A;  1GGW A;  4HSZ A;  3JTD C;  1K96 A;  3D10 A;  2YGU A;  1S6I A;  5F6T A;  1XYD A;  4JPZ B;  2F3Y A;  4YGC B;  1FF1 A;  1NUB A;  2E30 A;  4JWQ A;  1QWV A;  1R6P A;  2PQL A;  4Q04 A;  5FI6 A;  4AOM A;  1EJ3 A;  2KAY A;  3A4U B;  1RTP 1;  3PN7 C;  2ZKM X;  4CFQ A;  3LK1 A;  3B6X A;  1Z4H A;  2HQ8 A;  5CSF A;  4GFT A;  1IQ3 A;  2K2F A;  1A2X A;  2LM5 A;  1B47 A;  2Q91 A;  2CT9 A;  1OZO A;  2PVB A;  4WQ2 A;  1A29 A;  1PUL A;  3EK8 A;  2KQY A;  1F54 A;  2LVV A;  2JXC A;  2HPS A;  1QTX A;  2SCP A;  1N2D A;  4PHJ A;  2BEC A;  2KSP A;  3A8R A;  3IQO A;  4E68 A;  4I5K A;  1HT9 A;  3NSK A;  4A4C A;  1TNQ A;  1QX7 A;  4BY4 A;  1RJV A;  1TUJ A;  1KWO B;  3E3R A;  2BL0 B;  2L2E A;  3S0B A;  2L5Y A;  4NQG A;  2BKI B;  2LLT A;  2WCM A;  1SR6 B;  2JRF A;  3NHT A;  2LVI A;  1CM4 A;  2LLU A;  2LVK A;  1WLM A;  2Y4Q A;  4GUK A;  2LUC A;  1J7O A;  4AQI A;  1LA3 A;  2D8N A;  2FJU B;  2JUL A;  3D74 A;  4IJ7 A;  1EG4 A;  2JT8 A;  5JJG A;  3NGV A;  1NPQ A;  2CNP A;  1GQM A;  1BMO A;  3HX4 A;  3OP0 A;  1M39 A;  2PAS A;  3DY9 A;  3D78 A;  1P28 A;  1YVL A;  3KHE A;  3OB1 B;  5AER A;  1IKU A;  1BOC A;  4C0J A;  1S26 D;  1LS8 A;  1B1G A;  4MRY A;  3TUY C;  3KEV A;  1REC A;  3RLZ A;  1NWD A;  5DKN A;  3BJH A;  1C3Y A;  1S6J A;  2ERB A;  1UP5 A;  1W7I B;  2KYC A;  1KQV A;  1OOH A;  2LUX A;  4GGF C;  1QVI Z;  4ZCU A;  2MRD A;  2WCH A;  1AUI B;  2NCO A;  2HQW A;  3EK4 A;  5D69 A;  1SBJ A;  2KOT A;  5HKZ A;  1YRU B;  2BE6 A;  3DVK A;  1GGZ A;  2KPH A;  1IIO A;  2NZ0 A;  1IGV A;  1T14 A;  3NSO A;  2A4J A;  2BNX A;  3TUY B;  2M49 B;  3L47 A;  1SY9 A;  1Y6W A;  1TWO A;  2JOJ A;  1A75 A;  1XFW O;  2LMV A;  2QDI A;  3CR2 A;  4GBA A;  2KAV A;  1QXP A;  2QAC A;  4MZK A;  1QAT A;  4WRI A;  1AJ5 A;  5HL1 A;  2QEB A;  1DJW A;  2JU0 A;  1SL7 A;  2L4I A;  2L51 A;  3KO0 A;  2L50 A;  3OX5 A;  4DIR A;  1JSA A;  2F2O A;  1EG3 A;  2GGZ A;  1JWD A;  4GGF A;  1CFP A;  3C1V A;  4P2Y B;  1KSO A;  1M63 B;  1MF8 B;  4OVN F;  1JFJ A;  2Y5I A;  4INX A;  4PE1 A;  3CR4 X;  3PLF B;  3Q8I A;  3SS3 A;  3VRP A;  2TN4 A;  2ZFD A;  1LA0 A;  2JTZ A;  3SS5 A;  1WDC C;  2L5X B;  2QEV A;  1B8R A;  2JNF A;  1CLM A;  4M2Q A;  1NX0 A;  1DC1 A;  2LLS A;  1TCF A;  1DJH A;  2ZND A;  1ZUZ A;  1CB1 A;  2WCK A;  1QLS A;  1XO5 A;  2WCL A;  2LP3 A;  4MEW A;  2KFF A;  3SG7 A;  5HYD A;  5AAN A;  3CR5 X;  3PM2 A;  1TTX A;  3RM1 A;  2CXJ A;  5FI2 A;  1XA5 A;  5G08 A;  3LCP C;  3R1P A;  1U5I A;  2OTG C;  3TS5 B;  1J55 A;  1S36 A;  3BUO B;  3CDN A;  4PHN A;  4ORB B;  1B4C A;  1CNP A;  1XFV O;  1XFZ O;  4UPG A;  1TCO B;  1PSB A;  2G2B A;  2NLN A;  1IQ5 A;  2OS8 C;  3UNW A;  1WRK A;  3DXL A;  3O4Y A;  5CSN A;  3ZWH A;  3L4L A;  2KAX A;  1A75 B;  2JTT A;  3WHT B;  1KFX S;  2KFH A;  3IVT A;  1X02 A;  4HRG A;  1QX5 B;  4MBE A;  4C0L A;  3CZ0 A;  3I5G C;  5PAL A;  2KQ6 A;  1CMF A;  3FE6 A;  1QV1 A;  3B7A A;  4I5J A;  4CID A;  2MA2 A;  1KSM A;  5CSI A;  2MHH A;  5FI7 A;  4PE7 A;  5HKW A;  1C3Z A;  1DGV A;  1ORG A;  4DS7 A;  2ZN9 A;  4CFR A;  2JNX A;  2VRG A;  2WC5 A;  3GK1 A;  3OHM B;  2F3Z A;  1LIN A;  1FBV A;  1A03 A;  2WCB A;  1YR5 A;  1B7T Y;  1XVJ A;  2AAO A;  5I94 A;  3B87 A;  1OOG A;  3KPX A;  2CCM A;  4MZJ A;  3M0W A;  4P5O E;  1EH2 A;  2H8V A;  2PAL A;  2MLF C;  1YUR A;  4TNC A;  2JC2 A;  2GGM A;  1YUU A;  3LL8 B;  3O4X A;  3K1E A;  1TUZ A;  2E6W A;  2M9G A;  1XK4 A;  1S6C A;  1SCM C;  1IJ6 A;  3FWC A;  1BR1 B;  3NSL A;  1C7W A;  1K94 A;  5KSZ A;  1SYM A;  2K0J A;  2M0R A;  1RK9 A;  3SJS A;  3BOW B;  1N0Y A;  3FE9 A;  2JQ6 A;  2H2K A;  1ZAC A;  1LVC D;  3CTN A;  1WY9 A;  3N7H A;  2DOQ A;  2K7C A;  3BYA A;  3EVU A;  5ER5 A;  2O60 A;  2QPT A;  3BUW B;  5KTY A;  1TIZ A;  1JF2 A;  3F45 A;  4MN0 A;  1B9A A;  4YGD B;  1NP8 A;  1K2H A;  3D73 A;  5I2O A;  1BU3 A;  1EXR A;  4GPL B;  2Y1M A;  1PVB A;  1S3P A;  1YX7 A;  1IJ5 A;  2K61 A;  3BQ3 A;  3BUM B;  1SCM B;  3BXK A;  1TN4 A;  1OZS A;  4NDC A;  3SG3 A;  2L98 A;  4NDB A;  1KK7 Z;  4N5X A;  3BOW A;  1JFK A;  1K95 A;  3NSI A;  1OE9 B;  3MSE B;  3OB2 B;  3BUX B;  3RZS A;  3DVM A;  2LAN A;  1DEL A;  1NX1 A;  1QVI Y;  1YRT B;  1U5I B;  3I5G B;  3OX6 A;  1J1D A;  1G8I A;  4M2P A;  2LV7 A;  1QV0 A;  1F70 A;  1L7Z A;  1OMR A;  2SAS A;  2CBL A;  2H61 A;  1F71 A;  1CDN A;  5D3O A;  4L9M A;  3S0E A;  2ZN8 A;  1DT7 B;  2FCD A;  1NIW A;  5J3X A;  4I5L B;  4XJK B;  3FIA A;  4M2O A;  5K89 A;  1WLZ A;  5JOL A;  1XFY O;  1DVI A;  1YUS A;  3EKH A;  3SS4 A;  3TS5 C;  3SG2 A;  1CFF A;  3R1O A;  2OPO A;  2HF5 A;  2ZNE A;  1SR6 C;  2FCE A;  3AAJ A;  3AKA A;  1SSE B;  1FW4 A;  1L2O B;  1UHI A;  1S5G Y;  4GNK B;  1DJX A;  1CM1 A;  4MZL A;  2K7B A;  5CSJ A;  1B7T Z;  4DRW A;  1HQV A;  1DGU A;  1YTZ C;  2OTG B;  2M8U A;  1MUX A;  4A4B A;  1MXL C;  2I94 A;  1BLQ A;  4R1E A;  2BE4 A;  4N1G A;  2ZRT A;  3D77 A;  1JF0 A;  1NX3 A;  1VRK A;  1GJY A;  2LMT A;  1ALW A;  1SL8 A;  4PDZ A;  4YBH B;  3PSR A;  2H61 C;  2GV5 A;  2K2A A;  4QJ5 B;  2KGR A;  1KFU L;  2L4H A;  3CWG A;  1OOI X;  1DMO A;  3CS1 A;  4YRU A;  4OCI A;  1Q80 A;  3UO9 A;  1YVH A;  3IF7 A;  4YGE B;  2M29 A;  1XFX O;  3GOF A;  3OBV A;  3AKB A;  1DJZ A;  2KNE A;  3CZ1 A;  1K9U A;  4INW A;  1BJF A;  1IWQ A;  1N65 A;  1UUS A;  3IQQ A;  1J1E A;  1Y1U A;  1DF0 A;  2QEH A;  4CLN A;  5AFP A;  1CLL A;  1SKT A;  1CDP A;  4OZD A;  2M1K B;  3TZ1 A;  3ZNI A;  4D1E A;  3GK4 X;  1TRF A;  1K93 D;  1UHJ A;  2KI6 D;  2EC6 C;  1A4P A;  1FI6 A;  2KYF A;  1LXF C;  3I5H C;  1CDL A;  1XFR A;  2RGI A;  1Y1X A;  1J7R A;  2JPT A;  2LHL A;  3D0Y B;  3I5F B;  2MAZ A;  1AJ4 A;  2KLE A;  2KBM A;  5HLV A;  1QS7 A;  1EL4 A;  1RRO A;  4PE0 A;  4JKT A;  3DZT A;  3DYE A;  4ICB A;  1KFX L;  1UWO A;  2V53 A;  4PHM A;  2FJY A;  2JZI A;  1DF0 B;  3VRN A;  2MBX A;  3PAL A;  2I18 A;  1QAS A;  5EL2 A;  3OGN A;  1DEK A;  5I2Q A;  4FQO A;  1DQE A;  1JUO A;  1WDC B;  2R2I A;  4YI8 A;  4PT1 A;  2NXQ A;  2IS9 A;  3O6B A;  4MRX A;  1QIW A;  2ISD A;  3CZT X;  3SG5 A;  4OKH A;  3I5I C;  1K9K A;  4ORA B;  1PAL A;  4HRE E;  1UUR A;  2MLE C;  2WC6 A;  3O78 A;  1NSH A;  3TDZ A;  1XK4 C;  1PVA A;  2WC8 A;  3DD4 A;  1KCY A;  5CPV A;  4F0Z B;  2KDH A;  3LLE A;  1K8U A;  1JC2 A;  1GM0 A;  2O5G A;  1UHN A;  4PCW A;  5AEQ A;  1M46 A;  3WXA A;  5GQQ C;  1MQ1 A;  2LMU A;  3V2L A;  2NCP A;  1CLB A;  2OS8 B;  3SIB A;  4C0K A;  3DVE A;  1OOF A;  2P71 A;  1C7V A;  2M97 A;  1XFU O;  4JD9 A;  2LHI A;  1ZOT B;  3ICB A;  3VRQ A;  1MR8 A;  1AK8 A;  1YUT A;  1LKJ A;  4GGN A;  4MVF A;  1MXE A;  1IG5 A;  2PSR A;  5HLO A;  4BY5 A;  1FPW A;  4JQ0 D;  1OSA A;  2M1U A;  3CLN A;  3I5H B;  5KU1 A;  2AUC A;  4OR9 B;  1CDM A;  2Q4U A;  3QME A;  2PYQ A;  1TNX A;  2LE9 B;  1BOD A;  4MSP A;  1Y0V H;  2LCP A;  3EK7 A;  1H8B A;  2I7A A;  5TNC A;  3SG6 A;  1CFD A;  1JBA A;  3S0F A;  3FS7 A;  3JTD B;  3VRR A;  1CKK A;  1RWY A;  2BAP A;  4F7F A;  2Y1N A;  5ER4 X;  1SMG A;  1K90 D;  1W9Z A;  1IH0 A;  4FTG A;  5D7F A;  2KI6 C;  3DVJ A;  3DF0 B;  2COL B;  2L2C A;  4U8D A;  4WQ3 A;  3BUN B;  2M7N A;  2BCA A;  3CAB A;  1NCY A;  2GTE A;  1V1F A;  1ODB A;  2KI4 C;  2BBM A;  2G9B A;  2KHN A;  2BBN A;  2JT3 A;  4YGB B;  1DJY A;  2KBI A;  1BR4 B;  5BPJ A;  1TNP A;  5DKR A;  1CMG A;  1M31 A;  1AVS A;  1PSR A;  1J7Q A;  1FI5 A;  4GAO A;  2QEO A;  1G4Y R;  2PRU A;  3PM8 A;  3BFH A;  3WHU B;  3EVR A;  3L4A A;  5B8I B;  1C07 A;  4ETO A;  1OQP A;  2BCB A;  1W7J B;  1K9P A;  3TDU A;  1SCV A;  4XJK A;  1OMD A;  1KWO C;  2KLD A;  4IL1 A;  2PMY A;  2KGB C;  1B8C A;  2K7O A;  3O2P A;  1AP4 A;  1AHR A;  2AMI A;  3B86 A;  3JVT B;  5HKY A;  2JXL A;  2B1U A;  4DCK A;  2EHB A;  2BCX A;  1F8H A;  2JT0 A;  1D1O A;  2M7L A;  1QIV A;  1KK8 C;  4PHK A;  1YX8 A;  3KF9 A;  3S0G A;  1NCZ A;  1NX2 A;  1SL9 A;  1TOP A;  1SNL A;  2F33 A;  2L0P A;  3VB1 A;  5IBW A;  4OV2 A;  2K60 A;  1Y1A A;  3CZ2 A;  1IRJ A;  2WCE A;  2KFG A;  3SG4 A;  1KFU S;  2K7D A;  4FQT A;  2JWW A;  1KK7 Y;  1R2U A;  5FYX A;  1PRW A;  1Z2C B;  1M45 A;  3K21 A;  3S0A A;  5DIC A;  1KK8 B;  3TDI A;  1BF5 A;  5AXI A;  1E8A A;  1F4O A;  3VRO A;  2JPO A;  4ZCV A;  3B88 A;  3QRX A;  1DTL A;  1UHK A;  3WNX B;  4AQJ A;  4HRH A;  1ZMZ A;  2K8M B;  2F2P A;  2CTN A;  3PAT A;  3SIA A;  3HCM A;  2P70 A;  1S1E A;  1V1G A;  2F8P A;  3GK2 A;  5DKQ A;  1UHH A;  3AAK A;  2WCJ A;  3PJI A;  2I2R E;  3R1V A;  1DJI A;  2LNK A;  2WCF A;  1CFC A;  2BKH B;  1QJT A;  3PN7 B;  1DJG A;  4I5N B;  3BFB A;  3CGA A;  2LVJ A;  1OW4 A;  3NHI A;  1WRZ A;  3D0Y A;  2KI4 B;  3DF0 A;  4MLW A;  1SK6 D;  1PK0 D;  3I5I B;  4CPV A;  3D76 A;  4KYN A;  1KQM C;  1RFJ A;  3D75 A;  3EVV A;  1QX2 A;  2LAP A;  4PE4 A;  3JVT C;  1KQM B;  3EG5 B;  3VGO A;  2WOS A;  1NCX A;  3NXA A;  2BL0 C;  1WRL A;  1F4Q A;  2LP2 A;  1S5G Z;  4ORC B;  1L2O C;  1J7P A;  1SW8 A;  2EC6 B;  2LC5 A;  3LK0 A;  1B8L A;  1BG1 A;  2WND A;  2WOR A;  3R72 A;  1F55 A;  3H4S E;  2HET A;  4PAL A;  3BFA A;  1ZFS A;  1TNW A;  1SPY A;  2MJW B;  2P6B B;  5I8N A;  1NYA A;  1OMV A;  3PFV A;  3S0D A;  4DUQ A;  4YGA A;  1H4B A;  3CYZ A;  4QJ4 B;  3FE8 A;  4N1F A;  2FOT A;  2M3W A;  3EKJ A;  1MHO A; 
#chains in the Genus database with same CATH homology
 1OOJ A;  5I2L A;  1BT6 A;  4NDD A;  3FWB A;  4USL A;  1CTR A;  4YI9 A;  4QJ3 B;  1G33 A;  2ZRS A;  1ALV A;  1SRA A;  2EGD A;  1QLK A;  1MWN A;  3I5F C;  4XYN A;  1GGW A;  4HSZ A;  3JTD C;  1K96 A;  3D10 A;  1S6I A;  5F6T A;  1XYD A;  4JPZ B;  2F3Y A;  4YGC B;  1FF1 A;  1NUB A;  2E30 A;  4JWQ A;  1R6P A;  4AOM A;  4Q04 A;  1EJ3 A;  2KAY A;  3A4U B;  1RTP 1;  3PN7 C;  2ZKM X;  4CFQ A;  3LK1 A;  2HQ8 A;  5CSF A;  4GFT A;  1IQ3 A;  2K2F A;  1A2X A;  2LM5 A;  1B47 A;  2Q91 A;  2CT9 A;  1OZO A;  2PVB A;  4WQ2 A;  1A29 A;  1PUL A;  3EK8 A;  2KQY A;  1F54 A;  2LVV A;  2JXC A;  2HPS A;  1QTX A;  2SCP A;  1N2D A;  4PHJ A;  2BEC A;  2KSP A;  3A8R A;  3IQO A;  4E68 A;  4I5K A;  1HT9 A;  3NSK A;  4A4C A;  1TNQ A;  1QX7 A;  4BY4 A;  1RJV A;  1KWO B;  3E3R A;  2BL0 B;  2L2E A;  4NQG A;  2BKI B;  2LLT A;  1SR6 B;  2JRF A;  2LVI A;  1CM4 A;  2LLU A;  2LVK A;  1WLM A;  2Y4Q A;  4GUK A;  2LUC A;  1J7O A;  4AQI A;  1LA3 A;  2D8N A;  2FJU B;  2JUL A;  1EG4 A;  2JT8 A;  5JJG A;  1NPQ A;  2CNP A;  1GQM A;  1BMO A;  3HX4 A;  3OP0 A;  1M39 A;  2PAS A;  3KHE A;  3OB1 B;  1BOC A;  1YVL A;  5AER A;  1IKU A;  4C0J A;  1S26 D;  1B1G A;  4MRY A;  3TUY C;  3KEV A;  1REC A;  3RLZ A;  1NWD A;  5DKN A;  1S6J A;  1UP5 A;  1W7I B;  2KYC A;  1KQV A;  2LUX A;  4GGF C;  1QVI Z;  4ZCU A;  2MRD A;  1AUI B;  2NCO A;  2HQW A;  3EK4 A;  5D69 A;  1SBJ A;  2KOT A;  5HKZ A;  1YRU B;  2BE6 A;  3DVK A;  1GGZ A;  2NZ0 A;  1IGV A;  3NSO A;  2A4J A;  3TUY B;  2M49 B;  1SY9 A;  1Y6W A;  2JOJ A;  1A75 A;  1XFW O;  2LMV A;  3CR2 A;  4GBA A;  2KAV A;  1QXP A;  2QAC A;  4MZK A;  1QAT A;  4WRI A;  1AJ5 A;  1DJW A;  2JU0 A;  1SL7 A;  2L4I A;  2L51 A;  3KO0 A;  2L50 A;  3OX5 A;  4DIR A;  1JSA A;  2GGZ A;  2F2O A;  1EG3 A;  1JWD A;  4GGF A;  1CFP A;  3C1V A;  4P2Y B;  1KSO A;  1M63 B;  1MF8 B;  4OVN F;  1JFJ A;  2Y5I A;  4PE1 A;  3CR4 X;  3PLF B;  3VRP A;  2TN4 A;  2ZFD A;  1LA0 A;  2JTZ A;  1WDC C;  2L5X B;  1B8R A;  2JNF A;  1CLM A;  4M2Q A;  1NX0 A;  2LLS A;  1TCF A;  1DJH A;  2ZND A;  1ZUZ A;  1CB1 A;  1QLS A;  1XO5 A;  2LP3 A;  4MEW A;  2KFF A;  3SG7 A;  5HYD A;  5AAN A;  3CR5 X;  1TTX A;  3RM1 A;  2CXJ A;  1XA5 A;  5G08 A;  3LCP C;  3TS5 B;  1U5I A;  2OTG C;  1B4C A;  1J55 A;  1S36 A;  3BUO B;  4PHN A;  4ORB B;  1CNP A;  1XFV O;  1XFZ O;  4UPG A;  1TCO B;  1PSB A;  2G2B A;  2NLN A;  1IQ5 A;  2OS8 C;  1WRK A;  3O4Y A;  5CSN A;  3ZWH A;  2KAX A;  1A75 B;  2JTT A;  3WHT B;  1KFX S;  2KFH A;  1X02 A;  4HRG A;  1QX5 B;  4MBE A;  4C0L A;  3I5G C;  5PAL A;  2KQ6 A;  1CMF A;  1QV1 A;  4I5J A;  4CID A;  2MA2 A;  1KSM A;  5CSI A;  2MHH A;  4PE7 A;  5HKW A;  1DGV A;  4DS7 A;  2ZN9 A;  4CFR A;  2JNX A;  2VRG A;  3GK1 A;  3OHM B;  2F3Z A;  1LIN A;  1FBV A;  1A03 A;  2WCB A;  1YR5 A;  1B7T Y;  1XVJ A;  2AAO A;  1EH2 A;  3KPX A;  2CCM A;  4MZJ A;  3M0W A;  4P5O E;  2PAL A;  2MLF C;  1YUR A;  4TNC A;  2JC2 A;  2GGM A;  1YUU A;  3LL8 B;  2E6W A;  2M9G A;  1XK4 A;  1S6C A;  1SCM C;  1IJ6 A;  3FWC A;  1BR1 B;  3NSL A;  1C7W A;  1K94 A;  5KSZ A;  1SYM A;  2K0J A;  2M0R A;  1RK9 A;  3SJS A;  3BOW B;  1N0Y A;  2JQ6 A;  2H2K A;  1ZAC A;  1LVC D;  3CTN A;  1WY9 A;  2DOQ A;  2K7C A;  3BYA A;  3EVU A;  5ER5 A;  2O60 A;  2QPT A;  3BUW B;  5KTY A;  1TIZ A;  1JF2 A;  3F45 A;  4MN0 A;  1B9A A;  4YGD B;  1NP8 A;  1K2H A;  5I2O A;  1BU3 A;  1EXR A;  4GPL B;  2Y1M A;  1PVB A;  1S3P A;  1YX7 A;  1IJ5 A;  2K61 A;  3BQ3 A;  3BUM B;  1SCM B;  3BXK A;  1TN4 A;  1OZS A;  4NDC A;  3SG3 A;  2L98 A;  4NDB A;  1KK7 Z;  4N5X A;  3BOW A;  1JFK A;  1K95 A;  3NSI A;  1OE9 B;  3MSE B;  3OB2 B;  3BUX B;  3DVM A;  2LAN A;  1NX1 A;  1QVI Y;  1YRT B;  1U5I B;  3I5G B;  3OX6 A;  1J1D A;  1G8I A;  4M2P A;  2LV7 A;  1QV0 A;  1F70 A;  1L7Z A;  1OMR A;  2SAS A;  2CBL A;  2H61 A;  1F71 A;  1CDN A;  4L9M A;  2ZN8 A;  1DT7 B;  2FCD A;  1NIW A;  5J3X A;  4I5L B;  4XJK B;  3FIA A;  4M2O A;  5K89 A;  1WLZ A;  5JOL A;  1XFY O;  1DVI A;  1YUS A;  3EKH A;  3TS5 C;  3SG2 A;  1CFF A;  2OPO A;  2HF5 A;  2ZNE A;  1SR6 C;  2FCE A;  3AAJ A;  3AKA A;  1FW4 A;  1L2O B;  1UHI A;  1S5G Y;  4GNK B;  1DJX A;  1CM1 A;  4MZL A;  2K7B A;  5CSJ A;  1B7T Z;  4DRW A;  1HQV A;  1DGU A;  1YTZ C;  2OTG B;  2M8U A;  1MUX A;  4A4B A;  1MXL C;  2I94 A;  1BLQ A;  4R1E A;  2BE4 A;  4N1G A;  2ZRT A;  1JF0 A;  1NX3 A;  1VRK A;  1GJY A;  2LMT A;  1ALW A;  1SL8 A;  4PDZ A;  4YBH B;  3PSR A;  2H61 C;  2GV5 A;  2K2A A;  4QJ5 B;  2KGR A;  1KFU L;  2L4H A;  3CWG A;  1DMO A;  3CS1 A;  4YRU A;  4OCI A;  1Q80 A;  1YVH A;  3IF7 A;  4YGE B;  2M29 A;  1XFX O;  3GOF A;  3AKB A;  1DJZ A;  2KNE A;  1K9U A;  1BJF A;  1IWQ A;  1N65 A;  1UUS A;  3IQQ A;  1J1E A;  1Y1U A;  1DF0 A;  4CLN A;  5AFP A;  1CLL A;  1SKT A;  1CDP A;  2M1K B;  3TZ1 A;  3ZNI A;  4D1E A;  3GK4 X;  1TRF A;  1K93 D;  1UHJ A;  2KI6 D;  2EC6 C;  1A4P A;  1FI6 A;  2KYF A;  1LXF C;  3I5H C;  1CDL A;  2RGI A;  1Y1X A;  1J7R A;  2JPT A;  2LHL A;  3D0Y B;  3I5F B;  2MAZ A;  1AJ4 A;  2KBM A;  5HLV A;  1QS7 A;  1EL4 A;  1RRO A;  4PE0 A;  4ICB A;  1KFX L;  1UWO A;  2V53 A;  4PHM A;  2JZI A;  1DF0 B;  3VRN A;  2MBX A;  3PAL A;  2I18 A;  1QAS A;  5I2Q A;  4FQO A;  1JUO A;  1WDC B;  2R2I A;  4YI8 A;  2NXQ A;  2IS9 A;  3O6B A;  4MRX A;  1QIW A;  2ISD A;  3CZT X;  3SG5 A;  4OKH A;  3I5I C;  1K9K A;  4ORA B;  1PAL A;  4HRE E;  1UUR A;  2MLE C;  3O78 A;  3TDZ A;  1NSH A;  1XK4 C;  1PVA A;  2WC8 A;  3DD4 A;  1KCY A;  5CPV A;  4F0Z B;  2KDH A;  3LLE A;  1K8U A;  1JC2 A;  2O5G A;  1UHN A;  4PCW A;  5AEQ A;  1M46 A;  3WXA A;  5GQQ C;  1MQ1 A;  2LMU A;  2NCP A;  1CLB A;  2OS8 B;  3SIB A;  4C0K A;  3DVE A;  1C7V A;  2M97 A;  1XFU O;  2LHI A;  1ZOT B;  3ICB A;  3VRQ A;  1MR8 A;  1AK8 A;  1YUT A;  1LKJ A;  4GGN A;  4MVF A;  1MXE A;  1IG5 A;  2PSR A;  5HLO A;  4BY5 A;  1FPW A;  4JQ0 D;  1OSA A;  2M1U A;  3CLN A;  3I5H B;  5KU1 A;  2AUC A;  4OR9 B;  1CDM A;  2Q4U A;  1TNX A;  2LE9 B;  1BOD A;  4MSP A;  1Y0V H;  2LCP A;  3EK7 A;  1H8B A;  2I7A A;  5TNC A;  3SG6 A;  1CFD A;  1JBA A;  3FS7 A;  3JTD B;  3VRR A;  1CKK A;  1RWY A;  2Y1N A;  5ER4 X;  1SMG A;  1K90 D;  1IH0 A;  4FTG A;  5D7F A;  2KI6 C;  3DVJ A;  3DF0 B;  2COL B;  4U8D A;  4WQ3 A;  3BUN B;  2M7N A;  2BCA A;  1NCY A;  1V1F A;  1ODB A;  2KI4 C;  2BBM A;  2G9B A;  2KHN A;  2BBN A;  2JT3 A;  4YGB B;  1DJY A;  2KBI A;  1BR4 B;  5BPJ A;  1TNP A;  5DKR A;  1CMG A;  1M31 A;  1AVS A;  1PSR A;  1J7Q A;  1FI5 A;  4GAO A;  1G4Y R;  2PRU A;  3PM8 A;  3WHU B;  3EVR A;  5B8I B;  1C07 A;  4ETO A;  1OQP A;  2BCB A;  1W7J B;  1K9P A;  3TDU A;  1SCV A;  4XJK A;  1OMD A;  1KWO C;  4IL1 A;  2PMY A;  2KGB C;  1B8C A;  2K7O A;  3O2P A;  1AP4 A;  1AHR A;  2AMI A;  3JVT B;  5HKY A;  2JXL A;  2B1U A;  4DCK A;  2EHB A;  2BCX A;  1F8H A;  2JT0 A;  1D1O A;  2M7L A;  1QIV A;  1KK8 C;  4PHK A;  1YX8 A;  3KF9 A;  1NCZ A;  1NX2 A;  1SL9 A;  1TOP A;  1SNL A;  2F33 A;  2L0P A;  5IBW A;  4OV2 A;  1Y1A A;  1IRJ A;  2WCE A;  2KFG A;  3SG4 A;  1KFU S;  2K7D A;  2JWW A;  1KK7 Y;  1R2U A;  5FYX A;  1PRW A;  1M45 A;  3K21 A;  3TDI A;  1KK8 B;  1BF5 A;  5AXI A;  1E8A A;  1F4O A;  3VRO A;  4ZCV A;  3QRX A;  1DTL A;  1UHK A;  3WNX B;  4AQJ A;  4HRH A;  1ZMZ A;  2K8M B;  2F2P A;  2CTN A;  3PAT A;  3SIA A;  3HCM A;  1S1E A;  1V1G A;  2F8P A;  3GK2 A;  5DKQ A;  1UHH A;  3AAK A;  2I2R E;  1DJI A;  2LNK A;  2WCF A;  1CFC A;  2BKH B;  1QJT A;  3PN7 B;  1DJG A;  4I5N B;  3CGA A;  2LVJ A;  1WRZ A;  3D0Y A;  2KI4 B;  3DF0 A;  4MLW A;  1SK6 D;  1PK0 D;  3I5I B;  4CPV A;  1KQM C;  1RFJ A;  3EVV A;  1QX2 A;  2LAP A;  4PE4 A;  3JVT C;  1KQM B;  3VGO A;  2WOS A;  1NCX A;  3NXA A;  2BL0 C;  1WRL A;  1F4Q A;  2LP2 A;  1S5G Z;  4ORC B;  1L2O C;  1J7P A;  1SW8 A;  2EC6 B;  2LC5 A;  3LK0 A;  1B8L A;  1BG1 A;  2WND A;  2WOR A;  1F55 A;  3H4S E;  2HET A;  4PAL A;  1ZFS A;  1TNW A;  1SPY A;  2MJW B;  2P6B B;  5I8N A;  1NYA A;  1OMV A;  3PFV A;  4DUQ A;  4YGA A;  1H4B A;  4QJ4 B;  4N1F A;  2FOT A;  2M3W A;  3EKJ A;  1MHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...