2A4JA

Solution structure of the c-terminal domain (t94-y172) of the human centrin 2 in complex with a 17 residues peptide (p1-xpc) from xeroderma pigmentosum group c protein
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
79
structure length
79
Chain Sequence
TQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Centrin 2
publication title Flexibility and plasticity of human centrin 2 binding to the xeroderma pigmentosum group C protein (XPC) from nuclear excision repair.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 15
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2005-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2a4jA00
1A2XA 3JTDB 3TDIA 3SG2A 1SW8A 1OSAA 2EHBA 4UPGA 5FYXA 3DVJA 2BL0B 1Y0VH 2H2KA 1AJ4A 5HLVA 2JRFA 1A75B 1CM1A 1QVIZ 2LMUA 4CLNA 1WRKA 1FPWA 1YUSA 4MZLA 4NDCA 1CDLA 3TUYB 1SKTA 1ZACA 5PALA 3D0YA 5J3XA 1WLZA 1XK4A 1XFYO 2OTGB 1U5IA 1SCMB 1IGVA 2F3YA 2O60A 5I8NA 4HRHA 4DRWA 4DCKA 2L98A 1K93D 1DF0A 4HRGA 1CMGA 4MLWA 3PSRA 2JOJA 1PVAA 1R2UA 2H61A 3NSOA 5AFPA 1TNWA 1KFUL 3RLZA 4AQJA 1MR8A 4YGEB 2PALA 1BLQA 1F8HA 2BKHB 3DVEA 1BR4B 3FWCA 3NSIA 2ZNDA 3A8RA 4MBEA 1J1EA 3HX4A 3EK7A 4PHMA 3VRPA 1WRZA 2Y1MA 4WQ3A 1TCFA 2O5GA 2MBXA 2FCDA 3BXKA 1A75A 3BUXB 1SCVA 5CSJA 1A29A 2WCFA 1K9KA 3VRRA 5AEQA 3TDZA 2B1UA 1F55A 1S5GZ 3CR4X 1BT6A 2LV7A 2L4IA 2M7LA 1KK7Y 2L51A 1XFWO 3I5FB 1XO5A 2K7BA 2EC6B 4OV2A 2ZRTA 3O6BA 1BG1A 1CNPA 1KQMC 3CR2A 2PASA 1TRFA 1MUXA 2LVVA 2KQYA 1TNXA 1MF8B 1JUOA 2JXLA 2KFFA 2BKIB 3PLFB 2KI6D 1ZMZA 4M2QA 4C0JA 1OQPA 1QV1A 1S1EA 2MHHA 1QIVA 2WORA 1Y1AA 4ORCB 1HQVA 2M7NA 1RROA 2NLNA 3OX6A 3C1VA 1K2HA 2BCBA 2G9BA 4M2OA 1CLBA 1XA5A 3OHMB 1X02A 1WLMA 1SL8A 1SY9A 3PFVA 1K9UA 2F8PA 1DMOA 1CDNA 1LINA 1YVHA 2FJUB 1K9PA 1IKUA 3DF0B 3I5IC 3ICBA 4GGFA 1L2OB 1XK4C 3WNXB 3KF9A 4GPLB 1B8LA 1SNLA 2PVBA 3VRQA 1KFXL 2IS9A 1XFZO 4MZKA 1SR6B 2K61A 3DD4A 3O78A 2AUCA 4N1GA 1DT7B 1G33A 3O4YA 4PE0A 4PCWA 5KU1A 4MSPA 5TNCA 1B7TZ 2H61C 3LLEA 1NCXA 1NUBA 1IWQA 4GBAA 1BF5A 2L4HA 1NCYA 2M29A 3LK1A 3JTDC 5B8IB 1NP8A 1K94A 1MWNA 1F4OA 3H4SE 1RTP1 2BL0C 2LLUA 1KFUS 2KYCA 1KSOA 2JWWA 4BY4A 1AVSA 1CM4A 1OMVA 1PRWA 1E8AA 4WRIA 2JU0A 3DF0A 4ZCUA 1NX1A 4WQ2A 3TUYC 1AHRA 3CZTX 2LHLA 1YR5A 2NZ0A 3OB2B 5K89A 5I2QA 2M8UA 2MRDA 1LXFC 2OTGC 1SCMC 4M2PA 2MAZA 1CKKA 2CNPA 2LMVA 1ALVA 2K7DA 4P2YB 3WXAA 2JPTA 1AK8A 1J7RA 4PHNA 1J7OA 3EKJA 1ZOTB 2OS8B 4HREE 3AAJA 4FQOA 2ISDA 3WHUB 3ZWHA 2L50A 1DGVA 2OPOA 5JJGA 2K2FA 4JQ0D 5F6TA 1NPQA 1M45A 4GFTA 4JPZB 1FBVA 3PM8A 2K2AA 3SG7A 3QRXA 1J55A 2LMTA 2ZRSA 1PSBA 1MXEA 3FWBA 1JF2A 1S36A 5ER4X 2KGRA 3SG5A 4NQGA 2KFGA 1B8RA 4AQIA 2MLFC 1TIZA 2BE6A 1YX8A 1GJYA 4A4CA 4GGNA 1Y1XA 3VROA 4BY5A 1G8IA 3GK1A 2FCEA 1A03A 5KSZA 3VRNA 1ZUZA 4ORAB 1R6PA 5CSFA 2WNDA 4D1EA 1WDCB 1W7IB 1CB1A 3I5FC 4GGFC 3DVKA 2EC6C 1DJYA 2LM5A 3SIBA 1DVIA 1QV0A 3BYAA 1UHKA 1UURA 4GAOA 1KSMA 2D8NA 1A4PA 3BUMB 2NXQA 2ZKMX 1EXRA 1YUUA 1DJZA 4U8DA 1DJIA 2M9GA 4ZCVA 1WRLA 2NCOA 2JQ6A 4MRYA 1YX7A 1KFXS 1BOCA 1ALWA 1C07A 2JULA 3IQQA 4QJ5B 1UHIA 3AKBA 3CS1A 1PVBA 1YRUB 3GOFA 1EG4A 1HT9A 1FI6A 1NX3A 2HQWA 2LAPA 2M49B 1QJTA 3E3RA 2KAVA 2JXCA 4YBHB 1D1OA 1NIWA 1J1DA 1YURA 2L5XB 1NYAA 1SL7A 3TZ1A 1QS7A 2MJWB 1KWOC 1L2OC 4YGAA 1JFKA 4NDDA 3BOWB 1H8BA 3F45A 3HCMA 1KCYA 1NCZA 3KO0A 2KQ6A 1SR6C 1IQ3A 3AKAA 1YRTB 2CBLA 2ZNEA 2HPSA 2JT0A 4YGCB 3FS7A 2BBMA 3JVTB 4DIRA 1GQMA 3O2PA 1JSAA 1MHOA 2WCEA 5HKYA 1N0YA 1JF0A 2V53A 4C0LA 1IH0A 2JC2A 1KQVA 1QVIY 1LKJA 1J7QA 1M46A 2ZN9A 2COLB 2PSRA 1K96A 1V1FA 5KTYA 1S6IA 4YRUA 4PE4A 4C0KA 2BECA 4N5XA 1IG5A 1CFCA 2M1UA 1EL4A 5G08A 3TS5B 4ICBA 4PHKA 2JZIA 2LLTA 1F71A 5HKZA 4R1EA 2GGMA 3BOWA 4YI8A 2Y1NA 2LP3A 3PN7B 1QIWA 2I7AA 2QACA 1L7ZA 1LVCD 1YTZC 2KI4B 2SASA 4P5OE 4DUQA 2PRUA 1W7JB 1CDPA 1F70A 2SCPA 3A4UB 5AXIA 4NDBA 2F2PA 2OS8C 1LA3A 2JTZA 2LUCA 3LCPC 2LCPA 1BODA 3K21A 3RM1A 4ORBB 5IBWA 1ZFSA 2LHIA 2ZN8A 4I5NB 2QPTA 1OMRA 1NWDA 2KBIA 3CGAA 1BU3A 2EGDA 4GUKA 1MQ1A 2HQ8A 2M1KB 1QX7A 3BUOB 1S5GY 4I5KA 4OCIA 1F54A 1UHHA 1SYMA 1KK8B 2LUXA 4USLA 5BPJA 1CTRA 4YGBB 2KAYA 5ER5A 3I5HB 1RK9A 1JBAA 2NCPA 3BUNB 1QX2A 1SBJA 1SK6D 2BCAA 2KNEA 4CFRA 2BBNA 5HLOA 1GGWA 1B9AA 1N2DA 1WDCC 1UP5A 2BE4A 1KK7Z 3KPXA 1H4BA 2M97A 1AUIB 1FF1A 4QJ4B 1EJ3A 3OX5A 1OOJA 2L2EA 4CIDA 1OE9B 2KOTA 2LANA 2R2IA 2LVKA 4XJKB 1DJXA 3TDUA 4ETOA 1RJVA 3KEVA 1VRKA 2Y4QA 1AP4A 4AOMA 1BR1B 2Q4UA 4GNKB 1B4CA 1OMDA 2F3ZA 1JWDA 3SG4A 2LC5A 3OB1B 1S3PA 2LP2A 1K90D 3I5GB 1NSHA 2I2RE 5I2OA 2TN4A 1QTXA 3ZNIA 1PULA 3FIAA 1TNQA 2AMIA 2WCBA 3BUWB 2KFHA 2G2BA 5DKQA 1SPYA 2CT9A 1Y1UA 1SMGA 2I94A 3CLNA 3EVRA 1Y6WA 1UWOA 2A4JA 1PK0D 1G4YR 4HSZA 1TN4A 3LK0A 4L9MA 2LNKA 4I5LB 2CXJA 1EH2A 1B7TY 2LE9B 2KI6C 2L0PA 1CFDA 4OVNF 1QLSA 1NX0A 3EK8A 4XJKA 4CPVA 4YGDB 5AERA 1IJ6A 3BQ3A 1CLLA 1C7WA 4MEWA 1XFUO 5D69A 1DGUA 3WHTB 1J7PA 5D7FA 1SL9A 1IQ5A 1DJHA 3JVTC 1S6CA 2F33A 2P6BB 2M0RA 1DTLA 1NX2A 2VRGA 1RFJA 4PHJA 1K95A 1M63B 1B8CA 1QASA 3OP0A 1N65A 1TOPA 2HETA 2JTTA 2KGBC 2ZFDA 1CLMA 1BJFA 2Y5IA 2AAOA 4OR9B 1QLKA 1TTXA 5CSNA 4PDZA 3TS5C 1FW4A 5GQQC 1CFFA 1UHJA 1LA0A 1JFJA 1QX5B 3GK4X 5AANA 2M3WA 3CWGA 1PSRA 3IF7A 3EVVA 2LLSA 3EKHA 4FTGA 2F2OA 2FOTA 4OKHA 5CPVA 3PN7C 2RGIA 1YVLA 2KI4C 2PMYA 4I5JA 3D10A 2KAXA 3M0WA 1B1GA 3LL8B 2KBMA 4XYNA 1S26D 2Q91A 1K8UA 3EVUA 4JWQA 4YI9A 5I2LA 5JOLA 1PALA 4PE1A 2K7CA 2GGZA 1MXLC 3CTNA 3AAKA 1M31A 3EK4A 2KDHA 1SRAA 1QATA 2JT3A 1RECA 2BCXA 1Q80A 1UHNA 1DJGA 1TCOB 2DOQA 1KK8C 1RWYA 3I5HC 4DS7A 1CFPA 3GK2A 1GGZA 1XFXO 3MSEB 1BMOA 1M39A 4MN0A 5HKWA 1F4QA 3VGOA 4MRXA 3IQOA 2E6WA 2KHNA 4MVFA 4E68A 1JC2A 1KQMB 4IL1A 1WY9A 3NSKA 5DKRA 1CMFA 1UUSA 1KWOB 1XYDA 2GV5A 4A4BA 2JT8A 2LVJA 4TNCA 2E30A 2K8MB 4CFQA 1EG3A 2MLEC 4F0ZB 2MA2A 2K0JA 1TNPA 5HYDA 1S6JA 3SIAA 4Q04A 3I5GC 4QJ3B 1C7VA 1DJWA 1IRJA 2I18A 1FI5A 2JNFA 3PALA 2JNXA 4PALA 3KHEA 2WC8A 1B47A 3I5IB 2LVIA 3SJSA 1OZOA 3D0YB 1ODBA 1AJ5A 1XFVO 3DVMA 1U5IB 5CSIA 5DKNA 2KYFA 3CR5X 1YUTA 1DF0B 3SG3A 1V1GA 1IJ5A 2HF5A 1QXPA 1OZSA 2KSPA 3NSLA 4PE7A 3SG6A 2CTNA 4N1FA 1CDMA 3PATA 2K7OA 2WOSA 3NXAA 2CCMA 4MZJA 1XVJA
chains in the Genus database with same CATH superfamily
1A2XA 3JTDB 3TDIA 3SG2A 2L2CA 1SW8A 1OSAA 2EHBA 4UPGA 5FYXA 3DVJA 2BL0B 3R72A 1Y0VH 2H2KA 1AJ4A 5HLVA 2JRFA 1A75B 1CM1A 1QVIZ 2LMUA 3CZ1A 1WRKA 4CLNA 1FPWA 1YUSA 4MZLA 4NDCA 1CDLA 3TUYB 1SKTA 1ZACA 2YGUA 3D0YA 5PALA 5J3XA 1WLZA 1XK4A 3R1PA 1SSEB 1XFYO 2OTGB 1U5IA 1SCMB 1IGVA 2F3YA 2O60A 5I8NA 4HRHA 4DRWA 4DCKA 2L98A 1K93D 1DF0A 4HRGA 1CMGA 4MLWA 3PSRA 2JOJA 1PVAA 1R2UA 3UO9A 2H61A 3NSOA 5AFPA 1TNWA 1KFUL 3RLZA 4INXA 4AQJA 1MR8A 2P70A 2PALA 4YGEB 1BLQA 1F8HA 2BKHB 3DVEA 1BR4B 3FWCA 3NSIA 2ZNDA 3A8RA 4MBEA 1J1EA 2BAPA 3HX4A 1Z4HA 3EK7A 1OOHA 2K60A 4PHMA 3VRPA 1WRZA 2Y1MA 4WQ3A 3CABA 1TCFA 2O5GA 3QMEA 2MBXA 2FCDA 3BXKA 1A75A 3S0DA 1QWVA 1SCVA 3BUXB 5CSJA 1OOGA 1A29A 2WC5A 1K9KA 2WCFA 3PJIA 3VRRA 5AEQA 2PYQA 2B1UA 3TDZA 1S5GZ 3CR4X 1F55A 1BT6A 2LV7A 1DC1A 2L4IA 2M7LA 1KK7Y 2WCJA 2L51A 1XFWO 3I5FB 1XO5A 2K7BA 2EC6B 4OV2A 2ZRTA 3O6BA 1BG1A 3BJHA 1CNPA 1KQMC 3DXLA 3CR2A 2PASA 1TRFA 1MUXA 2LVVA 2KQYA 1TNXA 1MF8B 1JUOA 1T14A 2JXLA 2BKIB 2KFFA 3PLFB 2KI6D 1ZMZA 4M2QA 4C0JA 1OQPA 1QV1A 1S1EA 1OOFA 1QIVA 2MHHA 3B88A 2WORA 1Y1AA 4ORCB 1HQVA 2M7NA 1RROA 2NLNA 3OX6A 3C1VA 1K2HA 2BCBA 3O4XA 2G9BA 4M2OA 1CLBA 1XA5A 3OHMB 1XFRA 1X02A 1WLMA 1SL8A 1SY9A 3PFVA 1K9UA 2F8PA 1DMOA 1CDNA 1LINA 1YVHA 2FJUB 1K9PA 1IKUA 1P28A 3DF0B 3I5IC 3ICBA 4GGFA 1L2OB 1XK4C 3WNXB 3KF9A 4GPLB 1B8LA 3D74A 1SNLA 2PVBA 3VRQA 1KFXL 2IS9A 3D76A 1XFZO 4JD9A 4MZKA 1SR6B 2K61A 3DD4A 3O78A 3S0EA 2AUCA 4N1GA 1DT7B 1G33A 3O4YA 4PE0A 3L47A 4PCWA 5KU1A 4MSPA 5TNCA 1B7TZ 2H61C 3LLEA 1NCXA 1NUBA 1GM0A 1IWQA 4GBAA 1BF5A 2L4HA 1NCYA 2M29A 3IVTA 3DY9A 3LK1A 3JTDC 5B8IB 1C3ZA 1NP8A 2WCHA 1K94A 1MWNA 1F4OA 3H4SE 1RTP1 2BL0C 3DYEA 2LLUA 1KFUS 2KYCA 1KSOA 2JWWA 2PQLA 4BY4A 1AVSA 1CM4A 1OMVA 1PRWA 1E8AA 4WRIA 2JU0A 3UNWA 3DF0A 4ZCUA 1NX1A 4WQ2A 3TUYC 1AHRA 3CZTX 2LHLA 3CYZA 1YR5A 2NZ0A 3SS4A 3OB2B 5K89A 5I2QA 2M8UA 2MRDA 1LXFC 2OTGC 1SCMC 3NHIA 4M2PA 2MAZA 1CKKA 2CNPA 2LMVA 1ALVA 2K7DA 3B6XA 4P2YB 3WXAA 2JPTA 1AK8A 1J7RA 4PHNA 1J7OA 3NHTA 3EKJA 1ZOTB 2OS8B 4HREE 3AAJA 4FQOA 2ISDA 3WHUB 3ZWHA 2L50A 1DGVA 2OPOA 5JJGA 2K2FA 4JQ0D 5F6TA 1NPQA 1M45A 4GFTA 4JPZB 1FBVA 3D78A 2K2AA 3PM8A 3SG7A 3QRXA 1J55A 2QEOA 2LMTA 2ZRSA 1PSBA 1MXEA 3FWBA 1JF2A 2QEVA 1S36A 5ER4X 4F7FA 2ERBA 2KGRA 3SG5A 4NQGA 2KFGA 1B8RA 4AQIA 2MLFC 1TIZA 2BE6A 1YX8A 1GJYA 4A4CA 4GGNA 1Y1XA 3VROA 2JPOA 1G8IA 3GK1A 4BY5A 2FCEA 1A03A 5KSZA 5D3OA 3VRNA 1ZUZA 4ORAB 1R6PA 5CSFA 3Q8IA 2WNDA 4D1EA 1WDCB 1W7IB 1CB1A 3I5FC 4GGFC 3DVKA 2EC6C 1DJYA 2LM5A 3SIBA 2KLEA 1DVIA 1QV0A 3BYAA 1UHKA 1UURA 3S0GA 4GAOA 1KSMA 2D8NA 3NGVA 1C3YA 1A4PA 3BUMB 2NXQA 2ZKMX 1EXRA 1YUUA 1DJZA 4U8DA 1DJIA 2M9GA 4ZCVA 1WRLA 3EG5B 2NCOA 2JQ6A 4MRYA 1YX7A 1KFXS 1BOCA 1ALWA 1C07A 2JULA 3IQQA 4QJ5B 1UHIA 3AKBA 3CS1A 1PVBA 1YRUB 3GOFA 1EG4A 1HT9A 1FI6A 1NX3A 2HQWA 2LAPA 2M49B 1QJTA 3E3RA 1IIOA 2KAVA 2JXCA 4YBHB 1D1OA 1NIWA 1LS8A 1J1DA 1YURA 2L5XB 1NYAA 1SL7A 1DELA 3TZ1A 1QS7A 2MJWB 1KWOC 1L2OC 4YGAA 1JFKA 4NDDA 3BOWB 1H8BA 3F45A 3HCMA 1KCYA 1NCZA 2L5YA 3KO0A 2KQ6A 1SR6C 1IQ3A 3AKAA 1YRTB 2CBLA 2ZNEA 2HPSA 2JT0A 4YGCB 3FS7A 2BBMA 3JVTB 4DIRA 1GQMA 3O2PA 1JSAA 1MHOA 2WCEA 5HKYA 1N0YA 1JF0A 2V53A 4C0LA 1IH0A 2JC2A 1KQVA 1QVIY 1LKJA 1J7QA 1M46A 2ZN9A 3B7AA 4FQTA 2COLB 2PSRA 4JKTA 1K96A 1V1FA 5I94A 1S6IA 4YRUA 5KTYA 4PE4A 4IJ7A 4C0KA 2BECA 4N5XA 1IG5A 2FJYA 1CFCA 2M1UA 1EL4A 5G08A 3TS5B 4ICBA 3RZSA 4PHKA 3S0BA 2JZIA 2LLTA 1F71A 5DICA 5HKZA 4R1EA 2GGMA 3BOWA 3PM2A 4YI8A 2Y1NA 2LP3A 3PN7B 1QIWA 2I7AA 2KPHA 2QACA 1L7ZA 1LVCD 1YTZC 2KI4B 2SASA 4P5OE 4DUQA 2PRUA 1W7JB 1CDPA 1F70A 3L4LA 3OBVA 2SCPA 2WCKA 3A4UB 5AXIA 4NDBA 2F2PA 2OS8C 3N7HA 1LA3A 2JTZA 2LUCA 1OOIX 3FE9A 3LCPC 2LCPA 1BODA 3K21A 3RM1A 3L4AA 4ORBB 5IBWA 1ZFSA 2LHIA 2ZN8A 4I5NB 3D77A 2QPTA 1OMRA 1NWDA 2KBIA 3CGAA 1BU3A 2EGDA 4GUKA 1MQ1A 2HQ8A 3CZ0A 5FI7A 2M1KB 1QX7A 3BUOB 1S5GY 4I5KA 4OCIA 4PT1A 1F54A 1UHHA 1SYMA 1KK8B 2LUXA 4USLA 5BPJA 1CTRA 4YGBB 2KAYA 5ER5A 3I5HB 1RK9A 1JBAA 1OW4A 2NCPA 1W9ZA 2WCMA 3BUNB 1QX2A 1SBJA 1SK6D 2BCAA 2KNEA 4CFRA 2BBNA 5HLOA 1GGWA 1B9AA 1N2DA 3B86A 1WDCC 1UP5A 2BE4A 1KK7Z 3KPXA 1H4BA 2M97A 1AUIB 1FF1A 4QJ4B 1EJ3A 3OX5A 1OOJA 2L2EA 3SS5A 4CIDA 1OE9B 2KOTA 2LANA 2R2IA 2LVKA 1Z2CB 4XJKB 1DJXA 2P71A 3R1OA 1RJVA 3TDUA 3VB1A 4ETOA 3KEVA 1VRKA 2Y4QA 1AP4A 4AOMA 1BR1B 2Q4UA 4GNKB 1B4CA 1OMDA 2F3ZA 1JWDA 3SG4A 2LC5A 3OB1B 1S3PA 2LP2A 1K90D 3I5GB 1NSHA 2I2RE 5I2OA 4KYNA 2TN4A 3OGNA 1QTXA 3ZNIA 1PULA 3FIAA 1TNQA 2AMIA 2WCBA 3BUWB 2KFHA 2G2BA 5DKQA 3FE6A 1SPYA 2CT9A 1Y1UA 1SMGA 2I94A 3CLNA 3EVRA 1Y6WA 1UWOA 2A4JA 2QEBA 2GTEA 2WC6A 3S0AA 1PK0D 1G4YR 4HSZA 1TN4A 3LK0A 4L9MA 2BNXA 2LNKA 4I5LB 2CXJA 1EH2A 1B7TY 1DEKA 2LE9B 2KI6C 2L0PA 1CFDA 4OVNF 1QLSA 1NX0A 3EK8A 4XJKA 4CPVA 4YGDB 5AERA 1IJ6A 3BQ3A 1CLLA 1C7WA 4MEWA 1XFUO 5D69A 1DGUA 3WHTB 1J7PA 5D7FA 1SL9A 1IQ5A 1DJHA 3JVTC 1S6CA 2F33A 5FI2A 2P6BB 2M0RA 1DTLA 1NX2A 2VRGA 1RFJA 4PHJA 1K95A 1M63B 3CZ2A 1B8CA 1QASA 3OP0A 1N65A 1ORGA 1TOPA 2HETA 2JTTA 2KGBC 2ZFDA 1CLMA 1BJFA 2Y5IA 2AAOA 4OR9B 1QLKA 1TTXA 3BFAA 5CSNA 4PDZA 3TS5C 1FW4A 5GQQC 2QDIA 3K1EA 1CFFA 1UHJA 1LA0A 3B87A 1JFJA 1QX5B 3GK4X 5AANA 2M3WA 3CWGA 1PSRA 3IF7A 3EVVA 2LLSA 3EKHA 4FTGA 2F2OA 2FOTA 4OKHA 5CPVA 3PN7C 2RGIA 1YVLA 2KI4C 2PMYA 4I5JA 3D10A 2KAXA 3M0WA 1B1GA 1TUJA 3LL8B 3S0FA 2KBMA 4XYNA 1S26D 2Q91A 1K8UA 3EVUA 4JWQA 3CDNA 4YI9A 1TWOA 5I2LA 5JOLA 1PALA 4PE1A 3D73A 2K7CA 2GGZA 1MXLC 3CTNA 3AAKA 1M31A 3EK4A 2KDHA 3BFHA 1SRAA 1QATA 2JT3A 1RECA 2BCXA 1TUZA 1TCOB 1UHNA 1Q80A 1DJGA 2DOQA 1KK8C 1RWYA 3I5HC 4DS7A 1CFPA 3GK2A 1GGZA 1XFXO 3D75A 3MSEB 4OZDA 1BMOA 3DZTA 3SS3A 1M39A 4MN0A 5FI6A 1F4QA 5HKWA 3VGOA 4MRXA 3IQOA 5HL1A 2E6WA 2KHNA 2KLDA 4MVFA 4E68A 1KQMB 4IL1A 1WY9A 4INWA 1JC2A 3NSKA 5DKRA 1CMFA 1UUSA 1KWOB 1XYDA 2GV5A 4A4BA 2JT8A 2LVJA 4TNCA 2E30A 2K8MB 4CFQA 1EG3A 2MLEC 2QEHA 4F0ZB 2MA2A 2K0JA 1TNPA 5HYDA 2H8VA 1S6JA 3SIAA 4Q04A 3I5GC 4QJ3B 1C7VA 1DJWA 1IRJA 2I18A 1FI5A 2JNFA 3PALA 2JNXA 4PALA 3KHEA 2WC8A 5EL2A 1B47A 3V2LA 3I5IB 2LVIA 3SJSA 1OZOA 3D0YB 1ODBA 1AJ5A 1XFVO 3FE8A 3DVMA 1U5IB 5CSIA 5DKNA 2KYFA 3CR5X 1YUTA 1DF0B 1DQEA 1V1GA 1IJ5A 2HF5A 1QXPA 3SG3A 3R1VA 2WCLA 1OZSA 2KSPA 3NSLA 4PE7A 3SG6A 2CTNA 4N1FA 3BFBA 1CDMA 3PATA 2K7OA 2WOSA 3NXAA 2CCMA 4MZJA 1XVJA
chains in the Genus database with same CATH topology
1A2XA 3JTDB 3TDIA 3SG2A 1SW8A 1OSAA 2EHBA 4UPGA 5FYXA 3DVJA 2BL0B 1Y0VH 2H2KA 1AJ4A 5HLVA 2JRFA 1A75B 1CM1A 1QVIZ 2LMUA 4CLNA 1WRKA 1FPWA 1YUSA 4MZLA 4NDCA 1CDLA 3TUYB 1SKTA 1ZACA 5PALA 3D0YA 5J3XA 1WLZA 1XK4A 1XFYO 2OTGB 1U5IA 1SCMB 1IGVA 2F3YA 2O60A 5I8NA 4HRHA 4DRWA 4DCKA 2L98A 1K93D 1DF0A 4HRGA 1CMGA 4MLWA 3PSRA 2JOJA 1PVAA 1R2UA 2H61A 3NSOA 5AFPA 1TNWA 1KFUL 3RLZA 4AQJA 1MR8A 4YGEB 2PALA 1BLQA 1F8HA 2BKHB 3DVEA 1BR4B 3FWCA 3NSIA 2ZNDA 3A8RA 4MBEA 1J1EA 3HX4A 3EK7A 4PHMA 3VRPA 1WRZA 2Y1MA 4WQ3A 1TCFA 2O5GA 2MBXA 2FCDA 3BXKA 1A75A 3BUXB 1SCVA 5CSJA 1A29A 2WCFA 1K9KA 3VRRA 5AEQA 3TDZA 2B1UA 1F55A 1S5GZ 3CR4X 1BT6A 2LV7A 2L4IA 2M7LA 1KK7Y 2L51A 1XFWO 3I5FB 1XO5A 2K7BA 2EC6B 4OV2A 2ZRTA 3O6BA 1BG1A 1CNPA 1KQMC 3CR2A 2PASA 1TRFA 1MUXA 2LVVA 2KQYA 1TNXA 1MF8B 1JUOA 2JXLA 2KFFA 2BKIB 3PLFB 2KI6D 1ZMZA 4M2QA 4C0JA 1OQPA 1QV1A 1S1EA 2MHHA 1QIVA 2WORA 1Y1AA 4ORCB 1HQVA 2M7NA 1RROA 2NLNA 3OX6A 3C1VA 1K2HA 2BCBA 2G9BA 4M2OA 1CLBA 1XA5A 3OHMB 1X02A 1WLMA 1SL8A 1SY9A 3PFVA 1K9UA 2F8PA 1DMOA 1CDNA 1LINA 1YVHA 2FJUB 1K9PA 1IKUA 3DF0B 3I5IC 3ICBA 4GGFA 1L2OB 1XK4C 3WNXB 3KF9A 4GPLB 1B8LA 1SNLA 2PVBA 3VRQA 1KFXL 2IS9A 1XFZO 4MZKA 1SR6B 2K61A 3DD4A 3O78A 2AUCA 4N1GA 1DT7B 1G33A 3O4YA 4PE0A 4PCWA 5KU1A 4MSPA 5TNCA 1B7TZ 2H61C 3LLEA 1NCXA 1NUBA 1IWQA 4GBAA 1BF5A 2L4HA 1NCYA 2M29A 3LK1A 3JTDC 5B8IB 1NP8A 1K94A 1MWNA 1F4OA 3H4SE 1RTP1 2BL0C 2LLUA 1KFUS 2KYCA 1KSOA 2JWWA 4BY4A 1AVSA 1CM4A 1OMVA 1PRWA 1E8AA 4WRIA 2JU0A 3DF0A 4ZCUA 1NX1A 4WQ2A 3TUYC 1AHRA 3CZTX 2LHLA 1YR5A 2NZ0A 3OB2B 5K89A 5I2QA 2M8UA 2MRDA 1LXFC 2OTGC 1SCMC 4M2PA 2MAZA 1CKKA 2CNPA 2LMVA 1ALVA 2K7DA 4P2YB 3WXAA 2JPTA 1AK8A 1J7RA 4PHNA 1J7OA 3EKJA 1ZOTB 2OS8B 4HREE 3AAJA 4FQOA 2ISDA 3WHUB 3ZWHA 2L50A 1DGVA 2OPOA 5JJGA 2K2FA 4JQ0D 5F6TA 1NPQA 1M45A 4GFTA 4JPZB 1FBVA 3PM8A 2K2AA 3SG7A 3QRXA 1J55A 2LMTA 2ZRSA 1PSBA 1MXEA 3FWBA 1JF2A 1S36A 5ER4X 2KGRA 3SG5A 4NQGA 2KFGA 1B8RA 4AQIA 2MLFC 1TIZA 2BE6A 1YX8A 1GJYA 4A4CA 4GGNA 1Y1XA 3VROA 4BY5A 1G8IA 3GK1A 2FCEA 1A03A 5KSZA 3VRNA 1ZUZA 4ORAB 1R6PA 5CSFA 2WNDA 4D1EA 1WDCB 1W7IB 1CB1A 3I5FC 4GGFC 3DVKA 2EC6C 1DJYA 2LM5A 3SIBA 1DVIA 1QV0A 3BYAA 1UHKA 1UURA 4GAOA 1KSMA 2D8NA 1A4PA 3BUMB 2NXQA 2ZKMX 1EXRA 1YUUA 1DJZA 4U8DA 1DJIA 2M9GA 4ZCVA 1WRLA 2NCOA 2JQ6A 4MRYA 1YX7A 1KFXS 1BOCA 1ALWA 1C07A 2JULA 3IQQA 4QJ5B 1UHIA 3AKBA 3CS1A 1PVBA 1YRUB 3GOFA 1EG4A 1HT9A 1FI6A 1NX3A 2HQWA 2LAPA 2M49B 1QJTA 3E3RA 2KAVA 2JXCA 4YBHB 1D1OA 1NIWA 1J1DA 1YURA 2L5XB 1NYAA 1SL7A 3TZ1A 1QS7A 2MJWB 1KWOC 1L2OC 4YGAA 1JFKA 4NDDA 3BOWB 1H8BA 3F45A 3HCMA 1KCYA 1NCZA 3KO0A 2KQ6A 1SR6C 1IQ3A 3AKAA 1YRTB 2CBLA 2ZNEA 2HPSA 2JT0A 4YGCB 3FS7A 2BBMA 3JVTB 4DIRA 1GQMA 3O2PA 1JSAA 1MHOA 2WCEA 5HKYA 1N0YA 1JF0A 2V53A 4C0LA 1IH0A 2JC2A 1KQVA 1QVIY 1LKJA 1J7QA 1M46A 2ZN9A 2COLB 2PSRA 1K96A 1V1FA 5KTYA 1S6IA 4YRUA 4PE4A 4C0KA 2BECA 4N5XA 1IG5A 1CFCA 2M1UA 1EL4A 5G08A 3TS5B 4ICBA 4PHKA 2JZIA 2LLTA 1F71A 5HKZA 4R1EA 2GGMA 3BOWA 4YI8A 2Y1NA 2LP3A 3PN7B 1QIWA 2I7AA 2QACA 1L7ZA 1LVCD 1YTZC 2KI4B 2SASA 4P5OE 4DUQA 2PRUA 1W7JB 1CDPA 1F70A 2SCPA 3A4UB 5AXIA 4NDBA 2F2PA 2OS8C 1LA3A 2JTZA 2LUCA 3LCPC 2LCPA 1BODA 3K21A 3RM1A 4ORBB 5IBWA 1ZFSA 2LHIA 2ZN8A 4I5NB 2QPTA 1OMRA 1NWDA 2KBIA 3CGAA 1BU3A 2EGDA 4GUKA 1MQ1A 2HQ8A 2M1KB 1QX7A 3BUOB 1S5GY 4I5KA 4OCIA 1F54A 1UHHA 1SYMA 1KK8B 2LUXA 4USLA 5BPJA 1CTRA 4YGBB 2KAYA 5ER5A 3I5HB 1RK9A 1JBAA 2NCPA 3BUNB 1QX2A 1SBJA 1SK6D 2BCAA 2KNEA 4CFRA 2BBNA 5HLOA 1GGWA 1B9AA 1N2DA 1WDCC 1UP5A 2BE4A 1KK7Z 3KPXA 1H4BA 2M97A 1AUIB 1FF1A 4QJ4B 1EJ3A 3OX5A 1OOJA 2L2EA 4CIDA 1OE9B 2KOTA 2LANA 2R2IA 2LVKA 4XJKB 1DJXA 3TDUA 4ETOA 1RJVA 3KEVA 1VRKA 2Y4QA 1AP4A 4AOMA 1BR1B 2Q4UA 4GNKB 1B4CA 1OMDA 2F3ZA 1JWDA 3SG4A 2LC5A 3OB1B 1S3PA 2LP2A 1K90D 3I5GB 1NSHA 2I2RE 5I2OA 2TN4A 1QTXA 3ZNIA 1PULA 3FIAA 1TNQA 2AMIA 2WCBA 3BUWB 2KFHA 2G2BA 5DKQA 1SPYA 2CT9A 1Y1UA 1SMGA 2I94A 3CLNA 3EVRA 1Y6WA 1UWOA 2A4JA 1PK0D 1G4YR 4HSZA 1TN4A 3LK0A 4L9MA 2LNKA 4I5LB 2CXJA 1EH2A 1B7TY 2LE9B 2KI6C 2L0PA 1CFDA 4OVNF 1QLSA 1NX0A 3EK8A 4XJKA 4CPVA 4YGDB 5AERA 1IJ6A 3BQ3A 1CLLA 1C7WA 4MEWA 1XFUO 5D69A 1DGUA 3WHTB 1J7PA 5D7FA 1SL9A 1IQ5A 1DJHA 3JVTC 1S6CA 2F33A 2P6BB 2M0RA 1DTLA 1NX2A 2VRGA 1RFJA 4PHJA 1K95A 1M63B 1B8CA 1QASA 3OP0A 1N65A 1TOPA 2HETA 2JTTA 2KGBC 2ZFDA 1CLMA 1BJFA 2Y5IA 2AAOA 4OR9B 1QLKA 1TTXA 5CSNA 4PDZA 3TS5C 1FW4A 5GQQC 1CFFA 1UHJA 1LA0A 1JFJA 1QX5B 3GK4X 5AANA 2M3WA 3CWGA 1PSRA 3IF7A 3EVVA 2LLSA 3EKHA 4FTGA 2F2OA 2FOTA 4OKHA 5CPVA 3PN7C 2RGIA 1YVLA 2KI4C 2PMYA 4I5JA 3D10A 2KAXA 3M0WA 1B1GA 3LL8B 2KBMA 4XYNA 1S26D 2Q91A 1K8UA 3EVUA 4JWQA 4YI9A 5I2LA 5JOLA 1PALA 4PE1A 2K7CA 2GGZA 1MXLC 3CTNA 3AAKA 1M31A 3EK4A 2KDHA 1SRAA 1QATA 2JT3A 1RECA 2BCXA 1Q80A 1UHNA 1DJGA 1TCOB 2DOQA 1KK8C 1RWYA 3I5HC 4DS7A 1CFPA 3GK2A 1GGZA 1XFXO 3MSEB 1BMOA 1M39A 4MN0A 5HKWA 1F4QA 3VGOA 4MRXA 3IQOA 2E6WA 2KHNA 4MVFA 4E68A 1JC2A 1KQMB 4IL1A 1WY9A 3NSKA 5DKRA 1CMFA 1UUSA 1KWOB 1XYDA 2GV5A 4A4BA 2JT8A 2LVJA 4TNCA 2E30A 2K8MB 4CFQA 1EG3A 2MLEC 4F0ZB 2MA2A 2K0JA 1TNPA 5HYDA 1S6JA 3SIAA 4Q04A 3I5GC 4QJ3B 1C7VA 1DJWA 1IRJA 2I18A 1FI5A 2JNFA 3PALA 2JNXA 4PALA 3KHEA 2WC8A 1B47A 3I5IB 2LVIA 3SJSA 1OZOA 3D0YB 1ODBA 1AJ5A 1XFVO 3DVMA 1U5IB 5CSIA 5DKNA 2KYFA 3CR5X 1YUTA 1DF0B 3SG3A 1V1GA 1IJ5A 2HF5A 1QXPA 1OZSA 2KSPA 3NSLA 4PE7A 3SG6A 2CTNA 4N1FA 1CDMA 3PATA 2K7OA 2WOSA 3NXAA 2CCMA 4MZJA 1XVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A2X A;  3JTD B;  3TDI A;  3SG2 A;  1SW8 A;  1OSA A;  2EHB A;  4UPG A;  5FYX A;  3DVJ A;  2BL0 B;  1Y0V H;  2H2K A;  1AJ4 A;  5HLV A;  2JRF A;  1A75 B;  1CM1 A;  1QVI Z;  2LMU A;  4CLN A;  1WRK A;  1FPW A;  1YUS A;  4MZL A;  4NDC A;  1CDL A;  3TUY B;  1SKT A;  1ZAC A;  5PAL A;  3D0Y A;  5J3X A;  1WLZ A;  1XK4 A;  1XFY O;  2OTG B;  1U5I A;  1SCM B;  1IGV A;  2F3Y A;  2O60 A;  5I8N A;  4HRH A;  4DRW A;  4DCK A;  2L98 A;  1K93 D;  1DF0 A;  4HRG A;  1CMG A;  4MLW A;  3PSR A;  2JOJ A;  1PVA A;  1R2U A;  2H61 A;  3NSO A;  5AFP A;  1TNW A;  1KFU L;  3RLZ A;  4AQJ A;  1MR8 A;  4YGE B;  2PAL A;  1BLQ A;  1F8H A;  2BKH B;  3DVE A;  1BR4 B;  3FWC A;  3NSI A;  2ZND A;  3A8R A;  4MBE A;  1J1E A;  3HX4 A;  3EK7 A;  4PHM A;  3VRP A;  1WRZ A;  2Y1M A;  4WQ3 A;  1TCF A;  2O5G A;  2MBX A;  2FCD A;  3BXK A;  1A75 A;  3BUX B;  1SCV A;  5CSJ A;  1A29 A;  2WCF A;  1K9K A;  3VRR A;  5AEQ A;  3TDZ A;  2B1U A;  1F55 A;  1S5G Z;  3CR4 X;  1BT6 A;  2LV7 A;  2L4I A;  2M7L A;  1KK7 Y;  2L51 A;  1XFW O;  3I5F B;  1XO5 A;  2K7B A;  2EC6 B;  4OV2 A;  2ZRT A;  3O6B A;  1BG1 A;  1CNP A;  1KQM C;  3CR2 A;  2PAS A;  1TRF A;  1MUX A;  2LVV A;  2KQY A;  1TNX A;  1MF8 B;  1JUO A;  2JXL A;  2KFF A;  2BKI B;  3PLF B;  2KI6 D;  1ZMZ A;  4M2Q A;  4C0J A;  1OQP A;  1QV1 A;  1S1E A;  2MHH A;  1QIV A;  2WOR A;  1Y1A A;  4ORC B;  1HQV A;  2M7N A;  1RRO A;  2NLN A;  3OX6 A;  3C1V A;  1K2H A;  2BCB A;  2G9B A;  4M2O A;  1CLB A;  1XA5 A;  3OHM B;  1X02 A;  1WLM A;  1SL8 A;  1SY9 A;  3PFV A;  1K9U A;  2F8P A;  1DMO A;  1CDN A;  1LIN A;  1YVH A;  2FJU B;  1K9P A;  1IKU A;  3DF0 B;  3I5I C;  3ICB A;  4GGF A;  1L2O B;  1XK4 C;  3WNX B;  3KF9 A;  4GPL B;  1B8L A;  1SNL A;  2PVB A;  3VRQ A;  1KFX L;  2IS9 A;  1XFZ O;  4MZK A;  1SR6 B;  2K61 A;  3DD4 A;  3O78 A;  2AUC A;  4N1G A;  1DT7 B;  1G33 A;  3O4Y A;  4PE0 A;  4PCW A;  5KU1 A;  4MSP A;  5TNC A;  1B7T Z;  2H61 C;  3LLE A;  1NCX A;  1NUB A;  1IWQ A;  4GBA A;  1BF5 A;  2L4H A;  1NCY A;  2M29 A;  3LK1 A;  3JTD C;  5B8I B;  1NP8 A;  1K94 A;  1MWN A;  1F4O A;  3H4S E;  1RTP 1;  2BL0 C;  2LLU A;  1KFU S;  2KYC A;  1KSO A;  2JWW A;  4BY4 A;  1AVS A;  1CM4 A;  1OMV A;  1PRW A;  1E8A A;  4WRI A;  2JU0 A;  3DF0 A;  4ZCU A;  1NX1 A;  4WQ2 A;  3TUY C;  1AHR A;  3CZT X;  2LHL A;  1YR5 A;  2NZ0 A;  3OB2 B;  5K89 A;  5I2Q A;  2M8U A;  2MRD A;  1LXF C;  2OTG C;  1SCM C;  4M2P A;  2MAZ A;  1CKK A;  2CNP A;  2LMV A;  1ALV A;  2K7D A;  4P2Y B;  3WXA A;  2JPT A;  1AK8 A;  1J7R A;  4PHN A;  1J7O A;  3EKJ A;  1ZOT B;  2OS8 B;  4HRE E;  3AAJ A;  4FQO A;  2ISD A;  3WHU B;  3ZWH A;  2L50 A;  1DGV A;  2OPO A;  5JJG A;  2K2F A;  4JQ0 D;  5F6T A;  1NPQ A;  1M45 A;  4GFT A;  4JPZ B;  1FBV A;  3PM8 A;  2K2A A;  3SG7 A;  3QRX A;  1J55 A;  2LMT A;  2ZRS A;  1PSB A;  1MXE A;  3FWB A;  1JF2 A;  1S36 A;  5ER4 X;  2KGR A;  3SG5 A;  4NQG A;  2KFG A;  1B8R A;  4AQI A;  2MLF C;  1TIZ A;  2BE6 A;  1YX8 A;  1GJY A;  4A4C A;  4GGN A;  1Y1X A;  3VRO A;  4BY5 A;  1G8I A;  3GK1 A;  2FCE A;  1A03 A;  5KSZ A;  3VRN A;  1ZUZ A;  4ORA B;  1R6P A;  5CSF A;  2WND A;  4D1E A;  1WDC B;  1W7I B;  1CB1 A;  3I5F C;  4GGF C;  3DVK A;  2EC6 C;  1DJY A;  2LM5 A;  3SIB A;  1DVI A;  1QV0 A;  3BYA A;  1UHK A;  1UUR A;  4GAO A;  1KSM A;  2D8N A;  1A4P A;  3BUM B;  2NXQ A;  2ZKM X;  1EXR A;  1YUU A;  1DJZ A;  4U8D A;  1DJI A;  2M9G A;  4ZCV A;  1WRL A;  2NCO A;  2JQ6 A;  4MRY A;  1YX7 A;  1KFX S;  1BOC A;  1ALW A;  1C07 A;  2JUL A;  3IQQ A;  4QJ5 B;  1UHI A;  3AKB A;  3CS1 A;  1PVB A;  1YRU B;  3GOF A;  1EG4 A;  1HT9 A;  1FI6 A;  1NX3 A;  2HQW A;  2LAP A;  2M49 B;  1QJT A;  3E3R A;  2KAV A;  2JXC A;  4YBH B;  1D1O A;  1NIW A;  1J1D A;  1YUR A;  2L5X B;  1NYA A;  1SL7 A;  3TZ1 A;  1QS7 A;  2MJW B;  1KWO C;  1L2O C;  4YGA A;  1JFK A;  4NDD A;  3BOW B;  1H8B A;  3F45 A;  3HCM A;  1KCY A;  1NCZ A;  3KO0 A;  2KQ6 A;  1SR6 C;  1IQ3 A;  3AKA A;  1YRT B;  2CBL A;  2ZNE A;  2HPS A;  2JT0 A;  4YGC B;  3FS7 A;  2BBM A;  3JVT B;  4DIR A;  1GQM A;  3O2P A;  1JSA A;  1MHO A;  2WCE A;  5HKY A;  1N0Y A;  1JF0 A;  2V53 A;  4C0L A;  1IH0 A;  2JC2 A;  1KQV A;  1QVI Y;  1LKJ A;  1J7Q A;  1M46 A;  2ZN9 A;  2COL B;  2PSR A;  1K96 A;  1V1F A;  5KTY A;  1S6I A;  4YRU A;  4PE4 A;  4C0K A;  2BEC A;  4N5X A;  1IG5 A;  1CFC A;  2M1U A;  1EL4 A;  5G08 A;  3TS5 B;  4ICB A;  4PHK A;  2JZI A;  2LLT A;  1F71 A;  5HKZ A;  4R1E A;  2GGM A;  3BOW A;  4YI8 A;  2Y1N A;  2LP3 A;  3PN7 B;  1QIW A;  2I7A A;  2QAC A;  1L7Z A;  1LVC D;  1YTZ C;  2KI4 B;  2SAS A;  4P5O E;  4DUQ A;  2PRU A;  1W7J B;  1CDP A;  1F70 A;  2SCP A;  3A4U B;  5AXI A;  4NDB A;  2F2P A;  2OS8 C;  1LA3 A;  2JTZ A;  2LUC A;  3LCP C;  2LCP A;  1BOD A;  3K21 A;  3RM1 A;  4ORB B;  5IBW A;  1ZFS A;  2LHI A;  2ZN8 A;  4I5N B;  2QPT A;  1OMR A;  1NWD A;  2KBI A;  3CGA A;  1BU3 A;  2EGD A;  4GUK A;  1MQ1 A;  2HQ8 A;  2M1K B;  1QX7 A;  3BUO B;  1S5G Y;  4I5K A;  4OCI A;  1F54 A;  1UHH A;  1SYM A;  1KK8 B;  2LUX A;  4USL A;  5BPJ A;  1CTR A;  4YGB B;  2KAY A;  5ER5 A;  3I5H B;  1RK9 A;  1JBA A;  2NCP A;  3BUN B;  1QX2 A;  1SBJ A;  1SK6 D;  2BCA A;  2KNE A;  4CFR A;  2BBN A;  5HLO A;  1GGW A;  1B9A A;  1N2D A;  1WDC C;  1UP5 A;  2BE4 A;  1KK7 Z;  3KPX A;  1H4B A;  2M97 A;  1AUI B;  1FF1 A;  4QJ4 B;  1EJ3 A;  3OX5 A;  1OOJ A;  2L2E A;  4CID A;  1OE9 B;  2KOT A;  2LAN A;  2R2I A;  2LVK A;  4XJK B;  1DJX A;  3TDU A;  4ETO A;  1RJV A;  3KEV A;  1VRK A;  2Y4Q A;  1AP4 A;  4AOM A;  1BR1 B;  2Q4U A;  4GNK B;  1B4C A;  1OMD A;  2F3Z A;  1JWD A;  3SG4 A;  2LC5 A;  3OB1 B;  1S3P A;  2LP2 A;  1K90 D;  3I5G B;  1NSH A;  2I2R E;  5I2O A;  2TN4 A;  1QTX A;  3ZNI A;  1PUL A;  3FIA A;  1TNQ A;  2AMI A;  2WCB A;  3BUW B;  2KFH A;  2G2B A;  5DKQ A;  1SPY A;  2CT9 A;  1Y1U A;  1SMG A;  2I94 A;  3CLN A;  3EVR A;  1Y6W A;  1UWO A;  2A4J A;  1PK0 D;  1G4Y R;  4HSZ A;  1TN4 A;  3LK0 A;  4L9M A;  2LNK A;  4I5L B;  2CXJ A;  1EH2 A;  1B7T Y;  2LE9 B;  2KI6 C;  2L0P A;  1CFD A;  4OVN F;  1QLS A;  1NX0 A;  3EK8 A;  4XJK A;  4CPV A;  4YGD B;  5AER A;  1IJ6 A;  3BQ3 A;  1CLL A;  1C7W A;  4MEW A;  1XFU O;  5D69 A;  1DGU A;  3WHT B;  1J7P A;  5D7F A;  1SL9 A;  1IQ5 A;  1DJH A;  3JVT C;  1S6C A;  2F33 A;  2P6B B;  2M0R A;  1DTL A;  1NX2 A;  2VRG A;  1RFJ A;  4PHJ A;  1K95 A;  1M63 B;  1B8C A;  1QAS A;  3OP0 A;  1N65 A;  1TOP A;  2HET A;  2JTT A;  2KGB C;  2ZFD A;  1CLM A;  1BJF A;  2Y5I A;  2AAO A;  4OR9 B;  1QLK A;  1TTX A;  5CSN A;  4PDZ A;  3TS5 C;  1FW4 A;  5GQQ C;  1CFF A;  1UHJ A;  1LA0 A;  1JFJ A;  1QX5 B;  3GK4 X;  5AAN A;  2M3W A;  3CWG A;  1PSR A;  3IF7 A;  3EVV A;  2LLS A;  3EKH A;  4FTG A;  2F2O A;  2FOT A;  4OKH A;  5CPV A;  3PN7 C;  2RGI A;  1YVL A;  2KI4 C;  2PMY A;  4I5J A;  3D10 A;  2KAX A;  3M0W A;  1B1G A;  3LL8 B;  2KBM A;  4XYN A;  1S26 D;  2Q91 A;  1K8U A;  3EVU A;  4JWQ A;  4YI9 A;  5I2L A;  5JOL A;  1PAL A;  4PE1 A;  2K7C A;  2GGZ A;  1MXL C;  3CTN A;  3AAK A;  1M31 A;  3EK4 A;  2KDH A;  1SRA A;  1QAT A;  2JT3 A;  1REC A;  2BCX A;  1Q80 A;  1UHN A;  1DJG A;  1TCO B;  2DOQ A;  1KK8 C;  1RWY A;  3I5H C;  4DS7 A;  1CFP A;  3GK2 A;  1GGZ A;  1XFX O;  3MSE B;  1BMO A;  1M39 A;  4MN0 A;  5HKW A;  1F4Q A;  3VGO A;  4MRX A;  3IQO A;  2E6W A;  2KHN A;  4MVF A;  4E68 A;  1JC2 A;  1KQM B;  4IL1 A;  1WY9 A;  3NSK A;  5DKR A;  1CMF A;  1UUS A;  1KWO B;  1XYD A;  2GV5 A;  4A4B A;  2JT8 A;  2LVJ A;  4TNC A;  2E30 A;  2K8M B;  4CFQ A;  1EG3 A;  2MLE C;  4F0Z B;  2MA2 A;  2K0J A;  1TNP A;  5HYD A;  1S6J A;  3SIA A;  4Q04 A;  3I5G C;  4QJ3 B;  1C7V A;  1DJW A;  1IRJ A;  2I18 A;  1FI5 A;  2JNF A;  3PAL A;  2JNX A;  4PAL A;  3KHE A;  2WC8 A;  1B47 A;  3I5I B;  2LVI A;  3SJS A;  1OZO A;  3D0Y B;  1ODB A;  1AJ5 A;  1XFV O;  3DVM A;  1U5I B;  5CSI A;  5DKN A;  2KYF A;  3CR5 X;  1YUT A;  1DF0 B;  3SG3 A;  1V1G A;  1IJ5 A;  2HF5 A;  1QXP A;  1OZS A;  2KSP A;  3NSL A;  4PE7 A;  3SG6 A;  2CTN A;  4N1F A;  1CDM A;  3PAT A;  2K7O A;  2WOS A;  3NXA A;  2CCM A;  4MZJ A;  1XVJ A; 
#chains in the Genus database with same CATH topology
 1A2X A;  3JTD B;  3TDI A;  3SG2 A;  2L2C A;  1SW8 A;  1OSA A;  2EHB A;  4UPG A;  5FYX A;  3DVJ A;  2BL0 B;  3R72 A;  1Y0V H;  2H2K A;  1AJ4 A;  5HLV A;  2JRF A;  1A75 B;  1CM1 A;  1QVI Z;  2LMU A;  3CZ1 A;  1WRK A;  4CLN A;  1FPW A;  1YUS A;  4MZL A;  4NDC A;  1CDL A;  3TUY B;  1SKT A;  1ZAC A;  2YGU A;  3D0Y A;  5PAL A;  5J3X A;  1WLZ A;  1XK4 A;  3R1P A;  1SSE B;  1XFY O;  2OTG B;  1U5I A;  1SCM B;  1IGV A;  2F3Y A;  2O60 A;  5I8N A;  4HRH A;  4DRW A;  4DCK A;  2L98 A;  1K93 D;  1DF0 A;  4HRG A;  1CMG A;  4MLW A;  3PSR A;  2JOJ A;  1PVA A;  1R2U A;  3UO9 A;  2H61 A;  3NSO A;  5AFP A;  1TNW A;  1KFU L;  3RLZ A;  4INX A;  4AQJ A;  1MR8 A;  2P70 A;  2PAL A;  4YGE B;  1BLQ A;  1F8H A;  2BKH B;  3DVE A;  1BR4 B;  3FWC A;  3NSI A;  2ZND A;  3A8R A;  4MBE A;  1J1E A;  2BAP A;  3HX4 A;  1Z4H A;  3EK7 A;  1OOH A;  2K60 A;  4PHM A;  3VRP A;  1WRZ A;  2Y1M A;  4WQ3 A;  3CAB A;  1TCF A;  2O5G A;  3QME A;  2MBX A;  2FCD A;  3BXK A;  1A75 A;  3S0D A;  1QWV A;  1SCV A;  3BUX B;  5CSJ A;  1OOG A;  1A29 A;  2WC5 A;  1K9K A;  2WCF A;  3PJI A;  3VRR A;  5AEQ A;  2PYQ A;  2B1U A;  3TDZ A;  1S5G Z;  3CR4 X;  1F55 A;  1BT6 A;  2LV7 A;  1DC1 A;  2L4I A;  2M7L A;  1KK7 Y;  2WCJ A;  2L51 A;  1XFW O;  3I5F B;  1XO5 A;  2K7B A;  2EC6 B;  4OV2 A;  2ZRT A;  3O6B A;  1BG1 A;  3BJH A;  1CNP A;  1KQM C;  3DXL A;  3CR2 A;  2PAS A;  1TRF A;  1MUX A;  2LVV A;  2KQY A;  1TNX A;  1MF8 B;  1JUO A;  1T14 A;  2JXL A;  2BKI B;  2KFF A;  3PLF B;  2KI6 D;  1ZMZ A;  4M2Q A;  4C0J A;  1OQP A;  1QV1 A;  1S1E A;  1OOF A;  1QIV A;  2MHH A;  3B88 A;  2WOR A;  1Y1A A;  4ORC B;  1HQV A;  2M7N A;  1RRO A;  2NLN A;  3OX6 A;  3C1V A;  1K2H A;  2BCB A;  3O4X A;  2G9B A;  4M2O A;  1CLB A;  1XA5 A;  3OHM B;  1XFR A;  1X02 A;  1WLM A;  1SL8 A;  1SY9 A;  3PFV A;  1K9U A;  2F8P A;  1DMO A;  1CDN A;  1LIN A;  1YVH A;  2FJU B;  1K9P A;  1IKU A;  1P28 A;  3DF0 B;  3I5I C;  3ICB A;  4GGF A;  1L2O B;  1XK4 C;  3WNX B;  3KF9 A;  4GPL B;  1B8L A;  3D74 A;  1SNL A;  2PVB A;  3VRQ A;  1KFX L;  2IS9 A;  3D76 A;  1XFZ O;  4JD9 A;  4MZK A;  1SR6 B;  2K61 A;  3DD4 A;  3O78 A;  3S0E A;  2AUC A;  4N1G A;  1DT7 B;  1G33 A;  3O4Y A;  4PE0 A;  3L47 A;  4PCW A;  5KU1 A;  4MSP A;  5TNC A;  1B7T Z;  2H61 C;  3LLE A;  1NCX A;  1NUB A;  1GM0 A;  1IWQ A;  4GBA A;  1BF5 A;  2L4H A;  1NCY A;  2M29 A;  3IVT A;  3DY9 A;  3LK1 A;  3JTD C;  5B8I B;  1C3Z A;  1NP8 A;  2WCH A;  1K94 A;  1MWN A;  1F4O A;  3H4S E;  1RTP 1;  2BL0 C;  3DYE A;  2LLU A;  1KFU S;  2KYC A;  1KSO A;  2JWW A;  2PQL A;  4BY4 A;  1AVS A;  1CM4 A;  1OMV A;  1PRW A;  1E8A A;  4WRI A;  2JU0 A;  3UNW A;  3DF0 A;  4ZCU A;  1NX1 A;  4WQ2 A;  3TUY C;  1AHR A;  3CZT X;  2LHL A;  3CYZ A;  1YR5 A;  2NZ0 A;  3SS4 A;  3OB2 B;  5K89 A;  5I2Q A;  2M8U A;  2MRD A;  1LXF C;  2OTG C;  1SCM C;  3NHI A;  4M2P A;  2MAZ A;  1CKK A;  2CNP A;  2LMV A;  1ALV A;  2K7D A;  3B6X A;  4P2Y B;  3WXA A;  2JPT A;  1AK8 A;  1J7R A;  4PHN A;  1J7O A;  3NHT A;  3EKJ A;  1ZOT B;  2OS8 B;  4HRE E;  3AAJ A;  4FQO A;  2ISD A;  3WHU B;  3ZWH A;  2L50 A;  1DGV A;  2OPO A;  5JJG A;  2K2F A;  4JQ0 D;  5F6T A;  1NPQ A;  1M45 A;  4GFT A;  4JPZ B;  1FBV A;  3D78 A;  2K2A A;  3PM8 A;  3SG7 A;  3QRX A;  1J55 A;  2QEO A;  2LMT A;  2ZRS A;  1PSB A;  1MXE A;  3FWB A;  1JF2 A;  2QEV A;  1S36 A;  5ER4 X;  4F7F A;  2ERB A;  2KGR A;  3SG5 A;  4NQG A;  2KFG A;  1B8R A;  4AQI A;  2MLF C;  1TIZ A;  2BE6 A;  1YX8 A;  1GJY A;  4A4C A;  4GGN A;  1Y1X A;  3VRO A;  2JPO A;  1G8I A;  3GK1 A;  4BY5 A;  2FCE A;  1A03 A;  5KSZ A;  5D3O A;  3VRN A;  1ZUZ A;  4ORA B;  1R6P A;  5CSF A;  3Q8I A;  2WND A;  4D1E A;  1WDC B;  1W7I B;  1CB1 A;  3I5F C;  4GGF C;  3DVK A;  2EC6 C;  1DJY A;  2LM5 A;  3SIB A;  2KLE A;  1DVI A;  1QV0 A;  3BYA A;  1UHK A;  1UUR A;  3S0G A;  4GAO A;  1KSM A;  2D8N A;  3NGV A;  1C3Y A;  1A4P A;  3BUM B;  2NXQ A;  2ZKM X;  1EXR A;  1YUU A;  1DJZ A;  4U8D A;  1DJI A;  2M9G A;  4ZCV A;  1WRL A;  3EG5 B;  2NCO A;  2JQ6 A;  4MRY A;  1YX7 A;  1KFX S;  1BOC A;  1ALW A;  1C07 A;  2JUL A;  3IQQ A;  4QJ5 B;  1UHI A;  3AKB A;  3CS1 A;  1PVB A;  1YRU B;  3GOF A;  1EG4 A;  1HT9 A;  1FI6 A;  1NX3 A;  2HQW A;  2LAP A;  2M49 B;  1QJT A;  3E3R A;  1IIO A;  2KAV A;  2JXC A;  4YBH B;  1D1O A;  1NIW A;  1LS8 A;  1J1D A;  1YUR A;  2L5X B;  1NYA A;  1SL7 A;  1DEL A;  3TZ1 A;  1QS7 A;  2MJW B;  1KWO C;  1L2O C;  4YGA A;  1JFK A;  4NDD A;  3BOW B;  1H8B A;  3F45 A;  3HCM A;  1KCY A;  1NCZ A;  2L5Y A;  3KO0 A;  2KQ6 A;  1SR6 C;  1IQ3 A;  3AKA A;  1YRT B;  2CBL A;  2ZNE A;  2HPS A;  2JT0 A;  4YGC B;  3FS7 A;  2BBM A;  3JVT B;  4DIR A;  1GQM A;  3O2P A;  1JSA A;  1MHO A;  2WCE A;  5HKY A;  1N0Y A;  1JF0 A;  2V53 A;  4C0L A;  1IH0 A;  2JC2 A;  1KQV A;  1QVI Y;  1LKJ A;  1J7Q A;  1M46 A;  2ZN9 A;  3B7A A;  4FQT A;  2COL B;  2PSR A;  4JKT A;  1K96 A;  1V1F A;  5I94 A;  1S6I A;  4YRU A;  5KTY A;  4PE4 A;  4IJ7 A;  4C0K A;  2BEC A;  4N5X A;  1IG5 A;  2FJY A;  1CFC A;  2M1U A;  1EL4 A;  5G08 A;  3TS5 B;  4ICB A;  3RZS A;  4PHK A;  3S0B A;  2JZI A;  2LLT A;  1F71 A;  5DIC A;  5HKZ A;  4R1E A;  2GGM A;  3BOW A;  3PM2 A;  4YI8 A;  2Y1N A;  2LP3 A;  3PN7 B;  1QIW A;  2I7A A;  2KPH A;  2QAC A;  1L7Z A;  1LVC D;  1YTZ C;  2KI4 B;  2SAS A;  4P5O E;  4DUQ A;  2PRU A;  1W7J B;  1CDP A;  1F70 A;  3L4L A;  3OBV A;  2SCP A;  2WCK A;  3A4U B;  5AXI A;  4NDB A;  2F2P A;  2OS8 C;  3N7H A;  1LA3 A;  2JTZ A;  2LUC A;  1OOI X;  3FE9 A;  3LCP C;  2LCP A;  1BOD A;  3K21 A;  3RM1 A;  3L4A A;  4ORB B;  5IBW A;  1ZFS A;  2LHI A;  2ZN8 A;  4I5N B;  3D77 A;  2QPT A;  1OMR A;  1NWD A;  2KBI A;  3CGA A;  1BU3 A;  2EGD A;  4GUK A;  1MQ1 A;  2HQ8 A;  3CZ0 A;  5FI7 A;  2M1K B;  1QX7 A;  3BUO B;  1S5G Y;  4I5K A;  4OCI A;  4PT1 A;  1F54 A;  1UHH A;  1SYM A;  1KK8 B;  2LUX A;  4USL A;  5BPJ A;  1CTR A;  4YGB B;  2KAY A;  5ER5 A;  3I5H B;  1RK9 A;  1JBA A;  1OW4 A;  2NCP A;  1W9Z A;  2WCM A;  3BUN B;  1QX2 A;  1SBJ A;  1SK6 D;  2BCA A;  2KNE A;  4CFR A;  2BBN A;  5HLO A;  1GGW A;  1B9A A;  1N2D A;  3B86 A;  1WDC C;  1UP5 A;  2BE4 A;  1KK7 Z;  3KPX A;  1H4B A;  2M97 A;  1AUI B;  1FF1 A;  4QJ4 B;  1EJ3 A;  3OX5 A;  1OOJ A;  2L2E A;  3SS5 A;  4CID A;  1OE9 B;  2KOT A;  2LAN A;  2R2I A;  2LVK A;  1Z2C B;  4XJK B;  1DJX A;  2P71 A;  3R1O A;  1RJV A;  3TDU A;  3VB1 A;  4ETO A;  3KEV A;  1VRK A;  2Y4Q A;  1AP4 A;  4AOM A;  1BR1 B;  2Q4U A;  4GNK B;  1B4C A;  1OMD A;  2F3Z A;  1JWD A;  3SG4 A;  2LC5 A;  3OB1 B;  1S3P A;  2LP2 A;  1K90 D;  3I5G B;  1NSH A;  2I2R E;  5I2O A;  4KYN A;  2TN4 A;  3OGN A;  1QTX A;  3ZNI A;  1PUL A;  3FIA A;  1TNQ A;  2AMI A;  2WCB A;  3BUW B;  2KFH A;  2G2B A;  5DKQ A;  3FE6 A;  1SPY A;  2CT9 A;  1Y1U A;  1SMG A;  2I94 A;  3CLN A;  3EVR A;  1Y6W A;  1UWO A;  2A4J A;  2QEB A;  2GTE A;  2WC6 A;  3S0A A;  1PK0 D;  1G4Y R;  4HSZ A;  1TN4 A;  3LK0 A;  4L9M A;  2BNX A;  2LNK A;  4I5L B;  2CXJ A;  1EH2 A;  1B7T Y;  1DEK A;  2LE9 B;  2KI6 C;  2L0P A;  1CFD A;  4OVN F;  1QLS A;  1NX0 A;  3EK8 A;  4XJK A;  4CPV A;  4YGD B;  5AER A;  1IJ6 A;  3BQ3 A;  1CLL A;  1C7W A;  4MEW A;  1XFU O;  5D69 A;  1DGU A;  3WHT B;  1J7P A;  5D7F A;  1SL9 A;  1IQ5 A;  1DJH A;  3JVT C;  1S6C A;  2F33 A;  5FI2 A;  2P6B B;  2M0R A;  1DTL A;  1NX2 A;  2VRG A;  1RFJ A;  4PHJ A;  1K95 A;  1M63 B;  3CZ2 A;  1B8C A;  1QAS A;  3OP0 A;  1N65 A;  1ORG A;  1TOP A;  2HET A;  2JTT A;  2KGB C;  2ZFD A;  1CLM A;  1BJF A;  2Y5I A;  2AAO A;  4OR9 B;  1QLK A;  1TTX A;  3BFA A;  5CSN A;  4PDZ A;  3TS5 C;  1FW4 A;  5GQQ C;  2QDI A;  3K1E A;  1CFF A;  1UHJ A;  1LA0 A;  3B87 A;  1JFJ A;  1QX5 B;  3GK4 X;  5AAN A;  2M3W A;  3CWG A;  1PSR A;  3IF7 A;  3EVV A;  2LLS A;  3EKH A;  4FTG A;  2F2O A;  2FOT A;  4OKH A;  5CPV A;  3PN7 C;  2RGI A;  1YVL A;  2KI4 C;  2PMY A;  4I5J A;  3D10 A;  2KAX A;  3M0W A;  1B1G A;  1TUJ A;  3LL8 B;  3S0F A;  2KBM A;  4XYN A;  1S26 D;  2Q91 A;  1K8U A;  3EVU A;  4JWQ A;  3CDN A;  4YI9 A;  1TWO A;  5I2L A;  5JOL A;  1PAL A;  4PE1 A;  3D73 A;  2K7C A;  2GGZ A;  1MXL C;  3CTN A;  3AAK A;  1M31 A;  3EK4 A;  2KDH A;  3BFH A;  1SRA A;  1QAT A;  2JT3 A;  1REC A;  2BCX A;  1TUZ A;  1TCO B;  1UHN A;  1Q80 A;  1DJG A;  2DOQ A;  1KK8 C;  1RWY A;  3I5H C;  4DS7 A;  1CFP A;  3GK2 A;  1GGZ A;  1XFX O;  3D75 A;  3MSE B;  4OZD A;  1BMO A;  3DZT A;  3SS3 A;  1M39 A;  4MN0 A;  5FI6 A;  1F4Q A;  5HKW A;  3VGO A;  4MRX A;  3IQO A;  5HL1 A;  2E6W A;  2KHN A;  2KLD A;  4MVF A;  4E68 A;  1KQM B;  4IL1 A;  1WY9 A;  4INW A;  1JC2 A;  3NSK A;  5DKR A;  1CMF A;  1UUS A;  1KWO B;  1XYD A;  2GV5 A;  4A4B A;  2JT8 A;  2LVJ A;  4TNC A;  2E30 A;  2K8M B;  4CFQ A;  1EG3 A;  2MLE C;  2QEH A;  4F0Z B;  2MA2 A;  2K0J A;  1TNP A;  5HYD A;  2H8V A;  1S6J A;  3SIA A;  4Q04 A;  3I5G C;  4QJ3 B;  1C7V A;  1DJW A;  1IRJ A;  2I18 A;  1FI5 A;  2JNF A;  3PAL A;  2JNX A;  4PAL A;  3KHE A;  2WC8 A;  5EL2 A;  1B47 A;  3V2L A;  3I5I B;  2LVI A;  3SJS A;  1OZO A;  3D0Y B;  1ODB A;  1AJ5 A;  1XFV O;  3FE8 A;  3DVM A;  1U5I B;  5CSI A;  5DKN A;  2KYF A;  3CR5 X;  1YUT A;  1DF0 B;  1DQE A;  1V1G A;  1IJ5 A;  2HF5 A;  1QXP A;  3SG3 A;  3R1V A;  2WCL A;  1OZS A;  2KSP A;  3NSL A;  4PE7 A;  3SG6 A;  2CTN A;  4N1F A;  3BFB A;  1CDM A;  3PAT A;  2K7O A;  2WOS A;  3NXA A;  2CCM A;  4MZJ A;  1XVJ A; 
#chains in the Genus database with same CATH homology
 1A2X A;  3JTD B;  3TDI A;  3SG2 A;  1SW8 A;  1OSA A;  2EHB A;  4UPG A;  5FYX A;  3DVJ A;  2BL0 B;  1Y0V H;  2H2K A;  1AJ4 A;  5HLV A;  2JRF A;  1A75 B;  1CM1 A;  1QVI Z;  2LMU A;  4CLN A;  1WRK A;  1FPW A;  1YUS A;  4MZL A;  4NDC A;  1CDL A;  3TUY B;  1SKT A;  1ZAC A;  5PAL A;  3D0Y A;  5J3X A;  1WLZ A;  1XK4 A;  1XFY O;  2OTG B;  1U5I A;  1SCM B;  1IGV A;  2F3Y A;  2O60 A;  5I8N A;  4HRH A;  4DRW A;  4DCK A;  2L98 A;  1K93 D;  1DF0 A;  4HRG A;  1CMG A;  4MLW A;  3PSR A;  2JOJ A;  1PVA A;  1R2U A;  2H61 A;  3NSO A;  5AFP A;  1TNW A;  1KFU L;  3RLZ A;  4AQJ A;  1MR8 A;  4YGE B;  2PAL A;  1BLQ A;  1F8H A;  2BKH B;  3DVE A;  1BR4 B;  3FWC A;  3NSI A;  2ZND A;  3A8R A;  4MBE A;  1J1E A;  3HX4 A;  3EK7 A;  4PHM A;  3VRP A;  1WRZ A;  2Y1M A;  4WQ3 A;  1TCF A;  2O5G A;  2MBX A;  2FCD A;  3BXK A;  1A75 A;  3BUX B;  1SCV A;  5CSJ A;  1A29 A;  2WCF A;  1K9K A;  3VRR A;  5AEQ A;  3TDZ A;  2B1U A;  1F55 A;  1S5G Z;  3CR4 X;  1BT6 A;  2LV7 A;  2L4I A;  2M7L A;  1KK7 Y;  2L51 A;  1XFW O;  3I5F B;  1XO5 A;  2K7B A;  2EC6 B;  4OV2 A;  2ZRT A;  3O6B A;  1BG1 A;  1CNP A;  1KQM C;  3CR2 A;  2PAS A;  1TRF A;  1MUX A;  2LVV A;  2KQY A;  1TNX A;  1MF8 B;  1JUO A;  2JXL A;  2KFF A;  2BKI B;  3PLF B;  2KI6 D;  1ZMZ A;  4M2Q A;  4C0J A;  1OQP A;  1QV1 A;  1S1E A;  2MHH A;  1QIV A;  2WOR A;  1Y1A A;  4ORC B;  1HQV A;  2M7N A;  1RRO A;  2NLN A;  3OX6 A;  3C1V A;  1K2H A;  2BCB A;  2G9B A;  4M2O A;  1CLB A;  1XA5 A;  3OHM B;  1X02 A;  1WLM A;  1SL8 A;  1SY9 A;  3PFV A;  1K9U A;  2F8P A;  1DMO A;  1CDN A;  1LIN A;  1YVH A;  2FJU B;  1K9P A;  1IKU A;  3DF0 B;  3I5I C;  3ICB A;  4GGF A;  1L2O B;  1XK4 C;  3WNX B;  3KF9 A;  4GPL B;  1B8L A;  1SNL A;  2PVB A;  3VRQ A;  1KFX L;  2IS9 A;  1XFZ O;  4MZK A;  1SR6 B;  2K61 A;  3DD4 A;  3O78 A;  2AUC A;  4N1G A;  1DT7 B;  1G33 A;  3O4Y A;  4PE0 A;  4PCW A;  5KU1 A;  4MSP A;  5TNC A;  1B7T Z;  2H61 C;  3LLE A;  1NCX A;  1NUB A;  1IWQ A;  4GBA A;  1BF5 A;  2L4H A;  1NCY A;  2M29 A;  3LK1 A;  3JTD C;  5B8I B;  1NP8 A;  1K94 A;  1MWN A;  1F4O A;  3H4S E;  1RTP 1;  2BL0 C;  2LLU A;  1KFU S;  2KYC A;  1KSO A;  2JWW A;  4BY4 A;  1AVS A;  1CM4 A;  1OMV A;  1PRW A;  1E8A A;  4WRI A;  2JU0 A;  3DF0 A;  4ZCU A;  1NX1 A;  4WQ2 A;  3TUY C;  1AHR A;  3CZT X;  2LHL A;  1YR5 A;  2NZ0 A;  3OB2 B;  5K89 A;  5I2Q A;  2M8U A;  2MRD A;  1LXF C;  2OTG C;  1SCM C;  4M2P A;  2MAZ A;  1CKK A;  2CNP A;  2LMV A;  1ALV A;  2K7D A;  4P2Y B;  3WXA A;  2JPT A;  1AK8 A;  1J7R A;  4PHN A;  1J7O A;  3EKJ A;  1ZOT B;  2OS8 B;  4HRE E;  3AAJ A;  4FQO A;  2ISD A;  3WHU B;  3ZWH A;  2L50 A;  1DGV A;  2OPO A;  5JJG A;  2K2F A;  4JQ0 D;  5F6T A;  1NPQ A;  1M45 A;  4GFT A;  4JPZ B;  1FBV A;  3PM8 A;  2K2A A;  3SG7 A;  3QRX A;  1J55 A;  2LMT A;  2ZRS A;  1PSB A;  1MXE A;  3FWB A;  1JF2 A;  1S36 A;  5ER4 X;  2KGR A;  3SG5 A;  4NQG A;  2KFG A;  1B8R A;  4AQI A;  2MLF C;  1TIZ A;  2BE6 A;  1YX8 A;  1GJY A;  4A4C A;  4GGN A;  1Y1X A;  3VRO A;  4BY5 A;  1G8I A;  3GK1 A;  2FCE A;  1A03 A;  5KSZ A;  3VRN A;  1ZUZ A;  4ORA B;  1R6P A;  5CSF A;  2WND A;  4D1E A;  1WDC B;  1W7I B;  1CB1 A;  3I5F C;  4GGF C;  3DVK A;  2EC6 C;  1DJY A;  2LM5 A;  3SIB A;  1DVI A;  1QV0 A;  3BYA A;  1UHK A;  1UUR A;  4GAO A;  1KSM A;  2D8N A;  1A4P A;  3BUM B;  2NXQ A;  2ZKM X;  1EXR A;  1YUU A;  1DJZ A;  4U8D A;  1DJI A;  2M9G A;  4ZCV A;  1WRL A;  2NCO A;  2JQ6 A;  4MRY A;  1YX7 A;  1KFX S;  1BOC A;  1ALW A;  1C07 A;  2JUL A;  3IQQ A;  4QJ5 B;  1UHI A;  3AKB A;  3CS1 A;  1PVB A;  1YRU B;  3GOF A;  1EG4 A;  1HT9 A;  1FI6 A;  1NX3 A;  2HQW A;  2LAP A;  2M49 B;  1QJT A;  3E3R A;  2KAV A;  2JXC A;  4YBH B;  1D1O A;  1NIW A;  1J1D A;  1YUR A;  2L5X B;  1NYA A;  1SL7 A;  3TZ1 A;  1QS7 A;  2MJW B;  1KWO C;  1L2O C;  4YGA A;  1JFK A;  4NDD A;  3BOW B;  1H8B A;  3F45 A;  3HCM A;  1KCY A;  1NCZ A;  3KO0 A;  2KQ6 A;  1SR6 C;  1IQ3 A;  3AKA A;  1YRT B;  2CBL A;  2ZNE A;  2HPS A;  2JT0 A;  4YGC B;  3FS7 A;  2BBM A;  3JVT B;  4DIR A;  1GQM A;  3O2P A;  1JSA A;  1MHO A;  2WCE A;  5HKY A;  1N0Y A;  1JF0 A;  2V53 A;  4C0L A;  1IH0 A;  2JC2 A;  1KQV A;  1QVI Y;  1LKJ A;  1J7Q A;  1M46 A;  2ZN9 A;  2COL B;  2PSR A;  1K96 A;  1V1F A;  5KTY A;  1S6I A;  4YRU A;  4PE4 A;  4C0K A;  2BEC A;  4N5X A;  1IG5 A;  1CFC A;  2M1U A;  1EL4 A;  5G08 A;  3TS5 B;  4ICB A;  4PHK A;  2JZI A;  2LLT A;  1F71 A;  5HKZ A;  4R1E A;  2GGM A;  3BOW A;  4YI8 A;  2Y1N A;  2LP3 A;  3PN7 B;  1QIW A;  2I7A A;  2QAC A;  1L7Z A;  1LVC D;  1YTZ C;  2KI4 B;  2SAS A;  4P5O E;  4DUQ A;  2PRU A;  1W7J B;  1CDP A;  1F70 A;  2SCP A;  3A4U B;  5AXI A;  4NDB A;  2F2P A;  2OS8 C;  1LA3 A;  2JTZ A;  2LUC A;  3LCP C;  2LCP A;  1BOD A;  3K21 A;  3RM1 A;  4ORB B;  5IBW A;  1ZFS A;  2LHI A;  2ZN8 A;  4I5N B;  2QPT A;  1OMR A;  1NWD A;  2KBI A;  3CGA A;  1BU3 A;  2EGD A;  4GUK A;  1MQ1 A;  2HQ8 A;  2M1K B;  1QX7 A;  3BUO B;  1S5G Y;  4I5K A;  4OCI A;  1F54 A;  1UHH A;  1SYM A;  1KK8 B;  2LUX A;  4USL A;  5BPJ A;  1CTR A;  4YGB B;  2KAY A;  5ER5 A;  3I5H B;  1RK9 A;  1JBA A;  2NCP A;  3BUN B;  1QX2 A;  1SBJ A;  1SK6 D;  2BCA A;  2KNE A;  4CFR A;  2BBN A;  5HLO A;  1GGW A;  1B9A A;  1N2D A;  1WDC C;  1UP5 A;  2BE4 A;  1KK7 Z;  3KPX A;  1H4B A;  2M97 A;  1AUI B;  1FF1 A;  4QJ4 B;  1EJ3 A;  3OX5 A;  1OOJ A;  2L2E A;  4CID A;  1OE9 B;  2KOT A;  2LAN A;  2R2I A;  2LVK A;  4XJK B;  1DJX A;  3TDU A;  4ETO A;  1RJV A;  3KEV A;  1VRK A;  2Y4Q A;  1AP4 A;  4AOM A;  1BR1 B;  2Q4U A;  4GNK B;  1B4C A;  1OMD A;  2F3Z A;  1JWD A;  3SG4 A;  2LC5 A;  3OB1 B;  1S3P A;  2LP2 A;  1K90 D;  3I5G B;  1NSH A;  2I2R E;  5I2O A;  2TN4 A;  1QTX A;  3ZNI A;  1PUL A;  3FIA A;  1TNQ A;  2AMI A;  2WCB A;  3BUW B;  2KFH A;  2G2B A;  5DKQ A;  1SPY A;  2CT9 A;  1Y1U A;  1SMG A;  2I94 A;  3CLN A;  3EVR A;  1Y6W A;  1UWO A;  2A4J A;  1PK0 D;  1G4Y R;  4HSZ A;  1TN4 A;  3LK0 A;  4L9M A;  2LNK A;  4I5L B;  2CXJ A;  1EH2 A;  1B7T Y;  2LE9 B;  2KI6 C;  2L0P A;  1CFD A;  4OVN F;  1QLS A;  1NX0 A;  3EK8 A;  4XJK A;  4CPV A;  4YGD B;  5AER A;  1IJ6 A;  3BQ3 A;  1CLL A;  1C7W A;  4MEW A;  1XFU O;  5D69 A;  1DGU A;  3WHT B;  1J7P A;  5D7F A;  1SL9 A;  1IQ5 A;  1DJH A;  3JVT C;  1S6C A;  2F33 A;  2P6B B;  2M0R A;  1DTL A;  1NX2 A;  2VRG A;  1RFJ A;  4PHJ A;  1K95 A;  1M63 B;  1B8C A;  1QAS A;  3OP0 A;  1N65 A;  1TOP A;  2HET A;  2JTT A;  2KGB C;  2ZFD A;  1CLM A;  1BJF A;  2Y5I A;  2AAO A;  4OR9 B;  1QLK A;  1TTX A;  5CSN A;  4PDZ A;  3TS5 C;  1FW4 A;  5GQQ C;  1CFF A;  1UHJ A;  1LA0 A;  1JFJ A;  1QX5 B;  3GK4 X;  5AAN A;  2M3W A;  3CWG A;  1PSR A;  3IF7 A;  3EVV A;  2LLS A;  3EKH A;  4FTG A;  2F2O A;  2FOT A;  4OKH A;  5CPV A;  3PN7 C;  2RGI A;  1YVL A;  2KI4 C;  2PMY A;  4I5J A;  3D10 A;  2KAX A;  3M0W A;  1B1G A;  3LL8 B;  2KBM A;  4XYN A;  1S26 D;  2Q91 A;  1K8U A;  3EVU A;  4JWQ A;  4YI9 A;  5I2L A;  5JOL A;  1PAL A;  4PE1 A;  2K7C A;  2GGZ A;  1MXL C;  3CTN A;  3AAK A;  1M31 A;  3EK4 A;  2KDH A;  1SRA A;  1QAT A;  2JT3 A;  1REC A;  2BCX A;  1Q80 A;  1UHN A;  1DJG A;  1TCO B;  2DOQ A;  1KK8 C;  1RWY A;  3I5H C;  4DS7 A;  1CFP A;  3GK2 A;  1GGZ A;  1XFX O;  3MSE B;  1BMO A;  1M39 A;  4MN0 A;  5HKW A;  1F4Q A;  3VGO A;  4MRX A;  3IQO A;  2E6W A;  2KHN A;  4MVF A;  4E68 A;  1JC2 A;  1KQM B;  4IL1 A;  1WY9 A;  3NSK A;  5DKR A;  1CMF A;  1UUS A;  1KWO B;  1XYD A;  2GV5 A;  4A4B A;  2JT8 A;  2LVJ A;  4TNC A;  2E30 A;  2K8M B;  4CFQ A;  1EG3 A;  2MLE C;  4F0Z B;  2MA2 A;  2K0J A;  1TNP A;  5HYD A;  1S6J A;  3SIA A;  4Q04 A;  3I5G C;  4QJ3 B;  1C7V A;  1DJW A;  1IRJ A;  2I18 A;  1FI5 A;  2JNF A;  3PAL A;  2JNX A;  4PAL A;  3KHE A;  2WC8 A;  1B47 A;  3I5I B;  2LVI A;  3SJS A;  1OZO A;  3D0Y B;  1ODB A;  1AJ5 A;  1XFV O;  3DVM A;  1U5I B;  5CSI A;  5DKN A;  2KYF A;  3CR5 X;  1YUT A;  1DF0 B;  3SG3 A;  1V1G A;  1IJ5 A;  2HF5 A;  1QXP A;  1OZS A;  2KSP A;  3NSL A;  4PE7 A;  3SG6 A;  2CTN A;  4N1F A;  1CDM A;  3PAT A;  2K7O A;  2WOS A;  3NXA A;  2CCM A;  4MZJ A;  1XVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...