2PYQA

Crystal structure of a duf2853 member protein (jann_4075) from jannaschia sp. ccs1 at 1.500 a resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
114
structure length
114
Chain Sequence
GMGKRDDLIAQYADDLRNKCGMEPDMALLEKVTKGCGPAIYNRDASTVAGSDTAELETIKKNFLMKKLGLADSESLMGGIQSVIETYGRSERNKYRAVVYYMLTKHFGKESVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of uncharacterized protein (YP_512017.1) from Jannaschia sp. CCS1 at 1.500 A resolution
rcsb
source organism Jannaschia sp. ccs1
molecule tags Unknown function
total genus 32
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11015 DUF2853 Protein of unknown function (DUF2853)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.120 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Jann4075-like 2pyqA00
2PYQA
chains in the Genus database with same CATH superfamily
3CGAA 2KSPA 1QVIY 1S26D 2M8UA 3OB2B 1TCOB 1NCZA 1SK6D 2AUCA 2CBLA 4MLWA 5TNCA 3TDUA 1KWOC 1R6PA 2LAPA 2LMVA 3D0YA 2LP2A 4DUQA 5AEQA 2BNXA 1T14A 1JFJA 2VRGA 3OBVA 1OQPA 1U5IB 2L51A 1TNQA 4ICBA 2I2RE 4I5KA 3PSRA 3WHTB 3SS5A 2K2AA 3OHMB 2LLTA 2OTGC 3DD4A 4ORAB 1J7PA 2ZNDA 3NSLA 1K96A 3R1VA 1KWOB 4BY4A 2AAOA 1F55A 2L4HA 3GK2A 2EHBA 2JPOA 2G2BA 1SKTA 2SASA 2TN4A 3BUMB 4JWQA 4YGDB 1R2UA 4MZKA 2B1UA 3SS3A 3DF0A 3GOFA 2E6WA 3FIAA 2KDHA 1OMRA 2M1UA 2K7BA 2ISDA 1SY9A 3CZTX 3B6XA 1ODBA 1KCYA 1MXEA 2KNEA 2LNKA 4JKTA 4QJ4B 1E8AA 4AQJA 1NX2A 1PVBA 2F3ZA 1F4QA 1QLSA 3CR5X 2KQYA 2QEVA 1CMFA 1TRFA 4M2OA 1XO5A 3BUWB 3LCPC 2FOTA 1C3ZA 1KK7Z 3CS1A 4IL1A 1EJ3A 3KEVA 1XFYO 1N0YA 1LXFC 3I5IC 2KHNA 2LUCA 4I5NB 3BQ3A 1RROA 4C0LA 2BCXA 3D77A 2JZIA 1ORGA 2PVBA 1KQMC 1SNLA 1ALVA 1LA3A 1UHIA 3A4UB 3VGOA 3PFVA 3FE8A 3IQOA 2JXCA 1NCXA 1X02A 2BL0B 3BUNB 3CZ1A 1OZOA 2CXJA 1A4PA 1QIWA 1JF0A 1S6IA 2PSRA 1DC1A 2WCKA 2KGBC 4XYNA 3SG2A 2LMTA 4I5LB 1UWOA 1SBJA 1YX8A 1TNXA 2KQ6A 5DKNA 1CB1A 1KFUL 1SMGA 1OOJA 3BJHA 1A75A 4YGEB 1S5GZ 1Y6WA 1UUSA 2COLB 3R72A 4DRWA 3EK8A 1DVIA 1QTXA 3CABA 3NSKA 3O6BA 2KAYA 3OX6A 1NPQA 3N7HA 1XFUO 1YVHA 3E3RA 2LVJA 4ETOA 1AUIB 1AK8A 3LK1A 2JWWA 2ZNEA 3HCMA 5AXIA 1IQ3A 1B8CA 1J55A 1SPYA 2HQ8A 3BFAA 3RLZA 4MVFA 3FWBA 1TUZA 1B1GA 2HETA 1JFKA 1F71A 1A03A 5B8IB 3NHIA 2NLNA 2M9GA 3CDNA 4D1EA 1NWDA 1OMDA 1DJHA 4PDZA 5DKQA 3SG6A 3UO9A 4OR9B 1L2OC 1J1DA 1Z2CB 3BOWB 1KSMA 2LM5A 2KI4C 3ZWHA 2JRFA 2JULA 1VRKA 1OSAA 5D7FA 2Y1NA 3PATA 4PE7A 4MZJA 1NUBA 4TNCA 2BAPA 2GGZA 5JJGA 1W7JB 2PASA 1LINA 4PHKA 1DT7B 1YUTA 1J1EA 1BR4B 2PYQA 1IH0A 3KHEA 1IG5A 2ZFDA 4N1FA 1J7QA 1BG1A 1HQVA 5AFPA 3JTDB 2QPTA 4FQTA 2KI4B 2P70A 5HL1A 3D0YB 3VRNA 1YRTB 3I5FB 3WHUB 1CKKA 2CNPA 1MR8A 2GV5A 4R1EA 1CFPA 1LA0A 4FQOA 2LANA 3CWGA 3EK7A 2E30A 2LUXA 1CDPA 4L9MA 3BXKA 3EVUA 2A4JA 2NCPA 3I5GB 1B8RA 4F0ZB 3PN7B 4ORBB 4PHJA 2LVIA 1KK7Y 3K21A 3VRQA 1FW4A 1QX2A 2F33A 3FE9A 2WOSA 3F45A 3D74A 1Y1UA 3NHTA 4HREE 5ER4X 5G08A 1EG3A 1KSOA 2JPTA 1JC2A 1F54A 4I5JA 2Y1MA 2K7OA 3DF0B 2M3WA 1ZFSA 1SR6B 3BFHA 4UPGA 2FCDA 1FI5A 4HSZA 2MLEC 1B9AA 1KFXL 1M45A 1XYDA 1DJGA 1K93D 2LE9B 2M49B 4YI8A 3S0GA 1MQ1A 3R1PA 1IJ5A 4ZCVA 2QACA 5KU1A 1V1FA 4GNKB 5KSZA 2JTTA 3AKBA 1QX7A 1EL4A 1N2DA 1QX5B 3SIBA 4C0JA 1IKUA 1FBVA 3PM8A 1NX0A 3IVTA 3D78A 1C7VA 2BBNA 1UURA 2H2KA 1WRLA 3I5HC 2M7LA 1IRJA 2BKIB 4OV2A 4P5OE 4KYNA 3BUXB 3O78A 3PLFB 1BLQA 2KYCA 1NX1A 1S5GY 1DQEA 4MEWA 3CR2A 1PRWA 4PE0A 3CZ2A 2KI6C 2WNDA 2Y5IA 3RM1A 1JBAA 1YVLA 1BF5A 2OTGB 4WQ3A 1CDMA 1K94A 1CDLA 1RFJA 1MUXA 1TWOA 3FWCA 5CSIA 5GQQC 1B8LA 2BECA 3SS4A 2GGMA 4MRXA 3LL8B 4XJKA 1V1GA 2I18A 3S0FA 2LV7A 3B88A 1RWYA 5JOLA 1TNPA 3I5HB 3EVRA 1SW8A 1MF8B 1FI6A 4DIRA 1BT6A 5D69A 5DKRA 1W7IB 1TOPA 2Q4UA 4P2YB 1F70A 1QWVA 1WRKA 4CPVA 3NXAA 2OPOA 1U5IA 1K95A 3ICBA 3PALA 3TUYC 1K90D 3EVVA 3O2PA 3QMEA 4OKHA 1NIWA 3BYAA 1BOCA 2ZRSA 2EC6C 2WC5A 2OS8C 1YUSA 1SCMC 4GUKA 4NDCA 4INWA 1QASA 1TTXA 2BE6A 3CR4X 3OGNA 2P71A 2K2FA 1C7WA 1S36A 4N5XA 3I5IB 3VB1A 5FI2A 1M39A 3B86A 2M7NA 3SJSA 1M46A 1BR1B 3SIAA 1AJ4A 5ER5A 4BY5A 1DGUA 1DEKA 1KQMB 3B7AA 2LMUA 4YBHB 2NXQA 3TDIA 2WCJA 1ALWA 5I2OA 3SG4A 2WCBA 1K9PA 1KFXS 2MRDA 3D76A 2ZN9A 3OB1B 3DY9A 1OOGA 4ORCB 4U8DA 2WCHA 1DJYA 1OOHA 1WLZA 1J7RA 2K8MB 2LC5A 4GPLB 4IJ7A 1RK9A 1B4CA 2QEHA 2JTZA 2L50A 2KPHA 1MXLC 1TUJA 5CPVA 3S0DA 1LS8A 1GM0A 4QJ3B 1A29A 1TN4A 4M2PA 1Z4HA 2JNXA 1JF2A 5CSJA 2PQLA 2MAZA 1GGZA 2KBMA 2CCMA 1QV0A 2L5XB 1CTRA 3IQQA 2R2IA 4AOMA 2KAXA 1S6JA 3VRRA 1PULA 3K1EA 1AHRA 1DJWA 2WORA 3KF9A 4GGFA 4CLNA 5FYXA 2FCEA 4PT1A 1CMGA 4NQGA 5I2LA 1G4YR 1ZUZA 1ZMZA 2KFFA 2SCPA 3NSOA 2EGDA 1DMOA 3JVTC 2L2CA 2CTNA 2K60A 3DVMA 2MBXA 3FS7A 4PE4A 3GK1A 2KOTA 4NDDA 3GK4X 1L2OB 1ZOTB 3EK4A 1YRUB 4A4BA 4CFQA 1KK8C 4YGBB 2QEBA 3HX4A 1DGVA 4A4CA 3LLEA 4C0KA 2LHLA 2M29A 3TZ1A 1IWQA 1PK0D 2LP3A 5PALA 5K89A 3QRXA 3O4XA 1D1OA 2ZN8A 1YURA 3EG5B 3JVTB 2HF5A 4FTGA 2PRUA 1DTLA 1ZACA 2BBMA 2NCOA 1NCYA 2L0PA 2O60A 3L47A 1KFUS 1DJXA 2L98A 4PE1A 1JWDA 1AJ5A 1SL7A 2AMIA 3CLNA 3BFBA 4DCKA 1CLLA 3L4LA 2JT3A 1K9UA 1IGVA 4Q04A 4JD9A 4YI9A 1Y0VH 3DVEA 5FI7A 4MZLA 5I8NA 3L4AA 4OCIA 2L5YA 1PSRA 1PVAA 5HKWA 1IIOA 1NSHA 3EKHA 2JQ6A 2LLUA 1YUUA 3DVKA 1K9KA 4CFRA 4E68A 4XJKB 2MLFC 1DF0A 2F2PA 2L4IA 1WLMA 2KAVA 1NYAA 1S1EA 1CLMA 2H61C 2ZRTA 1XFWO 1QIVA 4PCWA 5DICA 5CSNA 3UNWA 1B47A 3WNXB 1QJTA 1UHHA 2K7DA 3D75A 4GFTA 1NP8A 2MHHA 3CYZA 1GJYA 2F8PA 4GGNA 4MRYA 1YX7A 3C1VA 4PALA 1WRZA 4YGCB 3A8RA 1BMOA 1OMVA 3WXAA 3TDZA 4AQIA 1XK4A 2K7CA 3CTNA 3MSEB 1B7TZ 1SYMA 2JOJA 1CM4A 1NX3A 4M2QA 1RECA 3AKAA 1YR5A 1HT9A 3LK0A 4GAOA 3KO0A 1XVJA 1M31A 1XA5A 2BCAA 2JNFA 1EXRA 4JPZB 5BPJA 1FF1A 1A75B 3S0EA 1QLKA 1UP5A 2WCMA 1W9ZA 1CNPA 2KBIA 2WCLA 2I94A 3PM2A 1Y1XA 2GTEA 2LVKA 2WC6A 1OOIX 3NGVA 2G9BA 3FE6A 4JQ0D 1XFXO 2P6BB 1EG4A 4USLA 2JT8A 3AAJA 3S0BA 3DXLA 5HKYA 1QVIZ 2BL0C 3AAKA 1FPWA 2H61A 1C07A 5D3OA 1UHJA 2JXLA 2DOQA 1TNWA 4OVNF 5F6TA 4GGFC 3R1OA 1BJFA 4CIDA 3ZNIA 1QATA 3SG3A 5AERA 1L7ZA 1GQMA 2HQWA 2KLEA 3TUYB 1CDNA 1CLBA 1H4BA 1GGWA 1KQVA 1N65A 2EC6B 2L2EA 4PHMA 1IJ6A 5AANA 5KTYA 1CM1A 2OS8B 1SCMB 4OZDA 1AP4A 1EH2A 3SG7A 4DS7A 2LCPA 1JSAA 3O4YA 1K2HA 4HRHA 2MA2A 3KPXA 3M0WA 1LVCD 3VROA 1RTP1 1Q80A 1CFDA 1XFVO 5IBWA 3OP0A 1IQ5A 2IS9A 1PSBA 3PJIA 1SCVA 2I7AA 1PALA 1TCFA 2BKHB 1WDCC 2WCEA 3DVJA 3NSIA 3DYEA 4MBEA 1XFRA 2WCFA 5HLVA 1C3YA 4PHNA 2CT9A 1QV1A 2KYFA 4F7FA 3OX5A 2KGRA 5EL2A 1DJZA 1MHOA 4YGAA 1LKJA 5CSFA 2FJYA 1F8HA 3IF7A 4INXA 3Q8IA 1OZSA 4HRGA 3B87A 2M97A 3EKJA 1OOFA 1H8BA 5HYDA 1SL9A 4GBAA 2KFHA 3D73A 5HKZA 1J7OA 5J3XA 1A2XA 2JU0A 1WDCB 2KFGA 2JC2A 1DJIA 3H4SE 2KLDA 1WY9A 2KI6D 3CZ0A 3SG5A 2LVVA 2Y4QA 2HPSA 1UHNA 1YTZC 2M1KB 2ZKMX 2QEOA 3BUOB 5HLOA 1JUOA 1RJVA 1DELA 3VRPA 1BU3A 2BCBA 1AVSA 2BE4A 1G33A 2QDIA 3DZTA 3JTDC 4MN0A 5FI6A 1K8UA 4NDBA 3D10A 3I5FC 1M63B 3TS5C 2FJUB 2Q91A 2K61A 1MWNA 2F2OA 2LHIA 2PALA 2YGUA 5I2QA 3RZSA 4WRIA 2PMYA 1OW4A 2WC8A 2K0JA 2O5GA 1F4OA 1QS7A 1TIZA 2ERBA 1KK8B 1B7TY 1Y1AA 3I5GC 2H8VA 5I94A 1CFCA 3PN7C 1BODA 1SRAA 1DF0B 1P28A 1XK4C 2LLSA 4YRUA 2RGIA 1OE9B 3BOWA 1G8IA 1XFZO 4WQ2A 2D8NA 2M0RA 3TS5B 4N1GA 1SSEB 2F3YA 2MJWB 4MSPA 1UHKA 1CFFA 2NZ0A 1SR6C 2JT0A 4ZCUA 1SL8A 3V2LA 4QJ5B 2V53A 1S3PA 1S6CA 1QXPA 3S0AA
chains in the Genus database with same CATH topology
2PYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PYQ A; 
#chains in the Genus database with same CATH topology
 3CGA A;  2KSP A;  1QVI Y;  1S26 D;  2M8U A;  3OB2 B;  1TCO B;  1NCZ A;  1SK6 D;  2AUC A;  2CBL A;  4MLW A;  5TNC A;  3TDU A;  1KWO C;  1R6P A;  2LAP A;  2LMV A;  3D0Y A;  2LP2 A;  4DUQ A;  5AEQ A;  2BNX A;  1T14 A;  1JFJ A;  2VRG A;  3OBV A;  1OQP A;  1U5I B;  2L51 A;  1TNQ A;  4ICB A;  2I2R E;  4I5K A;  3PSR A;  3WHT B;  3SS5 A;  2K2A A;  3OHM B;  2LLT A;  2OTG C;  3DD4 A;  4ORA B;  1J7P A;  2ZND A;  3NSL A;  1K96 A;  3R1V A;  1KWO B;  4BY4 A;  2AAO A;  1F55 A;  2L4H A;  3GK2 A;  2EHB A;  2JPO A;  2G2B A;  1SKT A;  2SAS A;  2TN4 A;  3BUM B;  4JWQ A;  4YGD B;  1R2U A;  4MZK A;  2B1U A;  3SS3 A;  3DF0 A;  3GOF A;  2E6W A;  3FIA A;  2KDH A;  1OMR A;  2M1U A;  2K7B A;  2ISD A;  1SY9 A;  3CZT X;  3B6X A;  1ODB A;  1KCY A;  1MXE A;  2KNE A;  2LNK A;  4JKT A;  4QJ4 B;  1E8A A;  4AQJ A;  1NX2 A;  1PVB A;  2F3Z A;  1F4Q A;  1QLS A;  3CR5 X;  2KQY A;  2QEV A;  1CMF A;  1TRF A;  4M2O A;  1XO5 A;  3BUW B;  3LCP C;  2FOT A;  1C3Z A;  1KK7 Z;  3CS1 A;  4IL1 A;  1EJ3 A;  3KEV A;  1XFY O;  1N0Y A;  1LXF C;  3I5I C;  2KHN A;  2LUC A;  4I5N B;  3BQ3 A;  1RRO A;  4C0L A;  2BCX A;  3D77 A;  2JZI A;  1ORG A;  2PVB A;  1KQM C;  1SNL A;  1ALV A;  1LA3 A;  1UHI A;  3A4U B;  3VGO A;  3PFV A;  3FE8 A;  3IQO A;  2JXC A;  1NCX A;  1X02 A;  2BL0 B;  3BUN B;  3CZ1 A;  1OZO A;  2CXJ A;  1A4P A;  1QIW A;  1JF0 A;  1S6I A;  2PSR A;  1DC1 A;  2WCK A;  2KGB C;  4XYN A;  3SG2 A;  2LMT A;  4I5L B;  1UWO A;  1SBJ A;  1YX8 A;  1TNX A;  2KQ6 A;  5DKN A;  1CB1 A;  1KFU L;  1SMG A;  1OOJ A;  3BJH A;  1A75 A;  4YGE B;  1S5G Z;  1Y6W A;  1UUS A;  2COL B;  3R72 A;  4DRW A;  3EK8 A;  1DVI A;  1QTX A;  3CAB A;  3NSK A;  3O6B A;  2KAY A;  3OX6 A;  1NPQ A;  3N7H A;  1XFU O;  1YVH A;  3E3R A;  2LVJ A;  4ETO A;  1AUI B;  1AK8 A;  3LK1 A;  2JWW A;  2ZNE A;  3HCM A;  5AXI A;  1IQ3 A;  1B8C A;  1J55 A;  1SPY A;  2HQ8 A;  3BFA A;  3RLZ A;  4MVF A;  3FWB A;  1TUZ A;  1B1G A;  2HET A;  1JFK A;  1F71 A;  1A03 A;  5B8I B;  3NHI A;  2NLN A;  2M9G A;  3CDN A;  4D1E A;  1NWD A;  1OMD A;  1DJH A;  4PDZ A;  5DKQ A;  3SG6 A;  3UO9 A;  4OR9 B;  1L2O C;  1J1D A;  1Z2C B;  3BOW B;  1KSM A;  2LM5 A;  2KI4 C;  3ZWH A;  2JRF A;  2JUL A;  1VRK A;  1OSA A;  5D7F A;  2Y1N A;  3PAT A;  4PE7 A;  4MZJ A;  1NUB A;  4TNC A;  2BAP A;  2GGZ A;  5JJG A;  1W7J B;  2PAS A;  1LIN A;  4PHK A;  1DT7 B;  1YUT A;  1J1E A;  1BR4 B;  2PYQ A;  1IH0 A;  3KHE A;  1IG5 A;  2ZFD A;  4N1F A;  1J7Q A;  1BG1 A;  1HQV A;  5AFP A;  3JTD B;  2QPT A;  4FQT A;  2KI4 B;  2P70 A;  5HL1 A;  3D0Y B;  3VRN A;  1YRT B;  3I5F B;  3WHU B;  1CKK A;  2CNP A;  1MR8 A;  2GV5 A;  4R1E A;  1CFP A;  1LA0 A;  4FQO A;  2LAN A;  3CWG A;  3EK7 A;  2E30 A;  2LUX A;  1CDP A;  4L9M A;  3BXK A;  3EVU A;  2A4J A;  2NCP A;  3I5G B;  1B8R A;  4F0Z B;  3PN7 B;  4ORB B;  4PHJ A;  2LVI A;  1KK7 Y;  3K21 A;  3VRQ A;  1FW4 A;  1QX2 A;  2F33 A;  3FE9 A;  2WOS A;  3F45 A;  3D74 A;  1Y1U A;  3NHT A;  4HRE E;  5ER4 X;  5G08 A;  1EG3 A;  1KSO A;  2JPT A;  1JC2 A;  1F54 A;  4I5J A;  2Y1M A;  2K7O A;  3DF0 B;  2M3W A;  1ZFS A;  1SR6 B;  3BFH A;  4UPG A;  2FCD A;  1FI5 A;  4HSZ A;  2MLE C;  1B9A A;  1KFX L;  1M45 A;  1XYD A;  1DJG A;  1K93 D;  2LE9 B;  2M49 B;  4YI8 A;  3S0G A;  1MQ1 A;  3R1P A;  1IJ5 A;  4ZCV A;  2QAC A;  5KU1 A;  1V1F A;  4GNK B;  5KSZ A;  2JTT A;  3AKB A;  1QX7 A;  1EL4 A;  1N2D A;  1QX5 B;  3SIB A;  4C0J A;  1IKU A;  1FBV A;  3PM8 A;  1NX0 A;  3IVT A;  3D78 A;  1C7V A;  2BBN A;  1UUR A;  2H2K A;  1WRL A;  3I5H C;  2M7L A;  1IRJ A;  2BKI B;  4OV2 A;  4P5O E;  4KYN A;  3BUX B;  3O78 A;  3PLF B;  1BLQ A;  2KYC A;  1NX1 A;  1S5G Y;  1DQE A;  4MEW A;  3CR2 A;  1PRW A;  4PE0 A;  3CZ2 A;  2KI6 C;  2WND A;  2Y5I A;  3RM1 A;  1JBA A;  1YVL A;  1BF5 A;  2OTG B;  4WQ3 A;  1CDM A;  1K94 A;  1CDL A;  1RFJ A;  1MUX A;  1TWO A;  3FWC A;  5CSI A;  5GQQ C;  1B8L A;  2BEC A;  3SS4 A;  2GGM A;  4MRX A;  3LL8 B;  4XJK A;  1V1G A;  2I18 A;  3S0F A;  2LV7 A;  3B88 A;  1RWY A;  5JOL A;  1TNP A;  3I5H B;  3EVR A;  1SW8 A;  1MF8 B;  1FI6 A;  4DIR A;  1BT6 A;  5D69 A;  5DKR A;  1W7I B;  1TOP A;  2Q4U A;  4P2Y B;  1F70 A;  1QWV A;  1WRK A;  4CPV A;  3NXA A;  2OPO A;  1U5I A;  1K95 A;  3ICB A;  3PAL A;  3TUY C;  1K90 D;  3EVV A;  3O2P A;  3QME A;  4OKH A;  1NIW A;  3BYA A;  1BOC A;  2ZRS A;  2EC6 C;  2WC5 A;  2OS8 C;  1YUS A;  1SCM C;  4GUK A;  4NDC A;  4INW A;  1QAS A;  1TTX A;  2BE6 A;  3CR4 X;  3OGN A;  2P71 A;  2K2F A;  1C7W A;  1S36 A;  4N5X A;  3I5I B;  3VB1 A;  5FI2 A;  1M39 A;  3B86 A;  2M7N A;  3SJS A;  1M46 A;  1BR1 B;  3SIA A;  1AJ4 A;  5ER5 A;  4BY5 A;  1DGU A;  1DEK A;  1KQM B;  3B7A A;  2LMU A;  4YBH B;  2NXQ A;  3TDI A;  2WCJ A;  1ALW A;  5I2O A;  3SG4 A;  2WCB A;  1K9P A;  1KFX S;  2MRD A;  3D76 A;  2ZN9 A;  3OB1 B;  3DY9 A;  1OOG A;  4ORC B;  4U8D A;  2WCH A;  1DJY A;  1OOH A;  1WLZ A;  1J7R A;  2K8M B;  2LC5 A;  4GPL B;  4IJ7 A;  1RK9 A;  1B4C A;  2QEH A;  2JTZ A;  2L50 A;  2KPH A;  1MXL C;  1TUJ A;  5CPV A;  3S0D A;  1LS8 A;  1GM0 A;  4QJ3 B;  1A29 A;  1TN4 A;  4M2P A;  1Z4H A;  2JNX A;  1JF2 A;  5CSJ A;  2PQL A;  2MAZ A;  1GGZ A;  2KBM A;  2CCM A;  1QV0 A;  2L5X B;  1CTR A;  3IQQ A;  2R2I A;  4AOM A;  2KAX A;  1S6J A;  3VRR A;  1PUL A;  3K1E A;  1AHR A;  1DJW A;  2WOR A;  3KF9 A;  4GGF A;  4CLN A;  5FYX A;  2FCE A;  4PT1 A;  1CMG A;  4NQG A;  5I2L A;  1G4Y R;  1ZUZ A;  1ZMZ A;  2KFF A;  2SCP A;  3NSO A;  2EGD A;  1DMO A;  3JVT C;  2L2C A;  2CTN A;  2K60 A;  3DVM A;  2MBX A;  3FS7 A;  4PE4 A;  3GK1 A;  2KOT A;  4NDD A;  3GK4 X;  1L2O B;  1ZOT B;  3EK4 A;  1YRU B;  4A4B A;  4CFQ A;  1KK8 C;  4YGB B;  2QEB A;  3HX4 A;  1DGV A;  4A4C A;  3LLE A;  4C0K A;  2LHL A;  2M29 A;  3TZ1 A;  1IWQ A;  1PK0 D;  2LP3 A;  5PAL A;  5K89 A;  3QRX A;  3O4X A;  1D1O A;  2ZN8 A;  1YUR A;  3EG5 B;  3JVT B;  2HF5 A;  4FTG A;  2PRU A;  1DTL A;  1ZAC A;  2BBM A;  2NCO A;  1NCY A;  2L0P A;  2O60 A;  3L47 A;  1KFU S;  1DJX A;  2L98 A;  4PE1 A;  1JWD A;  1AJ5 A;  1SL7 A;  2AMI A;  3CLN A;  3BFB A;  4DCK A;  1CLL A;  3L4L A;  2JT3 A;  1K9U A;  1IGV A;  4Q04 A;  4JD9 A;  4YI9 A;  1Y0V H;  3DVE A;  5FI7 A;  4MZL A;  5I8N A;  3L4A A;  4OCI A;  2L5Y A;  1PSR A;  1PVA A;  5HKW A;  1IIO A;  1NSH A;  3EKH A;  2JQ6 A;  2LLU A;  1YUU A;  3DVK A;  1K9K A;  4CFR A;  4E68 A;  4XJK B;  2MLF C;  1DF0 A;  2F2P A;  2L4I A;  1WLM A;  2KAV A;  1NYA A;  1S1E A;  1CLM A;  2H61 C;  2ZRT A;  1XFW O;  1QIV A;  4PCW A;  5DIC A;  5CSN A;  3UNW A;  1B47 A;  3WNX B;  1QJT A;  1UHH A;  2K7D A;  3D75 A;  4GFT A;  1NP8 A;  2MHH A;  3CYZ A;  1GJY A;  2F8P A;  4GGN A;  4MRY A;  1YX7 A;  3C1V A;  4PAL A;  1WRZ A;  4YGC B;  3A8R A;  1BMO A;  1OMV A;  3WXA A;  3TDZ A;  4AQI A;  1XK4 A;  2K7C A;  3CTN A;  3MSE B;  1B7T Z;  1SYM A;  2JOJ A;  1CM4 A;  1NX3 A;  4M2Q A;  1REC A;  3AKA A;  1YR5 A;  1HT9 A;  3LK0 A;  4GAO A;  3KO0 A;  1XVJ A;  1M31 A;  1XA5 A;  2BCA A;  2JNF A;  1EXR A;  4JPZ B;  5BPJ A;  1FF1 A;  1A75 B;  3S0E A;  1QLK A;  1UP5 A;  2WCM A;  1W9Z A;  1CNP A;  2KBI A;  2WCL A;  2I94 A;  3PM2 A;  1Y1X A;  2GTE A;  2LVK A;  2WC6 A;  1OOI X;  3NGV A;  2G9B A;  3FE6 A;  4JQ0 D;  1XFX O;  2P6B B;  1EG4 A;  4USL A;  2JT8 A;  3AAJ A;  3S0B A;  3DXL A;  5HKY A;  1QVI Z;  2BL0 C;  3AAK A;  1FPW A;  2H61 A;  1C07 A;  5D3O A;  1UHJ A;  2JXL A;  2DOQ A;  1TNW A;  4OVN F;  5F6T A;  4GGF C;  3R1O A;  1BJF A;  4CID A;  3ZNI A;  1QAT A;  3SG3 A;  5AER A;  1L7Z A;  1GQM A;  2HQW A;  2KLE A;  3TUY B;  1CDN A;  1CLB A;  1H4B A;  1GGW A;  1KQV A;  1N65 A;  2EC6 B;  2L2E A;  4PHM A;  1IJ6 A;  5AAN A;  5KTY A;  1CM1 A;  2OS8 B;  1SCM B;  4OZD A;  1AP4 A;  1EH2 A;  3SG7 A;  4DS7 A;  2LCP A;  1JSA A;  3O4Y A;  1K2H A;  4HRH A;  2MA2 A;  3KPX A;  3M0W A;  1LVC D;  3VRO A;  1RTP 1;  1Q80 A;  1CFD A;  1XFV O;  5IBW A;  3OP0 A;  1IQ5 A;  2IS9 A;  1PSB A;  3PJI A;  1SCV A;  2I7A A;  1PAL A;  1TCF A;  2BKH B;  1WDC C;  2WCE A;  3DVJ A;  3NSI A;  3DYE A;  4MBE A;  1XFR A;  2WCF A;  5HLV A;  1C3Y A;  4PHN A;  2CT9 A;  1QV1 A;  2KYF A;  4F7F A;  3OX5 A;  2KGR A;  5EL2 A;  1DJZ A;  1MHO A;  4YGA A;  1LKJ A;  5CSF A;  2FJY A;  1F8H A;  3IF7 A;  4INX A;  3Q8I A;  1OZS A;  4HRG A;  3B87 A;  2M97 A;  3EKJ A;  1OOF A;  1H8B A;  5HYD A;  1SL9 A;  4GBA A;  2KFH A;  3D73 A;  5HKZ A;  1J7O A;  5J3X A;  1A2X A;  2JU0 A;  1WDC B;  2KFG A;  2JC2 A;  1DJI A;  3H4S E;  2KLD A;  1WY9 A;  2KI6 D;  3CZ0 A;  3SG5 A;  2LVV A;  2Y4Q A;  2HPS A;  1UHN A;  1YTZ C;  2M1K B;  2ZKM X;  2QEO A;  3BUO B;  5HLO A;  1JUO A;  1RJV A;  1DEL A;  3VRP A;  1BU3 A;  2BCB A;  1AVS A;  2BE4 A;  1G33 A;  2QDI A;  3DZT A;  3JTD C;  4MN0 A;  5FI6 A;  1K8U A;  4NDB A;  3D10 A;  3I5F C;  1M63 B;  3TS5 C;  2FJU B;  2Q91 A;  2K61 A;  1MWN A;  2F2O A;  2LHI A;  2PAL A;  2YGU A;  5I2Q A;  3RZS A;  4WRI A;  2PMY A;  1OW4 A;  2WC8 A;  2K0J A;  2O5G A;  1F4O A;  1QS7 A;  1TIZ A;  2ERB A;  1KK8 B;  1B7T Y;  1Y1A A;  3I5G C;  2H8V A;  5I94 A;  1CFC A;  3PN7 C;  1BOD A;  1SRA A;  1DF0 B;  1P28 A;  1XK4 C;  2LLS A;  4YRU A;  2RGI A;  1OE9 B;  3BOW A;  1G8I A;  1XFZ O;  4WQ2 A;  2D8N A;  2M0R A;  3TS5 B;  4N1G A;  1SSE B;  2F3Y A;  2MJW B;  4MSP A;  1UHK A;  1CFF A;  2NZ0 A;  1SR6 C;  2JT0 A;  4ZCU A;  1SL8 A;  3V2L A;  4QJ5 B;  2V53 A;  1S3P A;  1S6C A;  1QXP A;  3S0A A; 
#chains in the Genus database with same CATH homology
 2PYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...