4P2YB

Crystal structure of the human rage ectodomain (fragment vc1c2) in complex with mouse s100a6
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
88
structure length
88
Chain Sequence
ACPLDQAIGLLVAIFHKYSGKEGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMDDLDRNKDQEVNFQEYVAFLGALALIYNEALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Advanced glycosylation end product-specific receptor
publication title The Structure of the RAGE:S100A6 Complex Reveals a Unique Mode of Homodimerization for S100 Proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 36
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2014-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4p2yB00
2CT9A 4HRGA 4YBHB 1A03A 1KFUS 2LNKA 1SPYA 1S6CA 2L51A 4YGAA 1PSRA 1WRLA 1FI6A 2KDHA 5HLOA 3ICBA 1M45A 1W7JB 2M0RA 4MN0A 4NDDA 2GGMA 2OS8B 3EVUA 1OE9B 5DKRA 3SG5A 2ZN8A 1GGWA 3HX4A 5G08A 2Y5IA 1KK8C 1NIWA 2PRUA 4GNKB 1KCYA 3CTNA 2KGRA 1AUIB 3OP0A 2JC2A 1NUBA 1QLSA 1L7ZA 1CM4A 1J7RA 2LMVA 5F6TA 3VRQA 1XYDA 1LXFC 3SIAA 1G8IA 3DVMA 2O5GA 1DJGA 1YURA 3DF0B 1F4OA 2KI6D 2H2KA 2F33A 1VRKA 3SG3A 1DF0B 2OS8C 4CFRA 2CBLA 3EK4A 4I5KA 4YRUA 1NCZA 2WCFA 1MWNA 1M46A 1ALWA 1CFCA 3OHMB 1A2XA 1SR6B 2HF5A 4E68A 3PFVA 1C7WA 1IKUA 3PSRA 2F8PA 1Y1XA 4YGDB 4JPZB 1B8RA 1QV1A 1FPWA 1HT9A 2WORA 2BCXA 2LV7A 4QJ5B 4NDCA 1MQ1A 1XFYO 5CPVA 2LLUA 2G9BA 4MLWA 1QS7A 1B1GA 3VRPA 1QVIZ 5FYXA 3WNXB 3H4SE 1MR8A 1DGUA 1N65A 3BXKA 4CFQA 5CSNA 1K94A 1Y6WA 1KFXL 2JNXA 4HSZA 2KYCA 1M39A 4I5LB 4Q04A 2Q4UA 1XK4A 4HREE 2AAOA 1CDPA 1FW4A 1X02A 1QX2A 3WXAA 1K95A 2LUCA 1HQVA 1NSHA 1RWYA 2M8UA 2AUCA 4PHJA 2OTGC 4M2OA 1SL9A 4MZJA 3IF7A 1G33A 1WLZA 4CPVA 1ODBA 1QVIY 2KAYA 1BT6A 2LLTA 4AOMA 4DS7A 2KBMA 1CDLA 3MSEB 1ZUZA 2BKHB 1J7OA 1PALA 1RFJA 3NSIA 3LL8B 4L9MA 1RK9A 3QRXA 3TS5B 2MRDA 1PVBA 1ZMZA 1M31A 1S26D 5BPJA 2HETA 1YTZC 4ORBB 1A75B 2LE9B 1ZACA 3K21A 3NSLA 2CCMA 2LCPA 1N2DA 1GGZA 2ZKMX 4P2YB 5HYDA 1JF0A 1TTXA 3DVKA 1YX7A 1QV0A 2K7BA 4MZLA 1YR5A 2H61C 2NZ0A 4ZCUA 2EGDA 1IQ5A 3EKJA 3OX5A 2JT3A 2SCPA 3OB2B 5I2LA 2G2BA 1EG3A 3D10A 1JUOA 1UHIA 1JWDA 3NXAA 2CNPA 2KYFA 2BECA 2NLNA 1OZSA 1TIZA 1V1GA 2JOJA 2M49B 1QJTA 2WNDA 3BYAA 3I5HC 3BOWA 3EKHA 2BL0B 1KFUL 1BR1B 4GGFC 1CTRA 3TDIA 1QATA 2L98A 3ZWHA 1BU3A 2WOSA 4N1GA 3A8RA 3LCPC 4ZCVA 1KQMB 4R1EA 4PDZA 1UHJA 1J1EA 1XFXO 2JPTA 4GPLB 3NSOA 4M2PA 4F0ZB 1C07A 3LK1A 2KAXA 1BMOA 4GFTA 3AAKA 3ZNIA 4PE7A 1J7PA 1S6JA 2BCAA 1B4CA 5KU1A 1BF5A 1QIWA 3KO0A 1SK6D 1QTXA 2LVVA 2BL0C 3BUMB 5ER4X 3C1VA 1Q80A 3D0YB 3PLFB 5GQQC 3VRRA 2L0PA 4QJ4B 1J7QA 1F70A 4U8DA 4MRYA 5I2QA 2KQYA 1XA5A 2AMIA 2K0JA 1KQMC 4XJKA 1OMDA 3SG6A 4ICBA 2LP2A 2CTNA 2M7NA 1R2UA 1MXEA 1K93D 1JSAA 1JC2A 1LA3A 2WCEA 1F4QA 1RJVA 3RM1A 1EG4A 1UP5A 3PALA 1PSBA 2LLSA 2ISDA 1WLMA 5K89A 2I2RE 2MBXA 3SG2A 2ZN9A 4N1FA 4GAOA 5ER5A 3BUNB 1JF2A 1PRWA 1K96A 1NPQA 2NXQA 2V53A 3F45A 4DIRA 3HCMA 2GGZA 2PASA 4C0LA 2KGBC 1FF1A 3I5IB 2ZFDA 1K2HA 1DVIA 1N0YA 1B8CA 1F71A 3PM8A 3IQOA 1EJ3A 1V1FA 2CXJA 4YGEB 1YVHA 1LINA 2LHIA 2BE6A 2I18A 2KFFA 3EVVA 2WCBA 2OTGB 3A4UB 1CMGA 1OOJA 1IJ6A 4OV2A 1SCVA 2WC8A 4PHKA 4IL1A 4C0KA 2JWWA 1B8LA 1YUUA 1DJZA 1QLKA 1UUSA 5KTYA 2VRGA 3LK0A 2M97A 4P5OE 1SYMA 3WHTB 3I5IC 1C7VA 5CSJA 3WHUB 2JT8A 1CM1A 1OSAA 1K9PA 3EVRA 2OPOA 2PSRA 3CS1A 1YRUB 4USLA 1QIVA 1CFDA 2O60A 4NDBA 1UHHA 2L50A 3BOWB 1SKTA 1NCYA 2LMUA 2JXCA 3FWBA 1ZFSA 4C0JA 4ETOA 1OZOA 3CR5X 1G4YR 2K61A 1MUXA 2COLB 4I5NB 1YX8A 2Y1MA 1AJ5A 3PATA 5B8IB 4YGCB 3CWGA 4DRWA 4ORCB 3IQQA 1YUTA 2KNEA 3BQ3A 3NSKA 4PE0A 2ZRSA 1K9KA 2Q91A 2ZNDA 2JZIA 1KFXS 2HQWA 2KFHA 2LVJA 2PMYA 1WDCB 3VGOA 1NWDA 5AFPA 1S6IA 1WRKA 3BUOB 5AEQA 4YI9A 2PVBA 3I5HB 3BUWB 5AERA 4I5JA 1XFWO 1JBAA 2JU0A 2MLFC 4PHMA 5CSIA 1SL8A 3DF0A 1JFJA 1TN4A 2M29A 1DF0A 2BBMA 1DJXA 4CIDA 1EL4A 3GOFA 4MZKA 4TNCA 5HKZA 1U5IA 5KSZA 1CFPA 1W7IB 3O4YA 1DTLA 2JTZA 1IRJA 1E8AA 2JXLA 4MSPA 2E6WA 2KSPA 1SBJA 3KPXA 2K8MB 1CLMA 1WDCC 1IJ5A 3GK4X 4N5XA 3EK7A 3SIBA 3KEVA 3OX6A 2LP3A 1DJWA 3GK2A 4HRHA 4MVFA 1OMVA 5I2OA 2KI4C 1QX5B 1KSMA 1D1OA 2LC5A 4CLNA 3TUYC 2PALA 4GUKA 1CLBA 5HKWA 2BKIB 1IG5A 2F2PA 5CSFA 1XFZO 1BR4B 1QX7A 2M1UA 2KI6C 5TNCA 2E30A 2K2AA 2EC6C 2HPSA 4GGNA 1A29A 2JTTA 1UHKA 1ZOTB 3O6BA 2Y4QA 1PK0D 3CR2A 1S5GZ 2NCOA 1KQVA 1CKKA 4MBEA 1AHRA 1A4PA 1TNXA 2K7DA 4MEWA 1GJYA 1RECA 1SMGA 3E3RA 4WQ3A 1XVJA 2L4HA 1AJ4A 2MJWB 2LMTA 5I8NA 3CZTX 1YVLA 3GK1A 2KQ6A 2M3WA 4OCIA 3PN7B 1KK7Z 1TRFA 3AAJA 4A4BA 1Y0VH 2GV5A 3JTDC 2L2EA 1NX1A 1CLLA 5D7FA 1DMOA 1H4BA 4XYNA 2D8NA 4JQ0D 1MXLC 2BE4A 1A75A 1TNWA 1JFKA 4YGBB 3EK8A 1S5GY 4OR9B 1H8BA 2K2FA 4WQ2A 3KHEA 1DT7B 1XK4C 3CGAA 3CR4X 2QACA 1BLQA 2SASA 3AKBA 2KAVA 5D69A 2M7LA 3AKAA 3SG4A 4GGFA 1LKJA 2P6BB 4QJ3B 1CMFA 1B7TY 1S36A 2EHBA 4DCKA 2JNFA 1BODA 1UHNA 2I7AA 4AQIA 3PN7C 1TNPA 5AANA 1EH2A 1K8UA 1KK7Y 3BUXB 1SL7A 1CNPA 1B47A 5DKNA 1IH0A 4MRXA 5DKQA 4PE4A 3SG7A 2MA2A 4PALA 1OMRA 1NX2A 1J55A 1AVSA 4NQGA 2Y1NA 1TOPA 3I5GB 3M0WA 2B1UA 3SJSA 1U5IB 2A4JA 3LLEA 3DD4A 5PALA 4A4CA 1NX0A 4YI8A 1BG1A 4ORAB 1CB1A 3CLNA 1UURA 5JJGA 2FCEA 4PE1A 4JWQA 2M9GA 2K7OA 5J3XA 4BY4A 2LAPA 3TDZA 5HLVA 1OQPA 1LVCD 1MHOA 1SY9A 5AXIA 3I5FB 3FWCA 1YUSA 1IWQA 3I5GC 5HKYA 2RGIA 1EXRA 1NCXA 1S3PA 2K7CA 4WRIA 3TDUA 1SR6C 2BBNA 3D0YA 2I94A 3OB1B 4AQJA 4UPGA 1F54A 1DGVA 4M2QA 1UWOA 3DVEA 2F3ZA 1S1EA 1ALVA 4OVNF 2LVKA 2TN4A 1PVAA 2LHLA 2JRFA 1DJYA 3I5FC 5IBWA 2KI4B 1KWOB 1XO5A 2FJUB 3JVTB 4XJKB 1KSOA 2L5XB 2JULA 1CFFA 3TUYB 2MHHA 2FOTA 2M1KB 1XFVO 3TZ1A 2MAZA 4BY5A 1TCOB 2IS9A 5JOLA 1FI5A 1Y1UA 1SNLA 3VRNA 4FQOA 1SCMB 1CDMA 2F2OA 1R6PA 2EC6B 4DUQA 1RROA 2BCBA 3O2PA 2KHNA 1QASA 1TNQA 2JQ6A 1WY9A 1SRAA 3O78A 1F55A 2R2IA 2ZRTA 1L2OB 1WRZA 1IGVA 1F8HA 2HQ8A 1LA0A 1XFUO 3FIAA 1MF8B 1DJHA 2MLEC 1KWOC 2QPTA 4PCWA 3JVTC 2DOQA 2LVIA 3VROA 1PULA 2KOTA 4PHNA 4OKHA 1K9UA 1YRTB 3KF9A 3TS5C 1NYAA 2FCDA 1NP8A 1SCMC 4D1EA 1M63B 1K90D 3RLZA 1TCFA 1FBVA 2LUXA 1RTP1 2F3YA 4GBAA 3JTDB 2KFGA 2LM5A 1L2OC 2JT0A 1BJFA 1BOCA 2KBIA 3DVJA 3FS7A 2ZNEA 1CDNA 1KK8B 1QXPA 1GQMA 1AK8A 2H61A 2NCPA 4FTGA 1J1DA 1AP4A 1IQ3A 1DJIA 1B9AA 1NX3A 2L4IA 1Y1AA 1B7TZ 2LANA 1SW8A
chains in the Genus database with same CATH superfamily
3B88A 2CT9A 4HRGA 4YBHB 1A03A 1KFUS 3BFHA 2LNKA 1SPYA 3S0FA 1XFRA 1S6CA 2L51A 4YGAA 1PSRA 1WRLA 1FI6A 2KDHA 5HLOA 3ICBA 1M45A 1W7JB 2M0RA 4MN0A 4NDDA 2GGMA 2OS8B 3EVUA 1OE9B 5DKRA 3SG5A 2ZN8A 1GGWA 3HX4A 5G08A 3PM2A 2Y5IA 1KK8C 1NIWA 2PRUA 1OW4A 4GNKB 1KCYA 3CTNA 2KGRA 1AUIB 3O4XA 3OP0A 1TUJA 2JC2A 1NUBA 3UNWA 1QLSA 3R1PA 1L7ZA 2QDIA 1CM4A 5AERA 1J7RA 2LMVA 2P70A 2GTEA 5F6TA 3VRQA 1XYDA 1LXFC 3SIAA 1G8IA 3DVMA 2O5GA 3NGVA 1DJGA 1YURA 3DF0B 3Q8IA 1F4OA 2KI6D 2H2KA 3DYEA 2F33A 1VRKA 3SG3A 1DF0B 2OS8C 1DELA 4CFRA 2CBLA 3EK4A 3L4AA 4I5KA 4YRUA 1NCZA 3BFAA 2WCFA 1MWNA 1M46A 1ALWA 1CFCA 3OHMB 1A2XA 1SR6B 2HF5A 4E68A 1OOHA 1Z2CB 1C7WA 3PFVA 1IKUA 1TWOA 3PSRA 2F8PA 1Y1XA 4YGDB 4JPZB 1B8RA 1QV1A 1FPWA 1HT9A 2WORA 3S0EA 2BCXA 4FQTA 2LV7A 3S0AA 4QJ5B 4NDCA 1MQ1A 1XFYO 5CPVA 2LLUA 2G9BA 4MLWA 1QS7A 1B1GA 3VRPA 1QVIZ 5FYXA 3WNXB 3H4SE 1MR8A 1DGUA 1N65A 3BXKA 4CFQA 3D74A 5CSNA 2QEOA 1K94A 1Y6WA 1KFXL 2JNXA 4HSZA 2KYCA 1M39A 4I5LB 4Q04A 2Q4UA 1XK4A 1LS8A 4HREE 2BAPA 2AAOA 1CDPA 1FW4A 1X02A 1QX2A 3WXAA 1K95A 2LUCA 1HQVA 1NSHA 1RWYA 1OOGA 2M8UA 5FI7A 2AUCA 4PHJA 2OTGC 4M2OA 1SL9A 4MZJA 3IF7A 1G33A 1WLZA 4CPVA 1ODBA 1QVIY 2KAYA 1BT6A 2LLTA 3CZ2A 4AOMA 2KBMA 1CDLA 3MSEB 5D3OA 4DS7A 4JKTA 1ZUZA 1OOIX 2BKHB 1J7OA 1PALA 1RFJA 3NSIA 3LL8B 4L9MA 1RK9A 3QRXA 3TS5B 2MRDA 1PVBA 1DC1A 1ZMZA 1M31A 1S26D 5BPJA 2HETA 1IIOA 1YTZC 4ORBB 1A75B 2LE9B 1ZACA 3K21A 3NSLA 2CCMA 2LCPA 1N2DA 1GGZA 2ZKMX 4P2YB 5HYDA 3S0BA 1JF0A 1TTXA 3CYZA 3DVKA 1YX7A 1QV0A 2K7BA 4MZLA 1YR5A 3R72A 2H61C 2NZ0A 4ZCUA 3UO9A 2BNXA 2EGDA 1IQ5A 3EKJA 3OX5A 2JT3A 2SCPA 2WCMA 3OB2B 5I94A 5I2LA 3D77A 2G2BA 1EG3A 3D10A 1JUOA 1QWVA 1UHIA 2WCLA 1JWDA 3NXAA 2CNPA 3OGNA 2KYFA 2FJYA 2BECA 2NLNA 1OZSA 1TIZA 1V1GA 2JOJA 2M49B 1QJTA 2WNDA 3BYAA 3I5HC 3BOWA 3EKHA 2BL0B 1KFUL 1BR1B 4GGFC 1CTRA 3TDIA 2KLDA 1QATA 2L98A 3ZWHA 1BU3A 2WOSA 4N1GA 3A8RA 3LCPC 5FI6A 4ZCVA 1KQMB 4R1EA 4PDZA 2WCKA 1UHJA 3QMEA 1J1EA 4KYNA 1XFXO 2JPTA 4GPLB 3NSOA 4M2PA 4F0ZB 1C07A 3LK1A 2KAXA 4INWA 1BMOA 4GFTA 3AAKA 3ZNIA 3DXLA 4PE7A 1Z4HA 2PQLA 1J7PA 1S6JA 2BCAA 1B4CA 5KU1A 1BF5A 1QIWA 3KO0A 1SK6D 1QTXA 2K60A 2LVVA 2BL0C 3BUMB 5ER4X 3C1VA 1Q80A 3CABA 3D0YB 3PLFB 5GQQC 2L0PA 3VRRA 4QJ4B 1J7QA 1F70A 4U8DA 4MRYA 5I2QA 2KQYA 1XA5A 2AMIA 2K0JA 1KQMC 4XJKA 1OMDA 3SG6A 4ICBA 2LP2A 2CTNA 2M7NA 1R2UA 2JPOA 1MXEA 1K93D 3D73A 1JC2A 1LA3A 1JSAA 2WCEA 1F4QA 1RJVA 3RM1A 1EG4A 1UP5A 3PALA 1PSBA 2LLSA 2ISDA 1WLMA 3NHIA 2I2RE 4INXA 2MBXA 5K89A 3SG2A 2ZN9A 4N1FA 4GAOA 5ER5A 2H8VA 3BUNB 1JF2A 1PRWA 1K96A 1NPQA 2NXQA 2V53A 3F45A 4DIRA 3HCMA 2GGZA 2PASA 4C0LA 2KGBC 3RZSA 1FF1A 3I5IB 5DICA 2ZFDA 1K2HA 1DVIA 1N0YA 1B8CA 1F71A 3PM8A 3IQOA 1EJ3A 1V1FA 2CXJA 4YGEB 1YVHA 1LINA 2LHIA 2BE6A 2I18A 2KFFA 3EVVA 2WCBA 2OTGB 3A4UB 3N7HA 1CMGA 1OOJA 1IJ6A 4OV2A 1SCVA 2WC8A 4PHKA 4IL1A 4C0KA 4OZDA 2JWWA 1B8LA 1YUUA 1DJZA 1QLKA 1UUSA 5KTYA 2VRGA 3LK0A 2M97A 1SSEB 1SYMA 4P5OE 3WHTB 3I5IC 1C7VA 5CSJA 3WHUB 2JT8A 5HL1A 1CM1A 3B6XA 1OSAA 1K9PA 3EVRA 2OPOA 2PSRA 3CS1A 1YRUB 4USLA 1QIVA 1CFDA 3R1VA 2O60A 4NDBA 1UHHA 2L50A 3BOWB 1SKTA 1NCYA 2LMUA 2JXCA 3FWBA 1ZFSA 3D75A 4C0JA 2YGUA 4ETOA 1OZOA 3CR5X 1G4YR 2K61A 1MUXA 2COLB 4I5NB 1YX8A 2Y1MA 1AJ5A 3PATA 5B8IB 4PT1A 4YGCB 3CWGA 4DRWA 4ORCB 3IQQA 1YUTA 2KNEA 2WC5A 3BQ3A 3NSKA 4PE0A 2ZRSA 1K9KA 2Q91A 2ZNDA 2JZIA 1KFXS 2HQWA 2KFHA 2LVJA 2PMYA 1WDCB 3VGOA 1NWDA 5AFPA 1S6IA 1WRKA 3BUOB 5AEQA 4YI9A 2PVBA 3I5HB 3BUWB 2ERBA 4I5JA 1XFWO 4IJ7A 2JU0A 2MLFC 4PHMA 5CSIA 1SL8A 2QEVA 3DF0A 1JBAA 1TN4A 2M29A 3FE9A 1DF0A 2BBMA 1DJXA 4CIDA 1EL4A 3GOFA 4MZKA 4TNCA 5HKZA 1U5IA 5KSZA 1CFPA 1W7IB 3L47A 3O4YA 1DTLA 2JTZA 1IRJA 1E8AA 2JXLA 4MSPA 2E6WA 2KSPA 1SBJA 3IVTA 2K8MB 3KPXA 1CLMA 2L5YA 3EG5B 1WDCC 1IJ5A 2KPHA 3GK4X 3EK7A 4N5XA 3KEVA 3SIBA 3OX6A 1GM0A 2LP3A 1DJWA 3GK2A 4HRHA 4MVFA 1OMVA 5I2OA 2KI4C 1QX5B 3K1EA 1KSMA 1D1OA 2LC5A 4CLNA 3TUYC 2PALA 4GUKA 1CLBA 4F7FA 5HKWA 2BKIB 1IG5A 2F2PA 5CSFA 2QEBA 1XFZO 1BR4B 1QX7A 2M1UA 2KI6C 5TNCA 2E30A 2K2AA 2EC6C 2HPSA 4GGNA 2WCJA 3D76A 1A29A 2JTTA 1UHKA 1P28A 1ZOTB 3O6BA 2Y4QA 1PK0D 2L2CA 3CR2A 1S5GZ 2NCOA 1KQVA 1CKKA 4MBEA 1AHRA 1A4PA 1TNXA 2K7DA 4MEWA 1GJYA 1RECA 1SMGA 3E3RA 4WQ3A 1XVJA 2L4HA 2WC6A 1AJ4A 2MJWB 2LMTA 5I8NA 3CZTX 1YVLA 3GK1A 2KQ6A 2M3WA 4OCIA 3PN7B 4JD9A 1KK7Z 1TRFA 3AAJA 4A4BA 1Y0VH 2GV5A 3JTDC 2L2EA 1NX1A 1CLLA 5D7FA 1DMOA 1H4BA 4XYNA 2D8NA 4JQ0D 1MXLC 2BE4A 1A75A 1TNWA 1JFKA 4YGBB 1DQEA 3EK8A 1S5GY 4OR9B 3SS4A 1H8BA 3BFBA 2K2FA 4WQ2A 3KHEA 1DT7B 1XK4C 3CGAA 3CR4X 2QACA 1BLQA 2SASA 3AKBA 2KAVA 5D69A 3BJHA 3AKAA 2M7LA 4GGFA 3SG4A 1LKJA 2P6BB 1OOFA 3B86A 4QJ3B 1CMFA 1B7TY 1S36A 1TUZA 2EHBA 3S0GA 4DCKA 2JNFA 1BODA 1UHNA 2I7AA 4AQIA 3PN7C 3S0DA 5FI2A 1TNPA 3R1OA 5AANA 1EH2A 1K8UA 1KK7Y 3BUXB 1SL7A 1W9ZA 1B47A 3FE6A 5DKNA 3V2LA 1CNPA 1IH0A 3CZ0A 4MRXA 5DKQA 4PE4A 1JFJA 3SG7A 2MA2A 3NHTA 4PALA 1OMRA 1NX2A 1J55A 1AVSA 4NQGA 2P71A 2Y1NA 1TOPA 3I5GB 3M0WA 2B1UA 3SJSA 1U5IB 2A4JA 3LLEA 3B7AA 3DD4A 5PALA 4A4CA 1NX0A 4YI8A 1BG1A 4ORAB 1CB1A 3CDNA 1UURA 3CLNA 5JJGA 2FCEA 4PE1A 4JWQA 2M9GA 2K7OA 5J3XA 4BY4A 2LAPA 3TDZA 5HLVA 1OQPA 3DY9A 1LVCD 1MHOA 1SY9A 5AXIA 3I5FB 3FWCA 1YUSA 1IWQA 3I5GC 5EL2A 5HKYA 2RGIA 1EXRA 1NCXA 1S3PA 2K7CA 4WRIA 3TDUA 1SR6C 2BBNA 1C3ZA 2I94A 2QEHA 3D0YA 3OB1B 4AQJA 1DGVA 4M2QA 4UPGA 1F54A 1UWOA 3DVEA 2F3ZA 1S1EA 1ALVA 4OVNF 2LVKA 1C3YA 2TN4A 1PVAA 2LHLA 2JRFA 1DJYA 3I5FC 5IBWA 2KI4B 1KWOB 1XO5A 3CZ1A 2FJUB 3JVTB 4XJKB 1KSOA 2L5XB 2JULA 1CFFA 3TUYB 2MHHA 2FOTA 2M1KB 2PYQA 1XFVO 3TZ1A 2MAZA 4BY5A 1TCOB 2IS9A 5JOLA 1FI5A 1Y1UA 1SNLA 2WCHA 3VRNA 4FQOA 1SCMB 1CDMA 2F2OA 1R6PA 2EC6B 4DUQA 1RROA 2BCBA 3O2PA 2KHNA 1QASA 1TNQA 2JQ6A 1WY9A 3VB1A 1SRAA 3O78A 1F55A 2R2IA 2ZRTA 1L2OB 1WRZA 1IGVA 1F8HA 2HQ8A 1LA0A 1XFUO 3FIAA 1MF8B 1DJHA 2MLEC 1KWOC 2QPTA 4PCWA 3JVTC 2DOQA 3SS5A 2LVIA 3VROA 1PULA 2KOTA 4PHNA 4OKHA 3FE8A 1K9UA 1YRTB 3KF9A 3TS5C 3B87A 1NYAA 1ORGA 2FCDA 1NP8A 1SCMC 4D1EA 1M63B 2KLEA 1K90D 3RLZA 1TCFA 1FBVA 2LUXA 1RTP1 2F3YA 4GBAA 3JTDB 2KFGA 3L4LA 2LM5A 3SS3A 1L2OC 2JT0A 1BJFA 1BOCA 2KBIA 3DVJA 3DZTA 1DEKA 3FS7A 2ZNEA 1CDNA 3OBVA 3PJIA 1KK8B 1QXPA 3D78A 1GQMA 1T14A 1AK8A 2H61A 2NCPA 4FTGA 1J1DA 1AP4A 1IQ3A 1DJIA 1B9AA 1NX3A 2L4IA 1Y1AA 1B7TZ 2LANA 1SW8A
chains in the Genus database with same CATH topology
2CT9A 4HRGA 4YBHB 1A03A 1KFUS 2LNKA 1SPYA 1S6CA 2L51A 4YGAA 1PSRA 1WRLA 1FI6A 2KDHA 5HLOA 3ICBA 1M45A 1W7JB 2M0RA 4MN0A 4NDDA 2GGMA 2OS8B 3EVUA 1OE9B 5DKRA 3SG5A 2ZN8A 1GGWA 3HX4A 5G08A 2Y5IA 1KK8C 1NIWA 2PRUA 4GNKB 1KCYA 3CTNA 2KGRA 1AUIB 3OP0A 2JC2A 1NUBA 1QLSA 1L7ZA 1CM4A 1J7RA 2LMVA 5F6TA 3VRQA 1XYDA 1LXFC 3SIAA 1G8IA 3DVMA 2O5GA 1DJGA 1YURA 3DF0B 1F4OA 2KI6D 2H2KA 2F33A 1VRKA 3SG3A 1DF0B 2OS8C 4CFRA 2CBLA 3EK4A 4I5KA 4YRUA 1NCZA 2WCFA 1MWNA 1M46A 1ALWA 1CFCA 3OHMB 1A2XA 1SR6B 2HF5A 4E68A 3PFVA 1C7WA 1IKUA 3PSRA 2F8PA 1Y1XA 4YGDB 4JPZB 1B8RA 1QV1A 1FPWA 1HT9A 2WORA 2BCXA 2LV7A 4QJ5B 4NDCA 1MQ1A 1XFYO 5CPVA 2LLUA 2G9BA 4MLWA 1QS7A 1B1GA 3VRPA 1QVIZ 5FYXA 3WNXB 3H4SE 1MR8A 1DGUA 1N65A 3BXKA 4CFQA 5CSNA 1K94A 1Y6WA 1KFXL 2JNXA 4HSZA 2KYCA 1M39A 4I5LB 4Q04A 2Q4UA 1XK4A 4HREE 2AAOA 1CDPA 1FW4A 1X02A 1QX2A 3WXAA 1K95A 2LUCA 1HQVA 1NSHA 1RWYA 2M8UA 2AUCA 4PHJA 2OTGC 4M2OA 1SL9A 4MZJA 3IF7A 1G33A 1WLZA 4CPVA 1ODBA 1QVIY 2KAYA 1BT6A 2LLTA 4AOMA 4DS7A 2KBMA 1CDLA 3MSEB 1ZUZA 2BKHB 1J7OA 1PALA 1RFJA 3NSIA 3LL8B 4L9MA 1RK9A 3QRXA 3TS5B 2MRDA 1PVBA 1ZMZA 1M31A 1S26D 5BPJA 2HETA 1YTZC 4ORBB 1A75B 2LE9B 1ZACA 3K21A 3NSLA 2CCMA 2LCPA 1N2DA 1GGZA 2ZKMX 4P2YB 5HYDA 1JF0A 1TTXA 3DVKA 1YX7A 1QV0A 2K7BA 4MZLA 1YR5A 2H61C 2NZ0A 4ZCUA 2EGDA 1IQ5A 3EKJA 3OX5A 2JT3A 2SCPA 3OB2B 5I2LA 2G2BA 1EG3A 3D10A 1JUOA 1UHIA 1JWDA 3NXAA 2CNPA 2KYFA 2BECA 2NLNA 1OZSA 1TIZA 1V1GA 2JOJA 2M49B 1QJTA 2WNDA 3BYAA 3I5HC 3BOWA 3EKHA 2BL0B 1KFUL 1BR1B 4GGFC 1CTRA 3TDIA 1QATA 2L98A 3ZWHA 1BU3A 2WOSA 4N1GA 3A8RA 3LCPC 4ZCVA 1KQMB 4R1EA 4PDZA 1UHJA 1J1EA 1XFXO 2JPTA 4GPLB 3NSOA 4M2PA 4F0ZB 1C07A 3LK1A 2KAXA 1BMOA 4GFTA 3AAKA 3ZNIA 4PE7A 1J7PA 1S6JA 2BCAA 1B4CA 5KU1A 1BF5A 1QIWA 3KO0A 1SK6D 1QTXA 2LVVA 2BL0C 3BUMB 5ER4X 3C1VA 1Q80A 3D0YB 3PLFB 5GQQC 3VRRA 2L0PA 4QJ4B 1J7QA 1F70A 4U8DA 4MRYA 5I2QA 2KQYA 1XA5A 2AMIA 2K0JA 1KQMC 4XJKA 1OMDA 3SG6A 4ICBA 2LP2A 2CTNA 2M7NA 1R2UA 1MXEA 1K93D 1JSAA 1JC2A 1LA3A 2WCEA 1F4QA 1RJVA 3RM1A 1EG4A 1UP5A 3PALA 1PSBA 2LLSA 2ISDA 1WLMA 5K89A 2I2RE 2MBXA 3SG2A 2ZN9A 4N1FA 4GAOA 5ER5A 3BUNB 1JF2A 1PRWA 1K96A 1NPQA 2NXQA 2V53A 3F45A 4DIRA 3HCMA 2GGZA 2PASA 4C0LA 2KGBC 1FF1A 3I5IB 2ZFDA 1K2HA 1DVIA 1N0YA 1B8CA 1F71A 3PM8A 3IQOA 1EJ3A 1V1FA 2CXJA 4YGEB 1YVHA 1LINA 2LHIA 2BE6A 2I18A 2KFFA 3EVVA 2WCBA 2OTGB 3A4UB 1CMGA 1OOJA 1IJ6A 4OV2A 1SCVA 2WC8A 4PHKA 4IL1A 4C0KA 2JWWA 1B8LA 1YUUA 1DJZA 1QLKA 1UUSA 5KTYA 2VRGA 3LK0A 2M97A 4P5OE 1SYMA 3WHTB 3I5IC 1C7VA 5CSJA 3WHUB 2JT8A 1CM1A 1OSAA 1K9PA 3EVRA 2OPOA 2PSRA 3CS1A 1YRUB 4USLA 1QIVA 1CFDA 2O60A 4NDBA 1UHHA 2L50A 3BOWB 1SKTA 1NCYA 2LMUA 2JXCA 3FWBA 1ZFSA 4C0JA 4ETOA 1OZOA 3CR5X 1G4YR 2K61A 1MUXA 2COLB 4I5NB 1YX8A 2Y1MA 1AJ5A 3PATA 5B8IB 4YGCB 3CWGA 4DRWA 4ORCB 3IQQA 1YUTA 2KNEA 3BQ3A 3NSKA 4PE0A 2ZRSA 1K9KA 2Q91A 2ZNDA 2JZIA 1KFXS 2HQWA 2KFHA 2LVJA 2PMYA 1WDCB 3VGOA 1NWDA 5AFPA 1S6IA 1WRKA 3BUOB 5AEQA 4YI9A 2PVBA 3I5HB 3BUWB 5AERA 4I5JA 1XFWO 1JBAA 2JU0A 2MLFC 4PHMA 5CSIA 1SL8A 3DF0A 1JFJA 1TN4A 2M29A 1DF0A 2BBMA 1DJXA 4CIDA 1EL4A 3GOFA 4MZKA 4TNCA 5HKZA 1U5IA 5KSZA 1CFPA 1W7IB 3O4YA 1DTLA 2JTZA 1IRJA 1E8AA 2JXLA 4MSPA 2E6WA 2KSPA 1SBJA 3KPXA 2K8MB 1CLMA 1WDCC 1IJ5A 3GK4X 4N5XA 3EK7A 3SIBA 3KEVA 3OX6A 2LP3A 1DJWA 3GK2A 4HRHA 4MVFA 1OMVA 5I2OA 2KI4C 1QX5B 1KSMA 1D1OA 2LC5A 4CLNA 3TUYC 2PALA 4GUKA 1CLBA 5HKWA 2BKIB 1IG5A 2F2PA 5CSFA 1XFZO 1BR4B 1QX7A 2M1UA 2KI6C 5TNCA 2E30A 2K2AA 2EC6C 2HPSA 4GGNA 1A29A 2JTTA 1UHKA 1ZOTB 3O6BA 2Y4QA 1PK0D 3CR2A 1S5GZ 2NCOA 1KQVA 1CKKA 4MBEA 1AHRA 1A4PA 1TNXA 2K7DA 4MEWA 1GJYA 1RECA 1SMGA 3E3RA 4WQ3A 1XVJA 2L4HA 1AJ4A 2MJWB 2LMTA 5I8NA 3CZTX 1YVLA 3GK1A 2KQ6A 2M3WA 4OCIA 3PN7B 1KK7Z 1TRFA 3AAJA 4A4BA 1Y0VH 2GV5A 3JTDC 2L2EA 1NX1A 1CLLA 5D7FA 1DMOA 1H4BA 4XYNA 2D8NA 4JQ0D 1MXLC 2BE4A 1A75A 1TNWA 1JFKA 4YGBB 3EK8A 1S5GY 4OR9B 1H8BA 2K2FA 4WQ2A 3KHEA 1DT7B 1XK4C 3CGAA 3CR4X 2QACA 1BLQA 2SASA 3AKBA 2KAVA 5D69A 2M7LA 3AKAA 3SG4A 4GGFA 1LKJA 2P6BB 4QJ3B 1CMFA 1B7TY 1S36A 2EHBA 4DCKA 2JNFA 1BODA 1UHNA 2I7AA 4AQIA 3PN7C 1TNPA 5AANA 1EH2A 1K8UA 1KK7Y 3BUXB 1SL7A 1CNPA 1B47A 5DKNA 1IH0A 4MRXA 5DKQA 4PE4A 3SG7A 2MA2A 4PALA 1OMRA 1NX2A 1J55A 1AVSA 4NQGA 2Y1NA 1TOPA 3I5GB 3M0WA 2B1UA 3SJSA 1U5IB 2A4JA 3LLEA 3DD4A 5PALA 4A4CA 1NX0A 4YI8A 1BG1A 4ORAB 1CB1A 3CLNA 1UURA 5JJGA 2FCEA 4PE1A 4JWQA 2M9GA 2K7OA 5J3XA 4BY4A 2LAPA 3TDZA 5HLVA 1OQPA 1LVCD 1MHOA 1SY9A 5AXIA 3I5FB 3FWCA 1YUSA 1IWQA 3I5GC 5HKYA 2RGIA 1EXRA 1NCXA 1S3PA 2K7CA 4WRIA 3TDUA 1SR6C 2BBNA 3D0YA 2I94A 3OB1B 4AQJA 4UPGA 1F54A 1DGVA 4M2QA 1UWOA 3DVEA 2F3ZA 1S1EA 1ALVA 4OVNF 2LVKA 2TN4A 1PVAA 2LHLA 2JRFA 1DJYA 3I5FC 5IBWA 2KI4B 1KWOB 1XO5A 2FJUB 3JVTB 4XJKB 1KSOA 2L5XB 2JULA 1CFFA 3TUYB 2MHHA 2FOTA 2M1KB 1XFVO 3TZ1A 2MAZA 4BY5A 1TCOB 2IS9A 5JOLA 1FI5A 1Y1UA 1SNLA 3VRNA 4FQOA 1SCMB 1CDMA 2F2OA 1R6PA 2EC6B 4DUQA 1RROA 2BCBA 3O2PA 2KHNA 1QASA 1TNQA 2JQ6A 1WY9A 1SRAA 3O78A 1F55A 2R2IA 2ZRTA 1L2OB 1WRZA 1IGVA 1F8HA 2HQ8A 1LA0A 1XFUO 3FIAA 1MF8B 1DJHA 2MLEC 1KWOC 2QPTA 4PCWA 3JVTC 2DOQA 2LVIA 3VROA 1PULA 2KOTA 4PHNA 4OKHA 1K9UA 1YRTB 3KF9A 3TS5C 1NYAA 2FCDA 1NP8A 1SCMC 4D1EA 1M63B 1K90D 3RLZA 1TCFA 1FBVA 2LUXA 1RTP1 2F3YA 4GBAA 3JTDB 2KFGA 2LM5A 1L2OC 2JT0A 1BJFA 1BOCA 2KBIA 3DVJA 3FS7A 2ZNEA 1CDNA 1KK8B 1QXPA 1GQMA 1AK8A 2H61A 2NCPA 4FTGA 1J1DA 1AP4A 1IQ3A 1DJIA 1B9AA 1NX3A 2L4IA 1Y1AA 1B7TZ 2LANA 1SW8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CT9 A;  4HRG A;  4YBH B;  1A03 A;  1KFU S;  2LNK A;  1SPY A;  1S6C A;  2L51 A;  4YGA A;  1PSR A;  1WRL A;  1FI6 A;  2KDH A;  5HLO A;  3ICB A;  1M45 A;  1W7J B;  2M0R A;  4MN0 A;  4NDD A;  2GGM A;  2OS8 B;  3EVU A;  1OE9 B;  5DKR A;  3SG5 A;  2ZN8 A;  1GGW A;  3HX4 A;  5G08 A;  2Y5I A;  1KK8 C;  1NIW A;  2PRU A;  4GNK B;  1KCY A;  3CTN A;  2KGR A;  1AUI B;  3OP0 A;  2JC2 A;  1NUB A;  1QLS A;  1L7Z A;  1CM4 A;  1J7R A;  2LMV A;  5F6T A;  3VRQ A;  1XYD A;  1LXF C;  3SIA A;  1G8I A;  3DVM A;  2O5G A;  1DJG A;  1YUR A;  3DF0 B;  1F4O A;  2KI6 D;  2H2K A;  2F33 A;  1VRK A;  3SG3 A;  1DF0 B;  2OS8 C;  4CFR A;  2CBL A;  3EK4 A;  4I5K A;  4YRU A;  1NCZ A;  2WCF A;  1MWN A;  1M46 A;  1ALW A;  1CFC A;  3OHM B;  1A2X A;  1SR6 B;  2HF5 A;  4E68 A;  3PFV A;  1C7W A;  1IKU A;  3PSR A;  2F8P A;  1Y1X A;  4YGD B;  4JPZ B;  1B8R A;  1QV1 A;  1FPW A;  1HT9 A;  2WOR A;  2BCX A;  2LV7 A;  4QJ5 B;  4NDC A;  1MQ1 A;  1XFY O;  5CPV A;  2LLU A;  2G9B A;  4MLW A;  1QS7 A;  1B1G A;  3VRP A;  1QVI Z;  5FYX A;  3WNX B;  3H4S E;  1MR8 A;  1DGU A;  1N65 A;  3BXK A;  4CFQ A;  5CSN A;  1K94 A;  1Y6W A;  1KFX L;  2JNX A;  4HSZ A;  2KYC A;  1M39 A;  4I5L B;  4Q04 A;  2Q4U A;  1XK4 A;  4HRE E;  2AAO A;  1CDP A;  1FW4 A;  1X02 A;  1QX2 A;  3WXA A;  1K95 A;  2LUC A;  1HQV A;  1NSH A;  1RWY A;  2M8U A;  2AUC A;  4PHJ A;  2OTG C;  4M2O A;  1SL9 A;  4MZJ A;  3IF7 A;  1G33 A;  1WLZ A;  4CPV A;  1ODB A;  1QVI Y;  2KAY A;  1BT6 A;  2LLT A;  4AOM A;  4DS7 A;  2KBM A;  1CDL A;  3MSE B;  1ZUZ A;  2BKH B;  1J7O A;  1PAL A;  1RFJ A;  3NSI A;  3LL8 B;  4L9M A;  1RK9 A;  3QRX A;  3TS5 B;  2MRD A;  1PVB A;  1ZMZ A;  1M31 A;  1S26 D;  5BPJ A;  2HET A;  1YTZ C;  4ORB B;  1A75 B;  2LE9 B;  1ZAC A;  3K21 A;  3NSL A;  2CCM A;  2LCP A;  1N2D A;  1GGZ A;  2ZKM X;  4P2Y B;  5HYD A;  1JF0 A;  1TTX A;  3DVK A;  1YX7 A;  1QV0 A;  2K7B A;  4MZL A;  1YR5 A;  2H61 C;  2NZ0 A;  4ZCU A;  2EGD A;  1IQ5 A;  3EKJ A;  3OX5 A;  2JT3 A;  2SCP A;  3OB2 B;  5I2L A;  2G2B A;  1EG3 A;  3D10 A;  1JUO A;  1UHI A;  1JWD A;  3NXA A;  2CNP A;  2KYF A;  2BEC A;  2NLN A;  1OZS A;  1TIZ A;  1V1G A;  2JOJ A;  2M49 B;  1QJT A;  2WND A;  3BYA A;  3I5H C;  3BOW A;  3EKH A;  2BL0 B;  1KFU L;  1BR1 B;  4GGF C;  1CTR A;  3TDI A;  1QAT A;  2L98 A;  3ZWH A;  1BU3 A;  2WOS A;  4N1G A;  3A8R A;  3LCP C;  4ZCV A;  1KQM B;  4R1E A;  4PDZ A;  1UHJ A;  1J1E A;  1XFX O;  2JPT A;  4GPL B;  3NSO A;  4M2P A;  4F0Z B;  1C07 A;  3LK1 A;  2KAX A;  1BMO A;  4GFT A;  3AAK A;  3ZNI A;  4PE7 A;  1J7P A;  1S6J A;  2BCA A;  1B4C A;  5KU1 A;  1BF5 A;  1QIW A;  3KO0 A;  1SK6 D;  1QTX A;  2LVV A;  2BL0 C;  3BUM B;  5ER4 X;  3C1V A;  1Q80 A;  3D0Y B;  3PLF B;  5GQQ C;  3VRR A;  2L0P A;  4QJ4 B;  1J7Q A;  1F70 A;  4U8D A;  4MRY A;  5I2Q A;  2KQY A;  1XA5 A;  2AMI A;  2K0J A;  1KQM C;  4XJK A;  1OMD A;  3SG6 A;  4ICB A;  2LP2 A;  2CTN A;  2M7N A;  1R2U A;  1MXE A;  1K93 D;  1JSA A;  1JC2 A;  1LA3 A;  2WCE A;  1F4Q A;  1RJV A;  3RM1 A;  1EG4 A;  1UP5 A;  3PAL A;  1PSB A;  2LLS A;  2ISD A;  1WLM A;  5K89 A;  2I2R E;  2MBX A;  3SG2 A;  2ZN9 A;  4N1F A;  4GAO A;  5ER5 A;  3BUN B;  1JF2 A;  1PRW A;  1K96 A;  1NPQ A;  2NXQ A;  2V53 A;  3F45 A;  4DIR A;  3HCM A;  2GGZ A;  2PAS A;  4C0L A;  2KGB C;  1FF1 A;  3I5I B;  2ZFD A;  1K2H A;  1DVI A;  1N0Y A;  1B8C A;  1F71 A;  3PM8 A;  3IQO A;  1EJ3 A;  1V1F A;  2CXJ A;  4YGE B;  1YVH A;  1LIN A;  2LHI A;  2BE6 A;  2I18 A;  2KFF A;  3EVV A;  2WCB A;  2OTG B;  3A4U B;  1CMG A;  1OOJ A;  1IJ6 A;  4OV2 A;  1SCV A;  2WC8 A;  4PHK A;  4IL1 A;  4C0K A;  2JWW A;  1B8L A;  1YUU A;  1DJZ A;  1QLK A;  1UUS A;  5KTY A;  2VRG A;  3LK0 A;  2M97 A;  4P5O E;  1SYM A;  3WHT B;  3I5I C;  1C7V A;  5CSJ A;  3WHU B;  2JT8 A;  1CM1 A;  1OSA A;  1K9P A;  3EVR A;  2OPO A;  2PSR A;  3CS1 A;  1YRU B;  4USL A;  1QIV A;  1CFD A;  2O60 A;  4NDB A;  1UHH A;  2L50 A;  3BOW B;  1SKT A;  1NCY A;  2LMU A;  2JXC A;  3FWB A;  1ZFS A;  4C0J A;  4ETO A;  1OZO A;  3CR5 X;  1G4Y R;  2K61 A;  1MUX A;  2COL B;  4I5N B;  1YX8 A;  2Y1M A;  1AJ5 A;  3PAT A;  5B8I B;  4YGC B;  3CWG A;  4DRW A;  4ORC B;  3IQQ A;  1YUT A;  2KNE A;  3BQ3 A;  3NSK A;  4PE0 A;  2ZRS A;  1K9K A;  2Q91 A;  2ZND A;  2JZI A;  1KFX S;  2HQW A;  2KFH A;  2LVJ A;  2PMY A;  1WDC B;  3VGO A;  1NWD A;  5AFP A;  1S6I A;  1WRK A;  3BUO B;  5AEQ A;  4YI9 A;  2PVB A;  3I5H B;  3BUW B;  5AER A;  4I5J A;  1XFW O;  1JBA A;  2JU0 A;  2MLF C;  4PHM A;  5CSI A;  1SL8 A;  3DF0 A;  1JFJ A;  1TN4 A;  2M29 A;  1DF0 A;  2BBM A;  1DJX A;  4CID A;  1EL4 A;  3GOF A;  4MZK A;  4TNC A;  5HKZ A;  1U5I A;  5KSZ A;  1CFP A;  1W7I B;  3O4Y A;  1DTL A;  2JTZ A;  1IRJ A;  1E8A A;  2JXL A;  4MSP A;  2E6W A;  2KSP A;  1SBJ A;  3KPX A;  2K8M B;  1CLM A;  1WDC C;  1IJ5 A;  3GK4 X;  4N5X A;  3EK7 A;  3SIB A;  3KEV A;  3OX6 A;  2LP3 A;  1DJW A;  3GK2 A;  4HRH A;  4MVF A;  1OMV A;  5I2O A;  2KI4 C;  1QX5 B;  1KSM A;  1D1O A;  2LC5 A;  4CLN A;  3TUY C;  2PAL A;  4GUK A;  1CLB A;  5HKW A;  2BKI B;  1IG5 A;  2F2P A;  5CSF A;  1XFZ O;  1BR4 B;  1QX7 A;  2M1U A;  2KI6 C;  5TNC A;  2E30 A;  2K2A A;  2EC6 C;  2HPS A;  4GGN A;  1A29 A;  2JTT A;  1UHK A;  1ZOT B;  3O6B A;  2Y4Q A;  1PK0 D;  3CR2 A;  1S5G Z;  2NCO A;  1KQV A;  1CKK A;  4MBE A;  1AHR A;  1A4P A;  1TNX A;  2K7D A;  4MEW A;  1GJY A;  1REC A;  1SMG A;  3E3R A;  4WQ3 A;  1XVJ A;  2L4H A;  1AJ4 A;  2MJW B;  2LMT A;  5I8N A;  3CZT X;  1YVL A;  3GK1 A;  2KQ6 A;  2M3W A;  4OCI A;  3PN7 B;  1KK7 Z;  1TRF A;  3AAJ A;  4A4B A;  1Y0V H;  2GV5 A;  3JTD C;  2L2E A;  1NX1 A;  1CLL A;  5D7F A;  1DMO A;  1H4B A;  4XYN A;  2D8N A;  4JQ0 D;  1MXL C;  2BE4 A;  1A75 A;  1TNW A;  1JFK A;  4YGB B;  3EK8 A;  1S5G Y;  4OR9 B;  1H8B A;  2K2F A;  4WQ2 A;  3KHE A;  1DT7 B;  1XK4 C;  3CGA A;  3CR4 X;  2QAC A;  1BLQ A;  2SAS A;  3AKB A;  2KAV A;  5D69 A;  2M7L A;  3AKA A;  3SG4 A;  4GGF A;  1LKJ A;  2P6B B;  4QJ3 B;  1CMF A;  1B7T Y;  1S36 A;  2EHB A;  4DCK A;  2JNF A;  1BOD A;  1UHN A;  2I7A A;  4AQI A;  3PN7 C;  1TNP A;  5AAN A;  1EH2 A;  1K8U A;  1KK7 Y;  3BUX B;  1SL7 A;  1CNP A;  1B47 A;  5DKN A;  1IH0 A;  4MRX A;  5DKQ A;  4PE4 A;  3SG7 A;  2MA2 A;  4PAL A;  1OMR A;  1NX2 A;  1J55 A;  1AVS A;  4NQG A;  2Y1N A;  1TOP A;  3I5G B;  3M0W A;  2B1U A;  3SJS A;  1U5I B;  2A4J A;  3LLE A;  3DD4 A;  5PAL A;  4A4C A;  1NX0 A;  4YI8 A;  1BG1 A;  4ORA B;  1CB1 A;  3CLN A;  1UUR A;  5JJG A;  2FCE A;  4PE1 A;  4JWQ A;  2M9G A;  2K7O A;  5J3X A;  4BY4 A;  2LAP A;  3TDZ A;  5HLV A;  1OQP A;  1LVC D;  1MHO A;  1SY9 A;  5AXI A;  3I5F B;  3FWC A;  1YUS A;  1IWQ A;  3I5G C;  5HKY A;  2RGI A;  1EXR A;  1NCX A;  1S3P A;  2K7C A;  4WRI A;  3TDU A;  1SR6 C;  2BBN A;  3D0Y A;  2I94 A;  3OB1 B;  4AQJ A;  4UPG A;  1F54 A;  1DGV A;  4M2Q A;  1UWO A;  3DVE A;  2F3Z A;  1S1E A;  1ALV A;  4OVN F;  2LVK A;  2TN4 A;  1PVA A;  2LHL A;  2JRF A;  1DJY A;  3I5F C;  5IBW A;  2KI4 B;  1KWO B;  1XO5 A;  2FJU B;  3JVT B;  4XJK B;  1KSO A;  2L5X B;  2JUL A;  1CFF A;  3TUY B;  2MHH A;  2FOT A;  2M1K B;  1XFV O;  3TZ1 A;  2MAZ A;  4BY5 A;  1TCO B;  2IS9 A;  5JOL A;  1FI5 A;  1Y1U A;  1SNL A;  3VRN A;  4FQO A;  1SCM B;  1CDM A;  2F2O A;  1R6P A;  2EC6 B;  4DUQ A;  1RRO A;  2BCB A;  3O2P A;  2KHN A;  1QAS A;  1TNQ A;  2JQ6 A;  1WY9 A;  1SRA A;  3O78 A;  1F55 A;  2R2I A;  2ZRT A;  1L2O B;  1WRZ A;  1IGV A;  1F8H A;  2HQ8 A;  1LA0 A;  1XFU O;  3FIA A;  1MF8 B;  1DJH A;  2MLE C;  1KWO C;  2QPT A;  4PCW A;  3JVT C;  2DOQ A;  2LVI A;  3VRO A;  1PUL A;  2KOT A;  4PHN A;  4OKH A;  1K9U A;  1YRT B;  3KF9 A;  3TS5 C;  1NYA A;  2FCD A;  1NP8 A;  1SCM C;  4D1E A;  1M63 B;  1K90 D;  3RLZ A;  1TCF A;  1FBV A;  2LUX A;  1RTP 1;  2F3Y A;  4GBA A;  3JTD B;  2KFG A;  2LM5 A;  1L2O C;  2JT0 A;  1BJF A;  1BOC A;  2KBI A;  3DVJ A;  3FS7 A;  2ZNE A;  1CDN A;  1KK8 B;  1QXP A;  1GQM A;  1AK8 A;  2H61 A;  2NCP A;  4FTG A;  1J1D A;  1AP4 A;  1IQ3 A;  1DJI A;  1B9A A;  1NX3 A;  2L4I A;  1Y1A A;  1B7T Z;  2LAN A;  1SW8 A; 
#chains in the Genus database with same CATH topology
 3B88 A;  2CT9 A;  4HRG A;  4YBH B;  1A03 A;  1KFU S;  3BFH A;  2LNK A;  1SPY A;  3S0F A;  1XFR A;  1S6C A;  2L51 A;  4YGA A;  1PSR A;  1WRL A;  1FI6 A;  2KDH A;  5HLO A;  3ICB A;  1M45 A;  1W7J B;  2M0R A;  4MN0 A;  4NDD A;  2GGM A;  2OS8 B;  3EVU A;  1OE9 B;  5DKR A;  3SG5 A;  2ZN8 A;  1GGW A;  3HX4 A;  5G08 A;  3PM2 A;  2Y5I A;  1KK8 C;  1NIW A;  2PRU A;  1OW4 A;  4GNK B;  1KCY A;  3CTN A;  2KGR A;  1AUI B;  3O4X A;  3OP0 A;  1TUJ A;  2JC2 A;  1NUB A;  3UNW A;  1QLS A;  3R1P A;  1L7Z A;  2QDI A;  1CM4 A;  5AER A;  1J7R A;  2LMV A;  2P70 A;  2GTE A;  5F6T A;  3VRQ A;  1XYD A;  1LXF C;  3SIA A;  1G8I A;  3DVM A;  2O5G A;  3NGV A;  1DJG A;  1YUR A;  3DF0 B;  3Q8I A;  1F4O A;  2KI6 D;  2H2K A;  3DYE A;  2F33 A;  1VRK A;  3SG3 A;  1DF0 B;  2OS8 C;  1DEL A;  4CFR A;  2CBL A;  3EK4 A;  3L4A A;  4I5K A;  4YRU A;  1NCZ A;  3BFA A;  2WCF A;  1MWN A;  1M46 A;  1ALW A;  1CFC A;  3OHM B;  1A2X A;  1SR6 B;  2HF5 A;  4E68 A;  1OOH A;  1Z2C B;  1C7W A;  3PFV A;  1IKU A;  1TWO A;  3PSR A;  2F8P A;  1Y1X A;  4YGD B;  4JPZ B;  1B8R A;  1QV1 A;  1FPW A;  1HT9 A;  2WOR A;  3S0E A;  2BCX A;  4FQT A;  2LV7 A;  3S0A A;  4QJ5 B;  4NDC A;  1MQ1 A;  1XFY O;  5CPV A;  2LLU A;  2G9B A;  4MLW A;  1QS7 A;  1B1G A;  3VRP A;  1QVI Z;  5FYX A;  3WNX B;  3H4S E;  1MR8 A;  1DGU A;  1N65 A;  3BXK A;  4CFQ A;  3D74 A;  5CSN A;  2QEO A;  1K94 A;  1Y6W A;  1KFX L;  2JNX A;  4HSZ A;  2KYC A;  1M39 A;  4I5L B;  4Q04 A;  2Q4U A;  1XK4 A;  1LS8 A;  4HRE E;  2BAP A;  2AAO A;  1CDP A;  1FW4 A;  1X02 A;  1QX2 A;  3WXA A;  1K95 A;  2LUC A;  1HQV A;  1NSH A;  1RWY A;  1OOG A;  2M8U A;  5FI7 A;  2AUC A;  4PHJ A;  2OTG C;  4M2O A;  1SL9 A;  4MZJ A;  3IF7 A;  1G33 A;  1WLZ A;  4CPV A;  1ODB A;  1QVI Y;  2KAY A;  1BT6 A;  2LLT A;  3CZ2 A;  4AOM A;  2KBM A;  1CDL A;  3MSE B;  5D3O A;  4DS7 A;  4JKT A;  1ZUZ A;  1OOI X;  2BKH B;  1J7O A;  1PAL A;  1RFJ A;  3NSI A;  3LL8 B;  4L9M A;  1RK9 A;  3QRX A;  3TS5 B;  2MRD A;  1PVB A;  1DC1 A;  1ZMZ A;  1M31 A;  1S26 D;  5BPJ A;  2HET A;  1IIO A;  1YTZ C;  4ORB B;  1A75 B;  2LE9 B;  1ZAC A;  3K21 A;  3NSL A;  2CCM A;  2LCP A;  1N2D A;  1GGZ A;  2ZKM X;  4P2Y B;  5HYD A;  3S0B A;  1JF0 A;  1TTX A;  3CYZ A;  3DVK A;  1YX7 A;  1QV0 A;  2K7B A;  4MZL A;  1YR5 A;  3R72 A;  2H61 C;  2NZ0 A;  4ZCU A;  3UO9 A;  2BNX A;  2EGD A;  1IQ5 A;  3EKJ A;  3OX5 A;  2JT3 A;  2SCP A;  2WCM A;  3OB2 B;  5I94 A;  5I2L A;  3D77 A;  2G2B A;  1EG3 A;  3D10 A;  1JUO A;  1QWV A;  1UHI A;  2WCL A;  1JWD A;  3NXA A;  2CNP A;  3OGN A;  2KYF A;  2FJY A;  2BEC A;  2NLN A;  1OZS A;  1TIZ A;  1V1G A;  2JOJ A;  2M49 B;  1QJT A;  2WND A;  3BYA A;  3I5H C;  3BOW A;  3EKH A;  2BL0 B;  1KFU L;  1BR1 B;  4GGF C;  1CTR A;  3TDI A;  2KLD A;  1QAT A;  2L98 A;  3ZWH A;  1BU3 A;  2WOS A;  4N1G A;  3A8R A;  3LCP C;  5FI6 A;  4ZCV A;  1KQM B;  4R1E A;  4PDZ A;  2WCK A;  1UHJ A;  3QME A;  1J1E A;  4KYN A;  1XFX O;  2JPT A;  4GPL B;  3NSO A;  4M2P A;  4F0Z B;  1C07 A;  3LK1 A;  2KAX A;  4INW A;  1BMO A;  4GFT A;  3AAK A;  3ZNI A;  3DXL A;  4PE7 A;  1Z4H A;  2PQL A;  1J7P A;  1S6J A;  2BCA A;  1B4C A;  5KU1 A;  1BF5 A;  1QIW A;  3KO0 A;  1SK6 D;  1QTX A;  2K60 A;  2LVV A;  2BL0 C;  3BUM B;  5ER4 X;  3C1V A;  1Q80 A;  3CAB A;  3D0Y B;  3PLF B;  5GQQ C;  2L0P A;  3VRR A;  4QJ4 B;  1J7Q A;  1F70 A;  4U8D A;  4MRY A;  5I2Q A;  2KQY A;  1XA5 A;  2AMI A;  2K0J A;  1KQM C;  4XJK A;  1OMD A;  3SG6 A;  4ICB A;  2LP2 A;  2CTN A;  2M7N A;  1R2U A;  2JPO A;  1MXE A;  1K93 D;  3D73 A;  1JC2 A;  1LA3 A;  1JSA A;  2WCE A;  1F4Q A;  1RJV A;  3RM1 A;  1EG4 A;  1UP5 A;  3PAL A;  1PSB A;  2LLS A;  2ISD A;  1WLM A;  3NHI A;  2I2R E;  4INX A;  2MBX A;  5K89 A;  3SG2 A;  2ZN9 A;  4N1F A;  4GAO A;  5ER5 A;  2H8V A;  3BUN B;  1JF2 A;  1PRW A;  1K96 A;  1NPQ A;  2NXQ A;  2V53 A;  3F45 A;  4DIR A;  3HCM A;  2GGZ A;  2PAS A;  4C0L A;  2KGB C;  3RZS A;  1FF1 A;  3I5I B;  5DIC A;  2ZFD A;  1K2H A;  1DVI A;  1N0Y A;  1B8C A;  1F71 A;  3PM8 A;  3IQO A;  1EJ3 A;  1V1F A;  2CXJ A;  4YGE B;  1YVH A;  1LIN A;  2LHI A;  2BE6 A;  2I18 A;  2KFF A;  3EVV A;  2WCB A;  2OTG B;  3A4U B;  3N7H A;  1CMG A;  1OOJ A;  1IJ6 A;  4OV2 A;  1SCV A;  2WC8 A;  4PHK A;  4IL1 A;  4C0K A;  4OZD A;  2JWW A;  1B8L A;  1YUU A;  1DJZ A;  1QLK A;  1UUS A;  5KTY A;  2VRG A;  3LK0 A;  2M97 A;  1SSE B;  1SYM A;  4P5O E;  3WHT B;  3I5I C;  1C7V A;  5CSJ A;  3WHU B;  2JT8 A;  5HL1 A;  1CM1 A;  3B6X A;  1OSA A;  1K9P A;  3EVR A;  2OPO A;  2PSR A;  3CS1 A;  1YRU B;  4USL A;  1QIV A;  1CFD A;  3R1V A;  2O60 A;  4NDB A;  1UHH A;  2L50 A;  3BOW B;  1SKT A;  1NCY A;  2LMU A;  2JXC A;  3FWB A;  1ZFS A;  3D75 A;  4C0J A;  2YGU A;  4ETO A;  1OZO A;  3CR5 X;  1G4Y R;  2K61 A;  1MUX A;  2COL B;  4I5N B;  1YX8 A;  2Y1M A;  1AJ5 A;  3PAT A;  5B8I B;  4PT1 A;  4YGC B;  3CWG A;  4DRW A;  4ORC B;  3IQQ A;  1YUT A;  2KNE A;  2WC5 A;  3BQ3 A;  3NSK A;  4PE0 A;  2ZRS A;  1K9K A;  2Q91 A;  2ZND A;  2JZI A;  1KFX S;  2HQW A;  2KFH A;  2LVJ A;  2PMY A;  1WDC B;  3VGO A;  1NWD A;  5AFP A;  1S6I A;  1WRK A;  3BUO B;  5AEQ A;  4YI9 A;  2PVB A;  3I5H B;  3BUW B;  2ERB A;  4I5J A;  1XFW O;  4IJ7 A;  2JU0 A;  2MLF C;  4PHM A;  5CSI A;  1SL8 A;  2QEV A;  3DF0 A;  1JBA A;  1TN4 A;  2M29 A;  3FE9 A;  1DF0 A;  2BBM A;  1DJX A;  4CID A;  1EL4 A;  3GOF A;  4MZK A;  4TNC A;  5HKZ A;  1U5I A;  5KSZ A;  1CFP A;  1W7I B;  3L47 A;  3O4Y A;  1DTL A;  2JTZ A;  1IRJ A;  1E8A A;  2JXL A;  4MSP A;  2E6W A;  2KSP A;  1SBJ A;  3IVT A;  2K8M B;  3KPX A;  1CLM A;  2L5Y A;  3EG5 B;  1WDC C;  1IJ5 A;  2KPH A;  3GK4 X;  3EK7 A;  4N5X A;  3KEV A;  3SIB A;  3OX6 A;  1GM0 A;  2LP3 A;  1DJW A;  3GK2 A;  4HRH A;  4MVF A;  1OMV A;  5I2O A;  2KI4 C;  1QX5 B;  3K1E A;  1KSM A;  1D1O A;  2LC5 A;  4CLN A;  3TUY C;  2PAL A;  4GUK A;  1CLB A;  4F7F A;  5HKW A;  2BKI B;  1IG5 A;  2F2P A;  5CSF A;  2QEB A;  1XFZ O;  1BR4 B;  1QX7 A;  2M1U A;  2KI6 C;  5TNC A;  2E30 A;  2K2A A;  2EC6 C;  2HPS A;  4GGN A;  2WCJ A;  3D76 A;  1A29 A;  2JTT A;  1UHK A;  1P28 A;  1ZOT B;  3O6B A;  2Y4Q A;  1PK0 D;  2L2C A;  3CR2 A;  1S5G Z;  2NCO A;  1KQV A;  1CKK A;  4MBE A;  1AHR A;  1A4P A;  1TNX A;  2K7D A;  4MEW A;  1GJY A;  1REC A;  1SMG A;  3E3R A;  4WQ3 A;  1XVJ A;  2L4H A;  2WC6 A;  1AJ4 A;  2MJW B;  2LMT A;  5I8N A;  3CZT X;  1YVL A;  3GK1 A;  2KQ6 A;  2M3W A;  4OCI A;  3PN7 B;  4JD9 A;  1KK7 Z;  1TRF A;  3AAJ A;  4A4B A;  1Y0V H;  2GV5 A;  3JTD C;  2L2E A;  1NX1 A;  1CLL A;  5D7F A;  1DMO A;  1H4B A;  4XYN A;  2D8N A;  4JQ0 D;  1MXL C;  2BE4 A;  1A75 A;  1TNW A;  1JFK A;  4YGB B;  1DQE A;  3EK8 A;  1S5G Y;  4OR9 B;  3SS4 A;  1H8B A;  3BFB A;  2K2F A;  4WQ2 A;  3KHE A;  1DT7 B;  1XK4 C;  3CGA A;  3CR4 X;  2QAC A;  1BLQ A;  2SAS A;  3AKB A;  2KAV A;  5D69 A;  3BJH A;  3AKA A;  2M7L A;  4GGF A;  3SG4 A;  1LKJ A;  2P6B B;  1OOF A;  3B86 A;  4QJ3 B;  1CMF A;  1B7T Y;  1S36 A;  1TUZ A;  2EHB A;  3S0G A;  4DCK A;  2JNF A;  1BOD A;  1UHN A;  2I7A A;  4AQI A;  3PN7 C;  3S0D A;  5FI2 A;  1TNP A;  3R1O A;  5AAN A;  1EH2 A;  1K8U A;  1KK7 Y;  3BUX B;  1SL7 A;  1W9Z A;  1B47 A;  3FE6 A;  5DKN A;  3V2L A;  1CNP A;  1IH0 A;  3CZ0 A;  4MRX A;  5DKQ A;  4PE4 A;  1JFJ A;  3SG7 A;  2MA2 A;  3NHT A;  4PAL A;  1OMR A;  1NX2 A;  1J55 A;  1AVS A;  4NQG A;  2P71 A;  2Y1N A;  1TOP A;  3I5G B;  3M0W A;  2B1U A;  3SJS A;  1U5I B;  2A4J A;  3LLE A;  3B7A A;  3DD4 A;  5PAL A;  4A4C A;  1NX0 A;  4YI8 A;  1BG1 A;  4ORA B;  1CB1 A;  3CDN A;  1UUR A;  3CLN A;  5JJG A;  2FCE A;  4PE1 A;  4JWQ A;  2M9G A;  2K7O A;  5J3X A;  4BY4 A;  2LAP A;  3TDZ A;  5HLV A;  1OQP A;  3DY9 A;  1LVC D;  1MHO A;  1SY9 A;  5AXI A;  3I5F B;  3FWC A;  1YUS A;  1IWQ A;  3I5G C;  5EL2 A;  5HKY A;  2RGI A;  1EXR A;  1NCX A;  1S3P A;  2K7C A;  4WRI A;  3TDU A;  1SR6 C;  2BBN A;  1C3Z A;  2I94 A;  2QEH A;  3D0Y A;  3OB1 B;  4AQJ A;  1DGV A;  4M2Q A;  4UPG A;  1F54 A;  1UWO A;  3DVE A;  2F3Z A;  1S1E A;  1ALV A;  4OVN F;  2LVK A;  1C3Y A;  2TN4 A;  1PVA A;  2LHL A;  2JRF A;  1DJY A;  3I5F C;  5IBW A;  2KI4 B;  1KWO B;  1XO5 A;  3CZ1 A;  2FJU B;  3JVT B;  4XJK B;  1KSO A;  2L5X B;  2JUL A;  1CFF A;  3TUY B;  2MHH A;  2FOT A;  2M1K B;  2PYQ A;  1XFV O;  3TZ1 A;  2MAZ A;  4BY5 A;  1TCO B;  2IS9 A;  5JOL A;  1FI5 A;  1Y1U A;  1SNL A;  2WCH A;  3VRN A;  4FQO A;  1SCM B;  1CDM A;  2F2O A;  1R6P A;  2EC6 B;  4DUQ A;  1RRO A;  2BCB A;  3O2P A;  2KHN A;  1QAS A;  1TNQ A;  2JQ6 A;  1WY9 A;  3VB1 A;  1SRA A;  3O78 A;  1F55 A;  2R2I A;  2ZRT A;  1L2O B;  1WRZ A;  1IGV A;  1F8H A;  2HQ8 A;  1LA0 A;  1XFU O;  3FIA A;  1MF8 B;  1DJH A;  2MLE C;  1KWO C;  2QPT A;  4PCW A;  3JVT C;  2DOQ A;  3SS5 A;  2LVI A;  3VRO A;  1PUL A;  2KOT A;  4PHN A;  4OKH A;  3FE8 A;  1K9U A;  1YRT B;  3KF9 A;  3TS5 C;  3B87 A;  1NYA A;  1ORG A;  2FCD A;  1NP8 A;  1SCM C;  4D1E A;  1M63 B;  2KLE A;  1K90 D;  3RLZ A;  1TCF A;  1FBV A;  2LUX A;  1RTP 1;  2F3Y A;  4GBA A;  3JTD B;  2KFG A;  3L4L A;  2LM5 A;  3SS3 A;  1L2O C;  2JT0 A;  1BJF A;  1BOC A;  2KBI A;  3DVJ A;  3DZT A;  1DEK A;  3FS7 A;  2ZNE A;  1CDN A;  3OBV A;  3PJI A;  1KK8 B;  1QXP A;  3D78 A;  1GQM A;  1T14 A;  1AK8 A;  2H61 A;  2NCP A;  4FTG A;  1J1D A;  1AP4 A;  1IQ3 A;  1DJI A;  1B9A A;  1NX3 A;  2L4I A;  1Y1A A;  1B7T Z;  2LAN A;  1SW8 A; 
#chains in the Genus database with same CATH homology
 2CT9 A;  4HRG A;  4YBH B;  1A03 A;  1KFU S;  2LNK A;  1SPY A;  1S6C A;  2L51 A;  4YGA A;  1PSR A;  1WRL A;  1FI6 A;  2KDH A;  5HLO A;  3ICB A;  1M45 A;  1W7J B;  2M0R A;  4MN0 A;  4NDD A;  2GGM A;  2OS8 B;  3EVU A;  1OE9 B;  5DKR A;  3SG5 A;  2ZN8 A;  1GGW A;  3HX4 A;  5G08 A;  2Y5I A;  1KK8 C;  1NIW A;  2PRU A;  4GNK B;  1KCY A;  3CTN A;  2KGR A;  1AUI B;  3OP0 A;  2JC2 A;  1NUB A;  1QLS A;  1L7Z A;  1CM4 A;  1J7R A;  2LMV A;  5F6T A;  3VRQ A;  1XYD A;  1LXF C;  3SIA A;  1G8I A;  3DVM A;  2O5G A;  1DJG A;  1YUR A;  3DF0 B;  1F4O A;  2KI6 D;  2H2K A;  2F33 A;  1VRK A;  3SG3 A;  1DF0 B;  2OS8 C;  4CFR A;  2CBL A;  3EK4 A;  4I5K A;  4YRU A;  1NCZ A;  2WCF A;  1MWN A;  1M46 A;  1ALW A;  1CFC A;  3OHM B;  1A2X A;  1SR6 B;  2HF5 A;  4E68 A;  3PFV A;  1C7W A;  1IKU A;  3PSR A;  2F8P A;  1Y1X A;  4YGD B;  4JPZ B;  1B8R A;  1QV1 A;  1FPW A;  1HT9 A;  2WOR A;  2BCX A;  2LV7 A;  4QJ5 B;  4NDC A;  1MQ1 A;  1XFY O;  5CPV A;  2LLU A;  2G9B A;  4MLW A;  1QS7 A;  1B1G A;  3VRP A;  1QVI Z;  5FYX A;  3WNX B;  3H4S E;  1MR8 A;  1DGU A;  1N65 A;  3BXK A;  4CFQ A;  5CSN A;  1K94 A;  1Y6W A;  1KFX L;  2JNX A;  4HSZ A;  2KYC A;  1M39 A;  4I5L B;  4Q04 A;  2Q4U A;  1XK4 A;  4HRE E;  2AAO A;  1CDP A;  1FW4 A;  1X02 A;  1QX2 A;  3WXA A;  1K95 A;  2LUC A;  1HQV A;  1NSH A;  1RWY A;  2M8U A;  2AUC A;  4PHJ A;  2OTG C;  4M2O A;  1SL9 A;  4MZJ A;  3IF7 A;  1G33 A;  1WLZ A;  4CPV A;  1ODB A;  1QVI Y;  2KAY A;  1BT6 A;  2LLT A;  4AOM A;  4DS7 A;  2KBM A;  1CDL A;  3MSE B;  1ZUZ A;  2BKH B;  1J7O A;  1PAL A;  1RFJ A;  3NSI A;  3LL8 B;  4L9M A;  1RK9 A;  3QRX A;  3TS5 B;  2MRD A;  1PVB A;  1ZMZ A;  1M31 A;  1S26 D;  5BPJ A;  2HET A;  1YTZ C;  4ORB B;  1A75 B;  2LE9 B;  1ZAC A;  3K21 A;  3NSL A;  2CCM A;  2LCP A;  1N2D A;  1GGZ A;  2ZKM X;  4P2Y B;  5HYD A;  1JF0 A;  1TTX A;  3DVK A;  1YX7 A;  1QV0 A;  2K7B A;  4MZL A;  1YR5 A;  2H61 C;  2NZ0 A;  4ZCU A;  2EGD A;  1IQ5 A;  3EKJ A;  3OX5 A;  2JT3 A;  2SCP A;  3OB2 B;  5I2L A;  2G2B A;  1EG3 A;  3D10 A;  1JUO A;  1UHI A;  1JWD A;  3NXA A;  2CNP A;  2KYF A;  2BEC A;  2NLN A;  1OZS A;  1TIZ A;  1V1G A;  2JOJ A;  2M49 B;  1QJT A;  2WND A;  3BYA A;  3I5H C;  3BOW A;  3EKH A;  2BL0 B;  1KFU L;  1BR1 B;  4GGF C;  1CTR A;  3TDI A;  1QAT A;  2L98 A;  3ZWH A;  1BU3 A;  2WOS A;  4N1G A;  3A8R A;  3LCP C;  4ZCV A;  1KQM B;  4R1E A;  4PDZ A;  1UHJ A;  1J1E A;  1XFX O;  2JPT A;  4GPL B;  3NSO A;  4M2P A;  4F0Z B;  1C07 A;  3LK1 A;  2KAX A;  1BMO A;  4GFT A;  3AAK A;  3ZNI A;  4PE7 A;  1J7P A;  1S6J A;  2BCA A;  1B4C A;  5KU1 A;  1BF5 A;  1QIW A;  3KO0 A;  1SK6 D;  1QTX A;  2LVV A;  2BL0 C;  3BUM B;  5ER4 X;  3C1V A;  1Q80 A;  3D0Y B;  3PLF B;  5GQQ C;  3VRR A;  2L0P A;  4QJ4 B;  1J7Q A;  1F70 A;  4U8D A;  4MRY A;  5I2Q A;  2KQY A;  1XA5 A;  2AMI A;  2K0J A;  1KQM C;  4XJK A;  1OMD A;  3SG6 A;  4ICB A;  2LP2 A;  2CTN A;  2M7N A;  1R2U A;  1MXE A;  1K93 D;  1JSA A;  1JC2 A;  1LA3 A;  2WCE A;  1F4Q A;  1RJV A;  3RM1 A;  1EG4 A;  1UP5 A;  3PAL A;  1PSB A;  2LLS A;  2ISD A;  1WLM A;  5K89 A;  2I2R E;  2MBX A;  3SG2 A;  2ZN9 A;  4N1F A;  4GAO A;  5ER5 A;  3BUN B;  1JF2 A;  1PRW A;  1K96 A;  1NPQ A;  2NXQ A;  2V53 A;  3F45 A;  4DIR A;  3HCM A;  2GGZ A;  2PAS A;  4C0L A;  2KGB C;  1FF1 A;  3I5I B;  2ZFD A;  1K2H A;  1DVI A;  1N0Y A;  1B8C A;  1F71 A;  3PM8 A;  3IQO A;  1EJ3 A;  1V1F A;  2CXJ A;  4YGE B;  1YVH A;  1LIN A;  2LHI A;  2BE6 A;  2I18 A;  2KFF A;  3EVV A;  2WCB A;  2OTG B;  3A4U B;  1CMG A;  1OOJ A;  1IJ6 A;  4OV2 A;  1SCV A;  2WC8 A;  4PHK A;  4IL1 A;  4C0K A;  2JWW A;  1B8L A;  1YUU A;  1DJZ A;  1QLK A;  1UUS A;  5KTY A;  2VRG A;  3LK0 A;  2M97 A;  4P5O E;  1SYM A;  3WHT B;  3I5I C;  1C7V A;  5CSJ A;  3WHU B;  2JT8 A;  1CM1 A;  1OSA A;  1K9P A;  3EVR A;  2OPO A;  2PSR A;  3CS1 A;  1YRU B;  4USL A;  1QIV A;  1CFD A;  2O60 A;  4NDB A;  1UHH A;  2L50 A;  3BOW B;  1SKT A;  1NCY A;  2LMU A;  2JXC A;  3FWB A;  1ZFS A;  4C0J A;  4ETO A;  1OZO A;  3CR5 X;  1G4Y R;  2K61 A;  1MUX A;  2COL B;  4I5N B;  1YX8 A;  2Y1M A;  1AJ5 A;  3PAT A;  5B8I B;  4YGC B;  3CWG A;  4DRW A;  4ORC B;  3IQQ A;  1YUT A;  2KNE A;  3BQ3 A;  3NSK A;  4PE0 A;  2ZRS A;  1K9K A;  2Q91 A;  2ZND A;  2JZI A;  1KFX S;  2HQW A;  2KFH A;  2LVJ A;  2PMY A;  1WDC B;  3VGO A;  1NWD A;  5AFP A;  1S6I A;  1WRK A;  3BUO B;  5AEQ A;  4YI9 A;  2PVB A;  3I5H B;  3BUW B;  5AER A;  4I5J A;  1XFW O;  1JBA A;  2JU0 A;  2MLF C;  4PHM A;  5CSI A;  1SL8 A;  3DF0 A;  1JFJ A;  1TN4 A;  2M29 A;  1DF0 A;  2BBM A;  1DJX A;  4CID A;  1EL4 A;  3GOF A;  4MZK A;  4TNC A;  5HKZ A;  1U5I A;  5KSZ A;  1CFP A;  1W7I B;  3O4Y A;  1DTL A;  2JTZ A;  1IRJ A;  1E8A A;  2JXL A;  4MSP A;  2E6W A;  2KSP A;  1SBJ A;  3KPX A;  2K8M B;  1CLM A;  1WDC C;  1IJ5 A;  3GK4 X;  4N5X A;  3EK7 A;  3SIB A;  3KEV A;  3OX6 A;  2LP3 A;  1DJW A;  3GK2 A;  4HRH A;  4MVF A;  1OMV A;  5I2O A;  2KI4 C;  1QX5 B;  1KSM A;  1D1O A;  2LC5 A;  4CLN A;  3TUY C;  2PAL A;  4GUK A;  1CLB A;  5HKW A;  2BKI B;  1IG5 A;  2F2P A;  5CSF A;  1XFZ O;  1BR4 B;  1QX7 A;  2M1U A;  2KI6 C;  5TNC A;  2E30 A;  2K2A A;  2EC6 C;  2HPS A;  4GGN A;  1A29 A;  2JTT A;  1UHK A;  1ZOT B;  3O6B A;  2Y4Q A;  1PK0 D;  3CR2 A;  1S5G Z;  2NCO A;  1KQV A;  1CKK A;  4MBE A;  1AHR A;  1A4P A;  1TNX A;  2K7D A;  4MEW A;  1GJY A;  1REC A;  1SMG A;  3E3R A;  4WQ3 A;  1XVJ A;  2L4H A;  1AJ4 A;  2MJW B;  2LMT A;  5I8N A;  3CZT X;  1YVL A;  3GK1 A;  2KQ6 A;  2M3W A;  4OCI A;  3PN7 B;  1KK7 Z;  1TRF A;  3AAJ A;  4A4B A;  1Y0V H;  2GV5 A;  3JTD C;  2L2E A;  1NX1 A;  1CLL A;  5D7F A;  1DMO A;  1H4B A;  4XYN A;  2D8N A;  4JQ0 D;  1MXL C;  2BE4 A;  1A75 A;  1TNW A;  1JFK A;  4YGB B;  3EK8 A;  1S5G Y;  4OR9 B;  1H8B A;  2K2F A;  4WQ2 A;  3KHE A;  1DT7 B;  1XK4 C;  3CGA A;  3CR4 X;  2QAC A;  1BLQ A;  2SAS A;  3AKB A;  2KAV A;  5D69 A;  2M7L A;  3AKA A;  3SG4 A;  4GGF A;  1LKJ A;  2P6B B;  4QJ3 B;  1CMF A;  1B7T Y;  1S36 A;  2EHB A;  4DCK A;  2JNF A;  1BOD A;  1UHN A;  2I7A A;  4AQI A;  3PN7 C;  1TNP A;  5AAN A;  1EH2 A;  1K8U A;  1KK7 Y;  3BUX B;  1SL7 A;  1CNP A;  1B47 A;  5DKN A;  1IH0 A;  4MRX A;  5DKQ A;  4PE4 A;  3SG7 A;  2MA2 A;  4PAL A;  1OMR A;  1NX2 A;  1J55 A;  1AVS A;  4NQG A;  2Y1N A;  1TOP A;  3I5G B;  3M0W A;  2B1U A;  3SJS A;  1U5I B;  2A4J A;  3LLE A;  3DD4 A;  5PAL A;  4A4C A;  1NX0 A;  4YI8 A;  1BG1 A;  4ORA B;  1CB1 A;  3CLN A;  1UUR A;  5JJG A;  2FCE A;  4PE1 A;  4JWQ A;  2M9G A;  2K7O A;  5J3X A;  4BY4 A;  2LAP A;  3TDZ A;  5HLV A;  1OQP A;  1LVC D;  1MHO A;  1SY9 A;  5AXI A;  3I5F B;  3FWC A;  1YUS A;  1IWQ A;  3I5G C;  5HKY A;  2RGI A;  1EXR A;  1NCX A;  1S3P A;  2K7C A;  4WRI A;  3TDU A;  1SR6 C;  2BBN A;  3D0Y A;  2I94 A;  3OB1 B;  4AQJ A;  4UPG A;  1F54 A;  1DGV A;  4M2Q A;  1UWO A;  3DVE A;  2F3Z A;  1S1E A;  1ALV A;  4OVN F;  2LVK A;  2TN4 A;  1PVA A;  2LHL A;  2JRF A;  1DJY A;  3I5F C;  5IBW A;  2KI4 B;  1KWO B;  1XO5 A;  2FJU B;  3JVT B;  4XJK B;  1KSO A;  2L5X B;  2JUL A;  1CFF A;  3TUY B;  2MHH A;  2FOT A;  2M1K B;  1XFV O;  3TZ1 A;  2MAZ A;  4BY5 A;  1TCO B;  2IS9 A;  5JOL A;  1FI5 A;  1Y1U A;  1SNL A;  3VRN A;  4FQO A;  1SCM B;  1CDM A;  2F2O A;  1R6P A;  2EC6 B;  4DUQ A;  1RRO A;  2BCB A;  3O2P A;  2KHN A;  1QAS A;  1TNQ A;  2JQ6 A;  1WY9 A;  1SRA A;  3O78 A;  1F55 A;  2R2I A;  2ZRT A;  1L2O B;  1WRZ A;  1IGV A;  1F8H A;  2HQ8 A;  1LA0 A;  1XFU O;  3FIA A;  1MF8 B;  1DJH A;  2MLE C;  1KWO C;  2QPT A;  4PCW A;  3JVT C;  2DOQ A;  2LVI A;  3VRO A;  1PUL A;  2KOT A;  4PHN A;  4OKH A;  1K9U A;  1YRT B;  3KF9 A;  3TS5 C;  1NYA A;  2FCD A;  1NP8 A;  1SCM C;  4D1E A;  1M63 B;  1K90 D;  3RLZ A;  1TCF A;  1FBV A;  2LUX A;  1RTP 1;  2F3Y A;  4GBA A;  3JTD B;  2KFG A;  2LM5 A;  1L2O C;  2JT0 A;  1BJF A;  1BOC A;  2KBI A;  3DVJ A;  3FS7 A;  2ZNE A;  1CDN A;  1KK8 B;  1QXP A;  1GQM A;  1AK8 A;  2H61 A;  2NCP A;  4FTG A;  1J1D A;  1AP4 A;  1IQ3 A;  1DJI A;  1B9A A;  1NX3 A;  2L4I A;  1Y1A A;  1B7T Z;  2LAN A;  1SW8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...