1KSMA

Average nmr solution structure of ca ln calbindin d9k
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
75
structure length
75
Chain Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGMSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VITAMIN D-DEPENDENT CALCIUM-BINDING PROTEIN
publication title Paramagnetism-based versus classical constraints: an analysis of the solution structure of Ca Ln calbindin D9k.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 19
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2002-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ksmA00
1XFYO 1NX2A 1YRUB 2TN4A 2KI6D 1W7IB 3VRQA 3TUYB 4QJ4B 1K9UA 4JWQA 4OR9B 1QV0A 1MXEA 1K9PA 5HLOA 1DJZA 1JWDA 2L50A 1NCYA 1SMGA 4PE7A 1H4BA 4XJKB 3BUWB 2LVIA 1KFUS 2LVKA 2ZRSA 1SRAA 1FF1A 3VGOA 1QATA 2WCEA 2JULA 1YVHA 1TCOB 1A03A 1K90D 4YGAA 3D0YA 5CSJA 3WHTB 4R1EA 3OX6A 1CDPA 4DRWA 5AXIA 2WCBA 2K7BA 2JXLA 2KFHA 2A4JA 1M46A 2KAVA 1QIWA 2HQ8A 5HKWA 3PALA 1F4QA 2HETA 4PCWA 5AANA 3IQOA 1NX1A 4ORAB 4HRGA 4YI8A 3SG5A 2F3ZA 1KQMB 1TRFA 4NQGA 3PN7C 3JTDB 1EG3A 1SCMC 2PVBA 5I2LA 4MZKA 1DT7B 1Y1AA 1ZFSA 3AAJA 3I5FB 4WRIA 2BCXA 1L7ZA 3BQ3A 1UP5A 1V1FA 3EKJA 2KQ6A 3TDUA 2M1KB 1JUOA 1NWDA 2JT0A 3I5IC 4GGFA 1ODBA 4ZCUA 1F55A 4WQ3A 3K21A 3SIAA 1EJ3A 1J7PA 1A4PA 1UURA 2OS8C 1NP8A 1HQVA 4YGEB 1LA0A 2G2BA 1AVSA 1IQ5A 1UHNA 1WRLA 4MLWA 4I5KA 2BCAA 2JT3A 1MR8A 1NCZA 3BUOB 5D7FA 3GOFA 1ZACA 1BJFA 1ZUZA 3TS5B 1BG1A 1BF5A 1OZSA 1Y0VH 2MAZA 1G8IA 1RECA 1W7JB 2AUCA 3A4UB 2AAOA 1AJ4A 3O2PA 1IWQA 1QLKA 2K7CA 1KFXL 1NPQA 2JOJA 1B47A 2L51A 2FCDA 1FW4A 1XK4A 3CGAA 5JJGA 3AKAA 5J3XA 5CSIA 1Y1UA 4PE4A 1KWOB 1WRKA 3IQQA 1AJ5A 1SK6D 1AP4A 1N2DA 2M9GA 1YURA 2CTNA 1L2OB 4USLA 3BUXB 1IRJA 4HREE 1KK8B 2KFGA 3ZNIA 2COLB 4Q04A 4PHJA 2VRGA 1TOPA 5JOLA 3HCMA 2KGBC 3JVTB 4ICBA 4PE1A 4PHNA 2KBMA 3KF9A 1IJ5A 2CBLA 1M45A 1MQ1A 5ER4X 1M39A 4L9MA 1TIZA 2EGDA 3GK4X 1KK7Y 1KCYA 3DF0B 5B8IB 1KSOA 3I5GC 1QTXA 1PVAA 2KYCA 2HPSA 2O60A 2FOTA 1TCFA 3PFVA 2B1UA 1DJGA 2Q4UA 3CTNA 1MF8B 4MSPA 5DKQA 5PALA 3LK0A 2KBIA 3CWGA 2JC2A 2HF5A 2K61A 1CFFA 1JSAA 2PALA 1S5GY 1DJYA 4GBAA 4P2YB 1HT9A 3DVMA 1SCVA 4I5NB 5HYDA 1G33A 1LKJA 2M49B 3VRRA 1CLBA 1J55A 1SL7A 1CDLA 1XFXO 1K95A 2CNPA 2LLTA 3KO0A 2K8MB 1LA3A 2IS9A 1IKUA 1GQMA 4CPVA 2LVJA 2LP2A 4JQ0D 2I7AA 2BBMA 2ZNEA 1QLSA 5AEQA 1UHJA 2KI6C 4PALA 1CLMA 1RK9A 2BECA 4GUKA 2RGIA 1CFPA 5GQQC 1NSHA 2K2AA 3DVEA 1SCMB 3NXAA 2F2OA 3NSKA 4N1FA 2KI4C 1B1GA 4CLNA 2BL0B 3EKHA 3SG2A 5HLVA 1F71A 3CR4X 1N0YA 2LE9B 1WRZA 3ZWHA 1SW8A 1NIWA 4AQJA 2PRUA 5KSZA 1CTRA 1R2UA 2LVVA 1BMOA 1GGWA 1B7TZ 4OCIA 2L98A 2M1UA 1IH0A 1BT6A 4C0KA 1FBVA 4A4CA 4DCKA 2KQYA 1J1EA 2OS8B 5KU1A 4PHMA 4NDDA 2PASA 1DTLA 1XFWO 3DD4A 2O5GA 1M63B 2ZNDA 4FQOA 1OMDA 2AMIA 4GAOA 2KOTA 4MEWA 1XFVO 2BE4A 4UPGA 2WNDA 1OZOA 2ZN8A 4ORCB 2LLSA 3GK2A 4BY4A 1CNPA 2Y4QA 3DVJA 2LHLA 5TNCA 1YRTB 2NZ0A 1J7OA 1CFCA 3VROA 2JPTA 1NUBA 1ZMZA 1C7VA 3TDIA 4GGNA 1CKKA 5I8NA 1SY9A 4P5OE 4YI9A 2KGRA 4DIRA 4HSZA 3WHUB 2WCFA 3PSRA 1JC2A 2BKIB 1B4CA 1CDNA 1QVIZ 1BLQA 4C0JA 1DJIA 2WORA 2WOSA 3ICBA 1SPYA 1R6PA 2LM5A 4YGCB 1J1DA 4JPZB 3O4YA 2F33A 2ZFDA 4DS7A 4F0ZB 1BU3A 1DJXA 3KEVA 2LCPA 3CR5X 3H4SE 5G08A 5BPJA 1IGVA 2QPTA 1J7QA 3OHMB 4N1GA 1SL8A 2SASA 1E8AA 1TN4A 2EC6B 3FWBA 2MBXA 1PULA 1YUUA 1QASA 1SBJA 4NDCA 3BOWA 3TUYC 1F54A 1F8HA 3O78A 1CFDA 1U5IA 2LC5A 2L0PA 1SNLA 2F2PA 3BUMB 2PMYA 1K96A 1BR1B 4MRYA 1CMGA 4M2OA 2E6WA 1N65A 1LXFC 2KHNA 1FPWA 1XFUO 4GPLB 1KK7Z 1K9KA 2LUXA 3BXKA 1DMOA 1CMFA 4GNKB 1AK8A 1SYMA 2JRFA 1TNWA 4OVNF 3LL8B 1SR6B 1RJVA 3TZ1A 2V53A 2QACA 2LMVA 1ALWA 1OMRA 4YGBB 1C07A 2ZKMX 1K2HA 3O6BA 1WDCB 1OE9B 1KQMC 1A75A 1S6CA 1JFKA 1GGZA 2BCBA 1YUSA 2K7DA 2H2KA 2NLNA 2MA2A 3NSOA 2JWWA 3VRNA 2OPOA 5HKZA 2K2FA 1UHHA 2KI4B 1XFZO 1KFUL 4M2QA 2KSPA 2M7NA 2LUCA 2P6BB 2KAXA 1PSBA 4NDBA 2L4IA 2R2IA 1QX7A 1F4OA 1UUSA 1JF2A 1YUTA 3CR2A 3EK8A 2LANA 2FCEA 3AKBA 2I2RE 2L4HA 3NSIA 3RLZA 2F8PA 2Y1MA 2JT8A 2M29A 1JBAA 2FJUB 4M2PA 2I94A 1CM1A 2K0JA 1ALVA 2L5XB 4ZCVA 2GGZA 1TTXA 1QXPA 4ETOA 4AOMA 1IJ6A 2ZRTA 2M7LA 2NCPA 1YR5A 2OTGC 1XVJA 5F6TA 3KPXA 1IG5A 1NX3A 3PN7B 1Y6WA 1XA5A 4YRUA 4MBEA 3D0YB 4E68A 1DF0A 5HKYA 3BUNB 1KWOC 1J7RA 1JF0A 1KFXS 1CB1A 5FYXA 1YX7A 1KK8C 1TNQA 3I5IB 4YBHB 3PATA 4QJ3B 3JVTC 5DKRA 1Y1XA 1K93D 1QJTA 5CSFA 1DVIA 3LK1A 2LMUA 2ISDA 4A4BA 3OB1B 1RFJA 2BE6A 1UWOA 3D10A 3IF7A 5I2QA 3SG7A 2JTTA 1RTP1 1V1GA 2GGMA 5DKNA 1EG4A 5I2OA 2LHIA 1OQPA 2M8UA 3C1VA 1NCXA 4CFQA 3WNXB 1DGUA 1MXLC 1OMVA 1YX8A 2H61A 2MJWB 1PALA 2E30A 4I5LB 2HQWA 4OKHA 2DOQA 1CDMA 1SKTA 2JNFA 2K7OA 1B8RA 4MRXA 5AFPA 3TDZA 1S6IA 1BR4B 3MSEB 2JNXA 1Q80A 2Y5IA 2Q91A 4CFRA 4N5XA 3SIBA 3CLNA 2LLUA 4WQ2A 3GK1A 4MZJA 1TNPA 2F3YA 3WXAA 3QRXA 3BYAA 3BOWB 2EHBA 1FI5A 2H61C 1U5IB 3I5HC 4BY5A 2M97A 1K94A 1XO5A 1S36A 3EK4A 4XJKA 5D69A 1DGVA 3F45A 1PVBA 4IL1A 1OSAA 1EH2A 4CIDA 1B7TY 2JZIA 1PSRA 1TNXA 2LP3A 2M0RA 3E3RA 3VRPA 1CLLA 2CXJA 2NCOA 4FTGA 2KDHA 3EVVA 2CT9A 3I5GB 2LAPA 3FS7A 1S26D 2BL0C 1F70A 4PDZA 3FIAA 2LMTA 1CM4A 5ER5A 2LNKA 4OV2A 2BBNA 1QX5B 4QJ5B 4YGDB 3LLEA 1BOCA 1LINA 1B8CA 2JTZA 1A75B 1DJWA 2L2EA 1LVCD 1EXRA 4MN0A 2MRDA 1MUXA 3AAKA 1UHKA 4PE0A 3LCPC 1DJHA 1B9AA 1QV1A 1QVIY 1IQ3A 3CZTX 5CSNA 2CCMA 1YVLA 2KNEA 2SCPA 4GGFC 2KFFA 1A29A 1NX0A 2D8NA 1S5GZ 3EK7A 2OTGB 5CPVA 1JFJA 4C0LA 4I5JA 3SG3A 1VRKA 5AERA 3JTDC 2JXCA 1A2XA 1S3PA 2LV7A 4U8DA 1S1EA 4GFTA 5K89A 3I5FC 1K8UA 2G9BA 1GJYA 1AHRA 2JU0A 2M3WA 1EL4A 4TNCA 1ZOTB 1XYDA 3PLFB 4MZLA 1RWYA 4AQIA 1UHIA 1OOJA 1KSMA 3HX4A 1QS7A 1QX2A 3KHEA 1XK4C 4D1EA 2NXQA 1PK0D 1DF0B 4MVFA 4DUQA 3EVUA 3TS5C 2EC6C 2MHHA 1M31A 1KQVA 1G4YR 3OB2B 1H8BA 3FWCA 3SG4A 2ZN9A 1MWNA 2PSRA 3PM8A 4PHKA 4XYNA 1YTZC 3M0WA 3NSLA 2KYFA 2I18A 1MHOA 3SJSA 5IBWA 1WLZA 3DF0A 2JQ6A 3A8RA 4ORBB 3DVKA 2Y1NA 3CS1A 1L2OC 1SR6C 1NYAA 2MLEC 2BKHB 1C7WA 3RM1A 1WLMA 1X02A 2WC8A 3I5HB 3SG6A 1QIVA 1FI6A 3EVRA 2GV5A 2KAYA 4HRHA 1WDCC 2MLFC 1SL9A 1D1OA 1BODA 1PRWA 1AUIB 3OX5A 1B8LA 1WY9A 3OP0A 1RROA 1S6JA 5KTYA
chains in the Genus database with same CATH superfamily
1XFYO 1NX2A 1YRUB 2TN4A 4FQTA 2KI6D 1W7IB 3VRQA 3TUYB 4QJ4B 1K9UA 4JWQA 4OR9B 1QV0A 1MXEA 1K9PA 5HLOA 1DJZA 1JWDA 2L50A 1NCYA 1SMGA 2PYQA 4PE7A 1H4BA 4XJKB 3BUWB 2LVIA 1KFUS 2LVKA 2ZRSA 1SRAA 1FF1A 3VGOA 1QATA 2WCEA 2JULA 1YVHA 1TCOB 1A03A 3S0EA 1K90D 4YGAA 3CZ0A 3D0YA 5CSJA 3WHTB 4R1EA 3OX6A 1CDPA 4DRWA 5AXIA 2WCBA 2K7BA 1DELA 2JXLA 2KFHA 2A4JA 1M46A 2KAVA 1QIWA 2HQ8A 3B7AA 3O4XA 3PALA 5HKWA 1F4QA 2HETA 4PCWA 5AANA 3IQOA 1NX1A 4ORAB 4HRGA 4YI8A 3SG5A 2F3ZA 4INWA 1OOFA 1KQMB 1TRFA 4NQGA 3PN7C 3JTDB 1EG3A 1SSEB 1SCMC 2PVBA 5I2LA 4MZKA 1DT7B 1Y1AA 1ZFSA 3AAJA 3I5FB 4WRIA 2BCXA 1L7ZA 3BQ3A 1W9ZA 1UP5A 1V1FA 3EKJA 2KQ6A 3TDUA 2YGUA 2M1KB 1JUOA 1NWDA 2JT0A 3I5IC 4GGFA 1ODBA 4ZCUA 1F55A 3DXLA 4WQ3A 3K21A 3SIAA 1EJ3A 1J7PA 1A4PA 1UURA 2OS8C 1NP8A 1HQVA 4YGEB 1LA0A 2G2BA 2K60A 1AVSA 1IQ5A 1UHNA 1WRLA 4MLWA 4I5KA 2BCAA 2JT3A 3OBVA 1MR8A 1NCZA 3BUOB 5D7FA 3GOFA 1ZACA 1BJFA 1ZUZA 3TS5B 1BG1A 1BF5A 1OZSA 1Y0VH 2MAZA 1G8IA 1RECA 1W7JB 2AUCA 3A4UB 2AAOA 1AJ4A 3O2PA 1IWQA 5I94A 1QLKA 2K7CA 2KLDA 3B87A 1KFXL 1NPQA 4F7FA 2JOJA 1B47A 2L51A 2FCDA 1FW4A 1XK4A 3CGAA 5JJGA 3AKAA 5J3XA 5CSIA 1Y1UA 4PE4A 1KWOB 1WRKA 3IQQA 1AJ5A 1SK6D 1AP4A 1N2DA 2M9GA 3DY9A 1YURA 2CTNA 1L2OB 3BFAA 4USLA 3BUXB 1IRJA 4HREE 1KK8B 2KFGA 4IJ7A 3ZNIA 2COLB 4Q04A 4PHJA 2VRGA 1TOPA 5JOLA 3HCMA 2KGBC 3JVTB 4ICBA 4PE1A 4PHNA 2KBMA 3V2LA 3KF9A 1IJ5A 1TUZA 1M45A 1MQ1A 2CBLA 5ER4X 1M39A 4L9MA 1TIZA 2EGDA 3GK4X 1KK7Y 1KCYA 3Q8IA 3DF0B 5B8IB 1KSOA 3I5GC 1QTXA 1PVAA 2H8VA 2KYCA 2QDIA 3IVTA 2HPSA 2O60A 2FOTA 1TCFA 3PFVA 2B1UA 1DJGA 2Q4UA 3CTNA 1MF8B 4MSPA 5DKQA 5PALA 3LK0A 2KBIA 3CWGA 2JC2A 2HF5A 2K61A 1CFFA 1JSAA 2PALA 3OGNA 1S5GY 1DJYA 4GBAA 3L4LA 4P2YB 1HT9A 3DVMA 1SCVA 4I5NB 5HYDA 1G33A 1LKJA 2JPOA 2M49B 3VRRA 1CLBA 1J55A 1SL7A 1CDLA 1XFXO 1K95A 2CNPA 2LLTA 3KO0A 2K8MB 1LA3A 2IS9A 3UNWA 1GQMA 4CPVA 2LVJA 1IKUA 2QEBA 2LP2A 4JQ0D 2I7AA 2BBMA 2ZNEA 1QLSA 5AEQA 1UHJA 2KI6C 4PALA 3FE8A 1CLMA 1RK9A 2BECA 4GUKA 5EL2A 2RGIA 1CFPA 5GQQC 1NSHA 3NGVA 2K2AA 3DVEA 4JD9A 1SCMB 3NXAA 2F2OA 3NSKA 4N1FA 2KI4C 1B1GA 4CLNA 2BL0B 3EKHA 2L5YA 3SG2A 5HLVA 1F71A 3CR4X 1N0YA 2LE9B 1WRZA 3ZWHA 1SW8A 1NIWA 4AQJA 2PRUA 5KSZA 1CTRA 1R2UA 2LVVA 1BMOA 1GGWA 1B7TZ 4OCIA 2L98A 2M1UA 4PT1A 1IH0A 1BT6A 4C0KA 1FBVA 4A4CA 4DCKA 2KQYA 1J1EA 2OS8B 5KU1A 4PHMA 4NDDA 2PASA 1DTLA 1XFWO 3DD4A 2O5GA 1M63B 2ZNDA 4FQOA 3S0FA 1OMDA 2AMIA 4GAOA 2KOTA 4MEWA 1XFVO 5FI7A 2BE4A 4UPGA 2WNDA 1OZOA 2ZN8A 4ORCB 2LLSA 3GK2A 4BY4A 3L47A 1CNPA 2Y4QA 3DVJA 2LHLA 5TNCA 1YRTB 2NZ0A 1J7OA 1CFCA 3SS3A 3VROA 2JPTA 1NUBA 1ZMZA 2WCLA 1C7VA 3TDIA 4GGNA 1CKKA 5I8NA 1SY9A 4P5OE 4YI9A 2KGRA 4DIRA 4HSZA 3WHUB 2WCFA 3PSRA 2WCHA 1JC2A 2BKIB 1B4CA 1CDNA 1QVIZ 1BLQA 4C0JA 1DJIA 2WORA 5D3OA 2WOSA 3ICBA 1SPYA 1R6PA 2LM5A 4YGCB 1J1DA 3R1OA 4JPZB 3O4YA 2F33A 4INXA 2QEOA 2ZFDA 4DS7A 4F0ZB 1BU3A 2WCJA 1DJXA 2P71A 2LCPA 3CR5X 3H4SE 3KEVA 3NHIA 3R1VA 5G08A 5BPJA 3CDNA 1IGVA 2QPTA 1J7QA 3OHMB 4N1GA 1SL8A 2SASA 1E8AA 1TN4A 2EC6B 3FWBA 2MBXA 1PULA 1YUUA 1QASA 1SBJA 2KLEA 3BOWA 4NDCA 3TUYC 1F54A 1F8HA 3O78A 1CFDA 1U5IA 2LC5A 2L0PA 1SNLA 2F2PA 3BUMB 2PMYA 1K96A 1BR1B 4MRYA 1CMGA 3DYEA 3CYZA 2E6WA 1N65A 4M2OA 1LXFC 2KHNA 1FPWA 1XFUO 1T14A 1KK7Z 1K9KA 4GPLB 2LUXA 3BXKA 3S0DA 1OOHA 1DMOA 1CMFA 4GNKB 1AK8A 1SYMA 2P70A 3UO9A 2JRFA 1TNWA 4OVNF 2WC5A 3LL8B 1SR6B 1RJVA 2FJYA 2V53A 2QACA 2LMVA 3TZ1A 1ALWA 1OMRA 4YGBB 1C07A 2ZKMX 1Z2CB 1K2HA 3O6BA 1QWVA 2WCMA 1WDCB 1OE9B 2PQLA 1KQMC 1A75A 1S6CA 1JFKA 1GGZA 2BCBA 1YUSA 2K7DA 2H2KA 2NLNA 2MA2A 3NSOA 2JWWA 3VRNA 3B6XA 2OPOA 5HKZA 2K2FA 1UHHA 2KI4B 3SS4A 1XFZO 1KFUL 4M2QA 2KSPA 2M7NA 2LUCA 2P6BB 2KAXA 1PSBA 4NDBA 2L4IA 2R2IA 1XFRA 1QX7A 1F4OA 4CFQA 1UUSA 1JF2A 1YUTA 3CR2A 3EK8A 2LANA 2FCEA 1GM0A 3AKBA 2I2RE 3D78A 2L4HA 3NSIA 3RLZA 2F8PA 2Y1MA 2JT8A 2M29A 1JBAA 2FJUB 4M2PA 2I94A 1CM1A 3BFBA 2K0JA 1P28A 1ALVA 3BFHA 2L5XB 4ZCVA 3D74A 2GGZA 1TTXA 1QXPA 4ETOA 1OW4A 4AOMA 1IJ6A 1C3ZA 2ZRTA 2M7LA 3D75A 2NCPA 1YR5A 2OTGC 1XVJA 5F6TA 3KPXA 1IG5A 1NX3A 3BJHA 3PN7B 1Y6WA 1XA5A 3FE9A 4YRUA 4MBEA 3D0YB 4E68A 1DF0A 5HKYA 3BUNB 1KWOC 1DEKA 1J7RA 1JF0A 1KFXS 1CB1A 5FYXA 3CABA 1YX7A 1KK8C 1TNQA 2BAPA 3I5IB 4YBHB 3PATA 4QJ3B 2QEVA 3JVTC 5DKRA 1ORGA 1Y1XA 1K93D 1QJTA 5CSFA 1DVIA 3LK1A 2LMUA 2ERBA 2ISDA 4A4BA 1IIOA 3OB1B 1RFJA 2BE6A 1UWOA 3D10A 3FE6A 3IF7A 5I2QA 3SG7A 2JTTA 1RTP1 1V1GA 2GGMA 2KPHA 5DKNA 1EG4A 5I2OA 2LHIA 1OQPA 1Z4HA 2M8UA 1NCXA 3C1VA 3VB1A 1DGUA 1MXLC 1OMVA 1YX8A 2H61A 2MJWB 3WNXB 1PALA 2E30A 4I5LB 2HQWA 4OKHA 2WCKA 2DOQA 1CDMA 1SKTA 4OZDA 2JNFA 2K7OA 1B8RA 4MRXA 5AFPA 3TDZA 1S6IA 1BR4B 3D73A 2JNXA 3MSEB 1Q80A 2Y5IA 2Q91A 4CFRA 3B88A 4N5XA 3SIBA 3CLNA 2LLUA 4WQ2A 3GK1A 4MZJA 1TNPA 2F3YA 3WXAA 3QRXA 3BYAA 3BOWB 2EHBA 1FI5A 2H61C 1U5IB 3I5HC 4BY5A 2L2CA 2M97A 1K94A 1XO5A 1S36A 3EK4A 4XJKA 5D69A 1DGVA 3F45A 1PVBA 4IL1A 1OSAA 1EH2A 4CIDA 1B7TY 2JZIA 2QEHA 1PSRA 1TNXA 2LP3A 2M0RA 3E3RA 3VRPA 1CLLA 2CXJA 2NCOA 3R72A 4FTGA 2KDHA 3EVVA 2CT9A 3I5GB 3RZSA 2LAPA 3FS7A 1S26D 2BL0C 3D76A 1F70A 3B86A 4PDZA 3FIAA 2LMTA 1LS8A 1CM4A 5ER5A 2LNKA 4OV2A 2BBNA 1QX5B 4QJ5B 4YGDB 3NHTA 3LLEA 3N7HA 3S0GA 1BOCA 1LINA 1TUJA 1B8CA 2JTZA 5HL1A 1A75B 1DJWA 2L2EA 1LVCD 1EXRA 4MN0A 1DC1A 2MRDA 3PJIA 1MUXA 3AAKA 1UHKA 4PE0A 3SS5A 3LCPC 1DJHA 1B9AA 1QV1A 1TWOA 1QVIY 1IQ3A 3CZTX 5CSNA 3K1EA 2CCMA 1YVLA 2KNEA 2SCPA 4GGFC 2KFFA 1A29A 1NX0A 2D8NA 1S5GZ 3EK7A 2OTGB 1DQEA 5CPVA 1JFJA 4C0LA 4I5JA 3SG3A 1VRKA 3DZTA 5AERA 3JTDC 2JXCA 1A2XA 1S3PA 2GTEA 2LV7A 1S1EA 4U8DA 4GFTA 5K89A 3I5FC 5DICA 1K8UA 2G9BA 1GJYA 1AHRA 2JU0A 2M3WA 1EL4A 2BNXA 3R1PA 4TNCA 1ZOTB 1XYDA 3PLFB 4MZLA 1RWYA 4AQIA 1UHIA 1OOJA 1KSMA 3HX4A 1QS7A 1QX2A 3KHEA 1XK4C 4D1EA 1OOGA 2NXQA 1PK0D 1DF0B 3CZ1A 4MVFA 4DUQA 2WC6A 3EVUA 3TS5C 2EC6C 4KYNA 2MHHA 1M31A 3S0BA 1KQVA 1G4YR 3S0AA 3OB2B 1H8BA 3FWCA 3SG4A 2ZN9A 3EG5B 1MWNA 2PSRA 3PM8A 4PHKA 4XYNA 1YTZC 3M0WA 3NSLA 2KYFA 2I18A 1MHOA 3SJSA 5IBWA 1WLZA 5FI2A 3PM2A 3DF0A 2JQ6A 3A8RA 3D77A 4ORBB 3DVKA 2Y1NA 3CS1A 1L2OC 3L4AA 1SR6C 1NYAA 2MLEC 1C7WA 2BKHB 3RM1A 3QMEA 1WLMA 1X02A 2WC8A 3I5HB 4JKTA 5FI6A 3SG6A 1QIVA 1FI6A 1OOIX 3EVRA 2GV5A 2KAYA 3CZ2A 4HRHA 1WDCC 2MLFC 1C3YA 1SL9A 1D1OA 1BODA 1PRWA 1AUIB 3OX5A 1B8LA 1WY9A 3OP0A 1RROA 1S6JA 5KTYA
chains in the Genus database with same CATH topology
1XFYO 1NX2A 1YRUB 2TN4A 2KI6D 1W7IB 3VRQA 3TUYB 4QJ4B 1K9UA 4JWQA 4OR9B 1QV0A 1MXEA 1K9PA 5HLOA 1DJZA 1JWDA 2L50A 1NCYA 1SMGA 4PE7A 1H4BA 4XJKB 3BUWB 2LVIA 1KFUS 2LVKA 2ZRSA 1SRAA 1FF1A 3VGOA 1QATA 2WCEA 2JULA 1YVHA 1TCOB 1A03A 1K90D 4YGAA 3D0YA 5CSJA 3WHTB 4R1EA 3OX6A 1CDPA 4DRWA 5AXIA 2WCBA 2K7BA 2JXLA 2KFHA 2A4JA 1M46A 2KAVA 1QIWA 2HQ8A 5HKWA 3PALA 1F4QA 2HETA 4PCWA 5AANA 3IQOA 1NX1A 4ORAB 4HRGA 4YI8A 3SG5A 2F3ZA 1KQMB 1TRFA 4NQGA 3PN7C 3JTDB 1EG3A 1SCMC 2PVBA 5I2LA 4MZKA 1DT7B 1Y1AA 1ZFSA 3AAJA 3I5FB 4WRIA 2BCXA 1L7ZA 3BQ3A 1UP5A 1V1FA 3EKJA 2KQ6A 3TDUA 2M1KB 1JUOA 1NWDA 2JT0A 3I5IC 4GGFA 1ODBA 4ZCUA 1F55A 4WQ3A 3K21A 3SIAA 1EJ3A 1J7PA 1A4PA 1UURA 2OS8C 1NP8A 1HQVA 4YGEB 1LA0A 2G2BA 1AVSA 1IQ5A 1UHNA 1WRLA 4MLWA 4I5KA 2BCAA 2JT3A 1MR8A 1NCZA 3BUOB 5D7FA 3GOFA 1ZACA 1BJFA 1ZUZA 3TS5B 1BG1A 1BF5A 1OZSA 1Y0VH 2MAZA 1G8IA 1RECA 1W7JB 2AUCA 3A4UB 2AAOA 1AJ4A 3O2PA 1IWQA 1QLKA 2K7CA 1KFXL 1NPQA 2JOJA 1B47A 2L51A 2FCDA 1FW4A 1XK4A 3CGAA 5JJGA 3AKAA 5J3XA 5CSIA 1Y1UA 4PE4A 1KWOB 1WRKA 3IQQA 1AJ5A 1SK6D 1AP4A 1N2DA 2M9GA 1YURA 2CTNA 1L2OB 4USLA 3BUXB 1IRJA 4HREE 1KK8B 2KFGA 3ZNIA 2COLB 4Q04A 4PHJA 2VRGA 1TOPA 5JOLA 3HCMA 2KGBC 3JVTB 4ICBA 4PE1A 4PHNA 2KBMA 3KF9A 1IJ5A 2CBLA 1M45A 1MQ1A 5ER4X 1M39A 4L9MA 1TIZA 2EGDA 3GK4X 1KK7Y 1KCYA 3DF0B 5B8IB 1KSOA 3I5GC 1QTXA 1PVAA 2KYCA 2HPSA 2O60A 2FOTA 1TCFA 3PFVA 2B1UA 1DJGA 2Q4UA 3CTNA 1MF8B 4MSPA 5DKQA 5PALA 3LK0A 2KBIA 3CWGA 2JC2A 2HF5A 2K61A 1CFFA 1JSAA 2PALA 1S5GY 1DJYA 4GBAA 4P2YB 1HT9A 3DVMA 1SCVA 4I5NB 5HYDA 1G33A 1LKJA 2M49B 3VRRA 1CLBA 1J55A 1SL7A 1CDLA 1XFXO 1K95A 2CNPA 2LLTA 3KO0A 2K8MB 1LA3A 2IS9A 1IKUA 1GQMA 4CPVA 2LVJA 2LP2A 4JQ0D 2I7AA 2BBMA 2ZNEA 1QLSA 5AEQA 1UHJA 2KI6C 4PALA 1CLMA 1RK9A 2BECA 4GUKA 2RGIA 1CFPA 5GQQC 1NSHA 2K2AA 3DVEA 1SCMB 3NXAA 2F2OA 3NSKA 4N1FA 2KI4C 1B1GA 4CLNA 2BL0B 3EKHA 3SG2A 5HLVA 1F71A 3CR4X 1N0YA 2LE9B 1WRZA 3ZWHA 1SW8A 1NIWA 4AQJA 2PRUA 5KSZA 1CTRA 1R2UA 2LVVA 1BMOA 1GGWA 1B7TZ 4OCIA 2L98A 2M1UA 1IH0A 1BT6A 4C0KA 1FBVA 4A4CA 4DCKA 2KQYA 1J1EA 2OS8B 5KU1A 4PHMA 4NDDA 2PASA 1DTLA 1XFWO 3DD4A 2O5GA 1M63B 2ZNDA 4FQOA 1OMDA 2AMIA 4GAOA 2KOTA 4MEWA 1XFVO 2BE4A 4UPGA 2WNDA 1OZOA 2ZN8A 4ORCB 2LLSA 3GK2A 4BY4A 1CNPA 2Y4QA 3DVJA 2LHLA 5TNCA 1YRTB 2NZ0A 1J7OA 1CFCA 3VROA 2JPTA 1NUBA 1ZMZA 1C7VA 3TDIA 4GGNA 1CKKA 5I8NA 1SY9A 4P5OE 4YI9A 2KGRA 4DIRA 4HSZA 3WHUB 2WCFA 3PSRA 1JC2A 2BKIB 1B4CA 1CDNA 1QVIZ 1BLQA 4C0JA 1DJIA 2WORA 2WOSA 3ICBA 1SPYA 1R6PA 2LM5A 4YGCB 1J1DA 4JPZB 3O4YA 2F33A 2ZFDA 4DS7A 4F0ZB 1BU3A 1DJXA 3KEVA 2LCPA 3CR5X 3H4SE 5G08A 5BPJA 1IGVA 2QPTA 1J7QA 3OHMB 4N1GA 1SL8A 2SASA 1E8AA 1TN4A 2EC6B 3FWBA 2MBXA 1PULA 1YUUA 1QASA 1SBJA 4NDCA 3BOWA 3TUYC 1F54A 1F8HA 3O78A 1CFDA 1U5IA 2LC5A 2L0PA 1SNLA 2F2PA 3BUMB 2PMYA 1K96A 1BR1B 4MRYA 1CMGA 4M2OA 2E6WA 1N65A 1LXFC 2KHNA 1FPWA 1XFUO 4GPLB 1KK7Z 1K9KA 2LUXA 3BXKA 1DMOA 1CMFA 4GNKB 1AK8A 1SYMA 2JRFA 1TNWA 4OVNF 3LL8B 1SR6B 1RJVA 3TZ1A 2V53A 2QACA 2LMVA 1ALWA 1OMRA 4YGBB 1C07A 2ZKMX 1K2HA 3O6BA 1WDCB 1OE9B 1KQMC 1A75A 1S6CA 1JFKA 1GGZA 2BCBA 1YUSA 2K7DA 2H2KA 2NLNA 2MA2A 3NSOA 2JWWA 3VRNA 2OPOA 5HKZA 2K2FA 1UHHA 2KI4B 1XFZO 1KFUL 4M2QA 2KSPA 2M7NA 2LUCA 2P6BB 2KAXA 1PSBA 4NDBA 2L4IA 2R2IA 1QX7A 1F4OA 1UUSA 1JF2A 1YUTA 3CR2A 3EK8A 2LANA 2FCEA 3AKBA 2I2RE 2L4HA 3NSIA 3RLZA 2F8PA 2Y1MA 2JT8A 2M29A 1JBAA 2FJUB 4M2PA 2I94A 1CM1A 2K0JA 1ALVA 2L5XB 4ZCVA 2GGZA 1TTXA 1QXPA 4ETOA 4AOMA 1IJ6A 2ZRTA 2M7LA 2NCPA 1YR5A 2OTGC 1XVJA 5F6TA 3KPXA 1IG5A 1NX3A 3PN7B 1Y6WA 1XA5A 4YRUA 4MBEA 3D0YB 4E68A 1DF0A 5HKYA 3BUNB 1KWOC 1J7RA 1JF0A 1KFXS 1CB1A 5FYXA 1YX7A 1KK8C 1TNQA 3I5IB 4YBHB 3PATA 4QJ3B 3JVTC 5DKRA 1Y1XA 1K93D 1QJTA 5CSFA 1DVIA 3LK1A 2LMUA 2ISDA 4A4BA 3OB1B 1RFJA 2BE6A 1UWOA 3D10A 3IF7A 5I2QA 3SG7A 2JTTA 1RTP1 1V1GA 2GGMA 5DKNA 1EG4A 5I2OA 2LHIA 1OQPA 2M8UA 3C1VA 1NCXA 4CFQA 3WNXB 1DGUA 1MXLC 1OMVA 1YX8A 2H61A 2MJWB 1PALA 2E30A 4I5LB 2HQWA 4OKHA 2DOQA 1CDMA 1SKTA 2JNFA 2K7OA 1B8RA 4MRXA 5AFPA 3TDZA 1S6IA 1BR4B 3MSEB 2JNXA 1Q80A 2Y5IA 2Q91A 4CFRA 4N5XA 3SIBA 3CLNA 2LLUA 4WQ2A 3GK1A 4MZJA 1TNPA 2F3YA 3WXAA 3QRXA 3BYAA 3BOWB 2EHBA 1FI5A 2H61C 1U5IB 3I5HC 4BY5A 2M97A 1K94A 1XO5A 1S36A 3EK4A 4XJKA 5D69A 1DGVA 3F45A 1PVBA 4IL1A 1OSAA 1EH2A 4CIDA 1B7TY 2JZIA 1PSRA 1TNXA 2LP3A 2M0RA 3E3RA 3VRPA 1CLLA 2CXJA 2NCOA 4FTGA 2KDHA 3EVVA 2CT9A 3I5GB 2LAPA 3FS7A 1S26D 2BL0C 1F70A 4PDZA 3FIAA 2LMTA 1CM4A 5ER5A 2LNKA 4OV2A 2BBNA 1QX5B 4QJ5B 4YGDB 3LLEA 1BOCA 1LINA 1B8CA 2JTZA 1A75B 1DJWA 2L2EA 1LVCD 1EXRA 4MN0A 2MRDA 1MUXA 3AAKA 1UHKA 4PE0A 3LCPC 1DJHA 1B9AA 1QV1A 1QVIY 1IQ3A 3CZTX 5CSNA 2CCMA 1YVLA 2KNEA 2SCPA 4GGFC 2KFFA 1A29A 1NX0A 2D8NA 1S5GZ 3EK7A 2OTGB 5CPVA 1JFJA 4C0LA 4I5JA 3SG3A 1VRKA 5AERA 3JTDC 2JXCA 1A2XA 1S3PA 2LV7A 4U8DA 1S1EA 4GFTA 5K89A 3I5FC 1K8UA 2G9BA 1GJYA 1AHRA 2JU0A 2M3WA 1EL4A 4TNCA 1ZOTB 1XYDA 3PLFB 4MZLA 1RWYA 4AQIA 1UHIA 1OOJA 1KSMA 3HX4A 1QS7A 1QX2A 3KHEA 1XK4C 4D1EA 2NXQA 1PK0D 1DF0B 4MVFA 4DUQA 3EVUA 3TS5C 2EC6C 2MHHA 1M31A 1KQVA 1G4YR 3OB2B 1H8BA 3FWCA 3SG4A 2ZN9A 1MWNA 2PSRA 3PM8A 4PHKA 4XYNA 1YTZC 3M0WA 3NSLA 2KYFA 2I18A 1MHOA 3SJSA 5IBWA 1WLZA 3DF0A 2JQ6A 3A8RA 4ORBB 3DVKA 2Y1NA 3CS1A 1L2OC 1SR6C 1NYAA 2MLEC 2BKHB 1C7WA 3RM1A 1WLMA 1X02A 2WC8A 3I5HB 3SG6A 1QIVA 1FI6A 3EVRA 2GV5A 2KAYA 4HRHA 1WDCC 2MLFC 1SL9A 1D1OA 1BODA 1PRWA 1AUIB 3OX5A 1B8LA 1WY9A 3OP0A 1RROA 1S6JA 5KTYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XFY O;  1NX2 A;  1YRU B;  2TN4 A;  2KI6 D;  1W7I B;  3VRQ A;  3TUY B;  4QJ4 B;  1K9U A;  4JWQ A;  4OR9 B;  1QV0 A;  1MXE A;  1K9P A;  5HLO A;  1DJZ A;  1JWD A;  2L50 A;  1NCY A;  1SMG A;  4PE7 A;  1H4B A;  4XJK B;  3BUW B;  2LVI A;  1KFU S;  2LVK A;  2ZRS A;  1SRA A;  1FF1 A;  3VGO A;  1QAT A;  2WCE A;  2JUL A;  1YVH A;  1TCO B;  1A03 A;  1K90 D;  4YGA A;  3D0Y A;  5CSJ A;  3WHT B;  4R1E A;  3OX6 A;  1CDP A;  4DRW A;  5AXI A;  2WCB A;  2K7B A;  2JXL A;  2KFH A;  2A4J A;  1M46 A;  2KAV A;  1QIW A;  2HQ8 A;  5HKW A;  3PAL A;  1F4Q A;  2HET A;  4PCW A;  5AAN A;  3IQO A;  1NX1 A;  4ORA B;  4HRG A;  4YI8 A;  3SG5 A;  2F3Z A;  1KQM B;  1TRF A;  4NQG A;  3PN7 C;  3JTD B;  1EG3 A;  1SCM C;  2PVB A;  5I2L A;  4MZK A;  1DT7 B;  1Y1A A;  1ZFS A;  3AAJ A;  3I5F B;  4WRI A;  2BCX A;  1L7Z A;  3BQ3 A;  1UP5 A;  1V1F A;  3EKJ A;  2KQ6 A;  3TDU A;  2M1K B;  1JUO A;  1NWD A;  2JT0 A;  3I5I C;  4GGF A;  1ODB A;  4ZCU A;  1F55 A;  4WQ3 A;  3K21 A;  3SIA A;  1EJ3 A;  1J7P A;  1A4P A;  1UUR A;  2OS8 C;  1NP8 A;  1HQV A;  4YGE B;  1LA0 A;  2G2B A;  1AVS A;  1IQ5 A;  1UHN A;  1WRL A;  4MLW A;  4I5K A;  2BCA A;  2JT3 A;  1MR8 A;  1NCZ A;  3BUO B;  5D7F A;  3GOF A;  1ZAC A;  1BJF A;  1ZUZ A;  3TS5 B;  1BG1 A;  1BF5 A;  1OZS A;  1Y0V H;  2MAZ A;  1G8I A;  1REC A;  1W7J B;  2AUC A;  3A4U B;  2AAO A;  1AJ4 A;  3O2P A;  1IWQ A;  1QLK A;  2K7C A;  1KFX L;  1NPQ A;  2JOJ A;  1B47 A;  2L51 A;  2FCD A;  1FW4 A;  1XK4 A;  3CGA A;  5JJG A;  3AKA A;  5J3X A;  5CSI A;  1Y1U A;  4PE4 A;  1KWO B;  1WRK A;  3IQQ A;  1AJ5 A;  1SK6 D;  1AP4 A;  1N2D A;  2M9G A;  1YUR A;  2CTN A;  1L2O B;  4USL A;  3BUX B;  1IRJ A;  4HRE E;  1KK8 B;  2KFG A;  3ZNI A;  2COL B;  4Q04 A;  4PHJ A;  2VRG A;  1TOP A;  5JOL A;  3HCM A;  2KGB C;  3JVT B;  4ICB A;  4PE1 A;  4PHN A;  2KBM A;  3KF9 A;  1IJ5 A;  2CBL A;  1M45 A;  1MQ1 A;  5ER4 X;  1M39 A;  4L9M A;  1TIZ A;  2EGD A;  3GK4 X;  1KK7 Y;  1KCY A;  3DF0 B;  5B8I B;  1KSO A;  3I5G C;  1QTX A;  1PVA A;  2KYC A;  2HPS A;  2O60 A;  2FOT A;  1TCF A;  3PFV A;  2B1U A;  1DJG A;  2Q4U A;  3CTN A;  1MF8 B;  4MSP A;  5DKQ A;  5PAL A;  3LK0 A;  2KBI A;  3CWG A;  2JC2 A;  2HF5 A;  2K61 A;  1CFF A;  1JSA A;  2PAL A;  1S5G Y;  1DJY A;  4GBA A;  4P2Y B;  1HT9 A;  3DVM A;  1SCV A;  4I5N B;  5HYD A;  1G33 A;  1LKJ A;  2M49 B;  3VRR A;  1CLB A;  1J55 A;  1SL7 A;  1CDL A;  1XFX O;  1K95 A;  2CNP A;  2LLT A;  3KO0 A;  2K8M B;  1LA3 A;  2IS9 A;  1IKU A;  1GQM A;  4CPV A;  2LVJ A;  2LP2 A;  4JQ0 D;  2I7A A;  2BBM A;  2ZNE A;  1QLS A;  5AEQ A;  1UHJ A;  2KI6 C;  4PAL A;  1CLM A;  1RK9 A;  2BEC A;  4GUK A;  2RGI A;  1CFP A;  5GQQ C;  1NSH A;  2K2A A;  3DVE A;  1SCM B;  3NXA A;  2F2O A;  3NSK A;  4N1F A;  2KI4 C;  1B1G A;  4CLN A;  2BL0 B;  3EKH A;  3SG2 A;  5HLV A;  1F71 A;  3CR4 X;  1N0Y A;  2LE9 B;  1WRZ A;  3ZWH A;  1SW8 A;  1NIW A;  4AQJ A;  2PRU A;  5KSZ A;  1CTR A;  1R2U A;  2LVV A;  1BMO A;  1GGW A;  1B7T Z;  4OCI A;  2L98 A;  2M1U A;  1IH0 A;  1BT6 A;  4C0K A;  1FBV A;  4A4C A;  4DCK A;  2KQY A;  1J1E A;  2OS8 B;  5KU1 A;  4PHM A;  4NDD A;  2PAS A;  1DTL A;  1XFW O;  3DD4 A;  2O5G A;  1M63 B;  2ZND A;  4FQO A;  1OMD A;  2AMI A;  4GAO A;  2KOT A;  4MEW A;  1XFV O;  2BE4 A;  4UPG A;  2WND A;  1OZO A;  2ZN8 A;  4ORC B;  2LLS A;  3GK2 A;  4BY4 A;  1CNP A;  2Y4Q A;  3DVJ A;  2LHL A;  5TNC A;  1YRT B;  2NZ0 A;  1J7O A;  1CFC A;  3VRO A;  2JPT A;  1NUB A;  1ZMZ A;  1C7V A;  3TDI A;  4GGN A;  1CKK A;  5I8N A;  1SY9 A;  4P5O E;  4YI9 A;  2KGR A;  4DIR A;  4HSZ A;  3WHU B;  2WCF A;  3PSR A;  1JC2 A;  2BKI B;  1B4C A;  1CDN A;  1QVI Z;  1BLQ A;  4C0J A;  1DJI A;  2WOR A;  2WOS A;  3ICB A;  1SPY A;  1R6P A;  2LM5 A;  4YGC B;  1J1D A;  4JPZ B;  3O4Y A;  2F33 A;  2ZFD A;  4DS7 A;  4F0Z B;  1BU3 A;  1DJX A;  3KEV A;  2LCP A;  3CR5 X;  3H4S E;  5G08 A;  5BPJ A;  1IGV A;  2QPT A;  1J7Q A;  3OHM B;  4N1G A;  1SL8 A;  2SAS A;  1E8A A;  1TN4 A;  2EC6 B;  3FWB A;  2MBX A;  1PUL A;  1YUU A;  1QAS A;  1SBJ A;  4NDC A;  3BOW A;  3TUY C;  1F54 A;  1F8H A;  3O78 A;  1CFD A;  1U5I A;  2LC5 A;  2L0P A;  1SNL A;  2F2P A;  3BUM B;  2PMY A;  1K96 A;  1BR1 B;  4MRY A;  1CMG A;  4M2O A;  2E6W A;  1N65 A;  1LXF C;  2KHN A;  1FPW A;  1XFU O;  4GPL B;  1KK7 Z;  1K9K A;  2LUX A;  3BXK A;  1DMO A;  1CMF A;  4GNK B;  1AK8 A;  1SYM A;  2JRF A;  1TNW A;  4OVN F;  3LL8 B;  1SR6 B;  1RJV A;  3TZ1 A;  2V53 A;  2QAC A;  2LMV A;  1ALW A;  1OMR A;  4YGB B;  1C07 A;  2ZKM X;  1K2H A;  3O6B A;  1WDC B;  1OE9 B;  1KQM C;  1A75 A;  1S6C A;  1JFK A;  1GGZ A;  2BCB A;  1YUS A;  2K7D A;  2H2K A;  2NLN A;  2MA2 A;  3NSO A;  2JWW A;  3VRN A;  2OPO A;  5HKZ A;  2K2F A;  1UHH A;  2KI4 B;  1XFZ O;  1KFU L;  4M2Q A;  2KSP A;  2M7N A;  2LUC A;  2P6B B;  2KAX A;  1PSB A;  4NDB A;  2L4I A;  2R2I A;  1QX7 A;  1F4O A;  1UUS A;  1JF2 A;  1YUT A;  3CR2 A;  3EK8 A;  2LAN A;  2FCE A;  3AKB A;  2I2R E;  2L4H A;  3NSI A;  3RLZ A;  2F8P A;  2Y1M A;  2JT8 A;  2M29 A;  1JBA A;  2FJU B;  4M2P A;  2I94 A;  1CM1 A;  2K0J A;  1ALV A;  2L5X B;  4ZCV A;  2GGZ A;  1TTX A;  1QXP A;  4ETO A;  4AOM A;  1IJ6 A;  2ZRT A;  2M7L A;  2NCP A;  1YR5 A;  2OTG C;  1XVJ A;  5F6T A;  3KPX A;  1IG5 A;  1NX3 A;  3PN7 B;  1Y6W A;  1XA5 A;  4YRU A;  4MBE A;  3D0Y B;  4E68 A;  1DF0 A;  5HKY A;  3BUN B;  1KWO C;  1J7R A;  1JF0 A;  1KFX S;  1CB1 A;  5FYX A;  1YX7 A;  1KK8 C;  1TNQ A;  3I5I B;  4YBH B;  3PAT A;  4QJ3 B;  3JVT C;  5DKR A;  1Y1X A;  1K93 D;  1QJT A;  5CSF A;  1DVI A;  3LK1 A;  2LMU A;  2ISD A;  4A4B A;  3OB1 B;  1RFJ A;  2BE6 A;  1UWO A;  3D10 A;  3IF7 A;  5I2Q A;  3SG7 A;  2JTT A;  1RTP 1;  1V1G A;  2GGM A;  5DKN A;  1EG4 A;  5I2O A;  2LHI A;  1OQP A;  2M8U A;  3C1V A;  1NCX A;  4CFQ A;  3WNX B;  1DGU A;  1MXL C;  1OMV A;  1YX8 A;  2H61 A;  2MJW B;  1PAL A;  2E30 A;  4I5L B;  2HQW A;  4OKH A;  2DOQ A;  1CDM A;  1SKT A;  2JNF A;  2K7O A;  1B8R A;  4MRX A;  5AFP A;  3TDZ A;  1S6I A;  1BR4 B;  3MSE B;  2JNX A;  1Q80 A;  2Y5I A;  2Q91 A;  4CFR A;  4N5X A;  3SIB A;  3CLN A;  2LLU A;  4WQ2 A;  3GK1 A;  4MZJ A;  1TNP A;  2F3Y A;  3WXA A;  3QRX A;  3BYA A;  3BOW B;  2EHB A;  1FI5 A;  2H61 C;  1U5I B;  3I5H C;  4BY5 A;  2M97 A;  1K94 A;  1XO5 A;  1S36 A;  3EK4 A;  4XJK A;  5D69 A;  1DGV A;  3F45 A;  1PVB A;  4IL1 A;  1OSA A;  1EH2 A;  4CID A;  1B7T Y;  2JZI A;  1PSR A;  1TNX A;  2LP3 A;  2M0R A;  3E3R A;  3VRP A;  1CLL A;  2CXJ A;  2NCO A;  4FTG A;  2KDH A;  3EVV A;  2CT9 A;  3I5G B;  2LAP A;  3FS7 A;  1S26 D;  2BL0 C;  1F70 A;  4PDZ A;  3FIA A;  2LMT A;  1CM4 A;  5ER5 A;  2LNK A;  4OV2 A;  2BBN A;  1QX5 B;  4QJ5 B;  4YGD B;  3LLE A;  1BOC A;  1LIN A;  1B8C A;  2JTZ A;  1A75 B;  1DJW A;  2L2E A;  1LVC D;  1EXR A;  4MN0 A;  2MRD A;  1MUX A;  3AAK A;  1UHK A;  4PE0 A;  3LCP C;  1DJH A;  1B9A A;  1QV1 A;  1QVI Y;  1IQ3 A;  3CZT X;  5CSN A;  2CCM A;  1YVL A;  2KNE A;  2SCP A;  4GGF C;  2KFF A;  1A29 A;  1NX0 A;  2D8N A;  1S5G Z;  3EK7 A;  2OTG B;  5CPV A;  1JFJ A;  4C0L A;  4I5J A;  3SG3 A;  1VRK A;  5AER A;  3JTD C;  2JXC A;  1A2X A;  1S3P A;  2LV7 A;  4U8D A;  1S1E A;  4GFT A;  5K89 A;  3I5F C;  1K8U A;  2G9B A;  1GJY A;  1AHR A;  2JU0 A;  2M3W A;  1EL4 A;  4TNC A;  1ZOT B;  1XYD A;  3PLF B;  4MZL A;  1RWY A;  4AQI A;  1UHI A;  1OOJ A;  1KSM A;  3HX4 A;  1QS7 A;  1QX2 A;  3KHE A;  1XK4 C;  4D1E A;  2NXQ A;  1PK0 D;  1DF0 B;  4MVF A;  4DUQ A;  3EVU A;  3TS5 C;  2EC6 C;  2MHH A;  1M31 A;  1KQV A;  1G4Y R;  3OB2 B;  1H8B A;  3FWC A;  3SG4 A;  2ZN9 A;  1MWN A;  2PSR A;  3PM8 A;  4PHK A;  4XYN A;  1YTZ C;  3M0W A;  3NSL A;  2KYF A;  2I18 A;  1MHO A;  3SJS A;  5IBW A;  1WLZ A;  3DF0 A;  2JQ6 A;  3A8R A;  4ORB B;  3DVK A;  2Y1N A;  3CS1 A;  1L2O C;  1SR6 C;  1NYA A;  2MLE C;  2BKH B;  1C7W A;  3RM1 A;  1WLM A;  1X02 A;  2WC8 A;  3I5H B;  3SG6 A;  1QIV A;  1FI6 A;  3EVR A;  2GV5 A;  2KAY A;  4HRH A;  1WDC C;  2MLF C;  1SL9 A;  1D1O A;  1BOD A;  1PRW A;  1AUI B;  3OX5 A;  1B8L A;  1WY9 A;  3OP0 A;  1RRO A;  1S6J A;  5KTY A; 
#chains in the Genus database with same CATH topology
 1XFY O;  1NX2 A;  1YRU B;  2TN4 A;  4FQT A;  2KI6 D;  1W7I B;  3VRQ A;  3TUY B;  4QJ4 B;  1K9U A;  4JWQ A;  4OR9 B;  1QV0 A;  1MXE A;  1K9P A;  5HLO A;  1DJZ A;  1JWD A;  2L50 A;  1NCY A;  1SMG A;  2PYQ A;  4PE7 A;  1H4B A;  4XJK B;  3BUW B;  2LVI A;  1KFU S;  2LVK A;  2ZRS A;  1SRA A;  1FF1 A;  3VGO A;  1QAT A;  2WCE A;  2JUL A;  1YVH A;  1TCO B;  1A03 A;  3S0E A;  1K90 D;  4YGA A;  3CZ0 A;  3D0Y A;  5CSJ A;  3WHT B;  4R1E A;  3OX6 A;  1CDP A;  4DRW A;  5AXI A;  2WCB A;  2K7B A;  1DEL A;  2JXL A;  2KFH A;  2A4J A;  1M46 A;  2KAV A;  1QIW A;  2HQ8 A;  3B7A A;  3O4X A;  3PAL A;  5HKW A;  1F4Q A;  2HET A;  4PCW A;  5AAN A;  3IQO A;  1NX1 A;  4ORA B;  4HRG A;  4YI8 A;  3SG5 A;  2F3Z A;  4INW A;  1OOF A;  1KQM B;  1TRF A;  4NQG A;  3PN7 C;  3JTD B;  1EG3 A;  1SSE B;  1SCM C;  2PVB A;  5I2L A;  4MZK A;  1DT7 B;  1Y1A A;  1ZFS A;  3AAJ A;  3I5F B;  4WRI A;  2BCX A;  1L7Z A;  3BQ3 A;  1W9Z A;  1UP5 A;  1V1F A;  3EKJ A;  2KQ6 A;  3TDU A;  2YGU A;  2M1K B;  1JUO A;  1NWD A;  2JT0 A;  3I5I C;  4GGF A;  1ODB A;  4ZCU A;  1F55 A;  3DXL A;  4WQ3 A;  3K21 A;  3SIA A;  1EJ3 A;  1J7P A;  1A4P A;  1UUR A;  2OS8 C;  1NP8 A;  1HQV A;  4YGE B;  1LA0 A;  2G2B A;  2K60 A;  1AVS A;  1IQ5 A;  1UHN A;  1WRL A;  4MLW A;  4I5K A;  2BCA A;  2JT3 A;  3OBV A;  1MR8 A;  1NCZ A;  3BUO B;  5D7F A;  3GOF A;  1ZAC A;  1BJF A;  1ZUZ A;  3TS5 B;  1BG1 A;  1BF5 A;  1OZS A;  1Y0V H;  2MAZ A;  1G8I A;  1REC A;  1W7J B;  2AUC A;  3A4U B;  2AAO A;  1AJ4 A;  3O2P A;  1IWQ A;  5I94 A;  1QLK A;  2K7C A;  2KLD A;  3B87 A;  1KFX L;  1NPQ A;  4F7F A;  2JOJ A;  1B47 A;  2L51 A;  2FCD A;  1FW4 A;  1XK4 A;  3CGA A;  5JJG A;  3AKA A;  5J3X A;  5CSI A;  1Y1U A;  4PE4 A;  1KWO B;  1WRK A;  3IQQ A;  1AJ5 A;  1SK6 D;  1AP4 A;  1N2D A;  2M9G A;  3DY9 A;  1YUR A;  2CTN A;  1L2O B;  3BFA A;  4USL A;  3BUX B;  1IRJ A;  4HRE E;  1KK8 B;  2KFG A;  4IJ7 A;  3ZNI A;  2COL B;  4Q04 A;  4PHJ A;  2VRG A;  1TOP A;  5JOL A;  3HCM A;  2KGB C;  3JVT B;  4ICB A;  4PE1 A;  4PHN A;  2KBM A;  3V2L A;  3KF9 A;  1IJ5 A;  1TUZ A;  1M45 A;  1MQ1 A;  2CBL A;  5ER4 X;  1M39 A;  4L9M A;  1TIZ A;  2EGD A;  3GK4 X;  1KK7 Y;  1KCY A;  3Q8I A;  3DF0 B;  5B8I B;  1KSO A;  3I5G C;  1QTX A;  1PVA A;  2H8V A;  2KYC A;  2QDI A;  3IVT A;  2HPS A;  2O60 A;  2FOT A;  1TCF A;  3PFV A;  2B1U A;  1DJG A;  2Q4U A;  3CTN A;  1MF8 B;  4MSP A;  5DKQ A;  5PAL A;  3LK0 A;  2KBI A;  3CWG A;  2JC2 A;  2HF5 A;  2K61 A;  1CFF A;  1JSA A;  2PAL A;  3OGN A;  1S5G Y;  1DJY A;  4GBA A;  3L4L A;  4P2Y B;  1HT9 A;  3DVM A;  1SCV A;  4I5N B;  5HYD A;  1G33 A;  1LKJ A;  2JPO A;  2M49 B;  3VRR A;  1CLB A;  1J55 A;  1SL7 A;  1CDL A;  1XFX O;  1K95 A;  2CNP A;  2LLT A;  3KO0 A;  2K8M B;  1LA3 A;  2IS9 A;  3UNW A;  1GQM A;  4CPV A;  2LVJ A;  1IKU A;  2QEB A;  2LP2 A;  4JQ0 D;  2I7A A;  2BBM A;  2ZNE A;  1QLS A;  5AEQ A;  1UHJ A;  2KI6 C;  4PAL A;  3FE8 A;  1CLM A;  1RK9 A;  2BEC A;  4GUK A;  5EL2 A;  2RGI A;  1CFP A;  5GQQ C;  1NSH A;  3NGV A;  2K2A A;  3DVE A;  4JD9 A;  1SCM B;  3NXA A;  2F2O A;  3NSK A;  4N1F A;  2KI4 C;  1B1G A;  4CLN A;  2BL0 B;  3EKH A;  2L5Y A;  3SG2 A;  5HLV A;  1F71 A;  3CR4 X;  1N0Y A;  2LE9 B;  1WRZ A;  3ZWH A;  1SW8 A;  1NIW A;  4AQJ A;  2PRU A;  5KSZ A;  1CTR A;  1R2U A;  2LVV A;  1BMO A;  1GGW A;  1B7T Z;  4OCI A;  2L98 A;  2M1U A;  4PT1 A;  1IH0 A;  1BT6 A;  4C0K A;  1FBV A;  4A4C A;  4DCK A;  2KQY A;  1J1E A;  2OS8 B;  5KU1 A;  4PHM A;  4NDD A;  2PAS A;  1DTL A;  1XFW O;  3DD4 A;  2O5G A;  1M63 B;  2ZND A;  4FQO A;  3S0F A;  1OMD A;  2AMI A;  4GAO A;  2KOT A;  4MEW A;  1XFV O;  5FI7 A;  2BE4 A;  4UPG A;  2WND A;  1OZO A;  2ZN8 A;  4ORC B;  2LLS A;  3GK2 A;  4BY4 A;  3L47 A;  1CNP A;  2Y4Q A;  3DVJ A;  2LHL A;  5TNC A;  1YRT B;  2NZ0 A;  1J7O A;  1CFC A;  3SS3 A;  3VRO A;  2JPT A;  1NUB A;  1ZMZ A;  2WCL A;  1C7V A;  3TDI A;  4GGN A;  1CKK A;  5I8N A;  1SY9 A;  4P5O E;  4YI9 A;  2KGR A;  4DIR A;  4HSZ A;  3WHU B;  2WCF A;  3PSR A;  2WCH A;  1JC2 A;  2BKI B;  1B4C A;  1CDN A;  1QVI Z;  1BLQ A;  4C0J A;  1DJI A;  2WOR A;  5D3O A;  2WOS A;  3ICB A;  1SPY A;  1R6P A;  2LM5 A;  4YGC B;  1J1D A;  3R1O A;  4JPZ B;  3O4Y A;  2F33 A;  4INX A;  2QEO A;  2ZFD A;  4DS7 A;  4F0Z B;  1BU3 A;  2WCJ A;  1DJX A;  2P71 A;  2LCP A;  3CR5 X;  3H4S E;  3KEV A;  3NHI A;  3R1V A;  5G08 A;  5BPJ A;  3CDN A;  1IGV A;  2QPT A;  1J7Q A;  3OHM B;  4N1G A;  1SL8 A;  2SAS A;  1E8A A;  1TN4 A;  2EC6 B;  3FWB A;  2MBX A;  1PUL A;  1YUU A;  1QAS A;  1SBJ A;  2KLE A;  3BOW A;  4NDC A;  3TUY C;  1F54 A;  1F8H A;  3O78 A;  1CFD A;  1U5I A;  2LC5 A;  2L0P A;  1SNL A;  2F2P A;  3BUM B;  2PMY A;  1K96 A;  1BR1 B;  4MRY A;  1CMG A;  3DYE A;  3CYZ A;  2E6W A;  1N65 A;  4M2O A;  1LXF C;  2KHN A;  1FPW A;  1XFU O;  1T14 A;  1KK7 Z;  1K9K A;  4GPL B;  2LUX A;  3BXK A;  3S0D A;  1OOH A;  1DMO A;  1CMF A;  4GNK B;  1AK8 A;  1SYM A;  2P70 A;  3UO9 A;  2JRF A;  1TNW A;  4OVN F;  2WC5 A;  3LL8 B;  1SR6 B;  1RJV A;  2FJY A;  2V53 A;  2QAC A;  2LMV A;  3TZ1 A;  1ALW A;  1OMR A;  4YGB B;  1C07 A;  2ZKM X;  1Z2C B;  1K2H A;  3O6B A;  1QWV A;  2WCM A;  1WDC B;  1OE9 B;  2PQL A;  1KQM C;  1A75 A;  1S6C A;  1JFK A;  1GGZ A;  2BCB A;  1YUS A;  2K7D A;  2H2K A;  2NLN A;  2MA2 A;  3NSO A;  2JWW A;  3VRN A;  3B6X A;  2OPO A;  5HKZ A;  2K2F A;  1UHH A;  2KI4 B;  3SS4 A;  1XFZ O;  1KFU L;  4M2Q A;  2KSP A;  2M7N A;  2LUC A;  2P6B B;  2KAX A;  1PSB A;  4NDB A;  2L4I A;  2R2I A;  1XFR A;  1QX7 A;  1F4O A;  4CFQ A;  1UUS A;  1JF2 A;  1YUT A;  3CR2 A;  3EK8 A;  2LAN A;  2FCE A;  1GM0 A;  3AKB A;  2I2R E;  3D78 A;  2L4H A;  3NSI A;  3RLZ A;  2F8P A;  2Y1M A;  2JT8 A;  2M29 A;  1JBA A;  2FJU B;  4M2P A;  2I94 A;  1CM1 A;  3BFB A;  2K0J A;  1P28 A;  1ALV A;  3BFH A;  2L5X B;  4ZCV A;  3D74 A;  2GGZ A;  1TTX A;  1QXP A;  4ETO A;  1OW4 A;  4AOM A;  1IJ6 A;  1C3Z A;  2ZRT A;  2M7L A;  3D75 A;  2NCP A;  1YR5 A;  2OTG C;  1XVJ A;  5F6T A;  3KPX A;  1IG5 A;  1NX3 A;  3BJH A;  3PN7 B;  1Y6W A;  1XA5 A;  3FE9 A;  4YRU A;  4MBE A;  3D0Y B;  4E68 A;  1DF0 A;  5HKY A;  3BUN B;  1KWO C;  1DEK A;  1J7R A;  1JF0 A;  1KFX S;  1CB1 A;  5FYX A;  3CAB A;  1YX7 A;  1KK8 C;  1TNQ A;  2BAP A;  3I5I B;  4YBH B;  3PAT A;  4QJ3 B;  2QEV A;  3JVT C;  5DKR A;  1ORG A;  1Y1X A;  1K93 D;  1QJT A;  5CSF A;  1DVI A;  3LK1 A;  2LMU A;  2ERB A;  2ISD A;  4A4B A;  1IIO A;  3OB1 B;  1RFJ A;  2BE6 A;  1UWO A;  3D10 A;  3FE6 A;  3IF7 A;  5I2Q A;  3SG7 A;  2JTT A;  1RTP 1;  1V1G A;  2GGM A;  2KPH A;  5DKN A;  1EG4 A;  5I2O A;  2LHI A;  1OQP A;  1Z4H A;  2M8U A;  1NCX A;  3C1V A;  3VB1 A;  1DGU A;  1MXL C;  1OMV A;  1YX8 A;  2H61 A;  2MJW B;  3WNX B;  1PAL A;  2E30 A;  4I5L B;  2HQW A;  4OKH A;  2WCK A;  2DOQ A;  1CDM A;  1SKT A;  4OZD A;  2JNF A;  2K7O A;  1B8R A;  4MRX A;  5AFP A;  3TDZ A;  1S6I A;  1BR4 B;  3D73 A;  2JNX A;  3MSE B;  1Q80 A;  2Y5I A;  2Q91 A;  4CFR A;  3B88 A;  4N5X A;  3SIB A;  3CLN A;  2LLU A;  4WQ2 A;  3GK1 A;  4MZJ A;  1TNP A;  2F3Y A;  3WXA A;  3QRX A;  3BYA A;  3BOW B;  2EHB A;  1FI5 A;  2H61 C;  1U5I B;  3I5H C;  4BY5 A;  2L2C A;  2M97 A;  1K94 A;  1XO5 A;  1S36 A;  3EK4 A;  4XJK A;  5D69 A;  1DGV A;  3F45 A;  1PVB A;  4IL1 A;  1OSA A;  1EH2 A;  4CID A;  1B7T Y;  2JZI A;  2QEH A;  1PSR A;  1TNX A;  2LP3 A;  2M0R A;  3E3R A;  3VRP A;  1CLL A;  2CXJ A;  2NCO A;  3R72 A;  4FTG A;  2KDH A;  3EVV A;  2CT9 A;  3I5G B;  3RZS A;  2LAP A;  3FS7 A;  1S26 D;  2BL0 C;  3D76 A;  1F70 A;  3B86 A;  4PDZ A;  3FIA A;  2LMT A;  1LS8 A;  1CM4 A;  5ER5 A;  2LNK A;  4OV2 A;  2BBN A;  1QX5 B;  4QJ5 B;  4YGD B;  3NHT A;  3LLE A;  3N7H A;  3S0G A;  1BOC A;  1LIN A;  1TUJ A;  1B8C A;  2JTZ A;  5HL1 A;  1A75 B;  1DJW A;  2L2E A;  1LVC D;  1EXR A;  4MN0 A;  1DC1 A;  2MRD A;  3PJI A;  1MUX A;  3AAK A;  1UHK A;  4PE0 A;  3SS5 A;  3LCP C;  1DJH A;  1B9A A;  1QV1 A;  1TWO A;  1QVI Y;  1IQ3 A;  3CZT X;  5CSN A;  3K1E A;  2CCM A;  1YVL A;  2KNE A;  2SCP A;  4GGF C;  2KFF A;  1A29 A;  1NX0 A;  2D8N A;  1S5G Z;  3EK7 A;  2OTG B;  1DQE A;  5CPV A;  1JFJ A;  4C0L A;  4I5J A;  3SG3 A;  1VRK A;  3DZT A;  5AER A;  3JTD C;  2JXC A;  1A2X A;  1S3P A;  2GTE A;  2LV7 A;  1S1E A;  4U8D A;  4GFT A;  5K89 A;  3I5F C;  5DIC A;  1K8U A;  2G9B A;  1GJY A;  1AHR A;  2JU0 A;  2M3W A;  1EL4 A;  2BNX A;  3R1P A;  4TNC A;  1ZOT B;  1XYD A;  3PLF B;  4MZL A;  1RWY A;  4AQI A;  1UHI A;  1OOJ A;  1KSM A;  3HX4 A;  1QS7 A;  1QX2 A;  3KHE A;  1XK4 C;  4D1E A;  1OOG A;  2NXQ A;  1PK0 D;  1DF0 B;  3CZ1 A;  4MVF A;  4DUQ A;  2WC6 A;  3EVU A;  3TS5 C;  2EC6 C;  4KYN A;  2MHH A;  1M31 A;  3S0B A;  1KQV A;  1G4Y R;  3S0A A;  3OB2 B;  1H8B A;  3FWC A;  3SG4 A;  2ZN9 A;  3EG5 B;  1MWN A;  2PSR A;  3PM8 A;  4PHK A;  4XYN A;  1YTZ C;  3M0W A;  3NSL A;  2KYF A;  2I18 A;  1MHO A;  3SJS A;  5IBW A;  1WLZ A;  5FI2 A;  3PM2 A;  3DF0 A;  2JQ6 A;  3A8R A;  3D77 A;  4ORB B;  3DVK A;  2Y1N A;  3CS1 A;  1L2O C;  3L4A A;  1SR6 C;  1NYA A;  2MLE C;  1C7W A;  2BKH B;  3RM1 A;  3QME A;  1WLM A;  1X02 A;  2WC8 A;  3I5H B;  4JKT A;  5FI6 A;  3SG6 A;  1QIV A;  1FI6 A;  1OOI X;  3EVR A;  2GV5 A;  2KAY A;  3CZ2 A;  4HRH A;  1WDC C;  2MLF C;  1C3Y A;  1SL9 A;  1D1O A;  1BOD A;  1PRW A;  1AUI B;  3OX5 A;  1B8L A;  1WY9 A;  3OP0 A;  1RRO A;  1S6J A;  5KTY A; 
#chains in the Genus database with same CATH homology
 1XFY O;  1NX2 A;  1YRU B;  2TN4 A;  2KI6 D;  1W7I B;  3VRQ A;  3TUY B;  4QJ4 B;  1K9U A;  4JWQ A;  4OR9 B;  1QV0 A;  1MXE A;  1K9P A;  5HLO A;  1DJZ A;  1JWD A;  2L50 A;  1NCY A;  1SMG A;  4PE7 A;  1H4B A;  4XJK B;  3BUW B;  2LVI A;  1KFU S;  2LVK A;  2ZRS A;  1SRA A;  1FF1 A;  3VGO A;  1QAT A;  2WCE A;  2JUL A;  1YVH A;  1TCO B;  1A03 A;  1K90 D;  4YGA A;  3D0Y A;  5CSJ A;  3WHT B;  4R1E A;  3OX6 A;  1CDP A;  4DRW A;  5AXI A;  2WCB A;  2K7B A;  2JXL A;  2KFH A;  2A4J A;  1M46 A;  2KAV A;  1QIW A;  2HQ8 A;  5HKW A;  3PAL A;  1F4Q A;  2HET A;  4PCW A;  5AAN A;  3IQO A;  1NX1 A;  4ORA B;  4HRG A;  4YI8 A;  3SG5 A;  2F3Z A;  1KQM B;  1TRF A;  4NQG A;  3PN7 C;  3JTD B;  1EG3 A;  1SCM C;  2PVB A;  5I2L A;  4MZK A;  1DT7 B;  1Y1A A;  1ZFS A;  3AAJ A;  3I5F B;  4WRI A;  2BCX A;  1L7Z A;  3BQ3 A;  1UP5 A;  1V1F A;  3EKJ A;  2KQ6 A;  3TDU A;  2M1K B;  1JUO A;  1NWD A;  2JT0 A;  3I5I C;  4GGF A;  1ODB A;  4ZCU A;  1F55 A;  4WQ3 A;  3K21 A;  3SIA A;  1EJ3 A;  1J7P A;  1A4P A;  1UUR A;  2OS8 C;  1NP8 A;  1HQV A;  4YGE B;  1LA0 A;  2G2B A;  1AVS A;  1IQ5 A;  1UHN A;  1WRL A;  4MLW A;  4I5K A;  2BCA A;  2JT3 A;  1MR8 A;  1NCZ A;  3BUO B;  5D7F A;  3GOF A;  1ZAC A;  1BJF A;  1ZUZ A;  3TS5 B;  1BG1 A;  1BF5 A;  1OZS A;  1Y0V H;  2MAZ A;  1G8I A;  1REC A;  1W7J B;  2AUC A;  3A4U B;  2AAO A;  1AJ4 A;  3O2P A;  1IWQ A;  1QLK A;  2K7C A;  1KFX L;  1NPQ A;  2JOJ A;  1B47 A;  2L51 A;  2FCD A;  1FW4 A;  1XK4 A;  3CGA A;  5JJG A;  3AKA A;  5J3X A;  5CSI A;  1Y1U A;  4PE4 A;  1KWO B;  1WRK A;  3IQQ A;  1AJ5 A;  1SK6 D;  1AP4 A;  1N2D A;  2M9G A;  1YUR A;  2CTN A;  1L2O B;  4USL A;  3BUX B;  1IRJ A;  4HRE E;  1KK8 B;  2KFG A;  3ZNI A;  2COL B;  4Q04 A;  4PHJ A;  2VRG A;  1TOP A;  5JOL A;  3HCM A;  2KGB C;  3JVT B;  4ICB A;  4PE1 A;  4PHN A;  2KBM A;  3KF9 A;  1IJ5 A;  2CBL A;  1M45 A;  1MQ1 A;  5ER4 X;  1M39 A;  4L9M A;  1TIZ A;  2EGD A;  3GK4 X;  1KK7 Y;  1KCY A;  3DF0 B;  5B8I B;  1KSO A;  3I5G C;  1QTX A;  1PVA A;  2KYC A;  2HPS A;  2O60 A;  2FOT A;  1TCF A;  3PFV A;  2B1U A;  1DJG A;  2Q4U A;  3CTN A;  1MF8 B;  4MSP A;  5DKQ A;  5PAL A;  3LK0 A;  2KBI A;  3CWG A;  2JC2 A;  2HF5 A;  2K61 A;  1CFF A;  1JSA A;  2PAL A;  1S5G Y;  1DJY A;  4GBA A;  4P2Y B;  1HT9 A;  3DVM A;  1SCV A;  4I5N B;  5HYD A;  1G33 A;  1LKJ A;  2M49 B;  3VRR A;  1CLB A;  1J55 A;  1SL7 A;  1CDL A;  1XFX O;  1K95 A;  2CNP A;  2LLT A;  3KO0 A;  2K8M B;  1LA3 A;  2IS9 A;  1IKU A;  1GQM A;  4CPV A;  2LVJ A;  2LP2 A;  4JQ0 D;  2I7A A;  2BBM A;  2ZNE A;  1QLS A;  5AEQ A;  1UHJ A;  2KI6 C;  4PAL A;  1CLM A;  1RK9 A;  2BEC A;  4GUK A;  2RGI A;  1CFP A;  5GQQ C;  1NSH A;  2K2A A;  3DVE A;  1SCM B;  3NXA A;  2F2O A;  3NSK A;  4N1F A;  2KI4 C;  1B1G A;  4CLN A;  2BL0 B;  3EKH A;  3SG2 A;  5HLV A;  1F71 A;  3CR4 X;  1N0Y A;  2LE9 B;  1WRZ A;  3ZWH A;  1SW8 A;  1NIW A;  4AQJ A;  2PRU A;  5KSZ A;  1CTR A;  1R2U A;  2LVV A;  1BMO A;  1GGW A;  1B7T Z;  4OCI A;  2L98 A;  2M1U A;  1IH0 A;  1BT6 A;  4C0K A;  1FBV A;  4A4C A;  4DCK A;  2KQY A;  1J1E A;  2OS8 B;  5KU1 A;  4PHM A;  4NDD A;  2PAS A;  1DTL A;  1XFW O;  3DD4 A;  2O5G A;  1M63 B;  2ZND A;  4FQO A;  1OMD A;  2AMI A;  4GAO A;  2KOT A;  4MEW A;  1XFV O;  2BE4 A;  4UPG A;  2WND A;  1OZO A;  2ZN8 A;  4ORC B;  2LLS A;  3GK2 A;  4BY4 A;  1CNP A;  2Y4Q A;  3DVJ A;  2LHL A;  5TNC A;  1YRT B;  2NZ0 A;  1J7O A;  1CFC A;  3VRO A;  2JPT A;  1NUB A;  1ZMZ A;  1C7V A;  3TDI A;  4GGN A;  1CKK A;  5I8N A;  1SY9 A;  4P5O E;  4YI9 A;  2KGR A;  4DIR A;  4HSZ A;  3WHU B;  2WCF A;  3PSR A;  1JC2 A;  2BKI B;  1B4C A;  1CDN A;  1QVI Z;  1BLQ A;  4C0J A;  1DJI A;  2WOR A;  2WOS A;  3ICB A;  1SPY A;  1R6P A;  2LM5 A;  4YGC B;  1J1D A;  4JPZ B;  3O4Y A;  2F33 A;  2ZFD A;  4DS7 A;  4F0Z B;  1BU3 A;  1DJX A;  3KEV A;  2LCP A;  3CR5 X;  3H4S E;  5G08 A;  5BPJ A;  1IGV A;  2QPT A;  1J7Q A;  3OHM B;  4N1G A;  1SL8 A;  2SAS A;  1E8A A;  1TN4 A;  2EC6 B;  3FWB A;  2MBX A;  1PUL A;  1YUU A;  1QAS A;  1SBJ A;  4NDC A;  3BOW A;  3TUY C;  1F54 A;  1F8H A;  3O78 A;  1CFD A;  1U5I A;  2LC5 A;  2L0P A;  1SNL A;  2F2P A;  3BUM B;  2PMY A;  1K96 A;  1BR1 B;  4MRY A;  1CMG A;  4M2O A;  2E6W A;  1N65 A;  1LXF C;  2KHN A;  1FPW A;  1XFU O;  4GPL B;  1KK7 Z;  1K9K A;  2LUX A;  3BXK A;  1DMO A;  1CMF A;  4GNK B;  1AK8 A;  1SYM A;  2JRF A;  1TNW A;  4OVN F;  3LL8 B;  1SR6 B;  1RJV A;  3TZ1 A;  2V53 A;  2QAC A;  2LMV A;  1ALW A;  1OMR A;  4YGB B;  1C07 A;  2ZKM X;  1K2H A;  3O6B A;  1WDC B;  1OE9 B;  1KQM C;  1A75 A;  1S6C A;  1JFK A;  1GGZ A;  2BCB A;  1YUS A;  2K7D A;  2H2K A;  2NLN A;  2MA2 A;  3NSO A;  2JWW A;  3VRN A;  2OPO A;  5HKZ A;  2K2F A;  1UHH A;  2KI4 B;  1XFZ O;  1KFU L;  4M2Q A;  2KSP A;  2M7N A;  2LUC A;  2P6B B;  2KAX A;  1PSB A;  4NDB A;  2L4I A;  2R2I A;  1QX7 A;  1F4O A;  1UUS A;  1JF2 A;  1YUT A;  3CR2 A;  3EK8 A;  2LAN A;  2FCE A;  3AKB A;  2I2R E;  2L4H A;  3NSI A;  3RLZ A;  2F8P A;  2Y1M A;  2JT8 A;  2M29 A;  1JBA A;  2FJU B;  4M2P A;  2I94 A;  1CM1 A;  2K0J A;  1ALV A;  2L5X B;  4ZCV A;  2GGZ A;  1TTX A;  1QXP A;  4ETO A;  4AOM A;  1IJ6 A;  2ZRT A;  2M7L A;  2NCP A;  1YR5 A;  2OTG C;  1XVJ A;  5F6T A;  3KPX A;  1IG5 A;  1NX3 A;  3PN7 B;  1Y6W A;  1XA5 A;  4YRU A;  4MBE A;  3D0Y B;  4E68 A;  1DF0 A;  5HKY A;  3BUN B;  1KWO C;  1J7R A;  1JF0 A;  1KFX S;  1CB1 A;  5FYX A;  1YX7 A;  1KK8 C;  1TNQ A;  3I5I B;  4YBH B;  3PAT A;  4QJ3 B;  3JVT C;  5DKR A;  1Y1X A;  1K93 D;  1QJT A;  5CSF A;  1DVI A;  3LK1 A;  2LMU A;  2ISD A;  4A4B A;  3OB1 B;  1RFJ A;  2BE6 A;  1UWO A;  3D10 A;  3IF7 A;  5I2Q A;  3SG7 A;  2JTT A;  1RTP 1;  1V1G A;  2GGM A;  5DKN A;  1EG4 A;  5I2O A;  2LHI A;  1OQP A;  2M8U A;  3C1V A;  1NCX A;  4CFQ A;  3WNX B;  1DGU A;  1MXL C;  1OMV A;  1YX8 A;  2H61 A;  2MJW B;  1PAL A;  2E30 A;  4I5L B;  2HQW A;  4OKH A;  2DOQ A;  1CDM A;  1SKT A;  2JNF A;  2K7O A;  1B8R A;  4MRX A;  5AFP A;  3TDZ A;  1S6I A;  1BR4 B;  3MSE B;  2JNX A;  1Q80 A;  2Y5I A;  2Q91 A;  4CFR A;  4N5X A;  3SIB A;  3CLN A;  2LLU A;  4WQ2 A;  3GK1 A;  4MZJ A;  1TNP A;  2F3Y A;  3WXA A;  3QRX A;  3BYA A;  3BOW B;  2EHB A;  1FI5 A;  2H61 C;  1U5I B;  3I5H C;  4BY5 A;  2M97 A;  1K94 A;  1XO5 A;  1S36 A;  3EK4 A;  4XJK A;  5D69 A;  1DGV A;  3F45 A;  1PVB A;  4IL1 A;  1OSA A;  1EH2 A;  4CID A;  1B7T Y;  2JZI A;  1PSR A;  1TNX A;  2LP3 A;  2M0R A;  3E3R A;  3VRP A;  1CLL A;  2CXJ A;  2NCO A;  4FTG A;  2KDH A;  3EVV A;  2CT9 A;  3I5G B;  2LAP A;  3FS7 A;  1S26 D;  2BL0 C;  1F70 A;  4PDZ A;  3FIA A;  2LMT A;  1CM4 A;  5ER5 A;  2LNK A;  4OV2 A;  2BBN A;  1QX5 B;  4QJ5 B;  4YGD B;  3LLE A;  1BOC A;  1LIN A;  1B8C A;  2JTZ A;  1A75 B;  1DJW A;  2L2E A;  1LVC D;  1EXR A;  4MN0 A;  2MRD A;  1MUX A;  3AAK A;  1UHK A;  4PE0 A;  3LCP C;  1DJH A;  1B9A A;  1QV1 A;  1QVI Y;  1IQ3 A;  3CZT X;  5CSN A;  2CCM A;  1YVL A;  2KNE A;  2SCP A;  4GGF C;  2KFF A;  1A29 A;  1NX0 A;  2D8N A;  1S5G Z;  3EK7 A;  2OTG B;  5CPV A;  1JFJ A;  4C0L A;  4I5J A;  3SG3 A;  1VRK A;  5AER A;  3JTD C;  2JXC A;  1A2X A;  1S3P A;  2LV7 A;  4U8D A;  1S1E A;  4GFT A;  5K89 A;  3I5F C;  1K8U A;  2G9B A;  1GJY A;  1AHR A;  2JU0 A;  2M3W A;  1EL4 A;  4TNC A;  1ZOT B;  1XYD A;  3PLF B;  4MZL A;  1RWY A;  4AQI A;  1UHI A;  1OOJ A;  1KSM A;  3HX4 A;  1QS7 A;  1QX2 A;  3KHE A;  1XK4 C;  4D1E A;  2NXQ A;  1PK0 D;  1DF0 B;  4MVF A;  4DUQ A;  3EVU A;  3TS5 C;  2EC6 C;  2MHH A;  1M31 A;  1KQV A;  1G4Y R;  3OB2 B;  1H8B A;  3FWC A;  3SG4 A;  2ZN9 A;  1MWN A;  2PSR A;  3PM8 A;  4PHK A;  4XYN A;  1YTZ C;  3M0W A;  3NSL A;  2KYF A;  2I18 A;  1MHO A;  3SJS A;  5IBW A;  1WLZ A;  3DF0 A;  2JQ6 A;  3A8R A;  4ORB B;  3DVK A;  2Y1N A;  3CS1 A;  1L2O C;  1SR6 C;  1NYA A;  2MLE C;  2BKH B;  1C7W A;  3RM1 A;  1WLM A;  1X02 A;  2WC8 A;  3I5H B;  3SG6 A;  1QIV A;  1FI6 A;  3EVR A;  2GV5 A;  2KAY A;  4HRH A;  1WDC C;  2MLF C;  1SL9 A;  1D1O A;  1BOD A;  1PRW A;  1AUI B;  3OX5 A;  1B8L A;  1WY9 A;  3OP0 A;  1RRO A;  1S6J A;  5KTY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...