5JOLA

Calcium-free ef-hand domain of l-plastin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
82
structure length
82
Chain Sequence
MARGSVSDEEMMELREAFAKVDTDGNGYISFNELNDLFKAACLPLPGYRVREITENLMATGDLDQDGRISFDEFIKIFHGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plastin-2
publication title The Calcium-Dependent Switch Helix of L-Plastin Regulates Actin Bundling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 19
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2016-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5jolA00
3BXKA 1NP8A 4HRHA 1A2XA 2CBLA 2KBMA 2LMUA 4FTGA 2NZ0A 1UHIA 1V1GA 2JT3A 5CSJA 3TDZA 2BCXA 2EGDA 2M29A 3DVKA 1DF0A 1S1EA 4GAOA 2M8UA 1R6PA 2Y1NA 2ZN9A 4CFQA 4F0ZB 3CS1A 1KQMB 2K7DA 3LLEA 2H61C 2KFHA 1ODBA 2HPSA 3CGAA 4YRUA 1DF0B 1OE9B 4R1EA 1SMGA 3SG3A 1JF2A 1F4OA 1FI5A 2F3ZA 1QX7A 1EL4A 2M7NA 2BECA 2M9GA 4QJ3B 1KK8B 1QS7A 2BKIB 1AJ5A 5DKNA 1FBVA 1JBAA 1EJ3A 1BODA 1CMGA 2H2KA 4DCKA 2LLTA 4NQGA 2E6WA 1KWOC 1S6JA 2ISDA 3TDUA 3KHEA 1SCMC 3A8RA 2KQYA 1TNPA 5AERA 1B8LA 3OB1B 1QLSA 1DTLA 1BF5A 4ICBA 2Q4UA 1CM1A 2Y5IA 2F2PA 1AK8A 2JT0A 3DF0A 1QX2A 4PALA 4PE1A 4QJ4B 1YVHA 1IKUA 2JTTA 3AAJA 1TCFA 1EH2A 3FWBA 2L2EA 3TDIA 1F8HA 1NCXA 4DS7A 3TZ1A 1YX8A 2Y1MA 1CKKA 4CFRA 3PFVA 3ZWHA 2QACA 1K9UA 1F70A 1M63B 3SG5A 1TCOB 3DF0B 1YX7A 2AAOA 1ZOTB 2NCPA 1G33A 3BUOB 4CLNA 3EK4A 5AANA 4YI8A 2AUCA 5I2OA 1Y1XA 1KWOB 1H8BA 1BOCA 2LVVA 3RLZA 3SG2A 1KFXL 4XYNA 4U8DA 2KDHA 3EVUA 1SCMB 2LHIA 3O6BA 3WXAA 1B9AA 4QJ5B 1G4YR 1MWNA 1TIZA 4PHNA 1RFJA 1RJVA 4MN0A 1C7VA 3I5FC 1XFWO 4GGFA 4L9MA 4PHKA 2JXLA 2FCDA 1OMDA 1NX3A 3D10A 3I5HB 4YGBB 2OS8B 4CPVA 4XJKA 2MLEC 1NX0A 1WLZA 4OCIA 1XK4C 1YUUA 1QXPA 2HETA 2L51A 3VRRA 4YI9A 3CZTX 1SL7A 1E8AA 2KAVA 3ZNIA 1MF8B 5JOLA 1QLKA 3SIAA 4P5OE 2K8MB 4XJKB 1WDCC 2EC6B 4CIDA 1KK7Z 2I7AA 2WC8A 1NSHA 1L2OC 1V1FA 1ZMZA 1NX2A 2OTGB 1YRUB 2ZNEA 3CR5X 1NUBA 2BL0B 3BOWA 1AJ4A 2LV7A 4TNCA 1Y1AA 2WNDA 3DD4A 1CFFA 1RWYA 1WY9A 5JJGA 1YTZC 3LL8B 3I5FB 1ALWA 2WOSA 4I5KA 1XFYO 1QJTA 3DVEA 4MEWA 3BOWB 2LNKA 2LLUA 4D1EA 1EG4A 1IJ6A 1SRAA 5D69A 1DJZA 2K7OA 5F6TA 1J7RA 3LK1A 2FCEA 1UHHA 3NSOA 3AKAA 3SJSA 3DVJA 3F45A 5G08A 1UURA 1BR1B 1MR8A 4PCWA 1L2OB 2OPOA 2KSPA 1S6CA 4WRIA 1SR6C 3HX4A 2K7CA 5HKYA 1S26D 1DJGA 1S36A 1UHNA 3O78A 1B4CA 3BUWB 3CTNA 5AFPA 1BT6A 4UPGA 1SY9A 1GQMA 2LANA 1N0YA 3NXAA 4I5JA 4Q04A 2ZRSA 3A4UB 2MAZA 3I5IB 1EG3A 3MSEB 1BLQA 1TN4A 3KEVA 2R2IA 3EK7A 1SKTA 4PHMA 3WHUB 3BQ3A 2F8PA 2KHNA 1XO5A 1ZUZA 1IG5A 2GGMA 2HQWA 1PSBA 1TOPA 2ZN8A 3JVTC 1IWQA 2KYFA 2WCEA 5IBWA 5K89A 3OX5A 3I5GC 2WCFA 4M2QA 3TS5B 1VRKA 5KU1A 2G9BA 2K7BA 4GPLB 3ICBA 2I2RE 4OV2A 1CFCA 4DRWA 1S3PA 2JNFA 5KTYA 1QIWA 1UHKA 2SASA 3VRNA 2LUXA 1FI6A 1XA5A 1UP5A 4HREE 1YUTA 1TNXA 1K2HA 1WRKA 2CNPA 2WCBA 1W7JB 1GGZA 3O2PA 3PN7C 4GUKA 2H61A 2MRDA 1ZACA 1ALVA 2BCAA 3KPXA 1K90D 2ZFDA 1MXEA 2KOTA 2PRUA 4ORBB 1TRFA 2COLB 1B1GA 2KAYA 2LMVA 3AKBA 1AHRA 5CPVA 1MUXA 1GGWA 3DVMA 1B7TY 2JPTA 4C0JA 2LLSA 4MBEA 1W7IB 1CMFA 1DJWA 1LA0A 4WQ3A 1OQPA 1BG1A 2LHLA 3CLNA 3WNXB 4A4BA 4E68A 1K93D 1IRJA 1XFZO 2F33A 2LCPA 1WLMA 1NYAA 2BE6A 2M7LA 1HT9A 1TNQA 4YBHB 4YGEB 1QV1A 2LMTA 3PN7B 2LVKA 4AOMA 2I18A 1XFXO 5FYXA 2ZNDA 1X02A 1DJXA 1QIVA 1CFDA 2M1KB 3SG6A 1NPQA 1KSOA 4A4CA 1M39A 1RROA 2LAPA 3PALA 5CSIA 5AXIA 2JZIA 3TUYC 1YUSA 2M97A 1Q80A 3K21A 4MZJA 4DUQA 1QATA 3HCMA 2O60A 1PALA 2L50A 2PVBA 1CDPA 1BR4B 2IS9A 4I5NB 1CNPA 3SIBA 3VRPA 1A4PA 2NLNA 1DT7B 2JC2A 3PSRA 4PHJA 1JSAA 1F55A 3OHMB 1M46A 4GGNA 2CT9A 4N5XA 1LXFC 1IH0A 4ZCUA 1OMRA 1WRLA 2EHBA 1LINA 1GJYA 1IGVA 2CTNA 1Y1UA 3EK8A 1MXLC 1ZFSA 1A75A 1QVIY 2DOQA 2K61A 3GK2A 2VRGA 4I5LB 4GFTA 4BY4A 4WQ2A 5HYDA 1XK4A 5AEQA 2LVIA 2MHHA 1KFUL 1K8UA 4AQIA 5DKQA 1SBJA 1NX1A 1L7ZA 1TNWA 3H4SE 3NSLA 2CCMA 3QRXA 5D7FA 1K9PA 1KQVA 1B7TZ 1N65A 4JWQA 1CTRA 1Y0VH 2JXCA 2NXQA 1KFUS 2NCOA 2ZRTA 2M1UA 1CB1A 4AQJA 1OSAA 1FW4A 2KFGA 2LM5A 1WDCB 2KGRA 5HLOA 5TNCA 2PASA 2HQ8A 2KFFA 4OKHA 1AP4A 1J7QA 4YGDB 4NDBA 1F4QA 2MLFC 4M2PA 5HKZA 3OP0A 4C0KA 1CLLA 1AUIB 1F71A 1KQMC 2D8NA 3C1VA 1K95A 3O4YA 3CWGA 3VROA 1S5GY 1DGUA 1J1EA 1F54A 4N1GA 1OZSA 2JNXA 3VRQA 1DJHA 3SG7A 3SG4A 1CLMA 5KSZA 3CR4X 2B1UA 4MRYA 1XFUO 3PM8A 1KSMA 1SW8A 5HLVA 4GBAA 2KQ6A 1MQ1A 1C7WA 5BPJA 1SPYA 3LK0A 3M0WA 1FF1A 1IJ5A 1M45A 2HF5A 1J7OA 3KF9A 1D1OA 2BCBA 1LA3A 4NDDA 2CXJA 2O5GA 1DVIA 5DKRA 1J1DA 2LC5A 2SCPA 3PATA 1JWDA 2KI4C 2RGIA 1XFVO 4ORCB 1FPWA 1S6IA 1SR6B 3EKJA 4M2OA 1QVIZ 2LUCA 1RECA 1K94A 1B47A 5CSFA 4MRXA 1U5IA 2QPTA 3BYAA 3BUXB 1CFPA 1OMVA 4MLWA 1B8CA 1SL9A 2KBIA 4HRGA 3OX6A 2LE9B 1BJFA 1LVCD 2L5XB 1J55A 2JOJA 3OB2B 1U5IB 4BY5A 1DJIA 3CR2A 2M0RA 3FS7A 3JVTB 3RM1A 1KK7Y 4YGAA 3I5GB 4NDCA 1YR5A 3D0YA 3FWCA 3IF7A 1PK0D 1R2UA 3BUMB 3PLFB 1YVLA 4C0LA 1SYMA 4DIRA 2GGZA 1SK6D 4MVFA 1SL8A 1YURA 2K2AA 2GV5A 1N2DA 1DMOA 1B8RA 2P6BB 4PE7A 2KI4B 2JWWA 3D0YB 2PALA 1QX5B 4ZCVA 1G8IA 4MZKA 4MSPA 3I5HC 2OS8C 1CLBA 1S5GZ 1PVBA 1UUSA 4ETOA 1SCVA 5HKWA 4OVNF 1LKJA 2JTZA 2BBMA 1RK9A 1DJYA 1TTXA 1JF0A 1UHJA 1UWOA 1XYDA 2F2OA 2JU0A 3EVVA 5GQQC 1PSRA 2JRFA 5J3XA 2K2FA 4GGFC 2MBXA 3JTDC 1M31A 1JFKA 2I94A 2WORA 1NCYA 5ER4X 2EC6C 2Q91A 1IQ5A 1EXRA 4P2YB 2BBNA 1A03A 2G2BA 2M49B 3FIAA 3GK1A 2OTGC 1C07A 2LP3A 1CDLA 2BL0C 1BMOA 2L98A 1CDNA 3NSIA 2V53A 5I8NA 1PVAA 2F3YA 1QV0A 1NWDA 4FQOA 1NIWA 2TN4A 4HSZA 3IQQA 3IQOA 4ORAB 4YGCB 5I2LA 3EVRA 2LP2A 4MZLA 1J7PA 2MA2A 1HQVA 1KFXS 2A4JA 5ER5A 2LVJA 5B8IB 1PRWA 2Y4QA 3WHTB 1IQ3A 1KCYA 4PDZA 3GOFA 2L4IA 2KAXA 1CDMA 1BU3A 3TUYB 3E3RA 1Y6WA 1JC2A 3JTDB 1A75B 2PMYA 1K9KA 1K96A 3LCPC 1MHOA 4JPZB 5CSNA 2KGBC 1CM4A 1QASA 1JFJA 4USLA 2JULA 1DGVA 2KNEA 1H4BA 3GK4X 2KYCA 2L0PA 2BKHB 2ZKMX 1A29A 2KI6D 2M3WA 1PULA 4PE0A 4JQ0D 4GNKB 3AAKA 1SNLA 1WRZA 3I5IC 1NCZA 3NSKA 4N1FA 2MJWB 3VGOA 1OZOA 5I2QA 3KO0A 3BUNB 4OR9B 2FJUB 2AMIA 1XVJA 2JT8A 1OOJA 2KI6C 3EKHA 2BE4A 2JQ6A 2E30A 1AVSA 1JUOA 2PSRA 4IL1A 3TS5C 1RTP1 2L4HA 1QTXA 2K0JA 1YRTB 1KK8C 4PE4A 5PALA 2FOTA
chains in the Genus database with same CATH superfamily
3BXKA 1NP8A 4HRHA 1A2XA 2CBLA 2KBMA 2LMUA 4FTGA 2NZ0A 1UHIA 1V1GA 2JT3A 5CSJA 3TDZA 2BCXA 1Z2CB 2EGDA 2M29A 1DF0A 3DVKA 1S1EA 3DYEA 4GAOA 2M8UA 1R6PA 2QDIA 2Y1NA 2ZN9A 4CFQA 4F0ZB 3CS1A 1KQMB 2K7DA 1T14A 3LLEA 2H61C 2KFHA 1ODBA 2HPSA 3CGAA 3IVTA 1DF0B 1OE9B 4R1EA 1SMGA 3SG3A 4YRUA 1JF2A 1OW4A 1F4OA 1FI5A 2F3ZA 1QX7A 1EL4A 2M7NA 2BECA 2M9GA 4QJ3B 1KK8B 1QS7A 2BKIB 1AJ5A 3EG5B 5DKNA 3SS4A 1FBVA 1JBAA 1EJ3A 1BODA 1CMGA 2H2KA 4DCKA 2LLTA 4NQGA 2E6WA 1KWOC 1S6JA 2WC5A 2ISDA 3TDUA 3UNWA 2P71A 3KHEA 3B6XA 1SCMC 3A8RA 2KQYA 1TNPA 5AERA 1B8LA 3OB1B 1QLSA 1DTLA 1BF5A 4ICBA 2Q4UA 1CM1A 3NHIA 2Y5IA 2F2PA 1AK8A 2JT0A 3DF0A 1QX2A 4PALA 4PE1A 4QJ4B 1YVHA 1IKUA 2JTTA 3AAJA 1OOHA 1TCFA 1EH2A 3FWBA 2L2EA 3TDIA 1F8HA 1NCXA 4DS7A 3TZ1A 1YX8A 2Y1MA 1CKKA 4CFRA 3PFVA 3ZWHA 2QACA 1K9UA 1F70A 1M63B 3SG5A 1TCOB 3DF0B 3DY9A 1YX7A 2AAOA 1ZOTB 2NCPA 1G33A 3BUOB 4CLNA 3EK4A 5AANA 4YI8A 2AUCA 5I2OA 1Y1XA 1KWOB 2BNXA 1H8BA 1BOCA 2LVVA 3B87A 3RLZA 3SG2A 1KFXL 2L5YA 4XYNA 4U8DA 2KDHA 3EVUA 1SCMB 2LHIA 3O6BA 3WXAA 1B9AA 4QJ5B 1G4YR 1MWNA 1TIZA 4PHNA 1RFJA 1RJVA 2QEVA 4MN0A 1C7VA 2WCMA 3I5FC 1XFWO 4GGFA 4L9MA 4PHKA 2JXLA 2FCDA 1OMDA 1NX3A 2JPOA 3D10A 3I5HB 4YGBB 2OS8B 4CPVA 1GM0A 4XJKA 2MLEC 1NX0A 1WLZA 4OCIA 1XK4C 1YUUA 1QXPA 2HETA 1QWVA 1OOIX 2L51A 3VRRA 4YI9A 3CZTX 1DQEA 1SL7A 1E8AA 2KAVA 3ZNIA 1MF8B 5JOLA 1QLKA 3SIAA 4P5OE 2K8MB 4XJKB 1WDCC 2EC6B 1C3YA 4CIDA 1KK7Z 2I7AA 2WC8A 3L4AA 1NSHA 1L2OC 1V1FA 1ZMZA 1NX2A 2OTGB 1OOFA 3RZSA 1YRUB 2ZNEA 3CR5X 1IIOA 1NUBA 2BL0B 3BOWA 1AJ4A 1TUJA 2LV7A 4TNCA 4INWA 1Y1AA 2WNDA 3K1EA 3DD4A 3L4LA 1CFFA 1RWYA 1WY9A 5JJGA 1YTZC 3LL8B 3I5FB 1ALWA 2WOSA 3NHTA 3QMEA 4I5KA 1XFYO 1QJTA 3DVEA 4MEWA 4JKTA 3BOWB 2QEBA 3R72A 2LNKA 2LLUA 4D1EA 1EG4A 5FI6A 1IJ6A 1SRAA 5D69A 1DJZA 2K7OA 5F6TA 1J7RA 3PJIA 5FI2A 3LK1A 2FCEA 1UHHA 3NSOA 3AKAA 3SJSA 3DVJA 2QEOA 3F45A 5G08A 1UURA 1BR1B 1MR8A 4PCWA 1L2OB 2OPOA 2KSPA 1S6CA 4WRIA 1SR6C 3HX4A 2K7CA 5HKYA 1S26D 1DJGA 3S0FA 1S36A 1UHNA 3O78A 1B4CA 3BUWB 3CTNA 3S0BA 5AFPA 1BT6A 4UPGA 1SY9A 1GQMA 3BJHA 2LANA 1N0YA 3NXAA 4I5JA 4Q04A 2ZRSA 3A4UB 2MAZA 3I5IB 1EG3A 4FQTA 3MSEB 1BLQA 1TN4A 3DZTA 2R2IA 3EK7A 1SKTA 3KEVA 3R1VA 4PHMA 3WHUB 3BQ3A 2F8PA 2KLEA 2KHNA 1ZUZA 1OOGA 1IG5A 1XO5A 2GGMA 1PSBA 1TOPA 2HQWA 2ZN8A 3JVTC 1IWQA 2KYFA 2WCEA 4IJ7A 5IBWA 3OX5A 5K89A 3I5GC 2WCFA 4M2QA 3TS5B 1VRKA 5KU1A 2G9BA 2K7BA 3N7HA 3ICBA 2I2RE 4GPLB 3CABA 4OV2A 4DRWA 1CFCA 1S3PA 2JNFA 5KTYA 1QIWA 1UHKA 2SASA 3VRNA 2LUXA 1FI6A 1XA5A 1UP5A 4HREE 1YUTA 1TNXA 3D75A 1K2HA 1WRKA 2CNPA 2WCBA 2YGUA 1W7JB 1GGZA 3O2PA 3PN7C 3B7AA 4GUKA 2H61A 2MRDA 1ZACA 1ALVA 2BCAA 3KPXA 1K90D 2ZFDA 1MXEA 2KOTA 2PRUA 4ORBB 1TRFA 2COLB 1DEKA 1B1GA 2KAYA 2WCHA 2LMVA 3AKBA 2P70A 1AHRA 5CPVA 1MUXA 1GGWA 3DVMA 2H8VA 1B7TY 2JPTA 4C0JA 2LLSA 4MBEA 1W7IB 1CMFA 4OZDA 1SSEB 1DJWA 3OBVA 1LA0A 1XFRA 4WQ3A 1OQPA 1TUZA 2L2CA 3FE6A 2LHLA 3CLNA 3WNXB 4A4BA 4E68A 1BG1A 2PYQA 1K93D 1IRJA 1XFZO 2F33A 2LCPA 1WLMA 1NYAA 2BE6A 2M7LA 1HT9A 1TNQA 4YBHB 4YGEB 1QV1A 2LMTA 4KYNA 3PN7B 2LVKA 4AOMA 2I18A 1XFXO 5FYXA 2ZNDA 1X02A 1DJXA 1QIVA 3SS5A 1CFDA 2M1KB 3SG6A 1NPQA 1KSOA 4A4CA 1M39A 2WC6A 1RROA 2LAPA 3PALA 3R1OA 5CSIA 2JZIA 5AXIA 3S0EA 3TUYC 1DELA 1YUSA 2M97A 1Q80A 3K21A 3DXLA 4MZJA 4DUQA 1QATA 3HCMA 2KPHA 1PALA 2O60A 2L50A 2PVBA 1CDPA 1BR4B 2IS9A 2BAPA 4I5NB 1CNPA 3SIBA 3VRPA 1A4PA 2NLNA 1DT7B 2JC2A 3PSRA 4PHJA 1JSAA 1F55A 3OHMB 1M46A 4GGNA 2CT9A 1Z4HA 1P28A 3Q8IA 4N5XA 1LS8A 5I94A 1LXFC 1IH0A 4ZCUA 1OMRA 1WRLA 2EHBA 1LINA 1GJYA 1IGVA 2KLDA 2CTNA 1Y1UA 3D76A 3EK8A 1MXLC 3D77A 1C3ZA 1ZFSA 1A75A 1QVIY 2DOQA 2K61A 3GK2A 2VRGA 4I5LB 4GFTA 4BY4A 4WQ2A 5HYDA 1XK4A 5AEQA 2LVIA 2MHHA 3BFBA 1KFUL 1K8UA 3BFHA 4AQIA 5DKQA 1SBJA 1NX1A 1L7ZA 1TNWA 3H4SE 3NSLA 2CCMA 3QRXA 5D7FA 1K9PA 1KQVA 1B7TZ 1N65A 3FE9A 3S0AA 4JWQA 3PM2A 1CTRA 1Y0VH 2JXCA 2NXQA 1KFUS 2NCOA 2ZRTA 2M1UA 1CB1A 4AQJA 1OSAA 1FW4A 3V2LA 2KFGA 3CDNA 2LM5A 1WDCB 2KGRA 5HLOA 5TNCA 2PASA 2HQ8A 2KFFA 4OKHA 1AP4A 1J7QA 4INXA 4YGDB 4NDBA 1F4QA 2MLFC 4M2PA 5HKZA 3OP0A 4C0KA 1CLLA 1AUIB 1F71A 1KQMC 2D8NA 3C1VA 1K95A 3O4YA 3CWGA 2WCKA 1S5GY 3VROA 1DGUA 3S0DA 1J1EA 1F54A 4N1GA 1OZSA 2JNXA 3VRQA 1DJHA 3SG7A 3SG4A 1CLMA 5KSZA 3CR4X 2B1UA 4MRYA 1XFUO 3PM8A 1KSMA 1ORGA 1SW8A 5HLVA 4GBAA 2KQ6A 1MQ1A 2GTEA 1C7WA 5BPJA 1SPYA 3LK0A 3M0WA 1FF1A 1IJ5A 1M45A 2HF5A 1J7OA 3KF9A 1D1OA 2BCBA 1LA3A 4NDDA 2CXJA 2O5GA 1DVIA 5DKRA 1J1DA 2LC5A 2SCPA 3PATA 1JWDA 2KI4C 2RGIA 1XFVO 4ORCB 1FPWA 3NGVA 1S6IA 1SR6B 3EKJA 4M2OA 1QVIZ 2LUCA 1RECA 1K94A 1B47A 5CSFA 3SS3A 4MRXA 1U5IA 2PQLA 2QPTA 3BYAA 3BUXB 1CFPA 2WCLA 1OMVA 4MLWA 1B8CA 1SL9A 2KBIA 4HRGA 3OX6A 2LE9B 1BJFA 1LVCD 2L5XB 1J55A 2JOJA 3OB2B 1U5IB 4BY5A 1DJIA 3CR2A 2M0RA 3CZ0A 3FS7A 3JVTB 3RM1A 1KK7Y 4YGAA 3I5GB 4NDCA 1YR5A 3D0YA 3B88A 3FWCA 3IF7A 1PK0D 1R2UA 3BUMB 3PLFB 1YVLA 5EL2A 4C0LA 1SYMA 1W9ZA 4DIRA 2GGZA 1SK6D 4MVFA 1SL8A 1YURA 2WCJA 2K2AA 2GV5A 1N2DA 3FE8A 1B8RA 2P6BB 3OGNA 1DMOA 4PE7A 2KI4B 2JWWA 3D0YB 3L47A 2PALA 1QX5B 4ZCVA 1G8IA 3R1PA 4MZKA 4MSPA 3I5HC 2QEHA 2OS8C 1CLBA 1S5GZ 1PVBA 1UUSA 4ETOA 1SCVA 5HKWA 4OVNF 1LKJA 2JTZA 2BBMA 1RK9A 1DJYA 1TTXA 1JF0A 1UHJA 1UWOA 1XYDA 2F2OA 2JU0A 3EVVA 1TWOA 5GQQC 1PSRA 2JRFA 5J3XA 2K2FA 4GGFC 4PT1A 3JTDC 2MBXA 1M31A 1JFKA 2I94A 2WORA 5DICA 1NCYA 3O4XA 2EC6C 2Q91A 1IQ5A 5D3OA 4JD9A 5ER4X 1EXRA 4P2YB 2BBNA 1A03A 2G2BA 3CYZA 2M49B 3FIAA 3GK1A 4F7FA 2OTGC 1C07A 2LP3A 1CDLA 3D78A 3VB1A 2BL0C 1BMOA 2L98A 1CDNA 3NSIA 2V53A 2K60A 5I8NA 1PVAA 2F3YA 1QV0A 1NWDA 3B86A 1NIWA 2FJYA 2TN4A 4FQOA 4HSZA 3IQQA 3IQOA 4ORAB 4YGCB 5I2LA 5HL1A 3CZ1A 3EVRA 2LP2A 4MZLA 1J7PA 2MA2A 1HQVA 1KFXS 2A4JA 5ER5A 2LVJA 5B8IB 1PRWA 2Y4QA 3WHTB 1IQ3A 1KCYA 4PDZA 3GOFA 2L4IA 2KAXA 1CDMA 2ERBA 1BU3A 3TUYB 3E3RA 1Y6WA 3BFAA 3JTDB 1A75B 2PMYA 1K9KA 1JC2A 1K96A 3LCPC 1MHOA 4JPZB 5CSNA 2KGBC 1CM4A 1QASA 1JFJA 4USLA 2JULA 1DGVA 2KNEA 1H4BA 3D73A 2KYCA 2L0PA 3GK4X 2BKHB 2ZKMX 1A29A 2KI6D 2M3WA 1PULA 4PE0A 3D74A 4JQ0D 4GNKB 3AAKA 1SNLA 1WRZA 3I5IC 1NCZA 3NSKA 4N1FA 2MJWB 3VGOA 1OZOA 5I2QA 3KO0A 3BUNB 4OR9B 2FJUB 5FI7A 2AMIA 1XVJA 2JT8A 1OOJA 2KI6C 3EKHA 2BE4A 2JQ6A 1DC1A 2E30A 1AVSA 1JUOA 2PSRA 4IL1A 3TS5C 1RTP1 2L4HA 1QTXA 2K0JA 1YRTB 1KK8C 3CZ2A 4PE4A 5PALA 2FOTA 3S0GA 3UO9A
chains in the Genus database with same CATH topology
3BXKA 1NP8A 4HRHA 1A2XA 2CBLA 2KBMA 2LMUA 4FTGA 2NZ0A 1UHIA 1V1GA 2JT3A 5CSJA 3TDZA 2BCXA 2EGDA 2M29A 3DVKA 1DF0A 1S1EA 4GAOA 2M8UA 1R6PA 2Y1NA 2ZN9A 4CFQA 4F0ZB 3CS1A 1KQMB 2K7DA 3LLEA 2H61C 2KFHA 1ODBA 2HPSA 3CGAA 4YRUA 1DF0B 1OE9B 4R1EA 1SMGA 3SG3A 1JF2A 1F4OA 1FI5A 2F3ZA 1QX7A 1EL4A 2M7NA 2BECA 2M9GA 4QJ3B 1KK8B 1QS7A 2BKIB 1AJ5A 5DKNA 1FBVA 1JBAA 1EJ3A 1BODA 1CMGA 2H2KA 4DCKA 2LLTA 4NQGA 2E6WA 1KWOC 1S6JA 2ISDA 3TDUA 3KHEA 1SCMC 3A8RA 2KQYA 1TNPA 5AERA 1B8LA 3OB1B 1QLSA 1DTLA 1BF5A 4ICBA 2Q4UA 1CM1A 2Y5IA 2F2PA 1AK8A 2JT0A 3DF0A 1QX2A 4PALA 4PE1A 4QJ4B 1YVHA 1IKUA 2JTTA 3AAJA 1TCFA 1EH2A 3FWBA 2L2EA 3TDIA 1F8HA 1NCXA 4DS7A 3TZ1A 1YX8A 2Y1MA 1CKKA 4CFRA 3PFVA 3ZWHA 2QACA 1K9UA 1F70A 1M63B 3SG5A 1TCOB 3DF0B 1YX7A 2AAOA 1ZOTB 2NCPA 1G33A 3BUOB 4CLNA 3EK4A 5AANA 4YI8A 2AUCA 5I2OA 1Y1XA 1KWOB 1H8BA 1BOCA 2LVVA 3RLZA 3SG2A 1KFXL 4XYNA 4U8DA 2KDHA 3EVUA 1SCMB 2LHIA 3O6BA 3WXAA 1B9AA 4QJ5B 1G4YR 1MWNA 1TIZA 4PHNA 1RFJA 1RJVA 4MN0A 1C7VA 3I5FC 1XFWO 4GGFA 4L9MA 4PHKA 2JXLA 2FCDA 1OMDA 1NX3A 3D10A 3I5HB 4YGBB 2OS8B 4CPVA 4XJKA 2MLEC 1NX0A 1WLZA 4OCIA 1XK4C 1YUUA 1QXPA 2HETA 2L51A 3VRRA 4YI9A 3CZTX 1SL7A 1E8AA 2KAVA 3ZNIA 1MF8B 5JOLA 1QLKA 3SIAA 4P5OE 2K8MB 4XJKB 1WDCC 2EC6B 4CIDA 1KK7Z 2I7AA 2WC8A 1NSHA 1L2OC 1V1FA 1ZMZA 1NX2A 2OTGB 1YRUB 2ZNEA 3CR5X 1NUBA 2BL0B 3BOWA 1AJ4A 2LV7A 4TNCA 1Y1AA 2WNDA 3DD4A 1CFFA 1RWYA 1WY9A 5JJGA 1YTZC 3LL8B 3I5FB 1ALWA 2WOSA 4I5KA 1XFYO 1QJTA 3DVEA 4MEWA 3BOWB 2LNKA 2LLUA 4D1EA 1EG4A 1IJ6A 1SRAA 5D69A 1DJZA 2K7OA 5F6TA 1J7RA 3LK1A 2FCEA 1UHHA 3NSOA 3AKAA 3SJSA 3DVJA 3F45A 5G08A 1UURA 1BR1B 1MR8A 4PCWA 1L2OB 2OPOA 2KSPA 1S6CA 4WRIA 1SR6C 3HX4A 2K7CA 5HKYA 1S26D 1DJGA 1S36A 1UHNA 3O78A 1B4CA 3BUWB 3CTNA 5AFPA 1BT6A 4UPGA 1SY9A 1GQMA 2LANA 1N0YA 3NXAA 4I5JA 4Q04A 2ZRSA 3A4UB 2MAZA 3I5IB 1EG3A 3MSEB 1BLQA 1TN4A 3KEVA 2R2IA 3EK7A 1SKTA 4PHMA 3WHUB 3BQ3A 2F8PA 2KHNA 1XO5A 1ZUZA 1IG5A 2GGMA 2HQWA 1PSBA 1TOPA 2ZN8A 3JVTC 1IWQA 2KYFA 2WCEA 5IBWA 5K89A 3OX5A 3I5GC 2WCFA 4M2QA 3TS5B 1VRKA 5KU1A 2G9BA 2K7BA 4GPLB 3ICBA 2I2RE 4OV2A 1CFCA 4DRWA 1S3PA 2JNFA 5KTYA 1QIWA 1UHKA 2SASA 3VRNA 2LUXA 1FI6A 1XA5A 1UP5A 4HREE 1YUTA 1TNXA 1K2HA 1WRKA 2CNPA 2WCBA 1W7JB 1GGZA 3O2PA 3PN7C 4GUKA 2H61A 2MRDA 1ZACA 1ALVA 2BCAA 3KPXA 1K90D 2ZFDA 1MXEA 2KOTA 2PRUA 4ORBB 1TRFA 2COLB 1B1GA 2KAYA 2LMVA 3AKBA 1AHRA 5CPVA 1MUXA 1GGWA 3DVMA 1B7TY 2JPTA 4C0JA 2LLSA 4MBEA 1W7IB 1CMFA 1DJWA 1LA0A 4WQ3A 1OQPA 1BG1A 2LHLA 3CLNA 3WNXB 4A4BA 4E68A 1K93D 1IRJA 1XFZO 2F33A 2LCPA 1WLMA 1NYAA 2BE6A 2M7LA 1HT9A 1TNQA 4YBHB 4YGEB 1QV1A 2LMTA 3PN7B 2LVKA 4AOMA 2I18A 1XFXO 5FYXA 2ZNDA 1X02A 1DJXA 1QIVA 1CFDA 2M1KB 3SG6A 1NPQA 1KSOA 4A4CA 1M39A 1RROA 2LAPA 3PALA 5CSIA 5AXIA 2JZIA 3TUYC 1YUSA 2M97A 1Q80A 3K21A 4MZJA 4DUQA 1QATA 3HCMA 2O60A 1PALA 2L50A 2PVBA 1CDPA 1BR4B 2IS9A 4I5NB 1CNPA 3SIBA 3VRPA 1A4PA 2NLNA 1DT7B 2JC2A 3PSRA 4PHJA 1JSAA 1F55A 3OHMB 1M46A 4GGNA 2CT9A 4N5XA 1LXFC 1IH0A 4ZCUA 1OMRA 1WRLA 2EHBA 1LINA 1GJYA 1IGVA 2CTNA 1Y1UA 3EK8A 1MXLC 1ZFSA 1A75A 1QVIY 2DOQA 2K61A 3GK2A 2VRGA 4I5LB 4GFTA 4BY4A 4WQ2A 5HYDA 1XK4A 5AEQA 2LVIA 2MHHA 1KFUL 1K8UA 4AQIA 5DKQA 1SBJA 1NX1A 1L7ZA 1TNWA 3H4SE 3NSLA 2CCMA 3QRXA 5D7FA 1K9PA 1KQVA 1B7TZ 1N65A 4JWQA 1CTRA 1Y0VH 2JXCA 2NXQA 1KFUS 2NCOA 2ZRTA 2M1UA 1CB1A 4AQJA 1OSAA 1FW4A 2KFGA 2LM5A 1WDCB 2KGRA 5HLOA 5TNCA 2PASA 2HQ8A 2KFFA 4OKHA 1AP4A 1J7QA 4YGDB 4NDBA 1F4QA 2MLFC 4M2PA 5HKZA 3OP0A 4C0KA 1CLLA 1AUIB 1F71A 1KQMC 2D8NA 3C1VA 1K95A 3O4YA 3CWGA 3VROA 1S5GY 1DGUA 1J1EA 1F54A 4N1GA 1OZSA 2JNXA 3VRQA 1DJHA 3SG7A 3SG4A 1CLMA 5KSZA 3CR4X 2B1UA 4MRYA 1XFUO 3PM8A 1KSMA 1SW8A 5HLVA 4GBAA 2KQ6A 1MQ1A 1C7WA 5BPJA 1SPYA 3LK0A 3M0WA 1FF1A 1IJ5A 1M45A 2HF5A 1J7OA 3KF9A 1D1OA 2BCBA 1LA3A 4NDDA 2CXJA 2O5GA 1DVIA 5DKRA 1J1DA 2LC5A 2SCPA 3PATA 1JWDA 2KI4C 2RGIA 1XFVO 4ORCB 1FPWA 1S6IA 1SR6B 3EKJA 4M2OA 1QVIZ 2LUCA 1RECA 1K94A 1B47A 5CSFA 4MRXA 1U5IA 2QPTA 3BYAA 3BUXB 1CFPA 1OMVA 4MLWA 1B8CA 1SL9A 2KBIA 4HRGA 3OX6A 2LE9B 1BJFA 1LVCD 2L5XB 1J55A 2JOJA 3OB2B 1U5IB 4BY5A 1DJIA 3CR2A 2M0RA 3FS7A 3JVTB 3RM1A 1KK7Y 4YGAA 3I5GB 4NDCA 1YR5A 3D0YA 3FWCA 3IF7A 1PK0D 1R2UA 3BUMB 3PLFB 1YVLA 4C0LA 1SYMA 4DIRA 2GGZA 1SK6D 4MVFA 1SL8A 1YURA 2K2AA 2GV5A 1N2DA 1DMOA 1B8RA 2P6BB 4PE7A 2KI4B 2JWWA 3D0YB 2PALA 1QX5B 4ZCVA 1G8IA 4MZKA 4MSPA 3I5HC 2OS8C 1CLBA 1S5GZ 1PVBA 1UUSA 4ETOA 1SCVA 5HKWA 4OVNF 1LKJA 2JTZA 2BBMA 1RK9A 1DJYA 1TTXA 1JF0A 1UHJA 1UWOA 1XYDA 2F2OA 2JU0A 3EVVA 5GQQC 1PSRA 2JRFA 5J3XA 2K2FA 4GGFC 2MBXA 3JTDC 1M31A 1JFKA 2I94A 2WORA 1NCYA 5ER4X 2EC6C 2Q91A 1IQ5A 1EXRA 4P2YB 2BBNA 1A03A 2G2BA 2M49B 3FIAA 3GK1A 2OTGC 1C07A 2LP3A 1CDLA 2BL0C 1BMOA 2L98A 1CDNA 3NSIA 2V53A 5I8NA 1PVAA 2F3YA 1QV0A 1NWDA 4FQOA 1NIWA 2TN4A 4HSZA 3IQQA 3IQOA 4ORAB 4YGCB 5I2LA 3EVRA 2LP2A 4MZLA 1J7PA 2MA2A 1HQVA 1KFXS 2A4JA 5ER5A 2LVJA 5B8IB 1PRWA 2Y4QA 3WHTB 1IQ3A 1KCYA 4PDZA 3GOFA 2L4IA 2KAXA 1CDMA 1BU3A 3TUYB 3E3RA 1Y6WA 1JC2A 3JTDB 1A75B 2PMYA 1K9KA 1K96A 3LCPC 1MHOA 4JPZB 5CSNA 2KGBC 1CM4A 1QASA 1JFJA 4USLA 2JULA 1DGVA 2KNEA 1H4BA 3GK4X 2KYCA 2L0PA 2BKHB 2ZKMX 1A29A 2KI6D 2M3WA 1PULA 4PE0A 4JQ0D 4GNKB 3AAKA 1SNLA 1WRZA 3I5IC 1NCZA 3NSKA 4N1FA 2MJWB 3VGOA 1OZOA 5I2QA 3KO0A 3BUNB 4OR9B 2FJUB 2AMIA 1XVJA 2JT8A 1OOJA 2KI6C 3EKHA 2BE4A 2JQ6A 2E30A 1AVSA 1JUOA 2PSRA 4IL1A 3TS5C 1RTP1 2L4HA 1QTXA 2K0JA 1YRTB 1KK8C 4PE4A 5PALA 2FOTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BXK A;  1NP8 A;  4HRH A;  1A2X A;  2CBL A;  2KBM A;  2LMU A;  4FTG A;  2NZ0 A;  1UHI A;  1V1G A;  2JT3 A;  5CSJ A;  3TDZ A;  2BCX A;  2EGD A;  2M29 A;  3DVK A;  1DF0 A;  1S1E A;  4GAO A;  2M8U A;  1R6P A;  2Y1N A;  2ZN9 A;  4CFQ A;  4F0Z B;  3CS1 A;  1KQM B;  2K7D A;  3LLE A;  2H61 C;  2KFH A;  1ODB A;  2HPS A;  3CGA A;  4YRU A;  1DF0 B;  1OE9 B;  4R1E A;  1SMG A;  3SG3 A;  1JF2 A;  1F4O A;  1FI5 A;  2F3Z A;  1QX7 A;  1EL4 A;  2M7N A;  2BEC A;  2M9G A;  4QJ3 B;  1KK8 B;  1QS7 A;  2BKI B;  1AJ5 A;  5DKN A;  1FBV A;  1JBA A;  1EJ3 A;  1BOD A;  1CMG A;  2H2K A;  4DCK A;  2LLT A;  4NQG A;  2E6W A;  1KWO C;  1S6J A;  2ISD A;  3TDU A;  3KHE A;  1SCM C;  3A8R A;  2KQY A;  1TNP A;  5AER A;  1B8L A;  3OB1 B;  1QLS A;  1DTL A;  1BF5 A;  4ICB A;  2Q4U A;  1CM1 A;  2Y5I A;  2F2P A;  1AK8 A;  2JT0 A;  3DF0 A;  1QX2 A;  4PAL A;  4PE1 A;  4QJ4 B;  1YVH A;  1IKU A;  2JTT A;  3AAJ A;  1TCF A;  1EH2 A;  3FWB A;  2L2E A;  3TDI A;  1F8H A;  1NCX A;  4DS7 A;  3TZ1 A;  1YX8 A;  2Y1M A;  1CKK A;  4CFR A;  3PFV A;  3ZWH A;  2QAC A;  1K9U A;  1F70 A;  1M63 B;  3SG5 A;  1TCO B;  3DF0 B;  1YX7 A;  2AAO A;  1ZOT B;  2NCP A;  1G33 A;  3BUO B;  4CLN A;  3EK4 A;  5AAN A;  4YI8 A;  2AUC A;  5I2O A;  1Y1X A;  1KWO B;  1H8B A;  1BOC A;  2LVV A;  3RLZ A;  3SG2 A;  1KFX L;  4XYN A;  4U8D A;  2KDH A;  3EVU A;  1SCM B;  2LHI A;  3O6B A;  3WXA A;  1B9A A;  4QJ5 B;  1G4Y R;  1MWN A;  1TIZ A;  4PHN A;  1RFJ A;  1RJV A;  4MN0 A;  1C7V A;  3I5F C;  1XFW O;  4GGF A;  4L9M A;  4PHK A;  2JXL A;  2FCD A;  1OMD A;  1NX3 A;  3D10 A;  3I5H B;  4YGB B;  2OS8 B;  4CPV A;  4XJK A;  2MLE C;  1NX0 A;  1WLZ A;  4OCI A;  1XK4 C;  1YUU A;  1QXP A;  2HET A;  2L51 A;  3VRR A;  4YI9 A;  3CZT X;  1SL7 A;  1E8A A;  2KAV A;  3ZNI A;  1MF8 B;  5JOL A;  1QLK A;  3SIA A;  4P5O E;  2K8M B;  4XJK B;  1WDC C;  2EC6 B;  4CID A;  1KK7 Z;  2I7A A;  2WC8 A;  1NSH A;  1L2O C;  1V1F A;  1ZMZ A;  1NX2 A;  2OTG B;  1YRU B;  2ZNE A;  3CR5 X;  1NUB A;  2BL0 B;  3BOW A;  1AJ4 A;  2LV7 A;  4TNC A;  1Y1A A;  2WND A;  3DD4 A;  1CFF A;  1RWY A;  1WY9 A;  5JJG A;  1YTZ C;  3LL8 B;  3I5F B;  1ALW A;  2WOS A;  4I5K A;  1XFY O;  1QJT A;  3DVE A;  4MEW A;  3BOW B;  2LNK A;  2LLU A;  4D1E A;  1EG4 A;  1IJ6 A;  1SRA A;  5D69 A;  1DJZ A;  2K7O A;  5F6T A;  1J7R A;  3LK1 A;  2FCE A;  1UHH A;  3NSO A;  3AKA A;  3SJS A;  3DVJ A;  3F45 A;  5G08 A;  1UUR A;  1BR1 B;  1MR8 A;  4PCW A;  1L2O B;  2OPO A;  2KSP A;  1S6C A;  4WRI A;  1SR6 C;  3HX4 A;  2K7C A;  5HKY A;  1S26 D;  1DJG A;  1S36 A;  1UHN A;  3O78 A;  1B4C A;  3BUW B;  3CTN A;  5AFP A;  1BT6 A;  4UPG A;  1SY9 A;  1GQM A;  2LAN A;  1N0Y A;  3NXA A;  4I5J A;  4Q04 A;  2ZRS A;  3A4U B;  2MAZ A;  3I5I B;  1EG3 A;  3MSE B;  1BLQ A;  1TN4 A;  3KEV A;  2R2I A;  3EK7 A;  1SKT A;  4PHM A;  3WHU B;  3BQ3 A;  2F8P A;  2KHN A;  1XO5 A;  1ZUZ A;  1IG5 A;  2GGM A;  2HQW A;  1PSB A;  1TOP A;  2ZN8 A;  3JVT C;  1IWQ A;  2KYF A;  2WCE A;  5IBW A;  5K89 A;  3OX5 A;  3I5G C;  2WCF A;  4M2Q A;  3TS5 B;  1VRK A;  5KU1 A;  2G9B A;  2K7B A;  4GPL B;  3ICB A;  2I2R E;  4OV2 A;  1CFC A;  4DRW A;  1S3P A;  2JNF A;  5KTY A;  1QIW A;  1UHK A;  2SAS A;  3VRN A;  2LUX A;  1FI6 A;  1XA5 A;  1UP5 A;  4HRE E;  1YUT A;  1TNX A;  1K2H A;  1WRK A;  2CNP A;  2WCB A;  1W7J B;  1GGZ A;  3O2P A;  3PN7 C;  4GUK A;  2H61 A;  2MRD A;  1ZAC A;  1ALV A;  2BCA A;  3KPX A;  1K90 D;  2ZFD A;  1MXE A;  2KOT A;  2PRU A;  4ORB B;  1TRF A;  2COL B;  1B1G A;  2KAY A;  2LMV A;  3AKB A;  1AHR A;  5CPV A;  1MUX A;  1GGW A;  3DVM A;  1B7T Y;  2JPT A;  4C0J A;  2LLS A;  4MBE A;  1W7I B;  1CMF A;  1DJW A;  1LA0 A;  4WQ3 A;  1OQP A;  1BG1 A;  2LHL A;  3CLN A;  3WNX B;  4A4B A;  4E68 A;  1K93 D;  1IRJ A;  1XFZ O;  2F33 A;  2LCP A;  1WLM A;  1NYA A;  2BE6 A;  2M7L A;  1HT9 A;  1TNQ A;  4YBH B;  4YGE B;  1QV1 A;  2LMT A;  3PN7 B;  2LVK A;  4AOM A;  2I18 A;  1XFX O;  5FYX A;  2ZND A;  1X02 A;  1DJX A;  1QIV A;  1CFD A;  2M1K B;  3SG6 A;  1NPQ A;  1KSO A;  4A4C A;  1M39 A;  1RRO A;  2LAP A;  3PAL A;  5CSI A;  5AXI A;  2JZI A;  3TUY C;  1YUS A;  2M97 A;  1Q80 A;  3K21 A;  4MZJ A;  4DUQ A;  1QAT A;  3HCM A;  2O60 A;  1PAL A;  2L50 A;  2PVB A;  1CDP A;  1BR4 B;  2IS9 A;  4I5N B;  1CNP A;  3SIB A;  3VRP A;  1A4P A;  2NLN A;  1DT7 B;  2JC2 A;  3PSR A;  4PHJ A;  1JSA A;  1F55 A;  3OHM B;  1M46 A;  4GGN A;  2CT9 A;  4N5X A;  1LXF C;  1IH0 A;  4ZCU A;  1OMR A;  1WRL A;  2EHB A;  1LIN A;  1GJY A;  1IGV A;  2CTN A;  1Y1U A;  3EK8 A;  1MXL C;  1ZFS A;  1A75 A;  1QVI Y;  2DOQ A;  2K61 A;  3GK2 A;  2VRG A;  4I5L B;  4GFT A;  4BY4 A;  4WQ2 A;  5HYD A;  1XK4 A;  5AEQ A;  2LVI A;  2MHH A;  1KFU L;  1K8U A;  4AQI A;  5DKQ A;  1SBJ A;  1NX1 A;  1L7Z A;  1TNW A;  3H4S E;  3NSL A;  2CCM A;  3QRX A;  5D7F A;  1K9P A;  1KQV A;  1B7T Z;  1N65 A;  4JWQ A;  1CTR A;  1Y0V H;  2JXC A;  2NXQ A;  1KFU S;  2NCO A;  2ZRT A;  2M1U A;  1CB1 A;  4AQJ A;  1OSA A;  1FW4 A;  2KFG A;  2LM5 A;  1WDC B;  2KGR A;  5HLO A;  5TNC A;  2PAS A;  2HQ8 A;  2KFF A;  4OKH A;  1AP4 A;  1J7Q A;  4YGD B;  4NDB A;  1F4Q A;  2MLF C;  4M2P A;  5HKZ A;  3OP0 A;  4C0K A;  1CLL A;  1AUI B;  1F71 A;  1KQM C;  2D8N A;  3C1V A;  1K95 A;  3O4Y A;  3CWG A;  3VRO A;  1S5G Y;  1DGU A;  1J1E A;  1F54 A;  4N1G A;  1OZS A;  2JNX A;  3VRQ A;  1DJH A;  3SG7 A;  3SG4 A;  1CLM A;  5KSZ A;  3CR4 X;  2B1U A;  4MRY A;  1XFU O;  3PM8 A;  1KSM A;  1SW8 A;  5HLV A;  4GBA A;  2KQ6 A;  1MQ1 A;  1C7W A;  5BPJ A;  1SPY A;  3LK0 A;  3M0W A;  1FF1 A;  1IJ5 A;  1M45 A;  2HF5 A;  1J7O A;  3KF9 A;  1D1O A;  2BCB A;  1LA3 A;  4NDD A;  2CXJ A;  2O5G A;  1DVI A;  5DKR A;  1J1D A;  2LC5 A;  2SCP A;  3PAT A;  1JWD A;  2KI4 C;  2RGI A;  1XFV O;  4ORC B;  1FPW A;  1S6I A;  1SR6 B;  3EKJ A;  4M2O A;  1QVI Z;  2LUC A;  1REC A;  1K94 A;  1B47 A;  5CSF A;  4MRX A;  1U5I A;  2QPT A;  3BYA A;  3BUX B;  1CFP A;  1OMV A;  4MLW A;  1B8C A;  1SL9 A;  2KBI A;  4HRG A;  3OX6 A;  2LE9 B;  1BJF A;  1LVC D;  2L5X B;  1J55 A;  2JOJ A;  3OB2 B;  1U5I B;  4BY5 A;  1DJI A;  3CR2 A;  2M0R A;  3FS7 A;  3JVT B;  3RM1 A;  1KK7 Y;  4YGA A;  3I5G B;  4NDC A;  1YR5 A;  3D0Y A;  3FWC A;  3IF7 A;  1PK0 D;  1R2U A;  3BUM B;  3PLF B;  1YVL A;  4C0L A;  1SYM A;  4DIR A;  2GGZ A;  1SK6 D;  4MVF A;  1SL8 A;  1YUR A;  2K2A A;  2GV5 A;  1N2D A;  1DMO A;  1B8R A;  2P6B B;  4PE7 A;  2KI4 B;  2JWW A;  3D0Y B;  2PAL A;  1QX5 B;  4ZCV A;  1G8I A;  4MZK A;  4MSP A;  3I5H C;  2OS8 C;  1CLB A;  1S5G Z;  1PVB A;  1UUS A;  4ETO A;  1SCV A;  5HKW A;  4OVN F;  1LKJ A;  2JTZ A;  2BBM A;  1RK9 A;  1DJY A;  1TTX A;  1JF0 A;  1UHJ A;  1UWO A;  1XYD A;  2F2O A;  2JU0 A;  3EVV A;  5GQQ C;  1PSR A;  2JRF A;  5J3X A;  2K2F A;  4GGF C;  2MBX A;  3JTD C;  1M31 A;  1JFK A;  2I94 A;  2WOR A;  1NCY A;  5ER4 X;  2EC6 C;  2Q91 A;  1IQ5 A;  1EXR A;  4P2Y B;  2BBN A;  1A03 A;  2G2B A;  2M49 B;  3FIA A;  3GK1 A;  2OTG C;  1C07 A;  2LP3 A;  1CDL A;  2BL0 C;  1BMO A;  2L98 A;  1CDN A;  3NSI A;  2V53 A;  5I8N A;  1PVA A;  2F3Y A;  1QV0 A;  1NWD A;  4FQO A;  1NIW A;  2TN4 A;  4HSZ A;  3IQQ A;  3IQO A;  4ORA B;  4YGC B;  5I2L A;  3EVR A;  2LP2 A;  4MZL A;  1J7P A;  2MA2 A;  1HQV A;  1KFX S;  2A4J A;  5ER5 A;  2LVJ A;  5B8I B;  1PRW A;  2Y4Q A;  3WHT B;  1IQ3 A;  1KCY A;  4PDZ A;  3GOF A;  2L4I A;  2KAX A;  1CDM A;  1BU3 A;  3TUY B;  3E3R A;  1Y6W A;  1JC2 A;  3JTD B;  1A75 B;  2PMY A;  1K9K A;  1K96 A;  3LCP C;  1MHO A;  4JPZ B;  5CSN A;  2KGB C;  1CM4 A;  1QAS A;  1JFJ A;  4USL A;  2JUL A;  1DGV A;  2KNE A;  1H4B A;  3GK4 X;  2KYC A;  2L0P A;  2BKH B;  2ZKM X;  1A29 A;  2KI6 D;  2M3W A;  1PUL A;  4PE0 A;  4JQ0 D;  4GNK B;  3AAK A;  1SNL A;  1WRZ A;  3I5I C;  1NCZ A;  3NSK A;  4N1F A;  2MJW B;  3VGO A;  1OZO A;  5I2Q A;  3KO0 A;  3BUN B;  4OR9 B;  2FJU B;  2AMI A;  1XVJ A;  2JT8 A;  1OOJ A;  2KI6 C;  3EKH A;  2BE4 A;  2JQ6 A;  2E30 A;  1AVS A;  1JUO A;  2PSR A;  4IL1 A;  3TS5 C;  1RTP 1;  2L4H A;  1QTX A;  2K0J A;  1YRT B;  1KK8 C;  4PE4 A;  5PAL A;  2FOT A; 
#chains in the Genus database with same CATH topology
 3BXK A;  1NP8 A;  4HRH A;  1A2X A;  2CBL A;  2KBM A;  2LMU A;  4FTG A;  2NZ0 A;  1UHI A;  1V1G A;  2JT3 A;  5CSJ A;  3TDZ A;  2BCX A;  1Z2C B;  2EGD A;  2M29 A;  1DF0 A;  3DVK A;  1S1E A;  3DYE A;  4GAO A;  2M8U A;  1R6P A;  2QDI A;  2Y1N A;  2ZN9 A;  4CFQ A;  4F0Z B;  3CS1 A;  1KQM B;  2K7D A;  1T14 A;  3LLE A;  2H61 C;  2KFH A;  1ODB A;  2HPS A;  3CGA A;  3IVT A;  1DF0 B;  1OE9 B;  4R1E A;  1SMG A;  3SG3 A;  4YRU A;  1JF2 A;  1OW4 A;  1F4O A;  1FI5 A;  2F3Z A;  1QX7 A;  1EL4 A;  2M7N A;  2BEC A;  2M9G A;  4QJ3 B;  1KK8 B;  1QS7 A;  2BKI B;  1AJ5 A;  3EG5 B;  5DKN A;  3SS4 A;  1FBV A;  1JBA A;  1EJ3 A;  1BOD A;  1CMG A;  2H2K A;  4DCK A;  2LLT A;  4NQG A;  2E6W A;  1KWO C;  1S6J A;  2WC5 A;  2ISD A;  3TDU A;  3UNW A;  2P71 A;  3KHE A;  3B6X A;  1SCM C;  3A8R A;  2KQY A;  1TNP A;  5AER A;  1B8L A;  3OB1 B;  1QLS A;  1DTL A;  1BF5 A;  4ICB A;  2Q4U A;  1CM1 A;  3NHI A;  2Y5I A;  2F2P A;  1AK8 A;  2JT0 A;  3DF0 A;  1QX2 A;  4PAL A;  4PE1 A;  4QJ4 B;  1YVH A;  1IKU A;  2JTT A;  3AAJ A;  1OOH A;  1TCF A;  1EH2 A;  3FWB A;  2L2E A;  3TDI A;  1F8H A;  1NCX A;  4DS7 A;  3TZ1 A;  1YX8 A;  2Y1M A;  1CKK A;  4CFR A;  3PFV A;  3ZWH A;  2QAC A;  1K9U A;  1F70 A;  1M63 B;  3SG5 A;  1TCO B;  3DF0 B;  3DY9 A;  1YX7 A;  2AAO A;  1ZOT B;  2NCP A;  1G33 A;  3BUO B;  4CLN A;  3EK4 A;  5AAN A;  4YI8 A;  2AUC A;  5I2O A;  1Y1X A;  1KWO B;  2BNX A;  1H8B A;  1BOC A;  2LVV A;  3B87 A;  3RLZ A;  3SG2 A;  1KFX L;  2L5Y A;  4XYN A;  4U8D A;  2KDH A;  3EVU A;  1SCM B;  2LHI A;  3O6B A;  3WXA A;  1B9A A;  4QJ5 B;  1G4Y R;  1MWN A;  1TIZ A;  4PHN A;  1RFJ A;  1RJV A;  2QEV A;  4MN0 A;  1C7V A;  2WCM A;  3I5F C;  1XFW O;  4GGF A;  4L9M A;  4PHK A;  2JXL A;  2FCD A;  1OMD A;  1NX3 A;  2JPO A;  3D10 A;  3I5H B;  4YGB B;  2OS8 B;  4CPV A;  1GM0 A;  4XJK A;  2MLE C;  1NX0 A;  1WLZ A;  4OCI A;  1XK4 C;  1YUU A;  1QXP A;  2HET A;  1QWV A;  1OOI X;  2L51 A;  3VRR A;  4YI9 A;  3CZT X;  1DQE A;  1SL7 A;  1E8A A;  2KAV A;  3ZNI A;  1MF8 B;  5JOL A;  1QLK A;  3SIA A;  4P5O E;  2K8M B;  4XJK B;  1WDC C;  2EC6 B;  1C3Y A;  4CID A;  1KK7 Z;  2I7A A;  2WC8 A;  3L4A A;  1NSH A;  1L2O C;  1V1F A;  1ZMZ A;  1NX2 A;  2OTG B;  1OOF A;  3RZS A;  1YRU B;  2ZNE A;  3CR5 X;  1IIO A;  1NUB A;  2BL0 B;  3BOW A;  1AJ4 A;  1TUJ A;  2LV7 A;  4TNC A;  4INW A;  1Y1A A;  2WND A;  3K1E A;  3DD4 A;  3L4L A;  1CFF A;  1RWY A;  1WY9 A;  5JJG A;  1YTZ C;  3LL8 B;  3I5F B;  1ALW A;  2WOS A;  3NHT A;  3QME A;  4I5K A;  1XFY O;  1QJT A;  3DVE A;  4MEW A;  4JKT A;  3BOW B;  2QEB A;  3R72 A;  2LNK A;  2LLU A;  4D1E A;  1EG4 A;  5FI6 A;  1IJ6 A;  1SRA A;  5D69 A;  1DJZ A;  2K7O A;  5F6T A;  1J7R A;  3PJI A;  5FI2 A;  3LK1 A;  2FCE A;  1UHH A;  3NSO A;  3AKA A;  3SJS A;  3DVJ A;  2QEO A;  3F45 A;  5G08 A;  1UUR A;  1BR1 B;  1MR8 A;  4PCW A;  1L2O B;  2OPO A;  2KSP A;  1S6C A;  4WRI A;  1SR6 C;  3HX4 A;  2K7C A;  5HKY A;  1S26 D;  1DJG A;  3S0F A;  1S36 A;  1UHN A;  3O78 A;  1B4C A;  3BUW B;  3CTN A;  3S0B A;  5AFP A;  1BT6 A;  4UPG A;  1SY9 A;  1GQM A;  3BJH A;  2LAN A;  1N0Y A;  3NXA A;  4I5J A;  4Q04 A;  2ZRS A;  3A4U B;  2MAZ A;  3I5I B;  1EG3 A;  4FQT A;  3MSE B;  1BLQ A;  1TN4 A;  3DZT A;  2R2I A;  3EK7 A;  1SKT A;  3KEV A;  3R1V A;  4PHM A;  3WHU B;  3BQ3 A;  2F8P A;  2KLE A;  2KHN A;  1ZUZ A;  1OOG A;  1IG5 A;  1XO5 A;  2GGM A;  1PSB A;  1TOP A;  2HQW A;  2ZN8 A;  3JVT C;  1IWQ A;  2KYF A;  2WCE A;  4IJ7 A;  5IBW A;  3OX5 A;  5K89 A;  3I5G C;  2WCF A;  4M2Q A;  3TS5 B;  1VRK A;  5KU1 A;  2G9B A;  2K7B A;  3N7H A;  3ICB A;  2I2R E;  4GPL B;  3CAB A;  4OV2 A;  4DRW A;  1CFC A;  1S3P A;  2JNF A;  5KTY A;  1QIW A;  1UHK A;  2SAS A;  3VRN A;  2LUX A;  1FI6 A;  1XA5 A;  1UP5 A;  4HRE E;  1YUT A;  1TNX A;  3D75 A;  1K2H A;  1WRK A;  2CNP A;  2WCB A;  2YGU A;  1W7J B;  1GGZ A;  3O2P A;  3PN7 C;  3B7A A;  4GUK A;  2H61 A;  2MRD A;  1ZAC A;  1ALV A;  2BCA A;  3KPX A;  1K90 D;  2ZFD A;  1MXE A;  2KOT A;  2PRU A;  4ORB B;  1TRF A;  2COL B;  1DEK A;  1B1G A;  2KAY A;  2WCH A;  2LMV A;  3AKB A;  2P70 A;  1AHR A;  5CPV A;  1MUX A;  1GGW A;  3DVM A;  2H8V A;  1B7T Y;  2JPT A;  4C0J A;  2LLS A;  4MBE A;  1W7I B;  1CMF A;  4OZD A;  1SSE B;  1DJW A;  3OBV A;  1LA0 A;  1XFR A;  4WQ3 A;  1OQP A;  1TUZ A;  2L2C A;  3FE6 A;  2LHL A;  3CLN A;  3WNX B;  4A4B A;  4E68 A;  1BG1 A;  2PYQ A;  1K93 D;  1IRJ A;  1XFZ O;  2F33 A;  2LCP A;  1WLM A;  1NYA A;  2BE6 A;  2M7L A;  1HT9 A;  1TNQ A;  4YBH B;  4YGE B;  1QV1 A;  2LMT A;  4KYN A;  3PN7 B;  2LVK A;  4AOM A;  2I18 A;  1XFX O;  5FYX A;  2ZND A;  1X02 A;  1DJX A;  1QIV A;  3SS5 A;  1CFD A;  2M1K B;  3SG6 A;  1NPQ A;  1KSO A;  4A4C A;  1M39 A;  2WC6 A;  1RRO A;  2LAP A;  3PAL A;  3R1O A;  5CSI A;  2JZI A;  5AXI A;  3S0E A;  3TUY C;  1DEL A;  1YUS A;  2M97 A;  1Q80 A;  3K21 A;  3DXL A;  4MZJ A;  4DUQ A;  1QAT A;  3HCM A;  2KPH A;  1PAL A;  2O60 A;  2L50 A;  2PVB A;  1CDP A;  1BR4 B;  2IS9 A;  2BAP A;  4I5N B;  1CNP A;  3SIB A;  3VRP A;  1A4P A;  2NLN A;  1DT7 B;  2JC2 A;  3PSR A;  4PHJ A;  1JSA A;  1F55 A;  3OHM B;  1M46 A;  4GGN A;  2CT9 A;  1Z4H A;  1P28 A;  3Q8I A;  4N5X A;  1LS8 A;  5I94 A;  1LXF C;  1IH0 A;  4ZCU A;  1OMR A;  1WRL A;  2EHB A;  1LIN A;  1GJY A;  1IGV A;  2KLD A;  2CTN A;  1Y1U A;  3D76 A;  3EK8 A;  1MXL C;  3D77 A;  1C3Z A;  1ZFS A;  1A75 A;  1QVI Y;  2DOQ A;  2K61 A;  3GK2 A;  2VRG A;  4I5L B;  4GFT A;  4BY4 A;  4WQ2 A;  5HYD A;  1XK4 A;  5AEQ A;  2LVI A;  2MHH A;  3BFB A;  1KFU L;  1K8U A;  3BFH A;  4AQI A;  5DKQ A;  1SBJ A;  1NX1 A;  1L7Z A;  1TNW A;  3H4S E;  3NSL A;  2CCM A;  3QRX A;  5D7F A;  1K9P A;  1KQV A;  1B7T Z;  1N65 A;  3FE9 A;  3S0A A;  4JWQ A;  3PM2 A;  1CTR A;  1Y0V H;  2JXC A;  2NXQ A;  1KFU S;  2NCO A;  2ZRT A;  2M1U A;  1CB1 A;  4AQJ A;  1OSA A;  1FW4 A;  3V2L A;  2KFG A;  3CDN A;  2LM5 A;  1WDC B;  2KGR A;  5HLO A;  5TNC A;  2PAS A;  2HQ8 A;  2KFF A;  4OKH A;  1AP4 A;  1J7Q A;  4INX A;  4YGD B;  4NDB A;  1F4Q A;  2MLF C;  4M2P A;  5HKZ A;  3OP0 A;  4C0K A;  1CLL A;  1AUI B;  1F71 A;  1KQM C;  2D8N A;  3C1V A;  1K95 A;  3O4Y A;  3CWG A;  2WCK A;  1S5G Y;  3VRO A;  1DGU A;  3S0D A;  1J1E A;  1F54 A;  4N1G A;  1OZS A;  2JNX A;  3VRQ A;  1DJH A;  3SG7 A;  3SG4 A;  1CLM A;  5KSZ A;  3CR4 X;  2B1U A;  4MRY A;  1XFU O;  3PM8 A;  1KSM A;  1ORG A;  1SW8 A;  5HLV A;  4GBA A;  2KQ6 A;  1MQ1 A;  2GTE A;  1C7W A;  5BPJ A;  1SPY A;  3LK0 A;  3M0W A;  1FF1 A;  1IJ5 A;  1M45 A;  2HF5 A;  1J7O A;  3KF9 A;  1D1O A;  2BCB A;  1LA3 A;  4NDD A;  2CXJ A;  2O5G A;  1DVI A;  5DKR A;  1J1D A;  2LC5 A;  2SCP A;  3PAT A;  1JWD A;  2KI4 C;  2RGI A;  1XFV O;  4ORC B;  1FPW A;  3NGV A;  1S6I A;  1SR6 B;  3EKJ A;  4M2O A;  1QVI Z;  2LUC A;  1REC A;  1K94 A;  1B47 A;  5CSF A;  3SS3 A;  4MRX A;  1U5I A;  2PQL A;  2QPT A;  3BYA A;  3BUX B;  1CFP A;  2WCL A;  1OMV A;  4MLW A;  1B8C A;  1SL9 A;  2KBI A;  4HRG A;  3OX6 A;  2LE9 B;  1BJF A;  1LVC D;  2L5X B;  1J55 A;  2JOJ A;  3OB2 B;  1U5I B;  4BY5 A;  1DJI A;  3CR2 A;  2M0R A;  3CZ0 A;  3FS7 A;  3JVT B;  3RM1 A;  1KK7 Y;  4YGA A;  3I5G B;  4NDC A;  1YR5 A;  3D0Y A;  3B88 A;  3FWC A;  3IF7 A;  1PK0 D;  1R2U A;  3BUM B;  3PLF B;  1YVL A;  5EL2 A;  4C0L A;  1SYM A;  1W9Z A;  4DIR A;  2GGZ A;  1SK6 D;  4MVF A;  1SL8 A;  1YUR A;  2WCJ A;  2K2A A;  2GV5 A;  1N2D A;  3FE8 A;  1B8R A;  2P6B B;  3OGN A;  1DMO A;  4PE7 A;  2KI4 B;  2JWW A;  3D0Y B;  3L47 A;  2PAL A;  1QX5 B;  4ZCV A;  1G8I A;  3R1P A;  4MZK A;  4MSP A;  3I5H C;  2QEH A;  2OS8 C;  1CLB A;  1S5G Z;  1PVB A;  1UUS A;  4ETO A;  1SCV A;  5HKW A;  4OVN F;  1LKJ A;  2JTZ A;  2BBM A;  1RK9 A;  1DJY A;  1TTX A;  1JF0 A;  1UHJ A;  1UWO A;  1XYD A;  2F2O A;  2JU0 A;  3EVV A;  1TWO A;  5GQQ C;  1PSR A;  2JRF A;  5J3X A;  2K2F A;  4GGF C;  4PT1 A;  3JTD C;  2MBX A;  1M31 A;  1JFK A;  2I94 A;  2WOR A;  5DIC A;  1NCY A;  3O4X A;  2EC6 C;  2Q91 A;  1IQ5 A;  5D3O A;  4JD9 A;  5ER4 X;  1EXR A;  4P2Y B;  2BBN A;  1A03 A;  2G2B A;  3CYZ A;  2M49 B;  3FIA A;  3GK1 A;  4F7F A;  2OTG C;  1C07 A;  2LP3 A;  1CDL A;  3D78 A;  3VB1 A;  2BL0 C;  1BMO A;  2L98 A;  1CDN A;  3NSI A;  2V53 A;  2K60 A;  5I8N A;  1PVA A;  2F3Y A;  1QV0 A;  1NWD A;  3B86 A;  1NIW A;  2FJY A;  2TN4 A;  4FQO A;  4HSZ A;  3IQQ A;  3IQO A;  4ORA B;  4YGC B;  5I2L A;  5HL1 A;  3CZ1 A;  3EVR A;  2LP2 A;  4MZL A;  1J7P A;  2MA2 A;  1HQV A;  1KFX S;  2A4J A;  5ER5 A;  2LVJ A;  5B8I B;  1PRW A;  2Y4Q A;  3WHT B;  1IQ3 A;  1KCY A;  4PDZ A;  3GOF A;  2L4I A;  2KAX A;  1CDM A;  2ERB A;  1BU3 A;  3TUY B;  3E3R A;  1Y6W A;  3BFA A;  3JTD B;  1A75 B;  2PMY A;  1K9K A;  1JC2 A;  1K96 A;  3LCP C;  1MHO A;  4JPZ B;  5CSN A;  2KGB C;  1CM4 A;  1QAS A;  1JFJ A;  4USL A;  2JUL A;  1DGV A;  2KNE A;  1H4B A;  3D73 A;  2KYC A;  2L0P A;  3GK4 X;  2BKH B;  2ZKM X;  1A29 A;  2KI6 D;  2M3W A;  1PUL A;  4PE0 A;  3D74 A;  4JQ0 D;  4GNK B;  3AAK A;  1SNL A;  1WRZ A;  3I5I C;  1NCZ A;  3NSK A;  4N1F A;  2MJW B;  3VGO A;  1OZO A;  5I2Q A;  3KO0 A;  3BUN B;  4OR9 B;  2FJU B;  5FI7 A;  2AMI A;  1XVJ A;  2JT8 A;  1OOJ A;  2KI6 C;  3EKH A;  2BE4 A;  2JQ6 A;  1DC1 A;  2E30 A;  1AVS A;  1JUO A;  2PSR A;  4IL1 A;  3TS5 C;  1RTP 1;  2L4H A;  1QTX A;  2K0J A;  1YRT B;  1KK8 C;  3CZ2 A;  4PE4 A;  5PAL A;  2FOT A;  3S0G A;  3UO9 A; 
#chains in the Genus database with same CATH homology
 3BXK A;  1NP8 A;  4HRH A;  1A2X A;  2CBL A;  2KBM A;  2LMU A;  4FTG A;  2NZ0 A;  1UHI A;  1V1G A;  2JT3 A;  5CSJ A;  3TDZ A;  2BCX A;  2EGD A;  2M29 A;  3DVK A;  1DF0 A;  1S1E A;  4GAO A;  2M8U A;  1R6P A;  2Y1N A;  2ZN9 A;  4CFQ A;  4F0Z B;  3CS1 A;  1KQM B;  2K7D A;  3LLE A;  2H61 C;  2KFH A;  1ODB A;  2HPS A;  3CGA A;  4YRU A;  1DF0 B;  1OE9 B;  4R1E A;  1SMG A;  3SG3 A;  1JF2 A;  1F4O A;  1FI5 A;  2F3Z A;  1QX7 A;  1EL4 A;  2M7N A;  2BEC A;  2M9G A;  4QJ3 B;  1KK8 B;  1QS7 A;  2BKI B;  1AJ5 A;  5DKN A;  1FBV A;  1JBA A;  1EJ3 A;  1BOD A;  1CMG A;  2H2K A;  4DCK A;  2LLT A;  4NQG A;  2E6W A;  1KWO C;  1S6J A;  2ISD A;  3TDU A;  3KHE A;  1SCM C;  3A8R A;  2KQY A;  1TNP A;  5AER A;  1B8L A;  3OB1 B;  1QLS A;  1DTL A;  1BF5 A;  4ICB A;  2Q4U A;  1CM1 A;  2Y5I A;  2F2P A;  1AK8 A;  2JT0 A;  3DF0 A;  1QX2 A;  4PAL A;  4PE1 A;  4QJ4 B;  1YVH A;  1IKU A;  2JTT A;  3AAJ A;  1TCF A;  1EH2 A;  3FWB A;  2L2E A;  3TDI A;  1F8H A;  1NCX A;  4DS7 A;  3TZ1 A;  1YX8 A;  2Y1M A;  1CKK A;  4CFR A;  3PFV A;  3ZWH A;  2QAC A;  1K9U A;  1F70 A;  1M63 B;  3SG5 A;  1TCO B;  3DF0 B;  1YX7 A;  2AAO A;  1ZOT B;  2NCP A;  1G33 A;  3BUO B;  4CLN A;  3EK4 A;  5AAN A;  4YI8 A;  2AUC A;  5I2O A;  1Y1X A;  1KWO B;  1H8B A;  1BOC A;  2LVV A;  3RLZ A;  3SG2 A;  1KFX L;  4XYN A;  4U8D A;  2KDH A;  3EVU A;  1SCM B;  2LHI A;  3O6B A;  3WXA A;  1B9A A;  4QJ5 B;  1G4Y R;  1MWN A;  1TIZ A;  4PHN A;  1RFJ A;  1RJV A;  4MN0 A;  1C7V A;  3I5F C;  1XFW O;  4GGF A;  4L9M A;  4PHK A;  2JXL A;  2FCD A;  1OMD A;  1NX3 A;  3D10 A;  3I5H B;  4YGB B;  2OS8 B;  4CPV A;  4XJK A;  2MLE C;  1NX0 A;  1WLZ A;  4OCI A;  1XK4 C;  1YUU A;  1QXP A;  2HET A;  2L51 A;  3VRR A;  4YI9 A;  3CZT X;  1SL7 A;  1E8A A;  2KAV A;  3ZNI A;  1MF8 B;  5JOL A;  1QLK A;  3SIA A;  4P5O E;  2K8M B;  4XJK B;  1WDC C;  2EC6 B;  4CID A;  1KK7 Z;  2I7A A;  2WC8 A;  1NSH A;  1L2O C;  1V1F A;  1ZMZ A;  1NX2 A;  2OTG B;  1YRU B;  2ZNE A;  3CR5 X;  1NUB A;  2BL0 B;  3BOW A;  1AJ4 A;  2LV7 A;  4TNC A;  1Y1A A;  2WND A;  3DD4 A;  1CFF A;  1RWY A;  1WY9 A;  5JJG A;  1YTZ C;  3LL8 B;  3I5F B;  1ALW A;  2WOS A;  4I5K A;  1XFY O;  1QJT A;  3DVE A;  4MEW A;  3BOW B;  2LNK A;  2LLU A;  4D1E A;  1EG4 A;  1IJ6 A;  1SRA A;  5D69 A;  1DJZ A;  2K7O A;  5F6T A;  1J7R A;  3LK1 A;  2FCE A;  1UHH A;  3NSO A;  3AKA A;  3SJS A;  3DVJ A;  3F45 A;  5G08 A;  1UUR A;  1BR1 B;  1MR8 A;  4PCW A;  1L2O B;  2OPO A;  2KSP A;  1S6C A;  4WRI A;  1SR6 C;  3HX4 A;  2K7C A;  5HKY A;  1S26 D;  1DJG A;  1S36 A;  1UHN A;  3O78 A;  1B4C A;  3BUW B;  3CTN A;  5AFP A;  1BT6 A;  4UPG A;  1SY9 A;  1GQM A;  2LAN A;  1N0Y A;  3NXA A;  4I5J A;  4Q04 A;  2ZRS A;  3A4U B;  2MAZ A;  3I5I B;  1EG3 A;  3MSE B;  1BLQ A;  1TN4 A;  3KEV A;  2R2I A;  3EK7 A;  1SKT A;  4PHM A;  3WHU B;  3BQ3 A;  2F8P A;  2KHN A;  1XO5 A;  1ZUZ A;  1IG5 A;  2GGM A;  2HQW A;  1PSB A;  1TOP A;  2ZN8 A;  3JVT C;  1IWQ A;  2KYF A;  2WCE A;  5IBW A;  5K89 A;  3OX5 A;  3I5G C;  2WCF A;  4M2Q A;  3TS5 B;  1VRK A;  5KU1 A;  2G9B A;  2K7B A;  4GPL B;  3ICB A;  2I2R E;  4OV2 A;  1CFC A;  4DRW A;  1S3P A;  2JNF A;  5KTY A;  1QIW A;  1UHK A;  2SAS A;  3VRN A;  2LUX A;  1FI6 A;  1XA5 A;  1UP5 A;  4HRE E;  1YUT A;  1TNX A;  1K2H A;  1WRK A;  2CNP A;  2WCB A;  1W7J B;  1GGZ A;  3O2P A;  3PN7 C;  4GUK A;  2H61 A;  2MRD A;  1ZAC A;  1ALV A;  2BCA A;  3KPX A;  1K90 D;  2ZFD A;  1MXE A;  2KOT A;  2PRU A;  4ORB B;  1TRF A;  2COL B;  1B1G A;  2KAY A;  2LMV A;  3AKB A;  1AHR A;  5CPV A;  1MUX A;  1GGW A;  3DVM A;  1B7T Y;  2JPT A;  4C0J A;  2LLS A;  4MBE A;  1W7I B;  1CMF A;  1DJW A;  1LA0 A;  4WQ3 A;  1OQP A;  1BG1 A;  2LHL A;  3CLN A;  3WNX B;  4A4B A;  4E68 A;  1K93 D;  1IRJ A;  1XFZ O;  2F33 A;  2LCP A;  1WLM A;  1NYA A;  2BE6 A;  2M7L A;  1HT9 A;  1TNQ A;  4YBH B;  4YGE B;  1QV1 A;  2LMT A;  3PN7 B;  2LVK A;  4AOM A;  2I18 A;  1XFX O;  5FYX A;  2ZND A;  1X02 A;  1DJX A;  1QIV A;  1CFD A;  2M1K B;  3SG6 A;  1NPQ A;  1KSO A;  4A4C A;  1M39 A;  1RRO A;  2LAP A;  3PAL A;  5CSI A;  5AXI A;  2JZI A;  3TUY C;  1YUS A;  2M97 A;  1Q80 A;  3K21 A;  4MZJ A;  4DUQ A;  1QAT A;  3HCM A;  2O60 A;  1PAL A;  2L50 A;  2PVB A;  1CDP A;  1BR4 B;  2IS9 A;  4I5N B;  1CNP A;  3SIB A;  3VRP A;  1A4P A;  2NLN A;  1DT7 B;  2JC2 A;  3PSR A;  4PHJ A;  1JSA A;  1F55 A;  3OHM B;  1M46 A;  4GGN A;  2CT9 A;  4N5X A;  1LXF C;  1IH0 A;  4ZCU A;  1OMR A;  1WRL A;  2EHB A;  1LIN A;  1GJY A;  1IGV A;  2CTN A;  1Y1U A;  3EK8 A;  1MXL C;  1ZFS A;  1A75 A;  1QVI Y;  2DOQ A;  2K61 A;  3GK2 A;  2VRG A;  4I5L B;  4GFT A;  4BY4 A;  4WQ2 A;  5HYD A;  1XK4 A;  5AEQ A;  2LVI A;  2MHH A;  1KFU L;  1K8U A;  4AQI A;  5DKQ A;  1SBJ A;  1NX1 A;  1L7Z A;  1TNW A;  3H4S E;  3NSL A;  2CCM A;  3QRX A;  5D7F A;  1K9P A;  1KQV A;  1B7T Z;  1N65 A;  4JWQ A;  1CTR A;  1Y0V H;  2JXC A;  2NXQ A;  1KFU S;  2NCO A;  2ZRT A;  2M1U A;  1CB1 A;  4AQJ A;  1OSA A;  1FW4 A;  2KFG A;  2LM5 A;  1WDC B;  2KGR A;  5HLO A;  5TNC A;  2PAS A;  2HQ8 A;  2KFF A;  4OKH A;  1AP4 A;  1J7Q A;  4YGD B;  4NDB A;  1F4Q A;  2MLF C;  4M2P A;  5HKZ A;  3OP0 A;  4C0K A;  1CLL A;  1AUI B;  1F71 A;  1KQM C;  2D8N A;  3C1V A;  1K95 A;  3O4Y A;  3CWG A;  3VRO A;  1S5G Y;  1DGU A;  1J1E A;  1F54 A;  4N1G A;  1OZS A;  2JNX A;  3VRQ A;  1DJH A;  3SG7 A;  3SG4 A;  1CLM A;  5KSZ A;  3CR4 X;  2B1U A;  4MRY A;  1XFU O;  3PM8 A;  1KSM A;  1SW8 A;  5HLV A;  4GBA A;  2KQ6 A;  1MQ1 A;  1C7W A;  5BPJ A;  1SPY A;  3LK0 A;  3M0W A;  1FF1 A;  1IJ5 A;  1M45 A;  2HF5 A;  1J7O A;  3KF9 A;  1D1O A;  2BCB A;  1LA3 A;  4NDD A;  2CXJ A;  2O5G A;  1DVI A;  5DKR A;  1J1D A;  2LC5 A;  2SCP A;  3PAT A;  1JWD A;  2KI4 C;  2RGI A;  1XFV O;  4ORC B;  1FPW A;  1S6I A;  1SR6 B;  3EKJ A;  4M2O A;  1QVI Z;  2LUC A;  1REC A;  1K94 A;  1B47 A;  5CSF A;  4MRX A;  1U5I A;  2QPT A;  3BYA A;  3BUX B;  1CFP A;  1OMV A;  4MLW A;  1B8C A;  1SL9 A;  2KBI A;  4HRG A;  3OX6 A;  2LE9 B;  1BJF A;  1LVC D;  2L5X B;  1J55 A;  2JOJ A;  3OB2 B;  1U5I B;  4BY5 A;  1DJI A;  3CR2 A;  2M0R A;  3FS7 A;  3JVT B;  3RM1 A;  1KK7 Y;  4YGA A;  3I5G B;  4NDC A;  1YR5 A;  3D0Y A;  3FWC A;  3IF7 A;  1PK0 D;  1R2U A;  3BUM B;  3PLF B;  1YVL A;  4C0L A;  1SYM A;  4DIR A;  2GGZ A;  1SK6 D;  4MVF A;  1SL8 A;  1YUR A;  2K2A A;  2GV5 A;  1N2D A;  1DMO A;  1B8R A;  2P6B B;  4PE7 A;  2KI4 B;  2JWW A;  3D0Y B;  2PAL A;  1QX5 B;  4ZCV A;  1G8I A;  4MZK A;  4MSP A;  3I5H C;  2OS8 C;  1CLB A;  1S5G Z;  1PVB A;  1UUS A;  4ETO A;  1SCV A;  5HKW A;  4OVN F;  1LKJ A;  2JTZ A;  2BBM A;  1RK9 A;  1DJY A;  1TTX A;  1JF0 A;  1UHJ A;  1UWO A;  1XYD A;  2F2O A;  2JU0 A;  3EVV A;  5GQQ C;  1PSR A;  2JRF A;  5J3X A;  2K2F A;  4GGF C;  2MBX A;  3JTD C;  1M31 A;  1JFK A;  2I94 A;  2WOR A;  1NCY A;  5ER4 X;  2EC6 C;  2Q91 A;  1IQ5 A;  1EXR A;  4P2Y B;  2BBN A;  1A03 A;  2G2B A;  2M49 B;  3FIA A;  3GK1 A;  2OTG C;  1C07 A;  2LP3 A;  1CDL A;  2BL0 C;  1BMO A;  2L98 A;  1CDN A;  3NSI A;  2V53 A;  5I8N A;  1PVA A;  2F3Y A;  1QV0 A;  1NWD A;  4FQO A;  1NIW A;  2TN4 A;  4HSZ A;  3IQQ A;  3IQO A;  4ORA B;  4YGC B;  5I2L A;  3EVR A;  2LP2 A;  4MZL A;  1J7P A;  2MA2 A;  1HQV A;  1KFX S;  2A4J A;  5ER5 A;  2LVJ A;  5B8I B;  1PRW A;  2Y4Q A;  3WHT B;  1IQ3 A;  1KCY A;  4PDZ A;  3GOF A;  2L4I A;  2KAX A;  1CDM A;  1BU3 A;  3TUY B;  3E3R A;  1Y6W A;  1JC2 A;  3JTD B;  1A75 B;  2PMY A;  1K9K A;  1K96 A;  3LCP C;  1MHO A;  4JPZ B;  5CSN A;  2KGB C;  1CM4 A;  1QAS A;  1JFJ A;  4USL A;  2JUL A;  1DGV A;  2KNE A;  1H4B A;  3GK4 X;  2KYC A;  2L0P A;  2BKH B;  2ZKM X;  1A29 A;  2KI6 D;  2M3W A;  1PUL A;  4PE0 A;  4JQ0 D;  4GNK B;  3AAK A;  1SNL A;  1WRZ A;  3I5I C;  1NCZ A;  3NSK A;  4N1F A;  2MJW B;  3VGO A;  1OZO A;  5I2Q A;  3KO0 A;  3BUN B;  4OR9 B;  2FJU B;  2AMI A;  1XVJ A;  2JT8 A;  1OOJ A;  2KI6 C;  3EKH A;  2BE4 A;  2JQ6 A;  2E30 A;  1AVS A;  1JUO A;  2PSR A;  4IL1 A;  3TS5 C;  1RTP 1;  2L4H A;  1QTX A;  2K0J A;  1YRT B;  1KK8 C;  4PE4 A;  5PAL A;  2FOT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...