2JWWA

Calcium-free rat alpha-parvalbumin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
109
structure length
109
Chain Sequence
SMTDLLSAEDIKKAIGAFTAADSFDHKKFFQMVGLKKKSADDVKKVFHILDKDKSGFIEEDELGSILKGFSSDARDLSAKETKTLMAAGDKDGDGKIGVEEFSTLVAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Parvalbumin alpha
publication title Solution structure of Ca2+-free rat alpha-parvalbumin
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal binding protein
total genus 26
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2007-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2jwwA00
3I5FC 2CBLA 2KNEA 3TDUA 2KFHA 1J1DA 2E30A 1SBJA 1KFUS 1VRKA 4U8DA 2CT9A 3IF7A 2HQWA 3OB1B 4M2QA 1J7OA 3A4UB 1NX0A 4GGFC 4QJ3B 1TRFA 3KO0A 2NCPA 1F4OA 1SL8A 2BL0B 1K9PA 1SMGA 2L98A 3CR4X 3D10A 1K90D 1TNQA 1NCZA 4PCWA 3PM8A 1DF0A 1IJ5A 1NX2A 1S6CA 2K61A 3OHMB 1TNWA 4I5JA 4OVNF 2WC8A 4DUQA 1B4CA 1S3PA 4GBAA 1CDPA 2K7DA 4NDDA 4PHMA 1KWOB 1H8BA 2KFGA 4N1GA 1HT9A 2KHNA 3JVTC 2SCPA 1QV1A 5I2QA 1TN4A 1J7RA 2LLSA 1SCMC 2M1KB 4MBEA 1XFVO 5HKWA 1SK6D 1EJ3A 1XVJA 3BQ3A 3RM1A 2F3YA 4ORAB 2BE4A 2FCEA 2KI4B 3PN7B 2JQ6A 1FI6A 1W7IB 1TOPA 2F3ZA 4AOMA 1EG3A 5AXIA 2R2IA 1EL4A 1TNPA 3SG3A 4GGNA 1SY9A 1AK8A 1DJZA 2E6WA 2G9BA 2H2KA 5CSFA 3C1VA 1ALWA 2LVKA 4YI8A 1S1EA 2P6BB 1PK0D 1DT7B 1K2HA 1PSBA 3BXKA 4DS7A 1SPYA 5GQQC 3EK8A 1QTXA 2KSPA 4I5NB 4PDZA 1PSRA 3OX6A 1TCFA 5DKNA 1CLLA 2K7BA 3CR2A 5K89A 2Q4UA 4GUKA 2WCEA 4MVFA 5HLVA 4C0LA 1DF0B 2F8PA 2LHIA 1L7ZA 4CPVA 4YGBB 2MBXA 1N65A 3ZNIA 1QLKA 5PALA 1RK9A 1UHIA 2BBMA 2D8NA 4USLA 1DJXA 2BL0C 1NX3A 1JF2A 5D69A 1NCXA 2ZKMX 1CNPA 1QJTA 2ZNDA 2ZNEA 1UURA 5BPJA 4OV2A 1C07A 1NCYA 4ICBA 4P2YB 1FW4A 3I5HB 2JNFA 3PSRA 3IQOA 1U5IA 2WCBA 1F71A 1J55A 3OP0A 1KWOC 1Y1XA 1XFUO 1B7TZ 4HSZA 1OSAA 3NXAA 3WXAA 1BG1A 2O5GA 1CFFA 3O78A 4MRXA 2SASA 1LA3A 3SIBA 1N2DA 2ZFDA 3RLZA 1XA5A 1YRUB 3BYAA 2MAZA 2KI4C 3PN7C 3VRQA 4DIRA 2LANA 1YUTA 2LV7A 2KQ6A 1QV0A 1XFYO 1OMRA 4I5KA 1CM1A 4GNKB 1JSAA 3GOFA 4R1EA 3BOWB 1QIWA 4M2OA 4NDCA 1YX8A 1M45A 1DTLA 1ODBA 1PVAA 4N5XA 5JOLA 3BUWB 1OZOA 4I5LB 4PHKA 1AJ4A 2ZN9A 3H4SE 2JC2A 4MEWA 1FBVA 2PRUA 4WRIA 1L2OB 2JT0A 2LVVA 2L0PA 1QVIZ 2G2BA 1ZUZA 4CLNA 1RFJA 3SG5A 1AUIB 1IKUA 4CIDA 1OQPA 5CSIA 1IH0A 3PLFB 1G4YR 4QJ4B 5HYDA 5HKYA 2BBNA 2LP2A 1D1OA 4L9MA 1QASA 3BUMB 1CTRA 4PE0A 1U5IB 4BY5A 2WORA 2COLB 5AANA 2V53A 1S6JA 3VROA 4OKHA 1KSMA 1KQMB 1UHNA 3QRXA 1RTP1 1NX1A 1QLSA 2F33A 1UHHA 4PHJA 2GGZA 3GK4X 1QATA 1AHRA 3I5HC 3K21A 4YGEB 1EG4A 3CR5X 1C7WA 3DF0B 3O2PA 1G8IA 1IG5A 3AKBA 3DVJA 3KPXA 1Y1UA 4YGDB 1M63B 1IWQA 1OMVA 3M0WA 3VGOA 2VRGA 1YX7A 2OTGB 2HETA 2M49B 4GPLB 5B8IB 2KAXA 4CFRA 5F6TA 1K95A 1CFDA 2M7NA 5TNCA 1SW8A 4YI9A 1F55A 1KK8B 3DVKA 3EVVA 4ORCB 3SG6A 1IQ5A 1MWNA 4HRGA 3SIAA 2GGMA 2JNXA 5HLOA 4ORBB 1NP8A 3DD4A 1NUBA 1H4BA 1CDMA 2MJWB 3ICBA 1Q80A 5AFPA 2OS8B 1IGVA 2NLNA 2KBIA 4OCIA 3KEVA 5AERA 1L2OC 4HREE 4JQ0D 1CFPA 2M0RA 3I5IB 3IQQA 2CTNA 4WQ2A 1GQMA 1Y0VH 1DMOA 4MZKA 1PULA 1WLMA 2NZ0A 4D1EA 2ZRTA 1S5GY 2BKHB 1KQMC 3HX4A 1XYDA 1X02A 3HCMA 3PALA 1GJYA 2KGBC 3TUYB 2KI6D 4CFQA 4C0KA 4AQIA 2FCDA 1CB1A 1ZACA 1J1EA 2FJUB 2L50A 1BT6A 1DJYA 1V1GA 4YGCB 2JU0A 1RWYA 5AEQA 2CXJA 5DKQA 4MLWA 5I8NA 1YUSA 2AMIA 2WOSA 1B8LA 3VRNA 1A75A 1B9AA 2FOTA 4PE1A 2OTGC 2BKIB 1SR6B 2AAOA 1R2UA 1BR4B 2NCOA 1JFJA 3FIAA 1TTXA 4UPGA 1M39A 4JPZB 2I18A 1KK8C 1OZSA 1LXFC 3CZTX 1AVSA 2MLEC 2LUXA 2JZIA 3DVEA 4PHNA 2KAYA 3DVMA 2O60A 4DCKA 2EC6B 2OS8C 3EK4A 3AAJA 1C7VA 1DJHA 5HKZA 4FTGA 3KF9A 2KOTA 2JULA 3I5IC 2QACA 1OE9B 2JXLA 1IRJA 1B8CA 3JTDB 2H61A 4GAOA 1SL9A 2JOJA 4P5OE 1KFXS 2K2AA 1QS7A 3BUXB 1M31A 3WNXB 1XFZO 1K93D 5I2LA 2I94A 2M97A 3TS5B 2JT3A 1KQVA 1Y6WA 2IS9A 2LMTA 1WRZA 2KYFA 3VRRA 1BMOA 1BODA 2BCXA 3SG7A 1JFKA 1WLZA 3TUYC 1TIZA 1WRLA 1A75B 1DJGA 4DRWA 2LE9B 2LUCA 2MLFC 2OPOA 2PALA 4NDBA 1J7PA 1PALA 1JC2A 1IJ6A 1K94A 1E8AA 1XFXO 1SKTA 1FF1A 4YBHB 1SYMA 2LHLA 1G33A 2TN4A 1JWDA 1WDCB 1A4PA 4FQOA 4HRHA 4PALA 1XK4A 5I2OA 3GK1A 1CMFA 4PE7A 1F4QA 1NYAA 1YTZC 1OMDA 1SR6C 2WCFA 4YGAA 1FPWA 1BU3A 1MUXA 3NSOA 1CFCA 5CPVA 5IBWA 2F2PA 4MZLA 1ZMZA 2M29A 2K2FA 1BR1B 1QX7A 2GV5A 1AP4A 2M3WA 4MZJA 5FYXA 1RJVA 2MRDA 4PE4A 3WHTB 4XYNA 2LLUA 1K9KA 5KSZA 3VRPA 2EC6C 2LM5A 3SG4A 3TDIA 4A4CA 2PMYA 3CLNA 1DJIA 2BE6A 3I5GB 1B8RA 1YURA 1GGZA 1F54A 1YUUA 2JWWA 1B7TY 1DGVA 1XO5A 1ALVA 4E68A 2LVIA 3D0YA 1DVIA 2KFFA 5ER4X 1B47A 2ISDA 1KSOA 2K0JA 2B1UA 1ZFSA 2KI6C 4QJ5B 2LVJA 3SJSA 3JTDC 4MN0A 1QIVA 2PSRA 3CGAA 1NPQA 3CWGA 2BCBA 2ZN8A 1LA0A 1SRAA 1PRWA 2A4JA 2HF5A 2PVBA 4JWQA 4F0ZB 3E3RA 2L5XB 3TS5C 5DKRA 4OR9B 2Y1MA 2L2EA 5G08A 5D7FA 1NWDA 1UHKA 2M1UA 4XJKA 2LC5A 2LNKA 4GFTA 5J3XA 3BUNB 1DJWA 3LK1A 2BECA 1QVIY 1UUSA 1RECA 3OB2B 2JPTA 4ETOA 1LKJA 1AJ5A 1MXLC 3EKJA 1KFXL 3EVUA 4GGFA 1EH2A 1Y1AA 1MR8A 2LAPA 2WNDA 1WDCC 1CMGA 3LL8B 2M9GA 2L4IA 3PFVA 1K8UA 4C0JA 1JUOA 1KK7Y 5JJGA 3LK0A 2LMVA 1RROA 1WY9A 1J7QA 1KCYA 4MSPA 3O6BA 1A29A 3CTNA 1SCVA 2KQYA 1LINA 1YR5A 2JTTA 2JXCA 4A4BA 1YVHA 3D0YB 3MSEB 2F2OA 3EK7A 1QX5B 2BCAA 2AUCA 2M7LA 2CNPA 1HQVA 2DOQA 2KGRA 3BOWA 2JT8A 2K7CA 2L51A 2H61C 3CS1A 1SNLA 1CKKA 3OX5A 4BY4A 1F8HA 2MA2A 2Y4QA 2JRFA 3I5GC 3LCPC 1GGWA 1DGUA 3A8RA 1CDNA 1NSHA 1UP5A 2I2RE 1K9UA 3I5FB 4WQ3A 1TCOB 5ER5A 5CSJA 1S26D 1ZOTB 1N0YA 1NIWA 2L4HA 1YRTB 2EHBA 4XJKB 5CSNA 3WHUB 4ZCVA 3SG2A 1JF0A 1KFUL 1W7JB 4TNCA 1IQ3A 4AQJA 1WRKA 1JBAA 1BF5A 1LVCD 1R6PA 1CDLA 1SL7A 3ZWHA 2Y1NA 1TNXA 5KTYA 1XFWO 1QXPA 1CM4A 3KHEA 2HQ8A 1XK4C 1F70A 1CLMA 1K96A 2JTZA 2LLTA 3NSIA 1UWOA 1CLBA 3EVRA 3BUOB 1B1GA 1A03A 1MQ1A 2LCPA 1S6IA 2PASA 3DF0A 3FWCA 3AKAA 4Q04A 2RGIA 3AAKA 1S36A 2KDHA 3TDZA 3JVTB 1FI5A 2K7OA 2K8MB 1M46A 3NSLA 4IL1A 4M2PA 4ZCUA 5KU1A 1SCMB 3FWBA 1BOCA 2LP3A 1BJFA 1MXEA 2ZRSA 3EKHA 3TZ1A 1MF8B 1BLQA 1MHOA 4YRUA 3LLEA 2M8UA 2HPSA 3PATA 1EXRA 3F45A 4NQGA 1S5GZ 1OOJA 4MRYA 2KAVA 1A2XA 2EGDA 2LMUA 2NXQA 2Q91A 2KBMA 2KYCA 2Y5IA 2CCMA 1PVBA 2I7AA 2MHHA 1UHJA 3O4YA 2QPTA 1QX2A 4N1FA 1KK7Z 1V1FA 3FS7A 3NSKA 1YVLA 3GK2A
chains in the Genus database with same CATH superfamily
3I5FC 2CBLA 3EG5B 2KNEA 1DQEA 3TDUA 2KFHA 1J1DA 2E30A 1SBJA 4INXA 1KFUS 3S0DA 3R1OA 1VRKA 4U8DA 4ETOA 2CT9A 3IF7A 2HQWA 3OB1B 4M2QA 4F7FA 1J7OA 3A4UB 1NX0A 3L4LA 4GGFC 2GTEA 4QJ3B 1TRFA 1GM0A 3KO0A 2NCPA 3D73A 1F4OA 1SL8A 2BL0B 1K9PA 1SMGA 2L98A 3CR4X 3CYZA 3D10A 1K90D 1TNQA 1NCZA 4PCWA 3PM8A 1DF0A 3UO9A 1IJ5A 1NX2A 1S6CA 2K61A 3OHMB 1TNWA 4I5JA 4OVNF 2WC8A 4DUQA 1B4CA 1S3PA 4GBAA 1CDPA 2H8VA 2K7DA 4NDDA 4PHMA 1KWOB 1H8BA 2KFGA 4N1GA 1HT9A 2KHNA 3JVTC 2SCPA 1QV1A 5I2QA 1TN4A 4PT1A 1J7RA 2LLSA 1SCMC 1TUJA 2M1KB 1XFVO 4MBEA 5HKWA 5HL1A 1SK6D 1EJ3A 1XVJA 3BQ3A 3L47A 3RM1A 2F3YA 4ORAB 2BE4A 2FCEA 2KI4B 3PN7B 2JQ6A 1FI6A 1W7IB 1TOPA 2F3ZA 4AOMA 1EG3A 5AXIA 2R2IA 1EL4A 1C3ZA 1TNPA 4GGNA 3SG3A 1SY9A 1AK8A 1DJZA 2E6WA 2G9BA 2H2KA 5CSFA 3C1VA 1ALWA 2LVKA 1P28A 4YI8A 1S1EA 2P6BB 3QMEA 1PK0D 1DT7B 4IJ7A 1K2HA 1PSBA 3BXKA 4DS7A 3O4XA 1SPYA 3D77A 5GQQC 3EK8A 1QTXA 2KSPA 4I5NB 4PDZA 1PSRA 3OX6A 1TCFA 5DKNA 1CLLA 2L2CA 2WC6A 2K7BA 3CR2A 5K89A 2Q4UA 4GUKA 2WCEA 4MVFA 5HLVA 3FE8A 4C0LA 1DF0B 2F8PA 2LHIA 1L7ZA 4CPVA 4YGBB 2MBXA 2JPOA 1N65A 3ZNIA 1QLKA 5PALA 1RK9A 2WCKA 1UHIA 2BBMA 2D8NA 4USLA 1DJXA 2BL0C 1NX3A 3CDNA 1JF2A 5D69A 1NCXA 2ZKMX 1CNPA 3OBVA 1QJTA 2QEOA 2ZNDA 1UURA 2ZNEA 4OV2A 5BPJA 1C07A 1NCYA 4ICBA 4P2YB 1FW4A 3I5HB 1SSEB 2JNFA 3PSRA 3IQOA 1U5IA 2WCBA 3NHTA 1F71A 1J55A 3OP0A 1KWOC 1Y1XA 3SS5A 1XFUO 1B7TZ 3CZ1A 1OSAA 3NXAA 4HSZA 3WXAA 1BG1A 2O5GA 1CFFA 3O78A 4MRXA 2SASA 1LA3A 3SIBA 1N2DA 2ZFDA 3RLZA 1XA5A 1YRUB 2P71A 2MAZA 2QEHA 2KI4C 3BYAA 3PN7C 3VRQA 4DIRA 3D75A 2LANA 1YUTA 2LV7A 2KQ6A 1QV0A 1XFYO 1OMRA 4I5KA 1CM1A 4GNKB 1JSAA 1LS8A 3GOFA 1OOIX 4R1EA 3BOWB 3FE6A 1QIWA 3FS7A 3PM2A 4M2OA 3VB1A 4NDCA 1YX8A 1M45A 1DTLA 1ODBA 1PVAA 4N5XA 5JOLA 3BUWB 1OZOA 4I5LB 4PHKA 1AJ4A 2ZN9A 3H4SE 2JC2A 4MEWA 1FBVA 2PRUA 4WRIA 1L2OB 2JT0A 2LVVA 2L0PA 1QVIZ 2G2BA 1ZUZA 4CLNA 1RFJA 3SG5A 1AUIB 1IKUA 2WCJA 1OQPA 5CSIA 4CIDA 1IH0A 3PLFB 1G4YR 3B7AA 4QJ4B 5HYDA 5HKYA 2BBNA 2LP2A 2P70A 1D1OA 4L9MA 1QASA 3BUMB 1CTRA 4PE0A 1U5IB 2YGUA 4BY5A 2WORA 2COLB 5AANA 2V53A 1S6JA 3VROA 4OKHA 3UNWA 1KSMA 1KQMB 1UHNA 3QRXA 3NHIA 1RTP1 1NX1A 1QLSA 1Z4HA 2F33A 2QEBA 1UHHA 4PHJA 2GGZA 3GK4X 1QATA 1AHRA 3I5HC 3K21A 4YGEB 1EG4A 3CR5X 1C7WA 3DF0B 3O2PA 1G8IA 1IG5A 3AKBA 3DVJA 3D74A 3KPXA 3R1PA 5FI6A 1Y1UA 2WCMA 4YGDB 1M63B 1IWQA 1OMVA 1ORGA 3M0WA 3VGOA 2VRGA 1YX7A 2OTGB 2ERBA 2HETA 2M49B 4GPLB 1TWOA 2KAXA 4JD9A 4CFRA 5B8IB 3PJIA 5F6TA 1K95A 1CFDA 2M7NA 5TNCA 1SW8A 3B6XA 4YI9A 4FQTA 1KK8B 3DVKA 3EVVA 4ORCB 1F55A 3SG6A 1IQ5A 1MWNA 4HRGA 3SIAA 2K60A 2GGMA 2JNXA 3B86A 4ORBB 1NP8A 5HLOA 3DD4A 1NUBA 1H4BA 1CDMA 2MJWB 3D76A 3ICBA 1Q80A 5AFPA 2OS8B 1IGVA 2NLNA 2L5YA 2KBIA 4OCIA 3K1EA 3KEVA 5AERA 1L2OC 4HREE 1DELA 4JQ0D 1CFPA 2M0RA 3I5IB 3IQQA 2CTNA 1DC1A 4WQ2A 1GQMA 1Y0VH 1DMOA 4MZKA 1PULA 1WLMA 2PQLA 2NZ0A 4D1EA 2ZRTA 1S5GY 2BKHB 1KQMC 3HX4A 1XYDA 3DXLA 1X02A 3HCMA 3PALA 1GJYA 2KGBC 3TUYB 2KI6D 4CFQA 4C0KA 4AQIA 2FCDA 1CB1A 4INWA 1ZACA 1J1EA 1OW4A 2FJUB 1BT6A 1DJYA 2L50A 1V1GA 4YGCB 3DYEA 2JU0A 1RWYA 5AEQA 2CXJA 2WC5A 5DKQA 4MLWA 5I8NA 1YUSA 2AMIA 2WCLA 5FI2A 2PYQA 2WOSA 1B8LA 3VRNA 1A75A 1B9AA 2FOTA 4PE1A 3S0EA 2OTGC 1C3YA 2BKIB 3RZSA 1SR6B 2AAOA 1R2UA 1BR4B 2NCOA 1JFJA 3FIAA 1TTXA 4UPGA 1M39A 4JPZB 2I18A 1KK8C 1OZSA 1LXFC 3CZTX 1AVSA 2MLEC 2LUXA 2JZIA 3DVEA 4PHNA 2KAYA 3R1VA 3DVMA 2O60A 4DCKA 3IVTA 2EC6B 2OS8C 3EK4A 3AAJA 1OOHA 1C7VA 1DJHA 5FI7A 5HKZA 4FTGA 3KF9A 2KOTA 2JULA 3I5IC 3N7HA 2QACA 1OE9B 1IIOA 2JXLA 1IRJA 1B8CA 4JKTA 3L4AA 3JTDB 2H61A 4GAOA 1SL9A 2JOJA 4P5OE 1KFXS 2K2AA 3FE9A 1QS7A 3BUXB 1M31A 3WNXB 1XFZO 1K93D 5I2LA 3CZ0A 2I94A 2M97A 3TS5B 5D3OA 2JT3A 1KQVA 1Y6WA 2IS9A 2LMTA 1WRZA 2KYFA 3VRRA 1OOGA 1BMOA 1BODA 2BCXA 3SG7A 1JFKA 1WLZA 3TUYC 1TIZA 1WRLA 1A75B 1DJGA 4DRWA 2LE9B 2LUCA 2MLFC 2BAPA 2OPOA 2PALA 4NDBA 1J7PA 1PALA 1JC2A 1IJ6A 1K94A 1E8AA 1XFXO 1SKTA 5EL2A 1FF1A 4YBHB 1SYMA 2LHLA 1G33A 2TN4A 1JWDA 1WDCB 3DY9A 1A4PA 4FQOA 4HRHA 4PALA 1XK4A 5I2OA 3GK1A 1CMFA 4PE7A 1F4QA 1NYAA 1YTZC 1OMDA 1SR6C 2WCFA 4YGAA 1FPWA 1BU3A 2FJYA 3S0AA 1MUXA 3B87A 3NSOA 5CPVA 1CFCA 5IBWA 2F2PA 4MZLA 1ZMZA 2M29A 2K2FA 1BR1B 1QX7A 2GV5A 1W9ZA 1AP4A 2M3WA 4MZJA 5FYXA 2WCHA 1RJVA 2MRDA 4PE4A 3WHTB 4XYNA 2LLUA 1K9KA 5KSZA 3VRPA 2EC6C 2LM5A 3SG4A 3TDIA 4A4CA 2PMYA 3CLNA 1DJIA 2BE6A 2KLEA 3I5GB 1B8RA 1YURA 1GGZA 1F54A 1YUUA 2JWWA 1B7TY 1DGVA 1XO5A 1ALVA 4E68A 2LVIA 3D0YA 1DVIA 3BJHA 2KFFA 3R72A 5ER4X 1B47A 2ISDA 1KSOA 2K0JA 2B1UA 1ZFSA 2KI6C 4QJ5B 2LVJA 1DEKA 3SJSA 3JTDC 4MN0A 1QIVA 2PSRA 3CGAA 1NPQA 3CWGA 2BCBA 2ZN8A 3SS4A 1LA0A 1SRAA 1PRWA 2A4JA 2HF5A 2PVBA 4JWQA 4F0ZB 3E3RA 2L5XB 3TS5C 5DKRA 4OR9B 2Y1MA 2L2EA 5G08A 5D7FA 1NWDA 1UHKA 2M1UA 4XJKA 2LC5A 2LNKA 4GFTA 3BFAA 5J3XA 3BUNB 1DJWA 3LK1A 2BECA 1QVIY 1UUSA 1RECA 3OB2B 1QWVA 2JPTA 1LKJA 1AJ5A 1MXLC 3EKJA 1KFXL 3EVUA 4GGFA 3BFBA 1Y1AA 1MR8A 2LAPA 2WNDA 2QDIA 3S0GA 1WDCC 1CMGA 3LL8B 2M9GA 2L4IA 3PFVA 1K8UA 4C0JA 1JUOA 1KK7Y 5JJGA 3LK0A 2LMVA 1RROA 1WY9A 1J7QA 1KCYA 4MSPA 3O6BA 1A29A 3CTNA 1SCVA 2KQYA 1LINA 1YR5A 2JTTA 3OGNA 2JXCA 1OOFA 4A4BA 1YVHA 3D0YB 3MSEB 2F2OA 3EK7A 1QX5B 2BCAA 2AUCA 2M7LA 2CNPA 1HQVA 2DOQA 2KGRA 3BOWA 2JT8A 2K7CA 3S0BA 2L51A 2H61C 3CS1A 1SNLA 1CKKA 3OX5A 4BY4A 3CABA 1F8HA 2MA2A 2Y4QA 2JRFA 3I5GC 3LCPC 1GGWA 1DGUA 3A8RA 1TUZA 1CDNA 1NSHA 1UP5A 2I2RE 1K9UA 3I5FB 4WQ3A 1TCOB 1Z2CB 2KPHA 5ER5A 5CSJA 1S26D 1ZOTB 1N0YA 1NIWA 2L4HA 1YRTB 2EHBA 4XJKB 5CSNA 3WHUB 2QEVA 4ZCVA 3SG2A 1JF0A 1KFUL 1W7JB 4TNCA 1IQ3A 4AQJA 1WRKA 1JBAA 1BF5A 1LVCD 1R6PA 2BNXA 1CDLA 1SL7A 3BFHA 3ZWHA 2Y1NA 1TNXA 3V2LA 5KTYA 1XFWO 5I94A 1QXPA 1CM4A 3KHEA 2HQ8A 1XK4C 1F70A 1CLMA 1K96A 2JTZA 2LLTA 3NGVA 3NSIA 5DICA 1UWOA 1CLBA 3EVRA 3BUOB 3SS3A 1B1GA 3B88A 1A03A 1MQ1A 2LCPA 1S6IA 2PASA 3DF0A 3FWCA 3AKAA 4Q04A 2RGIA 3AAKA 4KYNA 1S36A 2KDHA 3TDZA 3JVTB 4OZDA 1FI5A 2K7OA 2K8MB 1M46A 3NSLA 4IL1A 4M2PA 4ZCUA 5KU1A 1SCMB 3FWBA 1BOCA 2LP3A 1BJFA 1MXEA 2ZRSA 3EKHA 3TZ1A 1MF8B 2KLDA 3CZ2A 1BLQA 1MHOA 4YRUA 3S0FA 3LLEA 1EH2A 2M8UA 2HPSA 3PATA 1EXRA 3F45A 4NQGA 1S5GZ 1OOJA 4MRYA 2KAVA 1A2XA 2EGDA 2LMUA 2NXQA 3D78A 2Q91A 2KBMA 2KYCA 2Y5IA 2CCMA 1PVBA 1T14A 2I7AA 2MHHA 1UHJA 3DZTA 2QPTA 3O4YA 1QX2A 4N1FA 1KK7Z 1V1FA 1XFRA 3NSKA 3Q8IA 1YVLA 3GK2A
chains in the Genus database with same CATH topology
3I5FC 2CBLA 2KNEA 3TDUA 2KFHA 1J1DA 2E30A 1SBJA 1KFUS 1VRKA 4U8DA 2CT9A 3IF7A 2HQWA 3OB1B 4M2QA 1J7OA 3A4UB 1NX0A 4GGFC 4QJ3B 1TRFA 3KO0A 2NCPA 1F4OA 1SL8A 2BL0B 1K9PA 1SMGA 2L98A 3CR4X 3D10A 1K90D 1TNQA 1NCZA 4PCWA 3PM8A 1DF0A 1IJ5A 1NX2A 1S6CA 2K61A 3OHMB 1TNWA 4I5JA 4OVNF 2WC8A 4DUQA 1B4CA 1S3PA 4GBAA 1CDPA 2K7DA 4NDDA 4PHMA 1KWOB 1H8BA 2KFGA 4N1GA 1HT9A 2KHNA 3JVTC 2SCPA 1QV1A 5I2QA 1TN4A 1J7RA 2LLSA 1SCMC 2M1KB 4MBEA 1XFVO 5HKWA 1SK6D 1EJ3A 1XVJA 3BQ3A 3RM1A 2F3YA 4ORAB 2BE4A 2FCEA 2KI4B 3PN7B 2JQ6A 1FI6A 1W7IB 1TOPA 2F3ZA 4AOMA 1EG3A 5AXIA 2R2IA 1EL4A 1TNPA 3SG3A 4GGNA 1SY9A 1AK8A 1DJZA 2E6WA 2G9BA 2H2KA 5CSFA 3C1VA 1ALWA 2LVKA 4YI8A 1S1EA 2P6BB 1PK0D 1DT7B 1K2HA 1PSBA 3BXKA 4DS7A 1SPYA 5GQQC 3EK8A 1QTXA 2KSPA 4I5NB 4PDZA 1PSRA 3OX6A 1TCFA 5DKNA 1CLLA 2K7BA 3CR2A 5K89A 2Q4UA 4GUKA 2WCEA 4MVFA 5HLVA 4C0LA 1DF0B 2F8PA 2LHIA 1L7ZA 4CPVA 4YGBB 2MBXA 1N65A 3ZNIA 1QLKA 5PALA 1RK9A 1UHIA 2BBMA 2D8NA 4USLA 1DJXA 2BL0C 1NX3A 1JF2A 5D69A 1NCXA 2ZKMX 1CNPA 1QJTA 2ZNDA 2ZNEA 1UURA 5BPJA 4OV2A 1C07A 1NCYA 4ICBA 4P2YB 1FW4A 3I5HB 2JNFA 3PSRA 3IQOA 1U5IA 2WCBA 1F71A 1J55A 3OP0A 1KWOC 1Y1XA 1XFUO 1B7TZ 4HSZA 1OSAA 3NXAA 3WXAA 1BG1A 2O5GA 1CFFA 3O78A 4MRXA 2SASA 1LA3A 3SIBA 1N2DA 2ZFDA 3RLZA 1XA5A 1YRUB 3BYAA 2MAZA 2KI4C 3PN7C 3VRQA 4DIRA 2LANA 1YUTA 2LV7A 2KQ6A 1QV0A 1XFYO 1OMRA 4I5KA 1CM1A 4GNKB 1JSAA 3GOFA 4R1EA 3BOWB 1QIWA 4M2OA 4NDCA 1YX8A 1M45A 1DTLA 1ODBA 1PVAA 4N5XA 5JOLA 3BUWB 1OZOA 4I5LB 4PHKA 1AJ4A 2ZN9A 3H4SE 2JC2A 4MEWA 1FBVA 2PRUA 4WRIA 1L2OB 2JT0A 2LVVA 2L0PA 1QVIZ 2G2BA 1ZUZA 4CLNA 1RFJA 3SG5A 1AUIB 1IKUA 4CIDA 1OQPA 5CSIA 1IH0A 3PLFB 1G4YR 4QJ4B 5HYDA 5HKYA 2BBNA 2LP2A 1D1OA 4L9MA 1QASA 3BUMB 1CTRA 4PE0A 1U5IB 4BY5A 2WORA 2COLB 5AANA 2V53A 1S6JA 3VROA 4OKHA 1KSMA 1KQMB 1UHNA 3QRXA 1RTP1 1NX1A 1QLSA 2F33A 1UHHA 4PHJA 2GGZA 3GK4X 1QATA 1AHRA 3I5HC 3K21A 4YGEB 1EG4A 3CR5X 1C7WA 3DF0B 3O2PA 1G8IA 1IG5A 3AKBA 3DVJA 3KPXA 1Y1UA 4YGDB 1M63B 1IWQA 1OMVA 3M0WA 3VGOA 2VRGA 1YX7A 2OTGB 2HETA 2M49B 4GPLB 5B8IB 2KAXA 4CFRA 5F6TA 1K95A 1CFDA 2M7NA 5TNCA 1SW8A 4YI9A 1F55A 1KK8B 3DVKA 3EVVA 4ORCB 3SG6A 1IQ5A 1MWNA 4HRGA 3SIAA 2GGMA 2JNXA 5HLOA 4ORBB 1NP8A 3DD4A 1NUBA 1H4BA 1CDMA 2MJWB 3ICBA 1Q80A 5AFPA 2OS8B 1IGVA 2NLNA 2KBIA 4OCIA 3KEVA 5AERA 1L2OC 4HREE 4JQ0D 1CFPA 2M0RA 3I5IB 3IQQA 2CTNA 4WQ2A 1GQMA 1Y0VH 1DMOA 4MZKA 1PULA 1WLMA 2NZ0A 4D1EA 2ZRTA 1S5GY 2BKHB 1KQMC 3HX4A 1XYDA 1X02A 3HCMA 3PALA 1GJYA 2KGBC 3TUYB 2KI6D 4CFQA 4C0KA 4AQIA 2FCDA 1CB1A 1ZACA 1J1EA 2FJUB 2L50A 1BT6A 1DJYA 1V1GA 4YGCB 2JU0A 1RWYA 5AEQA 2CXJA 5DKQA 4MLWA 5I8NA 1YUSA 2AMIA 2WOSA 1B8LA 3VRNA 1A75A 1B9AA 2FOTA 4PE1A 2OTGC 2BKIB 1SR6B 2AAOA 1R2UA 1BR4B 2NCOA 1JFJA 3FIAA 1TTXA 4UPGA 1M39A 4JPZB 2I18A 1KK8C 1OZSA 1LXFC 3CZTX 1AVSA 2MLEC 2LUXA 2JZIA 3DVEA 4PHNA 2KAYA 3DVMA 2O60A 4DCKA 2EC6B 2OS8C 3EK4A 3AAJA 1C7VA 1DJHA 5HKZA 4FTGA 3KF9A 2KOTA 2JULA 3I5IC 2QACA 1OE9B 2JXLA 1IRJA 1B8CA 3JTDB 2H61A 4GAOA 1SL9A 2JOJA 4P5OE 1KFXS 2K2AA 1QS7A 3BUXB 1M31A 3WNXB 1XFZO 1K93D 5I2LA 2I94A 2M97A 3TS5B 2JT3A 1KQVA 1Y6WA 2IS9A 2LMTA 1WRZA 2KYFA 3VRRA 1BMOA 1BODA 2BCXA 3SG7A 1JFKA 1WLZA 3TUYC 1TIZA 1WRLA 1A75B 1DJGA 4DRWA 2LE9B 2LUCA 2MLFC 2OPOA 2PALA 4NDBA 1J7PA 1PALA 1JC2A 1IJ6A 1K94A 1E8AA 1XFXO 1SKTA 1FF1A 4YBHB 1SYMA 2LHLA 1G33A 2TN4A 1JWDA 1WDCB 1A4PA 4FQOA 4HRHA 4PALA 1XK4A 5I2OA 3GK1A 1CMFA 4PE7A 1F4QA 1NYAA 1YTZC 1OMDA 1SR6C 2WCFA 4YGAA 1FPWA 1BU3A 1MUXA 3NSOA 1CFCA 5CPVA 5IBWA 2F2PA 4MZLA 1ZMZA 2M29A 2K2FA 1BR1B 1QX7A 2GV5A 1AP4A 2M3WA 4MZJA 5FYXA 1RJVA 2MRDA 4PE4A 3WHTB 4XYNA 2LLUA 1K9KA 5KSZA 3VRPA 2EC6C 2LM5A 3SG4A 3TDIA 4A4CA 2PMYA 3CLNA 1DJIA 2BE6A 3I5GB 1B8RA 1YURA 1GGZA 1F54A 1YUUA 2JWWA 1B7TY 1DGVA 1XO5A 1ALVA 4E68A 2LVIA 3D0YA 1DVIA 2KFFA 5ER4X 1B47A 2ISDA 1KSOA 2K0JA 2B1UA 1ZFSA 2KI6C 4QJ5B 2LVJA 3SJSA 3JTDC 4MN0A 1QIVA 2PSRA 3CGAA 1NPQA 3CWGA 2BCBA 2ZN8A 1LA0A 1SRAA 1PRWA 2A4JA 2HF5A 2PVBA 4JWQA 4F0ZB 3E3RA 2L5XB 3TS5C 5DKRA 4OR9B 2Y1MA 2L2EA 5G08A 5D7FA 1NWDA 1UHKA 2M1UA 4XJKA 2LC5A 2LNKA 4GFTA 5J3XA 3BUNB 1DJWA 3LK1A 2BECA 1QVIY 1UUSA 1RECA 3OB2B 2JPTA 4ETOA 1LKJA 1AJ5A 1MXLC 3EKJA 1KFXL 3EVUA 4GGFA 1EH2A 1Y1AA 1MR8A 2LAPA 2WNDA 1WDCC 1CMGA 3LL8B 2M9GA 2L4IA 3PFVA 1K8UA 4C0JA 1JUOA 1KK7Y 5JJGA 3LK0A 2LMVA 1RROA 1WY9A 1J7QA 1KCYA 4MSPA 3O6BA 1A29A 3CTNA 1SCVA 2KQYA 1LINA 1YR5A 2JTTA 2JXCA 4A4BA 1YVHA 3D0YB 3MSEB 2F2OA 3EK7A 1QX5B 2BCAA 2AUCA 2M7LA 2CNPA 1HQVA 2DOQA 2KGRA 3BOWA 2JT8A 2K7CA 2L51A 2H61C 3CS1A 1SNLA 1CKKA 3OX5A 4BY4A 1F8HA 2MA2A 2Y4QA 2JRFA 3I5GC 3LCPC 1GGWA 1DGUA 3A8RA 1CDNA 1NSHA 1UP5A 2I2RE 1K9UA 3I5FB 4WQ3A 1TCOB 5ER5A 5CSJA 1S26D 1ZOTB 1N0YA 1NIWA 2L4HA 1YRTB 2EHBA 4XJKB 5CSNA 3WHUB 4ZCVA 3SG2A 1JF0A 1KFUL 1W7JB 4TNCA 1IQ3A 4AQJA 1WRKA 1JBAA 1BF5A 1LVCD 1R6PA 1CDLA 1SL7A 3ZWHA 2Y1NA 1TNXA 5KTYA 1XFWO 1QXPA 1CM4A 3KHEA 2HQ8A 1XK4C 1F70A 1CLMA 1K96A 2JTZA 2LLTA 3NSIA 1UWOA 1CLBA 3EVRA 3BUOB 1B1GA 1A03A 1MQ1A 2LCPA 1S6IA 2PASA 3DF0A 3FWCA 3AKAA 4Q04A 2RGIA 3AAKA 1S36A 2KDHA 3TDZA 3JVTB 1FI5A 2K7OA 2K8MB 1M46A 3NSLA 4IL1A 4M2PA 4ZCUA 5KU1A 1SCMB 3FWBA 1BOCA 2LP3A 1BJFA 1MXEA 2ZRSA 3EKHA 3TZ1A 1MF8B 1BLQA 1MHOA 4YRUA 3LLEA 2M8UA 2HPSA 3PATA 1EXRA 3F45A 4NQGA 1S5GZ 1OOJA 4MRYA 2KAVA 1A2XA 2EGDA 2LMUA 2NXQA 2Q91A 2KBMA 2KYCA 2Y5IA 2CCMA 1PVBA 2I7AA 2MHHA 1UHJA 3O4YA 2QPTA 1QX2A 4N1FA 1KK7Z 1V1FA 3FS7A 3NSKA 1YVLA 3GK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I5F C;  2CBL A;  2KNE A;  3TDU A;  2KFH A;  1J1D A;  2E30 A;  1SBJ A;  1KFU S;  1VRK A;  4U8D A;  2CT9 A;  3IF7 A;  2HQW A;  3OB1 B;  4M2Q A;  1J7O A;  3A4U B;  1NX0 A;  4GGF C;  4QJ3 B;  1TRF A;  3KO0 A;  2NCP A;  1F4O A;  1SL8 A;  2BL0 B;  1K9P A;  1SMG A;  2L98 A;  3CR4 X;  3D10 A;  1K90 D;  1TNQ A;  1NCZ A;  4PCW A;  3PM8 A;  1DF0 A;  1IJ5 A;  1NX2 A;  1S6C A;  2K61 A;  3OHM B;  1TNW A;  4I5J A;  4OVN F;  2WC8 A;  4DUQ A;  1B4C A;  1S3P A;  4GBA A;  1CDP A;  2K7D A;  4NDD A;  4PHM A;  1KWO B;  1H8B A;  2KFG A;  4N1G A;  1HT9 A;  2KHN A;  3JVT C;  2SCP A;  1QV1 A;  5I2Q A;  1TN4 A;  1J7R A;  2LLS A;  1SCM C;  2M1K B;  4MBE A;  1XFV O;  5HKW A;  1SK6 D;  1EJ3 A;  1XVJ A;  3BQ3 A;  3RM1 A;  2F3Y A;  4ORA B;  2BE4 A;  2FCE A;  2KI4 B;  3PN7 B;  2JQ6 A;  1FI6 A;  1W7I B;  1TOP A;  2F3Z A;  4AOM A;  1EG3 A;  5AXI A;  2R2I A;  1EL4 A;  1TNP A;  3SG3 A;  4GGN A;  1SY9 A;  1AK8 A;  1DJZ A;  2E6W A;  2G9B A;  2H2K A;  5CSF A;  3C1V A;  1ALW A;  2LVK A;  4YI8 A;  1S1E A;  2P6B B;  1PK0 D;  1DT7 B;  1K2H A;  1PSB A;  3BXK A;  4DS7 A;  1SPY A;  5GQQ C;  3EK8 A;  1QTX A;  2KSP A;  4I5N B;  4PDZ A;  1PSR A;  3OX6 A;  1TCF A;  5DKN A;  1CLL A;  2K7B A;  3CR2 A;  5K89 A;  2Q4U A;  4GUK A;  2WCE A;  4MVF A;  5HLV A;  4C0L A;  1DF0 B;  2F8P A;  2LHI A;  1L7Z A;  4CPV A;  4YGB B;  2MBX A;  1N65 A;  3ZNI A;  1QLK A;  5PAL A;  1RK9 A;  1UHI A;  2BBM A;  2D8N A;  4USL A;  1DJX A;  2BL0 C;  1NX3 A;  1JF2 A;  5D69 A;  1NCX A;  2ZKM X;  1CNP A;  1QJT A;  2ZND A;  2ZNE A;  1UUR A;  5BPJ A;  4OV2 A;  1C07 A;  1NCY A;  4ICB A;  4P2Y B;  1FW4 A;  3I5H B;  2JNF A;  3PSR A;  3IQO A;  1U5I A;  2WCB A;  1F71 A;  1J55 A;  3OP0 A;  1KWO C;  1Y1X A;  1XFU O;  1B7T Z;  4HSZ A;  1OSA A;  3NXA A;  3WXA A;  1BG1 A;  2O5G A;  1CFF A;  3O78 A;  4MRX A;  2SAS A;  1LA3 A;  3SIB A;  1N2D A;  2ZFD A;  3RLZ A;  1XA5 A;  1YRU B;  3BYA A;  2MAZ A;  2KI4 C;  3PN7 C;  3VRQ A;  4DIR A;  2LAN A;  1YUT A;  2LV7 A;  2KQ6 A;  1QV0 A;  1XFY O;  1OMR A;  4I5K A;  1CM1 A;  4GNK B;  1JSA A;  3GOF A;  4R1E A;  3BOW B;  1QIW A;  4M2O A;  4NDC A;  1YX8 A;  1M45 A;  1DTL A;  1ODB A;  1PVA A;  4N5X A;  5JOL A;  3BUW B;  1OZO A;  4I5L B;  4PHK A;  1AJ4 A;  2ZN9 A;  3H4S E;  2JC2 A;  4MEW A;  1FBV A;  2PRU A;  4WRI A;  1L2O B;  2JT0 A;  2LVV A;  2L0P A;  1QVI Z;  2G2B A;  1ZUZ A;  4CLN A;  1RFJ A;  3SG5 A;  1AUI B;  1IKU A;  4CID A;  1OQP A;  5CSI A;  1IH0 A;  3PLF B;  1G4Y R;  4QJ4 B;  5HYD A;  5HKY A;  2BBN A;  2LP2 A;  1D1O A;  4L9M A;  1QAS A;  3BUM B;  1CTR A;  4PE0 A;  1U5I B;  4BY5 A;  2WOR A;  2COL B;  5AAN A;  2V53 A;  1S6J A;  3VRO A;  4OKH A;  1KSM A;  1KQM B;  1UHN A;  3QRX A;  1RTP 1;  1NX1 A;  1QLS A;  2F33 A;  1UHH A;  4PHJ A;  2GGZ A;  3GK4 X;  1QAT A;  1AHR A;  3I5H C;  3K21 A;  4YGE B;  1EG4 A;  3CR5 X;  1C7W A;  3DF0 B;  3O2P A;  1G8I A;  1IG5 A;  3AKB A;  3DVJ A;  3KPX A;  1Y1U A;  4YGD B;  1M63 B;  1IWQ A;  1OMV A;  3M0W A;  3VGO A;  2VRG A;  1YX7 A;  2OTG B;  2HET A;  2M49 B;  4GPL B;  5B8I B;  2KAX A;  4CFR A;  5F6T A;  1K95 A;  1CFD A;  2M7N A;  5TNC A;  1SW8 A;  4YI9 A;  1F55 A;  1KK8 B;  3DVK A;  3EVV A;  4ORC B;  3SG6 A;  1IQ5 A;  1MWN A;  4HRG A;  3SIA A;  2GGM A;  2JNX A;  5HLO A;  4ORB B;  1NP8 A;  3DD4 A;  1NUB A;  1H4B A;  1CDM A;  2MJW B;  3ICB A;  1Q80 A;  5AFP A;  2OS8 B;  1IGV A;  2NLN A;  2KBI A;  4OCI A;  3KEV A;  5AER A;  1L2O C;  4HRE E;  4JQ0 D;  1CFP A;  2M0R A;  3I5I B;  3IQQ A;  2CTN A;  4WQ2 A;  1GQM A;  1Y0V H;  1DMO A;  4MZK A;  1PUL A;  1WLM A;  2NZ0 A;  4D1E A;  2ZRT A;  1S5G Y;  2BKH B;  1KQM C;  3HX4 A;  1XYD A;  1X02 A;  3HCM A;  3PAL A;  1GJY A;  2KGB C;  3TUY B;  2KI6 D;  4CFQ A;  4C0K A;  4AQI A;  2FCD A;  1CB1 A;  1ZAC A;  1J1E A;  2FJU B;  2L50 A;  1BT6 A;  1DJY A;  1V1G A;  4YGC B;  2JU0 A;  1RWY A;  5AEQ A;  2CXJ A;  5DKQ A;  4MLW A;  5I8N A;  1YUS A;  2AMI A;  2WOS A;  1B8L A;  3VRN A;  1A75 A;  1B9A A;  2FOT A;  4PE1 A;  2OTG C;  2BKI B;  1SR6 B;  2AAO A;  1R2U A;  1BR4 B;  2NCO A;  1JFJ A;  3FIA A;  1TTX A;  4UPG A;  1M39 A;  4JPZ B;  2I18 A;  1KK8 C;  1OZS A;  1LXF C;  3CZT X;  1AVS A;  2MLE C;  2LUX A;  2JZI A;  3DVE A;  4PHN A;  2KAY A;  3DVM A;  2O60 A;  4DCK A;  2EC6 B;  2OS8 C;  3EK4 A;  3AAJ A;  1C7V A;  1DJH A;  5HKZ A;  4FTG A;  3KF9 A;  2KOT A;  2JUL A;  3I5I C;  2QAC A;  1OE9 B;  2JXL A;  1IRJ A;  1B8C A;  3JTD B;  2H61 A;  4GAO A;  1SL9 A;  2JOJ A;  4P5O E;  1KFX S;  2K2A A;  1QS7 A;  3BUX B;  1M31 A;  3WNX B;  1XFZ O;  1K93 D;  5I2L A;  2I94 A;  2M97 A;  3TS5 B;  2JT3 A;  1KQV A;  1Y6W A;  2IS9 A;  2LMT A;  1WRZ A;  2KYF A;  3VRR A;  1BMO A;  1BOD A;  2BCX A;  3SG7 A;  1JFK A;  1WLZ A;  3TUY C;  1TIZ A;  1WRL A;  1A75 B;  1DJG A;  4DRW A;  2LE9 B;  2LUC A;  2MLF C;  2OPO A;  2PAL A;  4NDB A;  1J7P A;  1PAL A;  1JC2 A;  1IJ6 A;  1K94 A;  1E8A A;  1XFX O;  1SKT A;  1FF1 A;  4YBH B;  1SYM A;  2LHL A;  1G33 A;  2TN4 A;  1JWD A;  1WDC B;  1A4P A;  4FQO A;  4HRH A;  4PAL A;  1XK4 A;  5I2O A;  3GK1 A;  1CMF A;  4PE7 A;  1F4Q A;  1NYA A;  1YTZ C;  1OMD A;  1SR6 C;  2WCF A;  4YGA A;  1FPW A;  1BU3 A;  1MUX A;  3NSO A;  1CFC A;  5CPV A;  5IBW A;  2F2P A;  4MZL A;  1ZMZ A;  2M29 A;  2K2F A;  1BR1 B;  1QX7 A;  2GV5 A;  1AP4 A;  2M3W A;  4MZJ A;  5FYX A;  1RJV A;  2MRD A;  4PE4 A;  3WHT B;  4XYN A;  2LLU A;  1K9K A;  5KSZ A;  3VRP A;  2EC6 C;  2LM5 A;  3SG4 A;  3TDI A;  4A4C A;  2PMY A;  3CLN A;  1DJI A;  2BE6 A;  3I5G B;  1B8R A;  1YUR A;  1GGZ A;  1F54 A;  1YUU A;  2JWW A;  1B7T Y;  1DGV A;  1XO5 A;  1ALV A;  4E68 A;  2LVI A;  3D0Y A;  1DVI A;  2KFF A;  5ER4 X;  1B47 A;  2ISD A;  1KSO A;  2K0J A;  2B1U A;  1ZFS A;  2KI6 C;  4QJ5 B;  2LVJ A;  3SJS A;  3JTD C;  4MN0 A;  1QIV A;  2PSR A;  3CGA A;  1NPQ A;  3CWG A;  2BCB A;  2ZN8 A;  1LA0 A;  1SRA A;  1PRW A;  2A4J A;  2HF5 A;  2PVB A;  4JWQ A;  4F0Z B;  3E3R A;  2L5X B;  3TS5 C;  5DKR A;  4OR9 B;  2Y1M A;  2L2E A;  5G08 A;  5D7F A;  1NWD A;  1UHK A;  2M1U A;  4XJK A;  2LC5 A;  2LNK A;  4GFT A;  5J3X A;  3BUN B;  1DJW A;  3LK1 A;  2BEC A;  1QVI Y;  1UUS A;  1REC A;  3OB2 B;  2JPT A;  4ETO A;  1LKJ A;  1AJ5 A;  1MXL C;  3EKJ A;  1KFX L;  3EVU A;  4GGF A;  1EH2 A;  1Y1A A;  1MR8 A;  2LAP A;  2WND A;  1WDC C;  1CMG A;  3LL8 B;  2M9G A;  2L4I A;  3PFV A;  1K8U A;  4C0J A;  1JUO A;  1KK7 Y;  5JJG A;  3LK0 A;  2LMV A;  1RRO A;  1WY9 A;  1J7Q A;  1KCY A;  4MSP A;  3O6B A;  1A29 A;  3CTN A;  1SCV A;  2KQY A;  1LIN A;  1YR5 A;  2JTT A;  2JXC A;  4A4B A;  1YVH A;  3D0Y B;  3MSE B;  2F2O A;  3EK7 A;  1QX5 B;  2BCA A;  2AUC A;  2M7L A;  2CNP A;  1HQV A;  2DOQ A;  2KGR A;  3BOW A;  2JT8 A;  2K7C A;  2L51 A;  2H61 C;  3CS1 A;  1SNL A;  1CKK A;  3OX5 A;  4BY4 A;  1F8H A;  2MA2 A;  2Y4Q A;  2JRF A;  3I5G C;  3LCP C;  1GGW A;  1DGU A;  3A8R A;  1CDN A;  1NSH A;  1UP5 A;  2I2R E;  1K9U A;  3I5F B;  4WQ3 A;  1TCO B;  5ER5 A;  5CSJ A;  1S26 D;  1ZOT B;  1N0Y A;  1NIW A;  2L4H A;  1YRT B;  2EHB A;  4XJK B;  5CSN A;  3WHU B;  4ZCV A;  3SG2 A;  1JF0 A;  1KFU L;  1W7J B;  4TNC A;  1IQ3 A;  4AQJ A;  1WRK A;  1JBA A;  1BF5 A;  1LVC D;  1R6P A;  1CDL A;  1SL7 A;  3ZWH A;  2Y1N A;  1TNX A;  5KTY A;  1XFW O;  1QXP A;  1CM4 A;  3KHE A;  2HQ8 A;  1XK4 C;  1F70 A;  1CLM A;  1K96 A;  2JTZ A;  2LLT A;  3NSI A;  1UWO A;  1CLB A;  3EVR A;  3BUO B;  1B1G A;  1A03 A;  1MQ1 A;  2LCP A;  1S6I A;  2PAS A;  3DF0 A;  3FWC A;  3AKA A;  4Q04 A;  2RGI A;  3AAK A;  1S36 A;  2KDH A;  3TDZ A;  3JVT B;  1FI5 A;  2K7O A;  2K8M B;  1M46 A;  3NSL A;  4IL1 A;  4M2P A;  4ZCU A;  5KU1 A;  1SCM B;  3FWB A;  1BOC A;  2LP3 A;  1BJF A;  1MXE A;  2ZRS A;  3EKH A;  3TZ1 A;  1MF8 B;  1BLQ A;  1MHO A;  4YRU A;  3LLE A;  2M8U A;  2HPS A;  3PAT A;  1EXR A;  3F45 A;  4NQG A;  1S5G Z;  1OOJ A;  4MRY A;  2KAV A;  1A2X A;  2EGD A;  2LMU A;  2NXQ A;  2Q91 A;  2KBM A;  2KYC A;  2Y5I A;  2CCM A;  1PVB A;  2I7A A;  2MHH A;  1UHJ A;  3O4Y A;  2QPT A;  1QX2 A;  4N1F A;  1KK7 Z;  1V1F A;  3FS7 A;  3NSK A;  1YVL A;  3GK2 A; 
#chains in the Genus database with same CATH topology
 3I5F C;  2CBL A;  3EG5 B;  2KNE A;  1DQE A;  3TDU A;  2KFH A;  1J1D A;  2E30 A;  1SBJ A;  4INX A;  1KFU S;  3S0D A;  3R1O A;  1VRK A;  4U8D A;  4ETO A;  2CT9 A;  3IF7 A;  2HQW A;  3OB1 B;  4M2Q A;  4F7F A;  1J7O A;  3A4U B;  1NX0 A;  3L4L A;  4GGF C;  2GTE A;  4QJ3 B;  1TRF A;  1GM0 A;  3KO0 A;  2NCP A;  3D73 A;  1F4O A;  1SL8 A;  2BL0 B;  1K9P A;  1SMG A;  2L98 A;  3CR4 X;  3CYZ A;  3D10 A;  1K90 D;  1TNQ A;  1NCZ A;  4PCW A;  3PM8 A;  1DF0 A;  3UO9 A;  1IJ5 A;  1NX2 A;  1S6C A;  2K61 A;  3OHM B;  1TNW A;  4I5J A;  4OVN F;  2WC8 A;  4DUQ A;  1B4C A;  1S3P A;  4GBA A;  1CDP A;  2H8V A;  2K7D A;  4NDD A;  4PHM A;  1KWO B;  1H8B A;  2KFG A;  4N1G A;  1HT9 A;  2KHN A;  3JVT C;  2SCP A;  1QV1 A;  5I2Q A;  1TN4 A;  4PT1 A;  1J7R A;  2LLS A;  1SCM C;  1TUJ A;  2M1K B;  1XFV O;  4MBE A;  5HKW A;  5HL1 A;  1SK6 D;  1EJ3 A;  1XVJ A;  3BQ3 A;  3L47 A;  3RM1 A;  2F3Y A;  4ORA B;  2BE4 A;  2FCE A;  2KI4 B;  3PN7 B;  2JQ6 A;  1FI6 A;  1W7I B;  1TOP A;  2F3Z A;  4AOM A;  1EG3 A;  5AXI A;  2R2I A;  1EL4 A;  1C3Z A;  1TNP A;  4GGN A;  3SG3 A;  1SY9 A;  1AK8 A;  1DJZ A;  2E6W A;  2G9B A;  2H2K A;  5CSF A;  3C1V A;  1ALW A;  2LVK A;  1P28 A;  4YI8 A;  1S1E A;  2P6B B;  3QME A;  1PK0 D;  1DT7 B;  4IJ7 A;  1K2H A;  1PSB A;  3BXK A;  4DS7 A;  3O4X A;  1SPY A;  3D77 A;  5GQQ C;  3EK8 A;  1QTX A;  2KSP A;  4I5N B;  4PDZ A;  1PSR A;  3OX6 A;  1TCF A;  5DKN A;  1CLL A;  2L2C A;  2WC6 A;  2K7B A;  3CR2 A;  5K89 A;  2Q4U A;  4GUK A;  2WCE A;  4MVF A;  5HLV A;  3FE8 A;  4C0L A;  1DF0 B;  2F8P A;  2LHI A;  1L7Z A;  4CPV A;  4YGB B;  2MBX A;  2JPO A;  1N65 A;  3ZNI A;  1QLK A;  5PAL A;  1RK9 A;  2WCK A;  1UHI A;  2BBM A;  2D8N A;  4USL A;  1DJX A;  2BL0 C;  1NX3 A;  3CDN A;  1JF2 A;  5D69 A;  1NCX A;  2ZKM X;  1CNP A;  3OBV A;  1QJT A;  2QEO A;  2ZND A;  1UUR A;  2ZNE A;  4OV2 A;  5BPJ A;  1C07 A;  1NCY A;  4ICB A;  4P2Y B;  1FW4 A;  3I5H B;  1SSE B;  2JNF A;  3PSR A;  3IQO A;  1U5I A;  2WCB A;  3NHT A;  1F71 A;  1J55 A;  3OP0 A;  1KWO C;  1Y1X A;  3SS5 A;  1XFU O;  1B7T Z;  3CZ1 A;  1OSA A;  3NXA A;  4HSZ A;  3WXA A;  1BG1 A;  2O5G A;  1CFF A;  3O78 A;  4MRX A;  2SAS A;  1LA3 A;  3SIB A;  1N2D A;  2ZFD A;  3RLZ A;  1XA5 A;  1YRU B;  2P71 A;  2MAZ A;  2QEH A;  2KI4 C;  3BYA A;  3PN7 C;  3VRQ A;  4DIR A;  3D75 A;  2LAN A;  1YUT A;  2LV7 A;  2KQ6 A;  1QV0 A;  1XFY O;  1OMR A;  4I5K A;  1CM1 A;  4GNK B;  1JSA A;  1LS8 A;  3GOF A;  1OOI X;  4R1E A;  3BOW B;  3FE6 A;  1QIW A;  3FS7 A;  3PM2 A;  4M2O A;  3VB1 A;  4NDC A;  1YX8 A;  1M45 A;  1DTL A;  1ODB A;  1PVA A;  4N5X A;  5JOL A;  3BUW B;  1OZO A;  4I5L B;  4PHK A;  1AJ4 A;  2ZN9 A;  3H4S E;  2JC2 A;  4MEW A;  1FBV A;  2PRU A;  4WRI A;  1L2O B;  2JT0 A;  2LVV A;  2L0P A;  1QVI Z;  2G2B A;  1ZUZ A;  4CLN A;  1RFJ A;  3SG5 A;  1AUI B;  1IKU A;  2WCJ A;  1OQP A;  5CSI A;  4CID A;  1IH0 A;  3PLF B;  1G4Y R;  3B7A A;  4QJ4 B;  5HYD A;  5HKY A;  2BBN A;  2LP2 A;  2P70 A;  1D1O A;  4L9M A;  1QAS A;  3BUM B;  1CTR A;  4PE0 A;  1U5I B;  2YGU A;  4BY5 A;  2WOR A;  2COL B;  5AAN A;  2V53 A;  1S6J A;  3VRO A;  4OKH A;  3UNW A;  1KSM A;  1KQM B;  1UHN A;  3QRX A;  3NHI A;  1RTP 1;  1NX1 A;  1QLS A;  1Z4H A;  2F33 A;  2QEB A;  1UHH A;  4PHJ A;  2GGZ A;  3GK4 X;  1QAT A;  1AHR A;  3I5H C;  3K21 A;  4YGE B;  1EG4 A;  3CR5 X;  1C7W A;  3DF0 B;  3O2P A;  1G8I A;  1IG5 A;  3AKB A;  3DVJ A;  3D74 A;  3KPX A;  3R1P A;  5FI6 A;  1Y1U A;  2WCM A;  4YGD B;  1M63 B;  1IWQ A;  1OMV A;  1ORG A;  3M0W A;  3VGO A;  2VRG A;  1YX7 A;  2OTG B;  2ERB A;  2HET A;  2M49 B;  4GPL B;  1TWO A;  2KAX A;  4JD9 A;  4CFR A;  5B8I B;  3PJI A;  5F6T A;  1K95 A;  1CFD A;  2M7N A;  5TNC A;  1SW8 A;  3B6X A;  4YI9 A;  4FQT A;  1KK8 B;  3DVK A;  3EVV A;  4ORC B;  1F55 A;  3SG6 A;  1IQ5 A;  1MWN A;  4HRG A;  3SIA A;  2K60 A;  2GGM A;  2JNX A;  3B86 A;  4ORB B;  1NP8 A;  5HLO A;  3DD4 A;  1NUB A;  1H4B A;  1CDM A;  2MJW B;  3D76 A;  3ICB A;  1Q80 A;  5AFP A;  2OS8 B;  1IGV A;  2NLN A;  2L5Y A;  2KBI A;  4OCI A;  3K1E A;  3KEV A;  5AER A;  1L2O C;  4HRE E;  1DEL A;  4JQ0 D;  1CFP A;  2M0R A;  3I5I B;  3IQQ A;  2CTN A;  1DC1 A;  4WQ2 A;  1GQM A;  1Y0V H;  1DMO A;  4MZK A;  1PUL A;  1WLM A;  2PQL A;  2NZ0 A;  4D1E A;  2ZRT A;  1S5G Y;  2BKH B;  1KQM C;  3HX4 A;  1XYD A;  3DXL A;  1X02 A;  3HCM A;  3PAL A;  1GJY A;  2KGB C;  3TUY B;  2KI6 D;  4CFQ A;  4C0K A;  4AQI A;  2FCD A;  1CB1 A;  4INW A;  1ZAC A;  1J1E A;  1OW4 A;  2FJU B;  1BT6 A;  1DJY A;  2L50 A;  1V1G A;  4YGC B;  3DYE A;  2JU0 A;  1RWY A;  5AEQ A;  2CXJ A;  2WC5 A;  5DKQ A;  4MLW A;  5I8N A;  1YUS A;  2AMI A;  2WCL A;  5FI2 A;  2PYQ A;  2WOS A;  1B8L A;  3VRN A;  1A75 A;  1B9A A;  2FOT A;  4PE1 A;  3S0E A;  2OTG C;  1C3Y A;  2BKI B;  3RZS A;  1SR6 B;  2AAO A;  1R2U A;  1BR4 B;  2NCO A;  1JFJ A;  3FIA A;  1TTX A;  4UPG A;  1M39 A;  4JPZ B;  2I18 A;  1KK8 C;  1OZS A;  1LXF C;  3CZT X;  1AVS A;  2MLE C;  2LUX A;  2JZI A;  3DVE A;  4PHN A;  2KAY A;  3R1V A;  3DVM A;  2O60 A;  4DCK A;  3IVT A;  2EC6 B;  2OS8 C;  3EK4 A;  3AAJ A;  1OOH A;  1C7V A;  1DJH A;  5FI7 A;  5HKZ A;  4FTG A;  3KF9 A;  2KOT A;  2JUL A;  3I5I C;  3N7H A;  2QAC A;  1OE9 B;  1IIO A;  2JXL A;  1IRJ A;  1B8C A;  4JKT A;  3L4A A;  3JTD B;  2H61 A;  4GAO A;  1SL9 A;  2JOJ A;  4P5O E;  1KFX S;  2K2A A;  3FE9 A;  1QS7 A;  3BUX B;  1M31 A;  3WNX B;  1XFZ O;  1K93 D;  5I2L A;  3CZ0 A;  2I94 A;  2M97 A;  3TS5 B;  5D3O A;  2JT3 A;  1KQV A;  1Y6W A;  2IS9 A;  2LMT A;  1WRZ A;  2KYF A;  3VRR A;  1OOG A;  1BMO A;  1BOD A;  2BCX A;  3SG7 A;  1JFK A;  1WLZ A;  3TUY C;  1TIZ A;  1WRL A;  1A75 B;  1DJG A;  4DRW A;  2LE9 B;  2LUC A;  2MLF C;  2BAP A;  2OPO A;  2PAL A;  4NDB A;  1J7P A;  1PAL A;  1JC2 A;  1IJ6 A;  1K94 A;  1E8A A;  1XFX O;  1SKT A;  5EL2 A;  1FF1 A;  4YBH B;  1SYM A;  2LHL A;  1G33 A;  2TN4 A;  1JWD A;  1WDC B;  3DY9 A;  1A4P A;  4FQO A;  4HRH A;  4PAL A;  1XK4 A;  5I2O A;  3GK1 A;  1CMF A;  4PE7 A;  1F4Q A;  1NYA A;  1YTZ C;  1OMD A;  1SR6 C;  2WCF A;  4YGA A;  1FPW A;  1BU3 A;  2FJY A;  3S0A A;  1MUX A;  3B87 A;  3NSO A;  5CPV A;  1CFC A;  5IBW A;  2F2P A;  4MZL A;  1ZMZ A;  2M29 A;  2K2F A;  1BR1 B;  1QX7 A;  2GV5 A;  1W9Z A;  1AP4 A;  2M3W A;  4MZJ A;  5FYX A;  2WCH A;  1RJV A;  2MRD A;  4PE4 A;  3WHT B;  4XYN A;  2LLU A;  1K9K A;  5KSZ A;  3VRP A;  2EC6 C;  2LM5 A;  3SG4 A;  3TDI A;  4A4C A;  2PMY A;  3CLN A;  1DJI A;  2BE6 A;  2KLE A;  3I5G B;  1B8R A;  1YUR A;  1GGZ A;  1F54 A;  1YUU A;  2JWW A;  1B7T Y;  1DGV A;  1XO5 A;  1ALV A;  4E68 A;  2LVI A;  3D0Y A;  1DVI A;  3BJH A;  2KFF A;  3R72 A;  5ER4 X;  1B47 A;  2ISD A;  1KSO A;  2K0J A;  2B1U A;  1ZFS A;  2KI6 C;  4QJ5 B;  2LVJ A;  1DEK A;  3SJS A;  3JTD C;  4MN0 A;  1QIV A;  2PSR A;  3CGA A;  1NPQ A;  3CWG A;  2BCB A;  2ZN8 A;  3SS4 A;  1LA0 A;  1SRA A;  1PRW A;  2A4J A;  2HF5 A;  2PVB A;  4JWQ A;  4F0Z B;  3E3R A;  2L5X B;  3TS5 C;  5DKR A;  4OR9 B;  2Y1M A;  2L2E A;  5G08 A;  5D7F A;  1NWD A;  1UHK A;  2M1U A;  4XJK A;  2LC5 A;  2LNK A;  4GFT A;  3BFA A;  5J3X A;  3BUN B;  1DJW A;  3LK1 A;  2BEC A;  1QVI Y;  1UUS A;  1REC A;  3OB2 B;  1QWV A;  2JPT A;  1LKJ A;  1AJ5 A;  1MXL C;  3EKJ A;  1KFX L;  3EVU A;  4GGF A;  3BFB A;  1Y1A A;  1MR8 A;  2LAP A;  2WND A;  2QDI A;  3S0G A;  1WDC C;  1CMG A;  3LL8 B;  2M9G A;  2L4I A;  3PFV A;  1K8U A;  4C0J A;  1JUO A;  1KK7 Y;  5JJG A;  3LK0 A;  2LMV A;  1RRO A;  1WY9 A;  1J7Q A;  1KCY A;  4MSP A;  3O6B A;  1A29 A;  3CTN A;  1SCV A;  2KQY A;  1LIN A;  1YR5 A;  2JTT A;  3OGN A;  2JXC A;  1OOF A;  4A4B A;  1YVH A;  3D0Y B;  3MSE B;  2F2O A;  3EK7 A;  1QX5 B;  2BCA A;  2AUC A;  2M7L A;  2CNP A;  1HQV A;  2DOQ A;  2KGR A;  3BOW A;  2JT8 A;  2K7C A;  3S0B A;  2L51 A;  2H61 C;  3CS1 A;  1SNL A;  1CKK A;  3OX5 A;  4BY4 A;  3CAB A;  1F8H A;  2MA2 A;  2Y4Q A;  2JRF A;  3I5G C;  3LCP C;  1GGW A;  1DGU A;  3A8R A;  1TUZ A;  1CDN A;  1NSH A;  1UP5 A;  2I2R E;  1K9U A;  3I5F B;  4WQ3 A;  1TCO B;  1Z2C B;  2KPH A;  5ER5 A;  5CSJ A;  1S26 D;  1ZOT B;  1N0Y A;  1NIW A;  2L4H A;  1YRT B;  2EHB A;  4XJK B;  5CSN A;  3WHU B;  2QEV A;  4ZCV A;  3SG2 A;  1JF0 A;  1KFU L;  1W7J B;  4TNC A;  1IQ3 A;  4AQJ A;  1WRK A;  1JBA A;  1BF5 A;  1LVC D;  1R6P A;  2BNX A;  1CDL A;  1SL7 A;  3BFH A;  3ZWH A;  2Y1N A;  1TNX A;  3V2L A;  5KTY A;  1XFW O;  5I94 A;  1QXP A;  1CM4 A;  3KHE A;  2HQ8 A;  1XK4 C;  1F70 A;  1CLM A;  1K96 A;  2JTZ A;  2LLT A;  3NGV A;  3NSI A;  5DIC A;  1UWO A;  1CLB A;  3EVR A;  3BUO B;  3SS3 A;  1B1G A;  3B88 A;  1A03 A;  1MQ1 A;  2LCP A;  1S6I A;  2PAS A;  3DF0 A;  3FWC A;  3AKA A;  4Q04 A;  2RGI A;  3AAK A;  4KYN A;  1S36 A;  2KDH A;  3TDZ A;  3JVT B;  4OZD A;  1FI5 A;  2K7O A;  2K8M B;  1M46 A;  3NSL A;  4IL1 A;  4M2P A;  4ZCU A;  5KU1 A;  1SCM B;  3FWB A;  1BOC A;  2LP3 A;  1BJF A;  1MXE A;  2ZRS A;  3EKH A;  3TZ1 A;  1MF8 B;  2KLD A;  3CZ2 A;  1BLQ A;  1MHO A;  4YRU A;  3S0F A;  3LLE A;  1EH2 A;  2M8U A;  2HPS A;  3PAT A;  1EXR A;  3F45 A;  4NQG A;  1S5G Z;  1OOJ A;  4MRY A;  2KAV A;  1A2X A;  2EGD A;  2LMU A;  2NXQ A;  3D78 A;  2Q91 A;  2KBM A;  2KYC A;  2Y5I A;  2CCM A;  1PVB A;  1T14 A;  2I7A A;  2MHH A;  1UHJ A;  3DZT A;  2QPT A;  3O4Y A;  1QX2 A;  4N1F A;  1KK7 Z;  1V1F A;  1XFR A;  3NSK A;  3Q8I A;  1YVL A;  3GK2 A; 
#chains in the Genus database with same CATH homology
 3I5F C;  2CBL A;  2KNE A;  3TDU A;  2KFH A;  1J1D A;  2E30 A;  1SBJ A;  1KFU S;  1VRK A;  4U8D A;  2CT9 A;  3IF7 A;  2HQW A;  3OB1 B;  4M2Q A;  1J7O A;  3A4U B;  1NX0 A;  4GGF C;  4QJ3 B;  1TRF A;  3KO0 A;  2NCP A;  1F4O A;  1SL8 A;  2BL0 B;  1K9P A;  1SMG A;  2L98 A;  3CR4 X;  3D10 A;  1K90 D;  1TNQ A;  1NCZ A;  4PCW A;  3PM8 A;  1DF0 A;  1IJ5 A;  1NX2 A;  1S6C A;  2K61 A;  3OHM B;  1TNW A;  4I5J A;  4OVN F;  2WC8 A;  4DUQ A;  1B4C A;  1S3P A;  4GBA A;  1CDP A;  2K7D A;  4NDD A;  4PHM A;  1KWO B;  1H8B A;  2KFG A;  4N1G A;  1HT9 A;  2KHN A;  3JVT C;  2SCP A;  1QV1 A;  5I2Q A;  1TN4 A;  1J7R A;  2LLS A;  1SCM C;  2M1K B;  4MBE A;  1XFV O;  5HKW A;  1SK6 D;  1EJ3 A;  1XVJ A;  3BQ3 A;  3RM1 A;  2F3Y A;  4ORA B;  2BE4 A;  2FCE A;  2KI4 B;  3PN7 B;  2JQ6 A;  1FI6 A;  1W7I B;  1TOP A;  2F3Z A;  4AOM A;  1EG3 A;  5AXI A;  2R2I A;  1EL4 A;  1TNP A;  3SG3 A;  4GGN A;  1SY9 A;  1AK8 A;  1DJZ A;  2E6W A;  2G9B A;  2H2K A;  5CSF A;  3C1V A;  1ALW A;  2LVK A;  4YI8 A;  1S1E A;  2P6B B;  1PK0 D;  1DT7 B;  1K2H A;  1PSB A;  3BXK A;  4DS7 A;  1SPY A;  5GQQ C;  3EK8 A;  1QTX A;  2KSP A;  4I5N B;  4PDZ A;  1PSR A;  3OX6 A;  1TCF A;  5DKN A;  1CLL A;  2K7B A;  3CR2 A;  5K89 A;  2Q4U A;  4GUK A;  2WCE A;  4MVF A;  5HLV A;  4C0L A;  1DF0 B;  2F8P A;  2LHI A;  1L7Z A;  4CPV A;  4YGB B;  2MBX A;  1N65 A;  3ZNI A;  1QLK A;  5PAL A;  1RK9 A;  1UHI A;  2BBM A;  2D8N A;  4USL A;  1DJX A;  2BL0 C;  1NX3 A;  1JF2 A;  5D69 A;  1NCX A;  2ZKM X;  1CNP A;  1QJT A;  2ZND A;  2ZNE A;  1UUR A;  5BPJ A;  4OV2 A;  1C07 A;  1NCY A;  4ICB A;  4P2Y B;  1FW4 A;  3I5H B;  2JNF A;  3PSR A;  3IQO A;  1U5I A;  2WCB A;  1F71 A;  1J55 A;  3OP0 A;  1KWO C;  1Y1X A;  1XFU O;  1B7T Z;  4HSZ A;  1OSA A;  3NXA A;  3WXA A;  1BG1 A;  2O5G A;  1CFF A;  3O78 A;  4MRX A;  2SAS A;  1LA3 A;  3SIB A;  1N2D A;  2ZFD A;  3RLZ A;  1XA5 A;  1YRU B;  3BYA A;  2MAZ A;  2KI4 C;  3PN7 C;  3VRQ A;  4DIR A;  2LAN A;  1YUT A;  2LV7 A;  2KQ6 A;  1QV0 A;  1XFY O;  1OMR A;  4I5K A;  1CM1 A;  4GNK B;  1JSA A;  3GOF A;  4R1E A;  3BOW B;  1QIW A;  4M2O A;  4NDC A;  1YX8 A;  1M45 A;  1DTL A;  1ODB A;  1PVA A;  4N5X A;  5JOL A;  3BUW B;  1OZO A;  4I5L B;  4PHK A;  1AJ4 A;  2ZN9 A;  3H4S E;  2JC2 A;  4MEW A;  1FBV A;  2PRU A;  4WRI A;  1L2O B;  2JT0 A;  2LVV A;  2L0P A;  1QVI Z;  2G2B A;  1ZUZ A;  4CLN A;  1RFJ A;  3SG5 A;  1AUI B;  1IKU A;  4CID A;  1OQP A;  5CSI A;  1IH0 A;  3PLF B;  1G4Y R;  4QJ4 B;  5HYD A;  5HKY A;  2BBN A;  2LP2 A;  1D1O A;  4L9M A;  1QAS A;  3BUM B;  1CTR A;  4PE0 A;  1U5I B;  4BY5 A;  2WOR A;  2COL B;  5AAN A;  2V53 A;  1S6J A;  3VRO A;  4OKH A;  1KSM A;  1KQM B;  1UHN A;  3QRX A;  1RTP 1;  1NX1 A;  1QLS A;  2F33 A;  1UHH A;  4PHJ A;  2GGZ A;  3GK4 X;  1QAT A;  1AHR A;  3I5H C;  3K21 A;  4YGE B;  1EG4 A;  3CR5 X;  1C7W A;  3DF0 B;  3O2P A;  1G8I A;  1IG5 A;  3AKB A;  3DVJ A;  3KPX A;  1Y1U A;  4YGD B;  1M63 B;  1IWQ A;  1OMV A;  3M0W A;  3VGO A;  2VRG A;  1YX7 A;  2OTG B;  2HET A;  2M49 B;  4GPL B;  5B8I B;  2KAX A;  4CFR A;  5F6T A;  1K95 A;  1CFD A;  2M7N A;  5TNC A;  1SW8 A;  4YI9 A;  1F55 A;  1KK8 B;  3DVK A;  3EVV A;  4ORC B;  3SG6 A;  1IQ5 A;  1MWN A;  4HRG A;  3SIA A;  2GGM A;  2JNX A;  5HLO A;  4ORB B;  1NP8 A;  3DD4 A;  1NUB A;  1H4B A;  1CDM A;  2MJW B;  3ICB A;  1Q80 A;  5AFP A;  2OS8 B;  1IGV A;  2NLN A;  2KBI A;  4OCI A;  3KEV A;  5AER A;  1L2O C;  4HRE E;  4JQ0 D;  1CFP A;  2M0R A;  3I5I B;  3IQQ A;  2CTN A;  4WQ2 A;  1GQM A;  1Y0V H;  1DMO A;  4MZK A;  1PUL A;  1WLM A;  2NZ0 A;  4D1E A;  2ZRT A;  1S5G Y;  2BKH B;  1KQM C;  3HX4 A;  1XYD A;  1X02 A;  3HCM A;  3PAL A;  1GJY A;  2KGB C;  3TUY B;  2KI6 D;  4CFQ A;  4C0K A;  4AQI A;  2FCD A;  1CB1 A;  1ZAC A;  1J1E A;  2FJU B;  2L50 A;  1BT6 A;  1DJY A;  1V1G A;  4YGC B;  2JU0 A;  1RWY A;  5AEQ A;  2CXJ A;  5DKQ A;  4MLW A;  5I8N A;  1YUS A;  2AMI A;  2WOS A;  1B8L A;  3VRN A;  1A75 A;  1B9A A;  2FOT A;  4PE1 A;  2OTG C;  2BKI B;  1SR6 B;  2AAO A;  1R2U A;  1BR4 B;  2NCO A;  1JFJ A;  3FIA A;  1TTX A;  4UPG A;  1M39 A;  4JPZ B;  2I18 A;  1KK8 C;  1OZS A;  1LXF C;  3CZT X;  1AVS A;  2MLE C;  2LUX A;  2JZI A;  3DVE A;  4PHN A;  2KAY A;  3DVM A;  2O60 A;  4DCK A;  2EC6 B;  2OS8 C;  3EK4 A;  3AAJ A;  1C7V A;  1DJH A;  5HKZ A;  4FTG A;  3KF9 A;  2KOT A;  2JUL A;  3I5I C;  2QAC A;  1OE9 B;  2JXL A;  1IRJ A;  1B8C A;  3JTD B;  2H61 A;  4GAO A;  1SL9 A;  2JOJ A;  4P5O E;  1KFX S;  2K2A A;  1QS7 A;  3BUX B;  1M31 A;  3WNX B;  1XFZ O;  1K93 D;  5I2L A;  2I94 A;  2M97 A;  3TS5 B;  2JT3 A;  1KQV A;  1Y6W A;  2IS9 A;  2LMT A;  1WRZ A;  2KYF A;  3VRR A;  1BMO A;  1BOD A;  2BCX A;  3SG7 A;  1JFK A;  1WLZ A;  3TUY C;  1TIZ A;  1WRL A;  1A75 B;  1DJG A;  4DRW A;  2LE9 B;  2LUC A;  2MLF C;  2OPO A;  2PAL A;  4NDB A;  1J7P A;  1PAL A;  1JC2 A;  1IJ6 A;  1K94 A;  1E8A A;  1XFX O;  1SKT A;  1FF1 A;  4YBH B;  1SYM A;  2LHL A;  1G33 A;  2TN4 A;  1JWD A;  1WDC B;  1A4P A;  4FQO A;  4HRH A;  4PAL A;  1XK4 A;  5I2O A;  3GK1 A;  1CMF A;  4PE7 A;  1F4Q A;  1NYA A;  1YTZ C;  1OMD A;  1SR6 C;  2WCF A;  4YGA A;  1FPW A;  1BU3 A;  1MUX A;  3NSO A;  1CFC A;  5CPV A;  5IBW A;  2F2P A;  4MZL A;  1ZMZ A;  2M29 A;  2K2F A;  1BR1 B;  1QX7 A;  2GV5 A;  1AP4 A;  2M3W A;  4MZJ A;  5FYX A;  1RJV A;  2MRD A;  4PE4 A;  3WHT B;  4XYN A;  2LLU A;  1K9K A;  5KSZ A;  3VRP A;  2EC6 C;  2LM5 A;  3SG4 A;  3TDI A;  4A4C A;  2PMY A;  3CLN A;  1DJI A;  2BE6 A;  3I5G B;  1B8R A;  1YUR A;  1GGZ A;  1F54 A;  1YUU A;  2JWW A;  1B7T Y;  1DGV A;  1XO5 A;  1ALV A;  4E68 A;  2LVI A;  3D0Y A;  1DVI A;  2KFF A;  5ER4 X;  1B47 A;  2ISD A;  1KSO A;  2K0J A;  2B1U A;  1ZFS A;  2KI6 C;  4QJ5 B;  2LVJ A;  3SJS A;  3JTD C;  4MN0 A;  1QIV A;  2PSR A;  3CGA A;  1NPQ A;  3CWG A;  2BCB A;  2ZN8 A;  1LA0 A;  1SRA A;  1PRW A;  2A4J A;  2HF5 A;  2PVB A;  4JWQ A;  4F0Z B;  3E3R A;  2L5X B;  3TS5 C;  5DKR A;  4OR9 B;  2Y1M A;  2L2E A;  5G08 A;  5D7F A;  1NWD A;  1UHK A;  2M1U A;  4XJK A;  2LC5 A;  2LNK A;  4GFT A;  5J3X A;  3BUN B;  1DJW A;  3LK1 A;  2BEC A;  1QVI Y;  1UUS A;  1REC A;  3OB2 B;  2JPT A;  4ETO A;  1LKJ A;  1AJ5 A;  1MXL C;  3EKJ A;  1KFX L;  3EVU A;  4GGF A;  1EH2 A;  1Y1A A;  1MR8 A;  2LAP A;  2WND A;  1WDC C;  1CMG A;  3LL8 B;  2M9G A;  2L4I A;  3PFV A;  1K8U A;  4C0J A;  1JUO A;  1KK7 Y;  5JJG A;  3LK0 A;  2LMV A;  1RRO A;  1WY9 A;  1J7Q A;  1KCY A;  4MSP A;  3O6B A;  1A29 A;  3CTN A;  1SCV A;  2KQY A;  1LIN A;  1YR5 A;  2JTT A;  2JXC A;  4A4B A;  1YVH A;  3D0Y B;  3MSE B;  2F2O A;  3EK7 A;  1QX5 B;  2BCA A;  2AUC A;  2M7L A;  2CNP A;  1HQV A;  2DOQ A;  2KGR A;  3BOW A;  2JT8 A;  2K7C A;  2L51 A;  2H61 C;  3CS1 A;  1SNL A;  1CKK A;  3OX5 A;  4BY4 A;  1F8H A;  2MA2 A;  2Y4Q A;  2JRF A;  3I5G C;  3LCP C;  1GGW A;  1DGU A;  3A8R A;  1CDN A;  1NSH A;  1UP5 A;  2I2R E;  1K9U A;  3I5F B;  4WQ3 A;  1TCO B;  5ER5 A;  5CSJ A;  1S26 D;  1ZOT B;  1N0Y A;  1NIW A;  2L4H A;  1YRT B;  2EHB A;  4XJK B;  5CSN A;  3WHU B;  4ZCV A;  3SG2 A;  1JF0 A;  1KFU L;  1W7J B;  4TNC A;  1IQ3 A;  4AQJ A;  1WRK A;  1JBA A;  1BF5 A;  1LVC D;  1R6P A;  1CDL A;  1SL7 A;  3ZWH A;  2Y1N A;  1TNX A;  5KTY A;  1XFW O;  1QXP A;  1CM4 A;  3KHE A;  2HQ8 A;  1XK4 C;  1F70 A;  1CLM A;  1K96 A;  2JTZ A;  2LLT A;  3NSI A;  1UWO A;  1CLB A;  3EVR A;  3BUO B;  1B1G A;  1A03 A;  1MQ1 A;  2LCP A;  1S6I A;  2PAS A;  3DF0 A;  3FWC A;  3AKA A;  4Q04 A;  2RGI A;  3AAK A;  1S36 A;  2KDH A;  3TDZ A;  3JVT B;  1FI5 A;  2K7O A;  2K8M B;  1M46 A;  3NSL A;  4IL1 A;  4M2P A;  4ZCU A;  5KU1 A;  1SCM B;  3FWB A;  1BOC A;  2LP3 A;  1BJF A;  1MXE A;  2ZRS A;  3EKH A;  3TZ1 A;  1MF8 B;  1BLQ A;  1MHO A;  4YRU A;  3LLE A;  2M8U A;  2HPS A;  3PAT A;  1EXR A;  3F45 A;  4NQG A;  1S5G Z;  1OOJ A;  4MRY A;  2KAV A;  1A2X A;  2EGD A;  2LMU A;  2NXQ A;  2Q91 A;  2KBM A;  2KYC A;  2Y5I A;  2CCM A;  1PVB A;  2I7A A;  2MHH A;  1UHJ A;  3O4Y A;  2QPT A;  1QX2 A;  4N1F A;  1KK7 Z;  1V1F A;  3FS7 A;  3NSK A;  1YVL A;  3GK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...