5JOLA

Calcium-free ef-hand domain of l-plastin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
82
structure length
82
Chain Sequence
MARGSVSDEEMMELREAFAKVDTDGNGYISFNELNDLFKAACLPLPGYRVREITENLMATGDLDQDGRISFDEFIKIFHGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Calcium-Dependent Switch Helix of L-Plastin Regulates Actin Bundling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Plastin-2
total genus 19
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2016-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5jolA00
2B1UA 2JTZA 1PALA 1K2HA 1WRZA 1Y1XA 2WNDA 5AFPA 4YRUA 4NDBA 1RJVA 1YTZC 2NCOA 1NCXA 2EC6C 1MXEA 1OE9B 2L4HA 1QX5B 1QX2A 2V53A 1JSAA 4JPZB 5DKQA 1MWNA 1NWDA 1SRAA 2ZN8A 4P2YB 1Y1UA 2M49B 5ER4X 1B7TY 2AAOA 1K9UA 4JWQA 4ICBA 2KSPA 1XFXO 4CPVA 2BBNA 2LVIA 3PN7C 1XFZO 2ZRSA 4MZLA 4XYNA 1J7PA 2E6WA 3SG7A 2Y4QA 3SJSA 1SCMB 1TN4A 1F8HA 2PMYA 1TIZA 3PSRA 4MRYA 1IWQA 5CSJA 3BOWA 1UHNA 1A75B 3I5HC 1B8CA 1ZMZA 1GGWA 1K96A 1S26D 4HSZA 3EK7A 3NSLA 2BCXA 2LMUA 1MF8B 4NDDA 1JWDA 1TNWA 1S36A 1G8IA 2H61A 2BECA 3CWGA 1AJ5A 4DCKA 2NLNA 3FS7A 2KFGA 1S6JA 1CM1A 2OS8B 2CCMA 1JUOA 2GGMA 4HRGA 4ORAB 1OMVA 2F2OA 1N0YA 3I5HB 2JXLA 5KTYA 3CLNA 4WRIA 1IKUA 4DUQA 1S5GY 1KQVA 1N2DA 4Q04A 4YBHB 2M0RA 1VRKA 5AANA 2FCEA 2LMTA 2KQ6A 1UHJA 1M63B 2JT0A 1DGUA 2OS8C 4I5NB 1W7JB 1WRLA 2KI6D 3CGAA 5KU1A 4AQIA 1AHRA 4CFRA 1DJXA 1NYAA 2EGDA 1F70A 2BBMA 2KGBC 2KAYA 4HREE 4L9MA 1MHOA 2MBXA 2KDHA 3LK1A 2Y1NA 1YUTA 2LVKA 1PK0D 4BY4A 2BKIB 5J3XA 1CFFA 2F8PA 1B7TZ 4M2OA 3I5FB 2FJUB 1CMGA 3O6BA 3IQOA 1JBAA 1GQMA 4A4CA 1QVIZ 1MR8A 2EHBA 4ORBB 4YGCB 2KAXA 1C7WA 1JF2A 1U5IB 3BUWB 4WQ2A 1KCYA 3TUYC 3SIAA 2I18A 1WDCB 2WOSA 1JC2A 3SIBA 1TTXA 3VRPA 2VRGA 1FPWA 1IGVA 1ZOTB 2FOTA 2QPTA 2G9BA 2K8MB 3BUMB 3AKAA 1M45A 3RM1A 1AK8A 3BQ3A 1BU3A 2K7OA 3TUYB 2EC6B 1IQ5A 1WDCC 1WLMA 2HF5A 1HT9A 3WNXB 1F4OA 2JU0A 4M2QA 2MLFC 2KYFA 3DVEA 5HKZA 1NCYA 4OCIA 1K8UA 3FWBA 2JZIA 1LVCD 1ZUZA 5I2OA 1MQ1A 5B8IB 1UURA 1CMFA 1AVSA 1UHKA 1QV0A 4U8DA 3GK4X 1N65A 3KEVA 3JTDC 3CTNA 2L98A 4USLA 1K93D 4NQGA 1HQVA 4ZCVA 2JRFA 3BYAA 1S6CA 1KFUL 4MN0A 1M46A 4PE0A 5PALA 3TS5B 3VROA 1SBJA 2ZFDA 4MEWA 1CDNA 2L51A 4MZJA 3H4SE 2SCPA 2ZNDA 4PDZA 4XJKB 2ISDA 1CLMA 1GJYA 1WY9A 1DT7B 3SG4A 3SG6A 5KSZA 2QACA 1IH0A 2M1UA 4XJKA 1B8LA 2JWWA 3FWCA 1KFXS 1H8BA 2I7AA 2L0PA 2SASA 2LVVA 4PHMA 4GAOA 2M29A 1E8AA 1NPQA 1K95A 3FIAA 1BOCA 2BE4A 1DGVA 1BF5A 1B9AA 2KYCA 1PVAA 1SKTA 3JTDB 4CFQA 4YGDB 4DRWA 1BODA 3TS5C 2GGZA 1TRFA 1BJFA 4PHKA 5D7FA 5HKWA 2P6BB 2KI6C 2LP3A 3LCPC 1SPYA 1ALWA 2WORA 1CM4A 1MUXA 3DVMA 3JVTB 3DF0A 1XFWO 4GGFA 1XYDA 5D69A 2CXJA 1UUSA 1JF0A 1RK9A 1J7RA 1J1DA 1KWOC 1QIVA 1CB1A 1OZSA 2NXQA 3ICBA 4OVNF 4E68A 1CFCA 1QX7A 1CKKA 1A2XA 1OQPA 1QVIY 2M8UA 2R2IA 1TNQA 2D8NA 2LUXA 4GPLB 3IQQA 3BXKA 1BR1B 3TZ1A 4QJ5B 1CFPA 4AOMA 4ZCUA 1NX2A 1UHIA 1QTXA 3D0YA 4AQJA 1RTP1 1CDMA 1CTRA 1JFJA 2F3YA 1J55A 1W7IB 4PCWA 1ZACA 2JNFA 4GBAA 3ZNIA 4ORCB 4PE1A 1KK8B 2JQ6A 1AUIB 1BMOA 1KSOA 3F45A 1XO5A 1S5GZ 5TNCA 4YGAA 3VRRA 1C07A 3HX4A 1YX8A 4MZKA 1L2OC 4YI9A 2JPTA 2PVBA 3E3RA 1YUUA 1FI5A 1C7VA 2CBLA 2JOJA 5JJGA 4CLNA 4WQ3A 4MVFA 1QIWA 3CR5X 1A4PA 2L5XB 4N5XA 1PSBA 1XFYO 2KBIA 1A75A 1EG3A 1NSHA 4F0ZB 3GOFA 1SK6D 1IQ3A 1B4CA 1KQMB 1FW4A 1RECA 1IG5A 1EL4A 2BCAA 1SL9A 3SG5A 1B8RA 3D10A 1L2OB 1DTLA 1AJ4A 1Y6WA 2CNPA 4N1FA 2MA2A 1QLKA 5AEQA 2WCFA 4QJ3B 1TNXA 1SCVA 2NCPA 3GK2A 3BUOB 1TCOB 4CIDA 3NSIA 2MLEC 4NDCA 4D1EA 2CTNA 1WLZA 3VRQA 1ALVA 1DF0A 2M97A 2KNEA 4C0KA 2LE9B 1DVIA 2K0JA 1RROA 3D0YB 1DJIA 4DIRA 4MRXA 1KQMC 3CS1A 1V1FA 1OMRA 1SL7A 1CNPA 1B47A 3EVVA 2LHLA 2LLSA 3K21A 1K9KA 1QLSA 2LV7A 4OR9B 4OV2A 2LNKA 1K94A 1R2UA 1V1GA 2Y5IA 4OKHA 5HYDA 1DF0B 1LINA 3BUNB 1QXPA 2JXCA 1KFXL 3PN7B 2KI4C 2KAVA 2M7NA 1S3PA 1FBVA 5HLOA 1A03A 3BOWB 2LP2A 3EKHA 3PALA 1J1EA 1BR4B 2Q4UA 2RGIA 1ODBA 1GGZA 2M9GA 3CZTX 1R6PA 4PE7A 3AAJA 1IJ5A 3LLEA 2LHIA 2K61A 2Q91A 3ZWHA 1XFVO 3AAKA 2OTGB 1OMDA 3JVTC 3I5GC 1FI6A 3O2PA 2CT9A 2LC5A 1ZFSA 1L7ZA 1K90D 1CDLA 2ZKMX 3NSOA 5BPJA 1KK7Y 2KI4B 1NUBA 4GGNA 3EVRA 3QRXA 1NX3A 3MSEB 2MRDA 2PRUA 5HLVA 1EXRA 1LA3A 4R1EA 4ETOA 2BL0B 3PLFB 1NX1A 1QASA 1XVJA 2L2EA 1CLBA 3SG3A 3O78A 3O4YA 1NP8A 1YVHA 2I2RE 4GFTA 3VGOA 1J7OA 1EG4A 2K7CA 3LL8B 3PATA 2I94A 3TDIA 1DJWA 1XFUO 1F55A 2ZN9A 4M2PA 1RFJA 3OX6A 4FTGA 3EK8A 2LVJA 1EJ3A 5GQQC 4IL1A 1M39A 1TNPA 1KK8C 2F2PA 2BKHB 1DJHA 1M31A 2KHNA 4GUKA 1D1OA 5IBWA 2JTTA 4N1GA 3DD4A 4I5JA 4MBEA 2K7DA 1SL8A 3KO0A 5DKRA 2O60A 1NIWA 5CPVA 2JC2A 5DKNA 3OX5A 5CSNA 1CFDA 1QS7A 4PE4A 2L50A 4FQOA 1BT6A 2KBMA 1BLQA 1S6IA 1YVLA 4YI8A 2LMVA 1LA0A 2PSRA 3GK1A 2E30A 3NSKA 3KF9A 2BE6A 1IJ6A 1SY9A 2OPOA 4DS7A 1TOPA 1SR6B 1YRUB 2M3WA 1EH2A 4YGEB 2PASA 3C1VA 1QV1A 4C0JA 3WHUB 3OHMB 3PFVA 1JFKA 1UP5A 2ZNEA 3OP0A 4I5KA 5K89A 4GNKB 3BUXB 3I5IC 1F71A 3IF7A 1U5IA 3DF0B 3NXAA 3SG2A 1LXFC 2LM5A 2PALA 1XA5A 2LAPA 4C0LA 4JQ0D 1OOJA 2KOTA 2TN4A 1QJTA 1XK4A 5F6TA 1UHHA 1KFUS 1SR6C 3LK0A 3OB1B 1DJYA 2K2FA 2KQYA 1SCMC 2LUCA 3RLZA 2LANA 3KPXA 2WCEA 3WHTB 2HQ8A 2WCBA 5HKYA 1KSMA 4TNCA 1Q80A 4MSPA 1YURA 2AUCA 1SNLA 3TDUA 1BG1A 2LLTA 4PHJA 2DOQA 3I5IB 2IS9A 1RWYA 1K9PA 1B1GA 1LKJA 1J7QA 1Y0VH 1AP4A 2O5GA 1PSRA 1QATA 4PALA 1DJZA 1Y1AA 1TCFA 2K2AA 3EVUA 3WXAA 1PVBA 1NX0A 1CDPA 2KFHA 1A29A 2K7BA 2MJWB 1WRKA 1XK4C 1G4YR 2H2KA 1SMGA 2A4JA 1SYMA 1DJGA 1X02A 1YRTB 2AMIA 5G08A 3CR2A 1IRJA 5AERA 3DVKA 2JT3A 2BL0C 1FF1A 1MXLC 5JOLA 1UWOA 2KGRA 3M0WA 1H4BA 5AXIA 4QJ4B 1S1EA 2L4IA 3TDZA 5I8NA 1PRWA 4MLWA 2COLB 3EKJA 1YX7A 5CSFA 4A4BA 1KWOB 4GGFC 4BY5A 2JT8A 2NZ0A 5I2LA 3HCMA 1CLLA 1SW8A 2G2BA 3I5FC 1YR5A 2F33A 2HPSA 2ZRTA 1KK7Z 3DVJA 1NCZA 4UPGA 3PM8A 2BCBA 2JNXA 2LCPA 2KFFA 3OB2B 2MAZA 4PHNA 2LLUA 4YGBB 2F3ZA 5I2QA 1DMOA 3A4UB 2H61C 1F54A 5CSIA 3AKBA 3A8RA 2MHHA 3CR4X 1OZOA 5ER5A 2Y1MA 4I5LB 3VRNA 2M1KB 4HRHA 2WC8A 2JULA 1OSAA 2M7LA 1YUSA 2HQWA 1G33A 2OTGC 3KHEA 4P5OE 3I5GB 3EK4A 1PULA 2FCDA 1F4QA 5FYXA 2HETA 2GV5A
chains in the Genus database with same CATH superfamily
2B1UA 2JTZA 1TUZA 1PALA 1K2HA 1WRZA 1Y1XA 2WNDA 5AFPA 4YRUA 4NDBA 1RJVA 1YTZC 2NCOA 1NCXA 3B88A 2EC6C 1MXEA 1OE9B 2L4HA 1QX5B 1QX2A 2V53A 1JSAA 4JPZB 5DKQA 1MWNA 1NWDA 1SRAA 2ZN8A 4P2YB 1Y1UA 2M49B 5ER4X 1B7TY 2AAOA 1K9UA 4JWQA 4ICBA 2KSPA 1XFXO 4CPVA 2BBNA 2LVIA 3PN7C 1XFZO 2ZRSA 4MZLA 4XYNA 1J7PA 2E6WA 3SG7A 2Y4QA 3SJSA 1SCMB 1SSEB 1TN4A 2PMYA 1TIZA 3B7AA 3PSRA 4MRYA 1IWQA 5CSJA 3BOWA 1F8HA 1UHNA 2H8VA 1A75B 3I5HC 1B8CA 1ZMZA 1GGWA 1K96A 1S26D 2BAPA 2JPOA 3DY9A 3EK7A 2BCXA 2LMUA 2WCJA 3NSLA 1MF8B 4HSZA 4NDDA 1JWDA 1TNWA 1S36A 1G8IA 2H61A 2BECA 3VB1A 3CWGA 1AJ5A 3DZTA 4DCKA 2NLNA 3FS7A 2KFGA 1S6JA 1CM1A 2OS8B 2CCMA 2L2CA 1JUOA 3S0GA 2GGMA 4HRGA 4ORAB 1OMVA 3OBVA 2F2OA 1N0YA 3I5HB 5FI2A 3NGVA 2JXLA 5KTYA 3CLNA 4WRIA 1IKUA 4DUQA 1S5GY 1KQVA 1N2DA 4PT1A 4Q04A 4YBHB 2M0RA 1VRKA 5AANA 2FCEA 2LMTA 3S0EA 2KQ6A 1UHJA 1M63B 2JT0A 1DGUA 2OS8C 4I5NB 1W7JB 1WRLA 2KI6D 4IJ7A 3CGAA 5KU1A 4AQIA 1AHRA 4CFRA 1DJXA 1NYAA 2EGDA 1F70A 2BBMA 2KGBC 2KAYA 4HREE 4L9MA 1MHOA 2MBXA 2KDHA 3LK1A 2Y1NA 1YUTA 2LVKA 1PK0D 4BY4A 2BKIB 5J3XA 1CFFA 2F8PA 1B7TZ 4M2OA 1DQEA 2FJUB 3I5FB 3O6BA 3CZ2A 1CMGA 1IIOA 1OW4A 3IQOA 1GQMA 4A4CA 1JBAA 1QVIZ 1MR8A 2EHBA 4ORBB 4YGCB 2KAXA 1C7WA 1JF2A 1U5IB 3BUWB 4WQ2A 3K1EA 1KCYA 3TUYC 2PYQA 2I18A 1WDCB 2WOSA 3SIAA 1JC2A 3SIBA 1TTXA 3VRPA 2VRGA 2KPHA 1IGVA 1FPWA 1ZOTB 2FOTA 2QPTA 1LS8A 2G9BA 2K8MB 3BUMB 3AKAA 1M45A 3RM1A 1AK8A 3BQ3A 1BU3A 1GM0A 2K7OA 3TUYB 2EC6B 3B87A 1IQ5A 1WDCC 2WC5A 1WLMA 2HF5A 1HT9A 3WNXB 1F4OA 2JU0A 4M2QA 2MLFC 1C3YA 2KYFA 3DVEA 5HKZA 1NCYA 4OCIA 3S0DA 1K8UA 3FWBA 3CZ1A 2JZIA 1LVCD 3N7HA 3SS5A 1ZUZA 5I2OA 1MQ1A 5B8IB 1UURA 1CMFA 1AVSA 1UHKA 1ORGA 3Q8IA 1QV0A 4U8DA 3GK4X 1N65A 3KEVA 3CABA 3JTDC 3CTNA 2L98A 2BNXA 4USLA 1K93D 4NQGA 1HQVA 4ZCVA 2JRFA 3BYAA 1S6CA 1KFUL 4MN0A 1M46A 4PE0A 5PALA 3TS5B 3UNWA 1SBJA 2ZFDA 4MEWA 1CDNA 2L51A 4MZJA 3H4SE 2SCPA 2ZNDA 3OGNA 4PDZA 4XJKB 2ISDA 1CLMA 1GJYA 1WY9A 3D73A 1DT7B 3SG4A 3SG6A 5KSZA 2QACA 1IH0A 2M1UA 4XJKA 1B8LA 2JWWA 3BFHA 1KFXS 3FWCA 1H8BA 2I7AA 2L0PA 2SASA 2LVVA 4PHMA 4GAOA 2M29A 1E8AA 1NPQA 1K95A 3FIAA 2QEBA 2BE4A 1DGVA 1BF5A 1BOCA 1B9AA 3S0AA 2KYCA 1PVAA 1SKTA 3JTDB 4CFQA 4YGDB 4DRWA 1BODA 3TS5C 2GGZA 1TRFA 1BJFA 4PHKA 5D7FA 5HKWA 2P6BB 2KI6C 2LP3A 3CZ0A 3LCPC 1SPYA 1ALWA 2WORA 1CM4A 1MUXA 3DVMA 3JVTB 3DF0A 1XFWO 4GGFA 1XYDA 5D69A 3S0BA 2CXJA 1UUSA 1JF0A 1RK9A 2KLEA 1J7RA 2K60A 1J1DA 1KWOC 1QIVA 1CB1A 1OZSA 2NXQA 3ICBA 4OVNF 4E68A 1CFCA 3BFBA 5FI6A 1QX7A 3VROA 3NHIA 1CKKA 1A2XA 1OQPA 1QVIY 2M8UA 2R2IA 1TNQA 2D8NA 2LUXA 5EL2A 3CYZA 4GPLB 3IQQA 3BXKA 2P70A 1BR1B 3TZ1A 4QJ5B 1CFPA 4AOMA 4ZCUA 1NX2A 1UHIA 1QTXA 3D0YA 4AQJA 1RTP1 1CDMA 1CTRA 1C3ZA 1JFJA 2F3YA 1J55A 1W7IB 4PCWA 4JD9A 1ZACA 2JNFA 4F7FA 4INXA 3DXLA 4GBAA 3ZNIA 4ORCB 4PE1A 1KK8B 2JQ6A 3EG5B 1AUIB 1BMOA 1KSOA 3F45A 1XO5A 1S5GZ 5TNCA 4YGAA 3VRRA 4KYNA 1C07A 3HX4A 1YX8A 4MZKA 1L2OC 4YI9A 2JPTA 2PVBA 3E3RA 1TUJA 1YUUA 1FI5A 1C7VA 1OOFA 2CBLA 4FQTA 2JOJA 5JJGA 4CLNA 4WQ3A 4MVFA 1QIWA 3CR5X 1A4PA 2L5YA 2L5XB 4N5XA 1PSBA 1XFYO 1DELA 2KBIA 1A75A 1EG3A 1NSHA 4F0ZB 3GOFA 1SK6D 1IQ3A 1B4CA 1KQMB 1FW4A 1RECA 1IG5A 1EL4A 2BCAA 1SL9A 3SG5A 1B8RA 3D10A 1L2OB 1DTLA 1AJ4A 1Y6WA 2CNPA 3D76A 4N1FA 2MA2A 1QLKA 5AEQA 2WCFA 4QJ3B 1TNXA 1SCVA 2NCPA 3GK2A 3BUOB 1TCOB 4CIDA 3NSIA 2MLEC 4NDCA 1Z4HA 4OZDA 4D1EA 2CTNA 1WLZA 3VRQA 1ALVA 1DF0A 2M97A 2KNEA 4C0KA 2LE9B 1DVIA 2K0JA 1RROA 3D0YB 1DJIA 4DIRA 2QDIA 1KQMC 3CS1A 4MRXA 3RZSA 1V1FA 1OMRA 1SL7A 1CNPA 1B47A 3EVVA 2LHLA 2LLSA 3K21A 1K9KA 1QLSA 2LV7A 4OR9B 4OV2A 2LNKA 1K94A 1R2UA 1V1GA 2WCHA 2Y5IA 4OKHA 3FE9A 5HYDA 1DF0B 1LINA 3BUNB 1QXPA 2JXCA 1KFXL 3PN7B 2KI4C 2KAVA 2M7NA 3PJIA 1S3PA 1FBVA 2GTEA 5HLOA 1A03A 3BOWB 2LP2A 3EKHA 3PALA 1J1EA 1BR4B 2Q4UA 2RGIA 1ODBA 1GGZA 2M9GA 3CZTX 1R6PA 4PE7A 5I94A 3AAJA 1IJ5A 3LLEA 2LHIA 2K61A 2Q91A 3ZWHA 1XFVO 3AAKA 2OTGB 1OMDA 3BFAA 3JVTC 3I5GC 1FI6A 3O2PA 2WCKA 2CT9A 3L4AA 3D77A 2LC5A 3D74A 1ZFSA 1L7ZA 1K90D 1CDLA 2ZKMX 3NSOA 2FJYA 1KK7Y 2KI4B 5BPJA 1NUBA 1XFRA 4GGNA 3EVRA 2WC6A 3QRXA 1NX3A 3MSEB 2MRDA 2PRUA 5D3OA 5HLVA 1EXRA 1LA3A 2WCLA 4R1EA 4ETOA 2BL0B 3FE6A 3PLFB 1NX1A 1QASA 1XVJA 2L2EA 1CLBA 3SG3A 3O78A 3O4YA 1NP8A 1YVHA 2I2RE 2P71A 4GFTA 3VGOA 3UO9A 1J7OA 1EG4A 2K7CA 3LL8B 3L47A 2I94A 3PATA 3BJHA 1DJWA 3TDIA 1XFUO 1F55A 2ZN9A 4M2PA 1RFJA 3OX6A 4FTGA 3EK8A 2LVJA 3S0FA 1EJ3A 2YGUA 5GQQC 4IL1A 1M39A 1TNPA 1KK8C 2F2PA 2BKHB 1DJHA 1M31A 2KHNA 4GUKA 1D1OA 5IBWA 2JTTA 3R1OA 1QWVA 4N1GA 3DD4A 4I5JA 4MBEA 2K7DA 1SL8A 3KO0A 5DKRA 2O60A 3CDNA 1DC1A 1NIWA 5CPVA 2JC2A 2WCMA 5DKNA 3OX5A 5CSNA 1CFDA 1QS7A 4PE4A 2L50A 4FQOA 1BT6A 2KBMA 4JKTA 1BLQA 1S6IA 1YVLA 4YI8A 2LMVA 1LA0A 2PSRA 3GK1A 2E30A 3NSKA 3KF9A 2BE6A 1IJ6A 1SY9A 2OPOA 4DS7A 1TOPA 1SR6B 1YRUB 2M3WA 3SS3A 1EH2A 4YGEB 1T14A 3R1VA 2PASA 3IVTA 3C1VA 1Z2CB 1QV1A 4C0JA 3WHUB 3OHMB 3PFVA 1JFKA 1UP5A 2ZNEA 3OP0A 4I5KA 5K89A 4GNKB 3BUXB 3I5IC 1F71A 3IF7A 1U5IA 3DF0B 3NXAA 3NHTA 3SG2A 1LXFC 2LM5A 2PALA 1XA5A 2LAPA 4C0LA 4JQ0D 1OOJA 2KLDA 2KOTA 2TN4A 1QJTA 1XK4A 5F6TA 1UHHA 1KFUS 3PM2A 1SR6C 3LK0A 3OB1B 1DJYA 2K2FA 2KQYA 1SCMC 2LUCA 3RLZA 2LANA 3KPXA 3R1PA 2WCEA 3WHTB 2HQ8A 2WCBA 5HKYA 1KSMA 4TNCA 1Q80A 3DYEA 4MSPA 1YURA 2AUCA 1SNLA 3TDUA 1BG1A 3D75A 2LLTA 4PHJA 1TWOA 2DOQA 3I5IB 1OOHA 2IS9A 1RWYA 1K9PA 1B1GA 1LKJA 1J7QA 3FE8A 1Y0VH 3QMEA 1AP4A 2O5GA 1PSRA 1QATA 4PALA 1DJZA 1Y1AA 1TCFA 2K2AA 3EVUA 3WXAA 1PVBA 1NX0A 1CDPA 1W9ZA 1P28A 1DEKA 2KFHA 1A29A 2K7BA 2MJWB 1WRKA 1XK4C 1G4YR 2H2KA 3L4LA 2QEHA 1SMGA 2A4JA 1SYMA 1DJGA 1X02A 1YRTB 2AMIA 5G08A 5HL1A 3CR2A 1OOIX 3B86A 1IRJA 5AERA 3DVKA 2JT3A 2BL0C 1FF1A 1MXLC 5JOLA 1UWOA 2KGRA 3O4XA 3M0WA 1H4BA 5AXIA 4QJ4B 1S1EA 2L4IA 4INWA 3TDZA 5I8NA 1PRWA 4MLWA 2COLB 3EKJA 1YX7A 5CSFA 4A4BA 1KWOB 4GGFC 4BY5A 2ERBA 2JT8A 2NZ0A 5I2LA 3HCMA 1CLLA 1SW8A 2G2BA 3I5FC 1YR5A 2F33A 2HPSA 2ZRTA 5FI7A 1KK7Z 3DVJA 1NCZA 4UPGA 3PM8A 3V2LA 2BCBA 2JNXA 3D78A 2LCPA 2KFFA 3OB2B 2MAZA 4PHNA 2LLUA 4YGBB 2F3ZA 5I2QA 1DMOA 3A4UB 2H61C 1F54A 5CSIA 2PQLA 3A8RA 2MHHA 3AKBA 1OZOA 3B6XA 3CR4X 1OOGA 2Y1MA 4I5LB 5ER5A 3SS4A 3VRNA 2M1KB 4HRHA 2QEOA 2JULA 2WC8A 1OSAA 2M7LA 1YUSA 2QEVA 5DICA 2HQWA 1G33A 2OTGC 3R72A 3KHEA 4P5OE 3I5GB 3EK4A 1PULA 2FCDA 1F4QA 5FYXA 2HETA 2GV5A
chains in the Genus database with same CATH topology
2B1UA 2JTZA 1PALA 1K2HA 1WRZA 1Y1XA 2WNDA 5AFPA 4YRUA 4NDBA 1RJVA 1YTZC 2NCOA 1NCXA 2EC6C 1MXEA 1OE9B 2L4HA 1QX5B 1QX2A 2V53A 1JSAA 4JPZB 5DKQA 1MWNA 1NWDA 1SRAA 2ZN8A 4P2YB 1Y1UA 2M49B 5ER4X 1B7TY 2AAOA 1K9UA 4JWQA 4ICBA 2KSPA 1XFXO 4CPVA 2BBNA 2LVIA 3PN7C 1XFZO 2ZRSA 4MZLA 4XYNA 1J7PA 2E6WA 3SG7A 2Y4QA 3SJSA 1SCMB 1TN4A 1F8HA 2PMYA 1TIZA 3PSRA 4MRYA 1IWQA 5CSJA 3BOWA 1UHNA 1A75B 3I5HC 1B8CA 1ZMZA 1GGWA 1K96A 1S26D 4HSZA 3EK7A 3NSLA 2BCXA 2LMUA 1MF8B 4NDDA 1JWDA 1TNWA 1S36A 1G8IA 2H61A 2BECA 3CWGA 1AJ5A 4DCKA 2NLNA 3FS7A 2KFGA 1S6JA 1CM1A 2OS8B 2CCMA 1JUOA 2GGMA 4HRGA 4ORAB 1OMVA 2F2OA 1N0YA 3I5HB 2JXLA 5KTYA 3CLNA 4WRIA 1IKUA 4DUQA 1S5GY 1KQVA 1N2DA 4Q04A 4YBHB 2M0RA 1VRKA 5AANA 2FCEA 2LMTA 2KQ6A 1UHJA 1M63B 2JT0A 1DGUA 2OS8C 4I5NB 1W7JB 1WRLA 2KI6D 3CGAA 5KU1A 4AQIA 1AHRA 4CFRA 1DJXA 1NYAA 2EGDA 1F70A 2BBMA 2KGBC 2KAYA 4HREE 4L9MA 1MHOA 2MBXA 2KDHA 3LK1A 2Y1NA 1YUTA 2LVKA 1PK0D 4BY4A 2BKIB 5J3XA 1CFFA 2F8PA 1B7TZ 4M2OA 3I5FB 2FJUB 1CMGA 3O6BA 3IQOA 1JBAA 1GQMA 4A4CA 1QVIZ 1MR8A 2EHBA 4ORBB 4YGCB 2KAXA 1C7WA 1JF2A 1U5IB 3BUWB 4WQ2A 1KCYA 3TUYC 3SIAA 2I18A 1WDCB 2WOSA 1JC2A 3SIBA 1TTXA 3VRPA 2VRGA 1FPWA 1IGVA 1ZOTB 2FOTA 2QPTA 2G9BA 2K8MB 3BUMB 3AKAA 1M45A 3RM1A 1AK8A 3BQ3A 1BU3A 2K7OA 3TUYB 2EC6B 1IQ5A 1WDCC 1WLMA 2HF5A 1HT9A 3WNXB 1F4OA 2JU0A 4M2QA 2MLFC 2KYFA 3DVEA 5HKZA 1NCYA 4OCIA 1K8UA 3FWBA 2JZIA 1LVCD 1ZUZA 5I2OA 1MQ1A 5B8IB 1UURA 1CMFA 1AVSA 1UHKA 1QV0A 4U8DA 3GK4X 1N65A 3KEVA 3JTDC 3CTNA 2L98A 4USLA 1K93D 4NQGA 1HQVA 4ZCVA 2JRFA 3BYAA 1S6CA 1KFUL 4MN0A 1M46A 4PE0A 5PALA 3TS5B 3VROA 1SBJA 2ZFDA 4MEWA 1CDNA 2L51A 4MZJA 3H4SE 2SCPA 2ZNDA 4PDZA 4XJKB 2ISDA 1CLMA 1GJYA 1WY9A 1DT7B 3SG4A 3SG6A 5KSZA 2QACA 1IH0A 2M1UA 4XJKA 1B8LA 2JWWA 3FWCA 1KFXS 1H8BA 2I7AA 2L0PA 2SASA 2LVVA 4PHMA 4GAOA 2M29A 1E8AA 1NPQA 1K95A 3FIAA 1BOCA 2BE4A 1DGVA 1BF5A 1B9AA 2KYCA 1PVAA 1SKTA 3JTDB 4CFQA 4YGDB 4DRWA 1BODA 3TS5C 2GGZA 1TRFA 1BJFA 4PHKA 5D7FA 5HKWA 2P6BB 2KI6C 2LP3A 3LCPC 1SPYA 1ALWA 2WORA 1CM4A 1MUXA 3DVMA 3JVTB 3DF0A 1XFWO 4GGFA 1XYDA 5D69A 2CXJA 1UUSA 1JF0A 1RK9A 1J7RA 1J1DA 1KWOC 1QIVA 1CB1A 1OZSA 2NXQA 3ICBA 4OVNF 4E68A 1CFCA 1QX7A 1CKKA 1A2XA 1OQPA 1QVIY 2M8UA 2R2IA 1TNQA 2D8NA 2LUXA 4GPLB 3IQQA 3BXKA 1BR1B 3TZ1A 4QJ5B 1CFPA 4AOMA 4ZCUA 1NX2A 1UHIA 1QTXA 3D0YA 4AQJA 1RTP1 1CDMA 1CTRA 1JFJA 2F3YA 1J55A 1W7IB 4PCWA 1ZACA 2JNFA 4GBAA 3ZNIA 4ORCB 4PE1A 1KK8B 2JQ6A 1AUIB 1BMOA 1KSOA 3F45A 1XO5A 1S5GZ 5TNCA 4YGAA 3VRRA 1C07A 3HX4A 1YX8A 4MZKA 1L2OC 4YI9A 2JPTA 2PVBA 3E3RA 1YUUA 1FI5A 1C7VA 2CBLA 2JOJA 5JJGA 4CLNA 4WQ3A 4MVFA 1QIWA 3CR5X 1A4PA 2L5XB 4N5XA 1PSBA 1XFYO 2KBIA 1A75A 1EG3A 1NSHA 4F0ZB 3GOFA 1SK6D 1IQ3A 1B4CA 1KQMB 1FW4A 1RECA 1IG5A 1EL4A 2BCAA 1SL9A 3SG5A 1B8RA 3D10A 1L2OB 1DTLA 1AJ4A 1Y6WA 2CNPA 4N1FA 2MA2A 1QLKA 5AEQA 2WCFA 4QJ3B 1TNXA 1SCVA 2NCPA 3GK2A 3BUOB 1TCOB 4CIDA 3NSIA 2MLEC 4NDCA 4D1EA 2CTNA 1WLZA 3VRQA 1ALVA 1DF0A 2M97A 2KNEA 4C0KA 2LE9B 1DVIA 2K0JA 1RROA 3D0YB 1DJIA 4DIRA 4MRXA 1KQMC 3CS1A 1V1FA 1OMRA 1SL7A 1CNPA 1B47A 3EVVA 2LHLA 2LLSA 3K21A 1K9KA 1QLSA 2LV7A 4OR9B 4OV2A 2LNKA 1K94A 1R2UA 1V1GA 2Y5IA 4OKHA 5HYDA 1DF0B 1LINA 3BUNB 1QXPA 2JXCA 1KFXL 3PN7B 2KI4C 2KAVA 2M7NA 1S3PA 1FBVA 5HLOA 1A03A 3BOWB 2LP2A 3EKHA 3PALA 1J1EA 1BR4B 2Q4UA 2RGIA 1ODBA 1GGZA 2M9GA 3CZTX 1R6PA 4PE7A 3AAJA 1IJ5A 3LLEA 2LHIA 2K61A 2Q91A 3ZWHA 1XFVO 3AAKA 2OTGB 1OMDA 3JVTC 3I5GC 1FI6A 3O2PA 2CT9A 2LC5A 1ZFSA 1L7ZA 1K90D 1CDLA 2ZKMX 3NSOA 5BPJA 1KK7Y 2KI4B 1NUBA 4GGNA 3EVRA 3QRXA 1NX3A 3MSEB 2MRDA 2PRUA 5HLVA 1EXRA 1LA3A 4R1EA 4ETOA 2BL0B 3PLFB 1NX1A 1QASA 1XVJA 2L2EA 1CLBA 3SG3A 3O78A 3O4YA 1NP8A 1YVHA 2I2RE 4GFTA 3VGOA 1J7OA 1EG4A 2K7CA 3LL8B 3PATA 2I94A 3TDIA 1DJWA 1XFUO 1F55A 2ZN9A 4M2PA 1RFJA 3OX6A 4FTGA 3EK8A 2LVJA 1EJ3A 5GQQC 4IL1A 1M39A 1TNPA 1KK8C 2F2PA 2BKHB 1DJHA 1M31A 2KHNA 4GUKA 1D1OA 5IBWA 2JTTA 4N1GA 3DD4A 4I5JA 4MBEA 2K7DA 1SL8A 3KO0A 5DKRA 2O60A 1NIWA 5CPVA 2JC2A 5DKNA 3OX5A 5CSNA 1CFDA 1QS7A 4PE4A 2L50A 4FQOA 1BT6A 2KBMA 1BLQA 1S6IA 1YVLA 4YI8A 2LMVA 1LA0A 2PSRA 3GK1A 2E30A 3NSKA 3KF9A 2BE6A 1IJ6A 1SY9A 2OPOA 4DS7A 1TOPA 1SR6B 1YRUB 2M3WA 1EH2A 4YGEB 2PASA 3C1VA 1QV1A 4C0JA 3WHUB 3OHMB 3PFVA 1JFKA 1UP5A 2ZNEA 3OP0A 4I5KA 5K89A 4GNKB 3BUXB 3I5IC 1F71A 3IF7A 1U5IA 3DF0B 3NXAA 3SG2A 1LXFC 2LM5A 2PALA 1XA5A 2LAPA 4C0LA 4JQ0D 1OOJA 2KOTA 2TN4A 1QJTA 1XK4A 5F6TA 1UHHA 1KFUS 1SR6C 3LK0A 3OB1B 1DJYA 2K2FA 2KQYA 1SCMC 2LUCA 3RLZA 2LANA 3KPXA 2WCEA 3WHTB 2HQ8A 2WCBA 5HKYA 1KSMA 4TNCA 1Q80A 4MSPA 1YURA 2AUCA 1SNLA 3TDUA 1BG1A 2LLTA 4PHJA 2DOQA 3I5IB 2IS9A 1RWYA 1K9PA 1B1GA 1LKJA 1J7QA 1Y0VH 1AP4A 2O5GA 1PSRA 1QATA 4PALA 1DJZA 1Y1AA 1TCFA 2K2AA 3EVUA 3WXAA 1PVBA 1NX0A 1CDPA 2KFHA 1A29A 2K7BA 2MJWB 1WRKA 1XK4C 1G4YR 2H2KA 1SMGA 2A4JA 1SYMA 1DJGA 1X02A 1YRTB 2AMIA 5G08A 3CR2A 1IRJA 5AERA 3DVKA 2JT3A 2BL0C 1FF1A 1MXLC 5JOLA 1UWOA 2KGRA 3M0WA 1H4BA 5AXIA 4QJ4B 1S1EA 2L4IA 3TDZA 5I8NA 1PRWA 4MLWA 2COLB 3EKJA 1YX7A 5CSFA 4A4BA 1KWOB 4GGFC 4BY5A 2JT8A 2NZ0A 5I2LA 3HCMA 1CLLA 1SW8A 2G2BA 3I5FC 1YR5A 2F33A 2HPSA 2ZRTA 1KK7Z 3DVJA 1NCZA 4UPGA 3PM8A 2BCBA 2JNXA 2LCPA 2KFFA 3OB2B 2MAZA 4PHNA 2LLUA 4YGBB 2F3ZA 5I2QA 1DMOA 3A4UB 2H61C 1F54A 5CSIA 3AKBA 3A8RA 2MHHA 3CR4X 1OZOA 5ER5A 2Y1MA 4I5LB 3VRNA 2M1KB 4HRHA 2WC8A 2JULA 1OSAA 2M7LA 1YUSA 2HQWA 1G33A 2OTGC 3KHEA 4P5OE 3I5GB 3EK4A 1PULA 2FCDA 1F4QA 5FYXA 2HETA 2GV5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B1U A;  2JTZ A;  1PAL A;  1K2H A;  1WRZ A;  1Y1X A;  2WND A;  5AFP A;  4YRU A;  4NDB A;  1RJV A;  1YTZ C;  2NCO A;  1NCX A;  2EC6 C;  1MXE A;  1OE9 B;  2L4H A;  1QX5 B;  1QX2 A;  2V53 A;  1JSA A;  4JPZ B;  5DKQ A;  1MWN A;  1NWD A;  1SRA A;  2ZN8 A;  4P2Y B;  1Y1U A;  2M49 B;  5ER4 X;  1B7T Y;  2AAO A;  1K9U A;  4JWQ A;  4ICB A;  2KSP A;  1XFX O;  4CPV A;  2BBN A;  2LVI A;  3PN7 C;  1XFZ O;  2ZRS A;  4MZL A;  4XYN A;  1J7P A;  2E6W A;  3SG7 A;  2Y4Q A;  3SJS A;  1SCM B;  1TN4 A;  1F8H A;  2PMY A;  1TIZ A;  3PSR A;  4MRY A;  1IWQ A;  5CSJ A;  3BOW A;  1UHN A;  1A75 B;  3I5H C;  1B8C A;  1ZMZ A;  1GGW A;  1K96 A;  1S26 D;  4HSZ A;  3EK7 A;  3NSL A;  2BCX A;  2LMU A;  1MF8 B;  4NDD A;  1JWD A;  1TNW A;  1S36 A;  1G8I A;  2H61 A;  2BEC A;  3CWG A;  1AJ5 A;  4DCK A;  2NLN A;  3FS7 A;  2KFG A;  1S6J A;  1CM1 A;  2OS8 B;  2CCM A;  1JUO A;  2GGM A;  4HRG A;  4ORA B;  1OMV A;  2F2O A;  1N0Y A;  3I5H B;  2JXL A;  5KTY A;  3CLN A;  4WRI A;  1IKU A;  4DUQ A;  1S5G Y;  1KQV A;  1N2D A;  4Q04 A;  4YBH B;  2M0R A;  1VRK A;  5AAN A;  2FCE A;  2LMT A;  2KQ6 A;  1UHJ A;  1M63 B;  2JT0 A;  1DGU A;  2OS8 C;  4I5N B;  1W7J B;  1WRL A;  2KI6 D;  3CGA A;  5KU1 A;  4AQI A;  1AHR A;  4CFR A;  1DJX A;  1NYA A;  2EGD A;  1F70 A;  2BBM A;  2KGB C;  2KAY A;  4HRE E;  4L9M A;  1MHO A;  2MBX A;  2KDH A;  3LK1 A;  2Y1N A;  1YUT A;  2LVK A;  1PK0 D;  4BY4 A;  2BKI B;  5J3X A;  1CFF A;  2F8P A;  1B7T Z;  4M2O A;  3I5F B;  2FJU B;  1CMG A;  3O6B A;  3IQO A;  1JBA A;  1GQM A;  4A4C A;  1QVI Z;  1MR8 A;  2EHB A;  4ORB B;  4YGC B;  2KAX A;  1C7W A;  1JF2 A;  1U5I B;  3BUW B;  4WQ2 A;  1KCY A;  3TUY C;  3SIA A;  2I18 A;  1WDC B;  2WOS A;  1JC2 A;  3SIB A;  1TTX A;  3VRP A;  2VRG A;  1FPW A;  1IGV A;  1ZOT B;  2FOT A;  2QPT A;  2G9B A;  2K8M B;  3BUM B;  3AKA A;  1M45 A;  3RM1 A;  1AK8 A;  3BQ3 A;  1BU3 A;  2K7O A;  3TUY B;  2EC6 B;  1IQ5 A;  1WDC C;  1WLM A;  2HF5 A;  1HT9 A;  3WNX B;  1F4O A;  2JU0 A;  4M2Q A;  2MLF C;  2KYF A;  3DVE A;  5HKZ A;  1NCY A;  4OCI A;  1K8U A;  3FWB A;  2JZI A;  1LVC D;  1ZUZ A;  5I2O A;  1MQ1 A;  5B8I B;  1UUR A;  1CMF A;  1AVS A;  1UHK A;  1QV0 A;  4U8D A;  3GK4 X;  1N65 A;  3KEV A;  3JTD C;  3CTN A;  2L98 A;  4USL A;  1K93 D;  4NQG A;  1HQV A;  4ZCV A;  2JRF A;  3BYA A;  1S6C A;  1KFU L;  4MN0 A;  1M46 A;  4PE0 A;  5PAL A;  3TS5 B;  3VRO A;  1SBJ A;  2ZFD A;  4MEW A;  1CDN A;  2L51 A;  4MZJ A;  3H4S E;  2SCP A;  2ZND A;  4PDZ A;  4XJK B;  2ISD A;  1CLM A;  1GJY A;  1WY9 A;  1DT7 B;  3SG4 A;  3SG6 A;  5KSZ A;  2QAC A;  1IH0 A;  2M1U A;  4XJK A;  1B8L A;  2JWW A;  3FWC A;  1KFX S;  1H8B A;  2I7A A;  2L0P A;  2SAS A;  2LVV A;  4PHM A;  4GAO A;  2M29 A;  1E8A A;  1NPQ A;  1K95 A;  3FIA A;  1BOC A;  2BE4 A;  1DGV A;  1BF5 A;  1B9A A;  2KYC A;  1PVA A;  1SKT A;  3JTD B;  4CFQ A;  4YGD B;  4DRW A;  1BOD A;  3TS5 C;  2GGZ A;  1TRF A;  1BJF A;  4PHK A;  5D7F A;  5HKW A;  2P6B B;  2KI6 C;  2LP3 A;  3LCP C;  1SPY A;  1ALW A;  2WOR A;  1CM4 A;  1MUX A;  3DVM A;  3JVT B;  3DF0 A;  1XFW O;  4GGF A;  1XYD A;  5D69 A;  2CXJ A;  1UUS A;  1JF0 A;  1RK9 A;  1J7R A;  1J1D A;  1KWO C;  1QIV A;  1CB1 A;  1OZS A;  2NXQ A;  3ICB A;  4OVN F;  4E68 A;  1CFC A;  1QX7 A;  1CKK A;  1A2X A;  1OQP A;  1QVI Y;  2M8U A;  2R2I A;  1TNQ A;  2D8N A;  2LUX A;  4GPL B;  3IQQ A;  3BXK A;  1BR1 B;  3TZ1 A;  4QJ5 B;  1CFP A;  4AOM A;  4ZCU A;  1NX2 A;  1UHI A;  1QTX A;  3D0Y A;  4AQJ A;  1RTP 1;  1CDM A;  1CTR A;  1JFJ A;  2F3Y A;  1J55 A;  1W7I B;  4PCW A;  1ZAC A;  2JNF A;  4GBA A;  3ZNI A;  4ORC B;  4PE1 A;  1KK8 B;  2JQ6 A;  1AUI B;  1BMO A;  1KSO A;  3F45 A;  1XO5 A;  1S5G Z;  5TNC A;  4YGA A;  3VRR A;  1C07 A;  3HX4 A;  1YX8 A;  4MZK A;  1L2O C;  4YI9 A;  2JPT A;  2PVB A;  3E3R A;  1YUU A;  1FI5 A;  1C7V A;  2CBL A;  2JOJ A;  5JJG A;  4CLN A;  4WQ3 A;  4MVF A;  1QIW A;  3CR5 X;  1A4P A;  2L5X B;  4N5X A;  1PSB A;  1XFY O;  2KBI A;  1A75 A;  1EG3 A;  1NSH A;  4F0Z B;  3GOF A;  1SK6 D;  1IQ3 A;  1B4C A;  1KQM B;  1FW4 A;  1REC A;  1IG5 A;  1EL4 A;  2BCA A;  1SL9 A;  3SG5 A;  1B8R A;  3D10 A;  1L2O B;  1DTL A;  1AJ4 A;  1Y6W A;  2CNP A;  4N1F A;  2MA2 A;  1QLK A;  5AEQ A;  2WCF A;  4QJ3 B;  1TNX A;  1SCV A;  2NCP A;  3GK2 A;  3BUO B;  1TCO B;  4CID A;  3NSI A;  2MLE C;  4NDC A;  4D1E A;  2CTN A;  1WLZ A;  3VRQ A;  1ALV A;  1DF0 A;  2M97 A;  2KNE A;  4C0K A;  2LE9 B;  1DVI A;  2K0J A;  1RRO A;  3D0Y B;  1DJI A;  4DIR A;  4MRX A;  1KQM C;  3CS1 A;  1V1F A;  1OMR A;  1SL7 A;  1CNP A;  1B47 A;  3EVV A;  2LHL A;  2LLS A;  3K21 A;  1K9K A;  1QLS A;  2LV7 A;  4OR9 B;  4OV2 A;  2LNK A;  1K94 A;  1R2U A;  1V1G A;  2Y5I A;  4OKH A;  5HYD A;  1DF0 B;  1LIN A;  3BUN B;  1QXP A;  2JXC A;  1KFX L;  3PN7 B;  2KI4 C;  2KAV A;  2M7N A;  1S3P A;  1FBV A;  5HLO A;  1A03 A;  3BOW B;  2LP2 A;  3EKH A;  3PAL A;  1J1E A;  1BR4 B;  2Q4U A;  2RGI A;  1ODB A;  1GGZ A;  2M9G A;  3CZT X;  1R6P A;  4PE7 A;  3AAJ A;  1IJ5 A;  3LLE A;  2LHI A;  2K61 A;  2Q91 A;  3ZWH A;  1XFV O;  3AAK A;  2OTG B;  1OMD A;  3JVT C;  3I5G C;  1FI6 A;  3O2P A;  2CT9 A;  2LC5 A;  1ZFS A;  1L7Z A;  1K90 D;  1CDL A;  2ZKM X;  3NSO A;  5BPJ A;  1KK7 Y;  2KI4 B;  1NUB A;  4GGN A;  3EVR A;  3QRX A;  1NX3 A;  3MSE B;  2MRD A;  2PRU A;  5HLV A;  1EXR A;  1LA3 A;  4R1E A;  4ETO A;  2BL0 B;  3PLF B;  1NX1 A;  1QAS A;  1XVJ A;  2L2E A;  1CLB A;  3SG3 A;  3O78 A;  3O4Y A;  1NP8 A;  1YVH A;  2I2R E;  4GFT A;  3VGO A;  1J7O A;  1EG4 A;  2K7C A;  3LL8 B;  3PAT A;  2I94 A;  3TDI A;  1DJW A;  1XFU O;  1F55 A;  2ZN9 A;  4M2P A;  1RFJ A;  3OX6 A;  4FTG A;  3EK8 A;  2LVJ A;  1EJ3 A;  5GQQ C;  4IL1 A;  1M39 A;  1TNP A;  1KK8 C;  2F2P A;  2BKH B;  1DJH A;  1M31 A;  2KHN A;  4GUK A;  1D1O A;  5IBW A;  2JTT A;  4N1G A;  3DD4 A;  4I5J A;  4MBE A;  2K7D A;  1SL8 A;  3KO0 A;  5DKR A;  2O60 A;  1NIW A;  5CPV A;  2JC2 A;  5DKN A;  3OX5 A;  5CSN A;  1CFD A;  1QS7 A;  4PE4 A;  2L50 A;  4FQO A;  1BT6 A;  2KBM A;  1BLQ A;  1S6I A;  1YVL A;  4YI8 A;  2LMV A;  1LA0 A;  2PSR A;  3GK1 A;  2E30 A;  3NSK A;  3KF9 A;  2BE6 A;  1IJ6 A;  1SY9 A;  2OPO A;  4DS7 A;  1TOP A;  1SR6 B;  1YRU B;  2M3W A;  1EH2 A;  4YGE B;  2PAS A;  3C1V A;  1QV1 A;  4C0J A;  3WHU B;  3OHM B;  3PFV A;  1JFK A;  1UP5 A;  2ZNE A;  3OP0 A;  4I5K A;  5K89 A;  4GNK B;  3BUX B;  3I5I C;  1F71 A;  3IF7 A;  1U5I A;  3DF0 B;  3NXA A;  3SG2 A;  1LXF C;  2LM5 A;  2PAL A;  1XA5 A;  2LAP A;  4C0L A;  4JQ0 D;  1OOJ A;  2KOT A;  2TN4 A;  1QJT A;  1XK4 A;  5F6T A;  1UHH A;  1KFU S;  1SR6 C;  3LK0 A;  3OB1 B;  1DJY A;  2K2F A;  2KQY A;  1SCM C;  2LUC A;  3RLZ A;  2LAN A;  3KPX A;  2WCE A;  3WHT B;  2HQ8 A;  2WCB A;  5HKY A;  1KSM A;  4TNC A;  1Q80 A;  4MSP A;  1YUR A;  2AUC A;  1SNL A;  3TDU A;  1BG1 A;  2LLT A;  4PHJ A;  2DOQ A;  3I5I B;  2IS9 A;  1RWY A;  1K9P A;  1B1G A;  1LKJ A;  1J7Q A;  1Y0V H;  1AP4 A;  2O5G A;  1PSR A;  1QAT A;  4PAL A;  1DJZ A;  1Y1A A;  1TCF A;  2K2A A;  3EVU A;  3WXA A;  1PVB A;  1NX0 A;  1CDP A;  2KFH A;  1A29 A;  2K7B A;  2MJW B;  1WRK A;  1XK4 C;  1G4Y R;  2H2K A;  1SMG A;  2A4J A;  1SYM A;  1DJG A;  1X02 A;  1YRT B;  2AMI A;  5G08 A;  3CR2 A;  1IRJ A;  5AER A;  3DVK A;  2JT3 A;  2BL0 C;  1FF1 A;  1MXL C;  5JOL A;  1UWO A;  2KGR A;  3M0W A;  1H4B A;  5AXI A;  4QJ4 B;  1S1E A;  2L4I A;  3TDZ A;  5I8N A;  1PRW A;  4MLW A;  2COL B;  3EKJ A;  1YX7 A;  5CSF A;  4A4B A;  1KWO B;  4GGF C;  4BY5 A;  2JT8 A;  2NZ0 A;  5I2L A;  3HCM A;  1CLL A;  1SW8 A;  2G2B A;  3I5F C;  1YR5 A;  2F33 A;  2HPS A;  2ZRT A;  1KK7 Z;  3DVJ A;  1NCZ A;  4UPG A;  3PM8 A;  2BCB A;  2JNX A;  2LCP A;  2KFF A;  3OB2 B;  2MAZ A;  4PHN A;  2LLU A;  4YGB B;  2F3Z A;  5I2Q A;  1DMO A;  3A4U B;  2H61 C;  1F54 A;  5CSI A;  3AKB A;  3A8R A;  2MHH A;  3CR4 X;  1OZO A;  5ER5 A;  2Y1M A;  4I5L B;  3VRN A;  2M1K B;  4HRH A;  2WC8 A;  2JUL A;  1OSA A;  2M7L A;  1YUS A;  2HQW A;  1G33 A;  2OTG C;  3KHE A;  4P5O E;  3I5G B;  3EK4 A;  1PUL A;  2FCD A;  1F4Q A;  5FYX A;  2HET A;  2GV5 A; 
#chains in the Genus database with same CATH topology
 2B1U A;  2JTZ A;  1TUZ A;  1PAL A;  1K2H A;  1WRZ A;  1Y1X A;  2WND A;  5AFP A;  4YRU A;  4NDB A;  1RJV A;  1YTZ C;  2NCO A;  1NCX A;  3B88 A;  2EC6 C;  1MXE A;  1OE9 B;  2L4H A;  1QX5 B;  1QX2 A;  2V53 A;  1JSA A;  4JPZ B;  5DKQ A;  1MWN A;  1NWD A;  1SRA A;  2ZN8 A;  4P2Y B;  1Y1U A;  2M49 B;  5ER4 X;  1B7T Y;  2AAO A;  1K9U A;  4JWQ A;  4ICB A;  2KSP A;  1XFX O;  4CPV A;  2BBN A;  2LVI A;  3PN7 C;  1XFZ O;  2ZRS A;  4MZL A;  4XYN A;  1J7P A;  2E6W A;  3SG7 A;  2Y4Q A;  3SJS A;  1SCM B;  1SSE B;  1TN4 A;  2PMY A;  1TIZ A;  3B7A A;  3PSR A;  4MRY A;  1IWQ A;  5CSJ A;  3BOW A;  1F8H A;  1UHN A;  2H8V A;  1A75 B;  3I5H C;  1B8C A;  1ZMZ A;  1GGW A;  1K96 A;  1S26 D;  2BAP A;  2JPO A;  3DY9 A;  3EK7 A;  2BCX A;  2LMU A;  2WCJ A;  3NSL A;  1MF8 B;  4HSZ A;  4NDD A;  1JWD A;  1TNW A;  1S36 A;  1G8I A;  2H61 A;  2BEC A;  3VB1 A;  3CWG A;  1AJ5 A;  3DZT A;  4DCK A;  2NLN A;  3FS7 A;  2KFG A;  1S6J A;  1CM1 A;  2OS8 B;  2CCM A;  2L2C A;  1JUO A;  3S0G A;  2GGM A;  4HRG A;  4ORA B;  1OMV A;  3OBV A;  2F2O A;  1N0Y A;  3I5H B;  5FI2 A;  3NGV A;  2JXL A;  5KTY A;  3CLN A;  4WRI A;  1IKU A;  4DUQ A;  1S5G Y;  1KQV A;  1N2D A;  4PT1 A;  4Q04 A;  4YBH B;  2M0R A;  1VRK A;  5AAN A;  2FCE A;  2LMT A;  3S0E A;  2KQ6 A;  1UHJ A;  1M63 B;  2JT0 A;  1DGU A;  2OS8 C;  4I5N B;  1W7J B;  1WRL A;  2KI6 D;  4IJ7 A;  3CGA A;  5KU1 A;  4AQI A;  1AHR A;  4CFR A;  1DJX A;  1NYA A;  2EGD A;  1F70 A;  2BBM A;  2KGB C;  2KAY A;  4HRE E;  4L9M A;  1MHO A;  2MBX A;  2KDH A;  3LK1 A;  2Y1N A;  1YUT A;  2LVK A;  1PK0 D;  4BY4 A;  2BKI B;  5J3X A;  1CFF A;  2F8P A;  1B7T Z;  4M2O A;  1DQE A;  2FJU B;  3I5F B;  3O6B A;  3CZ2 A;  1CMG A;  1IIO A;  1OW4 A;  3IQO A;  1GQM A;  4A4C A;  1JBA A;  1QVI Z;  1MR8 A;  2EHB A;  4ORB B;  4YGC B;  2KAX A;  1C7W A;  1JF2 A;  1U5I B;  3BUW B;  4WQ2 A;  3K1E A;  1KCY A;  3TUY C;  2PYQ A;  2I18 A;  1WDC B;  2WOS A;  3SIA A;  1JC2 A;  3SIB A;  1TTX A;  3VRP A;  2VRG A;  2KPH A;  1IGV A;  1FPW A;  1ZOT B;  2FOT A;  2QPT A;  1LS8 A;  2G9B A;  2K8M B;  3BUM B;  3AKA A;  1M45 A;  3RM1 A;  1AK8 A;  3BQ3 A;  1BU3 A;  1GM0 A;  2K7O A;  3TUY B;  2EC6 B;  3B87 A;  1IQ5 A;  1WDC C;  2WC5 A;  1WLM A;  2HF5 A;  1HT9 A;  3WNX B;  1F4O A;  2JU0 A;  4M2Q A;  2MLF C;  1C3Y A;  2KYF A;  3DVE A;  5HKZ A;  1NCY A;  4OCI A;  3S0D A;  1K8U A;  3FWB A;  3CZ1 A;  2JZI A;  1LVC D;  3N7H A;  3SS5 A;  1ZUZ A;  5I2O A;  1MQ1 A;  5B8I B;  1UUR A;  1CMF A;  1AVS A;  1UHK A;  1ORG A;  3Q8I A;  1QV0 A;  4U8D A;  3GK4 X;  1N65 A;  3KEV A;  3CAB A;  3JTD C;  3CTN A;  2L98 A;  2BNX A;  4USL A;  1K93 D;  4NQG A;  1HQV A;  4ZCV A;  2JRF A;  3BYA A;  1S6C A;  1KFU L;  4MN0 A;  1M46 A;  4PE0 A;  5PAL A;  3TS5 B;  3UNW A;  1SBJ A;  2ZFD A;  4MEW A;  1CDN A;  2L51 A;  4MZJ A;  3H4S E;  2SCP A;  2ZND A;  3OGN A;  4PDZ A;  4XJK B;  2ISD A;  1CLM A;  1GJY A;  1WY9 A;  3D73 A;  1DT7 B;  3SG4 A;  3SG6 A;  5KSZ A;  2QAC A;  1IH0 A;  2M1U A;  4XJK A;  1B8L A;  2JWW A;  3BFH A;  1KFX S;  3FWC A;  1H8B A;  2I7A A;  2L0P A;  2SAS A;  2LVV A;  4PHM A;  4GAO A;  2M29 A;  1E8A A;  1NPQ A;  1K95 A;  3FIA A;  2QEB A;  2BE4 A;  1DGV A;  1BF5 A;  1BOC A;  1B9A A;  3S0A A;  2KYC A;  1PVA A;  1SKT A;  3JTD B;  4CFQ A;  4YGD B;  4DRW A;  1BOD A;  3TS5 C;  2GGZ A;  1TRF A;  1BJF A;  4PHK A;  5D7F A;  5HKW A;  2P6B B;  2KI6 C;  2LP3 A;  3CZ0 A;  3LCP C;  1SPY A;  1ALW A;  2WOR A;  1CM4 A;  1MUX A;  3DVM A;  3JVT B;  3DF0 A;  1XFW O;  4GGF A;  1XYD A;  5D69 A;  3S0B A;  2CXJ A;  1UUS A;  1JF0 A;  1RK9 A;  2KLE A;  1J7R A;  2K60 A;  1J1D A;  1KWO C;  1QIV A;  1CB1 A;  1OZS A;  2NXQ A;  3ICB A;  4OVN F;  4E68 A;  1CFC A;  3BFB A;  5FI6 A;  1QX7 A;  3VRO A;  3NHI A;  1CKK A;  1A2X A;  1OQP A;  1QVI Y;  2M8U A;  2R2I A;  1TNQ A;  2D8N A;  2LUX A;  5EL2 A;  3CYZ A;  4GPL B;  3IQQ A;  3BXK A;  2P70 A;  1BR1 B;  3TZ1 A;  4QJ5 B;  1CFP A;  4AOM A;  4ZCU A;  1NX2 A;  1UHI A;  1QTX A;  3D0Y A;  4AQJ A;  1RTP 1;  1CDM A;  1CTR A;  1C3Z A;  1JFJ A;  2F3Y A;  1J55 A;  1W7I B;  4PCW A;  4JD9 A;  1ZAC A;  2JNF A;  4F7F A;  4INX A;  3DXL A;  4GBA A;  3ZNI A;  4ORC B;  4PE1 A;  1KK8 B;  2JQ6 A;  3EG5 B;  1AUI B;  1BMO A;  1KSO A;  3F45 A;  1XO5 A;  1S5G Z;  5TNC A;  4YGA A;  3VRR A;  4KYN A;  1C07 A;  3HX4 A;  1YX8 A;  4MZK A;  1L2O C;  4YI9 A;  2JPT A;  2PVB A;  3E3R A;  1TUJ A;  1YUU A;  1FI5 A;  1C7V A;  1OOF A;  2CBL A;  4FQT A;  2JOJ A;  5JJG A;  4CLN A;  4WQ3 A;  4MVF A;  1QIW A;  3CR5 X;  1A4P A;  2L5Y A;  2L5X B;  4N5X A;  1PSB A;  1XFY O;  1DEL A;  2KBI A;  1A75 A;  1EG3 A;  1NSH A;  4F0Z B;  3GOF A;  1SK6 D;  1IQ3 A;  1B4C A;  1KQM B;  1FW4 A;  1REC A;  1IG5 A;  1EL4 A;  2BCA A;  1SL9 A;  3SG5 A;  1B8R A;  3D10 A;  1L2O B;  1DTL A;  1AJ4 A;  1Y6W A;  2CNP A;  3D76 A;  4N1F A;  2MA2 A;  1QLK A;  5AEQ A;  2WCF A;  4QJ3 B;  1TNX A;  1SCV A;  2NCP A;  3GK2 A;  3BUO B;  1TCO B;  4CID A;  3NSI A;  2MLE C;  4NDC A;  1Z4H A;  4OZD A;  4D1E A;  2CTN A;  1WLZ A;  3VRQ A;  1ALV A;  1DF0 A;  2M97 A;  2KNE A;  4C0K A;  2LE9 B;  1DVI A;  2K0J A;  1RRO A;  3D0Y B;  1DJI A;  4DIR A;  2QDI A;  1KQM C;  3CS1 A;  4MRX A;  3RZS A;  1V1F A;  1OMR A;  1SL7 A;  1CNP A;  1B47 A;  3EVV A;  2LHL A;  2LLS A;  3K21 A;  1K9K A;  1QLS A;  2LV7 A;  4OR9 B;  4OV2 A;  2LNK A;  1K94 A;  1R2U A;  1V1G A;  2WCH A;  2Y5I A;  4OKH A;  3FE9 A;  5HYD A;  1DF0 B;  1LIN A;  3BUN B;  1QXP A;  2JXC A;  1KFX L;  3PN7 B;  2KI4 C;  2KAV A;  2M7N A;  3PJI A;  1S3P A;  1FBV A;  2GTE A;  5HLO A;  1A03 A;  3BOW B;  2LP2 A;  3EKH A;  3PAL A;  1J1E A;  1BR4 B;  2Q4U A;  2RGI A;  1ODB A;  1GGZ A;  2M9G A;  3CZT X;  1R6P A;  4PE7 A;  5I94 A;  3AAJ A;  1IJ5 A;  3LLE A;  2LHI A;  2K61 A;  2Q91 A;  3ZWH A;  1XFV O;  3AAK A;  2OTG B;  1OMD A;  3BFA A;  3JVT C;  3I5G C;  1FI6 A;  3O2P A;  2WCK A;  2CT9 A;  3L4A A;  3D77 A;  2LC5 A;  3D74 A;  1ZFS A;  1L7Z A;  1K90 D;  1CDL A;  2ZKM X;  3NSO A;  2FJY A;  1KK7 Y;  2KI4 B;  5BPJ A;  1NUB A;  1XFR A;  4GGN A;  3EVR A;  2WC6 A;  3QRX A;  1NX3 A;  3MSE B;  2MRD A;  2PRU A;  5D3O A;  5HLV A;  1EXR A;  1LA3 A;  2WCL A;  4R1E A;  4ETO A;  2BL0 B;  3FE6 A;  3PLF B;  1NX1 A;  1QAS A;  1XVJ A;  2L2E A;  1CLB A;  3SG3 A;  3O78 A;  3O4Y A;  1NP8 A;  1YVH A;  2I2R E;  2P71 A;  4GFT A;  3VGO A;  3UO9 A;  1J7O A;  1EG4 A;  2K7C A;  3LL8 B;  3L47 A;  2I94 A;  3PAT A;  3BJH A;  1DJW A;  3TDI A;  1XFU O;  1F55 A;  2ZN9 A;  4M2P A;  1RFJ A;  3OX6 A;  4FTG A;  3EK8 A;  2LVJ A;  3S0F A;  1EJ3 A;  2YGU A;  5GQQ C;  4IL1 A;  1M39 A;  1TNP A;  1KK8 C;  2F2P A;  2BKH B;  1DJH A;  1M31 A;  2KHN A;  4GUK A;  1D1O A;  5IBW A;  2JTT A;  3R1O A;  1QWV A;  4N1G A;  3DD4 A;  4I5J A;  4MBE A;  2K7D A;  1SL8 A;  3KO0 A;  5DKR A;  2O60 A;  3CDN A;  1DC1 A;  1NIW A;  5CPV A;  2JC2 A;  2WCM A;  5DKN A;  3OX5 A;  5CSN A;  1CFD A;  1QS7 A;  4PE4 A;  2L50 A;  4FQO A;  1BT6 A;  2KBM A;  4JKT A;  1BLQ A;  1S6I A;  1YVL A;  4YI8 A;  2LMV A;  1LA0 A;  2PSR A;  3GK1 A;  2E30 A;  3NSK A;  3KF9 A;  2BE6 A;  1IJ6 A;  1SY9 A;  2OPO A;  4DS7 A;  1TOP A;  1SR6 B;  1YRU B;  2M3W A;  3SS3 A;  1EH2 A;  4YGE B;  1T14 A;  3R1V A;  2PAS A;  3IVT A;  3C1V A;  1Z2C B;  1QV1 A;  4C0J A;  3WHU B;  3OHM B;  3PFV A;  1JFK A;  1UP5 A;  2ZNE A;  3OP0 A;  4I5K A;  5K89 A;  4GNK B;  3BUX B;  3I5I C;  1F71 A;  3IF7 A;  1U5I A;  3DF0 B;  3NXA A;  3NHT A;  3SG2 A;  1LXF C;  2LM5 A;  2PAL A;  1XA5 A;  2LAP A;  4C0L A;  4JQ0 D;  1OOJ A;  2KLD A;  2KOT A;  2TN4 A;  1QJT A;  1XK4 A;  5F6T A;  1UHH A;  1KFU S;  3PM2 A;  1SR6 C;  3LK0 A;  3OB1 B;  1DJY A;  2K2F A;  2KQY A;  1SCM C;  2LUC A;  3RLZ A;  2LAN A;  3KPX A;  3R1P A;  2WCE A;  3WHT B;  2HQ8 A;  2WCB A;  5HKY A;  1KSM A;  4TNC A;  1Q80 A;  3DYE A;  4MSP A;  1YUR A;  2AUC A;  1SNL A;  3TDU A;  1BG1 A;  3D75 A;  2LLT A;  4PHJ A;  1TWO A;  2DOQ A;  3I5I B;  1OOH A;  2IS9 A;  1RWY A;  1K9P A;  1B1G A;  1LKJ A;  1J7Q A;  3FE8 A;  1Y0V H;  3QME A;  1AP4 A;  2O5G A;  1PSR A;  1QAT A;  4PAL A;  1DJZ A;  1Y1A A;  1TCF A;  2K2A A;  3EVU A;  3WXA A;  1PVB A;  1NX0 A;  1CDP A;  1W9Z A;  1P28 A;  1DEK A;  2KFH A;  1A29 A;  2K7B A;  2MJW B;  1WRK A;  1XK4 C;  1G4Y R;  2H2K A;  3L4L A;  2QEH A;  1SMG A;  2A4J A;  1SYM A;  1DJG A;  1X02 A;  1YRT B;  2AMI A;  5G08 A;  5HL1 A;  3CR2 A;  1OOI X;  3B86 A;  1IRJ A;  5AER A;  3DVK A;  2JT3 A;  2BL0 C;  1FF1 A;  1MXL C;  5JOL A;  1UWO A;  2KGR A;  3O4X A;  3M0W A;  1H4B A;  5AXI A;  4QJ4 B;  1S1E A;  2L4I A;  4INW A;  3TDZ A;  5I8N A;  1PRW A;  4MLW A;  2COL B;  3EKJ A;  1YX7 A;  5CSF A;  4A4B A;  1KWO B;  4GGF C;  4BY5 A;  2ERB A;  2JT8 A;  2NZ0 A;  5I2L A;  3HCM A;  1CLL A;  1SW8 A;  2G2B A;  3I5F C;  1YR5 A;  2F33 A;  2HPS A;  2ZRT A;  5FI7 A;  1KK7 Z;  3DVJ A;  1NCZ A;  4UPG A;  3PM8 A;  3V2L A;  2BCB A;  2JNX A;  3D78 A;  2LCP A;  2KFF A;  3OB2 B;  2MAZ A;  4PHN A;  2LLU A;  4YGB B;  2F3Z A;  5I2Q A;  1DMO A;  3A4U B;  2H61 C;  1F54 A;  5CSI A;  2PQL A;  3A8R A;  2MHH A;  3AKB A;  1OZO A;  3B6X A;  3CR4 X;  1OOG A;  2Y1M A;  4I5L B;  5ER5 A;  3SS4 A;  3VRN A;  2M1K B;  4HRH A;  2QEO A;  2JUL A;  2WC8 A;  1OSA A;  2M7L A;  1YUS A;  2QEV A;  5DIC A;  2HQW A;  1G33 A;  2OTG C;  3R72 A;  3KHE A;  4P5O E;  3I5G B;  3EK4 A;  1PUL A;  2FCD A;  1F4Q A;  5FYX A;  2HET A;  2GV5 A; 
#chains in the Genus database with same CATH homology
 2B1U A;  2JTZ A;  1PAL A;  1K2H A;  1WRZ A;  1Y1X A;  2WND A;  5AFP A;  4YRU A;  4NDB A;  1RJV A;  1YTZ C;  2NCO A;  1NCX A;  2EC6 C;  1MXE A;  1OE9 B;  2L4H A;  1QX5 B;  1QX2 A;  2V53 A;  1JSA A;  4JPZ B;  5DKQ A;  1MWN A;  1NWD A;  1SRA A;  2ZN8 A;  4P2Y B;  1Y1U A;  2M49 B;  5ER4 X;  1B7T Y;  2AAO A;  1K9U A;  4JWQ A;  4ICB A;  2KSP A;  1XFX O;  4CPV A;  2BBN A;  2LVI A;  3PN7 C;  1XFZ O;  2ZRS A;  4MZL A;  4XYN A;  1J7P A;  2E6W A;  3SG7 A;  2Y4Q A;  3SJS A;  1SCM B;  1TN4 A;  1F8H A;  2PMY A;  1TIZ A;  3PSR A;  4MRY A;  1IWQ A;  5CSJ A;  3BOW A;  1UHN A;  1A75 B;  3I5H C;  1B8C A;  1ZMZ A;  1GGW A;  1K96 A;  1S26 D;  4HSZ A;  3EK7 A;  3NSL A;  2BCX A;  2LMU A;  1MF8 B;  4NDD A;  1JWD A;  1TNW A;  1S36 A;  1G8I A;  2H61 A;  2BEC A;  3CWG A;  1AJ5 A;  4DCK A;  2NLN A;  3FS7 A;  2KFG A;  1S6J A;  1CM1 A;  2OS8 B;  2CCM A;  1JUO A;  2GGM A;  4HRG A;  4ORA B;  1OMV A;  2F2O A;  1N0Y A;  3I5H B;  2JXL A;  5KTY A;  3CLN A;  4WRI A;  1IKU A;  4DUQ A;  1S5G Y;  1KQV A;  1N2D A;  4Q04 A;  4YBH B;  2M0R A;  1VRK A;  5AAN A;  2FCE A;  2LMT A;  2KQ6 A;  1UHJ A;  1M63 B;  2JT0 A;  1DGU A;  2OS8 C;  4I5N B;  1W7J B;  1WRL A;  2KI6 D;  3CGA A;  5KU1 A;  4AQI A;  1AHR A;  4CFR A;  1DJX A;  1NYA A;  2EGD A;  1F70 A;  2BBM A;  2KGB C;  2KAY A;  4HRE E;  4L9M A;  1MHO A;  2MBX A;  2KDH A;  3LK1 A;  2Y1N A;  1YUT A;  2LVK A;  1PK0 D;  4BY4 A;  2BKI B;  5J3X A;  1CFF A;  2F8P A;  1B7T Z;  4M2O A;  3I5F B;  2FJU B;  1CMG A;  3O6B A;  3IQO A;  1JBA A;  1GQM A;  4A4C A;  1QVI Z;  1MR8 A;  2EHB A;  4ORB B;  4YGC B;  2KAX A;  1C7W A;  1JF2 A;  1U5I B;  3BUW B;  4WQ2 A;  1KCY A;  3TUY C;  3SIA A;  2I18 A;  1WDC B;  2WOS A;  1JC2 A;  3SIB A;  1TTX A;  3VRP A;  2VRG A;  1FPW A;  1IGV A;  1ZOT B;  2FOT A;  2QPT A;  2G9B A;  2K8M B;  3BUM B;  3AKA A;  1M45 A;  3RM1 A;  1AK8 A;  3BQ3 A;  1BU3 A;  2K7O A;  3TUY B;  2EC6 B;  1IQ5 A;  1WDC C;  1WLM A;  2HF5 A;  1HT9 A;  3WNX B;  1F4O A;  2JU0 A;  4M2Q A;  2MLF C;  2KYF A;  3DVE A;  5HKZ A;  1NCY A;  4OCI A;  1K8U A;  3FWB A;  2JZI A;  1LVC D;  1ZUZ A;  5I2O A;  1MQ1 A;  5B8I B;  1UUR A;  1CMF A;  1AVS A;  1UHK A;  1QV0 A;  4U8D A;  3GK4 X;  1N65 A;  3KEV A;  3JTD C;  3CTN A;  2L98 A;  4USL A;  1K93 D;  4NQG A;  1HQV A;  4ZCV A;  2JRF A;  3BYA A;  1S6C A;  1KFU L;  4MN0 A;  1M46 A;  4PE0 A;  5PAL A;  3TS5 B;  3VRO A;  1SBJ A;  2ZFD A;  4MEW A;  1CDN A;  2L51 A;  4MZJ A;  3H4S E;  2SCP A;  2ZND A;  4PDZ A;  4XJK B;  2ISD A;  1CLM A;  1GJY A;  1WY9 A;  1DT7 B;  3SG4 A;  3SG6 A;  5KSZ A;  2QAC A;  1IH0 A;  2M1U A;  4XJK A;  1B8L A;  2JWW A;  3FWC A;  1KFX S;  1H8B A;  2I7A A;  2L0P A;  2SAS A;  2LVV A;  4PHM A;  4GAO A;  2M29 A;  1E8A A;  1NPQ A;  1K95 A;  3FIA A;  1BOC A;  2BE4 A;  1DGV A;  1BF5 A;  1B9A A;  2KYC A;  1PVA A;  1SKT A;  3JTD B;  4CFQ A;  4YGD B;  4DRW A;  1BOD A;  3TS5 C;  2GGZ A;  1TRF A;  1BJF A;  4PHK A;  5D7F A;  5HKW A;  2P6B B;  2KI6 C;  2LP3 A;  3LCP C;  1SPY A;  1ALW A;  2WOR A;  1CM4 A;  1MUX A;  3DVM A;  3JVT B;  3DF0 A;  1XFW O;  4GGF A;  1XYD A;  5D69 A;  2CXJ A;  1UUS A;  1JF0 A;  1RK9 A;  1J7R A;  1J1D A;  1KWO C;  1QIV A;  1CB1 A;  1OZS A;  2NXQ A;  3ICB A;  4OVN F;  4E68 A;  1CFC A;  1QX7 A;  1CKK A;  1A2X A;  1OQP A;  1QVI Y;  2M8U A;  2R2I A;  1TNQ A;  2D8N A;  2LUX A;  4GPL B;  3IQQ A;  3BXK A;  1BR1 B;  3TZ1 A;  4QJ5 B;  1CFP A;  4AOM A;  4ZCU A;  1NX2 A;  1UHI A;  1QTX A;  3D0Y A;  4AQJ A;  1RTP 1;  1CDM A;  1CTR A;  1JFJ A;  2F3Y A;  1J55 A;  1W7I B;  4PCW A;  1ZAC A;  2JNF A;  4GBA A;  3ZNI A;  4ORC B;  4PE1 A;  1KK8 B;  2JQ6 A;  1AUI B;  1BMO A;  1KSO A;  3F45 A;  1XO5 A;  1S5G Z;  5TNC A;  4YGA A;  3VRR A;  1C07 A;  3HX4 A;  1YX8 A;  4MZK A;  1L2O C;  4YI9 A;  2JPT A;  2PVB A;  3E3R A;  1YUU A;  1FI5 A;  1C7V A;  2CBL A;  2JOJ A;  5JJG A;  4CLN A;  4WQ3 A;  4MVF A;  1QIW A;  3CR5 X;  1A4P A;  2L5X B;  4N5X A;  1PSB A;  1XFY O;  2KBI A;  1A75 A;  1EG3 A;  1NSH A;  4F0Z B;  3GOF A;  1SK6 D;  1IQ3 A;  1B4C A;  1KQM B;  1FW4 A;  1REC A;  1IG5 A;  1EL4 A;  2BCA A;  1SL9 A;  3SG5 A;  1B8R A;  3D10 A;  1L2O B;  1DTL A;  1AJ4 A;  1Y6W A;  2CNP A;  4N1F A;  2MA2 A;  1QLK A;  5AEQ A;  2WCF A;  4QJ3 B;  1TNX A;  1SCV A;  2NCP A;  3GK2 A;  3BUO B;  1TCO B;  4CID A;  3NSI A;  2MLE C;  4NDC A;  4D1E A;  2CTN A;  1WLZ A;  3VRQ A;  1ALV A;  1DF0 A;  2M97 A;  2KNE A;  4C0K A;  2LE9 B;  1DVI A;  2K0J A;  1RRO A;  3D0Y B;  1DJI A;  4DIR A;  4MRX A;  1KQM C;  3CS1 A;  1V1F A;  1OMR A;  1SL7 A;  1CNP A;  1B47 A;  3EVV A;  2LHL A;  2LLS A;  3K21 A;  1K9K A;  1QLS A;  2LV7 A;  4OR9 B;  4OV2 A;  2LNK A;  1K94 A;  1R2U A;  1V1G A;  2Y5I A;  4OKH A;  5HYD A;  1DF0 B;  1LIN A;  3BUN B;  1QXP A;  2JXC A;  1KFX L;  3PN7 B;  2KI4 C;  2KAV A;  2M7N A;  1S3P A;  1FBV A;  5HLO A;  1A03 A;  3BOW B;  2LP2 A;  3EKH A;  3PAL A;  1J1E A;  1BR4 B;  2Q4U A;  2RGI A;  1ODB A;  1GGZ A;  2M9G A;  3CZT X;  1R6P A;  4PE7 A;  3AAJ A;  1IJ5 A;  3LLE A;  2LHI A;  2K61 A;  2Q91 A;  3ZWH A;  1XFV O;  3AAK A;  2OTG B;  1OMD A;  3JVT C;  3I5G C;  1FI6 A;  3O2P A;  2CT9 A;  2LC5 A;  1ZFS A;  1L7Z A;  1K90 D;  1CDL A;  2ZKM X;  3NSO A;  5BPJ A;  1KK7 Y;  2KI4 B;  1NUB A;  4GGN A;  3EVR A;  3QRX A;  1NX3 A;  3MSE B;  2MRD A;  2PRU A;  5HLV A;  1EXR A;  1LA3 A;  4R1E A;  4ETO A;  2BL0 B;  3PLF B;  1NX1 A;  1QAS A;  1XVJ A;  2L2E A;  1CLB A;  3SG3 A;  3O78 A;  3O4Y A;  1NP8 A;  1YVH A;  2I2R E;  4GFT A;  3VGO A;  1J7O A;  1EG4 A;  2K7C A;  3LL8 B;  3PAT A;  2I94 A;  3TDI A;  1DJW A;  1XFU O;  1F55 A;  2ZN9 A;  4M2P A;  1RFJ A;  3OX6 A;  4FTG A;  3EK8 A;  2LVJ A;  1EJ3 A;  5GQQ C;  4IL1 A;  1M39 A;  1TNP A;  1KK8 C;  2F2P A;  2BKH B;  1DJH A;  1M31 A;  2KHN A;  4GUK A;  1D1O A;  5IBW A;  2JTT A;  4N1G A;  3DD4 A;  4I5J A;  4MBE A;  2K7D A;  1SL8 A;  3KO0 A;  5DKR A;  2O60 A;  1NIW A;  5CPV A;  2JC2 A;  5DKN A;  3OX5 A;  5CSN A;  1CFD A;  1QS7 A;  4PE4 A;  2L50 A;  4FQO A;  1BT6 A;  2KBM A;  1BLQ A;  1S6I A;  1YVL A;  4YI8 A;  2LMV A;  1LA0 A;  2PSR A;  3GK1 A;  2E30 A;  3NSK A;  3KF9 A;  2BE6 A;  1IJ6 A;  1SY9 A;  2OPO A;  4DS7 A;  1TOP A;  1SR6 B;  1YRU B;  2M3W A;  1EH2 A;  4YGE B;  2PAS A;  3C1V A;  1QV1 A;  4C0J A;  3WHU B;  3OHM B;  3PFV A;  1JFK A;  1UP5 A;  2ZNE A;  3OP0 A;  4I5K A;  5K89 A;  4GNK B;  3BUX B;  3I5I C;  1F71 A;  3IF7 A;  1U5I A;  3DF0 B;  3NXA A;  3SG2 A;  1LXF C;  2LM5 A;  2PAL A;  1XA5 A;  2LAP A;  4C0L A;  4JQ0 D;  1OOJ A;  2KOT A;  2TN4 A;  1QJT A;  1XK4 A;  5F6T A;  1UHH A;  1KFU S;  1SR6 C;  3LK0 A;  3OB1 B;  1DJY A;  2K2F A;  2KQY A;  1SCM C;  2LUC A;  3RLZ A;  2LAN A;  3KPX A;  2WCE A;  3WHT B;  2HQ8 A;  2WCB A;  5HKY A;  1KSM A;  4TNC A;  1Q80 A;  4MSP A;  1YUR A;  2AUC A;  1SNL A;  3TDU A;  1BG1 A;  2LLT A;  4PHJ A;  2DOQ A;  3I5I B;  2IS9 A;  1RWY A;  1K9P A;  1B1G A;  1LKJ A;  1J7Q A;  1Y0V H;  1AP4 A;  2O5G A;  1PSR A;  1QAT A;  4PAL A;  1DJZ A;  1Y1A A;  1TCF A;  2K2A A;  3EVU A;  3WXA A;  1PVB A;  1NX0 A;  1CDP A;  2KFH A;  1A29 A;  2K7B A;  2MJW B;  1WRK A;  1XK4 C;  1G4Y R;  2H2K A;  1SMG A;  2A4J A;  1SYM A;  1DJG A;  1X02 A;  1YRT B;  2AMI A;  5G08 A;  3CR2 A;  1IRJ A;  5AER A;  3DVK A;  2JT3 A;  2BL0 C;  1FF1 A;  1MXL C;  5JOL A;  1UWO A;  2KGR A;  3M0W A;  1H4B A;  5AXI A;  4QJ4 B;  1S1E A;  2L4I A;  3TDZ A;  5I8N A;  1PRW A;  4MLW A;  2COL B;  3EKJ A;  1YX7 A;  5CSF A;  4A4B A;  1KWO B;  4GGF C;  4BY5 A;  2JT8 A;  2NZ0 A;  5I2L A;  3HCM A;  1CLL A;  1SW8 A;  2G2B A;  3I5F C;  1YR5 A;  2F33 A;  2HPS A;  2ZRT A;  1KK7 Z;  3DVJ A;  1NCZ A;  4UPG A;  3PM8 A;  2BCB A;  2JNX A;  2LCP A;  2KFF A;  3OB2 B;  2MAZ A;  4PHN A;  2LLU A;  4YGB B;  2F3Z A;  5I2Q A;  1DMO A;  3A4U B;  2H61 C;  1F54 A;  5CSI A;  3AKB A;  3A8R A;  2MHH A;  3CR4 X;  1OZO A;  5ER5 A;  2Y1M A;  4I5L B;  3VRN A;  2M1K B;  4HRH A;  2WC8 A;  2JUL A;  1OSA A;  2M7L A;  1YUS A;  2HQW A;  1G33 A;  2OTG C;  3KHE A;  4P5O E;  3I5G B;  3EK4 A;  1PUL A;  2FCD A;  1F4Q A;  5FYX A;  2HET A;  2GV5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...