1KSMA

Average nmr solution structure of ca ln calbindin d9k
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
75
structure length
75
Chain Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGMSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords VITAMIN D-DEPENDENT CALCIUM-BINDING PROTEIN
publication title Paramagnetism-based versus classical constraints: an analysis of the solution structure of Ca Ln calbindin D9k.
pubmed doi rcsb
source organism Bos taurus
total genus 19
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2002-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ksmA00
1FF1A 3A8RA 3LL8B 3TDIA 3BUNB 1KK7Y 2OPOA 3LCPC 3CWGA 1TNQA 2BE4A 2F33A 1SCMC 2KQYA 1EJ3A 2JT0A 1J1DA 4PCWA 1B8LA 1MF8B 3WNXB 1B9AA 3D0YB 5CSNA 1DJGA 5HKWA 2WORA 4L9MA 2OS8B 1KQMB 1WLMA 1BG1A 1AJ4A 4DUQA 1UWOA 4GBAA 4XJKB 1SY9A 1SR6C 1IGVA 1FI6A 1EG4A 2A4JA 2BCAA 2FOTA 1DJWA 3OHMB 2MLFC 1YVLA 2V53A 1A03A 2BL0B 2LVKA 2OS8C 3DF0B 1W7JB 1KK8C 4QJ5B 1UHIA 1MXLC 2H2KA 2LUXA 2LLSA 2PSRA 2KFHA 1KWOC 1S6IA 2NCOA 1KSOA 2KI6D 2L4IA 3WHTB 2G2BA 4N1GA 1C7WA 1QXPA 1OOJA 3KO0A 1MR8A 2L50A 3FS7A 3DVMA 3HCMA 1KCYA 5GQQC 1LA3A 2H61C 1BR4B 1UHKA 2LVJA 1KFXL 1ZOTB 2BCBA 1B8CA 2L51A 1YX7A 3SG7A 4NDDA 1Y0VH 5TNCA 1SL7A 1J7OA 3ZWHA 2GGMA 3BYAA 4HRHA 2BBMA 1C7VA 5I2OA 1NCXA 5DKRA 3SG5A 2F3ZA 3TS5B 1RJVA 4PE1A 1QIVA 3D0YA 2WCBA 4OCIA 1IWQA 1F70A 2TN4A 2JRFA 2M8UA 4CIDA 2F2PA 1UURA 4XJKA 1XFYO 2L0PA 3PFVA 1ODBA 3NXAA 1G4YR 4M2QA 3PSRA 3RM1A 4GGFC 4PHKA 4BY4A 1S5GY 1UHHA 3DF0A 2H61A 2Y4QA 3I5GB 4NDCA 1MUXA 1CLMA 1J1EA 1F54A 3CGAA 1CM4A 1AJ5A 1S26D 1FPWA 1N65A 3SG6A 1XFXO 1NX1A 3GOFA 1OQPA 4M2PA 4YBHB 3OX6A 5HKZA 1XYDA 3PN7B 4JPZB 2MLEC 4MRYA 1DJHA 1SNLA 1QLKA 1PULA 1A4PA 2ZKMX 4GFTA 2RGIA 1L7ZA 4PHJA 1K90D 1B8RA 3GK4X 3PN7C 5CSJA 1DF0A 2O5GA 3CTNA 1WY9A 3EKJA 1QIWA 3SG3A 2I7AA 4U8DA 1W7IB 4GGFA 2LHLA 1LKJA 3VROA 4QJ3B 3I5IB 2IS9A 1H8BA 2HF5A 4PHMA 1JUOA 3O2PA 1KQVA 3BOWB 3O4YA 2WOSA 1PVAA 2KOTA 4CLNA 5D7FA 1K9KA 1BOCA 3I5FC 1WDCB 2LLTA 5I2QA 1IQ5A 2CT9A 1QX5B 1MHOA 2VRGA 3OB1B 1AP4A 5PALA 4ORBB 2KAXA 1XVJA 2WNDA 2M3WA 1QVIZ 1RK9A 3AKBA 1PALA 1EH2A 1GJYA 1OMVA 2JTZA 2AAOA 2Q4UA 2KI4C 3AAJA 3H4SE 3VGOA 1PVBA 3IF7A 4MEWA 1YR5A 1EXRA 2PRUA 4N5XA 3SJSA 4C0LA 1OMRA 2JNXA 3LLEA 2BKIB 1CNPA 2KBIA 1XA5A 1HQVA 4GUKA 3C1VA 2BKHB 4PALA 1ZUZA 4IL1A 3TUYC 3SIBA 1WRKA 1J7QA 4WRIA 1QX7A 3DVJA 1S6JA 1XFVO 1YUSA 3PM8A 2F3YA 1OZSA 3BOWA 1S1EA 3VRPA 1SR6B 3KPXA 2JQ6A 1DT7B 2COLB 5B8IB 4DRWA 3BXKA 4YGDB 4E68A 1B7TY 2BECA 4MRXA 1CMGA 3WXAA 1KK8B 2MJWB 2L4HA 1KWOB 4HREE 2PVBA 1QVIY 2E30A 2HQ8A 5G08A 3NSKA 5I8NA 1SKTA 1EG3A 1CDLA 4YGCB 5AEQA 2I2RE 1CLLA 4NDBA 1S5GZ 1SRAA 4AOMA 1XFUO 2ZNEA 3AKAA 2NCPA 1G33A 2KGBC 5FYXA 2JXLA 4D1EA 1NCYA 2JTTA 2LANA 3KHEA 1QX2A 1WRLA 3VRNA 4DIRA 2K8MB 2BCXA 3JTDC 1MQ1A 2G9BA 5HLOA 3JVTC 1D1OA 1QLSA 4NQGA 1TOPA 2JULA 5KTYA 4PE7A 3FIAA 2LCPA 1GGZA 2KQ6A 2M9GA 2ZN9A 1NX0A 3FWBA 1M31A 1A29A 4TNCA 1SK6D 1ALVA 1DF0B 1DJXA 1MWNA 3E3RA 1NWDA 2Q91A 5F6TA 1GQMA 3ICBA 4WQ2A 2LP2A 4OV2A 1RFJA 1H4BA 2NLNA 3O78A 3LK1A 5KU1A 1J7RA 3BUWB 1IJ6A 1CFPA 5KSZA 4PHNA 2O60A 4MSPA 4YGEB 3CR4X 1LVCD 1CB1A 2NXQA 1DJZA 1HT9A 1V1GA 5HYDA 1G8IA 2KFFA 4GGNA 1TNPA 1Y1AA 2MRDA 4P2YB 1TN4A 1X02A 1TNXA 3KF9A 3M0WA 1MXEA 1CM1A 1YX8A 1FBVA 1F4QA 4USLA 4OVNF 5AFPA 1JWDA 2HPSA 3CS1A 1YRUB 2KSPA 1CFFA 1LA0A 1KFXS 3BUOB 2QACA 2ISDA 1PSRA 2CXJA 2EGDA 2CNPA 1K2HA 4A4BA 2LMTA 3BUXB 4F0ZB 2KDHA 1K95A 3CLNA 1S36A 1DGVA 3TZ1A 1QATA 1BJFA 3SG2A 4BY5A 3I5FB 5HKYA 1BMOA 3HX4A 2KI6C 2LE9B 2ZN8A 3AAKA 4YI9A 3CR2A 4ETOA 1E8AA 1C07A 1TCFA 1ZMZA 1NSHA 1L2OC 5AANA 1AK8A 1IQ3A 4I5LB 1RTP1 3I5HC 1ALWA 1M63B 4MN0A 1OZOA 3EK7A 2KAVA 3EK8A 3IQOA 3CR5X 1LXFC 1B7TZ 2JOJA 2ZNDA 4OR9B 2KI4B 1IG5A 2M0RA 1Y6WA 1K93D 2MAZA 5AERA 1CDMA 1AHRA 2LHIA 1IJ5A 1A75B 3PALA 4ICBA 1CDNA 2JPTA 1KFUL 2P6BB 1F4OA 3O6BA 2WCFA 1YVHA 1CDPA 3EVVA 1YURA 3QRXA 3TUYB 3DVKA 1OMDA 3GK2A 1JC2A 3PLFB 2KYFA 2K7CA 1KSMA 2JXCA 1Q80A 2KNEA 3EVUA 3NSIA 2NZ0A 1QJTA 1UP5A 1TTXA 1PK0D 3FWCA 1B4CA 1NX3A 2CBLA 2LNKA 5HLVA 2FCEA 4MVFA 4ZCUA 2WCEA 4DCKA 2L5XB 4ORCB 3SIAA 3VRRA 4JWQA 4I5KA 1LINA 4P5OE 3D10A 1JBAA 4MBEA 1UHJA 1N2DA 3EKHA 1SBJA 4FTGA 1SYMA 1UHNA 3TDUA 1QV0A 1CKKA 1RECA 2KBMA 5I2LA 2BE6A 4AQJA 4GPLB 1A75A 2OTGC 1XO5A 3SG4A 2ZFDA 1NYAA 1K9UA 3EK4A 2E6WA 2K7OA 1CFCA 1XFZO 2L98A 3JTDB 1A2XA 2M97A 3K21A 1WRZA 3JVTB 1IH0A 1FW4A 3WHUB 3F45A 5DKQA 4FQOA 4GAOA 1XFWO 2M29A 1YUUA 2JZIA 1CLBA 2HETA 2F8PA 2ZRTA 1DJYA 3ZNIA 1K94A 1RWYA 2LM5A 2D8NA 2LVIA 1F8HA 4YGAA 3NSLA 2JNFA 3PATA 2KAYA 1BR1B 1Y1XA 2MHHA 3DVEA 1NPQA 1SPYA 1N0YA 1BF5A 1SL8A 5BPJA 1KQMC 1AUIB 2K0JA 1U5IB 3A4UB 2MBXA 2SASA 1GGWA 5IBWA 4YGBB 1WLZA 1SMGA 2LLUA 1BT6A 5JOLA 2BL0C 1QASA 4YRUA 1DMOA 4I5NB 2KHNA 2EC6B 2PMYA 5JJGA 2GV5A 2KFGA 2AMIA 1SCVA 2LV7A 2K2AA 3RLZA 1JFJA 1JF0A 2I94A 5AXIA 1OSAA 5CSFA 2JT3A 2M7NA 1UUSA 2Y1NA 3OX5A 4JQ0D 4M2OA 2EC6C 2CCMA 5ER5A 4C0KA 2R2IA 1ZFSA 1VRKA 4AQIA 1TCOB 1SL9A 1CMFA 1M39A 3OB2B 1J7PA 4HRGA 2EHBA 3MSEB 4PE0A 2JT8A 3TS5C 1IKUA 1BODA 2LUCA 1PSBA 4MZKA 5J3XA 1L2OB 2BBNA 1ZACA 2CTNA 1R2UA 2PALA 3DD4A 3I5HB 4YI8A 4ZCVA 1JSAA 1U5IA 1XK4C 4QJ4B 1NUBA 3CZTX 1NIWA 4XYNA 4MZLA 5CSIA 3VRQA 2HQWA 4I5JA 1NX2A 1B47A 2K61A 4MLWA 2LAPA 3OP0A 3GK1A 3I5GC 4CPVA 2Y5IA 2PASA 4DS7A 3BQ3A 2KGRA 2LMUA 1M46A 1JFKA 5K89A 1DTLA 2LP3A 1J55A 1QS7A 2FJUB 2JC2A 4MZJA 1K8UA 4ORAB 4UPGA 2L2EA 2ZRSA 4PE4A 1YUTA 1CTRA 2FCDA 4R1EA 2MA2A 1TRFA 2B1UA 2I18A 2K7DA 3EVRA 2M1KB 1KK7Z 2KYCA 1F55A 1SW8A 2QPTA 1S6CA 2AUCA 2K2FA 5ER4X 1YTZC 1QV1A 1BLQA 1K96A 1XK4A 1JF2A 1CFDA 2M49B 4GNKB 5CPVA 2DOQA 2M1UA 1B1GA 4Q04A 1BU3A 3TDZA 3I5IC 3BUMB 1YRTB 1K9PA 1EL4A 1PRWA 1FI5A 1OE9B 1V1FA 2GGZA 3NSOA 4HSZA 4PDZA 5D69A 3LK0A 2Y1MA 4OKHA 1RROA 1S3PA 1WDCC 3IQQA 1AVSA 2M7LA 4A4CA 1NCZA 1M45A 2LC5A 4C0JA 1R6PA 1Y1UA 4CFQA 1IRJA 2OTGB 4WQ3A 4N1FA 2F2OA 2LVVA 3KEVA 1QTXA 5DKNA 2WC8A 2LMVA 1DGUA 1TNWA 1SCMB 4CFRA 1F71A 2JWWA 1KFUS 1DJIA 2JU0A 2K7BA 2SCPA 1TIZA 1DVIA 1NP8A
chains in the Genus database with same CATH superfamily
1FF1A 3A8RA 3LL8B 3TDIA 2QDIA 3BUNB 1KK7Y 2OPOA 3LCPC 3CWGA 1TNQA 2BE4A 5D3OA 2F33A 1SCMC 1IIOA 2KQYA 1EJ3A 2JT0A 3OBVA 1J1DA 4PCWA 1B8LA 1MF8B 3WNXB 1B9AA 3D0YB 5CSNA 1DJGA 5HKWA 2WORA 2QEBA 4L9MA 2OS8B 3R1VA 1KQMB 1WLMA 1BG1A 1AJ4A 4DUQA 1UWOA 4GBAA 2JPOA 1SY9A 1SR6C 1IGVA 3N7HA 4XJKB 3V2LA 1EG4A 2A4JA 2BCAA 2FOTA 1DJWA 3OHMB 2KLDA 1OOHA 2MLFC 1YVLA 2V53A 2P70A 1A03A 1TUZA 2BL0B 2LVKA 2OS8C 3DF0B 1W7JB 1KK8C 4QJ5B 1UHIA 1MXLC 2H2KA 2LUXA 2LLSA 2PSRA 2KFHA 1KWOC 5FI6A 1S6IA 2NCOA 1KSOA 2KI6D 2L4IA 3WHTB 2G2BA 4N1GA 1C7WA 1QXPA 1OOJA 3KO0A 1MR8A 2L50A 3FS7A 3L4AA 3DVMA 3HCMA 3S0AA 1KCYA 5GQQC 1LA3A 2H61C 1BR4B 1UHKA 2LVJA 1KFXL 1ZOTB 2BCBA 1B8CA 2L51A 1YX7A 1Z4HA 3SG7A 4NDDA 1Y0VH 5TNCA 1SL7A 1J7OA 3ZWHA 2GGMA 2L5YA 3BYAA 4HRHA 2BBMA 1C7VA 5I2OA 1NCXA 3R1PA 5DKRA 3SG5A 1ORGA 2F3ZA 1RJVA 3EG5B 3B88A 3TS5B 4PE1A 1QIVA 3D0YA 3FE6A 2WCBA 1FI6A 4OCIA 1IWQA 1F70A 2TN4A 2JRFA 2M8UA 2WCMA 4CIDA 2F2PA 1UURA 4XJKA 1P28A 1XFYO 2L0PA 3PFVA 1ODBA 3NXAA 1G4YR 4M2QA 3PSRA 3RM1A 4GGFC 4PHKA 4BY4A 5HL1A 1S5GY 1UHHA 3DF0A 2H61A 2Y4QA 2PYQA 3I5GB 4NDCA 1MUXA 2PQLA 1CLMA 1J1EA 1F54A 3CGAA 4FQTA 1CM4A 1AJ5A 1DEKA 1S26D 1FPWA 1N65A 3RZSA 3SG6A 1XFXO 1NX1A 3GOFA 1OQPA 4M2PA 4YBHB 3OX6A 5HKZA 1XYDA 3PN7B 2K60A 1OOIX 4JPZB 2MLEC 4MRYA 1DJHA 1OOGA 1SNLA 1QLKA 1PULA 1A4PA 2ZKMX 4GFTA 2RGIA 1L7ZA 4PHJA 1K90D 1B8RA 3GK4X 3PN7C 5CSJA 1DF0A 2O5GA 3CTNA 1WY9A 3EKJA 3CDNA 1QIWA 3SG3A 2I7AA 2WCKA 1W7IB 4U8DA 4GGFA 2LHLA 1LKJA 3VROA 4QJ3B 3I5IB 2IS9A 1H8BA 2HF5A 4PHMA 1JUOA 3O2PA 1KQVA 3BOWB 3O4YA 5DICA 2WOSA 1PVAA 2KOTA 2WCHA 5D7FA 1K9KA 3NHIA 4CLNA 3I5FC 1BOCA 1WDCB 2LLTA 5I2QA 1IQ5A 2CT9A 2KPHA 1QX5B 1MHOA 2VRGA 3OB1B 1AP4A 5PALA 3L47A 4ORBB 2GTEA 2KAXA 1XVJA 2WNDA 2M3WA 1QVIZ 1RK9A 3AKBA 1XFRA 1PALA 1EH2A 1GJYA 1OMVA 2JTZA 3CZ1A 3UO9A 2AAOA 2Q4UA 2KI4C 3AAJA 3H4SE 3VGOA 1PVBA 3IF7A 1T14A 4MEWA 2QEOA 1YR5A 1EXRA 2PRUA 3BFBA 4N5XA 3SJSA 4C0LA 1OMRA 2JNXA 3LLEA 2BKIB 1CNPA 2KBIA 1XA5A 1HQVA 1TUJA 4GUKA 3C1VA 2BKHB 4PALA 1ZUZA 4IL1A 3TUYC 3SIBA 1WRKA 3OGNA 1J7QA 4WRIA 1QX7A 3DVJA 1S6JA 1XFVO 5I94A 1YUSA 3PM8A 2F3YA 1OZSA 1QWVA 3BOWA 2QEHA 1S1EA 3VRPA 1SR6B 3KPXA 1OW4A 2JQ6A 1DT7B 2COLB 5B8IB 3CYZA 3B6XA 3BXKA 4YGDB 4DRWA 4E68A 1B7TY 3DXLA 2BECA 4MRXA 1CMGA 3WXAA 1KK8B 2MJWB 2L4HA 1KWOB 4HREE 2PVBA 1QVIY 2E30A 2HQ8A 5G08A 2H8VA 3O4XA 3NSKA 5I8NA 1SKTA 3B86A 1EG3A 1CDLA 4YGCB 5AEQA 3B87A 2I2RE 1CLLA 4NDBA 1S5GZ 1SRAA 3SS5A 4AOMA 1XFUO 2ZNEA 3AKAA 2NCPA 3CZ2A 1G33A 2KGBC 5FYXA 2JXLA 4D1EA 1NCYA 2JTTA 2LANA 3KHEA 1QX2A 4F7FA 4IJ7A 1WRLA 3VRNA 4DIRA 4JD9A 2K8MB 2BCXA 3BJHA 3D74A 3JTDC 1C3ZA 1MQ1A 2G9BA 5HLOA 3JVTC 1D1OA 3FE8A 1QLSA 4NQGA 1TOPA 2JULA 5KTYA 4PE7A 3BFAA 3FIAA 2LCPA 1GGZA 2KQ6A 2M9GA 2ZN9A 1NX0A 3FWBA 3SS3A 1M31A 2ERBA 1A29A 4TNCA 1SK6D 1ALVA 1DF0B 1DJXA 1MWNA 3E3RA 1NWDA 2Q91A 5F6TA 1GQMA 3ICBA 4WQ2A 2LP2A 4OV2A 1RFJA 1H4BA 2NLNA 3O78A 2QEVA 3LK1A 5KU1A 1J7RA 3BUWB 1IJ6A 1CFPA 2P71A 3D78A 4PHNA 5KSZA 2O60A 3CABA 4MSPA 4YGEB 3CR4X 1LVCD 1CB1A 2NXQA 1DJZA 1HT9A 1V1GA 5HYDA 1G8IA 2KFFA 4GGNA 1TNPA 1Y1AA 2MRDA 4P2YB 5FI2A 1TN4A 1X02A 1TNXA 3KF9A 3M0WA 1MXEA 1CM1A 1YX8A 1FBVA 1F4QA 4USLA 4OVNF 5AFPA 1JWDA 2HPSA 3CS1A 1YRUB 3L4LA 2KSPA 1CFFA 1LA0A 1KFXS 3BUOB 3SS4A 2QACA 3PM2A 2ISDA 1PSRA 2CXJA 2EGDA 1W9ZA 2CNPA 1K2HA 2WC5A 4A4BA 1C3YA 2LMTA 3BUXB 4F0ZB 2KDHA 2WCLA 1K95A 3CLNA 1S36A 1DGVA 3TZ1A 1QATA 1BJFA 3SG2A 4BY5A 3I5FB 5HKYA 1BMOA 3HX4A 2KI6C 3R72A 2LE9B 2ZN8A 3AAKA 4YI9A 3CR2A 4ETOA 1E8AA 3D77A 1TCFA 1C07A 1ZMZA 1NSHA 1L2OC 5AANA 1AK8A 1IQ3A 4I5LB 1RTP1 3I5HC 1ALWA 1M63B 4MN0A 1OZOA 3EK7A 2KAVA 3EK8A 3IQOA 3CR5X 1LXFC 1B7TZ 2JOJA 2ZNDA 4OR9B 2KI4B 3FE9A 1IG5A 1F8HA 2M0RA 1Y6WA 1K93D 2MAZA 5AERA 1CDMA 1AHRA 2LHIA 1IJ5A 1A75B 3PALA 4ICBA 1CDNA 2JPTA 1KFUL 1DELA 2P6BB 1F4OA 3O6BA 2WCFA 1YVHA 1CDPA 3EVVA 1YURA 3QRXA 3TUYB 4PT1A 3DVKA 1OMDA 3GK2A 3PJIA 1JC2A 3PLFB 2KYFA 3NGVA 2K7CA 1KSMA 2JXCA 4JKTA 1Q80A 2KNEA 4INWA 3EVUA 3NSIA 2NZ0A 1QJTA 1UP5A 1TTXA 1PK0D 3FWCA 1B4CA 1NX3A 2CBLA 2LNKA 5HLVA 2FCEA 4MVFA 4ZCUA 2WCEA 4DCKA 2L5XB 4ORCB 3SIAA 3VRRA 4JWQA 4I5KA 4KYNA 1LINA 1DQEA 4P5OE 3D10A 1JBAA 4MBEA 1UHJA 4INXA 1N2DA 3EKHA 1SBJA 4FTGA 1SYMA 1UHNA 3TDUA 1QV0A 3VB1A 1CKKA 1RECA 2KBMA 5I2LA 2BE6A 4AQJA 4GPLB 1A75A 3Q8IA 2OTGC 1XO5A 3SG4A 2ZFDA 1NYAA 1K9UA 3EK4A 2E6WA 2L2CA 2K7OA 1CFCA 1XFZO 2L98A 3JTDB 1A2XA 2M97A 3K21A 1WRZA 3JVTB 3DZTA 3NHTA 1IH0A 1FW4A 3WHUB 3F45A 5DKQA 4FQOA 3S0BA 4GAOA 1XFWO 3S0FA 2M29A 1YUUA 2JZIA 1CLBA 2HETA 2F8PA 2ZRTA 1DJYA 3ZNIA 1K94A 1RWYA 2LM5A 2D8NA 2LVIA 1LS8A 4YGAA 3NSLA 2JNFA 3PATA 2KAYA 1BR1B 1Y1XA 2MHHA 3DVEA 1DC1A 1NPQA 1SPYA 1N0YA 1BF5A 1SL8A 5BPJA 1KQMC 1AUIB 5FI7A 2K0JA 1SSEB 1U5IB 3A4UB 2MBXA 2SASA 1GGWA 5IBWA 4YGBB 1WLZA 3D76A 1SMGA 2LLUA 1BT6A 5JOLA 2BL0C 1QASA 4YRUA 1DMOA 4I5NB 2KHNA 3DYEA 2EC6B 2PMYA 5JJGA 2GV5A 2KFGA 2AMIA 1SCVA 2LV7A 2K2AA 3RLZA 1JFJA 1JF0A 2I94A 2WCJA 5AXIA 1OSAA 2FJYA 5CSFA 2JT3A 2M7NA 1UUSA 3D75A 2Y1NA 3OX5A 4JQ0D 4M2OA 2EC6C 2WC6A 2CCMA 5ER5A 4C0KA 2R2IA 1ZFSA 1VRKA 4AQIA 1TCOB 1SL9A 1CMFA 1M39A 3OB2B 1J7PA 4HRGA 2EHBA 3MSEB 4PE0A 2JT8A 3TS5C 1IKUA 1BODA 2LUCA 1PSBA 4MZKA 5J3XA 1L2OB 2BBNA 1ZACA 2CTNA 1R2UA 2PALA 3DD4A 3I5HB 4YI8A 4ZCVA 1JSAA 3IVTA 1U5IA 1XK4C 4QJ4B 1NUBA 3CZTX 3S0EA 1NIWA 1TWOA 4XYNA 4MZLA 5CSIA 3VRQA 2HQWA 4I5JA 1NX2A 3DY9A 1B47A 2K61A 4MLWA 4OZDA 2LAPA 3OP0A 2KLEA 3UNWA 3GK1A 3I5GC 4CPVA 2Y5IA 3CZ0A 2PASA 4DS7A 3BQ3A 2KGRA 2LMUA 1M46A 1JFKA 3K1EA 5K89A 1DTLA 2LP3A 1J55A 1QS7A 2FJUB 2JC2A 2YGUA 1K8UA 4MZJA 4ORAB 3S0DA 4UPGA 2L2EA 2ZRSA 2BAPA 3BFHA 4PE4A 1YUTA 1CTRA 2FCDA 4R1EA 2MA2A 1TRFA 2B1UA 2I18A 2K7DA 3EVRA 1OOFA 2M1KB 3D73A 1KK7Z 2KYCA 3B7AA 1SW8A 1F55A 2QPTA 1S6CA 2AUCA 2K2FA 5ER4X 1YTZC 1QV1A 1BLQA 1K96A 1XK4A 1JF2A 1CFDA 2M49B 4GNKB 5CPVA 3S0GA 2DOQA 2M1UA 1Z2CB 1B1GA 4Q04A 1BU3A 3TDZA 3I5IC 3BUMB 1YRTB 1K9PA 1EL4A 1PRWA 1FI5A 1OE9B 1V1FA 2GGZA 3NSOA 4HSZA 4PDZA 5D69A 3LK0A 2Y1MA 4OKHA 1RROA 1S3PA 1WDCC 3IQQA 1AVSA 2M7LA 4A4CA 1NCZA 3R1OA 1M45A 2LC5A 4C0JA 1GM0A 1R6PA 1Y1UA 3QMEA 5EL2A 4CFQA 1IRJA 2OTGB 4WQ3A 2BNXA 4N1FA 2F2OA 2LVVA 3KEVA 1QTXA 5DKNA 2WC8A 2LMVA 1DGUA 1TNWA 1SCMB 4CFRA 1F71A 2JWWA 1KFUS 1DJIA 2JU0A 2K7BA 2SCPA 1TIZA 1DVIA 1NP8A
chains in the Genus database with same CATH topology
1FF1A 3A8RA 3LL8B 3TDIA 3BUNB 1KK7Y 2OPOA 3LCPC 3CWGA 1TNQA 2BE4A 2F33A 1SCMC 2KQYA 1EJ3A 2JT0A 1J1DA 4PCWA 1B8LA 1MF8B 3WNXB 1B9AA 3D0YB 5CSNA 1DJGA 5HKWA 2WORA 4L9MA 2OS8B 1KQMB 1WLMA 1BG1A 1AJ4A 4DUQA 1UWOA 4GBAA 4XJKB 1SY9A 1SR6C 1IGVA 1FI6A 1EG4A 2A4JA 2BCAA 2FOTA 1DJWA 3OHMB 2MLFC 1YVLA 2V53A 1A03A 2BL0B 2LVKA 2OS8C 3DF0B 1W7JB 1KK8C 4QJ5B 1UHIA 1MXLC 2H2KA 2LUXA 2LLSA 2PSRA 2KFHA 1KWOC 1S6IA 2NCOA 1KSOA 2KI6D 2L4IA 3WHTB 2G2BA 4N1GA 1C7WA 1QXPA 1OOJA 3KO0A 1MR8A 2L50A 3FS7A 3DVMA 3HCMA 1KCYA 5GQQC 1LA3A 2H61C 1BR4B 1UHKA 2LVJA 1KFXL 1ZOTB 2BCBA 1B8CA 2L51A 1YX7A 3SG7A 4NDDA 1Y0VH 5TNCA 1SL7A 1J7OA 3ZWHA 2GGMA 3BYAA 4HRHA 2BBMA 1C7VA 5I2OA 1NCXA 5DKRA 3SG5A 2F3ZA 3TS5B 1RJVA 4PE1A 1QIVA 3D0YA 2WCBA 4OCIA 1IWQA 1F70A 2TN4A 2JRFA 2M8UA 4CIDA 2F2PA 1UURA 4XJKA 1XFYO 2L0PA 3PFVA 1ODBA 3NXAA 1G4YR 4M2QA 3PSRA 3RM1A 4GGFC 4PHKA 4BY4A 1S5GY 1UHHA 3DF0A 2H61A 2Y4QA 3I5GB 4NDCA 1MUXA 1CLMA 1J1EA 1F54A 3CGAA 1CM4A 1AJ5A 1S26D 1FPWA 1N65A 3SG6A 1XFXO 1NX1A 3GOFA 1OQPA 4M2PA 4YBHB 3OX6A 5HKZA 1XYDA 3PN7B 4JPZB 2MLEC 4MRYA 1DJHA 1SNLA 1QLKA 1PULA 1A4PA 2ZKMX 4GFTA 2RGIA 1L7ZA 4PHJA 1K90D 1B8RA 3GK4X 3PN7C 5CSJA 1DF0A 2O5GA 3CTNA 1WY9A 3EKJA 1QIWA 3SG3A 2I7AA 4U8DA 1W7IB 4GGFA 2LHLA 1LKJA 3VROA 4QJ3B 3I5IB 2IS9A 1H8BA 2HF5A 4PHMA 1JUOA 3O2PA 1KQVA 3BOWB 3O4YA 2WOSA 1PVAA 2KOTA 4CLNA 5D7FA 1K9KA 1BOCA 3I5FC 1WDCB 2LLTA 5I2QA 1IQ5A 2CT9A 1QX5B 1MHOA 2VRGA 3OB1B 1AP4A 5PALA 4ORBB 2KAXA 1XVJA 2WNDA 2M3WA 1QVIZ 1RK9A 3AKBA 1PALA 1EH2A 1GJYA 1OMVA 2JTZA 2AAOA 2Q4UA 2KI4C 3AAJA 3H4SE 3VGOA 1PVBA 3IF7A 4MEWA 1YR5A 1EXRA 2PRUA 4N5XA 3SJSA 4C0LA 1OMRA 2JNXA 3LLEA 2BKIB 1CNPA 2KBIA 1XA5A 1HQVA 4GUKA 3C1VA 2BKHB 4PALA 1ZUZA 4IL1A 3TUYC 3SIBA 1WRKA 1J7QA 4WRIA 1QX7A 3DVJA 1S6JA 1XFVO 1YUSA 3PM8A 2F3YA 1OZSA 3BOWA 1S1EA 3VRPA 1SR6B 3KPXA 2JQ6A 1DT7B 2COLB 5B8IB 4DRWA 3BXKA 4YGDB 4E68A 1B7TY 2BECA 4MRXA 1CMGA 3WXAA 1KK8B 2MJWB 2L4HA 1KWOB 4HREE 2PVBA 1QVIY 2E30A 2HQ8A 5G08A 3NSKA 5I8NA 1SKTA 1EG3A 1CDLA 4YGCB 5AEQA 2I2RE 1CLLA 4NDBA 1S5GZ 1SRAA 4AOMA 1XFUO 2ZNEA 3AKAA 2NCPA 1G33A 2KGBC 5FYXA 2JXLA 4D1EA 1NCYA 2JTTA 2LANA 3KHEA 1QX2A 1WRLA 3VRNA 4DIRA 2K8MB 2BCXA 3JTDC 1MQ1A 2G9BA 5HLOA 3JVTC 1D1OA 1QLSA 4NQGA 1TOPA 2JULA 5KTYA 4PE7A 3FIAA 2LCPA 1GGZA 2KQ6A 2M9GA 2ZN9A 1NX0A 3FWBA 1M31A 1A29A 4TNCA 1SK6D 1ALVA 1DF0B 1DJXA 1MWNA 3E3RA 1NWDA 2Q91A 5F6TA 1GQMA 3ICBA 4WQ2A 2LP2A 4OV2A 1RFJA 1H4BA 2NLNA 3O78A 3LK1A 5KU1A 1J7RA 3BUWB 1IJ6A 1CFPA 5KSZA 4PHNA 2O60A 4MSPA 4YGEB 3CR4X 1LVCD 1CB1A 2NXQA 1DJZA 1HT9A 1V1GA 5HYDA 1G8IA 2KFFA 4GGNA 1TNPA 1Y1AA 2MRDA 4P2YB 1TN4A 1X02A 1TNXA 3KF9A 3M0WA 1MXEA 1CM1A 1YX8A 1FBVA 1F4QA 4USLA 4OVNF 5AFPA 1JWDA 2HPSA 3CS1A 1YRUB 2KSPA 1CFFA 1LA0A 1KFXS 3BUOB 2QACA 2ISDA 1PSRA 2CXJA 2EGDA 2CNPA 1K2HA 4A4BA 2LMTA 3BUXB 4F0ZB 2KDHA 1K95A 3CLNA 1S36A 1DGVA 3TZ1A 1QATA 1BJFA 3SG2A 4BY5A 3I5FB 5HKYA 1BMOA 3HX4A 2KI6C 2LE9B 2ZN8A 3AAKA 4YI9A 3CR2A 4ETOA 1E8AA 1C07A 1TCFA 1ZMZA 1NSHA 1L2OC 5AANA 1AK8A 1IQ3A 4I5LB 1RTP1 3I5HC 1ALWA 1M63B 4MN0A 1OZOA 3EK7A 2KAVA 3EK8A 3IQOA 3CR5X 1LXFC 1B7TZ 2JOJA 2ZNDA 4OR9B 2KI4B 1IG5A 2M0RA 1Y6WA 1K93D 2MAZA 5AERA 1CDMA 1AHRA 2LHIA 1IJ5A 1A75B 3PALA 4ICBA 1CDNA 2JPTA 1KFUL 2P6BB 1F4OA 3O6BA 2WCFA 1YVHA 1CDPA 3EVVA 1YURA 3QRXA 3TUYB 3DVKA 1OMDA 3GK2A 1JC2A 3PLFB 2KYFA 2K7CA 1KSMA 2JXCA 1Q80A 2KNEA 3EVUA 3NSIA 2NZ0A 1QJTA 1UP5A 1TTXA 1PK0D 3FWCA 1B4CA 1NX3A 2CBLA 2LNKA 5HLVA 2FCEA 4MVFA 4ZCUA 2WCEA 4DCKA 2L5XB 4ORCB 3SIAA 3VRRA 4JWQA 4I5KA 1LINA 4P5OE 3D10A 1JBAA 4MBEA 1UHJA 1N2DA 3EKHA 1SBJA 4FTGA 1SYMA 1UHNA 3TDUA 1QV0A 1CKKA 1RECA 2KBMA 5I2LA 2BE6A 4AQJA 4GPLB 1A75A 2OTGC 1XO5A 3SG4A 2ZFDA 1NYAA 1K9UA 3EK4A 2E6WA 2K7OA 1CFCA 1XFZO 2L98A 3JTDB 1A2XA 2M97A 3K21A 1WRZA 3JVTB 1IH0A 1FW4A 3WHUB 3F45A 5DKQA 4FQOA 4GAOA 1XFWO 2M29A 1YUUA 2JZIA 1CLBA 2HETA 2F8PA 2ZRTA 1DJYA 3ZNIA 1K94A 1RWYA 2LM5A 2D8NA 2LVIA 1F8HA 4YGAA 3NSLA 2JNFA 3PATA 2KAYA 1BR1B 1Y1XA 2MHHA 3DVEA 1NPQA 1SPYA 1N0YA 1BF5A 1SL8A 5BPJA 1KQMC 1AUIB 2K0JA 1U5IB 3A4UB 2MBXA 2SASA 1GGWA 5IBWA 4YGBB 1WLZA 1SMGA 2LLUA 1BT6A 5JOLA 2BL0C 1QASA 4YRUA 1DMOA 4I5NB 2KHNA 2EC6B 2PMYA 5JJGA 2GV5A 2KFGA 2AMIA 1SCVA 2LV7A 2K2AA 3RLZA 1JFJA 1JF0A 2I94A 5AXIA 1OSAA 5CSFA 2JT3A 2M7NA 1UUSA 2Y1NA 3OX5A 4JQ0D 4M2OA 2EC6C 2CCMA 5ER5A 4C0KA 2R2IA 1ZFSA 1VRKA 4AQIA 1TCOB 1SL9A 1CMFA 1M39A 3OB2B 1J7PA 4HRGA 2EHBA 3MSEB 4PE0A 2JT8A 3TS5C 1IKUA 1BODA 2LUCA 1PSBA 4MZKA 5J3XA 1L2OB 2BBNA 1ZACA 2CTNA 1R2UA 2PALA 3DD4A 3I5HB 4YI8A 4ZCVA 1JSAA 1U5IA 1XK4C 4QJ4B 1NUBA 3CZTX 1NIWA 4XYNA 4MZLA 5CSIA 3VRQA 2HQWA 4I5JA 1NX2A 1B47A 2K61A 4MLWA 2LAPA 3OP0A 3GK1A 3I5GC 4CPVA 2Y5IA 2PASA 4DS7A 3BQ3A 2KGRA 2LMUA 1M46A 1JFKA 5K89A 1DTLA 2LP3A 1J55A 1QS7A 2FJUB 2JC2A 4MZJA 1K8UA 4ORAB 4UPGA 2L2EA 2ZRSA 4PE4A 1YUTA 1CTRA 2FCDA 4R1EA 2MA2A 1TRFA 2B1UA 2I18A 2K7DA 3EVRA 2M1KB 1KK7Z 2KYCA 1F55A 1SW8A 2QPTA 1S6CA 2AUCA 2K2FA 5ER4X 1YTZC 1QV1A 1BLQA 1K96A 1XK4A 1JF2A 1CFDA 2M49B 4GNKB 5CPVA 2DOQA 2M1UA 1B1GA 4Q04A 1BU3A 3TDZA 3I5IC 3BUMB 1YRTB 1K9PA 1EL4A 1PRWA 1FI5A 1OE9B 1V1FA 2GGZA 3NSOA 4HSZA 4PDZA 5D69A 3LK0A 2Y1MA 4OKHA 1RROA 1S3PA 1WDCC 3IQQA 1AVSA 2M7LA 4A4CA 1NCZA 1M45A 2LC5A 4C0JA 1R6PA 1Y1UA 4CFQA 1IRJA 2OTGB 4WQ3A 4N1FA 2F2OA 2LVVA 3KEVA 1QTXA 5DKNA 2WC8A 2LMVA 1DGUA 1TNWA 1SCMB 4CFRA 1F71A 2JWWA 1KFUS 1DJIA 2JU0A 2K7BA 2SCPA 1TIZA 1DVIA 1NP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FF1 A;  3A8R A;  3LL8 B;  3TDI A;  3BUN B;  1KK7 Y;  2OPO A;  3LCP C;  3CWG A;  1TNQ A;  2BE4 A;  2F33 A;  1SCM C;  2KQY A;  1EJ3 A;  2JT0 A;  1J1D A;  4PCW A;  1B8L A;  1MF8 B;  3WNX B;  1B9A A;  3D0Y B;  5CSN A;  1DJG A;  5HKW A;  2WOR A;  4L9M A;  2OS8 B;  1KQM B;  1WLM A;  1BG1 A;  1AJ4 A;  4DUQ A;  1UWO A;  4GBA A;  4XJK B;  1SY9 A;  1SR6 C;  1IGV A;  1FI6 A;  1EG4 A;  2A4J A;  2BCA A;  2FOT A;  1DJW A;  3OHM B;  2MLF C;  1YVL A;  2V53 A;  1A03 A;  2BL0 B;  2LVK A;  2OS8 C;  3DF0 B;  1W7J B;  1KK8 C;  4QJ5 B;  1UHI A;  1MXL C;  2H2K A;  2LUX A;  2LLS A;  2PSR A;  2KFH A;  1KWO C;  1S6I A;  2NCO A;  1KSO A;  2KI6 D;  2L4I A;  3WHT B;  2G2B A;  4N1G A;  1C7W A;  1QXP A;  1OOJ A;  3KO0 A;  1MR8 A;  2L50 A;  3FS7 A;  3DVM A;  3HCM A;  1KCY A;  5GQQ C;  1LA3 A;  2H61 C;  1BR4 B;  1UHK A;  2LVJ A;  1KFX L;  1ZOT B;  2BCB A;  1B8C A;  2L51 A;  1YX7 A;  3SG7 A;  4NDD A;  1Y0V H;  5TNC A;  1SL7 A;  1J7O A;  3ZWH A;  2GGM A;  3BYA A;  4HRH A;  2BBM A;  1C7V A;  5I2O A;  1NCX A;  5DKR A;  3SG5 A;  2F3Z A;  3TS5 B;  1RJV A;  4PE1 A;  1QIV A;  3D0Y A;  2WCB A;  4OCI A;  1IWQ A;  1F70 A;  2TN4 A;  2JRF A;  2M8U A;  4CID A;  2F2P A;  1UUR A;  4XJK A;  1XFY O;  2L0P A;  3PFV A;  1ODB A;  3NXA A;  1G4Y R;  4M2Q A;  3PSR A;  3RM1 A;  4GGF C;  4PHK A;  4BY4 A;  1S5G Y;  1UHH A;  3DF0 A;  2H61 A;  2Y4Q A;  3I5G B;  4NDC A;  1MUX A;  1CLM A;  1J1E A;  1F54 A;  3CGA A;  1CM4 A;  1AJ5 A;  1S26 D;  1FPW A;  1N65 A;  3SG6 A;  1XFX O;  1NX1 A;  3GOF A;  1OQP A;  4M2P A;  4YBH B;  3OX6 A;  5HKZ A;  1XYD A;  3PN7 B;  4JPZ B;  2MLE C;  4MRY A;  1DJH A;  1SNL A;  1QLK A;  1PUL A;  1A4P A;  2ZKM X;  4GFT A;  2RGI A;  1L7Z A;  4PHJ A;  1K90 D;  1B8R A;  3GK4 X;  3PN7 C;  5CSJ A;  1DF0 A;  2O5G A;  3CTN A;  1WY9 A;  3EKJ A;  1QIW A;  3SG3 A;  2I7A A;  4U8D A;  1W7I B;  4GGF A;  2LHL A;  1LKJ A;  3VRO A;  4QJ3 B;  3I5I B;  2IS9 A;  1H8B A;  2HF5 A;  4PHM A;  1JUO A;  3O2P A;  1KQV A;  3BOW B;  3O4Y A;  2WOS A;  1PVA A;  2KOT A;  4CLN A;  5D7F A;  1K9K A;  1BOC A;  3I5F C;  1WDC B;  2LLT A;  5I2Q A;  1IQ5 A;  2CT9 A;  1QX5 B;  1MHO A;  2VRG A;  3OB1 B;  1AP4 A;  5PAL A;  4ORB B;  2KAX A;  1XVJ A;  2WND A;  2M3W A;  1QVI Z;  1RK9 A;  3AKB A;  1PAL A;  1EH2 A;  1GJY A;  1OMV A;  2JTZ A;  2AAO A;  2Q4U A;  2KI4 C;  3AAJ A;  3H4S E;  3VGO A;  1PVB A;  3IF7 A;  4MEW A;  1YR5 A;  1EXR A;  2PRU A;  4N5X A;  3SJS A;  4C0L A;  1OMR A;  2JNX A;  3LLE A;  2BKI B;  1CNP A;  2KBI A;  1XA5 A;  1HQV A;  4GUK A;  3C1V A;  2BKH B;  4PAL A;  1ZUZ A;  4IL1 A;  3TUY C;  3SIB A;  1WRK A;  1J7Q A;  4WRI A;  1QX7 A;  3DVJ A;  1S6J A;  1XFV O;  1YUS A;  3PM8 A;  2F3Y A;  1OZS A;  3BOW A;  1S1E A;  3VRP A;  1SR6 B;  3KPX A;  2JQ6 A;  1DT7 B;  2COL B;  5B8I B;  4DRW A;  3BXK A;  4YGD B;  4E68 A;  1B7T Y;  2BEC A;  4MRX A;  1CMG A;  3WXA A;  1KK8 B;  2MJW B;  2L4H A;  1KWO B;  4HRE E;  2PVB A;  1QVI Y;  2E30 A;  2HQ8 A;  5G08 A;  3NSK A;  5I8N A;  1SKT A;  1EG3 A;  1CDL A;  4YGC B;  5AEQ A;  2I2R E;  1CLL A;  4NDB A;  1S5G Z;  1SRA A;  4AOM A;  1XFU O;  2ZNE A;  3AKA A;  2NCP A;  1G33 A;  2KGB C;  5FYX A;  2JXL A;  4D1E A;  1NCY A;  2JTT A;  2LAN A;  3KHE A;  1QX2 A;  1WRL A;  3VRN A;  4DIR A;  2K8M B;  2BCX A;  3JTD C;  1MQ1 A;  2G9B A;  5HLO A;  3JVT C;  1D1O A;  1QLS A;  4NQG A;  1TOP A;  2JUL A;  5KTY A;  4PE7 A;  3FIA A;  2LCP A;  1GGZ A;  2KQ6 A;  2M9G A;  2ZN9 A;  1NX0 A;  3FWB A;  1M31 A;  1A29 A;  4TNC A;  1SK6 D;  1ALV A;  1DF0 B;  1DJX A;  1MWN A;  3E3R A;  1NWD A;  2Q91 A;  5F6T A;  1GQM A;  3ICB A;  4WQ2 A;  2LP2 A;  4OV2 A;  1RFJ A;  1H4B A;  2NLN A;  3O78 A;  3LK1 A;  5KU1 A;  1J7R A;  3BUW B;  1IJ6 A;  1CFP A;  5KSZ A;  4PHN A;  2O60 A;  4MSP A;  4YGE B;  3CR4 X;  1LVC D;  1CB1 A;  2NXQ A;  1DJZ A;  1HT9 A;  1V1G A;  5HYD A;  1G8I A;  2KFF A;  4GGN A;  1TNP A;  1Y1A A;  2MRD A;  4P2Y B;  1TN4 A;  1X02 A;  1TNX A;  3KF9 A;  3M0W A;  1MXE A;  1CM1 A;  1YX8 A;  1FBV A;  1F4Q A;  4USL A;  4OVN F;  5AFP A;  1JWD A;  2HPS A;  3CS1 A;  1YRU B;  2KSP A;  1CFF A;  1LA0 A;  1KFX S;  3BUO B;  2QAC A;  2ISD A;  1PSR A;  2CXJ A;  2EGD A;  2CNP A;  1K2H A;  4A4B A;  2LMT A;  3BUX B;  4F0Z B;  2KDH A;  1K95 A;  3CLN A;  1S36 A;  1DGV A;  3TZ1 A;  1QAT A;  1BJF A;  3SG2 A;  4BY5 A;  3I5F B;  5HKY A;  1BMO A;  3HX4 A;  2KI6 C;  2LE9 B;  2ZN8 A;  3AAK A;  4YI9 A;  3CR2 A;  4ETO A;  1E8A A;  1C07 A;  1TCF A;  1ZMZ A;  1NSH A;  1L2O C;  5AAN A;  1AK8 A;  1IQ3 A;  4I5L B;  1RTP 1;  3I5H C;  1ALW A;  1M63 B;  4MN0 A;  1OZO A;  3EK7 A;  2KAV A;  3EK8 A;  3IQO A;  3CR5 X;  1LXF C;  1B7T Z;  2JOJ A;  2ZND A;  4OR9 B;  2KI4 B;  1IG5 A;  2M0R A;  1Y6W A;  1K93 D;  2MAZ A;  5AER A;  1CDM A;  1AHR A;  2LHI A;  1IJ5 A;  1A75 B;  3PAL A;  4ICB A;  1CDN A;  2JPT A;  1KFU L;  2P6B B;  1F4O A;  3O6B A;  2WCF A;  1YVH A;  1CDP A;  3EVV A;  1YUR A;  3QRX A;  3TUY B;  3DVK A;  1OMD A;  3GK2 A;  1JC2 A;  3PLF B;  2KYF A;  2K7C A;  1KSM A;  2JXC A;  1Q80 A;  2KNE A;  3EVU A;  3NSI A;  2NZ0 A;  1QJT A;  1UP5 A;  1TTX A;  1PK0 D;  3FWC A;  1B4C A;  1NX3 A;  2CBL A;  2LNK A;  5HLV A;  2FCE A;  4MVF A;  4ZCU A;  2WCE A;  4DCK A;  2L5X B;  4ORC B;  3SIA A;  3VRR A;  4JWQ A;  4I5K A;  1LIN A;  4P5O E;  3D10 A;  1JBA A;  4MBE A;  1UHJ A;  1N2D A;  3EKH A;  1SBJ A;  4FTG A;  1SYM A;  1UHN A;  3TDU A;  1QV0 A;  1CKK A;  1REC A;  2KBM A;  5I2L A;  2BE6 A;  4AQJ A;  4GPL B;  1A75 A;  2OTG C;  1XO5 A;  3SG4 A;  2ZFD A;  1NYA A;  1K9U A;  3EK4 A;  2E6W A;  2K7O A;  1CFC A;  1XFZ O;  2L98 A;  3JTD B;  1A2X A;  2M97 A;  3K21 A;  1WRZ A;  3JVT B;  1IH0 A;  1FW4 A;  3WHU B;  3F45 A;  5DKQ A;  4FQO A;  4GAO A;  1XFW O;  2M29 A;  1YUU A;  2JZI A;  1CLB A;  2HET A;  2F8P A;  2ZRT A;  1DJY A;  3ZNI A;  1K94 A;  1RWY A;  2LM5 A;  2D8N A;  2LVI A;  1F8H A;  4YGA A;  3NSL A;  2JNF A;  3PAT A;  2KAY A;  1BR1 B;  1Y1X A;  2MHH A;  3DVE A;  1NPQ A;  1SPY A;  1N0Y A;  1BF5 A;  1SL8 A;  5BPJ A;  1KQM C;  1AUI B;  2K0J A;  1U5I B;  3A4U B;  2MBX A;  2SAS A;  1GGW A;  5IBW A;  4YGB B;  1WLZ A;  1SMG A;  2LLU A;  1BT6 A;  5JOL A;  2BL0 C;  1QAS A;  4YRU A;  1DMO A;  4I5N B;  2KHN A;  2EC6 B;  2PMY A;  5JJG A;  2GV5 A;  2KFG A;  2AMI A;  1SCV A;  2LV7 A;  2K2A A;  3RLZ A;  1JFJ A;  1JF0 A;  2I94 A;  5AXI A;  1OSA A;  5CSF A;  2JT3 A;  2M7N A;  1UUS A;  2Y1N A;  3OX5 A;  4JQ0 D;  4M2O A;  2EC6 C;  2CCM A;  5ER5 A;  4C0K A;  2R2I A;  1ZFS A;  1VRK A;  4AQI A;  1TCO B;  1SL9 A;  1CMF A;  1M39 A;  3OB2 B;  1J7P A;  4HRG A;  2EHB A;  3MSE B;  4PE0 A;  2JT8 A;  3TS5 C;  1IKU A;  1BOD A;  2LUC A;  1PSB A;  4MZK A;  5J3X A;  1L2O B;  2BBN A;  1ZAC A;  2CTN A;  1R2U A;  2PAL A;  3DD4 A;  3I5H B;  4YI8 A;  4ZCV A;  1JSA A;  1U5I A;  1XK4 C;  4QJ4 B;  1NUB A;  3CZT X;  1NIW A;  4XYN A;  4MZL A;  5CSI A;  3VRQ A;  2HQW A;  4I5J A;  1NX2 A;  1B47 A;  2K61 A;  4MLW A;  2LAP A;  3OP0 A;  3GK1 A;  3I5G C;  4CPV A;  2Y5I A;  2PAS A;  4DS7 A;  3BQ3 A;  2KGR A;  2LMU A;  1M46 A;  1JFK A;  5K89 A;  1DTL A;  2LP3 A;  1J55 A;  1QS7 A;  2FJU B;  2JC2 A;  4MZJ A;  1K8U A;  4ORA B;  4UPG A;  2L2E A;  2ZRS A;  4PE4 A;  1YUT A;  1CTR A;  2FCD A;  4R1E A;  2MA2 A;  1TRF A;  2B1U A;  2I18 A;  2K7D A;  3EVR A;  2M1K B;  1KK7 Z;  2KYC A;  1F55 A;  1SW8 A;  2QPT A;  1S6C A;  2AUC A;  2K2F A;  5ER4 X;  1YTZ C;  1QV1 A;  1BLQ A;  1K96 A;  1XK4 A;  1JF2 A;  1CFD A;  2M49 B;  4GNK B;  5CPV A;  2DOQ A;  2M1U A;  1B1G A;  4Q04 A;  1BU3 A;  3TDZ A;  3I5I C;  3BUM B;  1YRT B;  1K9P A;  1EL4 A;  1PRW A;  1FI5 A;  1OE9 B;  1V1F A;  2GGZ A;  3NSO A;  4HSZ A;  4PDZ A;  5D69 A;  3LK0 A;  2Y1M A;  4OKH A;  1RRO A;  1S3P A;  1WDC C;  3IQQ A;  1AVS A;  2M7L A;  4A4C A;  1NCZ A;  1M45 A;  2LC5 A;  4C0J A;  1R6P A;  1Y1U A;  4CFQ A;  1IRJ A;  2OTG B;  4WQ3 A;  4N1F A;  2F2O A;  2LVV A;  3KEV A;  1QTX A;  5DKN A;  2WC8 A;  2LMV A;  1DGU A;  1TNW A;  1SCM B;  4CFR A;  1F71 A;  2JWW A;  1KFU S;  1DJI A;  2JU0 A;  2K7B A;  2SCP A;  1TIZ A;  1DVI A;  1NP8 A; 
#chains in the Genus database with same CATH topology
 1FF1 A;  3A8R A;  3LL8 B;  3TDI A;  2QDI A;  3BUN B;  1KK7 Y;  2OPO A;  3LCP C;  3CWG A;  1TNQ A;  2BE4 A;  5D3O A;  2F33 A;  1SCM C;  1IIO A;  2KQY A;  1EJ3 A;  2JT0 A;  3OBV A;  1J1D A;  4PCW A;  1B8L A;  1MF8 B;  3WNX B;  1B9A A;  3D0Y B;  5CSN A;  1DJG A;  5HKW A;  2WOR A;  2QEB A;  4L9M A;  2OS8 B;  3R1V A;  1KQM B;  1WLM A;  1BG1 A;  1AJ4 A;  4DUQ A;  1UWO A;  4GBA A;  2JPO A;  1SY9 A;  1SR6 C;  1IGV A;  3N7H A;  4XJK B;  3V2L A;  1EG4 A;  2A4J A;  2BCA A;  2FOT A;  1DJW A;  3OHM B;  2KLD A;  1OOH A;  2MLF C;  1YVL A;  2V53 A;  2P70 A;  1A03 A;  1TUZ A;  2BL0 B;  2LVK A;  2OS8 C;  3DF0 B;  1W7J B;  1KK8 C;  4QJ5 B;  1UHI A;  1MXL C;  2H2K A;  2LUX A;  2LLS A;  2PSR A;  2KFH A;  1KWO C;  5FI6 A;  1S6I A;  2NCO A;  1KSO A;  2KI6 D;  2L4I A;  3WHT B;  2G2B A;  4N1G A;  1C7W A;  1QXP A;  1OOJ A;  3KO0 A;  1MR8 A;  2L50 A;  3FS7 A;  3L4A A;  3DVM A;  3HCM A;  3S0A A;  1KCY A;  5GQQ C;  1LA3 A;  2H61 C;  1BR4 B;  1UHK A;  2LVJ A;  1KFX L;  1ZOT B;  2BCB A;  1B8C A;  2L51 A;  1YX7 A;  1Z4H A;  3SG7 A;  4NDD A;  1Y0V H;  5TNC A;  1SL7 A;  1J7O A;  3ZWH A;  2GGM A;  2L5Y A;  3BYA A;  4HRH A;  2BBM A;  1C7V A;  5I2O A;  1NCX A;  3R1P A;  5DKR A;  3SG5 A;  1ORG A;  2F3Z A;  1RJV A;  3EG5 B;  3B88 A;  3TS5 B;  4PE1 A;  1QIV A;  3D0Y A;  3FE6 A;  2WCB A;  1FI6 A;  4OCI A;  1IWQ A;  1F70 A;  2TN4 A;  2JRF A;  2M8U A;  2WCM A;  4CID A;  2F2P A;  1UUR A;  4XJK A;  1P28 A;  1XFY O;  2L0P A;  3PFV A;  1ODB A;  3NXA A;  1G4Y R;  4M2Q A;  3PSR A;  3RM1 A;  4GGF C;  4PHK A;  4BY4 A;  5HL1 A;  1S5G Y;  1UHH A;  3DF0 A;  2H61 A;  2Y4Q A;  2PYQ A;  3I5G B;  4NDC A;  1MUX A;  2PQL A;  1CLM A;  1J1E A;  1F54 A;  3CGA A;  4FQT A;  1CM4 A;  1AJ5 A;  1DEK A;  1S26 D;  1FPW A;  1N65 A;  3RZS A;  3SG6 A;  1XFX O;  1NX1 A;  3GOF A;  1OQP A;  4M2P A;  4YBH B;  3OX6 A;  5HKZ A;  1XYD A;  3PN7 B;  2K60 A;  1OOI X;  4JPZ B;  2MLE C;  4MRY A;  1DJH A;  1OOG A;  1SNL A;  1QLK A;  1PUL A;  1A4P A;  2ZKM X;  4GFT A;  2RGI A;  1L7Z A;  4PHJ A;  1K90 D;  1B8R A;  3GK4 X;  3PN7 C;  5CSJ A;  1DF0 A;  2O5G A;  3CTN A;  1WY9 A;  3EKJ A;  3CDN A;  1QIW A;  3SG3 A;  2I7A A;  2WCK A;  1W7I B;  4U8D A;  4GGF A;  2LHL A;  1LKJ A;  3VRO A;  4QJ3 B;  3I5I B;  2IS9 A;  1H8B A;  2HF5 A;  4PHM A;  1JUO A;  3O2P A;  1KQV A;  3BOW B;  3O4Y A;  5DIC A;  2WOS A;  1PVA A;  2KOT A;  2WCH A;  5D7F A;  1K9K A;  3NHI A;  4CLN A;  3I5F C;  1BOC A;  1WDC B;  2LLT A;  5I2Q A;  1IQ5 A;  2CT9 A;  2KPH A;  1QX5 B;  1MHO A;  2VRG A;  3OB1 B;  1AP4 A;  5PAL A;  3L47 A;  4ORB B;  2GTE A;  2KAX A;  1XVJ A;  2WND A;  2M3W A;  1QVI Z;  1RK9 A;  3AKB A;  1XFR A;  1PAL A;  1EH2 A;  1GJY A;  1OMV A;  2JTZ A;  3CZ1 A;  3UO9 A;  2AAO A;  2Q4U A;  2KI4 C;  3AAJ A;  3H4S E;  3VGO A;  1PVB A;  3IF7 A;  1T14 A;  4MEW A;  2QEO A;  1YR5 A;  1EXR A;  2PRU A;  3BFB A;  4N5X A;  3SJS A;  4C0L A;  1OMR A;  2JNX A;  3LLE A;  2BKI B;  1CNP A;  2KBI A;  1XA5 A;  1HQV A;  1TUJ A;  4GUK A;  3C1V A;  2BKH B;  4PAL A;  1ZUZ A;  4IL1 A;  3TUY C;  3SIB A;  1WRK A;  3OGN A;  1J7Q A;  4WRI A;  1QX7 A;  3DVJ A;  1S6J A;  1XFV O;  5I94 A;  1YUS A;  3PM8 A;  2F3Y A;  1OZS A;  1QWV A;  3BOW A;  2QEH A;  1S1E A;  3VRP A;  1SR6 B;  3KPX A;  1OW4 A;  2JQ6 A;  1DT7 B;  2COL B;  5B8I B;  3CYZ A;  3B6X A;  3BXK A;  4YGD B;  4DRW A;  4E68 A;  1B7T Y;  3DXL A;  2BEC A;  4MRX A;  1CMG A;  3WXA A;  1KK8 B;  2MJW B;  2L4H A;  1KWO B;  4HRE E;  2PVB A;  1QVI Y;  2E30 A;  2HQ8 A;  5G08 A;  2H8V A;  3O4X A;  3NSK A;  5I8N A;  1SKT A;  3B86 A;  1EG3 A;  1CDL A;  4YGC B;  5AEQ A;  3B87 A;  2I2R E;  1CLL A;  4NDB A;  1S5G Z;  1SRA A;  3SS5 A;  4AOM A;  1XFU O;  2ZNE A;  3AKA A;  2NCP A;  3CZ2 A;  1G33 A;  2KGB C;  5FYX A;  2JXL A;  4D1E A;  1NCY A;  2JTT A;  2LAN A;  3KHE A;  1QX2 A;  4F7F A;  4IJ7 A;  1WRL A;  3VRN A;  4DIR A;  4JD9 A;  2K8M B;  2BCX A;  3BJH A;  3D74 A;  3JTD C;  1C3Z A;  1MQ1 A;  2G9B A;  5HLO A;  3JVT C;  1D1O A;  3FE8 A;  1QLS A;  4NQG A;  1TOP A;  2JUL A;  5KTY A;  4PE7 A;  3BFA A;  3FIA A;  2LCP A;  1GGZ A;  2KQ6 A;  2M9G A;  2ZN9 A;  1NX0 A;  3FWB A;  3SS3 A;  1M31 A;  2ERB A;  1A29 A;  4TNC A;  1SK6 D;  1ALV A;  1DF0 B;  1DJX A;  1MWN A;  3E3R A;  1NWD A;  2Q91 A;  5F6T A;  1GQM A;  3ICB A;  4WQ2 A;  2LP2 A;  4OV2 A;  1RFJ A;  1H4B A;  2NLN A;  3O78 A;  2QEV A;  3LK1 A;  5KU1 A;  1J7R A;  3BUW B;  1IJ6 A;  1CFP A;  2P71 A;  3D78 A;  4PHN A;  5KSZ A;  2O60 A;  3CAB A;  4MSP A;  4YGE B;  3CR4 X;  1LVC D;  1CB1 A;  2NXQ A;  1DJZ A;  1HT9 A;  1V1G A;  5HYD A;  1G8I A;  2KFF A;  4GGN A;  1TNP A;  1Y1A A;  2MRD A;  4P2Y B;  5FI2 A;  1TN4 A;  1X02 A;  1TNX A;  3KF9 A;  3M0W A;  1MXE A;  1CM1 A;  1YX8 A;  1FBV A;  1F4Q A;  4USL A;  4OVN F;  5AFP A;  1JWD A;  2HPS A;  3CS1 A;  1YRU B;  3L4L A;  2KSP A;  1CFF A;  1LA0 A;  1KFX S;  3BUO B;  3SS4 A;  2QAC A;  3PM2 A;  2ISD A;  1PSR A;  2CXJ A;  2EGD A;  1W9Z A;  2CNP A;  1K2H A;  2WC5 A;  4A4B A;  1C3Y A;  2LMT A;  3BUX B;  4F0Z B;  2KDH A;  2WCL A;  1K95 A;  3CLN A;  1S36 A;  1DGV A;  3TZ1 A;  1QAT A;  1BJF A;  3SG2 A;  4BY5 A;  3I5F B;  5HKY A;  1BMO A;  3HX4 A;  2KI6 C;  3R72 A;  2LE9 B;  2ZN8 A;  3AAK A;  4YI9 A;  3CR2 A;  4ETO A;  1E8A A;  3D77 A;  1TCF A;  1C07 A;  1ZMZ A;  1NSH A;  1L2O C;  5AAN A;  1AK8 A;  1IQ3 A;  4I5L B;  1RTP 1;  3I5H C;  1ALW A;  1M63 B;  4MN0 A;  1OZO A;  3EK7 A;  2KAV A;  3EK8 A;  3IQO A;  3CR5 X;  1LXF C;  1B7T Z;  2JOJ A;  2ZND A;  4OR9 B;  2KI4 B;  3FE9 A;  1IG5 A;  1F8H A;  2M0R A;  1Y6W A;  1K93 D;  2MAZ A;  5AER A;  1CDM A;  1AHR A;  2LHI A;  1IJ5 A;  1A75 B;  3PAL A;  4ICB A;  1CDN A;  2JPT A;  1KFU L;  1DEL A;  2P6B B;  1F4O A;  3O6B A;  2WCF A;  1YVH A;  1CDP A;  3EVV A;  1YUR A;  3QRX A;  3TUY B;  4PT1 A;  3DVK A;  1OMD A;  3GK2 A;  3PJI A;  1JC2 A;  3PLF B;  2KYF A;  3NGV A;  2K7C A;  1KSM A;  2JXC A;  4JKT A;  1Q80 A;  2KNE A;  4INW A;  3EVU A;  3NSI A;  2NZ0 A;  1QJT A;  1UP5 A;  1TTX A;  1PK0 D;  3FWC A;  1B4C A;  1NX3 A;  2CBL A;  2LNK A;  5HLV A;  2FCE A;  4MVF A;  4ZCU A;  2WCE A;  4DCK A;  2L5X B;  4ORC B;  3SIA A;  3VRR A;  4JWQ A;  4I5K A;  4KYN A;  1LIN A;  1DQE A;  4P5O E;  3D10 A;  1JBA A;  4MBE A;  1UHJ A;  4INX A;  1N2D A;  3EKH A;  1SBJ A;  4FTG A;  1SYM A;  1UHN A;  3TDU A;  1QV0 A;  3VB1 A;  1CKK A;  1REC A;  2KBM A;  5I2L A;  2BE6 A;  4AQJ A;  4GPL B;  1A75 A;  3Q8I A;  2OTG C;  1XO5 A;  3SG4 A;  2ZFD A;  1NYA A;  1K9U A;  3EK4 A;  2E6W A;  2L2C A;  2K7O A;  1CFC A;  1XFZ O;  2L98 A;  3JTD B;  1A2X A;  2M97 A;  3K21 A;  1WRZ A;  3JVT B;  3DZT A;  3NHT A;  1IH0 A;  1FW4 A;  3WHU B;  3F45 A;  5DKQ A;  4FQO A;  3S0B A;  4GAO A;  1XFW O;  3S0F A;  2M29 A;  1YUU A;  2JZI A;  1CLB A;  2HET A;  2F8P A;  2ZRT A;  1DJY A;  3ZNI A;  1K94 A;  1RWY A;  2LM5 A;  2D8N A;  2LVI A;  1LS8 A;  4YGA A;  3NSL A;  2JNF A;  3PAT A;  2KAY A;  1BR1 B;  1Y1X A;  2MHH A;  3DVE A;  1DC1 A;  1NPQ A;  1SPY A;  1N0Y A;  1BF5 A;  1SL8 A;  5BPJ A;  1KQM C;  1AUI B;  5FI7 A;  2K0J A;  1SSE B;  1U5I B;  3A4U B;  2MBX A;  2SAS A;  1GGW A;  5IBW A;  4YGB B;  1WLZ A;  3D76 A;  1SMG A;  2LLU A;  1BT6 A;  5JOL A;  2BL0 C;  1QAS A;  4YRU A;  1DMO A;  4I5N B;  2KHN A;  3DYE A;  2EC6 B;  2PMY A;  5JJG A;  2GV5 A;  2KFG A;  2AMI A;  1SCV A;  2LV7 A;  2K2A A;  3RLZ A;  1JFJ A;  1JF0 A;  2I94 A;  2WCJ A;  5AXI A;  1OSA A;  2FJY A;  5CSF A;  2JT3 A;  2M7N A;  1UUS A;  3D75 A;  2Y1N A;  3OX5 A;  4JQ0 D;  4M2O A;  2EC6 C;  2WC6 A;  2CCM A;  5ER5 A;  4C0K A;  2R2I A;  1ZFS A;  1VRK A;  4AQI A;  1TCO B;  1SL9 A;  1CMF A;  1M39 A;  3OB2 B;  1J7P A;  4HRG A;  2EHB A;  3MSE B;  4PE0 A;  2JT8 A;  3TS5 C;  1IKU A;  1BOD A;  2LUC A;  1PSB A;  4MZK A;  5J3X A;  1L2O B;  2BBN A;  1ZAC A;  2CTN A;  1R2U A;  2PAL A;  3DD4 A;  3I5H B;  4YI8 A;  4ZCV A;  1JSA A;  3IVT A;  1U5I A;  1XK4 C;  4QJ4 B;  1NUB A;  3CZT X;  3S0E A;  1NIW A;  1TWO A;  4XYN A;  4MZL A;  5CSI A;  3VRQ A;  2HQW A;  4I5J A;  1NX2 A;  3DY9 A;  1B47 A;  2K61 A;  4MLW A;  4OZD A;  2LAP A;  3OP0 A;  2KLE A;  3UNW A;  3GK1 A;  3I5G C;  4CPV A;  2Y5I A;  3CZ0 A;  2PAS A;  4DS7 A;  3BQ3 A;  2KGR A;  2LMU A;  1M46 A;  1JFK A;  3K1E A;  5K89 A;  1DTL A;  2LP3 A;  1J55 A;  1QS7 A;  2FJU B;  2JC2 A;  2YGU A;  1K8U A;  4MZJ A;  4ORA B;  3S0D A;  4UPG A;  2L2E A;  2ZRS A;  2BAP A;  3BFH A;  4PE4 A;  1YUT A;  1CTR A;  2FCD A;  4R1E A;  2MA2 A;  1TRF A;  2B1U A;  2I18 A;  2K7D A;  3EVR A;  1OOF A;  2M1K B;  3D73 A;  1KK7 Z;  2KYC A;  3B7A A;  1SW8 A;  1F55 A;  2QPT A;  1S6C A;  2AUC A;  2K2F A;  5ER4 X;  1YTZ C;  1QV1 A;  1BLQ A;  1K96 A;  1XK4 A;  1JF2 A;  1CFD A;  2M49 B;  4GNK B;  5CPV A;  3S0G A;  2DOQ A;  2M1U A;  1Z2C B;  1B1G A;  4Q04 A;  1BU3 A;  3TDZ A;  3I5I C;  3BUM B;  1YRT B;  1K9P A;  1EL4 A;  1PRW A;  1FI5 A;  1OE9 B;  1V1F A;  2GGZ A;  3NSO A;  4HSZ A;  4PDZ A;  5D69 A;  3LK0 A;  2Y1M A;  4OKH A;  1RRO A;  1S3P A;  1WDC C;  3IQQ A;  1AVS A;  2M7L A;  4A4C A;  1NCZ A;  3R1O A;  1M45 A;  2LC5 A;  4C0J A;  1GM0 A;  1R6P A;  1Y1U A;  3QME A;  5EL2 A;  4CFQ A;  1IRJ A;  2OTG B;  4WQ3 A;  2BNX A;  4N1F A;  2F2O A;  2LVV A;  3KEV A;  1QTX A;  5DKN A;  2WC8 A;  2LMV A;  1DGU A;  1TNW A;  1SCM B;  4CFR A;  1F71 A;  2JWW A;  1KFU S;  1DJI A;  2JU0 A;  2K7B A;  2SCP A;  1TIZ A;  1DVI A;  1NP8 A; 
#chains in the Genus database with same CATH homology
 1FF1 A;  3A8R A;  3LL8 B;  3TDI A;  3BUN B;  1KK7 Y;  2OPO A;  3LCP C;  3CWG A;  1TNQ A;  2BE4 A;  2F33 A;  1SCM C;  2KQY A;  1EJ3 A;  2JT0 A;  1J1D A;  4PCW A;  1B8L A;  1MF8 B;  3WNX B;  1B9A A;  3D0Y B;  5CSN A;  1DJG A;  5HKW A;  2WOR A;  4L9M A;  2OS8 B;  1KQM B;  1WLM A;  1BG1 A;  1AJ4 A;  4DUQ A;  1UWO A;  4GBA A;  4XJK B;  1SY9 A;  1SR6 C;  1IGV A;  1FI6 A;  1EG4 A;  2A4J A;  2BCA A;  2FOT A;  1DJW A;  3OHM B;  2MLF C;  1YVL A;  2V53 A;  1A03 A;  2BL0 B;  2LVK A;  2OS8 C;  3DF0 B;  1W7J B;  1KK8 C;  4QJ5 B;  1UHI A;  1MXL C;  2H2K A;  2LUX A;  2LLS A;  2PSR A;  2KFH A;  1KWO C;  1S6I A;  2NCO A;  1KSO A;  2KI6 D;  2L4I A;  3WHT B;  2G2B A;  4N1G A;  1C7W A;  1QXP A;  1OOJ A;  3KO0 A;  1MR8 A;  2L50 A;  3FS7 A;  3DVM A;  3HCM A;  1KCY A;  5GQQ C;  1LA3 A;  2H61 C;  1BR4 B;  1UHK A;  2LVJ A;  1KFX L;  1ZOT B;  2BCB A;  1B8C A;  2L51 A;  1YX7 A;  3SG7 A;  4NDD A;  1Y0V H;  5TNC A;  1SL7 A;  1J7O A;  3ZWH A;  2GGM A;  3BYA A;  4HRH A;  2BBM A;  1C7V A;  5I2O A;  1NCX A;  5DKR A;  3SG5 A;  2F3Z A;  3TS5 B;  1RJV A;  4PE1 A;  1QIV A;  3D0Y A;  2WCB A;  4OCI A;  1IWQ A;  1F70 A;  2TN4 A;  2JRF A;  2M8U A;  4CID A;  2F2P A;  1UUR A;  4XJK A;  1XFY O;  2L0P A;  3PFV A;  1ODB A;  3NXA A;  1G4Y R;  4M2Q A;  3PSR A;  3RM1 A;  4GGF C;  4PHK A;  4BY4 A;  1S5G Y;  1UHH A;  3DF0 A;  2H61 A;  2Y4Q A;  3I5G B;  4NDC A;  1MUX A;  1CLM A;  1J1E A;  1F54 A;  3CGA A;  1CM4 A;  1AJ5 A;  1S26 D;  1FPW A;  1N65 A;  3SG6 A;  1XFX O;  1NX1 A;  3GOF A;  1OQP A;  4M2P A;  4YBH B;  3OX6 A;  5HKZ A;  1XYD A;  3PN7 B;  4JPZ B;  2MLE C;  4MRY A;  1DJH A;  1SNL A;  1QLK A;  1PUL A;  1A4P A;  2ZKM X;  4GFT A;  2RGI A;  1L7Z A;  4PHJ A;  1K90 D;  1B8R A;  3GK4 X;  3PN7 C;  5CSJ A;  1DF0 A;  2O5G A;  3CTN A;  1WY9 A;  3EKJ A;  1QIW A;  3SG3 A;  2I7A A;  4U8D A;  1W7I B;  4GGF A;  2LHL A;  1LKJ A;  3VRO A;  4QJ3 B;  3I5I B;  2IS9 A;  1H8B A;  2HF5 A;  4PHM A;  1JUO A;  3O2P A;  1KQV A;  3BOW B;  3O4Y A;  2WOS A;  1PVA A;  2KOT A;  4CLN A;  5D7F A;  1K9K A;  1BOC A;  3I5F C;  1WDC B;  2LLT A;  5I2Q A;  1IQ5 A;  2CT9 A;  1QX5 B;  1MHO A;  2VRG A;  3OB1 B;  1AP4 A;  5PAL A;  4ORB B;  2KAX A;  1XVJ A;  2WND A;  2M3W A;  1QVI Z;  1RK9 A;  3AKB A;  1PAL A;  1EH2 A;  1GJY A;  1OMV A;  2JTZ A;  2AAO A;  2Q4U A;  2KI4 C;  3AAJ A;  3H4S E;  3VGO A;  1PVB A;  3IF7 A;  4MEW A;  1YR5 A;  1EXR A;  2PRU A;  4N5X A;  3SJS A;  4C0L A;  1OMR A;  2JNX A;  3LLE A;  2BKI B;  1CNP A;  2KBI A;  1XA5 A;  1HQV A;  4GUK A;  3C1V A;  2BKH B;  4PAL A;  1ZUZ A;  4IL1 A;  3TUY C;  3SIB A;  1WRK A;  1J7Q A;  4WRI A;  1QX7 A;  3DVJ A;  1S6J A;  1XFV O;  1YUS A;  3PM8 A;  2F3Y A;  1OZS A;  3BOW A;  1S1E A;  3VRP A;  1SR6 B;  3KPX A;  2JQ6 A;  1DT7 B;  2COL B;  5B8I B;  4DRW A;  3BXK A;  4YGD B;  4E68 A;  1B7T Y;  2BEC A;  4MRX A;  1CMG A;  3WXA A;  1KK8 B;  2MJW B;  2L4H A;  1KWO B;  4HRE E;  2PVB A;  1QVI Y;  2E30 A;  2HQ8 A;  5G08 A;  3NSK A;  5I8N A;  1SKT A;  1EG3 A;  1CDL A;  4YGC B;  5AEQ A;  2I2R E;  1CLL A;  4NDB A;  1S5G Z;  1SRA A;  4AOM A;  1XFU O;  2ZNE A;  3AKA A;  2NCP A;  1G33 A;  2KGB C;  5FYX A;  2JXL A;  4D1E A;  1NCY A;  2JTT A;  2LAN A;  3KHE A;  1QX2 A;  1WRL A;  3VRN A;  4DIR A;  2K8M B;  2BCX A;  3JTD C;  1MQ1 A;  2G9B A;  5HLO A;  3JVT C;  1D1O A;  1QLS A;  4NQG A;  1TOP A;  2JUL A;  5KTY A;  4PE7 A;  3FIA A;  2LCP A;  1GGZ A;  2KQ6 A;  2M9G A;  2ZN9 A;  1NX0 A;  3FWB A;  1M31 A;  1A29 A;  4TNC A;  1SK6 D;  1ALV A;  1DF0 B;  1DJX A;  1MWN A;  3E3R A;  1NWD A;  2Q91 A;  5F6T A;  1GQM A;  3ICB A;  4WQ2 A;  2LP2 A;  4OV2 A;  1RFJ A;  1H4B A;  2NLN A;  3O78 A;  3LK1 A;  5KU1 A;  1J7R A;  3BUW B;  1IJ6 A;  1CFP A;  5KSZ A;  4PHN A;  2O60 A;  4MSP A;  4YGE B;  3CR4 X;  1LVC D;  1CB1 A;  2NXQ A;  1DJZ A;  1HT9 A;  1V1G A;  5HYD A;  1G8I A;  2KFF A;  4GGN A;  1TNP A;  1Y1A A;  2MRD A;  4P2Y B;  1TN4 A;  1X02 A;  1TNX A;  3KF9 A;  3M0W A;  1MXE A;  1CM1 A;  1YX8 A;  1FBV A;  1F4Q A;  4USL A;  4OVN F;  5AFP A;  1JWD A;  2HPS A;  3CS1 A;  1YRU B;  2KSP A;  1CFF A;  1LA0 A;  1KFX S;  3BUO B;  2QAC A;  2ISD A;  1PSR A;  2CXJ A;  2EGD A;  2CNP A;  1K2H A;  4A4B A;  2LMT A;  3BUX B;  4F0Z B;  2KDH A;  1K95 A;  3CLN A;  1S36 A;  1DGV A;  3TZ1 A;  1QAT A;  1BJF A;  3SG2 A;  4BY5 A;  3I5F B;  5HKY A;  1BMO A;  3HX4 A;  2KI6 C;  2LE9 B;  2ZN8 A;  3AAK A;  4YI9 A;  3CR2 A;  4ETO A;  1E8A A;  1C07 A;  1TCF A;  1ZMZ A;  1NSH A;  1L2O C;  5AAN A;  1AK8 A;  1IQ3 A;  4I5L B;  1RTP 1;  3I5H C;  1ALW A;  1M63 B;  4MN0 A;  1OZO A;  3EK7 A;  2KAV A;  3EK8 A;  3IQO A;  3CR5 X;  1LXF C;  1B7T Z;  2JOJ A;  2ZND A;  4OR9 B;  2KI4 B;  1IG5 A;  2M0R A;  1Y6W A;  1K93 D;  2MAZ A;  5AER A;  1CDM A;  1AHR A;  2LHI A;  1IJ5 A;  1A75 B;  3PAL A;  4ICB A;  1CDN A;  2JPT A;  1KFU L;  2P6B B;  1F4O A;  3O6B A;  2WCF A;  1YVH A;  1CDP A;  3EVV A;  1YUR A;  3QRX A;  3TUY B;  3DVK A;  1OMD A;  3GK2 A;  1JC2 A;  3PLF B;  2KYF A;  2K7C A;  1KSM A;  2JXC A;  1Q80 A;  2KNE A;  3EVU A;  3NSI A;  2NZ0 A;  1QJT A;  1UP5 A;  1TTX A;  1PK0 D;  3FWC A;  1B4C A;  1NX3 A;  2CBL A;  2LNK A;  5HLV A;  2FCE A;  4MVF A;  4ZCU A;  2WCE A;  4DCK A;  2L5X B;  4ORC B;  3SIA A;  3VRR A;  4JWQ A;  4I5K A;  1LIN A;  4P5O E;  3D10 A;  1JBA A;  4MBE A;  1UHJ A;  1N2D A;  3EKH A;  1SBJ A;  4FTG A;  1SYM A;  1UHN A;  3TDU A;  1QV0 A;  1CKK A;  1REC A;  2KBM A;  5I2L A;  2BE6 A;  4AQJ A;  4GPL B;  1A75 A;  2OTG C;  1XO5 A;  3SG4 A;  2ZFD A;  1NYA A;  1K9U A;  3EK4 A;  2E6W A;  2K7O A;  1CFC A;  1XFZ O;  2L98 A;  3JTD B;  1A2X A;  2M97 A;  3K21 A;  1WRZ A;  3JVT B;  1IH0 A;  1FW4 A;  3WHU B;  3F45 A;  5DKQ A;  4FQO A;  4GAO A;  1XFW O;  2M29 A;  1YUU A;  2JZI A;  1CLB A;  2HET A;  2F8P A;  2ZRT A;  1DJY A;  3ZNI A;  1K94 A;  1RWY A;  2LM5 A;  2D8N A;  2LVI A;  1F8H A;  4YGA A;  3NSL A;  2JNF A;  3PAT A;  2KAY A;  1BR1 B;  1Y1X A;  2MHH A;  3DVE A;  1NPQ A;  1SPY A;  1N0Y A;  1BF5 A;  1SL8 A;  5BPJ A;  1KQM C;  1AUI B;  2K0J A;  1U5I B;  3A4U B;  2MBX A;  2SAS A;  1GGW A;  5IBW A;  4YGB B;  1WLZ A;  1SMG A;  2LLU A;  1BT6 A;  5JOL A;  2BL0 C;  1QAS A;  4YRU A;  1DMO A;  4I5N B;  2KHN A;  2EC6 B;  2PMY A;  5JJG A;  2GV5 A;  2KFG A;  2AMI A;  1SCV A;  2LV7 A;  2K2A A;  3RLZ A;  1JFJ A;  1JF0 A;  2I94 A;  5AXI A;  1OSA A;  5CSF A;  2JT3 A;  2M7N A;  1UUS A;  2Y1N A;  3OX5 A;  4JQ0 D;  4M2O A;  2EC6 C;  2CCM A;  5ER5 A;  4C0K A;  2R2I A;  1ZFS A;  1VRK A;  4AQI A;  1TCO B;  1SL9 A;  1CMF A;  1M39 A;  3OB2 B;  1J7P A;  4HRG A;  2EHB A;  3MSE B;  4PE0 A;  2JT8 A;  3TS5 C;  1IKU A;  1BOD A;  2LUC A;  1PSB A;  4MZK A;  5J3X A;  1L2O B;  2BBN A;  1ZAC A;  2CTN A;  1R2U A;  2PAL A;  3DD4 A;  3I5H B;  4YI8 A;  4ZCV A;  1JSA A;  1U5I A;  1XK4 C;  4QJ4 B;  1NUB A;  3CZT X;  1NIW A;  4XYN A;  4MZL A;  5CSI A;  3VRQ A;  2HQW A;  4I5J A;  1NX2 A;  1B47 A;  2K61 A;  4MLW A;  2LAP A;  3OP0 A;  3GK1 A;  3I5G C;  4CPV A;  2Y5I A;  2PAS A;  4DS7 A;  3BQ3 A;  2KGR A;  2LMU A;  1M46 A;  1JFK A;  5K89 A;  1DTL A;  2LP3 A;  1J55 A;  1QS7 A;  2FJU B;  2JC2 A;  4MZJ A;  1K8U A;  4ORA B;  4UPG A;  2L2E A;  2ZRS A;  4PE4 A;  1YUT A;  1CTR A;  2FCD A;  4R1E A;  2MA2 A;  1TRF A;  2B1U A;  2I18 A;  2K7D A;  3EVR A;  2M1K B;  1KK7 Z;  2KYC A;  1F55 A;  1SW8 A;  2QPT A;  1S6C A;  2AUC A;  2K2F A;  5ER4 X;  1YTZ C;  1QV1 A;  1BLQ A;  1K96 A;  1XK4 A;  1JF2 A;  1CFD A;  2M49 B;  4GNK B;  5CPV A;  2DOQ A;  2M1U A;  1B1G A;  4Q04 A;  1BU3 A;  3TDZ A;  3I5I C;  3BUM B;  1YRT B;  1K9P A;  1EL4 A;  1PRW A;  1FI5 A;  1OE9 B;  1V1F A;  2GGZ A;  3NSO A;  4HSZ A;  4PDZ A;  5D69 A;  3LK0 A;  2Y1M A;  4OKH A;  1RRO A;  1S3P A;  1WDC C;  3IQQ A;  1AVS A;  2M7L A;  4A4C A;  1NCZ A;  1M45 A;  2LC5 A;  4C0J A;  1R6P A;  1Y1U A;  4CFQ A;  1IRJ A;  2OTG B;  4WQ3 A;  4N1F A;  2F2O A;  2LVV A;  3KEV A;  1QTX A;  5DKN A;  2WC8 A;  2LMV A;  1DGU A;  1TNW A;  1SCM B;  4CFR A;  1F71 A;  2JWW A;  1KFU S;  1DJI A;  2JU0 A;  2K7B A;  2SCP A;  1TIZ A;  1DVI A;  1NP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...