2PYQA

Crystal structure of a duf2853 member protein (jann_4075) from jannaschia sp. ccs1 at 1.500 a resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
114
structure length
114
Chain Sequence
GMGKRDDLIAQYADDLRNKCGMEPDMALLEKVTKGCGPAIYNRDASTVAGSDTAELETIKKNFLMKKLGLADSESLMGGIQSVIETYGRSERNKYRAVVYYMLTKHFGKESVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of uncharacterized protein (YP_512017.1) from Jannaschia sp. CCS1 at 1.500 A resolution
rcsb
source organism Jannaschia sp. ccs1
molecule tags Unknown function
total genus 32
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11015 DUF2853 Protein of unknown function (DUF2853)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.120 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Jann4075-like 2pyqA00
2PYQA
chains in the Genus database with same CATH superfamily
2K60A 2M8UA 3ICBA 3OB1B 3VRPA 2YGUA 2JULA 1WDCC 2OS8B 1AVSA 3L4LA 3GK1A 3L4AA 4QJ3B 2JPOA 2ERBA 3JVTC 4CFQA 1KK8C 2BECA 2F3ZA 3CABA 3S0EA 1TIZA 1OQPA 1JWDA 1PULA 5HYDA 1SK6D 1SL7A 2KGRA 2LLUA 3D73A 4C0LA 1K95A 2NXQA 1GM0A 3B88A 1GQMA 1AHRA 1KFXL 1CM4A 3KEVA 1WRKA 2ZN8A 4XJKB 1M31A 1XYDA 1L2OC 1OE9B 4MSPA 3BOWB 1IJ6A 5D69A 4PHMA 4Q04A 1DMOA 1PVBA 2ZNDA 2CXJA 2JOJA 2I94A 3DF0B 1S6JA 3RLZA 2K7OA 2M3WA 2LE9B 1RTP1 3OX5A 1SPYA 2JTZA 1XA5A 1DJGA 1JF2A 1MF8B 1UURA 2KOTA 4JQ0D 4OV2A 4INWA 1DVIA 2P71A 2KQYA 2JXLA 1UHKA 3HX4A 4DCKA 2KLEA 2R2IA 3LLEA 4PHKA 2O5GA 4ORAB 3DYEA 2JNXA 1YUSA 5AFPA 5FI2A 4HSZA 3GK2A 5G08A 2QEHA 3IQQA 2L2EA 2JRFA 3DD4A 4ZCUA 5HKZA 1B7TY 1FI5A 3BUNB 2BKHB 1J1DA 2JZIA 1MXLC 3DZTA 2L4HA 3S0GA 3TDIA 1S36A 2A4JA 1IIOA 2M49B 5AEQA 2MLFC 1IQ3A 1KFUS 1R6PA 1XK4A 1OOFA 1C07A 1NX3A 4HRGA 5FYXA 2EGDA 4UPGA 3B6XA 1IRJA 3H4SE 2LVJA 1KQMB 2HQ8A 1XK4C 1B1GA 2LLSA 3VRRA 1JF0A 1NX0A 1LXFC 2FJUB 2LANA 1PK0D 1BU3A 2K2AA 3NXAA 3UO9A 4QJ4B 2JC2A 3PSRA 1SR6C 3B86A 1C3YA 1RJVA 2WCEA 3D0YB 5KSZA 3I5HC 1Y1UA 4OZDA 2L2CA 1C7WA 1CTRA 2WOSA 1LVCD 1FI6A 3K21A 5D7FA 2LC5A 1ODBA 1OOHA 1W7IB 2BL0B 2M7NA 3V2LA 1QX2A 1TUZA 4OVNF 3SS3A 1CLLA 2F33A 2TN4A 4ETOA 1FPWA 2LUCA 2WCJA 1CMFA 4U8DA 1UWOA 2OTGB 1F4QA 1NPQA 1PVAA 1YTZC 2GGMA 3I5GB 1B47A 1V1FA 4PE4A 2L0PA 2KHNA 3PN7B 3PATA 1TCFA 1NWDA 1CFFA 1MUXA 1HQVA 1M39A 1R2UA 1TNXA 4WQ3A 3O2PA 1MHOA 1DF0A 1ORGA 2ZRTA 1YRUB 4F7FA 4C0KA 3I5IB 3DVJA 4YGBB 2KI4B 1JC2A 2F2PA 1SW8A 4IL1A 4MLWA 3TUYB 2G9BA 1SCVA 2L5XB 5ER4X 3FIAA 2HPSA 1BG1A 1D1OA 2JNFA 1UP5A 3EK8A 3A4UB 1KK8B 4NDDA 2HETA 3VGOA 1K93D 1LKJA 1BF5A 1SRAA 1Y6WA 1BR1B 2CTNA 3BUMB 2MJWB 5BPJA 1J7PA 2HF5A 4DRWA 1DJIA 4QJ5B 3SIBA 1GGWA 2JTTA 4OR9B 2ZRSA 2LLTA 4PALA 2LCPA 2KFHA 3DXLA 2WORA 4MBEA 5KTYA 1XFRA 1DGVA 4CIDA 1L2OB 1OOGA 4PCWA 1F71A 3LK0A 4BY4A 2WCKA 2JT3A 2L4IA 3A8RA 1UHNA 2KBIA 4MRXA 1CM1A 2I7AA 4WQ2A 2LVKA 1NCYA 2QDIA 2WC6A 1N65A 1N2DA 1TNWA 2WNDA 3EVRA 1WLZA 2GV5A 3O78A 1KSMA 4WRIA 1BODA 2L5YA 1BT6A 2KAXA 3JTDC 2CCMA 2ZN9A 4I5LB 1JFKA 1U5IA 1LA0A 5TNCA 3EKHA 5CPVA 4P5OE 1WY9A 1SL8A 3BYAA 1XFXO 3VRNA 1QVIZ 3CZ2A 1SY9A 4JD9A 1CFPA 3DVMA 1JFJA 1KQVA 5AXIA 4NQGA 4MEWA 1K96A 1OMVA 3DVKA 3PFVA 1DJZA 1M45A 3WHTB 1JBAA 1A75A 1SCMC 4GBAA 3B87A 3QRXA 5F6TA 4N5XA 2RGIA 3VRQA 3R1VA 3OHMB 1DJYA 3LCPC 1SSEB 2O60A 3AAJA 1MQ1A 1NSHA 1QLSA 1YUUA 2H2KA 3NSIA 1B4CA 1B8CA 1PSBA 2SASA 2QPTA 1CLMA 2WC5A 4I5NB 4M2PA 1DELA 3EVVA 1BLQA 3QMEA 4YI8A 1B8LA 4N1FA 1N0YA 4OCIA 1A29A 1XFVO 1XFYO 2BBMA 4MVFA 4XYNA 4YGCB 1IH0A 1SR6B 1IWQA 1XFZO 3M0WA 1CDLA 3O4YA 1NUBA 3VROA 1TN4A 1IGVA 1KSOA 2PRUA 5GQQC 3TDZA 5EL2A 1F4OA 1YUTA 1ZACA 2JQ6A 3D77A 3RM1A 2LHIA 1HT9A 2M29A 2K7CA 3D78A 4NDCA 2MHHA 3CS1A 1IQ5A 2D8NA 2I2RE 2ISDA 3TDUA 1OMDA 4GUKA 2Y1MA 4MZJA 1G4YR 1GJYA 2QEBA 4FQTA 2CT9A 1J55A 2JT8A 1YVLA 1YR5A 3I5FB 4YRUA 2OS8C 2WCHA 3EG5B 3O6BA 3K1EA 3ZNIA 5HLVA 5I2QA 2MRDA 3S0AA 1GGZA 1F54A 3AAKA 3OB2B 3NGVA 4PHJA 1KWOB 1B7TZ 2JU0A 3EK7A 4PE0A 4XJKA 3BFBA 3BXKA 3BOWA 1L7ZA 1RWYA 2KGBC 3R1PA 2AMIA 4M2QA 3DF0A 3SG6A 2LVVA 2BCBA 2JT0A 2KFGA 3KPXA 4I5KA 1BMOA 4HREE 4F0ZB 1KFXS 1K8UA 1QJTA 1KK7Z 5D3OA 1WRLA 4A4BA 1J7OA 2COLB 3F45A 1YURA 1Q80A 4GFTA 2PALA 1IG5A 1EXRA 1SL9A 2B1UA 2CNPA 1XVJA 1ALWA 3DVEA 5ER5A 2MAZA 4DUQA 2M9GA 3EVUA 2KDHA 3N7HA 2Y4QA 1M46A 1SKTA 2Q91A 1TCOB 1Z4HA 5HKWA 2K2FA 2JXCA 2BE6A 5I2OA 2GTEA 4TNCA 4INXA 4YBHB 2I18A 3IVTA 4PDZA 4CFRA 4R1EA 4GAOA 3FE8A 1SMGA 1CLBA 1QV0A 3D74A 4PE1A 1DGUA 1DTLA 1E8AA 1NP8A 2EC6C 2FJYA 3CDNA 3EKJA 3SG5A 3FWCA 2OPOA 4AOMA 1AK8A 1QX7A 2KYCA 4KYNA 5JJGA 1IKUA 3CLNA 1QWVA 1WDCB 2IS9A 3DY9A 3MSEB 3JVTB 1EL4A 2LMVA 2KSPA 1NX1A 2H61A 3D76A 1EG3A 3BQ3A 1S6IA 1A2XA 3D0YA 2V53A 3SG2A 1S26D 1M63B 1S5GY 3NHTA 4ICBA 4BY5A 3GOFA 1TOPA 2H61C 4MZLA 3SJSA 2KFFA 5DKNA 3CZ1A 2BAPA 1Y1AA 4JPZB 1SCMB 1DQEA 4N1GA 1QXPA 3S0BA 1DEKA 4YI9A 2LUXA 3VB1A 3LL8B 4DIRA 1FF1A 2QEOA 1NCZA 1VRKA 2KYFA 2WC8A 1CNPA 1BJFA 1LA3A 2BL0C 3SG4A 4GNKB 4FQOA 1NIWA 1JSAA 2F2OA 2E30A 1RROA 2AUCA 3O4XA 4PHNA 1K2HA 5CSFA 2OTGC 1ALVA 3D10A 3BFAA 1QATA 2JPTA 1EH2A 1V1GA 2NCOA 2P70A 3PN7C 1Y1XA 4ZCVA 3TS5C 3TZ1A 2M7LA 1QV1A 1DJHA 1QX5B 3SS4A 2WCMA 4OKHA 4I5JA 4MRYA 1TWOA 1KFUL 1AUIB 3S0DA 1QLKA 3OX6A 3WHUB 1J7RA 1WRZA 2F3YA 1NX2A 3I5IC 5B8IB 2KI4C 1LS8A 4E68A 2NLNA 3CZ0A 2FCDA 1IJ5A 3FS7A 3KHEA 3TUYC 2K7DA 3BUOB 4GGFA 1K9PA 1G33A 1CB1A 3CZTX 3FWBA 1RFJA 5HL1A 3OBVA 1G8IA 3LK1A 1TRFA 2BE4A 1H4BA 1FW4A 1MR8A 2DOQA 3PALA 1RECA 2LP2A 5K89A 2FCEA 1CDNA 1C7VA 4GGFC 3Q8IA 4DS7A 1Y0VH 1CDMA 1K94A 2WCFA 1SNLA 3EK4A 3NHIA 5FI6A 2PASA 2LVIA 3I5HB 4JKTA 4M2OA 3NSOA 2LAPA 1MXEA 1FBVA 3CWGA 3IF7A 4NDBA 1P28A 3BJHA 1PALA 1OZOA 3KO0A 3OGNA 3NSLA 2MA2A 2CBLA 1DC1A 1QS7A 2ZFDA 2BNXA 1NYAA 2BKIB 4D1EA 1AP4A 1T14A 4CPVA 1H8BA 1S6CA 1B8RA 4YGAA 1CFDA 3OP0A 5I2LA 1YRTB 4PE7A 1OZSA 1SYMA 3C1VA 3UNWA 2KAVA 1OOJA 1WLMA 2M0RA 2ZNEA 4YGEB 3CR2A 1QTXA 5DICA 3KF9A 5I8NA 2H8VA 1XFWO 1YX7A 3WXAA 1ZUZA 1K9UA 1W7JB 2SCPA 5J3XA 2EC6B 2BCXA 1QIVA 1C3ZA 3CTNA 3BFHA 1Z2CB 4IJ7A 1CMGA 2AAOA 1MWNA 2KI6D 2PSRA 3D75A 5HKYA 3R1OA 1DF0B 5PALA 1CFCA 2F8PA 5FI7A 1DT7B 1AJ4A 2LM5A 2K61A 1XFUO 2NCPA 5IBWA 1B9AA 3E3RA 2WCLA 2BBNA 1K9KA 2GGZA 4GPLB 3L47A 3CGAA 1S3PA 4CLNA 1PSRA 2KNEA 3SS5A 5CSJA 1TNPA 1BOCA 1ZFSA 1OW4A 2VRGA 1KK7Y 5DKQA 2PVBA 2KPHA 2LMTA 3AKBA 1EG4A 1K90D 2FOTA 2M1UA 2LV7A 2PMYA 1DJXA 2PQLA 3GK4X 2E6WA 4GGNA 3WNXB 2K8MB 3SG3A 2HQWA 2QACA 3SG7A 1J1EA 4AQIA 3SIAA 4C0JA 1KCYA 4ORCB 1UUSA 4AQJA 4A4CA 2Y1NA 1DJWA 4L9MA 4ORBB 2L98A 1BR4B 1SBJA 2Y5IA 3ZWHA 1LINA 1UHHA 2KBMA 3PM2A 3IQOA 1A03A 1F8HA 1TNQA 2KLDA 5AANA 1A4PA 2MLEC 1X02A 2KI6C 2L50A 3HCMA 2G2BA 4JWQA 3PM8A 3I5FC 3JTDB 2M97A 3CR4X 1JUOA 1TTXA 1YVHA 3TS5B 5CSNA 1CDPA 2LHLA 1J7QA 2NZ0A 3CR5X 4PT1A 3NSKA 4MZKA 1KQMC 1F55A 1W9ZA 1QIWA 1AJ5A 1KWOC 1U5IB 2MBXA 3B7AA 2EHBA 3RZSA 5AERA 3PLFB 3S0FA 3PJIA 5I94A 2Q4UA 2ZKMX 4P2YB 2QEVA 2KAYA 2KQ6A 2M1KB 1OOIX 2LMUA 1OSAA 1YX8A 3FE6A 3AKAA 4USLA 1TUJA 2BCAA 1UHJA 1A75B 2L51A 2JWWA 5DKRA 1S5GZ 5JOLA 1NCXA 1OMRA 2K0JA 2LNKA 1QASA 3BUWB 5CSIA 4YGDB 4MN0A 3I5GC 3R72A 1CKKA 2LP3A 2K7BA 2P6BB 5KU1A 1UHIA 2PYQA 1PRWA 1ZOTB 3FE9A 4HRHA 1XO5A 4FTGA 3BUXB 5HLOA 2WCBA 1S1EA 1ZMZA 3CYZA 1EJ3A 1F70A 1QVIY 1RK9A
chains in the Genus database with same CATH topology
2PYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PYQ A; 
#chains in the Genus database with same CATH topology
 2K60 A;  2M8U A;  3ICB A;  3OB1 B;  3VRP A;  2YGU A;  2JUL A;  1WDC C;  2OS8 B;  1AVS A;  3L4L A;  3GK1 A;  3L4A A;  4QJ3 B;  2JPO A;  2ERB A;  3JVT C;  4CFQ A;  1KK8 C;  2BEC A;  2F3Z A;  3CAB A;  3S0E A;  1TIZ A;  1OQP A;  1JWD A;  1PUL A;  5HYD A;  1SK6 D;  1SL7 A;  2KGR A;  2LLU A;  3D73 A;  4C0L A;  1K95 A;  2NXQ A;  1GM0 A;  3B88 A;  1GQM A;  1AHR A;  1KFX L;  1CM4 A;  3KEV A;  1WRK A;  2ZN8 A;  4XJK B;  1M31 A;  1XYD A;  1L2O C;  1OE9 B;  4MSP A;  3BOW B;  1IJ6 A;  5D69 A;  4PHM A;  4Q04 A;  1DMO A;  1PVB A;  2ZND A;  2CXJ A;  2JOJ A;  2I94 A;  3DF0 B;  1S6J A;  3RLZ A;  2K7O A;  2M3W A;  2LE9 B;  1RTP 1;  3OX5 A;  1SPY A;  2JTZ A;  1XA5 A;  1DJG A;  1JF2 A;  1MF8 B;  1UUR A;  2KOT A;  4JQ0 D;  4OV2 A;  4INW A;  1DVI A;  2P71 A;  2KQY A;  2JXL A;  1UHK A;  3HX4 A;  4DCK A;  2KLE A;  2R2I A;  3LLE A;  4PHK A;  2O5G A;  4ORA B;  3DYE A;  2JNX A;  1YUS A;  5AFP A;  5FI2 A;  4HSZ A;  3GK2 A;  5G08 A;  2QEH A;  3IQQ A;  2L2E A;  2JRF A;  3DD4 A;  4ZCU A;  5HKZ A;  1B7T Y;  1FI5 A;  3BUN B;  2BKH B;  1J1D A;  2JZI A;  1MXL C;  3DZT A;  2L4H A;  3S0G A;  3TDI A;  1S36 A;  2A4J A;  1IIO A;  2M49 B;  5AEQ A;  2MLF C;  1IQ3 A;  1KFU S;  1R6P A;  1XK4 A;  1OOF A;  1C07 A;  1NX3 A;  4HRG A;  5FYX A;  2EGD A;  4UPG A;  3B6X A;  1IRJ A;  3H4S E;  2LVJ A;  1KQM B;  2HQ8 A;  1XK4 C;  1B1G A;  2LLS A;  3VRR A;  1JF0 A;  1NX0 A;  1LXF C;  2FJU B;  2LAN A;  1PK0 D;  1BU3 A;  2K2A A;  3NXA A;  3UO9 A;  4QJ4 B;  2JC2 A;  3PSR A;  1SR6 C;  3B86 A;  1C3Y A;  1RJV A;  2WCE A;  3D0Y B;  5KSZ A;  3I5H C;  1Y1U A;  4OZD A;  2L2C A;  1C7W A;  1CTR A;  2WOS A;  1LVC D;  1FI6 A;  3K21 A;  5D7F A;  2LC5 A;  1ODB A;  1OOH A;  1W7I B;  2BL0 B;  2M7N A;  3V2L A;  1QX2 A;  1TUZ A;  4OVN F;  3SS3 A;  1CLL A;  2F33 A;  2TN4 A;  4ETO A;  1FPW A;  2LUC A;  2WCJ A;  1CMF A;  4U8D A;  1UWO A;  2OTG B;  1F4Q A;  1NPQ A;  1PVA A;  1YTZ C;  2GGM A;  3I5G B;  1B47 A;  1V1F A;  4PE4 A;  2L0P A;  2KHN A;  3PN7 B;  3PAT A;  1TCF A;  1NWD A;  1CFF A;  1MUX A;  1HQV A;  1M39 A;  1R2U A;  1TNX A;  4WQ3 A;  3O2P A;  1MHO A;  1DF0 A;  1ORG A;  2ZRT A;  1YRU B;  4F7F A;  4C0K A;  3I5I B;  3DVJ A;  4YGB B;  2KI4 B;  1JC2 A;  2F2P A;  1SW8 A;  4IL1 A;  4MLW A;  3TUY B;  2G9B A;  1SCV A;  2L5X B;  5ER4 X;  3FIA A;  2HPS A;  1BG1 A;  1D1O A;  2JNF A;  1UP5 A;  3EK8 A;  3A4U B;  1KK8 B;  4NDD A;  2HET A;  3VGO A;  1K93 D;  1LKJ A;  1BF5 A;  1SRA A;  1Y6W A;  1BR1 B;  2CTN A;  3BUM B;  2MJW B;  5BPJ A;  1J7P A;  2HF5 A;  4DRW A;  1DJI A;  4QJ5 B;  3SIB A;  1GGW A;  2JTT A;  4OR9 B;  2ZRS A;  2LLT A;  4PAL A;  2LCP A;  2KFH A;  3DXL A;  2WOR A;  4MBE A;  5KTY A;  1XFR A;  1DGV A;  4CID A;  1L2O B;  1OOG A;  4PCW A;  1F71 A;  3LK0 A;  4BY4 A;  2WCK A;  2JT3 A;  2L4I A;  3A8R A;  1UHN A;  2KBI A;  4MRX A;  1CM1 A;  2I7A A;  4WQ2 A;  2LVK A;  1NCY A;  2QDI A;  2WC6 A;  1N65 A;  1N2D A;  1TNW A;  2WND A;  3EVR A;  1WLZ A;  2GV5 A;  3O78 A;  1KSM A;  4WRI A;  1BOD A;  2L5Y A;  1BT6 A;  2KAX A;  3JTD C;  2CCM A;  2ZN9 A;  4I5L B;  1JFK A;  1U5I A;  1LA0 A;  5TNC A;  3EKH A;  5CPV A;  4P5O E;  1WY9 A;  1SL8 A;  3BYA A;  1XFX O;  3VRN A;  1QVI Z;  3CZ2 A;  1SY9 A;  4JD9 A;  1CFP A;  3DVM A;  1JFJ A;  1KQV A;  5AXI A;  4NQG A;  4MEW A;  1K96 A;  1OMV A;  3DVK A;  3PFV A;  1DJZ A;  1M45 A;  3WHT B;  1JBA A;  1A75 A;  1SCM C;  4GBA A;  3B87 A;  3QRX A;  5F6T A;  4N5X A;  2RGI A;  3VRQ A;  3R1V A;  3OHM B;  1DJY A;  3LCP C;  1SSE B;  2O60 A;  3AAJ A;  1MQ1 A;  1NSH A;  1QLS A;  1YUU A;  2H2K A;  3NSI A;  1B4C A;  1B8C A;  1PSB A;  2SAS A;  2QPT A;  1CLM A;  2WC5 A;  4I5N B;  4M2P A;  1DEL A;  3EVV A;  1BLQ A;  3QME A;  4YI8 A;  1B8L A;  4N1F A;  1N0Y A;  4OCI A;  1A29 A;  1XFV O;  1XFY O;  2BBM A;  4MVF A;  4XYN A;  4YGC B;  1IH0 A;  1SR6 B;  1IWQ A;  1XFZ O;  3M0W A;  1CDL A;  3O4Y A;  1NUB A;  3VRO A;  1TN4 A;  1IGV A;  1KSO A;  2PRU A;  5GQQ C;  3TDZ A;  5EL2 A;  1F4O A;  1YUT A;  1ZAC A;  2JQ6 A;  3D77 A;  3RM1 A;  2LHI A;  1HT9 A;  2M29 A;  2K7C A;  3D78 A;  4NDC A;  2MHH A;  3CS1 A;  1IQ5 A;  2D8N A;  2I2R E;  2ISD A;  3TDU A;  1OMD A;  4GUK A;  2Y1M A;  4MZJ A;  1G4Y R;  1GJY A;  2QEB A;  4FQT A;  2CT9 A;  1J55 A;  2JT8 A;  1YVL A;  1YR5 A;  3I5F B;  4YRU A;  2OS8 C;  2WCH A;  3EG5 B;  3O6B A;  3K1E A;  3ZNI A;  5HLV A;  5I2Q A;  2MRD A;  3S0A A;  1GGZ A;  1F54 A;  3AAK A;  3OB2 B;  3NGV A;  4PHJ A;  1KWO B;  1B7T Z;  2JU0 A;  3EK7 A;  4PE0 A;  4XJK A;  3BFB A;  3BXK A;  3BOW A;  1L7Z A;  1RWY A;  2KGB C;  3R1P A;  2AMI A;  4M2Q A;  3DF0 A;  3SG6 A;  2LVV A;  2BCB A;  2JT0 A;  2KFG A;  3KPX A;  4I5K A;  1BMO A;  4HRE E;  4F0Z B;  1KFX S;  1K8U A;  1QJT A;  1KK7 Z;  5D3O A;  1WRL A;  4A4B A;  1J7O A;  2COL B;  3F45 A;  1YUR A;  1Q80 A;  4GFT A;  2PAL A;  1IG5 A;  1EXR A;  1SL9 A;  2B1U A;  2CNP A;  1XVJ A;  1ALW A;  3DVE A;  5ER5 A;  2MAZ A;  4DUQ A;  2M9G A;  3EVU A;  2KDH A;  3N7H A;  2Y4Q A;  1M46 A;  1SKT A;  2Q91 A;  1TCO B;  1Z4H A;  5HKW A;  2K2F A;  2JXC A;  2BE6 A;  5I2O A;  2GTE A;  4TNC A;  4INX A;  4YBH B;  2I18 A;  3IVT A;  4PDZ A;  4CFR A;  4R1E A;  4GAO A;  3FE8 A;  1SMG A;  1CLB A;  1QV0 A;  3D74 A;  4PE1 A;  1DGU A;  1DTL A;  1E8A A;  1NP8 A;  2EC6 C;  2FJY A;  3CDN A;  3EKJ A;  3SG5 A;  3FWC A;  2OPO A;  4AOM A;  1AK8 A;  1QX7 A;  2KYC A;  4KYN A;  5JJG A;  1IKU A;  3CLN A;  1QWV A;  1WDC B;  2IS9 A;  3DY9 A;  3MSE B;  3JVT B;  1EL4 A;  2LMV A;  2KSP A;  1NX1 A;  2H61 A;  3D76 A;  1EG3 A;  3BQ3 A;  1S6I A;  1A2X A;  3D0Y A;  2V53 A;  3SG2 A;  1S26 D;  1M63 B;  1S5G Y;  3NHT A;  4ICB A;  4BY5 A;  3GOF A;  1TOP A;  2H61 C;  4MZL A;  3SJS A;  2KFF A;  5DKN A;  3CZ1 A;  2BAP A;  1Y1A A;  4JPZ B;  1SCM B;  1DQE A;  4N1G A;  1QXP A;  3S0B A;  1DEK A;  4YI9 A;  2LUX A;  3VB1 A;  3LL8 B;  4DIR A;  1FF1 A;  2QEO A;  1NCZ A;  1VRK A;  2KYF A;  2WC8 A;  1CNP A;  1BJF A;  1LA3 A;  2BL0 C;  3SG4 A;  4GNK B;  4FQO A;  1NIW A;  1JSA A;  2F2O A;  2E30 A;  1RRO A;  2AUC A;  3O4X A;  4PHN A;  1K2H A;  5CSF A;  2OTG C;  1ALV A;  3D10 A;  3BFA A;  1QAT A;  2JPT A;  1EH2 A;  1V1G A;  2NCO A;  2P70 A;  3PN7 C;  1Y1X A;  4ZCV A;  3TS5 C;  3TZ1 A;  2M7L A;  1QV1 A;  1DJH A;  1QX5 B;  3SS4 A;  2WCM A;  4OKH A;  4I5J A;  4MRY A;  1TWO A;  1KFU L;  1AUI B;  3S0D A;  1QLK A;  3OX6 A;  3WHU B;  1J7R A;  1WRZ A;  2F3Y A;  1NX2 A;  3I5I C;  5B8I B;  2KI4 C;  1LS8 A;  4E68 A;  2NLN A;  3CZ0 A;  2FCD A;  1IJ5 A;  3FS7 A;  3KHE A;  3TUY C;  2K7D A;  3BUO B;  4GGF A;  1K9P A;  1G33 A;  1CB1 A;  3CZT X;  3FWB A;  1RFJ A;  5HL1 A;  3OBV A;  1G8I A;  3LK1 A;  1TRF A;  2BE4 A;  1H4B A;  1FW4 A;  1MR8 A;  2DOQ A;  3PAL A;  1REC A;  2LP2 A;  5K89 A;  2FCE A;  1CDN A;  1C7V A;  4GGF C;  3Q8I A;  4DS7 A;  1Y0V H;  1CDM A;  1K94 A;  2WCF A;  1SNL A;  3EK4 A;  3NHI A;  5FI6 A;  2PAS A;  2LVI A;  3I5H B;  4JKT A;  4M2O A;  3NSO A;  2LAP A;  1MXE A;  1FBV A;  3CWG A;  3IF7 A;  4NDB A;  1P28 A;  3BJH A;  1PAL A;  1OZO A;  3KO0 A;  3OGN A;  3NSL A;  2MA2 A;  2CBL A;  1DC1 A;  1QS7 A;  2ZFD A;  2BNX A;  1NYA A;  2BKI B;  4D1E A;  1AP4 A;  1T14 A;  4CPV A;  1H8B A;  1S6C A;  1B8R A;  4YGA A;  1CFD A;  3OP0 A;  5I2L A;  1YRT B;  4PE7 A;  1OZS A;  1SYM A;  3C1V A;  3UNW A;  2KAV A;  1OOJ A;  1WLM A;  2M0R A;  2ZNE A;  4YGE B;  3CR2 A;  1QTX A;  5DIC A;  3KF9 A;  5I8N A;  2H8V A;  1XFW O;  1YX7 A;  3WXA A;  1ZUZ A;  1K9U A;  1W7J B;  2SCP A;  5J3X A;  2EC6 B;  2BCX A;  1QIV A;  1C3Z A;  3CTN A;  3BFH A;  1Z2C B;  4IJ7 A;  1CMG A;  2AAO A;  1MWN A;  2KI6 D;  2PSR A;  3D75 A;  5HKY A;  3R1O A;  1DF0 B;  5PAL A;  1CFC A;  2F8P A;  5FI7 A;  1DT7 B;  1AJ4 A;  2LM5 A;  2K61 A;  1XFU O;  2NCP A;  5IBW A;  1B9A A;  3E3R A;  2WCL A;  2BBN A;  1K9K A;  2GGZ A;  4GPL B;  3L47 A;  3CGA A;  1S3P A;  4CLN A;  1PSR A;  2KNE A;  3SS5 A;  5CSJ A;  1TNP A;  1BOC A;  1ZFS A;  1OW4 A;  2VRG A;  1KK7 Y;  5DKQ A;  2PVB A;  2KPH A;  2LMT A;  3AKB A;  1EG4 A;  1K90 D;  2FOT A;  2M1U A;  2LV7 A;  2PMY A;  1DJX A;  2PQL A;  3GK4 X;  2E6W A;  4GGN A;  3WNX B;  2K8M B;  3SG3 A;  2HQW A;  2QAC A;  3SG7 A;  1J1E A;  4AQI A;  3SIA A;  4C0J A;  1KCY A;  4ORC B;  1UUS A;  4AQJ A;  4A4C A;  2Y1N A;  1DJW A;  4L9M A;  4ORB B;  2L98 A;  1BR4 B;  1SBJ A;  2Y5I A;  3ZWH A;  1LIN A;  1UHH A;  2KBM A;  3PM2 A;  3IQO A;  1A03 A;  1F8H A;  1TNQ A;  2KLD A;  5AAN A;  1A4P A;  2MLE C;  1X02 A;  2KI6 C;  2L50 A;  3HCM A;  2G2B A;  4JWQ A;  3PM8 A;  3I5F C;  3JTD B;  2M97 A;  3CR4 X;  1JUO A;  1TTX A;  1YVH A;  3TS5 B;  5CSN A;  1CDP A;  2LHL A;  1J7Q A;  2NZ0 A;  3CR5 X;  4PT1 A;  3NSK A;  4MZK A;  1KQM C;  1F55 A;  1W9Z A;  1QIW A;  1AJ5 A;  1KWO C;  1U5I B;  2MBX A;  3B7A A;  2EHB A;  3RZS A;  5AER A;  3PLF B;  3S0F A;  3PJI A;  5I94 A;  2Q4U A;  2ZKM X;  4P2Y B;  2QEV A;  2KAY A;  2KQ6 A;  2M1K B;  1OOI X;  2LMU A;  1OSA A;  1YX8 A;  3FE6 A;  3AKA A;  4USL A;  1TUJ A;  2BCA A;  1UHJ A;  1A75 B;  2L51 A;  2JWW A;  5DKR A;  1S5G Z;  5JOL A;  1NCX A;  1OMR A;  2K0J A;  2LNK A;  1QAS A;  3BUW B;  5CSI A;  4YGD B;  4MN0 A;  3I5G C;  3R72 A;  1CKK A;  2LP3 A;  2K7B A;  2P6B B;  5KU1 A;  1UHI A;  2PYQ A;  1PRW A;  1ZOT B;  3FE9 A;  4HRH A;  1XO5 A;  4FTG A;  3BUX B;  5HLO A;  2WCB A;  1S1E A;  1ZMZ A;  3CYZ A;  1EJ3 A;  1F70 A;  1QVI Y;  1RK9 A; 
#chains in the Genus database with same CATH homology
 2PYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...