2JWWA

Calcium-free rat alpha-parvalbumin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
109
structure length
109
Chain Sequence
SMTDLLSAEDIKKAIGAFTAADSFDHKKFFQMVGLKKKSADDVKKVFHILDKDKSGFIEEDELGSILKGFSSDARDLSAKETKTLMAAGDKDGDGKIGVEEFSTLVAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Parvalbumin alpha
publication title Solution structure of Ca2+-free rat alpha-parvalbumin
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal binding protein
total genus 26
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2007-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2jwwA00
2K61A 2IS9A 3AKAA 1QV0A 3HCMA 1V1GA 2WOSA 4PE0A 1H8BA 2KSPA 1SCVA 2LV7A 4QJ4B 1KK8B 2RGIA 4JQ0D 1VRKA 3OB1B 1SL9A 3SIAA 1N0YA 2COLB 3PN7B 1IJ6A 2ZFDA 1LXFC 5DKQA 3WHUB 1FW4A 3WHTB 4FTGA 1KQVA 5AXIA 2PVBA 1G4YR 1QVIZ 1M63B 3IQOA 1QS7A 1KK7Z 3DVKA 2H61A 2O60A 4AOMA 2GGMA 4PDZA 1HQVA 1IGVA 1WY9A 5IBWA 2M97A 2TN4A 3TDUA 1YUTA 4QJ5B 1JFKA 2KAYA 5CPVA 2WCBA 3PATA 1JWDA 3BQ3A 2MBXA 1IH0A 2SCPA 1M46A 1J55A 1CM1A 2M49B 1F70A 2JOJA 5I8NA 1SPYA 4N5XA 1GQMA 4MLWA 1DGUA 3I5FC 1LKJA 3OB2B 1KSOA 1Y0VH 3FWCA 1QASA 1Q80A 2FCEA 1ODBA 1AP4A 2L51A 3FIAA 1A75B 1OE9B 1TNXA 3BUWB 1BJFA 1K9KA 1TIZA 2PALA 3LL8B 1UP5A 2MHHA 1CNPA 1H4BA 3VRNA 1SKTA 2JC2A 2M7NA 1KFUS 4A4BA 5HYDA 1PVAA 2OS8C 2HQWA 2L50A 1N2DA 1A03A 1IJ5A 3EKHA 1SY9A 1W7IB 3CR4X 4I5LB 4OV2A 1F54A 1S26D 4C0JA 2JRFA 2JT0A 2LVKA 4U8DA 1A29A 2ZRSA 4YGCB 2KI4C 1UURA 5AFPA 4UPGA 4OCIA 4PE1A 1WDCB 2KAVA 2BCBA 5GQQC 2L4HA 3IF7A 1J1DA 3KPXA 1CFFA 1AVSA 2CXJA 3AAJA 1B7TZ 4GGFA 1SYMA 3LK1A 5AANA 5KTYA 1C07A 1PALA 1QX2A 2KNEA 3VRQA 3BUMB 2K7OA 1QIWA 3SG4A 1BLQA 1QX7A 2LANA 1V1FA 4MZLA 1JF2A 2Y1MA 2PRUA 1NWDA 1YR5A 2E6WA 4MN0A 5G08A 2KGBC 3LCPC 1K9PA 3CZTX 2H2KA 1CB1A 1NX1A 1FI6A 3RM1A 2BECA 1CMGA 4M2PA 3O2PA 2BE4A 4DUQA 4MZJA 4P2YB 2CT9A 4WRIA 1SW8A 1WDCC 1MHOA 4OVNF 1Y1XA 1YURA 2ZKMX 4MZKA 1NX2A 1IKUA 2M7LA 4JWQA 1XFWO 4HSZA 3KEVA 1FF1A 1DJYA 3NSIA 1K96A 2FCDA 1CFCA 1B8CA 1GJYA 5FYXA 3CS1A 1UHHA 2JTZA 3O4YA 1S5GZ 2H61C 1IQ5A 1XFXO 2LP3A 2G2BA 2M0RA 2M1KB 2MA2A 2Y1NA 2LM5A 5D69A 2LLSA 4ZCVA 2Q91A 1B8LA 1XO5A 1UUSA 2V53A 1KQMB 1SR6C 2K7BA 3PFVA 1BR1B 1SMGA 2GV5A 4WQ2A 2CTNA 1S1EA 1EXRA 2I2RE 3CR5X 2EC6B 2LHLA 3CTNA 1OMDA 1A4PA 4YI8A 3I5IC 1N65A 3I5HC 3NSLA 1EJ3A 1KCYA 4GAOA 3DVJA 2KBIA 5CSFA 1AJ5A 4AQIA 1XFZO 1YUUA 2MLEC 5KU1A 2KFGA 5I2QA 2WCFA 2WNDA 4GBAA 3DVMA 2BKIB 4DIRA 1MWNA 1NCYA 1SCMB 3ICBA 1OMVA 1KFXS 2F3YA 5DKNA 1DTLA 1OSAA 1TNQA 2KAXA 4CFQA 1KQMC 1DJWA 2DOQA 1L7ZA 2L5XB 2Y5IA 3SG5A 4DCKA 1QVIY 1OMRA 1KK7Y 2F2OA 2NLNA 2P6BB 2JT3A 4ORBB 2ISDA 1Y1AA 4NDCA 3NSOA 3PLFB 1K94A 1ZFSA 2JNFA 2QPTA 1JUOA 2JWWA 1G8IA 2JXLA 2LE9B 3BUXB 4FQOA 5HKZA 1KFXL 3KHEA 1RROA 3FWBA 5JOLA 3TZ1A 1QTXA 4GGFC 3DVEA 1XFVO 1KSMA 2M1UA 3I5GB 4PALA 1YTZC 4PHMA 2AAOA 2M29A 2L0PA 4A4CA 5AERA 2LLUA 5HLVA 3SG7A 1EG4A 1QXPA 1QLSA 1NSHA 2WCEA 2KYFA 3EK4A 3GK4X 4HRHA 1YVLA 5CSNA 2JZIA 1OOJA 4I5KA 3GK2A 1KK8C 1UHKA 3SIBA 1X02A 4ETOA 3PN7C 4PE7A 5CSJA 2JU0A 3AKBA 1J1EA 1B4CA 3FS7A 4PHJA 4JPZB 1DGVA 1AJ4A 3A4UB 1BG1A 1MF8B 1SL8A 3NSKA 1M39A 1A2XA 2FOTA 2MRDA 1F8HA 2GGZA 3GOFA 4YRUA 3TS5B 2CCMA 2B1UA 2KFHA 1RECA 1DT7B 3IQQA 1D1OA 2ZNEA 3VROA 1ZOTB 4MEWA 5I2LA 1BU3A 1KFUL 2HPSA 3VRRA 4BY4A 3K21A 1XK4A 4XJKB 1CDPA 3E3RA 2KDHA 5F6TA 1K93D 2A4JA 3D0YA 3F45A 1XA5A 1B7TY 1CM4A 2BCXA 4AQJA 1CLLA 1DF0A 1MXEA 2PSRA 2LVIA 2L4IA 5HKYA 1NX3A 4OKHA 4MRYA 1U5IA 2K0JA 1EH2A 1JC2A 3TUYB 1J7RA 2MLFC 1QIVA 2LUCA 1MR8A 1YX8A 1L2OB 1DVIA 3M0WA 3NXAA 3SJSA 1YX7A 1SL7A 2M9GA 4N1FA 3TS5C 2BKHB 1NX0A 2ZN8A 1W7JB 2E30A 3BUNB 3QRXA 1B47A 3MSEB 4ORCB 4YI9A 1CDNA 1PULA 2M3WA 1WRZA 1J7QA 2MAZA 5HKWA 4DRWA 4D1EA 2Q4UA 1TRFA 4PCWA 3WNXB 4YGDB 2I7AA 1F4QA 3AAKA 1YUSA 1LINA 2JTTA 2NXQA 2KI6D 2OPOA 1YRTB 4QJ3B 2HF5A 2Y4QA 3KF9A 1NYAA 1ZUZA 2BCAA 1S5GY 3ZWHA 1BOCA 1F55A 1S6IA 5J3XA 1F71A 2VRGA 1IRJA 2LVJA 1DJIA 1L2OC 3O78A 1UHIA 4GFTA 1CDMA 1OQPA 1QATA 3D0YB 3PSRA 1JSAA 3O6BA 1S36A 4P5OE 3SG3A 1CLMA 1DF0B 4GUKA 3WXAA 2F2PA 2K2FA 3EKJA 1EG3A 1EL4A 4MRXA 2F3ZA 1XFUO 2LHIA 5K89A 4F0ZB 1U5IB 3A8RA 4ICBA 1NCZA 1YRUB 1LA3A 3CLNA 1LVCD 5ER4X 4CPVA 1K95A 2AMIA 2KQYA 1MQ1A 1XFYO 2JNXA 4XJKA 2CNPA 1KWOB 1S6CA 2MJWB 3EK7A 3DF0A 4TNCA 3LLEA 4GPLB 2LMVA 2LNKA 5TNCA 1SNLA 2M8UA 1SBJA 2PASA 2R2IA 4I5JA 2EC6C 1IG5A 1XK4C 5PALA 1UHNA 1QV1A 4M2QA 5KSZA 1FBVA 1RFJA 2OTGB 3OX5A 1FPWA 3I5FB 4GGNA 1CTRA 3KO0A 4NQGA 1TCOB 2ZN9A 1IWQA 4GNKB 1TOPA 2KQ6A 3PALA 3TDZA 2LUXA 1MXLC 1M31A 2NCPA 2L2EA 3PM8A 1RK9A 2G9BA 2I94A 2HQ8A 4CIDA 1WLZA 2OS8B 1BF5A 1SCMC 3CGAA 1KWOC 1HT9A 1TCFA 4ZCUA 4ORAB 3EVRA 3VRPA 1TTXA 1WRLA 2AUCA 4PHKA 1CFPA 3ZNIA 2KI4B 3BOWA 4NDBA 2KBMA 5HLOA 1CDLA 1CFDA 2EHBA 4YGAA 5B8IB 1DJHA 1Y1UA 1PK0D 1AHRA 3RLZA 4HREE 1SRAA 4Q04A 2K7DA 1PSBA 3BXKA 4I5NB 1ZACA 2OTGC 2BBNA 3EVUA 5JJGA 3I5GC 1S6JA 2BL0B 4HRGA 4PHNA 3TDIA 2LLTA 1OZSA 4MVFA 2KYCA 3EK8A 5D7FA 4XYNA 2WORA 1MUXA 3DD4A 1PVBA 3DF0B 2WC8A 1NCXA 2HETA 2K8MB 1ALVA 4MBEA 3OX6A 1Y6WA 1J7PA 1K90D 1E8AA 3LK0A 4PE4A 3D10A 2LVVA 2KHNA 1K2HA 2K2AA 4CLNA 1RWYA 1JFJA 1K8UA 1YVHA 1QJTA 2LCPA 1AUIB 2LC5A 4BY5A 4MSPA 4YBHB 1BMOA 1DJZA 1TNPA 3JVTB 1DJGA 1UWOA 2O5GA 1ZMZA 3CR2A 2KOTA 2BL0C 1AK8A 2KFFA 2EGDA 2JT8A 4R1EA 4NDDA 3HX4A 4C0LA 1NPQA 1NIWA 2JQ6A 4CFRA 1IQ3A 2NZ0A 3C1VA 1CMFA 1C7VA 1SR6B 4L9MA 3BOWB 3JTDB 2CBLA 2LMTA 4M2OA 4OR9B 2JXCA 3SG6A 1QLKA 2ZNDA 3CWGA 1B1GA 2JULA 2F8PA 2BE6A 4N1GA 3TUYC 1LA0A 3BUOB 3I5IB 3I5HB 1J7OA 4DS7A 5ER5A 1BODA 1DMOA 1UHJA 3OP0A 5CSIA 4IL1A 2SASA 5DKRA 4USLA 1PSRA 4YGEB 1S3PA 1DJXA 3JVTC 1R6PA 2BBMA 1JF0A 3SG2A 1FI5A 1WRKA 4C0KA 1CKKA 2LP2A 5BPJA 1GGWA 3GK1A 1WLMA 3OHMB 1C7WA 2QACA 2LAPA 1G33A 2FJUB 2K7CA 2LMUA 2I18A 5I2OA 1TN4A 2PMYA 2L98A 1GGZA 3BYAA 3H4SE 3JTDC 3VGOA 1BT6A 1B8RA 1NUBA 1OZOA 1K9UA 1PRWA 1QX5B 1RJVA 3EVVA 1XVJA 2KI6C 1A75A 4WQ3A 1RTP1 1JBAA 2D8NA 1XYDA 2F33A 1B9AA 4YGBB 4E68A 1SK6D 2KGRA 5AEQA 1BR4B 1M45A 1R2UA 1F4OA 1TNWA 2NCOA 1CLBA 2JPTA 1ALWA 2ZRTA 1NP8A
chains in the Genus database with same CATH superfamily
3D76A 2K61A 2IS9A 3AKAA 1QV0A 3HCMA 1V1GA 2WOSA 4PE0A 1H8BA 2KSPA 1SCVA 2LV7A 3CZ1A 4QJ4B 1KK8B 2RGIA 4JQ0D 1VRKA 3OB1B 1SL9A 3SIAA 1N0YA 2COLB 3PN7B 1IJ6A 3B86A 2ZFDA 1LXFC 5DKQA 3WHUB 1FW4A 3WHTB 4FTGA 1KQVA 5AXIA 2PVBA 1G4YR 1QVIZ 1M63B 3IQOA 1QS7A 1KK7Z 3DVKA 2H61A 2O60A 4AOMA 3CZ2A 2GGMA 3QMEA 4PDZA 1HQVA 1IGVA 1WY9A 5IBWA 2M97A 2TN4A 3TDUA 1YUTA 4QJ5B 1JFKA 2KAYA 5CPVA 2WCBA 3PATA 1JWDA 3BQ3A 2MBXA 1IH0A 2SCPA 1M46A 1J55A 1CM1A 2M49B 1F70A 2JOJA 5I8NA 1SPYA 4N5XA 1GQMA 3D77A 4MLWA 5FI7A 3L47A 2WCHA 1QWVA 1DGUA 3I5FC 1LKJA 3OB2B 1KSOA 1Y0VH 3FWCA 3EG5B 1QASA 1Q80A 2FCEA 1ODBA 1AP4A 2L51A 2WCKA 3FIAA 1A75B 1OE9B 1TNXA 3BUWB 1BJFA 1K9KA 1TIZA 2PALA 3LL8B 1UP5A 2MHHA 1CNPA 1OOGA 1H4BA 3VRNA 1SKTA 2JC2A 2M7NA 3S0FA 3B88A 1KFUS 4A4BA 5HYDA 1PVAA 2OS8C 2HQWA 2L50A 1N2DA 1A03A 1IJ5A 3EKHA 1SY9A 1W7IB 3CR4X 3NHTA 4I5LB 4OV2A 1F54A 1S26D 4C0JA 2JRFA 2JT0A 2LVKA 4U8DA 1A29A 1OOHA 2ZRSA 2KI4C 1UURA 4YGCB 5AFPA 4UPGA 4OCIA 4PE1A 1WDCB 2KAVA 2BCBA 5GQQC 2L4HA 2P71A 3IF7A 1J1DA 3KPXA 1CFFA 1AVSA 2CXJA 3AAJA 1B7TZ 3S0DA 4GGFA 1SYMA 3LK1A 5AANA 5KTYA 1C07A 1PALA 1QX2A 2KNEA 3VRQA 3BUMB 2K7OA 1QIWA 3R1VA 3SG4A 1BLQA 1QX7A 2LANA 1V1FA 4MZLA 1OOIX 2PYQA 1JF2A 2Y1MA 2PRUA 1NWDA 1YR5A 2E6WA 4MN0A 5G08A 2KGBC 3SS4A 3LCPC 1K9PA 3CZTX 2H2KA 1CB1A 1NX1A 3R1OA 1FI6A 3RM1A 2BECA 3OGNA 3V2LA 3RZSA 4M2PA 1CMGA 3O2PA 2BE4A 4DUQA 4MZJA 4P2YB 3PJIA 2CT9A 4WRIA 3SS5A 1SW8A 1WDCC 1MHOA 4OVNF 1Y1XA 1YURA 2ZKMX 4MZKA 1NX2A 2WCMA 2M7LA 1IKUA 4JWQA 1XFWO 4HSZA 3KEVA 1FF1A 1DJYA 3NSIA 1K96A 2FCDA 3B6XA 1CFCA 1GJYA 1B8CA 1IIOA 5FYXA 3CS1A 1UHHA 1Z4HA 2JTZA 1W9ZA 3O4YA 1S5GZ 2H61C 1IQ5A 1DEKA 1XFXO 2LP3A 3BFHA 2G2BA 2M0RA 2M1KB 2MA2A 2Y1NA 3L4LA 2LM5A 2BAPA 5D69A 2LLSA 4ZCVA 2Q91A 4IJ7A 1B8LA 1XO5A 1UUSA 2V53A 1KQMB 1SR6C 2K7BA 2L2CA 3PFVA 1BR1B 1SMGA 2GV5A 2YGUA 4WQ2A 2CTNA 1S1EA 4INXA 1EXRA 2I2RE 3CR5X 2EC6B 2LHLA 4JD9A 3CTNA 1OMDA 1A4PA 4YI8A 3I5IC 1N65A 3I5HC 3NSLA 1EJ3A 2H8VA 1KCYA 4GAOA 3DVJA 2KBIA 5CSFA 1AJ5A 1C3YA 4AQIA 1XFZO 1YUUA 2MLEC 5KU1A 2KFGA 5I2QA 2WCFA 2WNDA 4GBAA 3DVMA 2BKIB 3FE9A 1MWNA 4DIRA 5I94A 1NCYA 3D73A 1SCMB 3NGVA 3ICBA 1OMVA 1KFXS 2F3YA 5DKNA 1DTLA 1OSAA 1TNQA 2KAXA 4CFQA 1KQMC 1DJWA 2DOQA 1L7ZA 2L5XB 2Y5IA 3SG5A 4DCKA 1QVIY 1OMRA 1KK7Y 2F2OA 2NLNA 2P6BB 2JT3A 4ORBB 2ISDA 1Y1AA 3UO9A 4NDCA 3NSOA 3PLFB 1K94A 1ZFSA 2JNFA 2QPTA 1JUOA 2JWWA 1G8IA 2JXLA 2LE9B 3BUXB 4FQOA 5HKZA 1KFXL 3KHEA 1RROA 3FWBA 5JOLA 3TZ1A 1QTXA 4GGFC 3DVEA 1XFVO 1KSMA 2M1UA 3I5GB 4PALA 1YTZC 4PHMA 2AAOA 2M29A 2L0PA 4A4CA 5AERA 2LLUA 5HLVA 3SG7A 1EG4A 1QXPA 1QLSA 1NSHA 2WCEA 2KYFA 3EK4A 3GK4X 4HRHA 4F7FA 1YVLA 5CSNA 4INWA 2JZIA 1OOJA 4I5KA 3GK2A 1KK8C 1UHKA 1Z2CB 3SIBA 1X02A 4ETOA 3B87A 3PN7C 4PE7A 5CSJA 4KYNA 3IVTA 2JU0A 3AKBA 1J1EA 1B4CA 3FS7A 4PHJA 4JPZB 1DGVA 1AJ4A 3A4UB 1BG1A 1MF8B 1SL8A 3NSKA 1M39A 1A2XA 2FOTA 5D3OA 2MRDA 1F8HA 2GGZA 3GOFA 4YRUA 3TS5B 2CCMA 2B1UA 2KFHA 1RECA 1DT7B 3IQQA 1OW4A 1D1OA 2ZNEA 3VROA 1ZOTB 4MEWA 5I2LA 1BU3A 1KFUL 2HPSA 3VRRA 4BY4A 3CZ0A 3K21A 1XK4A 4XJKB 1CDPA 3E3RA 2KDHA 5F6TA 1K93D 2A4JA 3D0YA 1C3ZA 3F45A 1XA5A 1B7TY 1CM4A 2BCXA 3SS3A 4AQJA 1CLLA 1DF0A 1MXEA 2PSRA 2LVIA 2L4IA 5HKYA 1NX3A 4OKHA 4MRYA 1U5IA 2K0JA 4OZDA 1EH2A 1JC2A 3TUYB 1J7RA 2MLFC 1QIVA 2LUCA 1MR8A 1YX8A 1L2OB 1DVIA 3M0WA 3NXAA 1DC1A 3SJSA 2P70A 1YX7A 1SL7A 2M9GA 2QEBA 4N1FA 3TS5C 2BKHB 5EL2A 1NX0A 2ZN8A 1W7JB 2E30A 3BUNB 3QRXA 1B47A 3MSEB 4ORCB 4YI9A 1CDNA 1PULA 2M3WA 1WRZA 1J7QA 2MAZA 5HKWA 4DRWA 4D1EA 2Q4UA 1TRFA 4JKTA 4PCWA 3WNXB 4YGDB 2I7AA 1F4QA 3AAKA 1YUSA 1LINA 2JTTA 2NXQA 2KI6D 2OPOA 1YRTB 4QJ3B 2HF5A 2Y4QA 3KF9A 1NYAA 1ZUZA 1LS8A 1S5GY 2BCAA 3PM2A 3ZWHA 1S6IA 1BOCA 1F55A 5J3XA 1F71A 2WC6A 2VRGA 1IRJA 3BFBA 2LVJA 1TWOA 1DJIA 1L2OC 3FE6A 3O78A 1UHIA 4GFTA 1DQEA 1CDMA 1OQPA 1QATA 2ERBA 3D0YB 3PSRA 1JSAA 3O6BA 1S36A 4P5OE 3SG3A 1DELA 1CLMA 1DF0B 4PT1A 4GUKA 3WXAA 2F2PA 2K2FA 3EKJA 1EG3A 1EL4A 4MRXA 2F3ZA 1XFUO 2LHIA 2WCJA 3CYZA 5K89A 4F0ZB 1U5IB 3A8RA 4ICBA 1NCZA 1YRUB 1LA3A 3CLNA 1LVCD 5ER4X 4CPVA 1K95A 2AMIA 2KQYA 1MQ1A 1XFYO 2JNXA 4XJKA 2CNPA 3Q8IA 1KWOB 2K60A 1S6CA 1GM0A 2MJWB 3EK7A 3DF0A 3OBVA 4TNCA 3D75A 3LLEA 4GPLB 2LMVA 2LNKA 5TNCA 1SNLA 2BNXA 2M8UA 2PQLA 1SBJA 2PASA 2R2IA 3BJHA 4I5JA 2EC6C 1IG5A 1XK4C 3R1PA 5PALA 1UHNA 1QV1A 4M2QA 5KSZA 2QDIA 1FBVA 5DICA 1RFJA 2OTGB 3OX5A 1FPWA 3I5FB 4GGNA 3NHIA 1CTRA 3KO0A 4NQGA 1TCOB 2L5YA 2ZN9A 1IWQA 4GNKB 1TOPA 2FJYA 2GTEA 2KQ6A 3PALA 3TDZA 2LUXA 3UNWA 1MXLC 1M31A 2NCPA 2L2EA 3PM8A 1RK9A 2G9BA 2I94A 2HQ8A 4CIDA 1WLZA 2OS8B 1BF5A 1SCMC 3CGAA 1KWOC 1HT9A 1TCFA 4ZCUA 4ORAB 3EVRA 3VRPA 1TTXA 1WRLA 2AUCA 4PHKA 1CFPA 2WCLA 3ZNIA 2KI4B 3BOWA 4NDBA 2KBMA 5HLOA 1CDLA 2WC5A 1CFDA 2EHBA 3K1EA 4YGAA 5B8IB 1DJHA 1Y1UA 1PK0D 1AHRA 3RLZA 4HREE 1SRAA 4Q04A 1SSEB 2K7DA 1PSBA 3BXKA 4I5NB 1ZACA 2OTGC 2BBNA 3EVUA 5JJGA 3I5GC 1S6JA 2BL0B 4HRGA 4PHNA 3TDIA 2LLTA 1OZSA 2QEVA 3DYEA 2KYCA 4MVFA 2QEHA 3EK8A 5D7FA 4XYNA 2WORA 1MUXA 3DD4A 1PVBA 3VB1A 3DF0B 2WC8A 1NCXA 2HETA 2K8MB 1ALVA 4MBEA 1P28A 3OX6A 3R72A 2KLEA 1Y6WA 1J7PA 1K90D 3L4AA 3D78A 1E8AA 3LK0A 4PE4A 3D10A 2LVVA 3BFAA 2KHNA 3CABA 1K2HA 2K2AA 4CLNA 1RWYA 3D74A 1JFJA 1K8UA 1YVHA 1OOFA 1QJTA 2LCPA 1AUIB 2LC5A 4BY5A 4MSPA 3N7HA 4YBHB 1BMOA 1DJZA 1TUZA 1TNPA 3JVTB 5FI6A 1DJGA 1T14A 1UWOA 2O5GA 1ZMZA 3CR2A 2KOTA 2BL0C 1AK8A 2KFFA 3DXLA 3DY9A 2EGDA 2JT8A 3O4XA 4R1EA 4NDDA 3HX4A 1TUJA 4C0LA 1NPQA 1NIWA 2JQ6A 5FI2A 4CFRA 1IQ3A 2NZ0A 3C1VA 1CMFA 1ORGA 1SR6B 1C7VA 4L9MA 2KPHA 3S0BA 3BOWB 3JTDB 2CBLA 2LMTA 2QEOA 4M2OA 2JXCA 4OR9B 3S0GA 1QLKA 3SG6A 2ZNDA 2JPOA 3CWGA 1B1GA 2JULA 3S0EA 2F8PA 2BE6A 4N1GA 3S0AA 3TUYC 1LA0A 3BUOB 3I5IB 3I5HB 1J7OA 4DS7A 5ER5A 1BODA 1DMOA 4FQTA 2KLDA 1UHJA 3OP0A 5CSIA 4IL1A 2SASA 1XFRA 5DKRA 4USLA 1PSRA 3DZTA 4YGEB 1S3PA 1DJXA 3JVTC 1R6PA 2BBMA 1JF0A 3SG2A 1FI5A 1WRKA 3B7AA 4C0KA 2LP2A 5BPJA 1CKKA 1GGWA 3GK1A 1WLMA 3OHMB 1C7WA 2QACA 2LAPA 1G33A 2FJUB 2K7CA 2LMUA 2I18A 5I2OA 1TN4A 2PMYA 2L98A 1GGZA 3BYAA 3H4SE 3JTDC 3VGOA 1BT6A 1B8RA 3FE8A 1NUBA 1OZOA 1K9UA 1PRWA 1QX5B 1RJVA 3CDNA 1XVJA 2KI6C 1A75A 3EVVA 4WQ3A 1RTP1 1JBAA 2D8NA 1XYDA 2F33A 1B9AA 4YGBB 4E68A 1SK6D 2KGRA 5AEQA 1BR4B 1M45A 1R2UA 1F4OA 1TNWA 2NCOA 1CLBA 2JPTA 1ALWA 2ZRTA 1NP8A 5HL1A
chains in the Genus database with same CATH topology
2K61A 2IS9A 3AKAA 1QV0A 3HCMA 1V1GA 2WOSA 4PE0A 1H8BA 2KSPA 1SCVA 2LV7A 4QJ4B 1KK8B 2RGIA 4JQ0D 1VRKA 3OB1B 1SL9A 3SIAA 1N0YA 2COLB 3PN7B 1IJ6A 2ZFDA 1LXFC 5DKQA 3WHUB 1FW4A 3WHTB 4FTGA 1KQVA 5AXIA 2PVBA 1G4YR 1QVIZ 1M63B 3IQOA 1QS7A 1KK7Z 3DVKA 2H61A 2O60A 4AOMA 2GGMA 4PDZA 1HQVA 1IGVA 1WY9A 5IBWA 2M97A 2TN4A 3TDUA 1YUTA 4QJ5B 1JFKA 2KAYA 5CPVA 2WCBA 3PATA 1JWDA 3BQ3A 2MBXA 1IH0A 2SCPA 1M46A 1J55A 1CM1A 2M49B 1F70A 2JOJA 5I8NA 1SPYA 4N5XA 1GQMA 4MLWA 1DGUA 3I5FC 1LKJA 3OB2B 1KSOA 1Y0VH 3FWCA 1QASA 1Q80A 2FCEA 1ODBA 1AP4A 2L51A 3FIAA 1A75B 1OE9B 1TNXA 3BUWB 1BJFA 1K9KA 1TIZA 2PALA 3LL8B 1UP5A 2MHHA 1CNPA 1H4BA 3VRNA 1SKTA 2JC2A 2M7NA 1KFUS 4A4BA 5HYDA 1PVAA 2OS8C 2HQWA 2L50A 1N2DA 1A03A 1IJ5A 3EKHA 1SY9A 1W7IB 3CR4X 4I5LB 4OV2A 1F54A 1S26D 4C0JA 2JRFA 2JT0A 2LVKA 4U8DA 1A29A 2ZRSA 4YGCB 2KI4C 1UURA 5AFPA 4UPGA 4OCIA 4PE1A 1WDCB 2KAVA 2BCBA 5GQQC 2L4HA 3IF7A 1J1DA 3KPXA 1CFFA 1AVSA 2CXJA 3AAJA 1B7TZ 4GGFA 1SYMA 3LK1A 5AANA 5KTYA 1C07A 1PALA 1QX2A 2KNEA 3VRQA 3BUMB 2K7OA 1QIWA 3SG4A 1BLQA 1QX7A 2LANA 1V1FA 4MZLA 1JF2A 2Y1MA 2PRUA 1NWDA 1YR5A 2E6WA 4MN0A 5G08A 2KGBC 3LCPC 1K9PA 3CZTX 2H2KA 1CB1A 1NX1A 1FI6A 3RM1A 2BECA 1CMGA 4M2PA 3O2PA 2BE4A 4DUQA 4MZJA 4P2YB 2CT9A 4WRIA 1SW8A 1WDCC 1MHOA 4OVNF 1Y1XA 1YURA 2ZKMX 4MZKA 1NX2A 1IKUA 2M7LA 4JWQA 1XFWO 4HSZA 3KEVA 1FF1A 1DJYA 3NSIA 1K96A 2FCDA 1CFCA 1B8CA 1GJYA 5FYXA 3CS1A 1UHHA 2JTZA 3O4YA 1S5GZ 2H61C 1IQ5A 1XFXO 2LP3A 2G2BA 2M0RA 2M1KB 2MA2A 2Y1NA 2LM5A 5D69A 2LLSA 4ZCVA 2Q91A 1B8LA 1XO5A 1UUSA 2V53A 1KQMB 1SR6C 2K7BA 3PFVA 1BR1B 1SMGA 2GV5A 4WQ2A 2CTNA 1S1EA 1EXRA 2I2RE 3CR5X 2EC6B 2LHLA 3CTNA 1OMDA 1A4PA 4YI8A 3I5IC 1N65A 3I5HC 3NSLA 1EJ3A 1KCYA 4GAOA 3DVJA 2KBIA 5CSFA 1AJ5A 4AQIA 1XFZO 1YUUA 2MLEC 5KU1A 2KFGA 5I2QA 2WCFA 2WNDA 4GBAA 3DVMA 2BKIB 4DIRA 1MWNA 1NCYA 1SCMB 3ICBA 1OMVA 1KFXS 2F3YA 5DKNA 1DTLA 1OSAA 1TNQA 2KAXA 4CFQA 1KQMC 1DJWA 2DOQA 1L7ZA 2L5XB 2Y5IA 3SG5A 4DCKA 1QVIY 1OMRA 1KK7Y 2F2OA 2NLNA 2P6BB 2JT3A 4ORBB 2ISDA 1Y1AA 4NDCA 3NSOA 3PLFB 1K94A 1ZFSA 2JNFA 2QPTA 1JUOA 2JWWA 1G8IA 2JXLA 2LE9B 3BUXB 4FQOA 5HKZA 1KFXL 3KHEA 1RROA 3FWBA 5JOLA 3TZ1A 1QTXA 4GGFC 3DVEA 1XFVO 1KSMA 2M1UA 3I5GB 4PALA 1YTZC 4PHMA 2AAOA 2M29A 2L0PA 4A4CA 5AERA 2LLUA 5HLVA 3SG7A 1EG4A 1QXPA 1QLSA 1NSHA 2WCEA 2KYFA 3EK4A 3GK4X 4HRHA 1YVLA 5CSNA 2JZIA 1OOJA 4I5KA 3GK2A 1KK8C 1UHKA 3SIBA 1X02A 4ETOA 3PN7C 4PE7A 5CSJA 2JU0A 3AKBA 1J1EA 1B4CA 3FS7A 4PHJA 4JPZB 1DGVA 1AJ4A 3A4UB 1BG1A 1MF8B 1SL8A 3NSKA 1M39A 1A2XA 2FOTA 2MRDA 1F8HA 2GGZA 3GOFA 4YRUA 3TS5B 2CCMA 2B1UA 2KFHA 1RECA 1DT7B 3IQQA 1D1OA 2ZNEA 3VROA 1ZOTB 4MEWA 5I2LA 1BU3A 1KFUL 2HPSA 3VRRA 4BY4A 3K21A 1XK4A 4XJKB 1CDPA 3E3RA 2KDHA 5F6TA 1K93D 2A4JA 3D0YA 3F45A 1XA5A 1B7TY 1CM4A 2BCXA 4AQJA 1CLLA 1DF0A 1MXEA 2PSRA 2LVIA 2L4IA 5HKYA 1NX3A 4OKHA 4MRYA 1U5IA 2K0JA 1EH2A 1JC2A 3TUYB 1J7RA 2MLFC 1QIVA 2LUCA 1MR8A 1YX8A 1L2OB 1DVIA 3M0WA 3NXAA 3SJSA 1YX7A 1SL7A 2M9GA 4N1FA 3TS5C 2BKHB 1NX0A 2ZN8A 1W7JB 2E30A 3BUNB 3QRXA 1B47A 3MSEB 4ORCB 4YI9A 1CDNA 1PULA 2M3WA 1WRZA 1J7QA 2MAZA 5HKWA 4DRWA 4D1EA 2Q4UA 1TRFA 4PCWA 3WNXB 4YGDB 2I7AA 1F4QA 3AAKA 1YUSA 1LINA 2JTTA 2NXQA 2KI6D 2OPOA 1YRTB 4QJ3B 2HF5A 2Y4QA 3KF9A 1NYAA 1ZUZA 2BCAA 1S5GY 3ZWHA 1BOCA 1F55A 1S6IA 5J3XA 1F71A 2VRGA 1IRJA 2LVJA 1DJIA 1L2OC 3O78A 1UHIA 4GFTA 1CDMA 1OQPA 1QATA 3D0YB 3PSRA 1JSAA 3O6BA 1S36A 4P5OE 3SG3A 1CLMA 1DF0B 4GUKA 3WXAA 2F2PA 2K2FA 3EKJA 1EG3A 1EL4A 4MRXA 2F3ZA 1XFUO 2LHIA 5K89A 4F0ZB 1U5IB 3A8RA 4ICBA 1NCZA 1YRUB 1LA3A 3CLNA 1LVCD 5ER4X 4CPVA 1K95A 2AMIA 2KQYA 1MQ1A 1XFYO 2JNXA 4XJKA 2CNPA 1KWOB 1S6CA 2MJWB 3EK7A 3DF0A 4TNCA 3LLEA 4GPLB 2LMVA 2LNKA 5TNCA 1SNLA 2M8UA 1SBJA 2PASA 2R2IA 4I5JA 2EC6C 1IG5A 1XK4C 5PALA 1UHNA 1QV1A 4M2QA 5KSZA 1FBVA 1RFJA 2OTGB 3OX5A 1FPWA 3I5FB 4GGNA 1CTRA 3KO0A 4NQGA 1TCOB 2ZN9A 1IWQA 4GNKB 1TOPA 2KQ6A 3PALA 3TDZA 2LUXA 1MXLC 1M31A 2NCPA 2L2EA 3PM8A 1RK9A 2G9BA 2I94A 2HQ8A 4CIDA 1WLZA 2OS8B 1BF5A 1SCMC 3CGAA 1KWOC 1HT9A 1TCFA 4ZCUA 4ORAB 3EVRA 3VRPA 1TTXA 1WRLA 2AUCA 4PHKA 1CFPA 3ZNIA 2KI4B 3BOWA 4NDBA 2KBMA 5HLOA 1CDLA 1CFDA 2EHBA 4YGAA 5B8IB 1DJHA 1Y1UA 1PK0D 1AHRA 3RLZA 4HREE 1SRAA 4Q04A 2K7DA 1PSBA 3BXKA 4I5NB 1ZACA 2OTGC 2BBNA 3EVUA 5JJGA 3I5GC 1S6JA 2BL0B 4HRGA 4PHNA 3TDIA 2LLTA 1OZSA 4MVFA 2KYCA 3EK8A 5D7FA 4XYNA 2WORA 1MUXA 3DD4A 1PVBA 3DF0B 2WC8A 1NCXA 2HETA 2K8MB 1ALVA 4MBEA 3OX6A 1Y6WA 1J7PA 1K90D 1E8AA 3LK0A 4PE4A 3D10A 2LVVA 2KHNA 1K2HA 2K2AA 4CLNA 1RWYA 1JFJA 1K8UA 1YVHA 1QJTA 2LCPA 1AUIB 2LC5A 4BY5A 4MSPA 4YBHB 1BMOA 1DJZA 1TNPA 3JVTB 1DJGA 1UWOA 2O5GA 1ZMZA 3CR2A 2KOTA 2BL0C 1AK8A 2KFFA 2EGDA 2JT8A 4R1EA 4NDDA 3HX4A 4C0LA 1NPQA 1NIWA 2JQ6A 4CFRA 1IQ3A 2NZ0A 3C1VA 1CMFA 1C7VA 1SR6B 4L9MA 3BOWB 3JTDB 2CBLA 2LMTA 4M2OA 4OR9B 2JXCA 3SG6A 1QLKA 2ZNDA 3CWGA 1B1GA 2JULA 2F8PA 2BE6A 4N1GA 3TUYC 1LA0A 3BUOB 3I5IB 3I5HB 1J7OA 4DS7A 5ER5A 1BODA 1DMOA 1UHJA 3OP0A 5CSIA 4IL1A 2SASA 5DKRA 4USLA 1PSRA 4YGEB 1S3PA 1DJXA 3JVTC 1R6PA 2BBMA 1JF0A 3SG2A 1FI5A 1WRKA 4C0KA 1CKKA 2LP2A 5BPJA 1GGWA 3GK1A 1WLMA 3OHMB 1C7WA 2QACA 2LAPA 1G33A 2FJUB 2K7CA 2LMUA 2I18A 5I2OA 1TN4A 2PMYA 2L98A 1GGZA 3BYAA 3H4SE 3JTDC 3VGOA 1BT6A 1B8RA 1NUBA 1OZOA 1K9UA 1PRWA 1QX5B 1RJVA 3EVVA 1XVJA 2KI6C 1A75A 4WQ3A 1RTP1 1JBAA 2D8NA 1XYDA 2F33A 1B9AA 4YGBB 4E68A 1SK6D 2KGRA 5AEQA 1BR4B 1M45A 1R2UA 1F4OA 1TNWA 2NCOA 1CLBA 2JPTA 1ALWA 2ZRTA 1NP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K61 A;  2IS9 A;  3AKA A;  1QV0 A;  3HCM A;  1V1G A;  2WOS A;  4PE0 A;  1H8B A;  2KSP A;  1SCV A;  2LV7 A;  4QJ4 B;  1KK8 B;  2RGI A;  4JQ0 D;  1VRK A;  3OB1 B;  1SL9 A;  3SIA A;  1N0Y A;  2COL B;  3PN7 B;  1IJ6 A;  2ZFD A;  1LXF C;  5DKQ A;  3WHU B;  1FW4 A;  3WHT B;  4FTG A;  1KQV A;  5AXI A;  2PVB A;  1G4Y R;  1QVI Z;  1M63 B;  3IQO A;  1QS7 A;  1KK7 Z;  3DVK A;  2H61 A;  2O60 A;  4AOM A;  2GGM A;  4PDZ A;  1HQV A;  1IGV A;  1WY9 A;  5IBW A;  2M97 A;  2TN4 A;  3TDU A;  1YUT A;  4QJ5 B;  1JFK A;  2KAY A;  5CPV A;  2WCB A;  3PAT A;  1JWD A;  3BQ3 A;  2MBX A;  1IH0 A;  2SCP A;  1M46 A;  1J55 A;  1CM1 A;  2M49 B;  1F70 A;  2JOJ A;  5I8N A;  1SPY A;  4N5X A;  1GQM A;  4MLW A;  1DGU A;  3I5F C;  1LKJ A;  3OB2 B;  1KSO A;  1Y0V H;  3FWC A;  1QAS A;  1Q80 A;  2FCE A;  1ODB A;  1AP4 A;  2L51 A;  3FIA A;  1A75 B;  1OE9 B;  1TNX A;  3BUW B;  1BJF A;  1K9K A;  1TIZ A;  2PAL A;  3LL8 B;  1UP5 A;  2MHH A;  1CNP A;  1H4B A;  3VRN A;  1SKT A;  2JC2 A;  2M7N A;  1KFU S;  4A4B A;  5HYD A;  1PVA A;  2OS8 C;  2HQW A;  2L50 A;  1N2D A;  1A03 A;  1IJ5 A;  3EKH A;  1SY9 A;  1W7I B;  3CR4 X;  4I5L B;  4OV2 A;  1F54 A;  1S26 D;  4C0J A;  2JRF A;  2JT0 A;  2LVK A;  4U8D A;  1A29 A;  2ZRS A;  4YGC B;  2KI4 C;  1UUR A;  5AFP A;  4UPG A;  4OCI A;  4PE1 A;  1WDC B;  2KAV A;  2BCB A;  5GQQ C;  2L4H A;  3IF7 A;  1J1D A;  3KPX A;  1CFF A;  1AVS A;  2CXJ A;  3AAJ A;  1B7T Z;  4GGF A;  1SYM A;  3LK1 A;  5AAN A;  5KTY A;  1C07 A;  1PAL A;  1QX2 A;  2KNE A;  3VRQ A;  3BUM B;  2K7O A;  1QIW A;  3SG4 A;  1BLQ A;  1QX7 A;  2LAN A;  1V1F A;  4MZL A;  1JF2 A;  2Y1M A;  2PRU A;  1NWD A;  1YR5 A;  2E6W A;  4MN0 A;  5G08 A;  2KGB C;  3LCP C;  1K9P A;  3CZT X;  2H2K A;  1CB1 A;  1NX1 A;  1FI6 A;  3RM1 A;  2BEC A;  1CMG A;  4M2P A;  3O2P A;  2BE4 A;  4DUQ A;  4MZJ A;  4P2Y B;  2CT9 A;  4WRI A;  1SW8 A;  1WDC C;  1MHO A;  4OVN F;  1Y1X A;  1YUR A;  2ZKM X;  4MZK A;  1NX2 A;  1IKU A;  2M7L A;  4JWQ A;  1XFW O;  4HSZ A;  3KEV A;  1FF1 A;  1DJY A;  3NSI A;  1K96 A;  2FCD A;  1CFC A;  1B8C A;  1GJY A;  5FYX A;  3CS1 A;  1UHH A;  2JTZ A;  3O4Y A;  1S5G Z;  2H61 C;  1IQ5 A;  1XFX O;  2LP3 A;  2G2B A;  2M0R A;  2M1K B;  2MA2 A;  2Y1N A;  2LM5 A;  5D69 A;  2LLS A;  4ZCV A;  2Q91 A;  1B8L A;  1XO5 A;  1UUS A;  2V53 A;  1KQM B;  1SR6 C;  2K7B A;  3PFV A;  1BR1 B;  1SMG A;  2GV5 A;  4WQ2 A;  2CTN A;  1S1E A;  1EXR A;  2I2R E;  3CR5 X;  2EC6 B;  2LHL A;  3CTN A;  1OMD A;  1A4P A;  4YI8 A;  3I5I C;  1N65 A;  3I5H C;  3NSL A;  1EJ3 A;  1KCY A;  4GAO A;  3DVJ A;  2KBI A;  5CSF A;  1AJ5 A;  4AQI A;  1XFZ O;  1YUU A;  2MLE C;  5KU1 A;  2KFG A;  5I2Q A;  2WCF A;  2WND A;  4GBA A;  3DVM A;  2BKI B;  4DIR A;  1MWN A;  1NCY A;  1SCM B;  3ICB A;  1OMV A;  1KFX S;  2F3Y A;  5DKN A;  1DTL A;  1OSA A;  1TNQ A;  2KAX A;  4CFQ A;  1KQM C;  1DJW A;  2DOQ A;  1L7Z A;  2L5X B;  2Y5I A;  3SG5 A;  4DCK A;  1QVI Y;  1OMR A;  1KK7 Y;  2F2O A;  2NLN A;  2P6B B;  2JT3 A;  4ORB B;  2ISD A;  1Y1A A;  4NDC A;  3NSO A;  3PLF B;  1K94 A;  1ZFS A;  2JNF A;  2QPT A;  1JUO A;  2JWW A;  1G8I A;  2JXL A;  2LE9 B;  3BUX B;  4FQO A;  5HKZ A;  1KFX L;  3KHE A;  1RRO A;  3FWB A;  5JOL A;  3TZ1 A;  1QTX A;  4GGF C;  3DVE A;  1XFV O;  1KSM A;  2M1U A;  3I5G B;  4PAL A;  1YTZ C;  4PHM A;  2AAO A;  2M29 A;  2L0P A;  4A4C A;  5AER A;  2LLU A;  5HLV A;  3SG7 A;  1EG4 A;  1QXP A;  1QLS A;  1NSH A;  2WCE A;  2KYF A;  3EK4 A;  3GK4 X;  4HRH A;  1YVL A;  5CSN A;  2JZI A;  1OOJ A;  4I5K A;  3GK2 A;  1KK8 C;  1UHK A;  3SIB A;  1X02 A;  4ETO A;  3PN7 C;  4PE7 A;  5CSJ A;  2JU0 A;  3AKB A;  1J1E A;  1B4C A;  3FS7 A;  4PHJ A;  4JPZ B;  1DGV A;  1AJ4 A;  3A4U B;  1BG1 A;  1MF8 B;  1SL8 A;  3NSK A;  1M39 A;  1A2X A;  2FOT A;  2MRD A;  1F8H A;  2GGZ A;  3GOF A;  4YRU A;  3TS5 B;  2CCM A;  2B1U A;  2KFH A;  1REC A;  1DT7 B;  3IQQ A;  1D1O A;  2ZNE A;  3VRO A;  1ZOT B;  4MEW A;  5I2L A;  1BU3 A;  1KFU L;  2HPS A;  3VRR A;  4BY4 A;  3K21 A;  1XK4 A;  4XJK B;  1CDP A;  3E3R A;  2KDH A;  5F6T A;  1K93 D;  2A4J A;  3D0Y A;  3F45 A;  1XA5 A;  1B7T Y;  1CM4 A;  2BCX A;  4AQJ A;  1CLL A;  1DF0 A;  1MXE A;  2PSR A;  2LVI A;  2L4I A;  5HKY A;  1NX3 A;  4OKH A;  4MRY A;  1U5I A;  2K0J A;  1EH2 A;  1JC2 A;  3TUY B;  1J7R A;  2MLF C;  1QIV A;  2LUC A;  1MR8 A;  1YX8 A;  1L2O B;  1DVI A;  3M0W A;  3NXA A;  3SJS A;  1YX7 A;  1SL7 A;  2M9G A;  4N1F A;  3TS5 C;  2BKH B;  1NX0 A;  2ZN8 A;  1W7J B;  2E30 A;  3BUN B;  3QRX A;  1B47 A;  3MSE B;  4ORC B;  4YI9 A;  1CDN A;  1PUL A;  2M3W A;  1WRZ A;  1J7Q A;  2MAZ A;  5HKW A;  4DRW A;  4D1E A;  2Q4U A;  1TRF A;  4PCW A;  3WNX B;  4YGD B;  2I7A A;  1F4Q A;  3AAK A;  1YUS A;  1LIN A;  2JTT A;  2NXQ A;  2KI6 D;  2OPO A;  1YRT B;  4QJ3 B;  2HF5 A;  2Y4Q A;  3KF9 A;  1NYA A;  1ZUZ A;  2BCA A;  1S5G Y;  3ZWH A;  1BOC A;  1F55 A;  1S6I A;  5J3X A;  1F71 A;  2VRG A;  1IRJ A;  2LVJ A;  1DJI A;  1L2O C;  3O78 A;  1UHI A;  4GFT A;  1CDM A;  1OQP A;  1QAT A;  3D0Y B;  3PSR A;  1JSA A;  3O6B A;  1S36 A;  4P5O E;  3SG3 A;  1CLM A;  1DF0 B;  4GUK A;  3WXA A;  2F2P A;  2K2F A;  3EKJ A;  1EG3 A;  1EL4 A;  4MRX A;  2F3Z A;  1XFU O;  2LHI A;  5K89 A;  4F0Z B;  1U5I B;  3A8R A;  4ICB A;  1NCZ A;  1YRU B;  1LA3 A;  3CLN A;  1LVC D;  5ER4 X;  4CPV A;  1K95 A;  2AMI A;  2KQY A;  1MQ1 A;  1XFY O;  2JNX A;  4XJK A;  2CNP A;  1KWO B;  1S6C A;  2MJW B;  3EK7 A;  3DF0 A;  4TNC A;  3LLE A;  4GPL B;  2LMV A;  2LNK A;  5TNC A;  1SNL A;  2M8U A;  1SBJ A;  2PAS A;  2R2I A;  4I5J A;  2EC6 C;  1IG5 A;  1XK4 C;  5PAL A;  1UHN A;  1QV1 A;  4M2Q A;  5KSZ A;  1FBV A;  1RFJ A;  2OTG B;  3OX5 A;  1FPW A;  3I5F B;  4GGN A;  1CTR A;  3KO0 A;  4NQG A;  1TCO B;  2ZN9 A;  1IWQ A;  4GNK B;  1TOP A;  2KQ6 A;  3PAL A;  3TDZ A;  2LUX A;  1MXL C;  1M31 A;  2NCP A;  2L2E A;  3PM8 A;  1RK9 A;  2G9B A;  2I94 A;  2HQ8 A;  4CID A;  1WLZ A;  2OS8 B;  1BF5 A;  1SCM C;  3CGA A;  1KWO C;  1HT9 A;  1TCF A;  4ZCU A;  4ORA B;  3EVR A;  3VRP A;  1TTX A;  1WRL A;  2AUC A;  4PHK A;  1CFP A;  3ZNI A;  2KI4 B;  3BOW A;  4NDB A;  2KBM A;  5HLO A;  1CDL A;  1CFD A;  2EHB A;  4YGA A;  5B8I B;  1DJH A;  1Y1U A;  1PK0 D;  1AHR A;  3RLZ A;  4HRE E;  1SRA A;  4Q04 A;  2K7D A;  1PSB A;  3BXK A;  4I5N B;  1ZAC A;  2OTG C;  2BBN A;  3EVU A;  5JJG A;  3I5G C;  1S6J A;  2BL0 B;  4HRG A;  4PHN A;  3TDI A;  2LLT A;  1OZS A;  4MVF A;  2KYC A;  3EK8 A;  5D7F A;  4XYN A;  2WOR A;  1MUX A;  3DD4 A;  1PVB A;  3DF0 B;  2WC8 A;  1NCX A;  2HET A;  2K8M B;  1ALV A;  4MBE A;  3OX6 A;  1Y6W A;  1J7P A;  1K90 D;  1E8A A;  3LK0 A;  4PE4 A;  3D10 A;  2LVV A;  2KHN A;  1K2H A;  2K2A A;  4CLN A;  1RWY A;  1JFJ A;  1K8U A;  1YVH A;  1QJT A;  2LCP A;  1AUI B;  2LC5 A;  4BY5 A;  4MSP A;  4YBH B;  1BMO A;  1DJZ A;  1TNP A;  3JVT B;  1DJG A;  1UWO A;  2O5G A;  1ZMZ A;  3CR2 A;  2KOT A;  2BL0 C;  1AK8 A;  2KFF A;  2EGD A;  2JT8 A;  4R1E A;  4NDD A;  3HX4 A;  4C0L A;  1NPQ A;  1NIW A;  2JQ6 A;  4CFR A;  1IQ3 A;  2NZ0 A;  3C1V A;  1CMF A;  1C7V A;  1SR6 B;  4L9M A;  3BOW B;  3JTD B;  2CBL A;  2LMT A;  4M2O A;  4OR9 B;  2JXC A;  3SG6 A;  1QLK A;  2ZND A;  3CWG A;  1B1G A;  2JUL A;  2F8P A;  2BE6 A;  4N1G A;  3TUY C;  1LA0 A;  3BUO B;  3I5I B;  3I5H B;  1J7O A;  4DS7 A;  5ER5 A;  1BOD A;  1DMO A;  1UHJ A;  3OP0 A;  5CSI A;  4IL1 A;  2SAS A;  5DKR A;  4USL A;  1PSR A;  4YGE B;  1S3P A;  1DJX A;  3JVT C;  1R6P A;  2BBM A;  1JF0 A;  3SG2 A;  1FI5 A;  1WRK A;  4C0K A;  1CKK A;  2LP2 A;  5BPJ A;  1GGW A;  3GK1 A;  1WLM A;  3OHM B;  1C7W A;  2QAC A;  2LAP A;  1G33 A;  2FJU B;  2K7C A;  2LMU A;  2I18 A;  5I2O A;  1TN4 A;  2PMY A;  2L98 A;  1GGZ A;  3BYA A;  3H4S E;  3JTD C;  3VGO A;  1BT6 A;  1B8R A;  1NUB A;  1OZO A;  1K9U A;  1PRW A;  1QX5 B;  1RJV A;  3EVV A;  1XVJ A;  2KI6 C;  1A75 A;  4WQ3 A;  1RTP 1;  1JBA A;  2D8N A;  1XYD A;  2F33 A;  1B9A A;  4YGB B;  4E68 A;  1SK6 D;  2KGR A;  5AEQ A;  1BR4 B;  1M45 A;  1R2U A;  1F4O A;  1TNW A;  2NCO A;  1CLB A;  2JPT A;  1ALW A;  2ZRT A;  1NP8 A; 
#chains in the Genus database with same CATH topology
 3D76 A;  2K61 A;  2IS9 A;  3AKA A;  1QV0 A;  3HCM A;  1V1G A;  2WOS A;  4PE0 A;  1H8B A;  2KSP A;  1SCV A;  2LV7 A;  3CZ1 A;  4QJ4 B;  1KK8 B;  2RGI A;  4JQ0 D;  1VRK A;  3OB1 B;  1SL9 A;  3SIA A;  1N0Y A;  2COL B;  3PN7 B;  1IJ6 A;  3B86 A;  2ZFD A;  1LXF C;  5DKQ A;  3WHU B;  1FW4 A;  3WHT B;  4FTG A;  1KQV A;  5AXI A;  2PVB A;  1G4Y R;  1QVI Z;  1M63 B;  3IQO A;  1QS7 A;  1KK7 Z;  3DVK A;  2H61 A;  2O60 A;  4AOM A;  3CZ2 A;  2GGM A;  3QME A;  4PDZ A;  1HQV A;  1IGV A;  1WY9 A;  5IBW A;  2M97 A;  2TN4 A;  3TDU A;  1YUT A;  4QJ5 B;  1JFK A;  2KAY A;  5CPV A;  2WCB A;  3PAT A;  1JWD A;  3BQ3 A;  2MBX A;  1IH0 A;  2SCP A;  1M46 A;  1J55 A;  1CM1 A;  2M49 B;  1F70 A;  2JOJ A;  5I8N A;  1SPY A;  4N5X A;  1GQM A;  3D77 A;  4MLW A;  5FI7 A;  3L47 A;  2WCH A;  1QWV A;  1DGU A;  3I5F C;  1LKJ A;  3OB2 B;  1KSO A;  1Y0V H;  3FWC A;  3EG5 B;  1QAS A;  1Q80 A;  2FCE A;  1ODB A;  1AP4 A;  2L51 A;  2WCK A;  3FIA A;  1A75 B;  1OE9 B;  1TNX A;  3BUW B;  1BJF A;  1K9K A;  1TIZ A;  2PAL A;  3LL8 B;  1UP5 A;  2MHH A;  1CNP A;  1OOG A;  1H4B A;  3VRN A;  1SKT A;  2JC2 A;  2M7N A;  3S0F A;  3B88 A;  1KFU S;  4A4B A;  5HYD A;  1PVA A;  2OS8 C;  2HQW A;  2L50 A;  1N2D A;  1A03 A;  1IJ5 A;  3EKH A;  1SY9 A;  1W7I B;  3CR4 X;  3NHT A;  4I5L B;  4OV2 A;  1F54 A;  1S26 D;  4C0J A;  2JRF A;  2JT0 A;  2LVK A;  4U8D A;  1A29 A;  1OOH A;  2ZRS A;  2KI4 C;  1UUR A;  4YGC B;  5AFP A;  4UPG A;  4OCI A;  4PE1 A;  1WDC B;  2KAV A;  2BCB A;  5GQQ C;  2L4H A;  2P71 A;  3IF7 A;  1J1D A;  3KPX A;  1CFF A;  1AVS A;  2CXJ A;  3AAJ A;  1B7T Z;  3S0D A;  4GGF A;  1SYM A;  3LK1 A;  5AAN A;  5KTY A;  1C07 A;  1PAL A;  1QX2 A;  2KNE A;  3VRQ A;  3BUM B;  2K7O A;  1QIW A;  3R1V A;  3SG4 A;  1BLQ A;  1QX7 A;  2LAN A;  1V1F A;  4MZL A;  1OOI X;  2PYQ A;  1JF2 A;  2Y1M A;  2PRU A;  1NWD A;  1YR5 A;  2E6W A;  4MN0 A;  5G08 A;  2KGB C;  3SS4 A;  3LCP C;  1K9P A;  3CZT X;  2H2K A;  1CB1 A;  1NX1 A;  3R1O A;  1FI6 A;  3RM1 A;  2BEC A;  3OGN A;  3V2L A;  3RZS A;  4M2P A;  1CMG A;  3O2P A;  2BE4 A;  4DUQ A;  4MZJ A;  4P2Y B;  3PJI A;  2CT9 A;  4WRI A;  3SS5 A;  1SW8 A;  1WDC C;  1MHO A;  4OVN F;  1Y1X A;  1YUR A;  2ZKM X;  4MZK A;  1NX2 A;  2WCM A;  2M7L A;  1IKU A;  4JWQ A;  1XFW O;  4HSZ A;  3KEV A;  1FF1 A;  1DJY A;  3NSI A;  1K96 A;  2FCD A;  3B6X A;  1CFC A;  1GJY A;  1B8C A;  1IIO A;  5FYX A;  3CS1 A;  1UHH A;  1Z4H A;  2JTZ A;  1W9Z A;  3O4Y A;  1S5G Z;  2H61 C;  1IQ5 A;  1DEK A;  1XFX O;  2LP3 A;  3BFH A;  2G2B A;  2M0R A;  2M1K B;  2MA2 A;  2Y1N A;  3L4L A;  2LM5 A;  2BAP A;  5D69 A;  2LLS A;  4ZCV A;  2Q91 A;  4IJ7 A;  1B8L A;  1XO5 A;  1UUS A;  2V53 A;  1KQM B;  1SR6 C;  2K7B A;  2L2C A;  3PFV A;  1BR1 B;  1SMG A;  2GV5 A;  2YGU A;  4WQ2 A;  2CTN A;  1S1E A;  4INX A;  1EXR A;  2I2R E;  3CR5 X;  2EC6 B;  2LHL A;  4JD9 A;  3CTN A;  1OMD A;  1A4P A;  4YI8 A;  3I5I C;  1N65 A;  3I5H C;  3NSL A;  1EJ3 A;  2H8V A;  1KCY A;  4GAO A;  3DVJ A;  2KBI A;  5CSF A;  1AJ5 A;  1C3Y A;  4AQI A;  1XFZ O;  1YUU A;  2MLE C;  5KU1 A;  2KFG A;  5I2Q A;  2WCF A;  2WND A;  4GBA A;  3DVM A;  2BKI B;  3FE9 A;  1MWN A;  4DIR A;  5I94 A;  1NCY A;  3D73 A;  1SCM B;  3NGV A;  3ICB A;  1OMV A;  1KFX S;  2F3Y A;  5DKN A;  1DTL A;  1OSA A;  1TNQ A;  2KAX A;  4CFQ A;  1KQM C;  1DJW A;  2DOQ A;  1L7Z A;  2L5X B;  2Y5I A;  3SG5 A;  4DCK A;  1QVI Y;  1OMR A;  1KK7 Y;  2F2O A;  2NLN A;  2P6B B;  2JT3 A;  4ORB B;  2ISD A;  1Y1A A;  3UO9 A;  4NDC A;  3NSO A;  3PLF B;  1K94 A;  1ZFS A;  2JNF A;  2QPT A;  1JUO A;  2JWW A;  1G8I A;  2JXL A;  2LE9 B;  3BUX B;  4FQO A;  5HKZ A;  1KFX L;  3KHE A;  1RRO A;  3FWB A;  5JOL A;  3TZ1 A;  1QTX A;  4GGF C;  3DVE A;  1XFV O;  1KSM A;  2M1U A;  3I5G B;  4PAL A;  1YTZ C;  4PHM A;  2AAO A;  2M29 A;  2L0P A;  4A4C A;  5AER A;  2LLU A;  5HLV A;  3SG7 A;  1EG4 A;  1QXP A;  1QLS A;  1NSH A;  2WCE A;  2KYF A;  3EK4 A;  3GK4 X;  4HRH A;  4F7F A;  1YVL A;  5CSN A;  4INW A;  2JZI A;  1OOJ A;  4I5K A;  3GK2 A;  1KK8 C;  1UHK A;  1Z2C B;  3SIB A;  1X02 A;  4ETO A;  3B87 A;  3PN7 C;  4PE7 A;  5CSJ A;  4KYN A;  3IVT A;  2JU0 A;  3AKB A;  1J1E A;  1B4C A;  3FS7 A;  4PHJ A;  4JPZ B;  1DGV A;  1AJ4 A;  3A4U B;  1BG1 A;  1MF8 B;  1SL8 A;  3NSK A;  1M39 A;  1A2X A;  2FOT A;  5D3O A;  2MRD A;  1F8H A;  2GGZ A;  3GOF A;  4YRU A;  3TS5 B;  2CCM A;  2B1U A;  2KFH A;  1REC A;  1DT7 B;  3IQQ A;  1OW4 A;  1D1O A;  2ZNE A;  3VRO A;  1ZOT B;  4MEW A;  5I2L A;  1BU3 A;  1KFU L;  2HPS A;  3VRR A;  4BY4 A;  3CZ0 A;  3K21 A;  1XK4 A;  4XJK B;  1CDP A;  3E3R A;  2KDH A;  5F6T A;  1K93 D;  2A4J A;  3D0Y A;  1C3Z A;  3F45 A;  1XA5 A;  1B7T Y;  1CM4 A;  2BCX A;  3SS3 A;  4AQJ A;  1CLL A;  1DF0 A;  1MXE A;  2PSR A;  2LVI A;  2L4I A;  5HKY A;  1NX3 A;  4OKH A;  4MRY A;  1U5I A;  2K0J A;  4OZD A;  1EH2 A;  1JC2 A;  3TUY B;  1J7R A;  2MLF C;  1QIV A;  2LUC A;  1MR8 A;  1YX8 A;  1L2O B;  1DVI A;  3M0W A;  3NXA A;  1DC1 A;  3SJS A;  2P70 A;  1YX7 A;  1SL7 A;  2M9G A;  2QEB A;  4N1F A;  3TS5 C;  2BKH B;  5EL2 A;  1NX0 A;  2ZN8 A;  1W7J B;  2E30 A;  3BUN B;  3QRX A;  1B47 A;  3MSE B;  4ORC B;  4YI9 A;  1CDN A;  1PUL A;  2M3W A;  1WRZ A;  1J7Q A;  2MAZ A;  5HKW A;  4DRW A;  4D1E A;  2Q4U A;  1TRF A;  4JKT A;  4PCW A;  3WNX B;  4YGD B;  2I7A A;  1F4Q A;  3AAK A;  1YUS A;  1LIN A;  2JTT A;  2NXQ A;  2KI6 D;  2OPO A;  1YRT B;  4QJ3 B;  2HF5 A;  2Y4Q A;  3KF9 A;  1NYA A;  1ZUZ A;  1LS8 A;  1S5G Y;  2BCA A;  3PM2 A;  3ZWH A;  1S6I A;  1BOC A;  1F55 A;  5J3X A;  1F71 A;  2WC6 A;  2VRG A;  1IRJ A;  3BFB A;  2LVJ A;  1TWO A;  1DJI A;  1L2O C;  3FE6 A;  3O78 A;  1UHI A;  4GFT A;  1DQE A;  1CDM A;  1OQP A;  1QAT A;  2ERB A;  3D0Y B;  3PSR A;  1JSA A;  3O6B A;  1S36 A;  4P5O E;  3SG3 A;  1DEL A;  1CLM A;  1DF0 B;  4PT1 A;  4GUK A;  3WXA A;  2F2P A;  2K2F A;  3EKJ A;  1EG3 A;  1EL4 A;  4MRX A;  2F3Z A;  1XFU O;  2LHI A;  2WCJ A;  3CYZ A;  5K89 A;  4F0Z B;  1U5I B;  3A8R A;  4ICB A;  1NCZ A;  1YRU B;  1LA3 A;  3CLN A;  1LVC D;  5ER4 X;  4CPV A;  1K95 A;  2AMI A;  2KQY A;  1MQ1 A;  1XFY O;  2JNX A;  4XJK A;  2CNP A;  3Q8I A;  1KWO B;  2K60 A;  1S6C A;  1GM0 A;  2MJW B;  3EK7 A;  3DF0 A;  3OBV A;  4TNC A;  3D75 A;  3LLE A;  4GPL B;  2LMV A;  2LNK A;  5TNC A;  1SNL A;  2BNX A;  2M8U A;  2PQL A;  1SBJ A;  2PAS A;  2R2I A;  3BJH A;  4I5J A;  2EC6 C;  1IG5 A;  1XK4 C;  3R1P A;  5PAL A;  1UHN A;  1QV1 A;  4M2Q A;  5KSZ A;  2QDI A;  1FBV A;  5DIC A;  1RFJ A;  2OTG B;  3OX5 A;  1FPW A;  3I5F B;  4GGN A;  3NHI A;  1CTR A;  3KO0 A;  4NQG A;  1TCO B;  2L5Y A;  2ZN9 A;  1IWQ A;  4GNK B;  1TOP A;  2FJY A;  2GTE A;  2KQ6 A;  3PAL A;  3TDZ A;  2LUX A;  3UNW A;  1MXL C;  1M31 A;  2NCP A;  2L2E A;  3PM8 A;  1RK9 A;  2G9B A;  2I94 A;  2HQ8 A;  4CID A;  1WLZ A;  2OS8 B;  1BF5 A;  1SCM C;  3CGA A;  1KWO C;  1HT9 A;  1TCF A;  4ZCU A;  4ORA B;  3EVR A;  3VRP A;  1TTX A;  1WRL A;  2AUC A;  4PHK A;  1CFP A;  2WCL A;  3ZNI A;  2KI4 B;  3BOW A;  4NDB A;  2KBM A;  5HLO A;  1CDL A;  2WC5 A;  1CFD A;  2EHB A;  3K1E A;  4YGA A;  5B8I B;  1DJH A;  1Y1U A;  1PK0 D;  1AHR A;  3RLZ A;  4HRE E;  1SRA A;  4Q04 A;  1SSE B;  2K7D A;  1PSB A;  3BXK A;  4I5N B;  1ZAC A;  2OTG C;  2BBN A;  3EVU A;  5JJG A;  3I5G C;  1S6J A;  2BL0 B;  4HRG A;  4PHN A;  3TDI A;  2LLT A;  1OZS A;  2QEV A;  3DYE A;  2KYC A;  4MVF A;  2QEH A;  3EK8 A;  5D7F A;  4XYN A;  2WOR A;  1MUX A;  3DD4 A;  1PVB A;  3VB1 A;  3DF0 B;  2WC8 A;  1NCX A;  2HET A;  2K8M B;  1ALV A;  4MBE A;  1P28 A;  3OX6 A;  3R72 A;  2KLE A;  1Y6W A;  1J7P A;  1K90 D;  3L4A A;  3D78 A;  1E8A A;  3LK0 A;  4PE4 A;  3D10 A;  2LVV A;  3BFA A;  2KHN A;  3CAB A;  1K2H A;  2K2A A;  4CLN A;  1RWY A;  3D74 A;  1JFJ A;  1K8U A;  1YVH A;  1OOF A;  1QJT A;  2LCP A;  1AUI B;  2LC5 A;  4BY5 A;  4MSP A;  3N7H A;  4YBH B;  1BMO A;  1DJZ A;  1TUZ A;  1TNP A;  3JVT B;  5FI6 A;  1DJG A;  1T14 A;  1UWO A;  2O5G A;  1ZMZ A;  3CR2 A;  2KOT A;  2BL0 C;  1AK8 A;  2KFF A;  3DXL A;  3DY9 A;  2EGD A;  2JT8 A;  3O4X A;  4R1E A;  4NDD A;  3HX4 A;  1TUJ A;  4C0L A;  1NPQ A;  1NIW A;  2JQ6 A;  5FI2 A;  4CFR A;  1IQ3 A;  2NZ0 A;  3C1V A;  1CMF A;  1ORG A;  1SR6 B;  1C7V A;  4L9M A;  2KPH A;  3S0B A;  3BOW B;  3JTD B;  2CBL A;  2LMT A;  2QEO A;  4M2O A;  2JXC A;  4OR9 B;  3S0G A;  1QLK A;  3SG6 A;  2ZND A;  2JPO A;  3CWG A;  1B1G A;  2JUL A;  3S0E A;  2F8P A;  2BE6 A;  4N1G A;  3S0A A;  3TUY C;  1LA0 A;  3BUO B;  3I5I B;  3I5H B;  1J7O A;  4DS7 A;  5ER5 A;  1BOD A;  1DMO A;  4FQT A;  2KLD A;  1UHJ A;  3OP0 A;  5CSI A;  4IL1 A;  2SAS A;  1XFR A;  5DKR A;  4USL A;  1PSR A;  3DZT A;  4YGE B;  1S3P A;  1DJX A;  3JVT C;  1R6P A;  2BBM A;  1JF0 A;  3SG2 A;  1FI5 A;  1WRK A;  3B7A A;  4C0K A;  2LP2 A;  5BPJ A;  1CKK A;  1GGW A;  3GK1 A;  1WLM A;  3OHM B;  1C7W A;  2QAC A;  2LAP A;  1G33 A;  2FJU B;  2K7C A;  2LMU A;  2I18 A;  5I2O A;  1TN4 A;  2PMY A;  2L98 A;  1GGZ A;  3BYA A;  3H4S E;  3JTD C;  3VGO A;  1BT6 A;  1B8R A;  3FE8 A;  1NUB A;  1OZO A;  1K9U A;  1PRW A;  1QX5 B;  1RJV A;  3CDN A;  1XVJ A;  2KI6 C;  1A75 A;  3EVV A;  4WQ3 A;  1RTP 1;  1JBA A;  2D8N A;  1XYD A;  2F33 A;  1B9A A;  4YGB B;  4E68 A;  1SK6 D;  2KGR A;  5AEQ A;  1BR4 B;  1M45 A;  1R2U A;  1F4O A;  1TNW A;  2NCO A;  1CLB A;  2JPT A;  1ALW A;  2ZRT A;  1NP8 A;  5HL1 A; 
#chains in the Genus database with same CATH homology
 2K61 A;  2IS9 A;  3AKA A;  1QV0 A;  3HCM A;  1V1G A;  2WOS A;  4PE0 A;  1H8B A;  2KSP A;  1SCV A;  2LV7 A;  4QJ4 B;  1KK8 B;  2RGI A;  4JQ0 D;  1VRK A;  3OB1 B;  1SL9 A;  3SIA A;  1N0Y A;  2COL B;  3PN7 B;  1IJ6 A;  2ZFD A;  1LXF C;  5DKQ A;  3WHU B;  1FW4 A;  3WHT B;  4FTG A;  1KQV A;  5AXI A;  2PVB A;  1G4Y R;  1QVI Z;  1M63 B;  3IQO A;  1QS7 A;  1KK7 Z;  3DVK A;  2H61 A;  2O60 A;  4AOM A;  2GGM A;  4PDZ A;  1HQV A;  1IGV A;  1WY9 A;  5IBW A;  2M97 A;  2TN4 A;  3TDU A;  1YUT A;  4QJ5 B;  1JFK A;  2KAY A;  5CPV A;  2WCB A;  3PAT A;  1JWD A;  3BQ3 A;  2MBX A;  1IH0 A;  2SCP A;  1M46 A;  1J55 A;  1CM1 A;  2M49 B;  1F70 A;  2JOJ A;  5I8N A;  1SPY A;  4N5X A;  1GQM A;  4MLW A;  1DGU A;  3I5F C;  1LKJ A;  3OB2 B;  1KSO A;  1Y0V H;  3FWC A;  1QAS A;  1Q80 A;  2FCE A;  1ODB A;  1AP4 A;  2L51 A;  3FIA A;  1A75 B;  1OE9 B;  1TNX A;  3BUW B;  1BJF A;  1K9K A;  1TIZ A;  2PAL A;  3LL8 B;  1UP5 A;  2MHH A;  1CNP A;  1H4B A;  3VRN A;  1SKT A;  2JC2 A;  2M7N A;  1KFU S;  4A4B A;  5HYD A;  1PVA A;  2OS8 C;  2HQW A;  2L50 A;  1N2D A;  1A03 A;  1IJ5 A;  3EKH A;  1SY9 A;  1W7I B;  3CR4 X;  4I5L B;  4OV2 A;  1F54 A;  1S26 D;  4C0J A;  2JRF A;  2JT0 A;  2LVK A;  4U8D A;  1A29 A;  2ZRS A;  4YGC B;  2KI4 C;  1UUR A;  5AFP A;  4UPG A;  4OCI A;  4PE1 A;  1WDC B;  2KAV A;  2BCB A;  5GQQ C;  2L4H A;  3IF7 A;  1J1D A;  3KPX A;  1CFF A;  1AVS A;  2CXJ A;  3AAJ A;  1B7T Z;  4GGF A;  1SYM A;  3LK1 A;  5AAN A;  5KTY A;  1C07 A;  1PAL A;  1QX2 A;  2KNE A;  3VRQ A;  3BUM B;  2K7O A;  1QIW A;  3SG4 A;  1BLQ A;  1QX7 A;  2LAN A;  1V1F A;  4MZL A;  1JF2 A;  2Y1M A;  2PRU A;  1NWD A;  1YR5 A;  2E6W A;  4MN0 A;  5G08 A;  2KGB C;  3LCP C;  1K9P A;  3CZT X;  2H2K A;  1CB1 A;  1NX1 A;  1FI6 A;  3RM1 A;  2BEC A;  1CMG A;  4M2P A;  3O2P A;  2BE4 A;  4DUQ A;  4MZJ A;  4P2Y B;  2CT9 A;  4WRI A;  1SW8 A;  1WDC C;  1MHO A;  4OVN F;  1Y1X A;  1YUR A;  2ZKM X;  4MZK A;  1NX2 A;  1IKU A;  2M7L A;  4JWQ A;  1XFW O;  4HSZ A;  3KEV A;  1FF1 A;  1DJY A;  3NSI A;  1K96 A;  2FCD A;  1CFC A;  1B8C A;  1GJY A;  5FYX A;  3CS1 A;  1UHH A;  2JTZ A;  3O4Y A;  1S5G Z;  2H61 C;  1IQ5 A;  1XFX O;  2LP3 A;  2G2B A;  2M0R A;  2M1K B;  2MA2 A;  2Y1N A;  2LM5 A;  5D69 A;  2LLS A;  4ZCV A;  2Q91 A;  1B8L A;  1XO5 A;  1UUS A;  2V53 A;  1KQM B;  1SR6 C;  2K7B A;  3PFV A;  1BR1 B;  1SMG A;  2GV5 A;  4WQ2 A;  2CTN A;  1S1E A;  1EXR A;  2I2R E;  3CR5 X;  2EC6 B;  2LHL A;  3CTN A;  1OMD A;  1A4P A;  4YI8 A;  3I5I C;  1N65 A;  3I5H C;  3NSL A;  1EJ3 A;  1KCY A;  4GAO A;  3DVJ A;  2KBI A;  5CSF A;  1AJ5 A;  4AQI A;  1XFZ O;  1YUU A;  2MLE C;  5KU1 A;  2KFG A;  5I2Q A;  2WCF A;  2WND A;  4GBA A;  3DVM A;  2BKI B;  4DIR A;  1MWN A;  1NCY A;  1SCM B;  3ICB A;  1OMV A;  1KFX S;  2F3Y A;  5DKN A;  1DTL A;  1OSA A;  1TNQ A;  2KAX A;  4CFQ A;  1KQM C;  1DJW A;  2DOQ A;  1L7Z A;  2L5X B;  2Y5I A;  3SG5 A;  4DCK A;  1QVI Y;  1OMR A;  1KK7 Y;  2F2O A;  2NLN A;  2P6B B;  2JT3 A;  4ORB B;  2ISD A;  1Y1A A;  4NDC A;  3NSO A;  3PLF B;  1K94 A;  1ZFS A;  2JNF A;  2QPT A;  1JUO A;  2JWW A;  1G8I A;  2JXL A;  2LE9 B;  3BUX B;  4FQO A;  5HKZ A;  1KFX L;  3KHE A;  1RRO A;  3FWB A;  5JOL A;  3TZ1 A;  1QTX A;  4GGF C;  3DVE A;  1XFV O;  1KSM A;  2M1U A;  3I5G B;  4PAL A;  1YTZ C;  4PHM A;  2AAO A;  2M29 A;  2L0P A;  4A4C A;  5AER A;  2LLU A;  5HLV A;  3SG7 A;  1EG4 A;  1QXP A;  1QLS A;  1NSH A;  2WCE A;  2KYF A;  3EK4 A;  3GK4 X;  4HRH A;  1YVL A;  5CSN A;  2JZI A;  1OOJ A;  4I5K A;  3GK2 A;  1KK8 C;  1UHK A;  3SIB A;  1X02 A;  4ETO A;  3PN7 C;  4PE7 A;  5CSJ A;  2JU0 A;  3AKB A;  1J1E A;  1B4C A;  3FS7 A;  4PHJ A;  4JPZ B;  1DGV A;  1AJ4 A;  3A4U B;  1BG1 A;  1MF8 B;  1SL8 A;  3NSK A;  1M39 A;  1A2X A;  2FOT A;  2MRD A;  1F8H A;  2GGZ A;  3GOF A;  4YRU A;  3TS5 B;  2CCM A;  2B1U A;  2KFH A;  1REC A;  1DT7 B;  3IQQ A;  1D1O A;  2ZNE A;  3VRO A;  1ZOT B;  4MEW A;  5I2L A;  1BU3 A;  1KFU L;  2HPS A;  3VRR A;  4BY4 A;  3K21 A;  1XK4 A;  4XJK B;  1CDP A;  3E3R A;  2KDH A;  5F6T A;  1K93 D;  2A4J A;  3D0Y A;  3F45 A;  1XA5 A;  1B7T Y;  1CM4 A;  2BCX A;  4AQJ A;  1CLL A;  1DF0 A;  1MXE A;  2PSR A;  2LVI A;  2L4I A;  5HKY A;  1NX3 A;  4OKH A;  4MRY A;  1U5I A;  2K0J A;  1EH2 A;  1JC2 A;  3TUY B;  1J7R A;  2MLF C;  1QIV A;  2LUC A;  1MR8 A;  1YX8 A;  1L2O B;  1DVI A;  3M0W A;  3NXA A;  3SJS A;  1YX7 A;  1SL7 A;  2M9G A;  4N1F A;  3TS5 C;  2BKH B;  1NX0 A;  2ZN8 A;  1W7J B;  2E30 A;  3BUN B;  3QRX A;  1B47 A;  3MSE B;  4ORC B;  4YI9 A;  1CDN A;  1PUL A;  2M3W A;  1WRZ A;  1J7Q A;  2MAZ A;  5HKW A;  4DRW A;  4D1E A;  2Q4U A;  1TRF A;  4PCW A;  3WNX B;  4YGD B;  2I7A A;  1F4Q A;  3AAK A;  1YUS A;  1LIN A;  2JTT A;  2NXQ A;  2KI6 D;  2OPO A;  1YRT B;  4QJ3 B;  2HF5 A;  2Y4Q A;  3KF9 A;  1NYA A;  1ZUZ A;  2BCA A;  1S5G Y;  3ZWH A;  1BOC A;  1F55 A;  1S6I A;  5J3X A;  1F71 A;  2VRG A;  1IRJ A;  2LVJ A;  1DJI A;  1L2O C;  3O78 A;  1UHI A;  4GFT A;  1CDM A;  1OQP A;  1QAT A;  3D0Y B;  3PSR A;  1JSA A;  3O6B A;  1S36 A;  4P5O E;  3SG3 A;  1CLM A;  1DF0 B;  4GUK A;  3WXA A;  2F2P A;  2K2F A;  3EKJ A;  1EG3 A;  1EL4 A;  4MRX A;  2F3Z A;  1XFU O;  2LHI A;  5K89 A;  4F0Z B;  1U5I B;  3A8R A;  4ICB A;  1NCZ A;  1YRU B;  1LA3 A;  3CLN A;  1LVC D;  5ER4 X;  4CPV A;  1K95 A;  2AMI A;  2KQY A;  1MQ1 A;  1XFY O;  2JNX A;  4XJK A;  2CNP A;  1KWO B;  1S6C A;  2MJW B;  3EK7 A;  3DF0 A;  4TNC A;  3LLE A;  4GPL B;  2LMV A;  2LNK A;  5TNC A;  1SNL A;  2M8U A;  1SBJ A;  2PAS A;  2R2I A;  4I5J A;  2EC6 C;  1IG5 A;  1XK4 C;  5PAL A;  1UHN A;  1QV1 A;  4M2Q A;  5KSZ A;  1FBV A;  1RFJ A;  2OTG B;  3OX5 A;  1FPW A;  3I5F B;  4GGN A;  1CTR A;  3KO0 A;  4NQG A;  1TCO B;  2ZN9 A;  1IWQ A;  4GNK B;  1TOP A;  2KQ6 A;  3PAL A;  3TDZ A;  2LUX A;  1MXL C;  1M31 A;  2NCP A;  2L2E A;  3PM8 A;  1RK9 A;  2G9B A;  2I94 A;  2HQ8 A;  4CID A;  1WLZ A;  2OS8 B;  1BF5 A;  1SCM C;  3CGA A;  1KWO C;  1HT9 A;  1TCF A;  4ZCU A;  4ORA B;  3EVR A;  3VRP A;  1TTX A;  1WRL A;  2AUC A;  4PHK A;  1CFP A;  3ZNI A;  2KI4 B;  3BOW A;  4NDB A;  2KBM A;  5HLO A;  1CDL A;  1CFD A;  2EHB A;  4YGA A;  5B8I B;  1DJH A;  1Y1U A;  1PK0 D;  1AHR A;  3RLZ A;  4HRE E;  1SRA A;  4Q04 A;  2K7D A;  1PSB A;  3BXK A;  4I5N B;  1ZAC A;  2OTG C;  2BBN A;  3EVU A;  5JJG A;  3I5G C;  1S6J A;  2BL0 B;  4HRG A;  4PHN A;  3TDI A;  2LLT A;  1OZS A;  4MVF A;  2KYC A;  3EK8 A;  5D7F A;  4XYN A;  2WOR A;  1MUX A;  3DD4 A;  1PVB A;  3DF0 B;  2WC8 A;  1NCX A;  2HET A;  2K8M B;  1ALV A;  4MBE A;  3OX6 A;  1Y6W A;  1J7P A;  1K90 D;  1E8A A;  3LK0 A;  4PE4 A;  3D10 A;  2LVV A;  2KHN A;  1K2H A;  2K2A A;  4CLN A;  1RWY A;  1JFJ A;  1K8U A;  1YVH A;  1QJT A;  2LCP A;  1AUI B;  2LC5 A;  4BY5 A;  4MSP A;  4YBH B;  1BMO A;  1DJZ A;  1TNP A;  3JVT B;  1DJG A;  1UWO A;  2O5G A;  1ZMZ A;  3CR2 A;  2KOT A;  2BL0 C;  1AK8 A;  2KFF A;  2EGD A;  2JT8 A;  4R1E A;  4NDD A;  3HX4 A;  4C0L A;  1NPQ A;  1NIW A;  2JQ6 A;  4CFR A;  1IQ3 A;  2NZ0 A;  3C1V A;  1CMF A;  1C7V A;  1SR6 B;  4L9M A;  3BOW B;  3JTD B;  2CBL A;  2LMT A;  4M2O A;  4OR9 B;  2JXC A;  3SG6 A;  1QLK A;  2ZND A;  3CWG A;  1B1G A;  2JUL A;  2F8P A;  2BE6 A;  4N1G A;  3TUY C;  1LA0 A;  3BUO B;  3I5I B;  3I5H B;  1J7O A;  4DS7 A;  5ER5 A;  1BOD A;  1DMO A;  1UHJ A;  3OP0 A;  5CSI A;  4IL1 A;  2SAS A;  5DKR A;  4USL A;  1PSR A;  4YGE B;  1S3P A;  1DJX A;  3JVT C;  1R6P A;  2BBM A;  1JF0 A;  3SG2 A;  1FI5 A;  1WRK A;  4C0K A;  1CKK A;  2LP2 A;  5BPJ A;  1GGW A;  3GK1 A;  1WLM A;  3OHM B;  1C7W A;  2QAC A;  2LAP A;  1G33 A;  2FJU B;  2K7C A;  2LMU A;  2I18 A;  5I2O A;  1TN4 A;  2PMY A;  2L98 A;  1GGZ A;  3BYA A;  3H4S E;  3JTD C;  3VGO A;  1BT6 A;  1B8R A;  1NUB A;  1OZO A;  1K9U A;  1PRW A;  1QX5 B;  1RJV A;  3EVV A;  1XVJ A;  2KI6 C;  1A75 A;  4WQ3 A;  1RTP 1;  1JBA A;  2D8N A;  1XYD A;  2F33 A;  1B9A A;  4YGB B;  4E68 A;  1SK6 D;  2KGR A;  5AEQ A;  1BR4 B;  1M45 A;  1R2U A;  1F4O A;  1TNW A;  2NCO A;  1CLB A;  2JPT A;  1ALW A;  2ZRT A;  1NP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...