2JWWA

Calcium-free rat alpha-parvalbumin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
109
structure length
109
Chain Sequence
SMTDLLSAEDIKKAIGAFTAADSFDHKKFFQMVGLKKKSADDVKKVFHILDKDKSGFIEEDELGSILKGFSSDARDLSAKETKTLMAAGDKDGDGKIGVEEFSTLVAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Parvalbumin alpha
publication title Solution structure of Ca2+-free rat alpha-parvalbumin
pubmed doi rcsb
source organism Rattus norvegicus
total genus 26
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2007-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2jwwA00
2JC2A 3TUYB 1K9UA 5AFPA 3RLZA 2EHBA 4XJKA 1AK8A 1JF0A 4ORAB 4CFQA 1OMRA 1WRZA 1JBAA 5CSIA 1NYAA 2KSPA 2Y5IA 3D10A 1MQ1A 4QJ4B 4YGDB 3D0YA 2BL0C 4PHJA 2WCEA 3DVMA 1IRJA 3EK4A 4C0KA 1PK0D 4DIRA 1S1EA 1OZSA 1M45A 1W7JB 1SCVA 1SMGA 1LKJA 1KK8B 1B8RA 1OMDA 2HQWA 1L7ZA 2JRFA 1XK4A 2ZN9A 1PVAA 3KHEA 2H61C 3AAKA 1B9AA 3VGOA 3SIAA 3IQQA 2ZFDA 1KFUS 1M31A 2EGDA 4ORCB 1R2UA 1NP8A 2K7OA 2F8PA 2AMIA 1SCMB 2KQ6A 3TUYC 1KFXL 1DT7B 2CCMA 1XO5A 1CNPA 1YUUA 1A29A 2L4IA 4OKHA 3CLNA 4M2PA 1MXLC 2PASA 4YGBB 1TNPA 1RJVA 2F2OA 1SY9A 3JVTB 3PATA 2PMYA 4JWQA 4PE4A 2L98A 2JQ6A 2NCOA 4L9MA 4R1EA 3A8RA 1SRAA 1KQMB 1CM1A 2EC6B 2LMUA 2O60A 5F6TA 1JWDA 2FCDA 3MSEB 1YRUB 2ZNDA 1BG1A 2K0JA 1TNXA 1QTXA 1KK8C 5JJGA 4N5XA 5KU1A 1AP4A 1F4OA 1WDCB 2FJUB 2LP3A 2M49B 2JT8A 1QX2A 2LE9B 3TS5B 5B8IB 4FQOA 1DJWA 1A2XA 3SG7A 2ZRSA 2G2BA 1FI5A 3BUOB 3WHTB 2QPTA 1A75B 5AANA 3FIAA 1C07A 1A03A 3FS7A 3PALA 1XFUO 3SJSA 1QV1A 4Q04A 1UHNA 1OZOA 3NSKA 1SCMC 2JULA 1FI6A 2CT9A 1YUSA 3CR2A 2Y1NA 1BLQA 2ZKMX 4AOMA 1J7OA 5K89A 3PM8A 3BYAA 4XJKB 1SBJA 3OB1B 2LVJA 1M39A 1KFXS 1LA3A 1V1GA 1YTZC 2M97A 2KFFA 2SCPA 4MZLA 4YRUA 1IKUA 3JVTC 5ER5A 1UWOA 2BKHB 1SPYA 2LAPA 3D0YB 3LCPC 1SL8A 1KQMC 2EC6C 1WLMA 1BOCA 1S6JA 4UPGA 2I18A 2JPTA 3PSRA 1MR8A 3SG3A 1B1GA 4OR9B 2BKIB 4NDBA 1UUSA 1WDCC 5AEQA 2KAXA 1KQVA 4PDZA 1G8IA 2LANA 4GFTA 3TS5C 3SG2A 1DJZA 1R6PA 3PFVA 1EL4A 4I5JA 3OB2B 1YX7A 2PRUA 1BF5A 1JFJA 1CFPA 5KSZA 3QRXA 5JOLA 1QXPA 1CB1A 2O5GA 1JUOA 1G33A 3VRPA 1RWYA 4HSZA 2BE6A 2GGZA 1MUXA 2AAOA 1OMVA 1PSRA 2K2FA 2KI4C 1W7IB 1XYDA 4YGEB 1AJ5A 1K9KA 2KFHA 2IS9A 3VROA 1BT6A 1D1OA 1IGVA 4A4BA 3CZTX 1IJ5A 4PHMA 2M1KB 3CTNA 3OHMB 3WXAA 5DKRA 5CSNA 3WNXB 1UHHA 5I2OA 1K95A 4OV2A 1XFZO 2KNEA 1XA5A 4NDCA 3BUXB 1K96A 1UP5A 1ZACA 3O4YA 1TNWA 3CR4X 2COLB 2KFGA 2M3WA 3F45A 3SG4A 3TDZA 3SIBA 3E3RA 1Y1XA 2JXLA 2KQYA 1NUBA 4MZJA 1AVSA 5I2LA 1OSAA 2JNXA 1DTLA 1F4QA 4BY4A 1XK4C 1GGZA 2OTGB 4N1FA 1TN4A 1NX3A 1K8UA 1CKKA 3KPXA 2LHIA 2PVBA 1JC2A 1TCOB 2JNFA 4P2YB 1QLSA 1AUIB 3BUMB 3BOWB 5BPJA 4YGAA 4MRXA 2JT0A 2KYCA 3EKHA 4C0JA 4PHKA 1ZUZA 4D1EA 1UHKA 2KAVA 1DMOA 2LVVA 3IF7A 2F3YA 5CSJA 2HPSA 2JU0A 4HRGA 2V53A 3BXKA 2LMTA 1DJIA 1QV0A 2KDHA 4QJ5B 2Q91A 1KSMA 1NX2A 1WLZA 3EVVA 2A4JA 2KAYA 3DVKA 1AHRA 3OX5A 5HKYA 4PE1A 2OTGC 2GV5A 2Y4QA 3GOFA 1FF1A 1UHIA 1CLMA 3EK7A 2L2EA 1N0YA 2WORA 5HLVA 4GPLB 4MLWA 3AKAA 1H4BA 3O6BA 4YI9A 4OCIA 3NSIA 1DF0B 1SNLA 1SYMA 4TNCA 1BJFA 2KBIA 2F2PA 1HT9A 1TCFA 1JFKA 1GQMA 1YVHA 3PLFB 2GGMA 1KWOB 1J1DA 1CFDA 3BQ3A 1ZOTB 1U5IA 3ZNIA 3O78A 1B47A 1QIVA 3KF9A 2D8NA 1S3PA 5CSFA 1V1FA 5AXIA 2E30A 2P6BB 1YRTB 1K93D 3CS1A 2BCBA 3TDIA 4MZKA 1TRFA 3WHUB 3BUNB 3DVEA 2NCPA 3GK4X 1DJGA 2WC8A 4N1GA 1Q80A 1CFFA 1XFVO 3I5IB 1J7RA 3ICBA 1CDMA 4MEWA 1FW4A 2KI4B 1XVJA 3IQOA 2LCPA 2MAZA 4A4CA 4ZCUA 3CWGA 1NCZA 4AQIA 2JT3A 2AUCA 1F54A 2JTZA 1A4PA 1OOJA 1DJHA 2M1UA 1NIWA 1NX0A 2LMVA 3VRNA 3HX4A 2KOTA 1MHOA 3NXAA 1CDNA 2CNPA 1OQPA 1SK6D 2DOQA 3H4SE 2KGRA 4GNKB 2R2IA 4BY5A 3A4UB 1K90D 1QJTA 4CIDA 1KWOC 4DUQA 2LP2A 2BCXA 3AAJA 2HF5A 2G9BA 5AERA 4M2QA 1F8HA 1F71A 1K2HA 5J3XA 3VRRA 1IQ3A 1Y1UA 3ZWHA 1BR1B 2JOJA 4HREE 2MA2A 2FCEA 5G08A 4HRHA 2K7DA 2ZRTA 1QLKA 2TN4A 3I5IC 3TDUA 1KK7Y 2WNDA 2MRDA 2Q4UA 4GUKA 1KSOA 1J55A 1N2DA 1B4CA 1DGVA 2LLSA 1QVIY 4ZCVA 1EJ3A 3JTDB 1HQVA 4F0ZB 2BECA 1Y1AA 1ALVA 2BBMA 4I5KA 4PE7A 5HKZA 1N65A 3GK2A 3I5HB 2PALA 1SKTA 2VRGA 3I5GB 2KYFA 2LVKA 3AKBA 1SL7A 1S36A 1WY9A 4IL1A 1CLLA 4OVNF 2MLFC 4M2OA 4XYNA 4JQ0D 1OE9B 1RK9A 1RTP1 1BU3A 1S6CA 2F3ZA 3C1VA 2FOTA 2I94A 2OPOA 1U5IB 4WQ2A 1IG5A 4ICBA 4PCWA 2LLUA 4MSPA 2M7LA 2JZIA 1NCXA 1S5GZ 2L0PA 4I5NB 2L51A 1NX1A 4C0LA 3NSOA 3SG6A 1PULA 4ORBB 2KGBC 3KEVA 1RFJA 3BUWB 4GGFA 5FYXA 1EG4A 1BR4B 5D7FA 1SW8A 1XFYO 1DJXA 3OX6A 3JTDC 2HQ8A 3EVRA 3PN7B 1KK7Z 2K8MB 1WRLA 4AQJA 1CDLA 1B7TY 2BBNA 1X02A 2WCBA 2K7CA 3I5HC 4GGNA 2H2KA 2LV7A 3I5GC 1CM4A 2Y1MA 5DKQA 1Y6WA 1QVIZ 2JWWA 4MRYA 4CPVA 2F33A 2BE4A 2WOSA 2CXJA 1C7VA 5HYDA 1B8CA 1IH0A 4MVFA 1NCYA 2RGIA 3OP0A 1ZFSA 3VRQA 1CDPA 2M8UA 1TNQA 3KO0A 3DF0A 1KCYA 2QACA 2LLTA 3O2PA 2KI6C 1CFCA 2ZNEA 1NPQA 1IWQA 5PALA 4DCKA 4CLNA 1CTRA 2JTTA 1WRKA 1MF8B 1SR6B 1DJYA 1LINA 4NQGA 1CMFA 1E8AA 1MXEA 5IBWA 1IQ5A 3PN7C 4NDDA 5CPVA 3FWBA 4I5LB 4DS7A 2MBXA 2K7BA 1ODBA 1DGUA 1YVLA 4QJ3B 1CMGA 1NSHA 2OS8B 1QS7A 1PRWA 3GK1A 2WCFA 1S26D 1BODA 4PALA 2H61A 1J7QA 2SASA 1TTXA 2MLEC 1ZMZA 3FWCA 4ETOA 1B7TZ 2JXCA 3NSLA 2LUCA 1JSAA 1DVIA 2LNKA 1J1EA 1VRKA 5HKWA 1K94A 2MHHA 1PVBA 4GAOA 4FTGA 3RM1A 1C7WA 3TZ1A 1F55A 3K21A 1L2OB 2ZN8A 1J7PA 4MN0A 1EG3A 1JF2A 3LK0A 2I2RE 3DVJA 3M0WA 3EK8A 2L5XB 1IJ6A 1SL9A 2M0RA 2KBMA 2NZ0A 2L50A 5GQQC 4WQ3A 1YURA 1H8BA 2CTNA 1NWDA 2M9GA 1SR6C 3DD4A 2B1UA 2I7AA 3EKJA 1PALA 3BOWA 5DKNA 5ER4X 2KI6D 3I5FB 4PHNA 1EXRA 1S5GY 2M29A 3CGAA 5I2QA 1PSBA 1RROA 2M7NA 3SG5A 2OS8C 5I8NA 4YBHB 1UHJA 1K9PA 1YUTA 2HETA 2BCAA 1EH2A 1FPWA 2NLNA 1ALWA 2LHLA 5HLOA 1G4YR 4WRIA 1LVCD 2L4HA 3HCMA 1QIWA 4P5OE 4PE0A 5KTYA 1GGWA 2MJWB 2LC5A 3EVUA 2CBLA 1B8LA 1GJYA 1M46A 1L2OC 4DRWA 1TIZA 1YR5A 2KHNA 1XFWO 3DF0B 1Y0VH 4USLA 1XFXO 4U8DA 3CR5X 1LXFC 1TOPA 3LLEA 2K61A 2LVIA 2K2AA 4JPZB 2BL0B 3LL8B 1QX5B 1DF0A 2PSRA 2LUXA 4GGFC 1FBVA 1M63B 3I5FC 2NXQA 1UURA 1CLBA 1BMOA 1AJ4A 1MWNA 2E6WA 5D69A 1LA0A 4E68A 3LK1A 1KFUL 4MBEA 1A75A 1QASA 1RECA 4YI8A 1F70A 1S6IA 1YX8A 1QX7A 2ISDA 4CFRA 4YGCB 1QATA 2LM5A 5TNCA 4GBAA
chains in the Genus database with same CATH superfamily
2JC2A 3TUYB 1K9UA 5AFPA 3RLZA 2EHBA 4XJKA 1AK8A 1JF0A 4ORAB 4CFQA 1OMRA 1WRZA 1JBAA 5CSIA 1NYAA 2KSPA 2Y5IA 3D10A 1MQ1A 4QJ4B 4YGDB 3D0YA 2BL0C 4PHJA 2WCEA 3DVMA 1IRJA 3EK4A 4C0KA 1PK0D 4DIRA 1S1EA 1OZSA 1M45A 1W7JB 3PM2A 1SCVA 1SMGA 1LKJA 1KK8B 1B8RA 1OMDA 2HQWA 5FI2A 1L7ZA 2JRFA 1XK4A 2GTEA 2ZN9A 1PVAA 3KHEA 2H61C 3AAKA 1B9AA 1DEKA 3VGOA 4INWA 3IQQA 2ZFDA 1KFUS 1M31A 2EGDA 4ORCB 3SIAA 1R2UA 1NP8A 2K7OA 1LS8A 2F8PA 2AMIA 1SCMB 2KQ6A 3TUYC 2YGUA 1KFXL 1DT7B 2CCMA 3DYEA 1XO5A 1CNPA 1YUUA 1A29A 2L4IA 3FE8A 4OKHA 3CLNA 4M2PA 1MXLC 2PASA 4YGBB 2L2CA 1TNPA 1RJVA 2F2OA 3N7HA 1SY9A 3JVTB 3PATA 2PMYA 4JWQA 4PE4A 2L98A 2JQ6A 2NCOA 4L9MA 4R1EA 3A8RA 1SRAA 1KQMB 1CM1A 2EC6B 2LMUA 2O60A 5F6TA 1JWDA 2FCDA 3MSEB 1YRUB 2ZNDA 1BG1A 2K0JA 1TNXA 1QTXA 1KK8C 5JJGA 4N5XA 5KU1A 1AP4A 1F4OA 1WDCB 2FJUB 2LP3A 2M49B 2JPOA 3QMEA 2JT8A 1QX2A 2LE9B 3TS5B 5B8IB 3BJHA 2WCJA 1DJWA 4FQOA 1A2XA 3SG7A 2ZRSA 2G2BA 1FI5A 3BUOB 3WHTB 2QPTA 1A75B 5AANA 3FIAA 1C07A 1A03A 3FS7A 3PALA 1XFUO 1IIOA 4KYNA 3SJSA 1DELA 1QV1A 3NHIA 4Q04A 1UHNA 1OZOA 3NSKA 1SCMC 2JULA 1FI6A 2CT9A 1YUSA 3CR2A 2Y1NA 1BLQA 2ZKMX 4AOMA 1J7OA 5K89A 3PM8A 3D78A 3BYAA 4XJKB 1SBJA 3OB1B 2LVJA 1M39A 1KFXS 1LA3A 1V1GA 1YTZC 2M97A 2KFFA 2SCPA 4MZLA 4YRUA 1IKUA 3JVTC 5ER5A 1UWOA 2BKHB 1SPYA 2LAPA 3D0YB 3LCPC 1SL8A 1KQMC 2EC6C 1WLMA 1BOCA 1S6JA 4UPGA 2I18A 2JPTA 2WCHA 1MR8A 3PSRA 3SG3A 1B1GA 4OR9B 2BKIB 4NDBA 1UUSA 1WDCC 5AEQA 2KAXA 1KQVA 4PDZA 2KPHA 1G8IA 2LANA 4GFTA 3TS5C 3SG2A 1DJZA 1R6PA 3PFVA 1EL4A 4I5JA 2QDIA 3OB2B 1YX7A 5HL1A 2PRUA 1BF5A 1JFJA 1CFPA 5KSZA 3QRXA 5JOLA 1QXPA 1CB1A 2O5GA 1JUOA 1G33A 3VRPA 1RWYA 4HSZA 2BE6A 2GGZA 1MUXA 2AAOA 1OMVA 1PSRA 2K2FA 2KI4C 1W7IB 1XYDA 4YGEB 1AJ5A 1K9KA 2KFHA 2IS9A 3VROA 5FI7A 1BT6A 1D1OA 1IGVA 4A4BA 3CZTX 1IJ5A 4PHMA 3L4AA 2M1KB 3CTNA 3OHMB 3WXAA 5DICA 5DKRA 5CSNA 3WNXB 1UHHA 5I2OA 3S0AA 1K95A 3L4LA 4OV2A 1XFZO 2KNEA 1XA5A 4NDCA 3BUXB 3SS4A 1K96A 1UP5A 3FE9A 1ZACA 3O4YA 1TNWA 3CR4X 2L5YA 2COLB 2KFGA 2M3WA 3F45A 3SG4A 3TDZA 3S0FA 2K60A 3SIBA 3E3RA 1Y1XA 2JXLA 2QEHA 2KQYA 1NUBA 4MZJA 1AVSA 5I2LA 1OSAA 2JNXA 1DTLA 1F4QA 4BY4A 1XK4C 1GGZA 2OTGB 4N1FA 1TN4A 4JKTA 1NX3A 1K8UA 1CKKA 3KPXA 1OOGA 2LHIA 2PVBA 2QEVA 1JC2A 1TCOB 2JNFA 4P2YB 3S0EA 1QLSA 3B6XA 2WC6A 1AUIB 3BUMB 3BOWB 5BPJA 4YGAA 3IVTA 3SS5A 4MRXA 2JT0A 2KYCA 3BFBA 3EKHA 4PHKA 4C0JA 3NGVA 1ZUZA 4D1EA 1UHKA 2KAVA 1DMOA 3S0GA 2LVVA 3D74A 3IF7A 2F3YA 1XFRA 5CSJA 2HPSA 2JU0A 4HRGA 2V53A 3NHTA 3B88A 3BXKA 2LMTA 1DJIA 1QV0A 4FQTA 2KDHA 4QJ5B 2Q91A 3D75A 1KSMA 1NX2A 1WLZA 3EVVA 2A4JA 2KAYA 3DVKA 1AHRA 3OX5A 5HKYA 4PE1A 2OTGC 2GV5A 2Y4QA 3GOFA 1FF1A 1UHIA 1CLMA 3EK7A 2L2EA 1N0YA 2WORA 5HLVA 1QWVA 4GPLB 4MLWA 3AKAA 1DQEA 3R1PA 1H4BA 3O6BA 4YI9A 4OCIA 3NSIA 1DF0B 1SNLA 1SYMA 4TNCA 2QEBA 1BJFA 1OOHA 2KBIA 2F2PA 1HT9A 1TCFA 1JFKA 1GQMA 1YVHA 3PLFB 2GGMA 1KWOB 2QEOA 1J1DA 1CFDA 3BQ3A 1ZOTB 1U5IA 3ZNIA 3Q8IA 3O78A 2PYQA 1B47A 1QIVA 3B86A 1DC1A 3KF9A 2D8NA 1S3PA 2WCLA 1V1FA 4JD9A 2E30A 2P6BB 5CSFA 5AXIA 1YRTB 1K93D 3CS1A 2BCBA 3TDIA 4MZKA 1TRFA 2WCKA 3OBVA 3WHUB 3BUNB 3DVEA 2ERBA 2NCPA 3GK4X 1DJGA 2WC8A 4N1GA 1Q80A 1CFFA 3S0BA 1XFVO 3I5IB 1J7RA 2P70A 3ICBA 1CDMA 4MEWA 1FW4A 2KI4B 1XVJA 3IQOA 2LCPA 2MAZA 4A4CA 3DXLA 4ZCUA 3CWGA 1NCZA 4AQIA 2JT3A 2AUCA 1F54A 2JTZA 1A4PA 1OOJA 1DJHA 2M1UA 1NIWA 1NX0A 2LMVA 3VRNA 3HX4A 2KOTA 1MHOA 3NXAA 1CDNA 2CNPA 3CYZA 1OQPA 1SK6D 2DOQA 3H4SE 2KGRA 4GNKB 2R2IA 4BY5A 3A4UB 1K90D 1QJTA 2BAPA 2KLDA 1OOIX 1KWOC 4CIDA 4DUQA 2LP2A 2BCXA 3AAJA 2HF5A 2G9BA 5AERA 4M2QA 1F8HA 1F71A 1K2HA 5J3XA 1SSEB 3VRRA 1IQ3A 1Y1UA 3ZWHA 1BR1B 3S0DA 2JOJA 4HREE 2MA2A 4F7FA 2FCEA 5EL2A 5G08A 4HRHA 2K7DA 2ZRTA 3CZ1A 1QLKA 2TN4A 3I5IC 3TDUA 1KK7Y 2WNDA 2MRDA 2Q4UA 3UO9A 4GUKA 1KSOA 1J55A 1N2DA 1B4CA 3VB1A 1DGVA 2LLSA 1QVIY 4ZCVA 1EJ3A 3JTDB 2P71A 1HQVA 4F0ZB 2BECA 1Y1AA 1ALVA 2BBMA 4I5KA 4PE7A 5HKZA 1N65A 3GK2A 3FE6A 3I5HB 1ORGA 1C3ZA 1SKTA 2PALA 2VRGA 3I5GB 2KYFA 2LVKA 3AKBA 1SL7A 1S36A 1WY9A 4IL1A 1CLLA 3R1OA 4OVNF 2MLFC 4M2OA 4XYNA 4JQ0D 1OE9B 1RK9A 1RTP1 1BU3A 1S6CA 2F3ZA 3C1VA 2FOTA 2I94A 2OPOA 1U5IB 4WQ2A 1IG5A 3DY9A 4ICBA 4PCWA 2LLUA 4MSPA 2M7LA 2JZIA 4INXA 1NCXA 1S5GZ 2L0PA 4I5NB 2L51A 1NX1A 4C0LA 3NSOA 3V2LA 3SG6A 1PULA 4ORBB 2KGBC 3KEVA 3D77A 1RFJA 3BUWB 4GGFA 5FYXA 1EG4A 1BR4B 5D7FA 1SW8A 1XFYO 1DJXA 3OX6A 3JTDC 2HQ8A 3EVRA 3PN7B 1KK7Z 3R1VA 2K8MB 1WRLA 4AQJA 1CDLA 1B7TY 2BBNA 1X02A 2WCBA 2K7CA 3I5HC 4GGNA 2H2KA 2LV7A 3I5GC 1CM4A 2Y1MA 1OW4A 5DKQA 1Y6WA 1QVIZ 3B7AA 2BNXA 4PT1A 2JWWA 4MRYA 3BFHA 4CPVA 2F33A 1T14A 3D73A 2BE4A 2WOSA 2CXJA 3DZTA 1C7VA 5HYDA 1B8CA 1IH0A 4MVFA 1NCYA 2RGIA 3OP0A 1ZFSA 2WC5A 3VRQA 1CDPA 2M8UA 1TNQA 3KO0A 3DF0A 1KCYA 2QACA 2LLTA 3O2PA 2KI6C 3EG5B 1CFCA 2ZNEA 1NPQA 1IWQA 5PALA 3PJIA 4DCKA 4CLNA 3CDNA 1CTRA 3R72A 2JTTA 1WRKA 1MF8B 1SR6B 1DJYA 1LINA 4NQGA 1CMFA 1E8AA 1MXEA 5IBWA 1IQ5A 3PN7C 4NDDA 5CPVA 3FWBA 4I5LB 4DS7A 3K1EA 2MBXA 2K7BA 1ODBA 1DGUA 1YVLA 4QJ3B 1CMGA 1NSHA 2OS8B 1QS7A 1PRWA 3GK1A 2H8VA 2KLEA 2WCFA 1S26D 1BODA 4PALA 2H61A 1J7QA 2SASA 1W9ZA 1TTXA 2MLEC 3SS3A 1ZMZA 3FWCA 4ETOA 1B7TZ 2JXCA 3NSLA 2LUCA 1JSAA 1DVIA 2LNKA 1J1EA 3CABA 1VRKA 1Z4HA 1K94A 5HKWA 2PQLA 2MHHA 1PVBA 4GAOA 4FTGA 3RM1A 1C7WA 3TZ1A 1F55A 3K21A 1L2OB 2ZN8A 3D76A 3O4XA 1J7PA 4MN0A 1EG3A 1JF2A 3LK0A 1GM0A 2I2RE 3DVJA 3M0WA 3EK8A 2L5XB 1IJ6A 1SL9A 2M0RA 2KBMA 2NZ0A 2L50A 5GQQC 4WQ3A 1YURA 1H8BA 2CTNA 1NWDA 2M9GA 1SR6C 3DD4A 2B1UA 3OGNA 2I7AA 3EKJA 1PALA 3BOWA 5DKNA 5ER4X 2KI6D 3I5FB 4PHNA 1EXRA 1S5GY 2M29A 3CGAA 5I2QA 1PSBA 1RROA 2M7NA 2WCMA 3SG5A 2OS8C 5FI6A 3RZSA 5I8NA 4YBHB 1UHJA 1K9PA 1YUTA 2HETA 2BCAA 1EH2A 1FPWA 2NLNA 1ALWA 2LHLA 1P28A 5HLOA 4IJ7A 1G4YR 4WRIA 1LVCD 1TWOA 2L4HA 1QIWA 3HCMA 4P5OE 4PE0A 5KTYA 1GGWA 2MJWB 2LC5A 3EVUA 2CBLA 1B8LA 1GJYA 1M46A 1L2OC 4DRWA 1TIZA 1YR5A 2KHNA 1XFWO 3DF0B 1Y0VH 4USLA 1XFXO 4U8DA 3CR5X 5D3OA 1LXFC 1Z2CB 1TOPA 3LLEA 2K61A 2LVIA 2K2AA 3B87A 4JPZB 5I94A 2BL0B 3LL8B 1QX5B 1DF0A 2PSRA 2LUXA 4GGFC 1FBVA 1M63B 3BFAA 3I5FC 2NXQA 1UURA 1CLBA 1BMOA 1AJ4A 1MWNA 2E6WA 3L47A 5D69A 4OZDA 1LA0A 3CZ0A 3LK1A 1OOFA 4E68A 1KFUL 4MBEA 1A75A 1QASA 1RECA 4YI8A 1F70A 1S6IA 1YX8A 1QX7A 2ISDA 1TUZA 3CZ2A 3UNWA 4CFRA 1C3YA 4YGCB 1QATA 2FJYA 2LM5A 5TNCA 4GBAA 1TUJA
chains in the Genus database with same CATH topology
2JC2A 3TUYB 1K9UA 5AFPA 3RLZA 2EHBA 4XJKA 1AK8A 1JF0A 4ORAB 4CFQA 1OMRA 1WRZA 1JBAA 5CSIA 1NYAA 2KSPA 2Y5IA 3D10A 1MQ1A 4QJ4B 4YGDB 3D0YA 2BL0C 4PHJA 2WCEA 3DVMA 1IRJA 3EK4A 4C0KA 1PK0D 4DIRA 1S1EA 1OZSA 1M45A 1W7JB 1SCVA 1SMGA 1LKJA 1KK8B 1B8RA 1OMDA 2HQWA 1L7ZA 2JRFA 1XK4A 2ZN9A 1PVAA 3KHEA 2H61C 3AAKA 1B9AA 3VGOA 3SIAA 3IQQA 2ZFDA 1KFUS 1M31A 2EGDA 4ORCB 1R2UA 1NP8A 2K7OA 2F8PA 2AMIA 1SCMB 2KQ6A 3TUYC 1KFXL 1DT7B 2CCMA 1XO5A 1CNPA 1YUUA 1A29A 2L4IA 4OKHA 3CLNA 4M2PA 1MXLC 2PASA 4YGBB 1TNPA 1RJVA 2F2OA 1SY9A 3JVTB 3PATA 2PMYA 4JWQA 4PE4A 2L98A 2JQ6A 2NCOA 4L9MA 4R1EA 3A8RA 1SRAA 1KQMB 1CM1A 2EC6B 2LMUA 2O60A 5F6TA 1JWDA 2FCDA 3MSEB 1YRUB 2ZNDA 1BG1A 2K0JA 1TNXA 1QTXA 1KK8C 5JJGA 4N5XA 5KU1A 1AP4A 1F4OA 1WDCB 2FJUB 2LP3A 2M49B 2JT8A 1QX2A 2LE9B 3TS5B 5B8IB 4FQOA 1DJWA 1A2XA 3SG7A 2ZRSA 2G2BA 1FI5A 3BUOB 3WHTB 2QPTA 1A75B 5AANA 3FIAA 1C07A 1A03A 3FS7A 3PALA 1XFUO 3SJSA 1QV1A 4Q04A 1UHNA 1OZOA 3NSKA 1SCMC 2JULA 1FI6A 2CT9A 1YUSA 3CR2A 2Y1NA 1BLQA 2ZKMX 4AOMA 1J7OA 5K89A 3PM8A 3BYAA 4XJKB 1SBJA 3OB1B 2LVJA 1M39A 1KFXS 1LA3A 1V1GA 1YTZC 2M97A 2KFFA 2SCPA 4MZLA 4YRUA 1IKUA 3JVTC 5ER5A 1UWOA 2BKHB 1SPYA 2LAPA 3D0YB 3LCPC 1SL8A 1KQMC 2EC6C 1WLMA 1BOCA 1S6JA 4UPGA 2I18A 2JPTA 3PSRA 1MR8A 3SG3A 1B1GA 4OR9B 2BKIB 4NDBA 1UUSA 1WDCC 5AEQA 2KAXA 1KQVA 4PDZA 1G8IA 2LANA 4GFTA 3TS5C 3SG2A 1DJZA 1R6PA 3PFVA 1EL4A 4I5JA 3OB2B 1YX7A 2PRUA 1BF5A 1JFJA 1CFPA 5KSZA 3QRXA 5JOLA 1QXPA 1CB1A 2O5GA 1JUOA 1G33A 3VRPA 1RWYA 4HSZA 2BE6A 2GGZA 1MUXA 2AAOA 1OMVA 1PSRA 2K2FA 2KI4C 1W7IB 1XYDA 4YGEB 1AJ5A 1K9KA 2KFHA 2IS9A 3VROA 1BT6A 1D1OA 1IGVA 4A4BA 3CZTX 1IJ5A 4PHMA 2M1KB 3CTNA 3OHMB 3WXAA 5DKRA 5CSNA 3WNXB 1UHHA 5I2OA 1K95A 4OV2A 1XFZO 2KNEA 1XA5A 4NDCA 3BUXB 1K96A 1UP5A 1ZACA 3O4YA 1TNWA 3CR4X 2COLB 2KFGA 2M3WA 3F45A 3SG4A 3TDZA 3SIBA 3E3RA 1Y1XA 2JXLA 2KQYA 1NUBA 4MZJA 1AVSA 5I2LA 1OSAA 2JNXA 1DTLA 1F4QA 4BY4A 1XK4C 1GGZA 2OTGB 4N1FA 1TN4A 1NX3A 1K8UA 1CKKA 3KPXA 2LHIA 2PVBA 1JC2A 1TCOB 2JNFA 4P2YB 1QLSA 1AUIB 3BUMB 3BOWB 5BPJA 4YGAA 4MRXA 2JT0A 2KYCA 3EKHA 4C0JA 4PHKA 1ZUZA 4D1EA 1UHKA 2KAVA 1DMOA 2LVVA 3IF7A 2F3YA 5CSJA 2HPSA 2JU0A 4HRGA 2V53A 3BXKA 2LMTA 1DJIA 1QV0A 2KDHA 4QJ5B 2Q91A 1KSMA 1NX2A 1WLZA 3EVVA 2A4JA 2KAYA 3DVKA 1AHRA 3OX5A 5HKYA 4PE1A 2OTGC 2GV5A 2Y4QA 3GOFA 1FF1A 1UHIA 1CLMA 3EK7A 2L2EA 1N0YA 2WORA 5HLVA 4GPLB 4MLWA 3AKAA 1H4BA 3O6BA 4YI9A 4OCIA 3NSIA 1DF0B 1SNLA 1SYMA 4TNCA 1BJFA 2KBIA 2F2PA 1HT9A 1TCFA 1JFKA 1GQMA 1YVHA 3PLFB 2GGMA 1KWOB 1J1DA 1CFDA 3BQ3A 1ZOTB 1U5IA 3ZNIA 3O78A 1B47A 1QIVA 3KF9A 2D8NA 1S3PA 5CSFA 1V1FA 5AXIA 2E30A 2P6BB 1YRTB 1K93D 3CS1A 2BCBA 3TDIA 4MZKA 1TRFA 3WHUB 3BUNB 3DVEA 2NCPA 3GK4X 1DJGA 2WC8A 4N1GA 1Q80A 1CFFA 1XFVO 3I5IB 1J7RA 3ICBA 1CDMA 4MEWA 1FW4A 2KI4B 1XVJA 3IQOA 2LCPA 2MAZA 4A4CA 4ZCUA 3CWGA 1NCZA 4AQIA 2JT3A 2AUCA 1F54A 2JTZA 1A4PA 1OOJA 1DJHA 2M1UA 1NIWA 1NX0A 2LMVA 3VRNA 3HX4A 2KOTA 1MHOA 3NXAA 1CDNA 2CNPA 1OQPA 1SK6D 2DOQA 3H4SE 2KGRA 4GNKB 2R2IA 4BY5A 3A4UB 1K90D 1QJTA 4CIDA 1KWOC 4DUQA 2LP2A 2BCXA 3AAJA 2HF5A 2G9BA 5AERA 4M2QA 1F8HA 1F71A 1K2HA 5J3XA 3VRRA 1IQ3A 1Y1UA 3ZWHA 1BR1B 2JOJA 4HREE 2MA2A 2FCEA 5G08A 4HRHA 2K7DA 2ZRTA 1QLKA 2TN4A 3I5IC 3TDUA 1KK7Y 2WNDA 2MRDA 2Q4UA 4GUKA 1KSOA 1J55A 1N2DA 1B4CA 1DGVA 2LLSA 1QVIY 4ZCVA 1EJ3A 3JTDB 1HQVA 4F0ZB 2BECA 1Y1AA 1ALVA 2BBMA 4I5KA 4PE7A 5HKZA 1N65A 3GK2A 3I5HB 2PALA 1SKTA 2VRGA 3I5GB 2KYFA 2LVKA 3AKBA 1SL7A 1S36A 1WY9A 4IL1A 1CLLA 4OVNF 2MLFC 4M2OA 4XYNA 4JQ0D 1OE9B 1RK9A 1RTP1 1BU3A 1S6CA 2F3ZA 3C1VA 2FOTA 2I94A 2OPOA 1U5IB 4WQ2A 1IG5A 4ICBA 4PCWA 2LLUA 4MSPA 2M7LA 2JZIA 1NCXA 1S5GZ 2L0PA 4I5NB 2L51A 1NX1A 4C0LA 3NSOA 3SG6A 1PULA 4ORBB 2KGBC 3KEVA 1RFJA 3BUWB 4GGFA 5FYXA 1EG4A 1BR4B 5D7FA 1SW8A 1XFYO 1DJXA 3OX6A 3JTDC 2HQ8A 3EVRA 3PN7B 1KK7Z 2K8MB 1WRLA 4AQJA 1CDLA 1B7TY 2BBNA 1X02A 2WCBA 2K7CA 3I5HC 4GGNA 2H2KA 2LV7A 3I5GC 1CM4A 2Y1MA 5DKQA 1Y6WA 1QVIZ 2JWWA 4MRYA 4CPVA 2F33A 2BE4A 2WOSA 2CXJA 1C7VA 5HYDA 1B8CA 1IH0A 4MVFA 1NCYA 2RGIA 3OP0A 1ZFSA 3VRQA 1CDPA 2M8UA 1TNQA 3KO0A 3DF0A 1KCYA 2QACA 2LLTA 3O2PA 2KI6C 1CFCA 2ZNEA 1NPQA 1IWQA 5PALA 4DCKA 4CLNA 1CTRA 2JTTA 1WRKA 1MF8B 1SR6B 1DJYA 1LINA 4NQGA 1CMFA 1E8AA 1MXEA 5IBWA 1IQ5A 3PN7C 4NDDA 5CPVA 3FWBA 4I5LB 4DS7A 2MBXA 2K7BA 1ODBA 1DGUA 1YVLA 4QJ3B 1CMGA 1NSHA 2OS8B 1QS7A 1PRWA 3GK1A 2WCFA 1S26D 1BODA 4PALA 2H61A 1J7QA 2SASA 1TTXA 2MLEC 1ZMZA 3FWCA 4ETOA 1B7TZ 2JXCA 3NSLA 2LUCA 1JSAA 1DVIA 2LNKA 1J1EA 1VRKA 5HKWA 1K94A 2MHHA 1PVBA 4GAOA 4FTGA 3RM1A 1C7WA 3TZ1A 1F55A 3K21A 1L2OB 2ZN8A 1J7PA 4MN0A 1EG3A 1JF2A 3LK0A 2I2RE 3DVJA 3M0WA 3EK8A 2L5XB 1IJ6A 1SL9A 2M0RA 2KBMA 2NZ0A 2L50A 5GQQC 4WQ3A 1YURA 1H8BA 2CTNA 1NWDA 2M9GA 1SR6C 3DD4A 2B1UA 2I7AA 3EKJA 1PALA 3BOWA 5DKNA 5ER4X 2KI6D 3I5FB 4PHNA 1EXRA 1S5GY 2M29A 3CGAA 5I2QA 1PSBA 1RROA 2M7NA 3SG5A 2OS8C 5I8NA 4YBHB 1UHJA 1K9PA 1YUTA 2HETA 2BCAA 1EH2A 1FPWA 2NLNA 1ALWA 2LHLA 5HLOA 1G4YR 4WRIA 1LVCD 2L4HA 3HCMA 1QIWA 4P5OE 4PE0A 5KTYA 1GGWA 2MJWB 2LC5A 3EVUA 2CBLA 1B8LA 1GJYA 1M46A 1L2OC 4DRWA 1TIZA 1YR5A 2KHNA 1XFWO 3DF0B 1Y0VH 4USLA 1XFXO 4U8DA 3CR5X 1LXFC 1TOPA 3LLEA 2K61A 2LVIA 2K2AA 4JPZB 2BL0B 3LL8B 1QX5B 1DF0A 2PSRA 2LUXA 4GGFC 1FBVA 1M63B 3I5FC 2NXQA 1UURA 1CLBA 1BMOA 1AJ4A 1MWNA 2E6WA 5D69A 1LA0A 4E68A 3LK1A 1KFUL 4MBEA 1A75A 1QASA 1RECA 4YI8A 1F70A 1S6IA 1YX8A 1QX7A 2ISDA 4CFRA 4YGCB 1QATA 2LM5A 5TNCA 4GBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JC2 A;  3TUY B;  1K9U A;  5AFP A;  3RLZ A;  2EHB A;  4XJK A;  1AK8 A;  1JF0 A;  4ORA B;  4CFQ A;  1OMR A;  1WRZ A;  1JBA A;  5CSI A;  1NYA A;  2KSP A;  2Y5I A;  3D10 A;  1MQ1 A;  4QJ4 B;  4YGD B;  3D0Y A;  2BL0 C;  4PHJ A;  2WCE A;  3DVM A;  1IRJ A;  3EK4 A;  4C0K A;  1PK0 D;  4DIR A;  1S1E A;  1OZS A;  1M45 A;  1W7J B;  1SCV A;  1SMG A;  1LKJ A;  1KK8 B;  1B8R A;  1OMD A;  2HQW A;  1L7Z A;  2JRF A;  1XK4 A;  2ZN9 A;  1PVA A;  3KHE A;  2H61 C;  3AAK A;  1B9A A;  3VGO A;  3SIA A;  3IQQ A;  2ZFD A;  1KFU S;  1M31 A;  2EGD A;  4ORC B;  1R2U A;  1NP8 A;  2K7O A;  2F8P A;  2AMI A;  1SCM B;  2KQ6 A;  3TUY C;  1KFX L;  1DT7 B;  2CCM A;  1XO5 A;  1CNP A;  1YUU A;  1A29 A;  2L4I A;  4OKH A;  3CLN A;  4M2P A;  1MXL C;  2PAS A;  4YGB B;  1TNP A;  1RJV A;  2F2O A;  1SY9 A;  3JVT B;  3PAT A;  2PMY A;  4JWQ A;  4PE4 A;  2L98 A;  2JQ6 A;  2NCO A;  4L9M A;  4R1E A;  3A8R A;  1SRA A;  1KQM B;  1CM1 A;  2EC6 B;  2LMU A;  2O60 A;  5F6T A;  1JWD A;  2FCD A;  3MSE B;  1YRU B;  2ZND A;  1BG1 A;  2K0J A;  1TNX A;  1QTX A;  1KK8 C;  5JJG A;  4N5X A;  5KU1 A;  1AP4 A;  1F4O A;  1WDC B;  2FJU B;  2LP3 A;  2M49 B;  2JT8 A;  1QX2 A;  2LE9 B;  3TS5 B;  5B8I B;  4FQO A;  1DJW A;  1A2X A;  3SG7 A;  2ZRS A;  2G2B A;  1FI5 A;  3BUO B;  3WHT B;  2QPT A;  1A75 B;  5AAN A;  3FIA A;  1C07 A;  1A03 A;  3FS7 A;  3PAL A;  1XFU O;  3SJS A;  1QV1 A;  4Q04 A;  1UHN A;  1OZO A;  3NSK A;  1SCM C;  2JUL A;  1FI6 A;  2CT9 A;  1YUS A;  3CR2 A;  2Y1N A;  1BLQ A;  2ZKM X;  4AOM A;  1J7O A;  5K89 A;  3PM8 A;  3BYA A;  4XJK B;  1SBJ A;  3OB1 B;  2LVJ A;  1M39 A;  1KFX S;  1LA3 A;  1V1G A;  1YTZ C;  2M97 A;  2KFF A;  2SCP A;  4MZL A;  4YRU A;  1IKU A;  3JVT C;  5ER5 A;  1UWO A;  2BKH B;  1SPY A;  2LAP A;  3D0Y B;  3LCP C;  1SL8 A;  1KQM C;  2EC6 C;  1WLM A;  1BOC A;  1S6J A;  4UPG A;  2I18 A;  2JPT A;  3PSR A;  1MR8 A;  3SG3 A;  1B1G A;  4OR9 B;  2BKI B;  4NDB A;  1UUS A;  1WDC C;  5AEQ A;  2KAX A;  1KQV A;  4PDZ A;  1G8I A;  2LAN A;  4GFT A;  3TS5 C;  3SG2 A;  1DJZ A;  1R6P A;  3PFV A;  1EL4 A;  4I5J A;  3OB2 B;  1YX7 A;  2PRU A;  1BF5 A;  1JFJ A;  1CFP A;  5KSZ A;  3QRX A;  5JOL A;  1QXP A;  1CB1 A;  2O5G A;  1JUO A;  1G33 A;  3VRP A;  1RWY A;  4HSZ A;  2BE6 A;  2GGZ A;  1MUX A;  2AAO A;  1OMV A;  1PSR A;  2K2F A;  2KI4 C;  1W7I B;  1XYD A;  4YGE B;  1AJ5 A;  1K9K A;  2KFH A;  2IS9 A;  3VRO A;  1BT6 A;  1D1O A;  1IGV A;  4A4B A;  3CZT X;  1IJ5 A;  4PHM A;  2M1K B;  3CTN A;  3OHM B;  3WXA A;  5DKR A;  5CSN A;  3WNX B;  1UHH A;  5I2O A;  1K95 A;  4OV2 A;  1XFZ O;  2KNE A;  1XA5 A;  4NDC A;  3BUX B;  1K96 A;  1UP5 A;  1ZAC A;  3O4Y A;  1TNW A;  3CR4 X;  2COL B;  2KFG A;  2M3W A;  3F45 A;  3SG4 A;  3TDZ A;  3SIB A;  3E3R A;  1Y1X A;  2JXL A;  2KQY A;  1NUB A;  4MZJ A;  1AVS A;  5I2L A;  1OSA A;  2JNX A;  1DTL A;  1F4Q A;  4BY4 A;  1XK4 C;  1GGZ A;  2OTG B;  4N1F A;  1TN4 A;  1NX3 A;  1K8U A;  1CKK A;  3KPX A;  2LHI A;  2PVB A;  1JC2 A;  1TCO B;  2JNF A;  4P2Y B;  1QLS A;  1AUI B;  3BUM B;  3BOW B;  5BPJ A;  4YGA A;  4MRX A;  2JT0 A;  2KYC A;  3EKH A;  4C0J A;  4PHK A;  1ZUZ A;  4D1E A;  1UHK A;  2KAV A;  1DMO A;  2LVV A;  3IF7 A;  2F3Y A;  5CSJ A;  2HPS A;  2JU0 A;  4HRG A;  2V53 A;  3BXK A;  2LMT A;  1DJI A;  1QV0 A;  2KDH A;  4QJ5 B;  2Q91 A;  1KSM A;  1NX2 A;  1WLZ A;  3EVV A;  2A4J A;  2KAY A;  3DVK A;  1AHR A;  3OX5 A;  5HKY A;  4PE1 A;  2OTG C;  2GV5 A;  2Y4Q A;  3GOF A;  1FF1 A;  1UHI A;  1CLM A;  3EK7 A;  2L2E A;  1N0Y A;  2WOR A;  5HLV A;  4GPL B;  4MLW A;  3AKA A;  1H4B A;  3O6B A;  4YI9 A;  4OCI A;  3NSI A;  1DF0 B;  1SNL A;  1SYM A;  4TNC A;  1BJF A;  2KBI A;  2F2P A;  1HT9 A;  1TCF A;  1JFK A;  1GQM A;  1YVH A;  3PLF B;  2GGM A;  1KWO B;  1J1D A;  1CFD A;  3BQ3 A;  1ZOT B;  1U5I A;  3ZNI A;  3O78 A;  1B47 A;  1QIV A;  3KF9 A;  2D8N A;  1S3P A;  5CSF A;  1V1F A;  5AXI A;  2E30 A;  2P6B B;  1YRT B;  1K93 D;  3CS1 A;  2BCB A;  3TDI A;  4MZK A;  1TRF A;  3WHU B;  3BUN B;  3DVE A;  2NCP A;  3GK4 X;  1DJG A;  2WC8 A;  4N1G A;  1Q80 A;  1CFF A;  1XFV O;  3I5I B;  1J7R A;  3ICB A;  1CDM A;  4MEW A;  1FW4 A;  2KI4 B;  1XVJ A;  3IQO A;  2LCP A;  2MAZ A;  4A4C A;  4ZCU A;  3CWG A;  1NCZ A;  4AQI A;  2JT3 A;  2AUC A;  1F54 A;  2JTZ A;  1A4P A;  1OOJ A;  1DJH A;  2M1U A;  1NIW A;  1NX0 A;  2LMV A;  3VRN A;  3HX4 A;  2KOT A;  1MHO A;  3NXA A;  1CDN A;  2CNP A;  1OQP A;  1SK6 D;  2DOQ A;  3H4S E;  2KGR A;  4GNK B;  2R2I A;  4BY5 A;  3A4U B;  1K90 D;  1QJT A;  4CID A;  1KWO C;  4DUQ A;  2LP2 A;  2BCX A;  3AAJ A;  2HF5 A;  2G9B A;  5AER A;  4M2Q A;  1F8H A;  1F71 A;  1K2H A;  5J3X A;  3VRR A;  1IQ3 A;  1Y1U A;  3ZWH A;  1BR1 B;  2JOJ A;  4HRE E;  2MA2 A;  2FCE A;  5G08 A;  4HRH A;  2K7D A;  2ZRT A;  1QLK A;  2TN4 A;  3I5I C;  3TDU A;  1KK7 Y;  2WND A;  2MRD A;  2Q4U A;  4GUK A;  1KSO A;  1J55 A;  1N2D A;  1B4C A;  1DGV A;  2LLS A;  1QVI Y;  4ZCV A;  1EJ3 A;  3JTD B;  1HQV A;  4F0Z B;  2BEC A;  1Y1A A;  1ALV A;  2BBM A;  4I5K A;  4PE7 A;  5HKZ A;  1N65 A;  3GK2 A;  3I5H B;  2PAL A;  1SKT A;  2VRG A;  3I5G B;  2KYF A;  2LVK A;  3AKB A;  1SL7 A;  1S36 A;  1WY9 A;  4IL1 A;  1CLL A;  4OVN F;  2MLF C;  4M2O A;  4XYN A;  4JQ0 D;  1OE9 B;  1RK9 A;  1RTP 1;  1BU3 A;  1S6C A;  2F3Z A;  3C1V A;  2FOT A;  2I94 A;  2OPO A;  1U5I B;  4WQ2 A;  1IG5 A;  4ICB A;  4PCW A;  2LLU A;  4MSP A;  2M7L A;  2JZI A;  1NCX A;  1S5G Z;  2L0P A;  4I5N B;  2L51 A;  1NX1 A;  4C0L A;  3NSO A;  3SG6 A;  1PUL A;  4ORB B;  2KGB C;  3KEV A;  1RFJ A;  3BUW B;  4GGF A;  5FYX A;  1EG4 A;  1BR4 B;  5D7F A;  1SW8 A;  1XFY O;  1DJX A;  3OX6 A;  3JTD C;  2HQ8 A;  3EVR A;  3PN7 B;  1KK7 Z;  2K8M B;  1WRL A;  4AQJ A;  1CDL A;  1B7T Y;  2BBN A;  1X02 A;  2WCB A;  2K7C A;  3I5H C;  4GGN A;  2H2K A;  2LV7 A;  3I5G C;  1CM4 A;  2Y1M A;  5DKQ A;  1Y6W A;  1QVI Z;  2JWW A;  4MRY A;  4CPV A;  2F33 A;  2BE4 A;  2WOS A;  2CXJ A;  1C7V A;  5HYD A;  1B8C A;  1IH0 A;  4MVF A;  1NCY A;  2RGI A;  3OP0 A;  1ZFS A;  3VRQ A;  1CDP A;  2M8U A;  1TNQ A;  3KO0 A;  3DF0 A;  1KCY A;  2QAC A;  2LLT A;  3O2P A;  2KI6 C;  1CFC A;  2ZNE A;  1NPQ A;  1IWQ A;  5PAL A;  4DCK A;  4CLN A;  1CTR A;  2JTT A;  1WRK A;  1MF8 B;  1SR6 B;  1DJY A;  1LIN A;  4NQG A;  1CMF A;  1E8A A;  1MXE A;  5IBW A;  1IQ5 A;  3PN7 C;  4NDD A;  5CPV A;  3FWB A;  4I5L B;  4DS7 A;  2MBX A;  2K7B A;  1ODB A;  1DGU A;  1YVL A;  4QJ3 B;  1CMG A;  1NSH A;  2OS8 B;  1QS7 A;  1PRW A;  3GK1 A;  2WCF A;  1S26 D;  1BOD A;  4PAL A;  2H61 A;  1J7Q A;  2SAS A;  1TTX A;  2MLE C;  1ZMZ A;  3FWC A;  4ETO A;  1B7T Z;  2JXC A;  3NSL A;  2LUC A;  1JSA A;  1DVI A;  2LNK A;  1J1E A;  1VRK A;  5HKW A;  1K94 A;  2MHH A;  1PVB A;  4GAO A;  4FTG A;  3RM1 A;  1C7W A;  3TZ1 A;  1F55 A;  3K21 A;  1L2O B;  2ZN8 A;  1J7P A;  4MN0 A;  1EG3 A;  1JF2 A;  3LK0 A;  2I2R E;  3DVJ A;  3M0W A;  3EK8 A;  2L5X B;  1IJ6 A;  1SL9 A;  2M0R A;  2KBM A;  2NZ0 A;  2L50 A;  5GQQ C;  4WQ3 A;  1YUR A;  1H8B A;  2CTN A;  1NWD A;  2M9G A;  1SR6 C;  3DD4 A;  2B1U A;  2I7A A;  3EKJ A;  1PAL A;  3BOW A;  5DKN A;  5ER4 X;  2KI6 D;  3I5F B;  4PHN A;  1EXR A;  1S5G Y;  2M29 A;  3CGA A;  5I2Q A;  1PSB A;  1RRO A;  2M7N A;  3SG5 A;  2OS8 C;  5I8N A;  4YBH B;  1UHJ A;  1K9P A;  1YUT A;  2HET A;  2BCA A;  1EH2 A;  1FPW A;  2NLN A;  1ALW A;  2LHL A;  5HLO A;  1G4Y R;  4WRI A;  1LVC D;  2L4H A;  3HCM A;  1QIW A;  4P5O E;  4PE0 A;  5KTY A;  1GGW A;  2MJW B;  2LC5 A;  3EVU A;  2CBL A;  1B8L A;  1GJY A;  1M46 A;  1L2O C;  4DRW A;  1TIZ A;  1YR5 A;  2KHN A;  1XFW O;  3DF0 B;  1Y0V H;  4USL A;  1XFX O;  4U8D A;  3CR5 X;  1LXF C;  1TOP A;  3LLE A;  2K61 A;  2LVI A;  2K2A A;  4JPZ B;  2BL0 B;  3LL8 B;  1QX5 B;  1DF0 A;  2PSR A;  2LUX A;  4GGF C;  1FBV A;  1M63 B;  3I5F C;  2NXQ A;  1UUR A;  1CLB A;  1BMO A;  1AJ4 A;  1MWN A;  2E6W A;  5D69 A;  1LA0 A;  4E68 A;  3LK1 A;  1KFU L;  4MBE A;  1A75 A;  1QAS A;  1REC A;  4YI8 A;  1F70 A;  1S6I A;  1YX8 A;  1QX7 A;  2ISD A;  4CFR A;  4YGC B;  1QAT A;  2LM5 A;  5TNC A;  4GBA A; 
#chains in the Genus database with same CATH topology
 2JC2 A;  3TUY B;  1K9U A;  5AFP A;  3RLZ A;  2EHB A;  4XJK A;  1AK8 A;  1JF0 A;  4ORA B;  4CFQ A;  1OMR A;  1WRZ A;  1JBA A;  5CSI A;  1NYA A;  2KSP A;  2Y5I A;  3D10 A;  1MQ1 A;  4QJ4 B;  4YGD B;  3D0Y A;  2BL0 C;  4PHJ A;  2WCE A;  3DVM A;  1IRJ A;  3EK4 A;  4C0K A;  1PK0 D;  4DIR A;  1S1E A;  1OZS A;  1M45 A;  1W7J B;  3PM2 A;  1SCV A;  1SMG A;  1LKJ A;  1KK8 B;  1B8R A;  1OMD A;  2HQW A;  5FI2 A;  1L7Z A;  2JRF A;  1XK4 A;  2GTE A;  2ZN9 A;  1PVA A;  3KHE A;  2H61 C;  3AAK A;  1B9A A;  1DEK A;  3VGO A;  4INW A;  3IQQ A;  2ZFD A;  1KFU S;  1M31 A;  2EGD A;  4ORC B;  3SIA A;  1R2U A;  1NP8 A;  2K7O A;  1LS8 A;  2F8P A;  2AMI A;  1SCM B;  2KQ6 A;  3TUY C;  2YGU A;  1KFX L;  1DT7 B;  2CCM A;  3DYE A;  1XO5 A;  1CNP A;  1YUU A;  1A29 A;  2L4I A;  3FE8 A;  4OKH A;  3CLN A;  4M2P A;  1MXL C;  2PAS A;  4YGB B;  2L2C A;  1TNP A;  1RJV A;  2F2O A;  3N7H A;  1SY9 A;  3JVT B;  3PAT A;  2PMY A;  4JWQ A;  4PE4 A;  2L98 A;  2JQ6 A;  2NCO A;  4L9M A;  4R1E A;  3A8R A;  1SRA A;  1KQM B;  1CM1 A;  2EC6 B;  2LMU A;  2O60 A;  5F6T A;  1JWD A;  2FCD A;  3MSE B;  1YRU B;  2ZND A;  1BG1 A;  2K0J A;  1TNX A;  1QTX A;  1KK8 C;  5JJG A;  4N5X A;  5KU1 A;  1AP4 A;  1F4O A;  1WDC B;  2FJU B;  2LP3 A;  2M49 B;  2JPO A;  3QME A;  2JT8 A;  1QX2 A;  2LE9 B;  3TS5 B;  5B8I B;  3BJH A;  2WCJ A;  1DJW A;  4FQO A;  1A2X A;  3SG7 A;  2ZRS A;  2G2B A;  1FI5 A;  3BUO B;  3WHT B;  2QPT A;  1A75 B;  5AAN A;  3FIA A;  1C07 A;  1A03 A;  3FS7 A;  3PAL A;  1XFU O;  1IIO A;  4KYN A;  3SJS A;  1DEL A;  1QV1 A;  3NHI A;  4Q04 A;  1UHN A;  1OZO A;  3NSK A;  1SCM C;  2JUL A;  1FI6 A;  2CT9 A;  1YUS A;  3CR2 A;  2Y1N A;  1BLQ A;  2ZKM X;  4AOM A;  1J7O A;  5K89 A;  3PM8 A;  3D78 A;  3BYA A;  4XJK B;  1SBJ A;  3OB1 B;  2LVJ A;  1M39 A;  1KFX S;  1LA3 A;  1V1G A;  1YTZ C;  2M97 A;  2KFF A;  2SCP A;  4MZL A;  4YRU A;  1IKU A;  3JVT C;  5ER5 A;  1UWO A;  2BKH B;  1SPY A;  2LAP A;  3D0Y B;  3LCP C;  1SL8 A;  1KQM C;  2EC6 C;  1WLM A;  1BOC A;  1S6J A;  4UPG A;  2I18 A;  2JPT A;  2WCH A;  1MR8 A;  3PSR A;  3SG3 A;  1B1G A;  4OR9 B;  2BKI B;  4NDB A;  1UUS A;  1WDC C;  5AEQ A;  2KAX A;  1KQV A;  4PDZ A;  2KPH A;  1G8I A;  2LAN A;  4GFT A;  3TS5 C;  3SG2 A;  1DJZ A;  1R6P A;  3PFV A;  1EL4 A;  4I5J A;  2QDI A;  3OB2 B;  1YX7 A;  5HL1 A;  2PRU A;  1BF5 A;  1JFJ A;  1CFP A;  5KSZ A;  3QRX A;  5JOL A;  1QXP A;  1CB1 A;  2O5G A;  1JUO A;  1G33 A;  3VRP A;  1RWY A;  4HSZ A;  2BE6 A;  2GGZ A;  1MUX A;  2AAO A;  1OMV A;  1PSR A;  2K2F A;  2KI4 C;  1W7I B;  1XYD A;  4YGE B;  1AJ5 A;  1K9K A;  2KFH A;  2IS9 A;  3VRO A;  5FI7 A;  1BT6 A;  1D1O A;  1IGV A;  4A4B A;  3CZT X;  1IJ5 A;  4PHM A;  3L4A A;  2M1K B;  3CTN A;  3OHM B;  3WXA A;  5DIC A;  5DKR A;  5CSN A;  3WNX B;  1UHH A;  5I2O A;  3S0A A;  1K95 A;  3L4L A;  4OV2 A;  1XFZ O;  2KNE A;  1XA5 A;  4NDC A;  3BUX B;  3SS4 A;  1K96 A;  1UP5 A;  3FE9 A;  1ZAC A;  3O4Y A;  1TNW A;  3CR4 X;  2L5Y A;  2COL B;  2KFG A;  2M3W A;  3F45 A;  3SG4 A;  3TDZ A;  3S0F A;  2K60 A;  3SIB A;  3E3R A;  1Y1X A;  2JXL A;  2QEH A;  2KQY A;  1NUB A;  4MZJ A;  1AVS A;  5I2L A;  1OSA A;  2JNX A;  1DTL A;  1F4Q A;  4BY4 A;  1XK4 C;  1GGZ A;  2OTG B;  4N1F A;  1TN4 A;  4JKT A;  1NX3 A;  1K8U A;  1CKK A;  3KPX A;  1OOG A;  2LHI A;  2PVB A;  2QEV A;  1JC2 A;  1TCO B;  2JNF A;  4P2Y B;  3S0E A;  1QLS A;  3B6X A;  2WC6 A;  1AUI B;  3BUM B;  3BOW B;  5BPJ A;  4YGA A;  3IVT A;  3SS5 A;  4MRX A;  2JT0 A;  2KYC A;  3BFB A;  3EKH A;  4PHK A;  4C0J A;  3NGV A;  1ZUZ A;  4D1E A;  1UHK A;  2KAV A;  1DMO A;  3S0G A;  2LVV A;  3D74 A;  3IF7 A;  2F3Y A;  1XFR A;  5CSJ A;  2HPS A;  2JU0 A;  4HRG A;  2V53 A;  3NHT A;  3B88 A;  3BXK A;  2LMT A;  1DJI A;  1QV0 A;  4FQT A;  2KDH A;  4QJ5 B;  2Q91 A;  3D75 A;  1KSM A;  1NX2 A;  1WLZ A;  3EVV A;  2A4J A;  2KAY A;  3DVK A;  1AHR A;  3OX5 A;  5HKY A;  4PE1 A;  2OTG C;  2GV5 A;  2Y4Q A;  3GOF A;  1FF1 A;  1UHI A;  1CLM A;  3EK7 A;  2L2E A;  1N0Y A;  2WOR A;  5HLV A;  1QWV A;  4GPL B;  4MLW A;  3AKA A;  1DQE A;  3R1P A;  1H4B A;  3O6B A;  4YI9 A;  4OCI A;  3NSI A;  1DF0 B;  1SNL A;  1SYM A;  4TNC A;  2QEB A;  1BJF A;  1OOH A;  2KBI A;  2F2P A;  1HT9 A;  1TCF A;  1JFK A;  1GQM A;  1YVH A;  3PLF B;  2GGM A;  1KWO B;  2QEO A;  1J1D A;  1CFD A;  3BQ3 A;  1ZOT B;  1U5I A;  3ZNI A;  3Q8I A;  3O78 A;  2PYQ A;  1B47 A;  1QIV A;  3B86 A;  1DC1 A;  3KF9 A;  2D8N A;  1S3P A;  2WCL A;  1V1F A;  4JD9 A;  2E30 A;  2P6B B;  5CSF A;  5AXI A;  1YRT B;  1K93 D;  3CS1 A;  2BCB A;  3TDI A;  4MZK A;  1TRF A;  2WCK A;  3OBV A;  3WHU B;  3BUN B;  3DVE A;  2ERB A;  2NCP A;  3GK4 X;  1DJG A;  2WC8 A;  4N1G A;  1Q80 A;  1CFF A;  3S0B A;  1XFV O;  3I5I B;  1J7R A;  2P70 A;  3ICB A;  1CDM A;  4MEW A;  1FW4 A;  2KI4 B;  1XVJ A;  3IQO A;  2LCP A;  2MAZ A;  4A4C A;  3DXL A;  4ZCU A;  3CWG A;  1NCZ A;  4AQI A;  2JT3 A;  2AUC A;  1F54 A;  2JTZ A;  1A4P A;  1OOJ A;  1DJH A;  2M1U A;  1NIW A;  1NX0 A;  2LMV A;  3VRN A;  3HX4 A;  2KOT A;  1MHO A;  3NXA A;  1CDN A;  2CNP A;  3CYZ A;  1OQP A;  1SK6 D;  2DOQ A;  3H4S E;  2KGR A;  4GNK B;  2R2I A;  4BY5 A;  3A4U B;  1K90 D;  1QJT A;  2BAP A;  2KLD A;  1OOI X;  1KWO C;  4CID A;  4DUQ A;  2LP2 A;  2BCX A;  3AAJ A;  2HF5 A;  2G9B A;  5AER A;  4M2Q A;  1F8H A;  1F71 A;  1K2H A;  5J3X A;  1SSE B;  3VRR A;  1IQ3 A;  1Y1U A;  3ZWH A;  1BR1 B;  3S0D A;  2JOJ A;  4HRE E;  2MA2 A;  4F7F A;  2FCE A;  5EL2 A;  5G08 A;  4HRH A;  2K7D A;  2ZRT A;  3CZ1 A;  1QLK A;  2TN4 A;  3I5I C;  3TDU A;  1KK7 Y;  2WND A;  2MRD A;  2Q4U A;  3UO9 A;  4GUK A;  1KSO A;  1J55 A;  1N2D A;  1B4C A;  3VB1 A;  1DGV A;  2LLS A;  1QVI Y;  4ZCV A;  1EJ3 A;  3JTD B;  2P71 A;  1HQV A;  4F0Z B;  2BEC A;  1Y1A A;  1ALV A;  2BBM A;  4I5K A;  4PE7 A;  5HKZ A;  1N65 A;  3GK2 A;  3FE6 A;  3I5H B;  1ORG A;  1C3Z A;  1SKT A;  2PAL A;  2VRG A;  3I5G B;  2KYF A;  2LVK A;  3AKB A;  1SL7 A;  1S36 A;  1WY9 A;  4IL1 A;  1CLL A;  3R1O A;  4OVN F;  2MLF C;  4M2O A;  4XYN A;  4JQ0 D;  1OE9 B;  1RK9 A;  1RTP 1;  1BU3 A;  1S6C A;  2F3Z A;  3C1V A;  2FOT A;  2I94 A;  2OPO A;  1U5I B;  4WQ2 A;  1IG5 A;  3DY9 A;  4ICB A;  4PCW A;  2LLU A;  4MSP A;  2M7L A;  2JZI A;  4INX A;  1NCX A;  1S5G Z;  2L0P A;  4I5N B;  2L51 A;  1NX1 A;  4C0L A;  3NSO A;  3V2L A;  3SG6 A;  1PUL A;  4ORB B;  2KGB C;  3KEV A;  3D77 A;  1RFJ A;  3BUW B;  4GGF A;  5FYX A;  1EG4 A;  1BR4 B;  5D7F A;  1SW8 A;  1XFY O;  1DJX A;  3OX6 A;  3JTD C;  2HQ8 A;  3EVR A;  3PN7 B;  1KK7 Z;  3R1V A;  2K8M B;  1WRL A;  4AQJ A;  1CDL A;  1B7T Y;  2BBN A;  1X02 A;  2WCB A;  2K7C A;  3I5H C;  4GGN A;  2H2K A;  2LV7 A;  3I5G C;  1CM4 A;  2Y1M A;  1OW4 A;  5DKQ A;  1Y6W A;  1QVI Z;  3B7A A;  2BNX A;  4PT1 A;  2JWW A;  4MRY A;  3BFH A;  4CPV A;  2F33 A;  1T14 A;  3D73 A;  2BE4 A;  2WOS A;  2CXJ A;  3DZT A;  1C7V A;  5HYD A;  1B8C A;  1IH0 A;  4MVF A;  1NCY A;  2RGI A;  3OP0 A;  1ZFS A;  2WC5 A;  3VRQ A;  1CDP A;  2M8U A;  1TNQ A;  3KO0 A;  3DF0 A;  1KCY A;  2QAC A;  2LLT A;  3O2P A;  2KI6 C;  3EG5 B;  1CFC A;  2ZNE A;  1NPQ A;  1IWQ A;  5PAL A;  3PJI A;  4DCK A;  4CLN A;  3CDN A;  1CTR A;  3R72 A;  2JTT A;  1WRK A;  1MF8 B;  1SR6 B;  1DJY A;  1LIN A;  4NQG A;  1CMF A;  1E8A A;  1MXE A;  5IBW A;  1IQ5 A;  3PN7 C;  4NDD A;  5CPV A;  3FWB A;  4I5L B;  4DS7 A;  3K1E A;  2MBX A;  2K7B A;  1ODB A;  1DGU A;  1YVL A;  4QJ3 B;  1CMG A;  1NSH A;  2OS8 B;  1QS7 A;  1PRW A;  3GK1 A;  2H8V A;  2KLE A;  2WCF A;  1S26 D;  1BOD A;  4PAL A;  2H61 A;  1J7Q A;  2SAS A;  1W9Z A;  1TTX A;  2MLE C;  3SS3 A;  1ZMZ A;  3FWC A;  4ETO A;  1B7T Z;  2JXC A;  3NSL A;  2LUC A;  1JSA A;  1DVI A;  2LNK A;  1J1E A;  3CAB A;  1VRK A;  1Z4H A;  1K94 A;  5HKW A;  2PQL A;  2MHH A;  1PVB A;  4GAO A;  4FTG A;  3RM1 A;  1C7W A;  3TZ1 A;  1F55 A;  3K21 A;  1L2O B;  2ZN8 A;  3D76 A;  3O4X A;  1J7P A;  4MN0 A;  1EG3 A;  1JF2 A;  3LK0 A;  1GM0 A;  2I2R E;  3DVJ A;  3M0W A;  3EK8 A;  2L5X B;  1IJ6 A;  1SL9 A;  2M0R A;  2KBM A;  2NZ0 A;  2L50 A;  5GQQ C;  4WQ3 A;  1YUR A;  1H8B A;  2CTN A;  1NWD A;  2M9G A;  1SR6 C;  3DD4 A;  2B1U A;  3OGN A;  2I7A A;  3EKJ A;  1PAL A;  3BOW A;  5DKN A;  5ER4 X;  2KI6 D;  3I5F B;  4PHN A;  1EXR A;  1S5G Y;  2M29 A;  3CGA A;  5I2Q A;  1PSB A;  1RRO A;  2M7N A;  2WCM A;  3SG5 A;  2OS8 C;  5FI6 A;  3RZS A;  5I8N A;  4YBH B;  1UHJ A;  1K9P A;  1YUT A;  2HET A;  2BCA A;  1EH2 A;  1FPW A;  2NLN A;  1ALW A;  2LHL A;  1P28 A;  5HLO A;  4IJ7 A;  1G4Y R;  4WRI A;  1LVC D;  1TWO A;  2L4H A;  1QIW A;  3HCM A;  4P5O E;  4PE0 A;  5KTY A;  1GGW A;  2MJW B;  2LC5 A;  3EVU A;  2CBL A;  1B8L A;  1GJY A;  1M46 A;  1L2O C;  4DRW A;  1TIZ A;  1YR5 A;  2KHN A;  1XFW O;  3DF0 B;  1Y0V H;  4USL A;  1XFX O;  4U8D A;  3CR5 X;  5D3O A;  1LXF C;  1Z2C B;  1TOP A;  3LLE A;  2K61 A;  2LVI A;  2K2A A;  3B87 A;  4JPZ B;  5I94 A;  2BL0 B;  3LL8 B;  1QX5 B;  1DF0 A;  2PSR A;  2LUX A;  4GGF C;  1FBV A;  1M63 B;  3BFA A;  3I5F C;  2NXQ A;  1UUR A;  1CLB A;  1BMO A;  1AJ4 A;  1MWN A;  2E6W A;  3L47 A;  5D69 A;  4OZD A;  1LA0 A;  3CZ0 A;  3LK1 A;  1OOF A;  4E68 A;  1KFU L;  4MBE A;  1A75 A;  1QAS A;  1REC A;  4YI8 A;  1F70 A;  1S6I A;  1YX8 A;  1QX7 A;  2ISD A;  1TUZ A;  3CZ2 A;  3UNW A;  4CFR A;  1C3Y A;  4YGC B;  1QAT A;  2FJY A;  2LM5 A;  5TNC A;  4GBA A;  1TUJ A; 
#chains in the Genus database with same CATH homology
 2JC2 A;  3TUY B;  1K9U A;  5AFP A;  3RLZ A;  2EHB A;  4XJK A;  1AK8 A;  1JF0 A;  4ORA B;  4CFQ A;  1OMR A;  1WRZ A;  1JBA A;  5CSI A;  1NYA A;  2KSP A;  2Y5I A;  3D10 A;  1MQ1 A;  4QJ4 B;  4YGD B;  3D0Y A;  2BL0 C;  4PHJ A;  2WCE A;  3DVM A;  1IRJ A;  3EK4 A;  4C0K A;  1PK0 D;  4DIR A;  1S1E A;  1OZS A;  1M45 A;  1W7J B;  1SCV A;  1SMG A;  1LKJ A;  1KK8 B;  1B8R A;  1OMD A;  2HQW A;  1L7Z A;  2JRF A;  1XK4 A;  2ZN9 A;  1PVA A;  3KHE A;  2H61 C;  3AAK A;  1B9A A;  3VGO A;  3SIA A;  3IQQ A;  2ZFD A;  1KFU S;  1M31 A;  2EGD A;  4ORC B;  1R2U A;  1NP8 A;  2K7O A;  2F8P A;  2AMI A;  1SCM B;  2KQ6 A;  3TUY C;  1KFX L;  1DT7 B;  2CCM A;  1XO5 A;  1CNP A;  1YUU A;  1A29 A;  2L4I A;  4OKH A;  3CLN A;  4M2P A;  1MXL C;  2PAS A;  4YGB B;  1TNP A;  1RJV A;  2F2O A;  1SY9 A;  3JVT B;  3PAT A;  2PMY A;  4JWQ A;  4PE4 A;  2L98 A;  2JQ6 A;  2NCO A;  4L9M A;  4R1E A;  3A8R A;  1SRA A;  1KQM B;  1CM1 A;  2EC6 B;  2LMU A;  2O60 A;  5F6T A;  1JWD A;  2FCD A;  3MSE B;  1YRU B;  2ZND A;  1BG1 A;  2K0J A;  1TNX A;  1QTX A;  1KK8 C;  5JJG A;  4N5X A;  5KU1 A;  1AP4 A;  1F4O A;  1WDC B;  2FJU B;  2LP3 A;  2M49 B;  2JT8 A;  1QX2 A;  2LE9 B;  3TS5 B;  5B8I B;  4FQO A;  1DJW A;  1A2X A;  3SG7 A;  2ZRS A;  2G2B A;  1FI5 A;  3BUO B;  3WHT B;  2QPT A;  1A75 B;  5AAN A;  3FIA A;  1C07 A;  1A03 A;  3FS7 A;  3PAL A;  1XFU O;  3SJS A;  1QV1 A;  4Q04 A;  1UHN A;  1OZO A;  3NSK A;  1SCM C;  2JUL A;  1FI6 A;  2CT9 A;  1YUS A;  3CR2 A;  2Y1N A;  1BLQ A;  2ZKM X;  4AOM A;  1J7O A;  5K89 A;  3PM8 A;  3BYA A;  4XJK B;  1SBJ A;  3OB1 B;  2LVJ A;  1M39 A;  1KFX S;  1LA3 A;  1V1G A;  1YTZ C;  2M97 A;  2KFF A;  2SCP A;  4MZL A;  4YRU A;  1IKU A;  3JVT C;  5ER5 A;  1UWO A;  2BKH B;  1SPY A;  2LAP A;  3D0Y B;  3LCP C;  1SL8 A;  1KQM C;  2EC6 C;  1WLM A;  1BOC A;  1S6J A;  4UPG A;  2I18 A;  2JPT A;  3PSR A;  1MR8 A;  3SG3 A;  1B1G A;  4OR9 B;  2BKI B;  4NDB A;  1UUS A;  1WDC C;  5AEQ A;  2KAX A;  1KQV A;  4PDZ A;  1G8I A;  2LAN A;  4GFT A;  3TS5 C;  3SG2 A;  1DJZ A;  1R6P A;  3PFV A;  1EL4 A;  4I5J A;  3OB2 B;  1YX7 A;  2PRU A;  1BF5 A;  1JFJ A;  1CFP A;  5KSZ A;  3QRX A;  5JOL A;  1QXP A;  1CB1 A;  2O5G A;  1JUO A;  1G33 A;  3VRP A;  1RWY A;  4HSZ A;  2BE6 A;  2GGZ A;  1MUX A;  2AAO A;  1OMV A;  1PSR A;  2K2F A;  2KI4 C;  1W7I B;  1XYD A;  4YGE B;  1AJ5 A;  1K9K A;  2KFH A;  2IS9 A;  3VRO A;  1BT6 A;  1D1O A;  1IGV A;  4A4B A;  3CZT X;  1IJ5 A;  4PHM A;  2M1K B;  3CTN A;  3OHM B;  3WXA A;  5DKR A;  5CSN A;  3WNX B;  1UHH A;  5I2O A;  1K95 A;  4OV2 A;  1XFZ O;  2KNE A;  1XA5 A;  4NDC A;  3BUX B;  1K96 A;  1UP5 A;  1ZAC A;  3O4Y A;  1TNW A;  3CR4 X;  2COL B;  2KFG A;  2M3W A;  3F45 A;  3SG4 A;  3TDZ A;  3SIB A;  3E3R A;  1Y1X A;  2JXL A;  2KQY A;  1NUB A;  4MZJ A;  1AVS A;  5I2L A;  1OSA A;  2JNX A;  1DTL A;  1F4Q A;  4BY4 A;  1XK4 C;  1GGZ A;  2OTG B;  4N1F A;  1TN4 A;  1NX3 A;  1K8U A;  1CKK A;  3KPX A;  2LHI A;  2PVB A;  1JC2 A;  1TCO B;  2JNF A;  4P2Y B;  1QLS A;  1AUI B;  3BUM B;  3BOW B;  5BPJ A;  4YGA A;  4MRX A;  2JT0 A;  2KYC A;  3EKH A;  4C0J A;  4PHK A;  1ZUZ A;  4D1E A;  1UHK A;  2KAV A;  1DMO A;  2LVV A;  3IF7 A;  2F3Y A;  5CSJ A;  2HPS A;  2JU0 A;  4HRG A;  2V53 A;  3BXK A;  2LMT A;  1DJI A;  1QV0 A;  2KDH A;  4QJ5 B;  2Q91 A;  1KSM A;  1NX2 A;  1WLZ A;  3EVV A;  2A4J A;  2KAY A;  3DVK A;  1AHR A;  3OX5 A;  5HKY A;  4PE1 A;  2OTG C;  2GV5 A;  2Y4Q A;  3GOF A;  1FF1 A;  1UHI A;  1CLM A;  3EK7 A;  2L2E A;  1N0Y A;  2WOR A;  5HLV A;  4GPL B;  4MLW A;  3AKA A;  1H4B A;  3O6B A;  4YI9 A;  4OCI A;  3NSI A;  1DF0 B;  1SNL A;  1SYM A;  4TNC A;  1BJF A;  2KBI A;  2F2P A;  1HT9 A;  1TCF A;  1JFK A;  1GQM A;  1YVH A;  3PLF B;  2GGM A;  1KWO B;  1J1D A;  1CFD A;  3BQ3 A;  1ZOT B;  1U5I A;  3ZNI A;  3O78 A;  1B47 A;  1QIV A;  3KF9 A;  2D8N A;  1S3P A;  5CSF A;  1V1F A;  5AXI A;  2E30 A;  2P6B B;  1YRT B;  1K93 D;  3CS1 A;  2BCB A;  3TDI A;  4MZK A;  1TRF A;  3WHU B;  3BUN B;  3DVE A;  2NCP A;  3GK4 X;  1DJG A;  2WC8 A;  4N1G A;  1Q80 A;  1CFF A;  1XFV O;  3I5I B;  1J7R A;  3ICB A;  1CDM A;  4MEW A;  1FW4 A;  2KI4 B;  1XVJ A;  3IQO A;  2LCP A;  2MAZ A;  4A4C A;  4ZCU A;  3CWG A;  1NCZ A;  4AQI A;  2JT3 A;  2AUC A;  1F54 A;  2JTZ A;  1A4P A;  1OOJ A;  1DJH A;  2M1U A;  1NIW A;  1NX0 A;  2LMV A;  3VRN A;  3HX4 A;  2KOT A;  1MHO A;  3NXA A;  1CDN A;  2CNP A;  1OQP A;  1SK6 D;  2DOQ A;  3H4S E;  2KGR A;  4GNK B;  2R2I A;  4BY5 A;  3A4U B;  1K90 D;  1QJT A;  4CID A;  1KWO C;  4DUQ A;  2LP2 A;  2BCX A;  3AAJ A;  2HF5 A;  2G9B A;  5AER A;  4M2Q A;  1F8H A;  1F71 A;  1K2H A;  5J3X A;  3VRR A;  1IQ3 A;  1Y1U A;  3ZWH A;  1BR1 B;  2JOJ A;  4HRE E;  2MA2 A;  2FCE A;  5G08 A;  4HRH A;  2K7D A;  2ZRT A;  1QLK A;  2TN4 A;  3I5I C;  3TDU A;  1KK7 Y;  2WND A;  2MRD A;  2Q4U A;  4GUK A;  1KSO A;  1J55 A;  1N2D A;  1B4C A;  1DGV A;  2LLS A;  1QVI Y;  4ZCV A;  1EJ3 A;  3JTD B;  1HQV A;  4F0Z B;  2BEC A;  1Y1A A;  1ALV A;  2BBM A;  4I5K A;  4PE7 A;  5HKZ A;  1N65 A;  3GK2 A;  3I5H B;  2PAL A;  1SKT A;  2VRG A;  3I5G B;  2KYF A;  2LVK A;  3AKB A;  1SL7 A;  1S36 A;  1WY9 A;  4IL1 A;  1CLL A;  4OVN F;  2MLF C;  4M2O A;  4XYN A;  4JQ0 D;  1OE9 B;  1RK9 A;  1RTP 1;  1BU3 A;  1S6C A;  2F3Z A;  3C1V A;  2FOT A;  2I94 A;  2OPO A;  1U5I B;  4WQ2 A;  1IG5 A;  4ICB A;  4PCW A;  2LLU A;  4MSP A;  2M7L A;  2JZI A;  1NCX A;  1S5G Z;  2L0P A;  4I5N B;  2L51 A;  1NX1 A;  4C0L A;  3NSO A;  3SG6 A;  1PUL A;  4ORB B;  2KGB C;  3KEV A;  1RFJ A;  3BUW B;  4GGF A;  5FYX A;  1EG4 A;  1BR4 B;  5D7F A;  1SW8 A;  1XFY O;  1DJX A;  3OX6 A;  3JTD C;  2HQ8 A;  3EVR A;  3PN7 B;  1KK7 Z;  2K8M B;  1WRL A;  4AQJ A;  1CDL A;  1B7T Y;  2BBN A;  1X02 A;  2WCB A;  2K7C A;  3I5H C;  4GGN A;  2H2K A;  2LV7 A;  3I5G C;  1CM4 A;  2Y1M A;  5DKQ A;  1Y6W A;  1QVI Z;  2JWW A;  4MRY A;  4CPV A;  2F33 A;  2BE4 A;  2WOS A;  2CXJ A;  1C7V A;  5HYD A;  1B8C A;  1IH0 A;  4MVF A;  1NCY A;  2RGI A;  3OP0 A;  1ZFS A;  3VRQ A;  1CDP A;  2M8U A;  1TNQ A;  3KO0 A;  3DF0 A;  1KCY A;  2QAC A;  2LLT A;  3O2P A;  2KI6 C;  1CFC A;  2ZNE A;  1NPQ A;  1IWQ A;  5PAL A;  4DCK A;  4CLN A;  1CTR A;  2JTT A;  1WRK A;  1MF8 B;  1SR6 B;  1DJY A;  1LIN A;  4NQG A;  1CMF A;  1E8A A;  1MXE A;  5IBW A;  1IQ5 A;  3PN7 C;  4NDD A;  5CPV A;  3FWB A;  4I5L B;  4DS7 A;  2MBX A;  2K7B A;  1ODB A;  1DGU A;  1YVL A;  4QJ3 B;  1CMG A;  1NSH A;  2OS8 B;  1QS7 A;  1PRW A;  3GK1 A;  2WCF A;  1S26 D;  1BOD A;  4PAL A;  2H61 A;  1J7Q A;  2SAS A;  1TTX A;  2MLE C;  1ZMZ A;  3FWC A;  4ETO A;  1B7T Z;  2JXC A;  3NSL A;  2LUC A;  1JSA A;  1DVI A;  2LNK A;  1J1E A;  1VRK A;  5HKW A;  1K94 A;  2MHH A;  1PVB A;  4GAO A;  4FTG A;  3RM1 A;  1C7W A;  3TZ1 A;  1F55 A;  3K21 A;  1L2O B;  2ZN8 A;  1J7P A;  4MN0 A;  1EG3 A;  1JF2 A;  3LK0 A;  2I2R E;  3DVJ A;  3M0W A;  3EK8 A;  2L5X B;  1IJ6 A;  1SL9 A;  2M0R A;  2KBM A;  2NZ0 A;  2L50 A;  5GQQ C;  4WQ3 A;  1YUR A;  1H8B A;  2CTN A;  1NWD A;  2M9G A;  1SR6 C;  3DD4 A;  2B1U A;  2I7A A;  3EKJ A;  1PAL A;  3BOW A;  5DKN A;  5ER4 X;  2KI6 D;  3I5F B;  4PHN A;  1EXR A;  1S5G Y;  2M29 A;  3CGA A;  5I2Q A;  1PSB A;  1RRO A;  2M7N A;  3SG5 A;  2OS8 C;  5I8N A;  4YBH B;  1UHJ A;  1K9P A;  1YUT A;  2HET A;  2BCA A;  1EH2 A;  1FPW A;  2NLN A;  1ALW A;  2LHL A;  5HLO A;  1G4Y R;  4WRI A;  1LVC D;  2L4H A;  3HCM A;  1QIW A;  4P5O E;  4PE0 A;  5KTY A;  1GGW A;  2MJW B;  2LC5 A;  3EVU A;  2CBL A;  1B8L A;  1GJY A;  1M46 A;  1L2O C;  4DRW A;  1TIZ A;  1YR5 A;  2KHN A;  1XFW O;  3DF0 B;  1Y0V H;  4USL A;  1XFX O;  4U8D A;  3CR5 X;  1LXF C;  1TOP A;  3LLE A;  2K61 A;  2LVI A;  2K2A A;  4JPZ B;  2BL0 B;  3LL8 B;  1QX5 B;  1DF0 A;  2PSR A;  2LUX A;  4GGF C;  1FBV A;  1M63 B;  3I5F C;  2NXQ A;  1UUR A;  1CLB A;  1BMO A;  1AJ4 A;  1MWN A;  2E6W A;  5D69 A;  1LA0 A;  4E68 A;  3LK1 A;  1KFU L;  4MBE A;  1A75 A;  1QAS A;  1REC A;  4YI8 A;  1F70 A;  1S6I A;  1YX8 A;  1QX7 A;  2ISD A;  4CFR A;  4YGC B;  1QAT A;  2LM5 A;  5TNC A;  4GBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...