2PYQA

Crystal structure of a duf2853 member protein (jann_4075) from jannaschia sp. ccs1 at 1.500 a resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
114
structure length
114
Chain Sequence
GMGKRDDLIAQYADDLRNKCGMEPDMALLEKVTKGCGPAIYNRDASTVAGSDTAELETIKKNFLMKKLGLADSESLMGGIQSVIETYGRSERNKYRAVVYYMLTKHFGKESVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Uncharacterized protein
publication title Crystal structure of uncharacterized protein (YP_512017.1) from Jannaschia sp. CCS1 at 1.500 A resolution
rcsb
source organism Jannaschia sp. ccs1
total genus 32
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11015 DUF2853 Protein of unknown function (DUF2853)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.120 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Jann4075-like 2pyqA00
2PYQA
chains in the Genus database with same CATH superfamily
2EC6B 3SG6A 3O2PA 1E8AA 5HYDA 2ZRTA 2CT9A 1LXFC 2BCXA 2ZRSA 2PVBA 3OB1B 1EG4A 3R72A 1K9UA 5AANA 2LMTA 3PFVA 2Y5IA 1H4BA 1SCMB 1F70A 3WXAA 3EKJA 3UO9A 1A4PA 1IWQA 1TNXA 2KYFA 1OW4A 1QVIZ 2M1UA 3D76A 3OHMB 4DCKA 3S0AA 3FS7A 1B1GA 1NX2A 2M7NA 3AAKA 1DJIA 3DVEA 1C07A 4MZLA 4DIRA 2MLEC 3ZNIA 1CMFA 3DXLA 2WCHA 1YUUA 2OPOA 1PSRA 2JXLA 2NLNA 3KHEA 3AKAA 2BE4A 4I5JA 4MSPA 1ALWA 2KAYA 3CS1A 4PDZA 3I5FB 1KK8B 2LANA 4DS7A 2KSPA 2M49B 1QX5B 1YVLA 2JC2A 1JBAA 3FE8A 3EVRA 1C7VA 2YGUA 3BFBA 3R1PA 1CDMA 1UP5A 4ZCUA 1M46A 3E3RA 3EK8A 1P28A 3KPXA 1JF2A 2GV5A 2BBMA 2JXCA 1AP4A 2PSRA 3CZ1A 3NSLA 4YRUA 1KQVA 1K95A 2D8NA 1QLSA 2QACA 3DVJA 1QIVA 3CR5X 3R1VA 1C7WA 1WDCC 2LMUA 3QMEA 2KYCA 1RWYA 2E30A 3I5IB 2OS8B 5FI7A 2VRGA 5CSFA 3HCMA 3NHIA 1DC1A 3O4XA 5ER4X 1BOCA 4M2PA 3TUYB 2JWWA 1JWDA 3TZ1A 3BYAA 2L5YA 4PE1A 4JQ0D 3VROA 1S6JA 1WRLA 3FIAA 2CTNA 4GNKB 2I18A 2WCLA 4INXA 2K8MB 3O6BA 4PE0A 2LVKA 5CSJA 3GOFA 2G9BA 5TNCA 1XFXO 2K7BA 2WCJA 1NCYA 1CFDA 1QASA 2OTGC 2JT8A 3BUNB 3KEVA 1FI6A 3HX4A 1Z2CB 1CKKA 4YGBB 1ZOTB 2F3YA 4GGFA 3DY9A 2P71A 3GK4X 2WC6A 3ZWHA 2ZKMX 4NDBA 2GTEA 3SG7A 3BUOB 3LK1A 1NX0A 1AJ4A 2GGZA 1UHIA 1FF1A 1J1EA 4JKTA 1KQMC 2K7OA 3EVVA 3IF7A 2M29A 3S0FA 3OP0A 1SSEB 2L50A 2M1KB 1DF0B 4NDCA 3SG3A 2KI6C 1A29A 2WCEA 3RZSA 4YGCB 3SS5A 3B87A 2LUCA 3K1EA 3JVTC 2H61A 3VGOA 4E68A 2BE6A 1S5GY 2KBMA 3PLFB 1XFYO 5I2OA 1OZSA 4YBHB 1K8UA 1M45A 1S36A 3D75A 1BU3A 5EL2A 5CPVA 2BKHB 2FCDA 1LA0A 2FOTA 4ORCB 5GQQC 4XYNA 3UNWA 1KSMA 1FI5A 1TIZA 1S5GZ 2LVJA 4WQ2A 2WCKA 2JQ6A 2PALA 3L47A 1MF8B 1SMGA 3AKBA 5DKRA 1VRKA 5FI2A 4PE4A 4NDDA 4IL1A 1F55A 4CIDA 2Y1MA 5I2LA 2IS9A 3EK7A 3IQOA 3DYEA 5D7FA 3CWGA 4DUQA 5D69A 4QJ3B 3VRNA 3CABA 1UUSA 1TRFA 2LC5A 3DVKA 1T14A 2F3ZA 2KFFA 2V53A 2ZN9A 4MRYA 2KI4C 2COLB 2H8VA 3V2LA 5I8NA 4I5LB 4M2QA 4A4CA 2KLDA 3I5GC 1Q80A 1TNWA 2L5XB 3QRXA 5AFPA 4ICBA 4M2OA 2F2OA 3PN7C 5AEQA 1K94A 1K9KA 4NQGA 3SJSA 1DT7B 1OOIX 4GAOA 1Y0VH 4GFTA 2LNKA 1L7ZA 4UPGA 2KFGA 4MVFA 2B1UA 1SNLA 1JSAA 1X02A 4P2YB 2LLUA 1SRAA 1PVBA 4GUKA 2FJUB 4Q04A 3VRQA 1GGZA 2Q91A 4ORAB 5I2QA 1ZACA 1RECA 1LINA 1TUJA 1DTLA 1DVIA 1DF0A 1JFJA 1NCXA 1V1FA 2LE9B 2K2FA 3TDZA 4OKHA 1QLKA 2LAPA 1B9AA 2NCPA 1IQ5A 2PASA 1KK7Y 2BAPA 2KFHA 4HSZA 4QJ4B 1KFXS 3CDNA 1N2DA 1QX7A 1YRTB 3O78A 1KFUS 1QV0A 3FWCA 1IIOA 1ORGA 1SKTA 2HPSA 3CZ2A 4ORBB 1NCZA 3D78A 1TCFA 2HQ8A 1BMOA 5F6TA 1KFXL 1PULA 3NXAA 1KK7Z 2P70A 1KFUL 1DJYA 2A4JA 4OCIA 2CNPA 1B7TY 1DJZA 2E6WA 2L4HA 4MEWA 5BPJA 2KHNA 2KDHA 3VB1A 1D1OA 1CLBA 2Q4UA 2JNXA 1QX2A 3DVMA 1C3YA 1CFPA 3B88A 3NHTA 4HREE 1ODBA 2L0PA 1OE9B 1DELA 3D0YB 1CTRA 1F4QA 3CGAA 1S6CA 2KQ6A 1AHRA 1KQMB 1BR4B 1MXLC 4HRGA 3S0DA 2I7AA 4BY5A 1B7TZ 1XK4C 1B47A 1PRWA 1YR5A 2BL0B 2JNFA 2NCOA 2QEOA 2WNDA 5KU1A 2LLSA 1M31A 3NSIA 1YX8A 4BY4A 3JVTB 3LCPC 1Y1XA 4PT1A 1PVAA 3CZ0A 2KGBC 1KSOA 1XA5A 2MHHA 1CDLA 1GJYA 1RTP1 2JOJA 2LP2A 2M0RA 2BCBA 1JFKA 1XYDA 4U8DA 1F4OA 1M63B 3A4UB 3BFHA 2HETA 1OMDA 1DGVA 1B4CA 1XFZO 1J7RA 2F33A 2QEBA 1B8CA 1TWOA 2WCFA 1NX3A 4CLNA 2LVVA 3FE6A 4INWA 2HQWA 2Y1NA 2M97A 4A4BA 2KOTA 1XFWO 4AOMA 3R1OA 1YURA 4YI9A 1DQEA 4AQIA 1XVJA 4OZDA 2F2PA 2K0JA 4R1EA 3JTDC 4YGEB 1W7JB 4I5KA 1NIWA 1Y1AA 5DKQA 5JOLA 3SS3A 2LVIA 1H8BA 2JT3A 2LUXA 1MUXA 4GPLB 3BJHA 2KPHA 1LA3A 3OX5A 1AVSA 2KI4B 4I5NB 5I94A 2I2RE 3L4LA 1YUSA 4HRHA 1UWOA 2MAZA 2WC5A 4OV2A 5CSIA 1BT6A 1FW4A 1AUIB 1BF5A 1W9ZA 2TN4A 1TCOB 1JUOA 3OB2B 3PN7B 2SASA 2SCPA 1MWNA 1MR8A 5CSNA 1F71A 4WQ3A 1N0YA 1IG5A 3BFAA 1MHOA 2LM5A 3PSRA 4YGAA 1M39A 1ALVA 1PK0D 3BQ3A 2WORA 5HKYA 5KTYA 3CR4X 1G33A 3PM8A 5FYXA 3B6XA 1UHKA 2K60A 2CBLA 1B8LA 1GQMA 1IJ5A 4MZKA 3CR2A 3BUWB 3BUXB 3TS5C 3NSOA 2OS8C 3D0YA 1UHNA 1TUZA 5D3OA 3OGNA 5AERA 1BLQA 2K61A 2KAVA 3OX6A 1QTXA 4OVNF 1FPWA 2KGRA 1TNQA 4ETOA 3S0EA 2JPOA 3B86A 4D1EA 2WC8A 3FWBA 1SCVA 3K21A 3M0WA 1CDNA 2AUCA 3SG4A 4C0JA 3I5HC 3NGVA 2WCMA 2H2KA 1TTXA 3BUMB 1KWOC 1OOFA 4N1FA 2PQLA 1CB1A 1YVHA 4GBAA 1G8IA 2ZNEA 5ER5A 2CXJA 1SBJA 4IJ7A 1JF0A 2MJWB 3PATA 1ZUZA 3IQQA 3Q8IA 1KCYA 4FQTA 1EL4A 2Y4QA 4MZJA 3LLEA 1F8HA 4WRIA 1F54A 2QPTA 3N7HA 5HLVA 1J1DA 3SIBA 1WDCB 1OMVA 2CCMA 2HF5A 3ICBA 4GGNA 1CMGA 1HQVA 2L98A 4PHNA 3SIAA 1LVCD 2NXQA 1IRJA 4PHKA 4FQOA 2AMIA 1A75B 1Y6WA 3BXKA 3D77A 5DKNA 1L2OC 1IKUA 1J7QA 1IGVA 3TDUA 5IBWA 1AJ5A 2JPTA 3SS4A 4JD9A 1K9PA 3D10A 2MRDA 3CLNA 1U5IB 3EK4A 4XJKB 2JULA 4FTGA 1IQ3A 3L4AA 4MBEA 1ZFSA 1CNPA 1SYMA 2LCPA 4PHMA 4C0LA 1W7IB 1K2HA 2BCAA 1DJWA 1WRZA 3EKHA 2OTGB 4YGDB 1DMOA 2GGMA 2O60A 1WRKA 4P5OE 3BOWB 1XO5A 1YX7A 3CTNA 1A03A 1BR1B 1BJFA 4F7FA 4DRWA 4YI8A 1CLLA 3SG2A 2KI6D 1OZOA 1TN4A 3JTDB 3A8RA 1QJTA 2MA2A 2R2IA 3MSEB 2ISDA 5HL1A 1SPYA 2QEVA 1PSBA 1XFUO 3B7AA 4CFQA 1EJ3A 1GM0A 2EHBA 3DF0A 4USLA 1J7PA 1C3ZA 2O5GA 2P6BB 2M9GA 1WLMA 5HKWA 1SR6C 1NPQA 2FCEA 3PJIA 1WLZA 1CDPA 2KLEA 1G4YR 1K93D 1QXPA 2JT0A 2EC6C 4PHJA 1OMRA 5AXIA 5J3XA 1AK8A 2LLTA 3RM1A 3WNXB 1DGUA 4PE7A 2ERBA 1DEKA 2AAOA 2ZN8A 1IH0A 4GGFC 1SCMC 1TNPA 5JJGA 1EXRA 3TS5B 1NSHA 1LKJA 2K2AA 4N1GA 1QS7A 1QV1A 3PM2A 3VRPA 2M7LA 1EH2A 1K90D 1OSAA 2JRFA 1Z4HA 4OR9B 1XK4A 1RK9A 2LP3A 2I94A 2QDIA 2MBXA 2L51A 3S0BA 2KBIA 2PMYA 2BECA 5FI6A 1A75A 1R2UA 1OOJA 1RJVA 2DOQA 4QJ5B 1UHHA 1WY9A 1BG1A 3C1VA 1SL7A 2QEHA 1SY9A 1FBVA 2L2CA 1V1GA 3LK0A 2H61C 4N5XA 4PCWA 1U5IA 3I5HB 1KK8C 2M3WA 2FJYA 3I5FC 3KO0A 1KWOB 4XJKA 5DICA 1OOHA 3I5GB 1S3PA 3PALA 1UHJA 4KYNA 3D74A 2L2EA 3KF9A 1ZMZA 3OBVA 1DJXA 1R6PA 2WOSA 4AQJA 1OOGA 3IVTA 3BOWA 1DJHA 1NWDA 1NYAA 3D73A 2LMVA 2ZFDA 1B8RA 1YRUB 3O4YA 1GGWA 1A2XA 4F0ZB 3VRRA 3LL8B 3AAJA 2PRUA 3I5IC 3TDIA 1TOPA 1XFVO 1CFCA 2ZNDA 2BNXA 1Y1UA 2BL0C 2RGIA 4JPZB 2K7CA 1J7OA 1NP8A 2LHIA 1CM4A 3NSKA 4L9MA 3TUYC 2K7DA 4TNCA 1L2OB 1OQPA 1UURA 3RLZA 3DZTA 1YUTA 2F8PA 4MRXA 1QWVA 2G2BA 3DF0B 1NX1A 3CYZA 3EG5B 1YTZC 2JZIA 2LV7A 1S1EA 1RROA 3H4SE 1J55A 1BODA 2JU0A 3WHUB 1S6IA 3DD4A 2KQYA 1QATA 1N65A 3S0GA 1CLMA 4PALA 1MXEA 3SG5A 3EVUA 1EG3A 2NZ0A 3GK2A 2LHLA 1SK6D 4MN0A 1K96A 1MQ1A 3FE9A 1SL8A 1NUBA 3F45A 2KNEA 5B8IB 5G08A 4C0KA 1CM1A 2BBNA 5HLOA 5KSZA 1IJ6A 2JTTA 2KAXA 1PALA 5K89A 1QIWA 5HKZA 2BKIB 4ZCVA 2WCBA 2M8UA 1XFRA 2L4IA 3CZTX 2PYQA 1CFFA 4JWQA 1LS8A 1HT9A 1SL9A 2EGDA 2JTZA 2MLFC 4CPVA 4MLWA 1S26D 1RFJA 4CFRA 1JC2A 1SR6B 3WHTB 3GK1A 5PALA 1SW8A 1DJGA 1QVIY
chains in the Genus database with same CATH topology
2PYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PYQ A; 
#chains in the Genus database with same CATH topology
 2EC6 B;  3SG6 A;  3O2P A;  1E8A A;  5HYD A;  2ZRT A;  2CT9 A;  1LXF C;  2BCX A;  2ZRS A;  2PVB A;  3OB1 B;  1EG4 A;  3R72 A;  1K9U A;  5AAN A;  2LMT A;  3PFV A;  2Y5I A;  1H4B A;  1SCM B;  1F70 A;  3WXA A;  3EKJ A;  3UO9 A;  1A4P A;  1IWQ A;  1TNX A;  2KYF A;  1OW4 A;  1QVI Z;  2M1U A;  3D76 A;  3OHM B;  4DCK A;  3S0A A;  3FS7 A;  1B1G A;  1NX2 A;  2M7N A;  3AAK A;  1DJI A;  3DVE A;  1C07 A;  4MZL A;  4DIR A;  2MLE C;  3ZNI A;  1CMF A;  3DXL A;  2WCH A;  1YUU A;  2OPO A;  1PSR A;  2JXL A;  2NLN A;  3KHE A;  3AKA A;  2BE4 A;  4I5J A;  4MSP A;  1ALW A;  2KAY A;  3CS1 A;  4PDZ A;  3I5F B;  1KK8 B;  2LAN A;  4DS7 A;  2KSP A;  2M49 B;  1QX5 B;  1YVL A;  2JC2 A;  1JBA A;  3FE8 A;  3EVR A;  1C7V A;  2YGU A;  3BFB A;  3R1P A;  1CDM A;  1UP5 A;  4ZCU A;  1M46 A;  3E3R A;  3EK8 A;  1P28 A;  3KPX A;  1JF2 A;  2GV5 A;  2BBM A;  2JXC A;  1AP4 A;  2PSR A;  3CZ1 A;  3NSL A;  4YRU A;  1KQV A;  1K95 A;  2D8N A;  1QLS A;  2QAC A;  3DVJ A;  1QIV A;  3CR5 X;  3R1V A;  1C7W A;  1WDC C;  2LMU A;  3QME A;  2KYC A;  1RWY A;  2E30 A;  3I5I B;  2OS8 B;  5FI7 A;  2VRG A;  5CSF A;  3HCM A;  3NHI A;  1DC1 A;  3O4X A;  5ER4 X;  1BOC A;  4M2P A;  3TUY B;  2JWW A;  1JWD A;  3TZ1 A;  3BYA A;  2L5Y A;  4PE1 A;  4JQ0 D;  3VRO A;  1S6J A;  1WRL A;  3FIA A;  2CTN A;  4GNK B;  2I18 A;  2WCL A;  4INX A;  2K8M B;  3O6B A;  4PE0 A;  2LVK A;  5CSJ A;  3GOF A;  2G9B A;  5TNC A;  1XFX O;  2K7B A;  2WCJ A;  1NCY A;  1CFD A;  1QAS A;  2OTG C;  2JT8 A;  3BUN B;  3KEV A;  1FI6 A;  3HX4 A;  1Z2C B;  1CKK A;  4YGB B;  1ZOT B;  2F3Y A;  4GGF A;  3DY9 A;  2P71 A;  3GK4 X;  2WC6 A;  3ZWH A;  2ZKM X;  4NDB A;  2GTE A;  3SG7 A;  3BUO B;  3LK1 A;  1NX0 A;  1AJ4 A;  2GGZ A;  1UHI A;  1FF1 A;  1J1E A;  4JKT A;  1KQM C;  2K7O A;  3EVV A;  3IF7 A;  2M29 A;  3S0F A;  3OP0 A;  1SSE B;  2L50 A;  2M1K B;  1DF0 B;  4NDC A;  3SG3 A;  2KI6 C;  1A29 A;  2WCE A;  3RZS A;  4YGC B;  3SS5 A;  3B87 A;  2LUC A;  3K1E A;  3JVT C;  2H61 A;  3VGO A;  4E68 A;  2BE6 A;  1S5G Y;  2KBM A;  3PLF B;  1XFY O;  5I2O A;  1OZS A;  4YBH B;  1K8U A;  1M45 A;  1S36 A;  3D75 A;  1BU3 A;  5EL2 A;  5CPV A;  2BKH B;  2FCD A;  1LA0 A;  2FOT A;  4ORC B;  5GQQ C;  4XYN A;  3UNW A;  1KSM A;  1FI5 A;  1TIZ A;  1S5G Z;  2LVJ A;  4WQ2 A;  2WCK A;  2JQ6 A;  2PAL A;  3L47 A;  1MF8 B;  1SMG A;  3AKB A;  5DKR A;  1VRK A;  5FI2 A;  4PE4 A;  4NDD A;  4IL1 A;  1F55 A;  4CID A;  2Y1M A;  5I2L A;  2IS9 A;  3EK7 A;  3IQO A;  3DYE A;  5D7F A;  3CWG A;  4DUQ A;  5D69 A;  4QJ3 B;  3VRN A;  3CAB A;  1UUS A;  1TRF A;  2LC5 A;  3DVK A;  1T14 A;  2F3Z A;  2KFF A;  2V53 A;  2ZN9 A;  4MRY A;  2KI4 C;  2COL B;  2H8V A;  3V2L A;  5I8N A;  4I5L B;  4M2Q A;  4A4C A;  2KLD A;  3I5G C;  1Q80 A;  1TNW A;  2L5X B;  3QRX A;  5AFP A;  4ICB A;  4M2O A;  2F2O A;  3PN7 C;  5AEQ A;  1K94 A;  1K9K A;  4NQG A;  3SJS A;  1DT7 B;  1OOI X;  4GAO A;  1Y0V H;  4GFT A;  2LNK A;  1L7Z A;  4UPG A;  2KFG A;  4MVF A;  2B1U A;  1SNL A;  1JSA A;  1X02 A;  4P2Y B;  2LLU A;  1SRA A;  1PVB A;  4GUK A;  2FJU B;  4Q04 A;  3VRQ A;  1GGZ A;  2Q91 A;  4ORA B;  5I2Q A;  1ZAC A;  1REC A;  1LIN A;  1TUJ A;  1DTL A;  1DVI A;  1DF0 A;  1JFJ A;  1NCX A;  1V1F A;  2LE9 B;  2K2F A;  3TDZ A;  4OKH A;  1QLK A;  2LAP A;  1B9A A;  2NCP A;  1IQ5 A;  2PAS A;  1KK7 Y;  2BAP A;  2KFH A;  4HSZ A;  4QJ4 B;  1KFX S;  3CDN A;  1N2D A;  1QX7 A;  1YRT B;  3O78 A;  1KFU S;  1QV0 A;  3FWC A;  1IIO A;  1ORG A;  1SKT A;  2HPS A;  3CZ2 A;  4ORB B;  1NCZ A;  3D78 A;  1TCF A;  2HQ8 A;  1BMO A;  5F6T A;  1KFX L;  1PUL A;  3NXA A;  1KK7 Z;  2P70 A;  1KFU L;  1DJY A;  2A4J A;  4OCI A;  2CNP A;  1B7T Y;  1DJZ A;  2E6W A;  2L4H A;  4MEW A;  5BPJ A;  2KHN A;  2KDH A;  3VB1 A;  1D1O A;  1CLB A;  2Q4U A;  2JNX A;  1QX2 A;  3DVM A;  1C3Y A;  1CFP A;  3B88 A;  3NHT A;  4HRE E;  1ODB A;  2L0P A;  1OE9 B;  1DEL A;  3D0Y B;  1CTR A;  1F4Q A;  3CGA A;  1S6C A;  2KQ6 A;  1AHR A;  1KQM B;  1BR4 B;  1MXL C;  4HRG A;  3S0D A;  2I7A A;  4BY5 A;  1B7T Z;  1XK4 C;  1B47 A;  1PRW A;  1YR5 A;  2BL0 B;  2JNF A;  2NCO A;  2QEO A;  2WND A;  5KU1 A;  2LLS A;  1M31 A;  3NSI A;  1YX8 A;  4BY4 A;  3JVT B;  3LCP C;  1Y1X A;  4PT1 A;  1PVA A;  3CZ0 A;  2KGB C;  1KSO A;  1XA5 A;  2MHH A;  1CDL A;  1GJY A;  1RTP 1;  2JOJ A;  2LP2 A;  2M0R A;  2BCB A;  1JFK A;  1XYD A;  4U8D A;  1F4O A;  1M63 B;  3A4U B;  3BFH A;  2HET A;  1OMD A;  1DGV A;  1B4C A;  1XFZ O;  1J7R A;  2F33 A;  2QEB A;  1B8C A;  1TWO A;  2WCF A;  1NX3 A;  4CLN A;  2LVV A;  3FE6 A;  4INW A;  2HQW A;  2Y1N A;  2M97 A;  4A4B A;  2KOT A;  1XFW O;  4AOM A;  3R1O A;  1YUR A;  4YI9 A;  1DQE A;  4AQI A;  1XVJ A;  4OZD A;  2F2P A;  2K0J A;  4R1E A;  3JTD C;  4YGE B;  1W7J B;  4I5K A;  1NIW A;  1Y1A A;  5DKQ A;  5JOL A;  3SS3 A;  2LVI A;  1H8B A;  2JT3 A;  2LUX A;  1MUX A;  4GPL B;  3BJH A;  2KPH A;  1LA3 A;  3OX5 A;  1AVS A;  2KI4 B;  4I5N B;  5I94 A;  2I2R E;  3L4L A;  1YUS A;  4HRH A;  1UWO A;  2MAZ A;  2WC5 A;  4OV2 A;  5CSI A;  1BT6 A;  1FW4 A;  1AUI B;  1BF5 A;  1W9Z A;  2TN4 A;  1TCO B;  1JUO A;  3OB2 B;  3PN7 B;  2SAS A;  2SCP A;  1MWN A;  1MR8 A;  5CSN A;  1F71 A;  4WQ3 A;  1N0Y A;  1IG5 A;  3BFA A;  1MHO A;  2LM5 A;  3PSR A;  4YGA A;  1M39 A;  1ALV A;  1PK0 D;  3BQ3 A;  2WOR A;  5HKY A;  5KTY A;  3CR4 X;  1G33 A;  3PM8 A;  5FYX A;  3B6X A;  1UHK A;  2K60 A;  2CBL A;  1B8L A;  1GQM A;  1IJ5 A;  4MZK A;  3CR2 A;  3BUW B;  3BUX B;  3TS5 C;  3NSO A;  2OS8 C;  3D0Y A;  1UHN A;  1TUZ A;  5D3O A;  3OGN A;  5AER A;  1BLQ A;  2K61 A;  2KAV A;  3OX6 A;  1QTX A;  4OVN F;  1FPW A;  2KGR A;  1TNQ A;  4ETO A;  3S0E A;  2JPO A;  3B86 A;  4D1E A;  2WC8 A;  3FWB A;  1SCV A;  3K21 A;  3M0W A;  1CDN A;  2AUC A;  3SG4 A;  4C0J A;  3I5H C;  3NGV A;  2WCM A;  2H2K A;  1TTX A;  3BUM B;  1KWO C;  1OOF A;  4N1F A;  2PQL A;  1CB1 A;  1YVH A;  4GBA A;  1G8I A;  2ZNE A;  5ER5 A;  2CXJ A;  1SBJ A;  4IJ7 A;  1JF0 A;  2MJW B;  3PAT A;  1ZUZ A;  3IQQ A;  3Q8I A;  1KCY A;  4FQT A;  1EL4 A;  2Y4Q A;  4MZJ A;  3LLE A;  1F8H A;  4WRI A;  1F54 A;  2QPT A;  3N7H A;  5HLV A;  1J1D A;  3SIB A;  1WDC B;  1OMV A;  2CCM A;  2HF5 A;  3ICB A;  4GGN A;  1CMG A;  1HQV A;  2L98 A;  4PHN A;  3SIA A;  1LVC D;  2NXQ A;  1IRJ A;  4PHK A;  4FQO A;  2AMI A;  1A75 B;  1Y6W A;  3BXK A;  3D77 A;  5DKN A;  1L2O C;  1IKU A;  1J7Q A;  1IGV A;  3TDU A;  5IBW A;  1AJ5 A;  2JPT A;  3SS4 A;  4JD9 A;  1K9P A;  3D10 A;  2MRD A;  3CLN A;  1U5I B;  3EK4 A;  4XJK B;  2JUL A;  4FTG A;  1IQ3 A;  3L4A A;  4MBE A;  1ZFS A;  1CNP A;  1SYM A;  2LCP A;  4PHM A;  4C0L A;  1W7I B;  1K2H A;  2BCA A;  1DJW A;  1WRZ A;  3EKH A;  2OTG B;  4YGD B;  1DMO A;  2GGM A;  2O60 A;  1WRK A;  4P5O E;  3BOW B;  1XO5 A;  1YX7 A;  3CTN A;  1A03 A;  1BR1 B;  1BJF A;  4F7F A;  4DRW A;  4YI8 A;  1CLL A;  3SG2 A;  2KI6 D;  1OZO A;  1TN4 A;  3JTD B;  3A8R A;  1QJT A;  2MA2 A;  2R2I A;  3MSE B;  2ISD A;  5HL1 A;  1SPY A;  2QEV A;  1PSB A;  1XFU O;  3B7A A;  4CFQ A;  1EJ3 A;  1GM0 A;  2EHB A;  3DF0 A;  4USL A;  1J7P A;  1C3Z A;  2O5G A;  2P6B B;  2M9G A;  1WLM A;  5HKW A;  1SR6 C;  1NPQ A;  2FCE A;  3PJI A;  1WLZ A;  1CDP A;  2KLE A;  1G4Y R;  1K93 D;  1QXP A;  2JT0 A;  2EC6 C;  4PHJ A;  1OMR A;  5AXI A;  5J3X A;  1AK8 A;  2LLT A;  3RM1 A;  3WNX B;  1DGU A;  4PE7 A;  2ERB A;  1DEK A;  2AAO A;  2ZN8 A;  1IH0 A;  4GGF C;  1SCM C;  1TNP A;  5JJG A;  1EXR A;  3TS5 B;  1NSH A;  1LKJ A;  2K2A A;  4N1G A;  1QS7 A;  1QV1 A;  3PM2 A;  3VRP A;  2M7L A;  1EH2 A;  1K90 D;  1OSA A;  2JRF A;  1Z4H A;  4OR9 B;  1XK4 A;  1RK9 A;  2LP3 A;  2I94 A;  2QDI A;  2MBX A;  2L51 A;  3S0B A;  2KBI A;  2PMY A;  2BEC A;  5FI6 A;  1A75 A;  1R2U A;  1OOJ A;  1RJV A;  2DOQ A;  4QJ5 B;  1UHH A;  1WY9 A;  1BG1 A;  3C1V A;  1SL7 A;  2QEH A;  1SY9 A;  1FBV A;  2L2C A;  1V1G A;  3LK0 A;  2H61 C;  4N5X A;  4PCW A;  1U5I A;  3I5H B;  1KK8 C;  2M3W A;  2FJY A;  3I5F C;  3KO0 A;  1KWO B;  4XJK A;  5DIC A;  1OOH A;  3I5G B;  1S3P A;  3PAL A;  1UHJ A;  4KYN A;  3D74 A;  2L2E A;  3KF9 A;  1ZMZ A;  3OBV A;  1DJX A;  1R6P A;  2WOS A;  4AQJ A;  1OOG A;  3IVT A;  3BOW A;  1DJH A;  1NWD A;  1NYA A;  3D73 A;  2LMV A;  2ZFD A;  1B8R A;  1YRU B;  3O4Y A;  1GGW A;  1A2X A;  4F0Z B;  3VRR A;  3LL8 B;  3AAJ A;  2PRU A;  3I5I C;  3TDI A;  1TOP A;  1XFV O;  1CFC A;  2ZND A;  2BNX A;  1Y1U A;  2BL0 C;  2RGI A;  4JPZ B;  2K7C A;  1J7O A;  1NP8 A;  2LHI A;  1CM4 A;  3NSK A;  4L9M A;  3TUY C;  2K7D A;  4TNC A;  1L2O B;  1OQP A;  1UUR A;  3RLZ A;  3DZT A;  1YUT A;  2F8P A;  4MRX A;  1QWV A;  2G2B A;  3DF0 B;  1NX1 A;  3CYZ A;  3EG5 B;  1YTZ C;  2JZI A;  2LV7 A;  1S1E A;  1RRO A;  3H4S E;  1J55 A;  1BOD A;  2JU0 A;  3WHU B;  1S6I A;  3DD4 A;  2KQY A;  1QAT A;  1N65 A;  3S0G A;  1CLM A;  4PAL A;  1MXE A;  3SG5 A;  3EVU A;  1EG3 A;  2NZ0 A;  3GK2 A;  2LHL A;  1SK6 D;  4MN0 A;  1K96 A;  1MQ1 A;  3FE9 A;  1SL8 A;  1NUB A;  3F45 A;  2KNE A;  5B8I B;  5G08 A;  4C0K A;  1CM1 A;  2BBN A;  5HLO A;  5KSZ A;  1IJ6 A;  2JTT A;  2KAX A;  1PAL A;  5K89 A;  1QIW A;  5HKZ A;  2BKI B;  4ZCV A;  2WCB A;  2M8U A;  1XFR A;  2L4I A;  3CZT X;  2PYQ A;  1CFF A;  4JWQ A;  1LS8 A;  1HT9 A;  1SL9 A;  2EGD A;  2JTZ A;  2MLF C;  4CPV A;  4MLW A;  1S26 D;  1RFJ A;  4CFR A;  1JC2 A;  1SR6 B;  3WHT B;  3GK1 A;  5PAL A;  1SW8 A;  1DJG A;  1QVI Y; 
#chains in the Genus database with same CATH homology
 2PYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...