1KSMA

Average nmr solution structure of ca ln calbindin d9k
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
75
structure length
75
Chain Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGMSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VITAMIN D-DEPENDENT CALCIUM-BINDING PROTEIN
publication title Paramagnetism-based versus classical constraints: an analysis of the solution structure of Ca Ln calbindin D9k.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 19
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2002-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ksmA00
3ZWHA 1DJXA 2F3YA 4GAOA 1KK8C 1QX7A 5AANA 1FI5A 2LV7A 5KTYA 1YUUA 1S6JA 4WQ3A 3O4YA 2OPOA 2G9BA 2MRDA 4JQ0D 4NDBA 1LXFC 1NIWA 1QLKA 1CDNA 1H4BA 3GOFA 5IBWA 1UHKA 1JBAA 2JWWA 2M8UA 2KI4B 1SY9A 5HKWA 1K95A 2LC5A 3TZ1A 5F6TA 3OX5A 1XO5A 2E30A 1SCMC 4NDCA 4GFTA 2LHIA 1CM4A 2KHNA 1SKTA 1YRTB 2M1UA 3ICBA 2LMTA 1F4QA 4MZLA 2MAZA 1K93D 2I94A 2FCDA 2L4IA 4PE1A 1GGWA 3BQ3A 1YR5A 3D0YA 3E3RA 1UHHA 5J3XA 4D1EA 2JXCA 1W7IB 1WDCB 1TNXA 1OE9B 1PVBA 2IS9A 1B1GA 1F55A 2JC2A 1XFVO 1YX8A 2LANA 2ZRSA 1SPYA 3I5GC 4HRGA 1G8IA 2ZKMX 4M2PA 1IQ3A 1KWOB 2Q91A 2ZNDA 1EH2A 1Q80A 1DJHA 1CFPA 5ER5A 1K9UA 2KDHA 2LMUA 1ZOTB 2WCBA 5D69A 3SJSA 3CR2A 2WC8A 4DIRA 2MA2A 3RLZA 1XFYO 3F45A 2JTTA 3CLNA 1YURA 1QIWA 1C7VA 1GJYA 5HLVA 2MLEC 1XVJA 3OB2B 1IRJA 1MR8A 1YTZC 4OV2A 5KSZA 1OMVA 3PLFB 2M97A 5I2QA 2BKHB 4MSPA 2MBXA 4MEWA 3TDIA 2CXJA 2M7NA 1FPWA 1A29A 2LCPA 2K7OA 3NXAA 2PMYA 2B1UA 1AJ5A 1SW8A 2GV5A 3EKHA 1Y1UA 3O2PA 1NPQA 3PALA 3C1VA 1J1EA 1JC2A 4AQIA 1M63B 3D10A 2WCFA 1IGVA 5GQQC 3BUWB 1AVSA 2QPTA 1M31A 3NSIA 2RGIA 1K8UA 1AUIB 1NX1A 2K7BA 1ODBA 4NQGA 1IH0A 1CLMA 1QVIZ 3AKBA 1WLZA 4OCIA 2H61A 1KSMA 1K96A 1S5GZ 4OVNF 2I2RE 3NSLA 2M7LA 4DUQA 1B8CA 1WLMA 1XFUO 3LLEA 1C7WA 1M39A 1RTP1 2LLTA 1MF8B 2DOQA 4MZKA 3WXAA 3SG4A 4A4BA 2CCMA 4Q04A 1NP8A 1SL7A 2BE6A 4PHJA 2KFGA 2PASA 1B7TY 1WY9A 1IG5A 2JPTA 2F8PA 2JULA 3AKAA 3CS1A 3LCPC 3CZTX 4P5OE 1DGVA 1KFUS 1LA0A 3GK4X 1F70A 1YRUB 3TUYB 3OP0A 1S3PA 2WOSA 2KAXA 2KQYA 3EKJA 1MXLC 1SCVA 1DJWA 3MSEB 4CFQA 1NCZA 2JQ6A 2M29A 1OMDA 2BL0C 4XYNA 2Y5IA 1SL9A 1YX7A 3VRRA 2MJWB 4AOMA 1CFCA 1J7PA 5CPVA 1S6IA 2OTGB 2L4HA 3I5IC 2F2PA 2LM5A 4C0LA 1KK7Z 1CM1A 2M49B 4NDDA 2LVIA 3OX6A 2E6WA 4ICBA 2FJUB 1XFWO 2NXQA 1PALA 3CWGA 5HLOA 1DJGA 1CDPA 4FQOA 1A03A 3BOWA 1FW4A 2QACA 4ORBB 2FOTA 4GUKA 1B8LA 2BBMA 1QXPA 1TIZA 2L98A 2BECA 3EVVA 2M1KB 1K9KA 2GGZA 1XK4A 2KI4C 2MHHA 3JTDB 2H2KA 5ER4X 3AAKA 2L51A 1F8HA 4UPGA 1LINA 1CKKA 1JF0A 4HREE 2BKIB 2NLNA 2ZFDA 1MUXA 1PVAA 3EK7A 1A4PA 1WRLA 4PE0A 2ISDA 1CNPA 4HRHA 4R1EA 1OQPA 3LL8B 2L50A 4WRIA 3CR5X 1WDCC 4C0JA 1NCXA 1EL4A 2CBLA 2KI6D 1S26D 1PSRA 3WNXB 1RJVA 2L2EA 1KQMB 3SG3A 3BUXB 3DVEA 1KWOC 1ALWA 3BOWB 3BYAA 1XK4C 1J7RA 2JNXA 2F2OA 1PK0D 4PHMA 2G2BA 2PALA 5TNCA 2MLFC 1F54A 1PRWA 4YBHB 1LA3A 1QTXA 2AMIA 3SG2A 1QIVA 3BXKA 2BE4A 1BODA 4U8DA 4N5XA 1BJFA 3RM1A 4USLA 4ETOA 2SASA 1G4YR 5DKQA 3JVTB 3VGOA 1SR6B 3VRNA 2PRUA 1UP5A 1ZFSA 1TOPA 1B47A 1TRFA 4ORAB 5CSJA 5PALA 3TDUA 2K61A 2JT3A 3CR4X 2EC6B 4AQJA 4IL1A 1B4CA 1QX2A 2CT9A 4YRUA 1TNWA 1R6PA 1X02A 3BUOB 1QLSA 2HQWA 2ZRTA 3WHUB 2LVVA 1BR4B 1LVCD 4PDZA 2SCPA 3PM8A 2KBMA 4I5JA 1IWQA 1QASA 3FIAA 3DD4A 4N1GA 1AK8A 1XFZO 1PSBA 4YGAA 2KFFA 2KGRA 1ALVA 1Y1XA 3SIBA 1YUSA 1JFKA 1HT9A 2Y1NA 4F0ZB 3PN7B 1HQVA 3ZNIA 3HCMA 3I5HB 5DKNA 1GQMA 4I5LB 1AJ4A 3SG6A 4BY4A 4L9MA 4I5NB 4GPLB 2AUCA 2D8NA 1KQVA 1VRKA 4MVFA 1LKJA 1TCFA 1B7TZ 5FYXA 4ZCVA 1JUOA 1FF1A 1L2OC 1UHNA 1Y1AA 1U5IB 1J55A 1B8RA 4CIDA 2KAYA 3PATA 4YI9A 2KI6C 1UWOA 1RFJA 1FI6A 1AHRA 2KOTA 1EXRA 2LVJA 1K90D 3IQQA 3TUYC 3FWCA 3AAJA 2FCEA 4ORCB 2JU0A 5B8IB 1NX2A 1SK6D 2H61C 2WCEA 1BR1B 1SMGA 1K2HA 2OS8B 2JNFA 4PE7A 1WRKA 3WHTB 1UURA 1TN4A 2PVBA 2OTGC 5CSIA 4JPZB 1SL8A 4YGDB 3EVRA 3VROA 1PULA 1FBVA 1JFJA 4TNCA 1NYAA 1V1GA 3M0WA 3KEVA 1DJYA 2LUXA 1OZOA 1L7ZA 1OSAA 4DRWA 3BUNB 1QJTA 3GK1A 1D1OA 2LVKA 4JWQA 1J1DA 2LE9B 4MBEA 4DCKA 5HKYA 1DMOA 1JSAA 2CNPA 1CFDA 3PFVA 3HX4A 1CLLA 2Q4UA 1DF0B 1ZACA 1KFUL 1SNLA 3JTDC 4GGFA 4PALA 5AEQA 1IJ6A 1NUBA 4C0KA 1BMOA 4M2OA 1KSOA 3I5FB 3QRXA 4MLWA 4XJKB 2KFHA 2BCAA 3A4UB 3DVJA 1H8BA 1JF2A 1XFXO 1XYDA 2JZIA 3IF7A 4OR9B 3TS5B 4MRXA 4N1FA 1UUSA 2L5XB 4YGCB 2K2AA 2M9GA 1EG4A 2O60A 1QV0A 1TTXA 2KNEA 1KK8B 1ZUZA 2K0JA 2VRGA 2ZN8A 4DS7A 1C07A 3KHEA 5AERA 2K7CA 3KPXA 3LK0A 4I5KA 5CSNA 1KCYA 5AXIA 5I2LA 4E68A 2CTNA 2LP2A 3PSRA 2I7AA 1KQMC 1IKUA 5D7FA 2WORA 4FTGA 3CGAA 1B9AA 3TDZA 4GGFC 2KSPA 1SYMA 1RROA 2HF5A 1SCMB 4GNKB 3VRPA 5I2OA 2ZN9A 3OHMB 5DKRA 2JOJA 1CDLA 1MWNA 2BCXA 1NX0A 5JOLA 4BY5A 2LNKA 2Y4QA 1BF5A 4YGBB 2COLB 1KFXS 4GGNA 3SIAA 2AAOA 4ZCUA 3EK8A 3JVTC 1SR6C 5AFPA 1CTRA 1S1EA 1SRAA 1OZSA 1R2UA 1JWDA 2JTZA 2Y1MA 3KF9A 4QJ5B 4CLNA 1K94A 2K7DA 2JT8A 3I5GB 1UHJA 2EC6C 2F3ZA 5HKZA 2M3WA 2KAVA 3O6BA 1QV1A 1N65A 2NCOA 1OMRA 2KGBC 1M46A 1U5IA 2KYCA 1IQ5A 2M0RA 1BG1A 1M45A 4PHNA 1MXEA 1DJIA 2PSRA 1UHIA 2HQ8A 2ZNEA 3EK4A 4CFRA 1Y6WA 1RWYA 1N0YA 1NSHA 1TCOB 1A2XA 2HETA 3O78A 5G08A 1DT7B 1ZMZA 4PCWA 1CB1A 1F71A 3H4SE 1QS7A 1MQ1A 1NCYA 4YGEB 2NZ0A 3D0YB 3PN7C 3A8RA 3FS7A 1AP4A 3I5HC 1EJ3A 3NSOA 4MN0A 5CSFA 1BOCA 1RECA 2GGMA 2KQ6A 1QX5B 4A4CA 1CDMA 2F33A 1KFXL 1CMGA 4CPVA 3FWBA 4M2QA 1IJ5A 3SG7A 4WQ2A 1V1FA 1TNPA 2KYFA 2LMVA 1N2DA 2NCPA 1S6CA 1BLQA 1J7QA 2BCBA 1SBJA 1EG3A 4MZJA 1XA5A 4YI8A 1DVIA 2LLSA 4PHKA 2P6BB 3BUMB 3OB1B 1QVIY 5JJGA 1YVHA 1J7OA 4QJ4B 2EGDA 2L0PA 2A4JA 3LK1A 3GK2A 1S5GY 2JRFA 1A75A 1DF0A 2OS8C 4HSZA 3VRQA 1G33A 3DF0A 4XJKA 4PE4A 1F4OA 5HYDA 2BBNA 1DGUA 3EVUA 3SG5A 3DVKA 2LHLA 1L2OB 2O5GA 3K21A 1CLBA 4QJ3B 1MHOA 2KBIA 5I8NA 1DTLA 5KU1A 1QATA 1RK9A 1WRZA 1Y0VH 4OKHA 1OOJA 2K2FA 3CTNA 1K9PA 4MRYA 2TN4A 2JT0A 1CMFA 1YVLA 3IQOA 1S36A 1TNQA 1YUTA 2JXLA 2WNDA 1CFFA 5K89A 2BL0B 2LP3A 2HPSA 2I18A 1W7JB 1BU3A 1A75B 1NX3A 1GGZA 2V53A 3NSKA 2R2IA 3I5FC 1DJZA 2EHBA 5BPJA 1E8AA 2K8MB 2LLUA 2LUCA 2LAPA 3I5IB 4GBAA 3DF0B 3DVMA 4P2YB 3TS5C 3KO0A 1BT6A 1NWDA 1KK7Y
chains in the Genus database with same CATH superfamily
1W9ZA 3ZWHA 1DJXA 2F3YA 4GAOA 1KK8C 1QX7A 5AANA 1FI5A 4IJ7A 2LV7A 5KTYA 1YUUA 2KPHA 1S6JA 4WQ3A 3O4YA 2OPOA 2G9BA 2MRDA 4JQ0D 4NDBA 1LXFC 1NIWA 1QLKA 1CDNA 2PQLA 1H4BA 3CZ0A 3GOFA 5IBWA 1UHKA 1JBAA 2JWWA 2M8UA 3D74A 2KI4B 1SY9A 5HKWA 1K95A 2LC5A 3TZ1A 3RZSA 5F6TA 3OX5A 3R1VA 3S0EA 2PYQA 1XO5A 2E30A 1SCMC 4NDCA 4GFTA 2LHIA 1CM4A 2KHNA 1SKTA 1YRTB 2M1UA 3ICBA 2LMTA 1F4QA 4MZLA 2MAZA 1K93D 2I94A 2FCDA 2L4IA 4PE1A 1GGWA 3BQ3A 1YR5A 3D0YA 3E3RA 1UHHA 5J3XA 4D1EA 4F7FA 2JXCA 2YGUA 1W7IB 1WDCB 1TNXA 1OE9B 1PVBA 2IS9A 1B1GA 1F55A 2JC2A 1XFVO 1YX8A 2LANA 2ZRSA 1SPYA 3I5GC 4HRGA 1G8IA 2ZKMX 4M2PA 1IQ3A 5FI7A 1KWOB 2Q91A 1DEKA 2ZNDA 1EH2A 1Q80A 1DJHA 1CFPA 5FI2A 5ER5A 2L2CA 1K9UA 2KDHA 2LMUA 1ZOTB 2WCBA 5D69A 4JKTA 3SJSA 3CR2A 2WC8A 4DIRA 2MA2A 3RLZA 1XFYO 3B88A 3F45A 2JTTA 3CLNA 1YURA 1QIWA 3PM2A 3DXLA 1C7VA 1GJYA 1LS8A 5HLVA 1T14A 1XVJA 2MLEC 1IRJA 1MR8A 1YTZC 3OB2B 4OV2A 5KSZA 1OMVA 3DY9A 3PLFB 2M97A 5I2QA 2BKHB 4MSPA 2MBXA 4MEWA 3TDIA 2CXJA 2M7NA 1FPWA 1QWVA 1A29A 2LCPA 2K7OA 3NXAA 2PMYA 1ORGA 2B1UA 1AJ5A 1SW8A 2WC5A 2GV5A 3EKHA 1Y1UA 3O2PA 1NPQA 3PALA 3C1VA 1J1EA 1JC2A 4AQIA 1M63B 4INWA 3D10A 2WCFA 1IGVA 5GQQC 3BUWB 1AVSA 2QPTA 1M31A 3NSIA 2RGIA 1K8UA 1AUIB 1NX1A 2K7BA 1ODBA 4NQGA 1IH0A 1CLMA 1QVIZ 3AKBA 1WLZA 5D3OA 4OCIA 2H61A 1KSMA 1K96A 1S5GZ 4OVNF 2I2RE 3NSLA 2M7LA 4DUQA 2QDIA 1B8CA 1WLMA 1XFUO 3LLEA 1C7WA 1M39A 1RTP1 2LLTA 1MF8B 2DOQA 4MZKA 3WXAA 3SG4A 4A4BA 2CCMA 4Q04A 3S0FA 1NP8A 1SL7A 2BE6A 2JPOA 2KFGA 3CZ1A 4PHJA 2PASA 4FQTA 1B7TY 1WY9A 1IG5A 2JPTA 2F8PA 2JULA 3AKAA 3CS1A 3LCPC 3CZTX 4P5OE 1DGVA 1KFUS 3BJHA 1LA0A 3GK4X 1F70A 1YRUB 3TUYB 3FE6A 3OP0A 3B87A 1S3PA 2WOSA 3VB1A 3BFBA 2KAXA 2KQYA 3EKJA 1MXLC 1SCVA 1DJWA 3MSEB 4CFQA 1NCZA 2JQ6A 2M29A 1OMDA 2BL0C 4XYNA 2Y5IA 5EL2A 3B86A 1SL9A 1YX7A 3VRRA 2MJWB 4AOMA 1CFCA 3PJIA 2P71A 1J7PA 5CPVA 1S6IA 2OTGB 2L4HA 2WC6A 3I5IC 2F2PA 2LM5A 4C0LA 1KK7Z 1CM1A 2M49B 4NDDA 2LVIA 3OX6A 2E6WA 4ICBA 3IVTA 2FJUB 1XFWO 1OOFA 2NXQA 3BFHA 1PALA 3CWGA 5HLOA 1DJGA 1CDPA 4FQOA 1A03A 3BOWA 1FW4A 2QACA 4ORBB 2FOTA 4GUKA 1B8LA 2BBMA 1QXPA 1TIZA 2L98A 2BECA 3EVVA 2M1KB 3R1OA 1K9KA 2GGZA 1XK4A 2KI4C 2MHHA 3JTDB 2H2KA 2WCHA 5ER4X 3AAKA 1TUZA 2L51A 1F8HA 4UPGA 1LINA 3CDNA 1CKKA 1JF0A 4HREE 2BKIB 2NLNA 2ZFDA 3UNWA 1MUXA 3NGVA 1PVAA 3EK7A 1A4PA 1WRLA 4PE0A 3L47A 2ISDA 1CNPA 4HRHA 4R1EA 1OQPA 3LL8B 1IIOA 4PT1A 2L50A 1SSEB 4WRIA 3CR5X 1WDCC 4C0JA 1NCXA 1EL4A 2WCJA 5I94A 2CBLA 2KI6D 1S26D 1PSRA 3WNXB 1RJVA 2L2EA 1KQMB 2KLDA 3SG3A 3BUXB 3DVEA 1KWOC 1ALWA 3BOWB 3BYAA 1XK4C 1J7RA 2JNXA 2F2OA 1PK0D 3NHTA 4PHMA 2G2BA 2PALA 5TNCA 2MLFC 1F54A 1PRWA 4YBHB 1LA3A 1QTXA 2AMIA 3SG2A 3FE8A 1QIVA 3BXKA 3DZTA 2BE4A 1BODA 4U8DA 4N5XA 1BJFA 2H8VA 3RM1A 4USLA 1OOGA 2SASA 1G4YR 4ETOA 5DKQA 3SS5A 3JVTB 3VGOA 1SR6B 3VRNA 2PRUA 1UP5A 1ZFSA 1TOPA 1B47A 1TRFA 4ORAB 5CSJA 5PALA 3TDUA 2K61A 2JT3A 3CR4X 2EC6B 4AQJA 4IL1A 1B4CA 2GTEA 1QX2A 2CT9A 4YRUA 1TNWA 1R6PA 1X02A 3BUOB 1QLSA 2HQWA 2ZRTA 3WHUB 2LVVA 1BR4B 1LVCD 3B6XA 4PDZA 2SCPA 3PM8A 2KBMA 4KYNA 4I5JA 1IWQA 3N7HA 1QASA 2P70A 3DD4A 3FIAA 4N1GA 1AK8A 1XFZO 1PSBA 4YGAA 2KFFA 3CABA 2KGRA 1ALVA 1Y1XA 3SIBA 1YUSA 1JFKA 1HT9A 2Y1NA 4F0ZB 3PN7B 1HQVA 3S0GA 3ZNIA 3HCMA 1TWOA 3I5HB 5DKNA 3S0AA 1GQMA 2FJYA 4I5LB 1AJ4A 3SG6A 1OOHA 3EG5B 4BY4A 3D78A 4L9MA 3L4AA 4I5NB 4GPLB 2AUCA 2D8NA 3DYEA 1VRKA 1KQVA 4MVFA 1LKJA 1TCFA 1B7TZ 3D77A 5FYXA 4ZCVA 1JUOA 1FF1A 1L2OC 1UHNA 1Y1AA 1U5IB 1J55A 1B8RA 4CIDA 2KAYA 3PATA 4YI9A 2KI6C 1UWOA 1RFJA 1FI6A 1AHRA 2KOTA 1EXRA 2LVJA 1K90D 3IQQA 3TUYC 3FWCA 3AAJA 1DC1A 3BFAA 2FCEA 4ORCB 2JU0A 5B8IB 3K1EA 1NX2A 1SK6D 2H61C 2WCEA 1BR1B 1SMGA 1K2HA 2OS8B 2JNFA 4PE7A 1WRKA 3WHTB 1UURA 3QMEA 3S0DA 1TN4A 2PVBA 2OTGC 5CSIA 4JPZB 1SL8A 4YGDB 3CYZA 3EVRA 3VROA 2BAPA 1OOIX 1PULA 1FBVA 1JFJA 4TNCA 1NYAA 5DICA 1V1GA 3M0WA 3KEVA 1DJYA 2LUXA 1OZOA 1L7ZA 1OSAA 3R1PA 4DRWA 3BUNB 1QJTA 3GK1A 1D1OA 4OZDA 2LVKA 4JWQA 1J1DA 2LE9B 4MBEA 4DCKA 5HKYA 1DMOA 1JSAA 2CNPA 1CFDA 3PFVA 3HX4A 1CLLA 1C3ZA 2Q4UA 1DF0B 1ZACA 1KFUL 1SNLA 3B7AA 3JTDC 4GGFA 4PALA 5AEQA 1IJ6A 1NUBA 3NHIA 4C0KA 1BMOA 4M2OA 1KSOA 3I5FB 1XFRA 3QRXA 4MLWA 2QEVA 4XJKB 2KFHA 2BCAA 3A4UB 3DVJA 1H8BA 1JF2A 1XFXO 1XYDA 2JZIA 3IF7A 4OR9B 3TS5B 4MRXA 4N1FA 3SS4A 1UUSA 2L5XB 4YGCB 1Z4HA 2K2AA 2M9GA 1EG4A 2O60A 1QV0A 1TTXA 2BNXA 1KK8B 1ZUZA 2K0JA 2KNEA 2ZN8A 4DS7A 1C07A 3KHEA 5AERA 2K7CA 3KPXA 3LK0A 4I5KA 5CSNA 1KCYA 5AXIA 5I2LA 4E68A 1GM0A 2CTNA 2LP2A 3PSRA 2I7AA 3R72A 1KQMC 1Z2CB 1IKUA 5D7FA 2WORA 4FTGA 3CGAA 1B9AA 3TDZA 4GGFC 2KSPA 1SYMA 1RROA 3L4LA 2HF5A 1SCMB 4GNKB 3VRPA 5I2OA 2ZN9A 3OHMB 5DKRA 2JOJA 1CDLA 1MWNA 2BCXA 1NX0A 5JOLA 4BY5A 3SS3A 3S0BA 2LNKA 2Y4QA 1BF5A 4YGBB 2COLB 3D73A 1KFXS 4GGNA 3SIAA 1P28A 2AAOA 1DELA 4ZCUA 3EK8A 3JVTC 1SR6C 5AFPA 1CTRA 1S1EA 1SRAA 1OZSA 1R2UA 1JWDA 2JTZA 2Y1MA 3KF9A 4INXA 4QJ5B 4CLNA 1K94A 2K7DA 2JT8A 3I5GB 1UHJA 2EC6C 2F3ZA 2WCKA 5HKZA 2M3WA 2KAVA 3O6BA 1QV1A 1N65A 3FE9A 2NCOA 1OMRA 2KLEA 2KGBC 1M46A 1U5IA 2KYCA 1IQ5A 2M0RA 3UO9A 1M45A 1BG1A 5HL1A 4PHNA 2K60A 1MXEA 1DJIA 2PSRA 1UHIA 2HQ8A 2ZNEA 3EK4A 4CFRA 1Y6WA 1RWYA 1N0YA 1NSHA 1TCOB 1A2XA 2HETA 3O78A 5G08A 1DT7B 1ZMZA 4PCWA 1CB1A 1F71A 2VRGA 3H4SE 1QS7A 1MQ1A 1NCYA 4YGEB 2NZ0A 3D0YB 3PN7C 3A8RA 3FS7A 1AP4A 3I5HC 1EJ3A 3NSOA 4MN0A 5CSFA 5FI6A 1BOCA 1RECA 2GGMA 2KQ6A 1QX5B 4A4CA 1CDMA 2F33A 1KFXL 2L5YA 4CPVA 1CMGA 3CZ2A 3FWBA 4M2QA 1IJ5A 2QEOA 3SG7A 4WQ2A 1V1FA 1TNPA 2KYFA 2LMVA 1N2DA 2NCPA 1S6CA 1BLQA 1J7QA 2BCBA 1SBJA 1EG3A 3D76A 2WCMA 4MZJA 1XA5A 4YI8A 1DVIA 2LLSA 4PHKA 2P6BB 3BUMB 3OB1B 1QVIY 5JJGA 1YVHA 1J7OA 4QJ4B 2EGDA 2L0PA 2A4JA 2WCLA 3LK1A 3GK2A 1S5GY 2JRFA 1A75A 1DF0A 2OS8C 4HSZA 3VRQA 2QEBA 1G33A 2ERBA 3DF0A 4XJKA 4PE4A 1F4OA 5HYDA 2BBNA 1DGUA 1DQEA 3EVUA 3SG5A 1C3YA 3DVKA 2LHLA 1OW4A 1L2OB 2O5GA 3K21A 1CLBA 4JD9A 4QJ3B 1MHOA 2KBIA 5I8NA 1DTLA 3OBVA 5KU1A 1QATA 1RK9A 1WRZA 1Y0VH 3D75A 1OOJA 2K2FA 4OKHA 3CTNA 1K9PA 4MRYA 2TN4A 2JT0A 1CMFA 1YVLA 1TUJA 3IQOA 1S36A 1TNQA 1YUTA 2JXLA 2WNDA 3V2LA 1CFFA 5K89A 2BL0B 2LP3A 2HPSA 2I18A 1W7JB 1BU3A 1A75B 3OGNA 1NX3A 1GGZA 2V53A 3NSKA 2R2IA 2QEHA 3I5FC 1DJZA 2EHBA 3O4XA 5BPJA 1E8AA 2K8MB 2LLUA 3Q8IA 2LUCA 2LAPA 3I5IB 4GBAA 3DF0B 3DVMA 4P2YB 3TS5C 3KO0A 1BT6A 1NWDA 1KK7Y
chains in the Genus database with same CATH topology
3ZWHA 1DJXA 2F3YA 4GAOA 1KK8C 1QX7A 5AANA 1FI5A 2LV7A 5KTYA 1YUUA 1S6JA 4WQ3A 3O4YA 2OPOA 2G9BA 2MRDA 4JQ0D 4NDBA 1LXFC 1NIWA 1QLKA 1CDNA 1H4BA 3GOFA 5IBWA 1UHKA 1JBAA 2JWWA 2M8UA 2KI4B 1SY9A 5HKWA 1K95A 2LC5A 3TZ1A 5F6TA 3OX5A 1XO5A 2E30A 1SCMC 4NDCA 4GFTA 2LHIA 1CM4A 2KHNA 1SKTA 1YRTB 2M1UA 3ICBA 2LMTA 1F4QA 4MZLA 2MAZA 1K93D 2I94A 2FCDA 2L4IA 4PE1A 1GGWA 3BQ3A 1YR5A 3D0YA 3E3RA 1UHHA 5J3XA 4D1EA 2JXCA 1W7IB 1WDCB 1TNXA 1OE9B 1PVBA 2IS9A 1B1GA 1F55A 2JC2A 1XFVO 1YX8A 2LANA 2ZRSA 1SPYA 3I5GC 4HRGA 1G8IA 2ZKMX 4M2PA 1IQ3A 1KWOB 2Q91A 2ZNDA 1EH2A 1Q80A 1DJHA 1CFPA 5ER5A 1K9UA 2KDHA 2LMUA 1ZOTB 2WCBA 5D69A 3SJSA 3CR2A 2WC8A 4DIRA 2MA2A 3RLZA 1XFYO 3F45A 2JTTA 3CLNA 1YURA 1QIWA 1C7VA 1GJYA 5HLVA 2MLEC 1XVJA 3OB2B 1IRJA 1MR8A 1YTZC 4OV2A 5KSZA 1OMVA 3PLFB 2M97A 5I2QA 2BKHB 4MSPA 2MBXA 4MEWA 3TDIA 2CXJA 2M7NA 1FPWA 1A29A 2LCPA 2K7OA 3NXAA 2PMYA 2B1UA 1AJ5A 1SW8A 2GV5A 3EKHA 1Y1UA 3O2PA 1NPQA 3PALA 3C1VA 1J1EA 1JC2A 4AQIA 1M63B 3D10A 2WCFA 1IGVA 5GQQC 3BUWB 1AVSA 2QPTA 1M31A 3NSIA 2RGIA 1K8UA 1AUIB 1NX1A 2K7BA 1ODBA 4NQGA 1IH0A 1CLMA 1QVIZ 3AKBA 1WLZA 4OCIA 2H61A 1KSMA 1K96A 1S5GZ 4OVNF 2I2RE 3NSLA 2M7LA 4DUQA 1B8CA 1WLMA 1XFUO 3LLEA 1C7WA 1M39A 1RTP1 2LLTA 1MF8B 2DOQA 4MZKA 3WXAA 3SG4A 4A4BA 2CCMA 4Q04A 1NP8A 1SL7A 2BE6A 4PHJA 2KFGA 2PASA 1B7TY 1WY9A 1IG5A 2JPTA 2F8PA 2JULA 3AKAA 3CS1A 3LCPC 3CZTX 4P5OE 1DGVA 1KFUS 1LA0A 3GK4X 1F70A 1YRUB 3TUYB 3OP0A 1S3PA 2WOSA 2KAXA 2KQYA 3EKJA 1MXLC 1SCVA 1DJWA 3MSEB 4CFQA 1NCZA 2JQ6A 2M29A 1OMDA 2BL0C 4XYNA 2Y5IA 1SL9A 1YX7A 3VRRA 2MJWB 4AOMA 1CFCA 1J7PA 5CPVA 1S6IA 2OTGB 2L4HA 3I5IC 2F2PA 2LM5A 4C0LA 1KK7Z 1CM1A 2M49B 4NDDA 2LVIA 3OX6A 2E6WA 4ICBA 2FJUB 1XFWO 2NXQA 1PALA 3CWGA 5HLOA 1DJGA 1CDPA 4FQOA 1A03A 3BOWA 1FW4A 2QACA 4ORBB 2FOTA 4GUKA 1B8LA 2BBMA 1QXPA 1TIZA 2L98A 2BECA 3EVVA 2M1KB 1K9KA 2GGZA 1XK4A 2KI4C 2MHHA 3JTDB 2H2KA 5ER4X 3AAKA 2L51A 1F8HA 4UPGA 1LINA 1CKKA 1JF0A 4HREE 2BKIB 2NLNA 2ZFDA 1MUXA 1PVAA 3EK7A 1A4PA 1WRLA 4PE0A 2ISDA 1CNPA 4HRHA 4R1EA 1OQPA 3LL8B 2L50A 4WRIA 3CR5X 1WDCC 4C0JA 1NCXA 1EL4A 2CBLA 2KI6D 1S26D 1PSRA 3WNXB 1RJVA 2L2EA 1KQMB 3SG3A 3BUXB 3DVEA 1KWOC 1ALWA 3BOWB 3BYAA 1XK4C 1J7RA 2JNXA 2F2OA 1PK0D 4PHMA 2G2BA 2PALA 5TNCA 2MLFC 1F54A 1PRWA 4YBHB 1LA3A 1QTXA 2AMIA 3SG2A 1QIVA 3BXKA 2BE4A 1BODA 4U8DA 4N5XA 1BJFA 3RM1A 4USLA 4ETOA 2SASA 1G4YR 5DKQA 3JVTB 3VGOA 1SR6B 3VRNA 2PRUA 1UP5A 1ZFSA 1TOPA 1B47A 1TRFA 4ORAB 5CSJA 5PALA 3TDUA 2K61A 2JT3A 3CR4X 2EC6B 4AQJA 4IL1A 1B4CA 1QX2A 2CT9A 4YRUA 1TNWA 1R6PA 1X02A 3BUOB 1QLSA 2HQWA 2ZRTA 3WHUB 2LVVA 1BR4B 1LVCD 4PDZA 2SCPA 3PM8A 2KBMA 4I5JA 1IWQA 1QASA 3FIAA 3DD4A 4N1GA 1AK8A 1XFZO 1PSBA 4YGAA 2KFFA 2KGRA 1ALVA 1Y1XA 3SIBA 1YUSA 1JFKA 1HT9A 2Y1NA 4F0ZB 3PN7B 1HQVA 3ZNIA 3HCMA 3I5HB 5DKNA 1GQMA 4I5LB 1AJ4A 3SG6A 4BY4A 4L9MA 4I5NB 4GPLB 2AUCA 2D8NA 1KQVA 1VRKA 4MVFA 1LKJA 1TCFA 1B7TZ 5FYXA 4ZCVA 1JUOA 1FF1A 1L2OC 1UHNA 1Y1AA 1U5IB 1J55A 1B8RA 4CIDA 2KAYA 3PATA 4YI9A 2KI6C 1UWOA 1RFJA 1FI6A 1AHRA 2KOTA 1EXRA 2LVJA 1K90D 3IQQA 3TUYC 3FWCA 3AAJA 2FCEA 4ORCB 2JU0A 5B8IB 1NX2A 1SK6D 2H61C 2WCEA 1BR1B 1SMGA 1K2HA 2OS8B 2JNFA 4PE7A 1WRKA 3WHTB 1UURA 1TN4A 2PVBA 2OTGC 5CSIA 4JPZB 1SL8A 4YGDB 3EVRA 3VROA 1PULA 1FBVA 1JFJA 4TNCA 1NYAA 1V1GA 3M0WA 3KEVA 1DJYA 2LUXA 1OZOA 1L7ZA 1OSAA 4DRWA 3BUNB 1QJTA 3GK1A 1D1OA 2LVKA 4JWQA 1J1DA 2LE9B 4MBEA 4DCKA 5HKYA 1DMOA 1JSAA 2CNPA 1CFDA 3PFVA 3HX4A 1CLLA 2Q4UA 1DF0B 1ZACA 1KFUL 1SNLA 3JTDC 4GGFA 4PALA 5AEQA 1IJ6A 1NUBA 4C0KA 1BMOA 4M2OA 1KSOA 3I5FB 3QRXA 4MLWA 4XJKB 2KFHA 2BCAA 3A4UB 3DVJA 1H8BA 1JF2A 1XFXO 1XYDA 2JZIA 3IF7A 4OR9B 3TS5B 4MRXA 4N1FA 1UUSA 2L5XB 4YGCB 2K2AA 2M9GA 1EG4A 2O60A 1QV0A 1TTXA 2KNEA 1KK8B 1ZUZA 2K0JA 2VRGA 2ZN8A 4DS7A 1C07A 3KHEA 5AERA 2K7CA 3KPXA 3LK0A 4I5KA 5CSNA 1KCYA 5AXIA 5I2LA 4E68A 2CTNA 2LP2A 3PSRA 2I7AA 1KQMC 1IKUA 5D7FA 2WORA 4FTGA 3CGAA 1B9AA 3TDZA 4GGFC 2KSPA 1SYMA 1RROA 2HF5A 1SCMB 4GNKB 3VRPA 5I2OA 2ZN9A 3OHMB 5DKRA 2JOJA 1CDLA 1MWNA 2BCXA 1NX0A 5JOLA 4BY5A 2LNKA 2Y4QA 1BF5A 4YGBB 2COLB 1KFXS 4GGNA 3SIAA 2AAOA 4ZCUA 3EK8A 3JVTC 1SR6C 5AFPA 1CTRA 1S1EA 1SRAA 1OZSA 1R2UA 1JWDA 2JTZA 2Y1MA 3KF9A 4QJ5B 4CLNA 1K94A 2K7DA 2JT8A 3I5GB 1UHJA 2EC6C 2F3ZA 5HKZA 2M3WA 2KAVA 3O6BA 1QV1A 1N65A 2NCOA 1OMRA 2KGBC 1M46A 1U5IA 2KYCA 1IQ5A 2M0RA 1BG1A 1M45A 4PHNA 1MXEA 1DJIA 2PSRA 1UHIA 2HQ8A 2ZNEA 3EK4A 4CFRA 1Y6WA 1RWYA 1N0YA 1NSHA 1TCOB 1A2XA 2HETA 3O78A 5G08A 1DT7B 1ZMZA 4PCWA 1CB1A 1F71A 3H4SE 1QS7A 1MQ1A 1NCYA 4YGEB 2NZ0A 3D0YB 3PN7C 3A8RA 3FS7A 1AP4A 3I5HC 1EJ3A 3NSOA 4MN0A 5CSFA 1BOCA 1RECA 2GGMA 2KQ6A 1QX5B 4A4CA 1CDMA 2F33A 1KFXL 1CMGA 4CPVA 3FWBA 4M2QA 1IJ5A 3SG7A 4WQ2A 1V1FA 1TNPA 2KYFA 2LMVA 1N2DA 2NCPA 1S6CA 1BLQA 1J7QA 2BCBA 1SBJA 1EG3A 4MZJA 1XA5A 4YI8A 1DVIA 2LLSA 4PHKA 2P6BB 3BUMB 3OB1B 1QVIY 5JJGA 1YVHA 1J7OA 4QJ4B 2EGDA 2L0PA 2A4JA 3LK1A 3GK2A 1S5GY 2JRFA 1A75A 1DF0A 2OS8C 4HSZA 3VRQA 1G33A 3DF0A 4XJKA 4PE4A 1F4OA 5HYDA 2BBNA 1DGUA 3EVUA 3SG5A 3DVKA 2LHLA 1L2OB 2O5GA 3K21A 1CLBA 4QJ3B 1MHOA 2KBIA 5I8NA 1DTLA 5KU1A 1QATA 1RK9A 1WRZA 1Y0VH 4OKHA 1OOJA 2K2FA 3CTNA 1K9PA 4MRYA 2TN4A 2JT0A 1CMFA 1YVLA 3IQOA 1S36A 1TNQA 1YUTA 2JXLA 2WNDA 1CFFA 5K89A 2BL0B 2LP3A 2HPSA 2I18A 1W7JB 1BU3A 1A75B 1NX3A 1GGZA 2V53A 3NSKA 2R2IA 3I5FC 1DJZA 2EHBA 5BPJA 1E8AA 2K8MB 2LLUA 2LUCA 2LAPA 3I5IB 4GBAA 3DF0B 3DVMA 4P2YB 3TS5C 3KO0A 1BT6A 1NWDA 1KK7Y
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZWH A;  1DJX A;  2F3Y A;  4GAO A;  1KK8 C;  1QX7 A;  5AAN A;  1FI5 A;  2LV7 A;  5KTY A;  1YUU A;  1S6J A;  4WQ3 A;  3O4Y A;  2OPO A;  2G9B A;  2MRD A;  4JQ0 D;  4NDB A;  1LXF C;  1NIW A;  1QLK A;  1CDN A;  1H4B A;  3GOF A;  5IBW A;  1UHK A;  1JBA A;  2JWW A;  2M8U A;  2KI4 B;  1SY9 A;  5HKW A;  1K95 A;  2LC5 A;  3TZ1 A;  5F6T A;  3OX5 A;  1XO5 A;  2E30 A;  1SCM C;  4NDC A;  4GFT A;  2LHI A;  1CM4 A;  2KHN A;  1SKT A;  1YRT B;  2M1U A;  3ICB A;  2LMT A;  1F4Q A;  4MZL A;  2MAZ A;  1K93 D;  2I94 A;  2FCD A;  2L4I A;  4PE1 A;  1GGW A;  3BQ3 A;  1YR5 A;  3D0Y A;  3E3R A;  1UHH A;  5J3X A;  4D1E A;  2JXC A;  1W7I B;  1WDC B;  1TNX A;  1OE9 B;  1PVB A;  2IS9 A;  1B1G A;  1F55 A;  2JC2 A;  1XFV O;  1YX8 A;  2LAN A;  2ZRS A;  1SPY A;  3I5G C;  4HRG A;  1G8I A;  2ZKM X;  4M2P A;  1IQ3 A;  1KWO B;  2Q91 A;  2ZND A;  1EH2 A;  1Q80 A;  1DJH A;  1CFP A;  5ER5 A;  1K9U A;  2KDH A;  2LMU A;  1ZOT B;  2WCB A;  5D69 A;  3SJS A;  3CR2 A;  2WC8 A;  4DIR A;  2MA2 A;  3RLZ A;  1XFY O;  3F45 A;  2JTT A;  3CLN A;  1YUR A;  1QIW A;  1C7V A;  1GJY A;  5HLV A;  2MLE C;  1XVJ A;  3OB2 B;  1IRJ A;  1MR8 A;  1YTZ C;  4OV2 A;  5KSZ A;  1OMV A;  3PLF B;  2M97 A;  5I2Q A;  2BKH B;  4MSP A;  2MBX A;  4MEW A;  3TDI A;  2CXJ A;  2M7N A;  1FPW A;  1A29 A;  2LCP A;  2K7O A;  3NXA A;  2PMY A;  2B1U A;  1AJ5 A;  1SW8 A;  2GV5 A;  3EKH A;  1Y1U A;  3O2P A;  1NPQ A;  3PAL A;  3C1V A;  1J1E A;  1JC2 A;  4AQI A;  1M63 B;  3D10 A;  2WCF A;  1IGV A;  5GQQ C;  3BUW B;  1AVS A;  2QPT A;  1M31 A;  3NSI A;  2RGI A;  1K8U A;  1AUI B;  1NX1 A;  2K7B A;  1ODB A;  4NQG A;  1IH0 A;  1CLM A;  1QVI Z;  3AKB A;  1WLZ A;  4OCI A;  2H61 A;  1KSM A;  1K96 A;  1S5G Z;  4OVN F;  2I2R E;  3NSL A;  2M7L A;  4DUQ A;  1B8C A;  1WLM A;  1XFU O;  3LLE A;  1C7W A;  1M39 A;  1RTP 1;  2LLT A;  1MF8 B;  2DOQ A;  4MZK A;  3WXA A;  3SG4 A;  4A4B A;  2CCM A;  4Q04 A;  1NP8 A;  1SL7 A;  2BE6 A;  4PHJ A;  2KFG A;  2PAS A;  1B7T Y;  1WY9 A;  1IG5 A;  2JPT A;  2F8P A;  2JUL A;  3AKA A;  3CS1 A;  3LCP C;  3CZT X;  4P5O E;  1DGV A;  1KFU S;  1LA0 A;  3GK4 X;  1F70 A;  1YRU B;  3TUY B;  3OP0 A;  1S3P A;  2WOS A;  2KAX A;  2KQY A;  3EKJ A;  1MXL C;  1SCV A;  1DJW A;  3MSE B;  4CFQ A;  1NCZ A;  2JQ6 A;  2M29 A;  1OMD A;  2BL0 C;  4XYN A;  2Y5I A;  1SL9 A;  1YX7 A;  3VRR A;  2MJW B;  4AOM A;  1CFC A;  1J7P A;  5CPV A;  1S6I A;  2OTG B;  2L4H A;  3I5I C;  2F2P A;  2LM5 A;  4C0L A;  1KK7 Z;  1CM1 A;  2M49 B;  4NDD A;  2LVI A;  3OX6 A;  2E6W A;  4ICB A;  2FJU B;  1XFW O;  2NXQ A;  1PAL A;  3CWG A;  5HLO A;  1DJG A;  1CDP A;  4FQO A;  1A03 A;  3BOW A;  1FW4 A;  2QAC A;  4ORB B;  2FOT A;  4GUK A;  1B8L A;  2BBM A;  1QXP A;  1TIZ A;  2L98 A;  2BEC A;  3EVV A;  2M1K B;  1K9K A;  2GGZ A;  1XK4 A;  2KI4 C;  2MHH A;  3JTD B;  2H2K A;  5ER4 X;  3AAK A;  2L51 A;  1F8H A;  4UPG A;  1LIN A;  1CKK A;  1JF0 A;  4HRE E;  2BKI B;  2NLN A;  2ZFD A;  1MUX A;  1PVA A;  3EK7 A;  1A4P A;  1WRL A;  4PE0 A;  2ISD A;  1CNP A;  4HRH A;  4R1E A;  1OQP A;  3LL8 B;  2L50 A;  4WRI A;  3CR5 X;  1WDC C;  4C0J A;  1NCX A;  1EL4 A;  2CBL A;  2KI6 D;  1S26 D;  1PSR A;  3WNX B;  1RJV A;  2L2E A;  1KQM B;  3SG3 A;  3BUX B;  3DVE A;  1KWO C;  1ALW A;  3BOW B;  3BYA A;  1XK4 C;  1J7R A;  2JNX A;  2F2O A;  1PK0 D;  4PHM A;  2G2B A;  2PAL A;  5TNC A;  2MLF C;  1F54 A;  1PRW A;  4YBH B;  1LA3 A;  1QTX A;  2AMI A;  3SG2 A;  1QIV A;  3BXK A;  2BE4 A;  1BOD A;  4U8D A;  4N5X A;  1BJF A;  3RM1 A;  4USL A;  4ETO A;  2SAS A;  1G4Y R;  5DKQ A;  3JVT B;  3VGO A;  1SR6 B;  3VRN A;  2PRU A;  1UP5 A;  1ZFS A;  1TOP A;  1B47 A;  1TRF A;  4ORA B;  5CSJ A;  5PAL A;  3TDU A;  2K61 A;  2JT3 A;  3CR4 X;  2EC6 B;  4AQJ A;  4IL1 A;  1B4C A;  1QX2 A;  2CT9 A;  4YRU A;  1TNW A;  1R6P A;  1X02 A;  3BUO B;  1QLS A;  2HQW A;  2ZRT A;  3WHU B;  2LVV A;  1BR4 B;  1LVC D;  4PDZ A;  2SCP A;  3PM8 A;  2KBM A;  4I5J A;  1IWQ A;  1QAS A;  3FIA A;  3DD4 A;  4N1G A;  1AK8 A;  1XFZ O;  1PSB A;  4YGA A;  2KFF A;  2KGR A;  1ALV A;  1Y1X A;  3SIB A;  1YUS A;  1JFK A;  1HT9 A;  2Y1N A;  4F0Z B;  3PN7 B;  1HQV A;  3ZNI A;  3HCM A;  3I5H B;  5DKN A;  1GQM A;  4I5L B;  1AJ4 A;  3SG6 A;  4BY4 A;  4L9M A;  4I5N B;  4GPL B;  2AUC A;  2D8N A;  1KQV A;  1VRK A;  4MVF A;  1LKJ A;  1TCF A;  1B7T Z;  5FYX A;  4ZCV A;  1JUO A;  1FF1 A;  1L2O C;  1UHN A;  1Y1A A;  1U5I B;  1J55 A;  1B8R A;  4CID A;  2KAY A;  3PAT A;  4YI9 A;  2KI6 C;  1UWO A;  1RFJ A;  1FI6 A;  1AHR A;  2KOT A;  1EXR A;  2LVJ A;  1K90 D;  3IQQ A;  3TUY C;  3FWC A;  3AAJ A;  2FCE A;  4ORC B;  2JU0 A;  5B8I B;  1NX2 A;  1SK6 D;  2H61 C;  2WCE A;  1BR1 B;  1SMG A;  1K2H A;  2OS8 B;  2JNF A;  4PE7 A;  1WRK A;  3WHT B;  1UUR A;  1TN4 A;  2PVB A;  2OTG C;  5CSI A;  4JPZ B;  1SL8 A;  4YGD B;  3EVR A;  3VRO A;  1PUL A;  1FBV A;  1JFJ A;  4TNC A;  1NYA A;  1V1G A;  3M0W A;  3KEV A;  1DJY A;  2LUX A;  1OZO A;  1L7Z A;  1OSA A;  4DRW A;  3BUN B;  1QJT A;  3GK1 A;  1D1O A;  2LVK A;  4JWQ A;  1J1D A;  2LE9 B;  4MBE A;  4DCK A;  5HKY A;  1DMO A;  1JSA A;  2CNP A;  1CFD A;  3PFV A;  3HX4 A;  1CLL A;  2Q4U A;  1DF0 B;  1ZAC A;  1KFU L;  1SNL A;  3JTD C;  4GGF A;  4PAL A;  5AEQ A;  1IJ6 A;  1NUB A;  4C0K A;  1BMO A;  4M2O A;  1KSO A;  3I5F B;  3QRX A;  4MLW A;  4XJK B;  2KFH A;  2BCA A;  3A4U B;  3DVJ A;  1H8B A;  1JF2 A;  1XFX O;  1XYD A;  2JZI A;  3IF7 A;  4OR9 B;  3TS5 B;  4MRX A;  4N1F A;  1UUS A;  2L5X B;  4YGC B;  2K2A A;  2M9G A;  1EG4 A;  2O60 A;  1QV0 A;  1TTX A;  2KNE A;  1KK8 B;  1ZUZ A;  2K0J A;  2VRG A;  2ZN8 A;  4DS7 A;  1C07 A;  3KHE A;  5AER A;  2K7C A;  3KPX A;  3LK0 A;  4I5K A;  5CSN A;  1KCY A;  5AXI A;  5I2L A;  4E68 A;  2CTN A;  2LP2 A;  3PSR A;  2I7A A;  1KQM C;  1IKU A;  5D7F A;  2WOR A;  4FTG A;  3CGA A;  1B9A A;  3TDZ A;  4GGF C;  2KSP A;  1SYM A;  1RRO A;  2HF5 A;  1SCM B;  4GNK B;  3VRP A;  5I2O A;  2ZN9 A;  3OHM B;  5DKR A;  2JOJ A;  1CDL A;  1MWN A;  2BCX A;  1NX0 A;  5JOL A;  4BY5 A;  2LNK A;  2Y4Q A;  1BF5 A;  4YGB B;  2COL B;  1KFX S;  4GGN A;  3SIA A;  2AAO A;  4ZCU A;  3EK8 A;  3JVT C;  1SR6 C;  5AFP A;  1CTR A;  1S1E A;  1SRA A;  1OZS A;  1R2U A;  1JWD A;  2JTZ A;  2Y1M A;  3KF9 A;  4QJ5 B;  4CLN A;  1K94 A;  2K7D A;  2JT8 A;  3I5G B;  1UHJ A;  2EC6 C;  2F3Z A;  5HKZ A;  2M3W A;  2KAV A;  3O6B A;  1QV1 A;  1N65 A;  2NCO A;  1OMR A;  2KGB C;  1M46 A;  1U5I A;  2KYC A;  1IQ5 A;  2M0R A;  1BG1 A;  1M45 A;  4PHN A;  1MXE A;  1DJI A;  2PSR A;  1UHI A;  2HQ8 A;  2ZNE A;  3EK4 A;  4CFR A;  1Y6W A;  1RWY A;  1N0Y A;  1NSH A;  1TCO B;  1A2X A;  2HET A;  3O78 A;  5G08 A;  1DT7 B;  1ZMZ A;  4PCW A;  1CB1 A;  1F71 A;  3H4S E;  1QS7 A;  1MQ1 A;  1NCY A;  4YGE B;  2NZ0 A;  3D0Y B;  3PN7 C;  3A8R A;  3FS7 A;  1AP4 A;  3I5H C;  1EJ3 A;  3NSO A;  4MN0 A;  5CSF A;  1BOC A;  1REC A;  2GGM A;  2KQ6 A;  1QX5 B;  4A4C A;  1CDM A;  2F33 A;  1KFX L;  1CMG A;  4CPV A;  3FWB A;  4M2Q A;  1IJ5 A;  3SG7 A;  4WQ2 A;  1V1F A;  1TNP A;  2KYF A;  2LMV A;  1N2D A;  2NCP A;  1S6C A;  1BLQ A;  1J7Q A;  2BCB A;  1SBJ A;  1EG3 A;  4MZJ A;  1XA5 A;  4YI8 A;  1DVI A;  2LLS A;  4PHK A;  2P6B B;  3BUM B;  3OB1 B;  1QVI Y;  5JJG A;  1YVH A;  1J7O A;  4QJ4 B;  2EGD A;  2L0P A;  2A4J A;  3LK1 A;  3GK2 A;  1S5G Y;  2JRF A;  1A75 A;  1DF0 A;  2OS8 C;  4HSZ A;  3VRQ A;  1G33 A;  3DF0 A;  4XJK A;  4PE4 A;  1F4O A;  5HYD A;  2BBN A;  1DGU A;  3EVU A;  3SG5 A;  3DVK A;  2LHL A;  1L2O B;  2O5G A;  3K21 A;  1CLB A;  4QJ3 B;  1MHO A;  2KBI A;  5I8N A;  1DTL A;  5KU1 A;  1QAT A;  1RK9 A;  1WRZ A;  1Y0V H;  4OKH A;  1OOJ A;  2K2F A;  3CTN A;  1K9P A;  4MRY A;  2TN4 A;  2JT0 A;  1CMF A;  1YVL A;  3IQO A;  1S36 A;  1TNQ A;  1YUT A;  2JXL A;  2WND A;  1CFF A;  5K89 A;  2BL0 B;  2LP3 A;  2HPS A;  2I18 A;  1W7J B;  1BU3 A;  1A75 B;  1NX3 A;  1GGZ A;  2V53 A;  3NSK A;  2R2I A;  3I5F C;  1DJZ A;  2EHB A;  5BPJ A;  1E8A A;  2K8M B;  2LLU A;  2LUC A;  2LAP A;  3I5I B;  4GBA A;  3DF0 B;  3DVM A;  4P2Y B;  3TS5 C;  3KO0 A;  1BT6 A;  1NWD A;  1KK7 Y; 
#chains in the Genus database with same CATH topology
 1W9Z A;  3ZWH A;  1DJX A;  2F3Y A;  4GAO A;  1KK8 C;  1QX7 A;  5AAN A;  1FI5 A;  4IJ7 A;  2LV7 A;  5KTY A;  1YUU A;  2KPH A;  1S6J A;  4WQ3 A;  3O4Y A;  2OPO A;  2G9B A;  2MRD A;  4JQ0 D;  4NDB A;  1LXF C;  1NIW A;  1QLK A;  1CDN A;  2PQL A;  1H4B A;  3CZ0 A;  3GOF A;  5IBW A;  1UHK A;  1JBA A;  2JWW A;  2M8U A;  3D74 A;  2KI4 B;  1SY9 A;  5HKW A;  1K95 A;  2LC5 A;  3TZ1 A;  3RZS A;  5F6T A;  3OX5 A;  3R1V A;  3S0E A;  2PYQ A;  1XO5 A;  2E30 A;  1SCM C;  4NDC A;  4GFT A;  2LHI A;  1CM4 A;  2KHN A;  1SKT A;  1YRT B;  2M1U A;  3ICB A;  2LMT A;  1F4Q A;  4MZL A;  2MAZ A;  1K93 D;  2I94 A;  2FCD A;  2L4I A;  4PE1 A;  1GGW A;  3BQ3 A;  1YR5 A;  3D0Y A;  3E3R A;  1UHH A;  5J3X A;  4D1E A;  4F7F A;  2JXC A;  2YGU A;  1W7I B;  1WDC B;  1TNX A;  1OE9 B;  1PVB A;  2IS9 A;  1B1G A;  1F55 A;  2JC2 A;  1XFV O;  1YX8 A;  2LAN A;  2ZRS A;  1SPY A;  3I5G C;  4HRG A;  1G8I A;  2ZKM X;  4M2P A;  1IQ3 A;  5FI7 A;  1KWO B;  2Q91 A;  1DEK A;  2ZND A;  1EH2 A;  1Q80 A;  1DJH A;  1CFP A;  5FI2 A;  5ER5 A;  2L2C A;  1K9U A;  2KDH A;  2LMU A;  1ZOT B;  2WCB A;  5D69 A;  4JKT A;  3SJS A;  3CR2 A;  2WC8 A;  4DIR A;  2MA2 A;  3RLZ A;  1XFY O;  3B88 A;  3F45 A;  2JTT A;  3CLN A;  1YUR A;  1QIW A;  3PM2 A;  3DXL A;  1C7V A;  1GJY A;  1LS8 A;  5HLV A;  1T14 A;  1XVJ A;  2MLE C;  1IRJ A;  1MR8 A;  1YTZ C;  3OB2 B;  4OV2 A;  5KSZ A;  1OMV A;  3DY9 A;  3PLF B;  2M97 A;  5I2Q A;  2BKH B;  4MSP A;  2MBX A;  4MEW A;  3TDI A;  2CXJ A;  2M7N A;  1FPW A;  1QWV A;  1A29 A;  2LCP A;  2K7O A;  3NXA A;  2PMY A;  1ORG A;  2B1U A;  1AJ5 A;  1SW8 A;  2WC5 A;  2GV5 A;  3EKH A;  1Y1U A;  3O2P A;  1NPQ A;  3PAL A;  3C1V A;  1J1E A;  1JC2 A;  4AQI A;  1M63 B;  4INW A;  3D10 A;  2WCF A;  1IGV A;  5GQQ C;  3BUW B;  1AVS A;  2QPT A;  1M31 A;  3NSI A;  2RGI A;  1K8U A;  1AUI B;  1NX1 A;  2K7B A;  1ODB A;  4NQG A;  1IH0 A;  1CLM A;  1QVI Z;  3AKB A;  1WLZ A;  5D3O A;  4OCI A;  2H61 A;  1KSM A;  1K96 A;  1S5G Z;  4OVN F;  2I2R E;  3NSL A;  2M7L A;  4DUQ A;  2QDI A;  1B8C A;  1WLM A;  1XFU O;  3LLE A;  1C7W A;  1M39 A;  1RTP 1;  2LLT A;  1MF8 B;  2DOQ A;  4MZK A;  3WXA A;  3SG4 A;  4A4B A;  2CCM A;  4Q04 A;  3S0F A;  1NP8 A;  1SL7 A;  2BE6 A;  2JPO A;  2KFG A;  3CZ1 A;  4PHJ A;  2PAS A;  4FQT A;  1B7T Y;  1WY9 A;  1IG5 A;  2JPT A;  2F8P A;  2JUL A;  3AKA A;  3CS1 A;  3LCP C;  3CZT X;  4P5O E;  1DGV A;  1KFU S;  3BJH A;  1LA0 A;  3GK4 X;  1F70 A;  1YRU B;  3TUY B;  3FE6 A;  3OP0 A;  3B87 A;  1S3P A;  2WOS A;  3VB1 A;  3BFB A;  2KAX A;  2KQY A;  3EKJ A;  1MXL C;  1SCV A;  1DJW A;  3MSE B;  4CFQ A;  1NCZ A;  2JQ6 A;  2M29 A;  1OMD A;  2BL0 C;  4XYN A;  2Y5I A;  5EL2 A;  3B86 A;  1SL9 A;  1YX7 A;  3VRR A;  2MJW B;  4AOM A;  1CFC A;  3PJI A;  2P71 A;  1J7P A;  5CPV A;  1S6I A;  2OTG B;  2L4H A;  2WC6 A;  3I5I C;  2F2P A;  2LM5 A;  4C0L A;  1KK7 Z;  1CM1 A;  2M49 B;  4NDD A;  2LVI A;  3OX6 A;  2E6W A;  4ICB A;  3IVT A;  2FJU B;  1XFW O;  1OOF A;  2NXQ A;  3BFH A;  1PAL A;  3CWG A;  5HLO A;  1DJG A;  1CDP A;  4FQO A;  1A03 A;  3BOW A;  1FW4 A;  2QAC A;  4ORB B;  2FOT A;  4GUK A;  1B8L A;  2BBM A;  1QXP A;  1TIZ A;  2L98 A;  2BEC A;  3EVV A;  2M1K B;  3R1O A;  1K9K A;  2GGZ A;  1XK4 A;  2KI4 C;  2MHH A;  3JTD B;  2H2K A;  2WCH A;  5ER4 X;  3AAK A;  1TUZ A;  2L51 A;  1F8H A;  4UPG A;  1LIN A;  3CDN A;  1CKK A;  1JF0 A;  4HRE E;  2BKI B;  2NLN A;  2ZFD A;  3UNW A;  1MUX A;  3NGV A;  1PVA A;  3EK7 A;  1A4P A;  1WRL A;  4PE0 A;  3L47 A;  2ISD A;  1CNP A;  4HRH A;  4R1E A;  1OQP A;  3LL8 B;  1IIO A;  4PT1 A;  2L50 A;  1SSE B;  4WRI A;  3CR5 X;  1WDC C;  4C0J A;  1NCX A;  1EL4 A;  2WCJ A;  5I94 A;  2CBL A;  2KI6 D;  1S26 D;  1PSR A;  3WNX B;  1RJV A;  2L2E A;  1KQM B;  2KLD A;  3SG3 A;  3BUX B;  3DVE A;  1KWO C;  1ALW A;  3BOW B;  3BYA A;  1XK4 C;  1J7R A;  2JNX A;  2F2O A;  1PK0 D;  3NHT A;  4PHM A;  2G2B A;  2PAL A;  5TNC A;  2MLF C;  1F54 A;  1PRW A;  4YBH B;  1LA3 A;  1QTX A;  2AMI A;  3SG2 A;  3FE8 A;  1QIV A;  3BXK A;  3DZT A;  2BE4 A;  1BOD A;  4U8D A;  4N5X A;  1BJF A;  2H8V A;  3RM1 A;  4USL A;  1OOG A;  2SAS A;  1G4Y R;  4ETO A;  5DKQ A;  3SS5 A;  3JVT B;  3VGO A;  1SR6 B;  3VRN A;  2PRU A;  1UP5 A;  1ZFS A;  1TOP A;  1B47 A;  1TRF A;  4ORA B;  5CSJ A;  5PAL A;  3TDU A;  2K61 A;  2JT3 A;  3CR4 X;  2EC6 B;  4AQJ A;  4IL1 A;  1B4C A;  2GTE A;  1QX2 A;  2CT9 A;  4YRU A;  1TNW A;  1R6P A;  1X02 A;  3BUO B;  1QLS A;  2HQW A;  2ZRT A;  3WHU B;  2LVV A;  1BR4 B;  1LVC D;  3B6X A;  4PDZ A;  2SCP A;  3PM8 A;  2KBM A;  4KYN A;  4I5J A;  1IWQ A;  3N7H A;  1QAS A;  2P70 A;  3DD4 A;  3FIA A;  4N1G A;  1AK8 A;  1XFZ O;  1PSB A;  4YGA A;  2KFF A;  3CAB A;  2KGR A;  1ALV A;  1Y1X A;  3SIB A;  1YUS A;  1JFK A;  1HT9 A;  2Y1N A;  4F0Z B;  3PN7 B;  1HQV A;  3S0G A;  3ZNI A;  3HCM A;  1TWO A;  3I5H B;  5DKN A;  3S0A A;  1GQM A;  2FJY A;  4I5L B;  1AJ4 A;  3SG6 A;  1OOH A;  3EG5 B;  4BY4 A;  3D78 A;  4L9M A;  3L4A A;  4I5N B;  4GPL B;  2AUC A;  2D8N A;  3DYE A;  1VRK A;  1KQV A;  4MVF A;  1LKJ A;  1TCF A;  1B7T Z;  3D77 A;  5FYX A;  4ZCV A;  1JUO A;  1FF1 A;  1L2O C;  1UHN A;  1Y1A A;  1U5I B;  1J55 A;  1B8R A;  4CID A;  2KAY A;  3PAT A;  4YI9 A;  2KI6 C;  1UWO A;  1RFJ A;  1FI6 A;  1AHR A;  2KOT A;  1EXR A;  2LVJ A;  1K90 D;  3IQQ A;  3TUY C;  3FWC A;  3AAJ A;  1DC1 A;  3BFA A;  2FCE A;  4ORC B;  2JU0 A;  5B8I B;  3K1E A;  1NX2 A;  1SK6 D;  2H61 C;  2WCE A;  1BR1 B;  1SMG A;  1K2H A;  2OS8 B;  2JNF A;  4PE7 A;  1WRK A;  3WHT B;  1UUR A;  3QME A;  3S0D A;  1TN4 A;  2PVB A;  2OTG C;  5CSI A;  4JPZ B;  1SL8 A;  4YGD B;  3CYZ A;  3EVR A;  3VRO A;  2BAP A;  1OOI X;  1PUL A;  1FBV A;  1JFJ A;  4TNC A;  1NYA A;  5DIC A;  1V1G A;  3M0W A;  3KEV A;  1DJY A;  2LUX A;  1OZO A;  1L7Z A;  1OSA A;  3R1P A;  4DRW A;  3BUN B;  1QJT A;  3GK1 A;  1D1O A;  4OZD A;  2LVK A;  4JWQ A;  1J1D A;  2LE9 B;  4MBE A;  4DCK A;  5HKY A;  1DMO A;  1JSA A;  2CNP A;  1CFD A;  3PFV A;  3HX4 A;  1CLL A;  1C3Z A;  2Q4U A;  1DF0 B;  1ZAC A;  1KFU L;  1SNL A;  3B7A A;  3JTD C;  4GGF A;  4PAL A;  5AEQ A;  1IJ6 A;  1NUB A;  3NHI A;  4C0K A;  1BMO A;  4M2O A;  1KSO A;  3I5F B;  1XFR A;  3QRX A;  4MLW A;  2QEV A;  4XJK B;  2KFH A;  2BCA A;  3A4U B;  3DVJ A;  1H8B A;  1JF2 A;  1XFX O;  1XYD A;  2JZI A;  3IF7 A;  4OR9 B;  3TS5 B;  4MRX A;  4N1F A;  3SS4 A;  1UUS A;  2L5X B;  4YGC B;  1Z4H A;  2K2A A;  2M9G A;  1EG4 A;  2O60 A;  1QV0 A;  1TTX A;  2BNX A;  1KK8 B;  1ZUZ A;  2K0J A;  2KNE A;  2ZN8 A;  4DS7 A;  1C07 A;  3KHE A;  5AER A;  2K7C A;  3KPX A;  3LK0 A;  4I5K A;  5CSN A;  1KCY A;  5AXI A;  5I2L A;  4E68 A;  1GM0 A;  2CTN A;  2LP2 A;  3PSR A;  2I7A A;  3R72 A;  1KQM C;  1Z2C B;  1IKU A;  5D7F A;  2WOR A;  4FTG A;  3CGA A;  1B9A A;  3TDZ A;  4GGF C;  2KSP A;  1SYM A;  1RRO A;  3L4L A;  2HF5 A;  1SCM B;  4GNK B;  3VRP A;  5I2O A;  2ZN9 A;  3OHM B;  5DKR A;  2JOJ A;  1CDL A;  1MWN A;  2BCX A;  1NX0 A;  5JOL A;  4BY5 A;  3SS3 A;  3S0B A;  2LNK A;  2Y4Q A;  1BF5 A;  4YGB B;  2COL B;  3D73 A;  1KFX S;  4GGN A;  3SIA A;  1P28 A;  2AAO A;  1DEL A;  4ZCU A;  3EK8 A;  3JVT C;  1SR6 C;  5AFP A;  1CTR A;  1S1E A;  1SRA A;  1OZS A;  1R2U A;  1JWD A;  2JTZ A;  2Y1M A;  3KF9 A;  4INX A;  4QJ5 B;  4CLN A;  1K94 A;  2K7D A;  2JT8 A;  3I5G B;  1UHJ A;  2EC6 C;  2F3Z A;  2WCK A;  5HKZ A;  2M3W A;  2KAV A;  3O6B A;  1QV1 A;  1N65 A;  3FE9 A;  2NCO A;  1OMR A;  2KLE A;  2KGB C;  1M46 A;  1U5I A;  2KYC A;  1IQ5 A;  2M0R A;  3UO9 A;  1M45 A;  1BG1 A;  5HL1 A;  4PHN A;  2K60 A;  1MXE A;  1DJI A;  2PSR A;  1UHI A;  2HQ8 A;  2ZNE A;  3EK4 A;  4CFR A;  1Y6W A;  1RWY A;  1N0Y A;  1NSH A;  1TCO B;  1A2X A;  2HET A;  3O78 A;  5G08 A;  1DT7 B;  1ZMZ A;  4PCW A;  1CB1 A;  1F71 A;  2VRG A;  3H4S E;  1QS7 A;  1MQ1 A;  1NCY A;  4YGE B;  2NZ0 A;  3D0Y B;  3PN7 C;  3A8R A;  3FS7 A;  1AP4 A;  3I5H C;  1EJ3 A;  3NSO A;  4MN0 A;  5CSF A;  5FI6 A;  1BOC A;  1REC A;  2GGM A;  2KQ6 A;  1QX5 B;  4A4C A;  1CDM A;  2F33 A;  1KFX L;  2L5Y A;  4CPV A;  1CMG A;  3CZ2 A;  3FWB A;  4M2Q A;  1IJ5 A;  2QEO A;  3SG7 A;  4WQ2 A;  1V1F A;  1TNP A;  2KYF A;  2LMV A;  1N2D A;  2NCP A;  1S6C A;  1BLQ A;  1J7Q A;  2BCB A;  1SBJ A;  1EG3 A;  3D76 A;  2WCM A;  4MZJ A;  1XA5 A;  4YI8 A;  1DVI A;  2LLS A;  4PHK A;  2P6B B;  3BUM B;  3OB1 B;  1QVI Y;  5JJG A;  1YVH A;  1J7O A;  4QJ4 B;  2EGD A;  2L0P A;  2A4J A;  2WCL A;  3LK1 A;  3GK2 A;  1S5G Y;  2JRF A;  1A75 A;  1DF0 A;  2OS8 C;  4HSZ A;  3VRQ A;  2QEB A;  1G33 A;  2ERB A;  3DF0 A;  4XJK A;  4PE4 A;  1F4O A;  5HYD A;  2BBN A;  1DGU A;  1DQE A;  3EVU A;  3SG5 A;  1C3Y A;  3DVK A;  2LHL A;  1OW4 A;  1L2O B;  2O5G A;  3K21 A;  1CLB A;  4JD9 A;  4QJ3 B;  1MHO A;  2KBI A;  5I8N A;  1DTL A;  3OBV A;  5KU1 A;  1QAT A;  1RK9 A;  1WRZ A;  1Y0V H;  3D75 A;  1OOJ A;  2K2F A;  4OKH A;  3CTN A;  1K9P A;  4MRY A;  2TN4 A;  2JT0 A;  1CMF A;  1YVL A;  1TUJ A;  3IQO A;  1S36 A;  1TNQ A;  1YUT A;  2JXL A;  2WND A;  3V2L A;  1CFF A;  5K89 A;  2BL0 B;  2LP3 A;  2HPS A;  2I18 A;  1W7J B;  1BU3 A;  1A75 B;  3OGN A;  1NX3 A;  1GGZ A;  2V53 A;  3NSK A;  2R2I A;  2QEH A;  3I5F C;  1DJZ A;  2EHB A;  3O4X A;  5BPJ A;  1E8A A;  2K8M B;  2LLU A;  3Q8I A;  2LUC A;  2LAP A;  3I5I B;  4GBA A;  3DF0 B;  3DVM A;  4P2Y B;  3TS5 C;  3KO0 A;  1BT6 A;  1NWD A;  1KK7 Y; 
#chains in the Genus database with same CATH homology
 3ZWH A;  1DJX A;  2F3Y A;  4GAO A;  1KK8 C;  1QX7 A;  5AAN A;  1FI5 A;  2LV7 A;  5KTY A;  1YUU A;  1S6J A;  4WQ3 A;  3O4Y A;  2OPO A;  2G9B A;  2MRD A;  4JQ0 D;  4NDB A;  1LXF C;  1NIW A;  1QLK A;  1CDN A;  1H4B A;  3GOF A;  5IBW A;  1UHK A;  1JBA A;  2JWW A;  2M8U A;  2KI4 B;  1SY9 A;  5HKW A;  1K95 A;  2LC5 A;  3TZ1 A;  5F6T A;  3OX5 A;  1XO5 A;  2E30 A;  1SCM C;  4NDC A;  4GFT A;  2LHI A;  1CM4 A;  2KHN A;  1SKT A;  1YRT B;  2M1U A;  3ICB A;  2LMT A;  1F4Q A;  4MZL A;  2MAZ A;  1K93 D;  2I94 A;  2FCD A;  2L4I A;  4PE1 A;  1GGW A;  3BQ3 A;  1YR5 A;  3D0Y A;  3E3R A;  1UHH A;  5J3X A;  4D1E A;  2JXC A;  1W7I B;  1WDC B;  1TNX A;  1OE9 B;  1PVB A;  2IS9 A;  1B1G A;  1F55 A;  2JC2 A;  1XFV O;  1YX8 A;  2LAN A;  2ZRS A;  1SPY A;  3I5G C;  4HRG A;  1G8I A;  2ZKM X;  4M2P A;  1IQ3 A;  1KWO B;  2Q91 A;  2ZND A;  1EH2 A;  1Q80 A;  1DJH A;  1CFP A;  5ER5 A;  1K9U A;  2KDH A;  2LMU A;  1ZOT B;  2WCB A;  5D69 A;  3SJS A;  3CR2 A;  2WC8 A;  4DIR A;  2MA2 A;  3RLZ A;  1XFY O;  3F45 A;  2JTT A;  3CLN A;  1YUR A;  1QIW A;  1C7V A;  1GJY A;  5HLV A;  2MLE C;  1XVJ A;  3OB2 B;  1IRJ A;  1MR8 A;  1YTZ C;  4OV2 A;  5KSZ A;  1OMV A;  3PLF B;  2M97 A;  5I2Q A;  2BKH B;  4MSP A;  2MBX A;  4MEW A;  3TDI A;  2CXJ A;  2M7N A;  1FPW A;  1A29 A;  2LCP A;  2K7O A;  3NXA A;  2PMY A;  2B1U A;  1AJ5 A;  1SW8 A;  2GV5 A;  3EKH A;  1Y1U A;  3O2P A;  1NPQ A;  3PAL A;  3C1V A;  1J1E A;  1JC2 A;  4AQI A;  1M63 B;  3D10 A;  2WCF A;  1IGV A;  5GQQ C;  3BUW B;  1AVS A;  2QPT A;  1M31 A;  3NSI A;  2RGI A;  1K8U A;  1AUI B;  1NX1 A;  2K7B A;  1ODB A;  4NQG A;  1IH0 A;  1CLM A;  1QVI Z;  3AKB A;  1WLZ A;  4OCI A;  2H61 A;  1KSM A;  1K96 A;  1S5G Z;  4OVN F;  2I2R E;  3NSL A;  2M7L A;  4DUQ A;  1B8C A;  1WLM A;  1XFU O;  3LLE A;  1C7W A;  1M39 A;  1RTP 1;  2LLT A;  1MF8 B;  2DOQ A;  4MZK A;  3WXA A;  3SG4 A;  4A4B A;  2CCM A;  4Q04 A;  1NP8 A;  1SL7 A;  2BE6 A;  4PHJ A;  2KFG A;  2PAS A;  1B7T Y;  1WY9 A;  1IG5 A;  2JPT A;  2F8P A;  2JUL A;  3AKA A;  3CS1 A;  3LCP C;  3CZT X;  4P5O E;  1DGV A;  1KFU S;  1LA0 A;  3GK4 X;  1F70 A;  1YRU B;  3TUY B;  3OP0 A;  1S3P A;  2WOS A;  2KAX A;  2KQY A;  3EKJ A;  1MXL C;  1SCV A;  1DJW A;  3MSE B;  4CFQ A;  1NCZ A;  2JQ6 A;  2M29 A;  1OMD A;  2BL0 C;  4XYN A;  2Y5I A;  1SL9 A;  1YX7 A;  3VRR A;  2MJW B;  4AOM A;  1CFC A;  1J7P A;  5CPV A;  1S6I A;  2OTG B;  2L4H A;  3I5I C;  2F2P A;  2LM5 A;  4C0L A;  1KK7 Z;  1CM1 A;  2M49 B;  4NDD A;  2LVI A;  3OX6 A;  2E6W A;  4ICB A;  2FJU B;  1XFW O;  2NXQ A;  1PAL A;  3CWG A;  5HLO A;  1DJG A;  1CDP A;  4FQO A;  1A03 A;  3BOW A;  1FW4 A;  2QAC A;  4ORB B;  2FOT A;  4GUK A;  1B8L A;  2BBM A;  1QXP A;  1TIZ A;  2L98 A;  2BEC A;  3EVV A;  2M1K B;  1K9K A;  2GGZ A;  1XK4 A;  2KI4 C;  2MHH A;  3JTD B;  2H2K A;  5ER4 X;  3AAK A;  2L51 A;  1F8H A;  4UPG A;  1LIN A;  1CKK A;  1JF0 A;  4HRE E;  2BKI B;  2NLN A;  2ZFD A;  1MUX A;  1PVA A;  3EK7 A;  1A4P A;  1WRL A;  4PE0 A;  2ISD A;  1CNP A;  4HRH A;  4R1E A;  1OQP A;  3LL8 B;  2L50 A;  4WRI A;  3CR5 X;  1WDC C;  4C0J A;  1NCX A;  1EL4 A;  2CBL A;  2KI6 D;  1S26 D;  1PSR A;  3WNX B;  1RJV A;  2L2E A;  1KQM B;  3SG3 A;  3BUX B;  3DVE A;  1KWO C;  1ALW A;  3BOW B;  3BYA A;  1XK4 C;  1J7R A;  2JNX A;  2F2O A;  1PK0 D;  4PHM A;  2G2B A;  2PAL A;  5TNC A;  2MLF C;  1F54 A;  1PRW A;  4YBH B;  1LA3 A;  1QTX A;  2AMI A;  3SG2 A;  1QIV A;  3BXK A;  2BE4 A;  1BOD A;  4U8D A;  4N5X A;  1BJF A;  3RM1 A;  4USL A;  4ETO A;  2SAS A;  1G4Y R;  5DKQ A;  3JVT B;  3VGO A;  1SR6 B;  3VRN A;  2PRU A;  1UP5 A;  1ZFS A;  1TOP A;  1B47 A;  1TRF A;  4ORA B;  5CSJ A;  5PAL A;  3TDU A;  2K61 A;  2JT3 A;  3CR4 X;  2EC6 B;  4AQJ A;  4IL1 A;  1B4C A;  1QX2 A;  2CT9 A;  4YRU A;  1TNW A;  1R6P A;  1X02 A;  3BUO B;  1QLS A;  2HQW A;  2ZRT A;  3WHU B;  2LVV A;  1BR4 B;  1LVC D;  4PDZ A;  2SCP A;  3PM8 A;  2KBM A;  4I5J A;  1IWQ A;  1QAS A;  3FIA A;  3DD4 A;  4N1G A;  1AK8 A;  1XFZ O;  1PSB A;  4YGA A;  2KFF A;  2KGR A;  1ALV A;  1Y1X A;  3SIB A;  1YUS A;  1JFK A;  1HT9 A;  2Y1N A;  4F0Z B;  3PN7 B;  1HQV A;  3ZNI A;  3HCM A;  3I5H B;  5DKN A;  1GQM A;  4I5L B;  1AJ4 A;  3SG6 A;  4BY4 A;  4L9M A;  4I5N B;  4GPL B;  2AUC A;  2D8N A;  1KQV A;  1VRK A;  4MVF A;  1LKJ A;  1TCF A;  1B7T Z;  5FYX A;  4ZCV A;  1JUO A;  1FF1 A;  1L2O C;  1UHN A;  1Y1A A;  1U5I B;  1J55 A;  1B8R A;  4CID A;  2KAY A;  3PAT A;  4YI9 A;  2KI6 C;  1UWO A;  1RFJ A;  1FI6 A;  1AHR A;  2KOT A;  1EXR A;  2LVJ A;  1K90 D;  3IQQ A;  3TUY C;  3FWC A;  3AAJ A;  2FCE A;  4ORC B;  2JU0 A;  5B8I B;  1NX2 A;  1SK6 D;  2H61 C;  2WCE A;  1BR1 B;  1SMG A;  1K2H A;  2OS8 B;  2JNF A;  4PE7 A;  1WRK A;  3WHT B;  1UUR A;  1TN4 A;  2PVB A;  2OTG C;  5CSI A;  4JPZ B;  1SL8 A;  4YGD B;  3EVR A;  3VRO A;  1PUL A;  1FBV A;  1JFJ A;  4TNC A;  1NYA A;  1V1G A;  3M0W A;  3KEV A;  1DJY A;  2LUX A;  1OZO A;  1L7Z A;  1OSA A;  4DRW A;  3BUN B;  1QJT A;  3GK1 A;  1D1O A;  2LVK A;  4JWQ A;  1J1D A;  2LE9 B;  4MBE A;  4DCK A;  5HKY A;  1DMO A;  1JSA A;  2CNP A;  1CFD A;  3PFV A;  3HX4 A;  1CLL A;  2Q4U A;  1DF0 B;  1ZAC A;  1KFU L;  1SNL A;  3JTD C;  4GGF A;  4PAL A;  5AEQ A;  1IJ6 A;  1NUB A;  4C0K A;  1BMO A;  4M2O A;  1KSO A;  3I5F B;  3QRX A;  4MLW A;  4XJK B;  2KFH A;  2BCA A;  3A4U B;  3DVJ A;  1H8B A;  1JF2 A;  1XFX O;  1XYD A;  2JZI A;  3IF7 A;  4OR9 B;  3TS5 B;  4MRX A;  4N1F A;  1UUS A;  2L5X B;  4YGC B;  2K2A A;  2M9G A;  1EG4 A;  2O60 A;  1QV0 A;  1TTX A;  2KNE A;  1KK8 B;  1ZUZ A;  2K0J A;  2VRG A;  2ZN8 A;  4DS7 A;  1C07 A;  3KHE A;  5AER A;  2K7C A;  3KPX A;  3LK0 A;  4I5K A;  5CSN A;  1KCY A;  5AXI A;  5I2L A;  4E68 A;  2CTN A;  2LP2 A;  3PSR A;  2I7A A;  1KQM C;  1IKU A;  5D7F A;  2WOR A;  4FTG A;  3CGA A;  1B9A A;  3TDZ A;  4GGF C;  2KSP A;  1SYM A;  1RRO A;  2HF5 A;  1SCM B;  4GNK B;  3VRP A;  5I2O A;  2ZN9 A;  3OHM B;  5DKR A;  2JOJ A;  1CDL A;  1MWN A;  2BCX A;  1NX0 A;  5JOL A;  4BY5 A;  2LNK A;  2Y4Q A;  1BF5 A;  4YGB B;  2COL B;  1KFX S;  4GGN A;  3SIA A;  2AAO A;  4ZCU A;  3EK8 A;  3JVT C;  1SR6 C;  5AFP A;  1CTR A;  1S1E A;  1SRA A;  1OZS A;  1R2U A;  1JWD A;  2JTZ A;  2Y1M A;  3KF9 A;  4QJ5 B;  4CLN A;  1K94 A;  2K7D A;  2JT8 A;  3I5G B;  1UHJ A;  2EC6 C;  2F3Z A;  5HKZ A;  2M3W A;  2KAV A;  3O6B A;  1QV1 A;  1N65 A;  2NCO A;  1OMR A;  2KGB C;  1M46 A;  1U5I A;  2KYC A;  1IQ5 A;  2M0R A;  1BG1 A;  1M45 A;  4PHN A;  1MXE A;  1DJI A;  2PSR A;  1UHI A;  2HQ8 A;  2ZNE A;  3EK4 A;  4CFR A;  1Y6W A;  1RWY A;  1N0Y A;  1NSH A;  1TCO B;  1A2X A;  2HET A;  3O78 A;  5G08 A;  1DT7 B;  1ZMZ A;  4PCW A;  1CB1 A;  1F71 A;  3H4S E;  1QS7 A;  1MQ1 A;  1NCY A;  4YGE B;  2NZ0 A;  3D0Y B;  3PN7 C;  3A8R A;  3FS7 A;  1AP4 A;  3I5H C;  1EJ3 A;  3NSO A;  4MN0 A;  5CSF A;  1BOC A;  1REC A;  2GGM A;  2KQ6 A;  1QX5 B;  4A4C A;  1CDM A;  2F33 A;  1KFX L;  1CMG A;  4CPV A;  3FWB A;  4M2Q A;  1IJ5 A;  3SG7 A;  4WQ2 A;  1V1F A;  1TNP A;  2KYF A;  2LMV A;  1N2D A;  2NCP A;  1S6C A;  1BLQ A;  1J7Q A;  2BCB A;  1SBJ A;  1EG3 A;  4MZJ A;  1XA5 A;  4YI8 A;  1DVI A;  2LLS A;  4PHK A;  2P6B B;  3BUM B;  3OB1 B;  1QVI Y;  5JJG A;  1YVH A;  1J7O A;  4QJ4 B;  2EGD A;  2L0P A;  2A4J A;  3LK1 A;  3GK2 A;  1S5G Y;  2JRF A;  1A75 A;  1DF0 A;  2OS8 C;  4HSZ A;  3VRQ A;  1G33 A;  3DF0 A;  4XJK A;  4PE4 A;  1F4O A;  5HYD A;  2BBN A;  1DGU A;  3EVU A;  3SG5 A;  3DVK A;  2LHL A;  1L2O B;  2O5G A;  3K21 A;  1CLB A;  4QJ3 B;  1MHO A;  2KBI A;  5I8N A;  1DTL A;  5KU1 A;  1QAT A;  1RK9 A;  1WRZ A;  1Y0V H;  4OKH A;  1OOJ A;  2K2F A;  3CTN A;  1K9P A;  4MRY A;  2TN4 A;  2JT0 A;  1CMF A;  1YVL A;  3IQO A;  1S36 A;  1TNQ A;  1YUT A;  2JXL A;  2WND A;  1CFF A;  5K89 A;  2BL0 B;  2LP3 A;  2HPS A;  2I18 A;  1W7J B;  1BU3 A;  1A75 B;  1NX3 A;  1GGZ A;  2V53 A;  3NSK A;  2R2I A;  3I5F C;  1DJZ A;  2EHB A;  5BPJ A;  1E8A A;  2K8M B;  2LLU A;  2LUC A;  2LAP A;  3I5I B;  4GBA A;  3DF0 B;  3DVM A;  4P2Y B;  3TS5 C;  3KO0 A;  1BT6 A;  1NWD A;  1KK7 Y; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...