5JOLA

Calcium-free ef-hand domain of l-plastin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
82
structure length
82
Chain Sequence
MARGSVSDEEMMELREAFAKVDTDGNGYISFNELNDLFKAACLPLPGYRVREITENLMATGDLDQDGRISFDEFIKIFHGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Calcium-Dependent Switch Helix of L-Plastin Regulates Actin Bundling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Plastin-2
total genus 19
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2016-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5jolA00
1XVJA 4MN0A 3PM8A 3A8RA 3I5FC 4NDDA 4N5XA 3LCPC 4C0JA 1G8IA 4MVFA 1L2OC 3GK1A 3JTDC 1CLLA 1B4CA 3IQQA 2HF5A 2P6BB 1OOJA 1QV0A 2NCPA 2LVVA 2Y5IA 5AFPA 2LMVA 2BECA 1SW8A 5DKQA 4OR9B 4AOMA 1WDCC 2FCEA 4QJ3B 1LKJA 1IJ6A 4CIDA 1K94A 4E68A 2LHLA 2JNFA 4GGFC 4JPZB 1TNPA 2LNKA 1KWOB 3I5IB 1EXRA 1IQ3A 2LAPA 4N1GA 2MBXA 2M29A 1CDLA 4CFQA 1RROA 2MLEC 1A2XA 1AVSA 2LE9B 1KFXS 1NX3A 5HKWA 1XO5A 2G9BA 1UHIA 2KYCA 3PALA 4N1FA 2KI6C 5AEQA 1PULA 1IJ5A 1DJIA 5CSIA 5GQQC 3LL8B 1KFUL 1SR6B 2LVIA 2WC8A 1W7IB 4TNCA 1QATA 1DJYA 5CSFA 2JQ6A 2LCPA 3JVTB 1KFXL 2H2KA 1RFJA 1CFCA 1BJFA 2GGMA 1B1GA 3E3RA 3DF0A 1CFPA 4WRIA 3FIAA 4M2PA 2NLNA 1TNQA 1KSOA 3O78A 2BE4A 4YBHB 2KBIA 1KFUS 1IRJA 2BE6A 2LLSA 1B7TY 1G4YR 1ODBA 1WLZA 1FI5A 1UHNA 1NCZA 3TS5C 4ETOA 1DT7B 4P5OE 4YGBB 3SG7A 4PHMA 5JJGA 3H4SE 4I5JA 2M1KB 2OS8B 2WOSA 3OB1B 5KSZA 3EK8A 1TOPA 1DJGA 1N2DA 2MA2A 4MBEA 3HCMA 4YGEB 1QX7A 4FTGA 2WCFA 1MXEA 1LA0A 1UUSA 2WCBA 3LK1A 2KGBC 1X02A 3BOWA 2AAOA 3VGOA 4I5KA 1XA5A 2JXCA 1FI6A 3I5GB 1LVCD 1ZMZA 3CWGA 4ORAB 4PE1A 1SNLA 1QV1A 1W7JB 4GNKB 1AJ4A 1N65A 1NX1A 2MHHA 4PHKA 2FJUB 1QIVA 2V53A 5DKRA 2EC6B 1HT9A 1OZOA 3IQOA 4A4BA 2JWWA 1C07A 1NSHA 5IBWA 1QASA 4M2QA 2K0JA 1SK6D 5PALA 4A4CA 1AJ5A 1TCFA 2BCAA 4MSPA 1ALVA 1BU3A 3GOFA 1ZACA 1XFXO 2KI4B 4ORCB 3WXAA 1V1FA 1RTP1 4OV2A 2F3ZA 1BODA 1A75A 2CBLA 4P2YB 3KEVA 2JNXA 4HSZA 1SL8A 1OQPA 3BUWB 1JC2A 1SCMC 3OHMB 3EK4A 1K9PA 2OTGB 4MLWA 3O2PA 4FQOA 1KK8C 4PE4A 1DTLA 1F71A 1TNWA 5HKZA 2I18A 2WORA 1YR5A 2JTZA 1QVIZ 2K7DA 4OVNF 4CFRA 1KCYA 2L2EA 1CMGA 2ZNEA 4ZCUA 2DOQA 3WNXB 2EC6C 2LUXA 1SMGA 4QJ4B 1K93D 1J1EA 1NX0A 1XFUO 1ZUZA 1S6JA 2K2FA 2VRGA 1QLSA 3BYAA 1J1DA 5I2LA 3QRXA 1C7VA 3PSRA 2K8MB 4ORBB 2MRDA 1EG4A 1A75B 1CB1A 1OMDA 1DJHA 2JOJA 5HLVA 4DIRA 1UHKA 1YURA 2LANA 1TRFA 3BUXB 3TDZA 3VRNA 1FF1A 1IGVA 1MR8A 5HLOA 1L7ZA 1QX2A 1Y1UA 2AUCA 1YRTB 2MJWB 4HRHA 1RJVA 2KQ6A 3M0WA 4GBAA 1BMOA 1F55A 3DVKA 4MRXA 4PHJA 2PSRA 2L51A 1NX2A 2O60A 1EH2A 5G08A 1C7WA 5I8NA 3LK0A 1YRUB 1V1GA 2OTGC 2ZRTA 4WQ2A 2Y1NA 2ZN9A 2Y1MA 1XFVO 3VRRA 1CLMA 3KO0A 2FCDA 1SKTA 1CDNA 2KI4C 1K95A 3EVVA 4C0LA 1B8RA 1EG3A 4NDBA 3I5HB 3TUYB 1UHHA 1GJYA 5D7FA 2H61A 4YRUA 2F33A 3TUYC 1AK8A 2KFFA 1SCMB 2R2IA 4YGCB 1JUOA 2B1UA 2AMIA 1H8BA 3VRQA 2M9GA 1BT6A 1JF2A 1MWNA 2TN4A 2KQYA 1PVBA 3C1VA 2E30A 3F45A 1NP8A 1SR6C 1UWOA 5AERA 1JF0A 1RECA 1BG1A 3D0YB 3NXAA 1YTZC 3PLFB 1NCYA 1S5GZ 1B9AA 1IG5A 2F8PA 1KK7Z 2HPSA 4JQ0D 1SBJA 1YUSA 1S6CA 2QPTA 1G33A 2EHBA 3K21A 2Y4QA 4I5LB 5I2QA 2LP2A 1CFDA 2JZIA 5TNCA 2NCOA 1DMOA 2K2AA 1S3PA 1KSMA 1WLMA 3EVRA 2PRUA 1F54A 1CLBA 1SY9A 2GV5A 1IH0A 2JULA 4PE7A 2PMYA 1AUIB 1MQ1A 1K90D 2GGZA 3ZWHA 1H4BA 1S5GY 1YVHA 2M3WA 3ICBA 1PALA 4MEWA 1XFZO 5JOLA 4DRWA 4QJ5B 2KFGA 1CMFA 1WRZA 3JTDB 4OCIA 1GGWA 4CPVA 1PRWA 2OS8C 2CXJA 1F8HA 4HREE 1OE9B 3PFVA 3PN7B 1KK8B 5CSJA 1OZSA 1DF0A 2K7CA 1JBAA 4YI9A 2BKIB 1IWQA 2KFHA 1QS7A 1PVAA 3LLEA 2I2RE 4XYNA 1QIWA 1DGUA 3OP0A 3JVTC 2F3YA 1LA3A 3TDIA 2JXLA 5CPVA 2JT3A 3D10A 4MRYA 4UPGA 1CFFA 1MF8B 1CM1A 1NPQA 2L4IA 2M49B 1EJ3A 1M39A 1AP4A 3SG2A 2KYFA 1S6IA 3VROA 4I5NB 1A4PA 1B8CA 1S36A 1BF5A 3FS7A 4PHNA 5D69A 2BBMA 3DD4A 4F0ZB 1Y1XA 5CSNA 5B8IB 2NXQA 2BCBA 1PSRA 3EKJA 3SIAA 2ZNDA 3KHEA 4DS7A 1HQVA 2M97A 2LC5A 1CM4A 2LLUA 1OSAA 1J7RA 5BPJA 1XFYO 3A4UB 1ZOTB 2BKHB 2LP3A 5ER4X 2F2PA 1J55A 1DJWA 1A29A 3DF0B 2IS9A 4GGNA 2KAYA 1DGVA 4JWQA 4YGAA 4XJKB 3SJSA 4DUQA 1TTXA 3FWBA 3BUNB 2RGIA 3BOWB 1R2UA 4PDZA 2KNEA 4XJKA 4AQIA 2HETA 1DVIA 2PALA 3EKHA 3NSKA 2LV7A 3SG6A 3ZNIA 5K89A 3CS1A 1FBVA 5DKNA 3KPXA 2KAVA 4C0KA 3HX4A 2CT9A 2LHIA 2MLFC 2G2BA 2JPTA 1XK4C 2ZFDA 1U5IB 1PK0D 4GFTA 3AAKA 1NWDA 4CLNA 2L98A 3I5FB 3BQ3A 3DVEA 1E8AA 1K9KA 2LM5A 1R6PA 3OX5A 3NSOA 1JFKA 1UHJA 2H61C 1UP5A 2JC2A 2E6WA 2PVBA 4USLA 1S26D 2EGDA 2M7LA 3IF7A 2L0PA 1K9UA 4IL1A 1MXLC 1D1OA 1N0YA 2L4HA 3O4YA 1JSAA 1QVIY 3AKAA 2BCXA 1TN4A 2I94A 1RK9A 3EK7A 1M45A 2KOTA 1BLQA 1GQMA 4GPLB 5J3XA 2LMTA 2KSPA 5AANA 1DF0B 1Q80A 3WHTB 1QX5B 2M0RA 4U8DA 2BL0C 1M63B 1EL4A 2ZRSA 4GAOA 1QXPA 3GK4X 2F2OA 3OB2B 3AAJA 2NZ0A 5I2OA 1Y1AA 1TCOB 4HRGA 1WDCB 2JTTA 3EVUA 1Y6WA 1YX7A 1J7OA 1SPYA 2HQ8A 1RWYA 1IKUA 1IQ5A 2BBNA 4YGDB 1Y0VH 3I5GC 1M46A 1K8UA 1L2OB 1CKKA 1JWDA 3FWCA 2BL0B 2I7AA 5FYXA 1LXFC 2LUCA 3WHUB 2CTNA 3RM1A 4PALA 1YUUA 2PASA 1WY9A 2LLTA 4NDCA 1LINA 1K96A 1A03A 1SYMA 3MSEB 2LVKA 2O5GA 4NQGA 2FOTA 4M2OA 5HKYA 1SCVA 1ALWA 1UURA 1GGZA 1OMVA 1KK7Y 1MUXA 1KQMC 1NIWA 2KAXA 1J7QA 4WQ3A 2ISDA 1NUBA 2K7OA 3SG3A 3TS5B 4BY4A 1FPWA 1CDPA 3DVJA 1XK4A 1VRKA 1U5IA 1YUTA 2M8UA 1BR1B 2JT0A 3BXKA 1OMRA 2CNPA 2LMUA 3CZTX 2ZN8A 1J7PA 4D1EA 3OX6A 2HQWA 3AKBA 3O6BA 2SCPA 3SG5A 1YX8A 1NCXA 2ZKMX 1S1EA 1CDMA 3CTNA 4MZLA 1B8LA 2KHNA 2L5XB 4OKHA 1TNXA 2M1UA 4Q04A 4PE0A 1B47A 1YVLA 2WCEA 1DJXA 4ZCVA 4L9MA 1CTRA 3DVMA 5HYDA 2WNDA 3CGAA 1JFJA 2JT8A 4GUKA 1SRAA 2Q4UA 1TIZA 4MZKA 1M31A 2LVJA 4R1EA 3SIBA 1WRLA 5KU1A 2KGRA 3NSLA 3TDUA 1FW4A 4DCKA 1AHRA 4PCWA 1WRKA 3BUMB 3D0YA 1DJZA 4BY5A 2JU0A 2KDHA 2SASA 3VRPA 2D8NA 1XFWO 1F70A 2Q91A 1KWOC 3I5IC 5AXIA 1SL9A 1KQVA 5F6TA 1QLKA 2KI6D 4AQJA 3I5HC 5KTYA 1F4OA 1ZFSA 2M7NA 5ER5A 1BOCA 3CLNA 4GGFA 1F4QA 2QACA 2COLB 1PSBA 2OPOA 3BUOB 2CCMA 3NSIA 2A4JA 2K61A 3CR2A 3TZ1A 2MAZA 1XYDA 4MZJA 2L50A 3RLZA 1QJTA 3GK2A 1NYAA 1KQMB 3PN7C 3CR5X 4ICBA 1BR4B 1B7TZ 2KBMA 3CR4X 1QTXA 1SL7A 3PATA 4YI8A 3KF9A 1MHOA 2JRFA 3SG4A 1CNPA 2K7BA 1K2HA
chains in the Genus database with same CATH superfamily
1XVJA 4MN0A 4JD9A 3PM8A 3A8RA 3D74A 3I5FC 2ERBA 4NDDA 4N5XA 1C3ZA 3LCPC 4C0JA 5HL1A 1G8IA 4MVFA 1L2OC 3GK1A 3JTDC 1GM0A 1CLLA 1B4CA 3IQQA 1SSEB 2HF5A 2P6BB 1OOJA 1QV0A 2NCPA 2LVVA 2Y5IA 5AFPA 2LMVA 2BECA 1SW8A 5DKQA 4OR9B 4AOMA 1WDCC 2FCEA 4QJ3B 1LKJA 3RZSA 3NGVA 1IJ6A 4CIDA 1K94A 4E68A 2LHLA 2QEOA 2JNFA 4GGFC 4JPZB 1TNPA 2LNKA 1KWOB 3I5IB 1EXRA 1IQ3A 2LAPA 4N1GA 2MBXA 2M29A 1CDLA 4CFQA 1RROA 2MLEC 5FI6A 5EL2A 1A2XA 1AVSA 2LE9B 1KFXS 1NX3A 5HKWA 1XO5A 2G9BA 1UHIA 2KYCA 3PALA 4N1FA 2KI6C 3O4XA 1PULA 1IJ5A 5AEQA 1DJIA 3PJIA 5CSIA 3OBVA 5GQQC 3LL8B 1KFUL 1SR6B 2LVIA 2WC8A 1W7IB 3R1PA 1QATA 1DJYA 4TNCA 5CSFA 2JQ6A 2LCPA 3JVTB 4INWA 1KFXL 2H2KA 1RFJA 1CFCA 1BJFA 2GGMA 1B1GA 3BJHA 3DF0A 3E3RA 1CFPA 4WRIA 3FIAA 2P71A 4M2PA 2NLNA 4OZDA 1TNQA 1KSOA 2KLDA 3R1OA 3O78A 2BE4A 2WCHA 4YBHB 2KBIA 1KFUS 1IRJA 2BE6A 2LLSA 1B7TY 1G4YR 1ODBA 1WLZA 1FI5A 1UHNA 1NCZA 3TS5C 4ETOA 1DT7B 2FJYA 4P5OE 4YGBB 4PHMA 3SG7A 3S0FA 5JJGA 3H4SE 4I5JA 2M1KB 2OS8B 4PT1A 2WOSA 3OB1B 5KSZA 3EK8A 1TOPA 1DJGA 1N2DA 2MA2A 4IJ7A 4MBEA 3HCMA 4YGEB 1QX7A 4FTGA 2WCFA 1MXEA 1LA0A 1UUSA 1IIOA 2WCBA 3LK1A 2KGBC 1X02A 3BOWA 2AAOA 3S0BA 3VGOA 4I5KA 1XA5A 2JXCA 1FI6A 3I5GB 1LVCD 1ZMZA 3CWGA 4ORAB 4PE1A 1SNLA 1QV1A 1W7JB 4GNKB 1AJ4A 1N65A 1NX1A 3FE6A 2MHHA 4PHKA 2FJUB 1QIVA 2V53A 5DKRA 2EC6B 1HT9A 1OZOA 3IQOA 4A4BA 2JWWA 1C07A 1NSHA 5IBWA 1QASA 4M2QA 2K0JA 1SK6D 5PALA 4A4CA 1AJ5A 1TCFA 2BCAA 2WCLA 4MSPA 1ALVA 1BU3A 3GOFA 3CZ2A 1ZACA 1XFXO 2KI4B 4ORCB 3WXAA 1V1FA 1RTP1 3NHIA 4OV2A 2F3ZA 1QWVA 1BODA 5D3OA 3IVTA 1A75A 2CBLA 4P2YB 3KEVA 2JNXA 4HSZA 1SL8A 1OQPA 3BUWB 1JC2A 1SCMC 3OHMB 3EK4A 1K9PA 2OTGB 4MLWA 3O2PA 4FQOA 1KK8C 4PE4A 1DTLA 1F71A 1TNWA 5HKZA 2I18A 2WORA 2H8VA 1YR5A 2JTZA 2QEHA 1QVIZ 2K7DA 4OVNF 4CFRA 3VB1A 2GTEA 2L2EA 1CMGA 2ZNEA 4ZCUA 1KCYA 2DOQA 3WNXB 2EC6C 2LUXA 1SMGA 4QJ4B 1K93D 1J1EA 1NX0A 1XFUO 1ZUZA 1S6JA 2K2FA 2VRGA 3BFBA 1QLSA 2PYQA 3CABA 3BYAA 1J1DA 5I2LA 3QRXA 1C7VA 3PSRA 2K8MB 1DELA 4ORBB 2MRDA 1EG4A 1A75B 1CB1A 1OMDA 1DJHA 2JOJA 5HLVA 4DIRA 1UHKA 1YURA 2LANA 1TRFA 2YGUA 3BUXB 3TDZA 1OW4A 1IGVA 3VRNA 1FF1A 1MR8A 5HLOA 1XFRA 2QEBA 1L7ZA 1QX2A 1Y1UA 2AUCA 1YRTB 2MJWB 4HRHA 1RJVA 2KQ6A 3M0WA 4GBAA 1BMOA 1F55A 3DVKA 4MRXA 4PHJA 2PSRA 2L51A 1NX2A 2O60A 1EH2A 5G08A 1C7WA 5I8NA 2K60A 3LK0A 1YRUB 1V1GA 2OTGC 2ZRTA 3D76A 4WQ2A 2Y1NA 2ZN9A 2Y1MA 2L5YA 1XFVO 3VRRA 1CLMA 3KO0A 2FCDA 1SKTA 1CDNA 2KI4C 1K95A 3EVVA 4C0LA 1B8RA 1EG3A 4JKTA 3I5HB 4NDBA 5FI2A 3TUYB 1UHHA 1GJYA 5D7FA 2H61A 4YRUA 2F33A 3TUYC 1AK8A 2KFFA 3FE8A 1SCMB 3FE9A 2L2CA 2R2IA 1LS8A 4YGCB 1JUOA 2B1UA 1ORGA 2AMIA 1H8BA 3VRQA 2M9GA 1BT6A 1JF2A 3B87A 1MWNA 2TN4A 2KQYA 3DY9A 3N7HA 1PVBA 3C1VA 2E30A 3R1VA 3S0EA 3F45A 1NP8A 1SR6C 1UWOA 5AERA 1JF0A 1RECA 3B86A 3D0YB 3NXAA 1BG1A 3L47A 1YTZC 3PLFB 1NCYA 1S5GZ 1B9AA 2WCJA 1IG5A 2F8PA 1KK7Z 2HPSA 4JQ0D 1SBJA 1YUSA 1S6CA 2QPTA 1G33A 2EHBA 3K21A 2Y4QA 2KLEA 4I5LB 5I2QA 2LP2A 1CFDA 2JZIA 5TNCA 2NCOA 1DMOA 2K2AA 3L4AA 1S3PA 1KSMA 1WLMA 1OOIX 3EVRA 2PRUA 1F54A 1CLBA 1SY9A 2GV5A 5I94A 1IH0A 2JULA 1Z4HA 4PE7A 2PMYA 3CZ1A 1AUIB 1MQ1A 1K90D 2GGZA 2BNXA 3ZWHA 4F7FA 1H4BA 1S5GY 1YVHA 2M3WA 3ICBA 1PALA 4MEWA 1XFZO 5JOLA 4DRWA 1DQEA 2KFGA 4QJ5B 1CMFA 1WRZA 3JTDB 4OCIA 1GGWA 4CPVA 1PRWA 2OS8C 2CXJA 1F8HA 4HREE 1OE9B 3PFVA 3PN7B 1KK8B 3DZTA 1OZSA 5CSJA 1DF0A 2K7CA 1DEKA 1JBAA 4YI9A 5FI7A 2BKIB 1IWQA 2KFHA 1QS7A 1PVAA 3LLEA 2I2RE 4XYNA 1QIWA 1DGUA 3OP0A 3JVTC 2F3YA 1LA3A 3Q8IA 3TDIA 2JXLA 5CPVA 2JT3A 3BFHA 3D10A 4MRYA 4UPGA 1MF8B 1CFFA 1CM1A 1NPQA 2L4IA 2M49B 1EJ3A 4FQTA 1M39A 3DYEA 1AP4A 3S0DA 2KYFA 1S6IA 3SG2A 3VROA 1T14A 4I5NB 1A4PA 1B8CA 1S36A 3B7AA 1BF5A 3FS7A 2WCKA 3EG5B 4PHNA 5D69A 2KPHA 2BBMA 1P28A 3DD4A 4F0ZB 1Y1XA 5CSNA 3UO9A 5B8IB 2NXQA 1TWOA 1PSRA 2BCBA 3CZ0A 3EKJA 2ZNDA 3SIAA 3KHEA 4DS7A 1HQVA 2M97A 2LC5A 2BAPA 1CM4A 2LLUA 1OSAA 1J7RA 5BPJA 1XFYO 1OOHA 3A4UB 3B88A 1ZOTB 2BKHB 2LP3A 5ER4X 2F2PA 1J55A 1DJWA 1A29A 2WC5A 3DF0B 2IS9A 4GGNA 2KAYA 1DGVA 4JWQA 4YGAA 2QEVA 4XJKB 3SJSA 4DUQA 1TTXA 3FWBA 3BUNB 2RGIA 3BOWB 1R2UA 4PDZA 2KNEA 4XJKA 1DC1A 3SS4A 4AQIA 2HETA 1DVIA 2PALA 3EKHA 3NSKA 2LV7A 3SG6A 3ZNIA 5K89A 3CS1A 1FBVA 5DKNA 2WC6A 3KPXA 2KAVA 4C0KA 3HX4A 3BFAA 2CT9A 2LHIA 2MLFC 2G2BA 2JPTA 1XK4C 2ZFDA 1U5IB 1PK0D 4GFTA 3AAKA 1NWDA 4CLNA 2L98A 3I5FB 3BQ3A 3DVEA 1E8AA 1K9KA 3K1EA 2LM5A 1R6PA 5DICA 3OX5A 3NSOA 1JFKA 1UHJA 2H61C 1UP5A 2JC2A 2E6WA 2PVBA 4USLA 1S26D 2EGDA 2JPOA 2M7LA 3IF7A 2L0PA 1K9UA 4IL1A 1MXLC 1D1OA 1N0YA 2L4HA 3O4YA 1JSAA 1QVIY 3UNWA 3AKAA 2BCXA 1TN4A 3S0AA 2I94A 1RK9A 3EK7A 1M45A 2KOTA 3DXLA 1BLQA 1GQMA 4GPLB 5J3XA 2LMTA 2KSPA 5AANA 1DF0B 1Q80A 3WHTB 1QX5B 2M0RA 4U8DA 2BL0C 1M63B 1EL4A 2ZRSA 4GAOA 1QXPA 3GK4X 2QDIA 2F2OA 3OB2B 3AAJA 2NZ0A 5I2OA 1Y1AA 1TCOB 4HRGA 1WDCB 1W9ZA 2JTTA 3EVUA 1Y6WA 1C3YA 1YX7A 1J7OA 1SPYA 2HQ8A 1RWYA 1IKUA 1IQ5A 2BBNA 4YGDB 1Y0VH 3I5GC 1M46A 1K8UA 1L2OB 1TUZA 1CKKA 1JWDA 3D75A 3FWCA 2BL0B 2I7AA 5FYXA 1LXFC 1OOFA 2LUCA 3WHUB 3SS5A 2CTNA 4KYNA 3RM1A 4PALA 1YUUA 2PASA 1WY9A 2LLTA 4NDCA 1LINA 1K96A 1A03A 1SYMA 3MSEB 2LVKA 2O5GA 4NQGA 2FOTA 4M2OA 5HKYA 1SCVA 1ALWA 1UURA 1GGZA 1OMVA 1Z2CB 1KK7Y 1MUXA 1KQMC 1NIWA 3QMEA 2KAXA 1J7QA 4WQ3A 2ISDA 1NUBA 2K7OA 3SG3A 3TS5B 4BY4A 1FPWA 1CDPA 3DVJA 1XK4A 1VRKA 1U5IA 1YUTA 2M8UA 1BR1B 2JT0A 3CYZA 3BXKA 1OMRA 2CNPA 2LMUA 3CZTX 2ZN8A 1J7PA 4D1EA 3OX6A 2HQWA 3AKBA 3O6BA 2SCPA 3SG5A 3V2LA 1YX8A 2P70A 1NCXA 2ZKMX 3D77A 1S1EA 1CDMA 3CTNA 4MZLA 3S0GA 1B8LA 2KHNA 2L5XB 4OKHA 1TNXA 2M1UA 4Q04A 2WCMA 1B47A 4PE0A 1YVLA 2WCEA 1DJXA 4ZCVA 4L9MA 1CTRA 3DVMA 5HYDA 2WNDA 3SS3A 4INXA 1TUJA 3D78A 3CGAA 1JFJA 2JT8A 4GUKA 1SRAA 2Q4UA 1TIZA 4MZKA 1M31A 2LVJA 4R1EA 3SIBA 1WRLA 5KU1A 2KGRA 3NSLA 3OGNA 3TDUA 1FW4A 4DCKA 3L4LA 1AHRA 4PCWA 1WRKA 3BUMB 3D0YA 1DJZA 4BY5A 2JU0A 2KDHA 2SASA 3VRPA 2D8NA 1XFWO 1F70A 2Q91A 1KWOC 3I5IC 5AXIA 1SL9A 2PQLA 3D73A 1KQVA 5F6TA 1QLKA 2KI6D 4AQJA 3I5HC 5KTYA 1F4OA 1ZFSA 2M7NA 5ER5A 1BOCA 3CLNA 4GGFA 1F4QA 3B6XA 3CDNA 2QACA 2COLB 1PSBA 2OPOA 3BUOB 2CCMA 3NSIA 2A4JA 2K61A 3CR2A 3NHTA 3TZ1A 2MAZA 1XYDA 4MZJA 2L50A 3RLZA 1QJTA 1OOGA 3GK2A 1NYAA 1KQMB 3PN7C 3CR5X 3PM2A 3R72A 4ICBA 1BR4B 1B7TZ 2KBMA 3CR4X 1QTXA 1SL7A 3PATA 4YI8A 3KF9A 1MHOA 2JRFA 3SG4A 1CNPA 2K7BA 1K2HA
chains in the Genus database with same CATH topology
1XVJA 4MN0A 3PM8A 3A8RA 3I5FC 4NDDA 4N5XA 3LCPC 4C0JA 1G8IA 4MVFA 1L2OC 3GK1A 3JTDC 1CLLA 1B4CA 3IQQA 2HF5A 2P6BB 1OOJA 1QV0A 2NCPA 2LVVA 2Y5IA 5AFPA 2LMVA 2BECA 1SW8A 5DKQA 4OR9B 4AOMA 1WDCC 2FCEA 4QJ3B 1LKJA 1IJ6A 4CIDA 1K94A 4E68A 2LHLA 2JNFA 4GGFC 4JPZB 1TNPA 2LNKA 1KWOB 3I5IB 1EXRA 1IQ3A 2LAPA 4N1GA 2MBXA 2M29A 1CDLA 4CFQA 1RROA 2MLEC 1A2XA 1AVSA 2LE9B 1KFXS 1NX3A 5HKWA 1XO5A 2G9BA 1UHIA 2KYCA 3PALA 4N1FA 2KI6C 5AEQA 1PULA 1IJ5A 1DJIA 5CSIA 5GQQC 3LL8B 1KFUL 1SR6B 2LVIA 2WC8A 1W7IB 4TNCA 1QATA 1DJYA 5CSFA 2JQ6A 2LCPA 3JVTB 1KFXL 2H2KA 1RFJA 1CFCA 1BJFA 2GGMA 1B1GA 3E3RA 3DF0A 1CFPA 4WRIA 3FIAA 4M2PA 2NLNA 1TNQA 1KSOA 3O78A 2BE4A 4YBHB 2KBIA 1KFUS 1IRJA 2BE6A 2LLSA 1B7TY 1G4YR 1ODBA 1WLZA 1FI5A 1UHNA 1NCZA 3TS5C 4ETOA 1DT7B 4P5OE 4YGBB 3SG7A 4PHMA 5JJGA 3H4SE 4I5JA 2M1KB 2OS8B 2WOSA 3OB1B 5KSZA 3EK8A 1TOPA 1DJGA 1N2DA 2MA2A 4MBEA 3HCMA 4YGEB 1QX7A 4FTGA 2WCFA 1MXEA 1LA0A 1UUSA 2WCBA 3LK1A 2KGBC 1X02A 3BOWA 2AAOA 3VGOA 4I5KA 1XA5A 2JXCA 1FI6A 3I5GB 1LVCD 1ZMZA 3CWGA 4ORAB 4PE1A 1SNLA 1QV1A 1W7JB 4GNKB 1AJ4A 1N65A 1NX1A 2MHHA 4PHKA 2FJUB 1QIVA 2V53A 5DKRA 2EC6B 1HT9A 1OZOA 3IQOA 4A4BA 2JWWA 1C07A 1NSHA 5IBWA 1QASA 4M2QA 2K0JA 1SK6D 5PALA 4A4CA 1AJ5A 1TCFA 2BCAA 4MSPA 1ALVA 1BU3A 3GOFA 1ZACA 1XFXO 2KI4B 4ORCB 3WXAA 1V1FA 1RTP1 4OV2A 2F3ZA 1BODA 1A75A 2CBLA 4P2YB 3KEVA 2JNXA 4HSZA 1SL8A 1OQPA 3BUWB 1JC2A 1SCMC 3OHMB 3EK4A 1K9PA 2OTGB 4MLWA 3O2PA 4FQOA 1KK8C 4PE4A 1DTLA 1F71A 1TNWA 5HKZA 2I18A 2WORA 1YR5A 2JTZA 1QVIZ 2K7DA 4OVNF 4CFRA 1KCYA 2L2EA 1CMGA 2ZNEA 4ZCUA 2DOQA 3WNXB 2EC6C 2LUXA 1SMGA 4QJ4B 1K93D 1J1EA 1NX0A 1XFUO 1ZUZA 1S6JA 2K2FA 2VRGA 1QLSA 3BYAA 1J1DA 5I2LA 3QRXA 1C7VA 3PSRA 2K8MB 4ORBB 2MRDA 1EG4A 1A75B 1CB1A 1OMDA 1DJHA 2JOJA 5HLVA 4DIRA 1UHKA 1YURA 2LANA 1TRFA 3BUXB 3TDZA 3VRNA 1FF1A 1IGVA 1MR8A 5HLOA 1L7ZA 1QX2A 1Y1UA 2AUCA 1YRTB 2MJWB 4HRHA 1RJVA 2KQ6A 3M0WA 4GBAA 1BMOA 1F55A 3DVKA 4MRXA 4PHJA 2PSRA 2L51A 1NX2A 2O60A 1EH2A 5G08A 1C7WA 5I8NA 3LK0A 1YRUB 1V1GA 2OTGC 2ZRTA 4WQ2A 2Y1NA 2ZN9A 2Y1MA 1XFVO 3VRRA 1CLMA 3KO0A 2FCDA 1SKTA 1CDNA 2KI4C 1K95A 3EVVA 4C0LA 1B8RA 1EG3A 4NDBA 3I5HB 3TUYB 1UHHA 1GJYA 5D7FA 2H61A 4YRUA 2F33A 3TUYC 1AK8A 2KFFA 1SCMB 2R2IA 4YGCB 1JUOA 2B1UA 2AMIA 1H8BA 3VRQA 2M9GA 1BT6A 1JF2A 1MWNA 2TN4A 2KQYA 1PVBA 3C1VA 2E30A 3F45A 1NP8A 1SR6C 1UWOA 5AERA 1JF0A 1RECA 1BG1A 3D0YB 3NXAA 1YTZC 3PLFB 1NCYA 1S5GZ 1B9AA 1IG5A 2F8PA 1KK7Z 2HPSA 4JQ0D 1SBJA 1YUSA 1S6CA 2QPTA 1G33A 2EHBA 3K21A 2Y4QA 4I5LB 5I2QA 2LP2A 1CFDA 2JZIA 5TNCA 2NCOA 1DMOA 2K2AA 1S3PA 1KSMA 1WLMA 3EVRA 2PRUA 1F54A 1CLBA 1SY9A 2GV5A 1IH0A 2JULA 4PE7A 2PMYA 1AUIB 1MQ1A 1K90D 2GGZA 3ZWHA 1H4BA 1S5GY 1YVHA 2M3WA 3ICBA 1PALA 4MEWA 1XFZO 5JOLA 4DRWA 4QJ5B 2KFGA 1CMFA 1WRZA 3JTDB 4OCIA 1GGWA 4CPVA 1PRWA 2OS8C 2CXJA 1F8HA 4HREE 1OE9B 3PFVA 3PN7B 1KK8B 5CSJA 1OZSA 1DF0A 2K7CA 1JBAA 4YI9A 2BKIB 1IWQA 2KFHA 1QS7A 1PVAA 3LLEA 2I2RE 4XYNA 1QIWA 1DGUA 3OP0A 3JVTC 2F3YA 1LA3A 3TDIA 2JXLA 5CPVA 2JT3A 3D10A 4MRYA 4UPGA 1CFFA 1MF8B 1CM1A 1NPQA 2L4IA 2M49B 1EJ3A 1M39A 1AP4A 3SG2A 2KYFA 1S6IA 3VROA 4I5NB 1A4PA 1B8CA 1S36A 1BF5A 3FS7A 4PHNA 5D69A 2BBMA 3DD4A 4F0ZB 1Y1XA 5CSNA 5B8IB 2NXQA 2BCBA 1PSRA 3EKJA 3SIAA 2ZNDA 3KHEA 4DS7A 1HQVA 2M97A 2LC5A 1CM4A 2LLUA 1OSAA 1J7RA 5BPJA 1XFYO 3A4UB 1ZOTB 2BKHB 2LP3A 5ER4X 2F2PA 1J55A 1DJWA 1A29A 3DF0B 2IS9A 4GGNA 2KAYA 1DGVA 4JWQA 4YGAA 4XJKB 3SJSA 4DUQA 1TTXA 3FWBA 3BUNB 2RGIA 3BOWB 1R2UA 4PDZA 2KNEA 4XJKA 4AQIA 2HETA 1DVIA 2PALA 3EKHA 3NSKA 2LV7A 3SG6A 3ZNIA 5K89A 3CS1A 1FBVA 5DKNA 3KPXA 2KAVA 4C0KA 3HX4A 2CT9A 2LHIA 2MLFC 2G2BA 2JPTA 1XK4C 2ZFDA 1U5IB 1PK0D 4GFTA 3AAKA 1NWDA 4CLNA 2L98A 3I5FB 3BQ3A 3DVEA 1E8AA 1K9KA 2LM5A 1R6PA 3OX5A 3NSOA 1JFKA 1UHJA 2H61C 1UP5A 2JC2A 2E6WA 2PVBA 4USLA 1S26D 2EGDA 2M7LA 3IF7A 2L0PA 1K9UA 4IL1A 1MXLC 1D1OA 1N0YA 2L4HA 3O4YA 1JSAA 1QVIY 3AKAA 2BCXA 1TN4A 2I94A 1RK9A 3EK7A 1M45A 2KOTA 1BLQA 1GQMA 4GPLB 5J3XA 2LMTA 2KSPA 5AANA 1DF0B 1Q80A 3WHTB 1QX5B 2M0RA 4U8DA 2BL0C 1M63B 1EL4A 2ZRSA 4GAOA 1QXPA 3GK4X 2F2OA 3OB2B 3AAJA 2NZ0A 5I2OA 1Y1AA 1TCOB 4HRGA 1WDCB 2JTTA 3EVUA 1Y6WA 1YX7A 1J7OA 1SPYA 2HQ8A 1RWYA 1IKUA 1IQ5A 2BBNA 4YGDB 1Y0VH 3I5GC 1M46A 1K8UA 1L2OB 1CKKA 1JWDA 3FWCA 2BL0B 2I7AA 5FYXA 1LXFC 2LUCA 3WHUB 2CTNA 3RM1A 4PALA 1YUUA 2PASA 1WY9A 2LLTA 4NDCA 1LINA 1K96A 1A03A 1SYMA 3MSEB 2LVKA 2O5GA 4NQGA 2FOTA 4M2OA 5HKYA 1SCVA 1ALWA 1UURA 1GGZA 1OMVA 1KK7Y 1MUXA 1KQMC 1NIWA 2KAXA 1J7QA 4WQ3A 2ISDA 1NUBA 2K7OA 3SG3A 3TS5B 4BY4A 1FPWA 1CDPA 3DVJA 1XK4A 1VRKA 1U5IA 1YUTA 2M8UA 1BR1B 2JT0A 3BXKA 1OMRA 2CNPA 2LMUA 3CZTX 2ZN8A 1J7PA 4D1EA 3OX6A 2HQWA 3AKBA 3O6BA 2SCPA 3SG5A 1YX8A 1NCXA 2ZKMX 1S1EA 1CDMA 3CTNA 4MZLA 1B8LA 2KHNA 2L5XB 4OKHA 1TNXA 2M1UA 4Q04A 4PE0A 1B47A 1YVLA 2WCEA 1DJXA 4ZCVA 4L9MA 1CTRA 3DVMA 5HYDA 2WNDA 3CGAA 1JFJA 2JT8A 4GUKA 1SRAA 2Q4UA 1TIZA 4MZKA 1M31A 2LVJA 4R1EA 3SIBA 1WRLA 5KU1A 2KGRA 3NSLA 3TDUA 1FW4A 4DCKA 1AHRA 4PCWA 1WRKA 3BUMB 3D0YA 1DJZA 4BY5A 2JU0A 2KDHA 2SASA 3VRPA 2D8NA 1XFWO 1F70A 2Q91A 1KWOC 3I5IC 5AXIA 1SL9A 1KQVA 5F6TA 1QLKA 2KI6D 4AQJA 3I5HC 5KTYA 1F4OA 1ZFSA 2M7NA 5ER5A 1BOCA 3CLNA 4GGFA 1F4QA 2QACA 2COLB 1PSBA 2OPOA 3BUOB 2CCMA 3NSIA 2A4JA 2K61A 3CR2A 3TZ1A 2MAZA 1XYDA 4MZJA 2L50A 3RLZA 1QJTA 3GK2A 1NYAA 1KQMB 3PN7C 3CR5X 4ICBA 1BR4B 1B7TZ 2KBMA 3CR4X 1QTXA 1SL7A 3PATA 4YI8A 3KF9A 1MHOA 2JRFA 3SG4A 1CNPA 2K7BA 1K2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XVJ A;  4MN0 A;  3PM8 A;  3A8R A;  3I5F C;  4NDD A;  4N5X A;  3LCP C;  4C0J A;  1G8I A;  4MVF A;  1L2O C;  3GK1 A;  3JTD C;  1CLL A;  1B4C A;  3IQQ A;  2HF5 A;  2P6B B;  1OOJ A;  1QV0 A;  2NCP A;  2LVV A;  2Y5I A;  5AFP A;  2LMV A;  2BEC A;  1SW8 A;  5DKQ A;  4OR9 B;  4AOM A;  1WDC C;  2FCE A;  4QJ3 B;  1LKJ A;  1IJ6 A;  4CID A;  1K94 A;  4E68 A;  2LHL A;  2JNF A;  4GGF C;  4JPZ B;  1TNP A;  2LNK A;  1KWO B;  3I5I B;  1EXR A;  1IQ3 A;  2LAP A;  4N1G A;  2MBX A;  2M29 A;  1CDL A;  4CFQ A;  1RRO A;  2MLE C;  1A2X A;  1AVS A;  2LE9 B;  1KFX S;  1NX3 A;  5HKW A;  1XO5 A;  2G9B A;  1UHI A;  2KYC A;  3PAL A;  4N1F A;  2KI6 C;  5AEQ A;  1PUL A;  1IJ5 A;  1DJI A;  5CSI A;  5GQQ C;  3LL8 B;  1KFU L;  1SR6 B;  2LVI A;  2WC8 A;  1W7I B;  4TNC A;  1QAT A;  1DJY A;  5CSF A;  2JQ6 A;  2LCP A;  3JVT B;  1KFX L;  2H2K A;  1RFJ A;  1CFC A;  1BJF A;  2GGM A;  1B1G A;  3E3R A;  3DF0 A;  1CFP A;  4WRI A;  3FIA A;  4M2P A;  2NLN A;  1TNQ A;  1KSO A;  3O78 A;  2BE4 A;  4YBH B;  2KBI A;  1KFU S;  1IRJ A;  2BE6 A;  2LLS A;  1B7T Y;  1G4Y R;  1ODB A;  1WLZ A;  1FI5 A;  1UHN A;  1NCZ A;  3TS5 C;  4ETO A;  1DT7 B;  4P5O E;  4YGB B;  3SG7 A;  4PHM A;  5JJG A;  3H4S E;  4I5J A;  2M1K B;  2OS8 B;  2WOS A;  3OB1 B;  5KSZ A;  3EK8 A;  1TOP A;  1DJG A;  1N2D A;  2MA2 A;  4MBE A;  3HCM A;  4YGE B;  1QX7 A;  4FTG A;  2WCF A;  1MXE A;  1LA0 A;  1UUS A;  2WCB A;  3LK1 A;  2KGB C;  1X02 A;  3BOW A;  2AAO A;  3VGO A;  4I5K A;  1XA5 A;  2JXC A;  1FI6 A;  3I5G B;  1LVC D;  1ZMZ A;  3CWG A;  4ORA B;  4PE1 A;  1SNL A;  1QV1 A;  1W7J B;  4GNK B;  1AJ4 A;  1N65 A;  1NX1 A;  2MHH A;  4PHK A;  2FJU B;  1QIV A;  2V53 A;  5DKR A;  2EC6 B;  1HT9 A;  1OZO A;  3IQO A;  4A4B A;  2JWW A;  1C07 A;  1NSH A;  5IBW A;  1QAS A;  4M2Q A;  2K0J A;  1SK6 D;  5PAL A;  4A4C A;  1AJ5 A;  1TCF A;  2BCA A;  4MSP A;  1ALV A;  1BU3 A;  3GOF A;  1ZAC A;  1XFX O;  2KI4 B;  4ORC B;  3WXA A;  1V1F A;  1RTP 1;  4OV2 A;  2F3Z A;  1BOD A;  1A75 A;  2CBL A;  4P2Y B;  3KEV A;  2JNX A;  4HSZ A;  1SL8 A;  1OQP A;  3BUW B;  1JC2 A;  1SCM C;  3OHM B;  3EK4 A;  1K9P A;  2OTG B;  4MLW A;  3O2P A;  4FQO A;  1KK8 C;  4PE4 A;  1DTL A;  1F71 A;  1TNW A;  5HKZ A;  2I18 A;  2WOR A;  1YR5 A;  2JTZ A;  1QVI Z;  2K7D A;  4OVN F;  4CFR A;  1KCY A;  2L2E A;  1CMG A;  2ZNE A;  4ZCU A;  2DOQ A;  3WNX B;  2EC6 C;  2LUX A;  1SMG A;  4QJ4 B;  1K93 D;  1J1E A;  1NX0 A;  1XFU O;  1ZUZ A;  1S6J A;  2K2F A;  2VRG A;  1QLS A;  3BYA A;  1J1D A;  5I2L A;  3QRX A;  1C7V A;  3PSR A;  2K8M B;  4ORB B;  2MRD A;  1EG4 A;  1A75 B;  1CB1 A;  1OMD A;  1DJH A;  2JOJ A;  5HLV A;  4DIR A;  1UHK A;  1YUR A;  2LAN A;  1TRF A;  3BUX B;  3TDZ A;  3VRN A;  1FF1 A;  1IGV A;  1MR8 A;  5HLO A;  1L7Z A;  1QX2 A;  1Y1U A;  2AUC A;  1YRT B;  2MJW B;  4HRH A;  1RJV A;  2KQ6 A;  3M0W A;  4GBA A;  1BMO A;  1F55 A;  3DVK A;  4MRX A;  4PHJ A;  2PSR A;  2L51 A;  1NX2 A;  2O60 A;  1EH2 A;  5G08 A;  1C7W A;  5I8N A;  3LK0 A;  1YRU B;  1V1G A;  2OTG C;  2ZRT A;  4WQ2 A;  2Y1N A;  2ZN9 A;  2Y1M A;  1XFV O;  3VRR A;  1CLM A;  3KO0 A;  2FCD A;  1SKT A;  1CDN A;  2KI4 C;  1K95 A;  3EVV A;  4C0L A;  1B8R A;  1EG3 A;  4NDB A;  3I5H B;  3TUY B;  1UHH A;  1GJY A;  5D7F A;  2H61 A;  4YRU A;  2F33 A;  3TUY C;  1AK8 A;  2KFF A;  1SCM B;  2R2I A;  4YGC B;  1JUO A;  2B1U A;  2AMI A;  1H8B A;  3VRQ A;  2M9G A;  1BT6 A;  1JF2 A;  1MWN A;  2TN4 A;  2KQY A;  1PVB A;  3C1V A;  2E30 A;  3F45 A;  1NP8 A;  1SR6 C;  1UWO A;  5AER A;  1JF0 A;  1REC A;  1BG1 A;  3D0Y B;  3NXA A;  1YTZ C;  3PLF B;  1NCY A;  1S5G Z;  1B9A A;  1IG5 A;  2F8P A;  1KK7 Z;  2HPS A;  4JQ0 D;  1SBJ A;  1YUS A;  1S6C A;  2QPT A;  1G33 A;  2EHB A;  3K21 A;  2Y4Q A;  4I5L B;  5I2Q A;  2LP2 A;  1CFD A;  2JZI A;  5TNC A;  2NCO A;  1DMO A;  2K2A A;  1S3P A;  1KSM A;  1WLM A;  3EVR A;  2PRU A;  1F54 A;  1CLB A;  1SY9 A;  2GV5 A;  1IH0 A;  2JUL A;  4PE7 A;  2PMY A;  1AUI B;  1MQ1 A;  1K90 D;  2GGZ A;  3ZWH A;  1H4B A;  1S5G Y;  1YVH A;  2M3W A;  3ICB A;  1PAL A;  4MEW A;  1XFZ O;  5JOL A;  4DRW A;  4QJ5 B;  2KFG A;  1CMF A;  1WRZ A;  3JTD B;  4OCI A;  1GGW A;  4CPV A;  1PRW A;  2OS8 C;  2CXJ A;  1F8H A;  4HRE E;  1OE9 B;  3PFV A;  3PN7 B;  1KK8 B;  5CSJ A;  1OZS A;  1DF0 A;  2K7C A;  1JBA A;  4YI9 A;  2BKI B;  1IWQ A;  2KFH A;  1QS7 A;  1PVA A;  3LLE A;  2I2R E;  4XYN A;  1QIW A;  1DGU A;  3OP0 A;  3JVT C;  2F3Y A;  1LA3 A;  3TDI A;  2JXL A;  5CPV A;  2JT3 A;  3D10 A;  4MRY A;  4UPG A;  1CFF A;  1MF8 B;  1CM1 A;  1NPQ A;  2L4I A;  2M49 B;  1EJ3 A;  1M39 A;  1AP4 A;  3SG2 A;  2KYF A;  1S6I A;  3VRO A;  4I5N B;  1A4P A;  1B8C A;  1S36 A;  1BF5 A;  3FS7 A;  4PHN A;  5D69 A;  2BBM A;  3DD4 A;  4F0Z B;  1Y1X A;  5CSN A;  5B8I B;  2NXQ A;  2BCB A;  1PSR A;  3EKJ A;  3SIA A;  2ZND A;  3KHE A;  4DS7 A;  1HQV A;  2M97 A;  2LC5 A;  1CM4 A;  2LLU A;  1OSA A;  1J7R A;  5BPJ A;  1XFY O;  3A4U B;  1ZOT B;  2BKH B;  2LP3 A;  5ER4 X;  2F2P A;  1J55 A;  1DJW A;  1A29 A;  3DF0 B;  2IS9 A;  4GGN A;  2KAY A;  1DGV A;  4JWQ A;  4YGA A;  4XJK B;  3SJS A;  4DUQ A;  1TTX A;  3FWB A;  3BUN B;  2RGI A;  3BOW B;  1R2U A;  4PDZ A;  2KNE A;  4XJK A;  4AQI A;  2HET A;  1DVI A;  2PAL A;  3EKH A;  3NSK A;  2LV7 A;  3SG6 A;  3ZNI A;  5K89 A;  3CS1 A;  1FBV A;  5DKN A;  3KPX A;  2KAV A;  4C0K A;  3HX4 A;  2CT9 A;  2LHI A;  2MLF C;  2G2B A;  2JPT A;  1XK4 C;  2ZFD A;  1U5I B;  1PK0 D;  4GFT A;  3AAK A;  1NWD A;  4CLN A;  2L98 A;  3I5F B;  3BQ3 A;  3DVE A;  1E8A A;  1K9K A;  2LM5 A;  1R6P A;  3OX5 A;  3NSO A;  1JFK A;  1UHJ A;  2H61 C;  1UP5 A;  2JC2 A;  2E6W A;  2PVB A;  4USL A;  1S26 D;  2EGD A;  2M7L A;  3IF7 A;  2L0P A;  1K9U A;  4IL1 A;  1MXL C;  1D1O A;  1N0Y A;  2L4H A;  3O4Y A;  1JSA A;  1QVI Y;  3AKA A;  2BCX A;  1TN4 A;  2I94 A;  1RK9 A;  3EK7 A;  1M45 A;  2KOT A;  1BLQ A;  1GQM A;  4GPL B;  5J3X A;  2LMT A;  2KSP A;  5AAN A;  1DF0 B;  1Q80 A;  3WHT B;  1QX5 B;  2M0R A;  4U8D A;  2BL0 C;  1M63 B;  1EL4 A;  2ZRS A;  4GAO A;  1QXP A;  3GK4 X;  2F2O A;  3OB2 B;  3AAJ A;  2NZ0 A;  5I2O A;  1Y1A A;  1TCO B;  4HRG A;  1WDC B;  2JTT A;  3EVU A;  1Y6W A;  1YX7 A;  1J7O A;  1SPY A;  2HQ8 A;  1RWY A;  1IKU A;  1IQ5 A;  2BBN A;  4YGD B;  1Y0V H;  3I5G C;  1M46 A;  1K8U A;  1L2O B;  1CKK A;  1JWD A;  3FWC A;  2BL0 B;  2I7A A;  5FYX A;  1LXF C;  2LUC A;  3WHU B;  2CTN A;  3RM1 A;  4PAL A;  1YUU A;  2PAS A;  1WY9 A;  2LLT A;  4NDC A;  1LIN A;  1K96 A;  1A03 A;  1SYM A;  3MSE B;  2LVK A;  2O5G A;  4NQG A;  2FOT A;  4M2O A;  5HKY A;  1SCV A;  1ALW A;  1UUR A;  1GGZ A;  1OMV A;  1KK7 Y;  1MUX A;  1KQM C;  1NIW A;  2KAX A;  1J7Q A;  4WQ3 A;  2ISD A;  1NUB A;  2K7O A;  3SG3 A;  3TS5 B;  4BY4 A;  1FPW A;  1CDP A;  3DVJ A;  1XK4 A;  1VRK A;  1U5I A;  1YUT A;  2M8U A;  1BR1 B;  2JT0 A;  3BXK A;  1OMR A;  2CNP A;  2LMU A;  3CZT X;  2ZN8 A;  1J7P A;  4D1E A;  3OX6 A;  2HQW A;  3AKB A;  3O6B A;  2SCP A;  3SG5 A;  1YX8 A;  1NCX A;  2ZKM X;  1S1E A;  1CDM A;  3CTN A;  4MZL A;  1B8L A;  2KHN A;  2L5X B;  4OKH A;  1TNX A;  2M1U A;  4Q04 A;  4PE0 A;  1B47 A;  1YVL A;  2WCE A;  1DJX A;  4ZCV A;  4L9M A;  1CTR A;  3DVM A;  5HYD A;  2WND A;  3CGA A;  1JFJ A;  2JT8 A;  4GUK A;  1SRA A;  2Q4U A;  1TIZ A;  4MZK A;  1M31 A;  2LVJ A;  4R1E A;  3SIB A;  1WRL A;  5KU1 A;  2KGR A;  3NSL A;  3TDU A;  1FW4 A;  4DCK A;  1AHR A;  4PCW A;  1WRK A;  3BUM B;  3D0Y A;  1DJZ A;  4BY5 A;  2JU0 A;  2KDH A;  2SAS A;  3VRP A;  2D8N A;  1XFW O;  1F70 A;  2Q91 A;  1KWO C;  3I5I C;  5AXI A;  1SL9 A;  1KQV A;  5F6T A;  1QLK A;  2KI6 D;  4AQJ A;  3I5H C;  5KTY A;  1F4O A;  1ZFS A;  2M7N A;  5ER5 A;  1BOC A;  3CLN A;  4GGF A;  1F4Q A;  2QAC A;  2COL B;  1PSB A;  2OPO A;  3BUO B;  2CCM A;  3NSI A;  2A4J A;  2K61 A;  3CR2 A;  3TZ1 A;  2MAZ A;  1XYD A;  4MZJ A;  2L50 A;  3RLZ A;  1QJT A;  3GK2 A;  1NYA A;  1KQM B;  3PN7 C;  3CR5 X;  4ICB A;  1BR4 B;  1B7T Z;  2KBM A;  3CR4 X;  1QTX A;  1SL7 A;  3PAT A;  4YI8 A;  3KF9 A;  1MHO A;  2JRF A;  3SG4 A;  1CNP A;  2K7B A;  1K2H A; 
#chains in the Genus database with same CATH topology
 1XVJ A;  4MN0 A;  4JD9 A;  3PM8 A;  3A8R A;  3D74 A;  3I5F C;  2ERB A;  4NDD A;  4N5X A;  1C3Z A;  3LCP C;  4C0J A;  5HL1 A;  1G8I A;  4MVF A;  1L2O C;  3GK1 A;  3JTD C;  1GM0 A;  1CLL A;  1B4C A;  3IQQ A;  1SSE B;  2HF5 A;  2P6B B;  1OOJ A;  1QV0 A;  2NCP A;  2LVV A;  2Y5I A;  5AFP A;  2LMV A;  2BEC A;  1SW8 A;  5DKQ A;  4OR9 B;  4AOM A;  1WDC C;  2FCE A;  4QJ3 B;  1LKJ A;  3RZS A;  3NGV A;  1IJ6 A;  4CID A;  1K94 A;  4E68 A;  2LHL A;  2QEO A;  2JNF A;  4GGF C;  4JPZ B;  1TNP A;  2LNK A;  1KWO B;  3I5I B;  1EXR A;  1IQ3 A;  2LAP A;  4N1G A;  2MBX A;  2M29 A;  1CDL A;  4CFQ A;  1RRO A;  2MLE C;  5FI6 A;  5EL2 A;  1A2X A;  1AVS A;  2LE9 B;  1KFX S;  1NX3 A;  5HKW A;  1XO5 A;  2G9B A;  1UHI A;  2KYC A;  3PAL A;  4N1F A;  2KI6 C;  3O4X A;  1PUL A;  1IJ5 A;  5AEQ A;  1DJI A;  3PJI A;  5CSI A;  3OBV A;  5GQQ C;  3LL8 B;  1KFU L;  1SR6 B;  2LVI A;  2WC8 A;  1W7I B;  3R1P A;  1QAT A;  1DJY A;  4TNC A;  5CSF A;  2JQ6 A;  2LCP A;  3JVT B;  4INW A;  1KFX L;  2H2K A;  1RFJ A;  1CFC A;  1BJF A;  2GGM A;  1B1G A;  3BJH A;  3DF0 A;  3E3R A;  1CFP A;  4WRI A;  3FIA A;  2P71 A;  4M2P A;  2NLN A;  4OZD A;  1TNQ A;  1KSO A;  2KLD A;  3R1O A;  3O78 A;  2BE4 A;  2WCH A;  4YBH B;  2KBI A;  1KFU S;  1IRJ A;  2BE6 A;  2LLS A;  1B7T Y;  1G4Y R;  1ODB A;  1WLZ A;  1FI5 A;  1UHN A;  1NCZ A;  3TS5 C;  4ETO A;  1DT7 B;  2FJY A;  4P5O E;  4YGB B;  4PHM A;  3SG7 A;  3S0F A;  5JJG A;  3H4S E;  4I5J A;  2M1K B;  2OS8 B;  4PT1 A;  2WOS A;  3OB1 B;  5KSZ A;  3EK8 A;  1TOP A;  1DJG A;  1N2D A;  2MA2 A;  4IJ7 A;  4MBE A;  3HCM A;  4YGE B;  1QX7 A;  4FTG A;  2WCF A;  1MXE A;  1LA0 A;  1UUS A;  1IIO A;  2WCB A;  3LK1 A;  2KGB C;  1X02 A;  3BOW A;  2AAO A;  3S0B A;  3VGO A;  4I5K A;  1XA5 A;  2JXC A;  1FI6 A;  3I5G B;  1LVC D;  1ZMZ A;  3CWG A;  4ORA B;  4PE1 A;  1SNL A;  1QV1 A;  1W7J B;  4GNK B;  1AJ4 A;  1N65 A;  1NX1 A;  3FE6 A;  2MHH A;  4PHK A;  2FJU B;  1QIV A;  2V53 A;  5DKR A;  2EC6 B;  1HT9 A;  1OZO A;  3IQO A;  4A4B A;  2JWW A;  1C07 A;  1NSH A;  5IBW A;  1QAS A;  4M2Q A;  2K0J A;  1SK6 D;  5PAL A;  4A4C A;  1AJ5 A;  1TCF A;  2BCA A;  2WCL A;  4MSP A;  1ALV A;  1BU3 A;  3GOF A;  3CZ2 A;  1ZAC A;  1XFX O;  2KI4 B;  4ORC B;  3WXA A;  1V1F A;  1RTP 1;  3NHI A;  4OV2 A;  2F3Z A;  1QWV A;  1BOD A;  5D3O A;  3IVT A;  1A75 A;  2CBL A;  4P2Y B;  3KEV A;  2JNX A;  4HSZ A;  1SL8 A;  1OQP A;  3BUW B;  1JC2 A;  1SCM C;  3OHM B;  3EK4 A;  1K9P A;  2OTG B;  4MLW A;  3O2P A;  4FQO A;  1KK8 C;  4PE4 A;  1DTL A;  1F71 A;  1TNW A;  5HKZ A;  2I18 A;  2WOR A;  2H8V A;  1YR5 A;  2JTZ A;  2QEH A;  1QVI Z;  2K7D A;  4OVN F;  4CFR A;  3VB1 A;  2GTE A;  2L2E A;  1CMG A;  2ZNE A;  4ZCU A;  1KCY A;  2DOQ A;  3WNX B;  2EC6 C;  2LUX A;  1SMG A;  4QJ4 B;  1K93 D;  1J1E A;  1NX0 A;  1XFU O;  1ZUZ A;  1S6J A;  2K2F A;  2VRG A;  3BFB A;  1QLS A;  2PYQ A;  3CAB A;  3BYA A;  1J1D A;  5I2L A;  3QRX A;  1C7V A;  3PSR A;  2K8M B;  1DEL A;  4ORB B;  2MRD A;  1EG4 A;  1A75 B;  1CB1 A;  1OMD A;  1DJH A;  2JOJ A;  5HLV A;  4DIR A;  1UHK A;  1YUR A;  2LAN A;  1TRF A;  2YGU A;  3BUX B;  3TDZ A;  1OW4 A;  1IGV A;  3VRN A;  1FF1 A;  1MR8 A;  5HLO A;  1XFR A;  2QEB A;  1L7Z A;  1QX2 A;  1Y1U A;  2AUC A;  1YRT B;  2MJW B;  4HRH A;  1RJV A;  2KQ6 A;  3M0W A;  4GBA A;  1BMO A;  1F55 A;  3DVK A;  4MRX A;  4PHJ A;  2PSR A;  2L51 A;  1NX2 A;  2O60 A;  1EH2 A;  5G08 A;  1C7W A;  5I8N A;  2K60 A;  3LK0 A;  1YRU B;  1V1G A;  2OTG C;  2ZRT A;  3D76 A;  4WQ2 A;  2Y1N A;  2ZN9 A;  2Y1M A;  2L5Y A;  1XFV O;  3VRR A;  1CLM A;  3KO0 A;  2FCD A;  1SKT A;  1CDN A;  2KI4 C;  1K95 A;  3EVV A;  4C0L A;  1B8R A;  1EG3 A;  4JKT A;  3I5H B;  4NDB A;  5FI2 A;  3TUY B;  1UHH A;  1GJY A;  5D7F A;  2H61 A;  4YRU A;  2F33 A;  3TUY C;  1AK8 A;  2KFF A;  3FE8 A;  1SCM B;  3FE9 A;  2L2C A;  2R2I A;  1LS8 A;  4YGC B;  1JUO A;  2B1U A;  1ORG A;  2AMI A;  1H8B A;  3VRQ A;  2M9G A;  1BT6 A;  1JF2 A;  3B87 A;  1MWN A;  2TN4 A;  2KQY A;  3DY9 A;  3N7H A;  1PVB A;  3C1V A;  2E30 A;  3R1V A;  3S0E A;  3F45 A;  1NP8 A;  1SR6 C;  1UWO A;  5AER A;  1JF0 A;  1REC A;  3B86 A;  3D0Y B;  3NXA A;  1BG1 A;  3L47 A;  1YTZ C;  3PLF B;  1NCY A;  1S5G Z;  1B9A A;  2WCJ A;  1IG5 A;  2F8P A;  1KK7 Z;  2HPS A;  4JQ0 D;  1SBJ A;  1YUS A;  1S6C A;  2QPT A;  1G33 A;  2EHB A;  3K21 A;  2Y4Q A;  2KLE A;  4I5L B;  5I2Q A;  2LP2 A;  1CFD A;  2JZI A;  5TNC A;  2NCO A;  1DMO A;  2K2A A;  3L4A A;  1S3P A;  1KSM A;  1WLM A;  1OOI X;  3EVR A;  2PRU A;  1F54 A;  1CLB A;  1SY9 A;  2GV5 A;  5I94 A;  1IH0 A;  2JUL A;  1Z4H A;  4PE7 A;  2PMY A;  3CZ1 A;  1AUI B;  1MQ1 A;  1K90 D;  2GGZ A;  2BNX A;  3ZWH A;  4F7F A;  1H4B A;  1S5G Y;  1YVH A;  2M3W A;  3ICB A;  1PAL A;  4MEW A;  1XFZ O;  5JOL A;  4DRW A;  1DQE A;  2KFG A;  4QJ5 B;  1CMF A;  1WRZ A;  3JTD B;  4OCI A;  1GGW A;  4CPV A;  1PRW A;  2OS8 C;  2CXJ A;  1F8H A;  4HRE E;  1OE9 B;  3PFV A;  3PN7 B;  1KK8 B;  3DZT A;  1OZS A;  5CSJ A;  1DF0 A;  2K7C A;  1DEK A;  1JBA A;  4YI9 A;  5FI7 A;  2BKI B;  1IWQ A;  2KFH A;  1QS7 A;  1PVA A;  3LLE A;  2I2R E;  4XYN A;  1QIW A;  1DGU A;  3OP0 A;  3JVT C;  2F3Y A;  1LA3 A;  3Q8I A;  3TDI A;  2JXL A;  5CPV A;  2JT3 A;  3BFH A;  3D10 A;  4MRY A;  4UPG A;  1MF8 B;  1CFF A;  1CM1 A;  1NPQ A;  2L4I A;  2M49 B;  1EJ3 A;  4FQT A;  1M39 A;  3DYE A;  1AP4 A;  3S0D A;  2KYF A;  1S6I A;  3SG2 A;  3VRO A;  1T14 A;  4I5N B;  1A4P A;  1B8C A;  1S36 A;  3B7A A;  1BF5 A;  3FS7 A;  2WCK A;  3EG5 B;  4PHN A;  5D69 A;  2KPH A;  2BBM A;  1P28 A;  3DD4 A;  4F0Z B;  1Y1X A;  5CSN A;  3UO9 A;  5B8I B;  2NXQ A;  1TWO A;  1PSR A;  2BCB A;  3CZ0 A;  3EKJ A;  2ZND A;  3SIA A;  3KHE A;  4DS7 A;  1HQV A;  2M97 A;  2LC5 A;  2BAP A;  1CM4 A;  2LLU A;  1OSA A;  1J7R A;  5BPJ A;  1XFY O;  1OOH A;  3A4U B;  3B88 A;  1ZOT B;  2BKH B;  2LP3 A;  5ER4 X;  2F2P A;  1J55 A;  1DJW A;  1A29 A;  2WC5 A;  3DF0 B;  2IS9 A;  4GGN A;  2KAY A;  1DGV A;  4JWQ A;  4YGA A;  2QEV A;  4XJK B;  3SJS A;  4DUQ A;  1TTX A;  3FWB A;  3BUN B;  2RGI A;  3BOW B;  1R2U A;  4PDZ A;  2KNE A;  4XJK A;  1DC1 A;  3SS4 A;  4AQI A;  2HET A;  1DVI A;  2PAL A;  3EKH A;  3NSK A;  2LV7 A;  3SG6 A;  3ZNI A;  5K89 A;  3CS1 A;  1FBV A;  5DKN A;  2WC6 A;  3KPX A;  2KAV A;  4C0K A;  3HX4 A;  3BFA A;  2CT9 A;  2LHI A;  2MLF C;  2G2B A;  2JPT A;  1XK4 C;  2ZFD A;  1U5I B;  1PK0 D;  4GFT A;  3AAK A;  1NWD A;  4CLN A;  2L98 A;  3I5F B;  3BQ3 A;  3DVE A;  1E8A A;  1K9K A;  3K1E A;  2LM5 A;  1R6P A;  5DIC A;  3OX5 A;  3NSO A;  1JFK A;  1UHJ A;  2H61 C;  1UP5 A;  2JC2 A;  2E6W A;  2PVB A;  4USL A;  1S26 D;  2EGD A;  2JPO A;  2M7L A;  3IF7 A;  2L0P A;  1K9U A;  4IL1 A;  1MXL C;  1D1O A;  1N0Y A;  2L4H A;  3O4Y A;  1JSA A;  1QVI Y;  3UNW A;  3AKA A;  2BCX A;  1TN4 A;  3S0A A;  2I94 A;  1RK9 A;  3EK7 A;  1M45 A;  2KOT A;  3DXL A;  1BLQ A;  1GQM A;  4GPL B;  5J3X A;  2LMT A;  2KSP A;  5AAN A;  1DF0 B;  1Q80 A;  3WHT B;  1QX5 B;  2M0R A;  4U8D A;  2BL0 C;  1M63 B;  1EL4 A;  2ZRS A;  4GAO A;  1QXP A;  3GK4 X;  2QDI A;  2F2O A;  3OB2 B;  3AAJ A;  2NZ0 A;  5I2O A;  1Y1A A;  1TCO B;  4HRG A;  1WDC B;  1W9Z A;  2JTT A;  3EVU A;  1Y6W A;  1C3Y A;  1YX7 A;  1J7O A;  1SPY A;  2HQ8 A;  1RWY A;  1IKU A;  1IQ5 A;  2BBN A;  4YGD B;  1Y0V H;  3I5G C;  1M46 A;  1K8U A;  1L2O B;  1TUZ A;  1CKK A;  1JWD A;  3D75 A;  3FWC A;  2BL0 B;  2I7A A;  5FYX A;  1LXF C;  1OOF A;  2LUC A;  3WHU B;  3SS5 A;  2CTN A;  4KYN A;  3RM1 A;  4PAL A;  1YUU A;  2PAS A;  1WY9 A;  2LLT A;  4NDC A;  1LIN A;  1K96 A;  1A03 A;  1SYM A;  3MSE B;  2LVK A;  2O5G A;  4NQG A;  2FOT A;  4M2O A;  5HKY A;  1SCV A;  1ALW A;  1UUR A;  1GGZ A;  1OMV A;  1Z2C B;  1KK7 Y;  1MUX A;  1KQM C;  1NIW A;  3QME A;  2KAX A;  1J7Q A;  4WQ3 A;  2ISD A;  1NUB A;  2K7O A;  3SG3 A;  3TS5 B;  4BY4 A;  1FPW A;  1CDP A;  3DVJ A;  1XK4 A;  1VRK A;  1U5I A;  1YUT A;  2M8U A;  1BR1 B;  2JT0 A;  3CYZ A;  3BXK A;  1OMR A;  2CNP A;  2LMU A;  3CZT X;  2ZN8 A;  1J7P A;  4D1E A;  3OX6 A;  2HQW A;  3AKB A;  3O6B A;  2SCP A;  3SG5 A;  3V2L A;  1YX8 A;  2P70 A;  1NCX A;  2ZKM X;  3D77 A;  1S1E A;  1CDM A;  3CTN A;  4MZL A;  3S0G A;  1B8L A;  2KHN A;  2L5X B;  4OKH A;  1TNX A;  2M1U A;  4Q04 A;  2WCM A;  1B47 A;  4PE0 A;  1YVL A;  2WCE A;  1DJX A;  4ZCV A;  4L9M A;  1CTR A;  3DVM A;  5HYD A;  2WND A;  3SS3 A;  4INX A;  1TUJ A;  3D78 A;  3CGA A;  1JFJ A;  2JT8 A;  4GUK A;  1SRA A;  2Q4U A;  1TIZ A;  4MZK A;  1M31 A;  2LVJ A;  4R1E A;  3SIB A;  1WRL A;  5KU1 A;  2KGR A;  3NSL A;  3OGN A;  3TDU A;  1FW4 A;  4DCK A;  3L4L A;  1AHR A;  4PCW A;  1WRK A;  3BUM B;  3D0Y A;  1DJZ A;  4BY5 A;  2JU0 A;  2KDH A;  2SAS A;  3VRP A;  2D8N A;  1XFW O;  1F70 A;  2Q91 A;  1KWO C;  3I5I C;  5AXI A;  1SL9 A;  2PQL A;  3D73 A;  1KQV A;  5F6T A;  1QLK A;  2KI6 D;  4AQJ A;  3I5H C;  5KTY A;  1F4O A;  1ZFS A;  2M7N A;  5ER5 A;  1BOC A;  3CLN A;  4GGF A;  1F4Q A;  3B6X A;  3CDN A;  2QAC A;  2COL B;  1PSB A;  2OPO A;  3BUO B;  2CCM A;  3NSI A;  2A4J A;  2K61 A;  3CR2 A;  3NHT A;  3TZ1 A;  2MAZ A;  1XYD A;  4MZJ A;  2L50 A;  3RLZ A;  1QJT A;  1OOG A;  3GK2 A;  1NYA A;  1KQM B;  3PN7 C;  3CR5 X;  3PM2 A;  3R72 A;  4ICB A;  1BR4 B;  1B7T Z;  2KBM A;  3CR4 X;  1QTX A;  1SL7 A;  3PAT A;  4YI8 A;  3KF9 A;  1MHO A;  2JRF A;  3SG4 A;  1CNP A;  2K7B A;  1K2H A; 
#chains in the Genus database with same CATH homology
 1XVJ A;  4MN0 A;  3PM8 A;  3A8R A;  3I5F C;  4NDD A;  4N5X A;  3LCP C;  4C0J A;  1G8I A;  4MVF A;  1L2O C;  3GK1 A;  3JTD C;  1CLL A;  1B4C A;  3IQQ A;  2HF5 A;  2P6B B;  1OOJ A;  1QV0 A;  2NCP A;  2LVV A;  2Y5I A;  5AFP A;  2LMV A;  2BEC A;  1SW8 A;  5DKQ A;  4OR9 B;  4AOM A;  1WDC C;  2FCE A;  4QJ3 B;  1LKJ A;  1IJ6 A;  4CID A;  1K94 A;  4E68 A;  2LHL A;  2JNF A;  4GGF C;  4JPZ B;  1TNP A;  2LNK A;  1KWO B;  3I5I B;  1EXR A;  1IQ3 A;  2LAP A;  4N1G A;  2MBX A;  2M29 A;  1CDL A;  4CFQ A;  1RRO A;  2MLE C;  1A2X A;  1AVS A;  2LE9 B;  1KFX S;  1NX3 A;  5HKW A;  1XO5 A;  2G9B A;  1UHI A;  2KYC A;  3PAL A;  4N1F A;  2KI6 C;  5AEQ A;  1PUL A;  1IJ5 A;  1DJI A;  5CSI A;  5GQQ C;  3LL8 B;  1KFU L;  1SR6 B;  2LVI A;  2WC8 A;  1W7I B;  4TNC A;  1QAT A;  1DJY A;  5CSF A;  2JQ6 A;  2LCP A;  3JVT B;  1KFX L;  2H2K A;  1RFJ A;  1CFC A;  1BJF A;  2GGM A;  1B1G A;  3E3R A;  3DF0 A;  1CFP A;  4WRI A;  3FIA A;  4M2P A;  2NLN A;  1TNQ A;  1KSO A;  3O78 A;  2BE4 A;  4YBH B;  2KBI A;  1KFU S;  1IRJ A;  2BE6 A;  2LLS A;  1B7T Y;  1G4Y R;  1ODB A;  1WLZ A;  1FI5 A;  1UHN A;  1NCZ A;  3TS5 C;  4ETO A;  1DT7 B;  4P5O E;  4YGB B;  3SG7 A;  4PHM A;  5JJG A;  3H4S E;  4I5J A;  2M1K B;  2OS8 B;  2WOS A;  3OB1 B;  5KSZ A;  3EK8 A;  1TOP A;  1DJG A;  1N2D A;  2MA2 A;  4MBE A;  3HCM A;  4YGE B;  1QX7 A;  4FTG A;  2WCF A;  1MXE A;  1LA0 A;  1UUS A;  2WCB A;  3LK1 A;  2KGB C;  1X02 A;  3BOW A;  2AAO A;  3VGO A;  4I5K A;  1XA5 A;  2JXC A;  1FI6 A;  3I5G B;  1LVC D;  1ZMZ A;  3CWG A;  4ORA B;  4PE1 A;  1SNL A;  1QV1 A;  1W7J B;  4GNK B;  1AJ4 A;  1N65 A;  1NX1 A;  2MHH A;  4PHK A;  2FJU B;  1QIV A;  2V53 A;  5DKR A;  2EC6 B;  1HT9 A;  1OZO A;  3IQO A;  4A4B A;  2JWW A;  1C07 A;  1NSH A;  5IBW A;  1QAS A;  4M2Q A;  2K0J A;  1SK6 D;  5PAL A;  4A4C A;  1AJ5 A;  1TCF A;  2BCA A;  4MSP A;  1ALV A;  1BU3 A;  3GOF A;  1ZAC A;  1XFX O;  2KI4 B;  4ORC B;  3WXA A;  1V1F A;  1RTP 1;  4OV2 A;  2F3Z A;  1BOD A;  1A75 A;  2CBL A;  4P2Y B;  3KEV A;  2JNX A;  4HSZ A;  1SL8 A;  1OQP A;  3BUW B;  1JC2 A;  1SCM C;  3OHM B;  3EK4 A;  1K9P A;  2OTG B;  4MLW A;  3O2P A;  4FQO A;  1KK8 C;  4PE4 A;  1DTL A;  1F71 A;  1TNW A;  5HKZ A;  2I18 A;  2WOR A;  1YR5 A;  2JTZ A;  1QVI Z;  2K7D A;  4OVN F;  4CFR A;  1KCY A;  2L2E A;  1CMG A;  2ZNE A;  4ZCU A;  2DOQ A;  3WNX B;  2EC6 C;  2LUX A;  1SMG A;  4QJ4 B;  1K93 D;  1J1E A;  1NX0 A;  1XFU O;  1ZUZ A;  1S6J A;  2K2F A;  2VRG A;  1QLS A;  3BYA A;  1J1D A;  5I2L A;  3QRX A;  1C7V A;  3PSR A;  2K8M B;  4ORB B;  2MRD A;  1EG4 A;  1A75 B;  1CB1 A;  1OMD A;  1DJH A;  2JOJ A;  5HLV A;  4DIR A;  1UHK A;  1YUR A;  2LAN A;  1TRF A;  3BUX B;  3TDZ A;  3VRN A;  1FF1 A;  1IGV A;  1MR8 A;  5HLO A;  1L7Z A;  1QX2 A;  1Y1U A;  2AUC A;  1YRT B;  2MJW B;  4HRH A;  1RJV A;  2KQ6 A;  3M0W A;  4GBA A;  1BMO A;  1F55 A;  3DVK A;  4MRX A;  4PHJ A;  2PSR A;  2L51 A;  1NX2 A;  2O60 A;  1EH2 A;  5G08 A;  1C7W A;  5I8N A;  3LK0 A;  1YRU B;  1V1G A;  2OTG C;  2ZRT A;  4WQ2 A;  2Y1N A;  2ZN9 A;  2Y1M A;  1XFV O;  3VRR A;  1CLM A;  3KO0 A;  2FCD A;  1SKT A;  1CDN A;  2KI4 C;  1K95 A;  3EVV A;  4C0L A;  1B8R A;  1EG3 A;  4NDB A;  3I5H B;  3TUY B;  1UHH A;  1GJY A;  5D7F A;  2H61 A;  4YRU A;  2F33 A;  3TUY C;  1AK8 A;  2KFF A;  1SCM B;  2R2I A;  4YGC B;  1JUO A;  2B1U A;  2AMI A;  1H8B A;  3VRQ A;  2M9G A;  1BT6 A;  1JF2 A;  1MWN A;  2TN4 A;  2KQY A;  1PVB A;  3C1V A;  2E30 A;  3F45 A;  1NP8 A;  1SR6 C;  1UWO A;  5AER A;  1JF0 A;  1REC A;  1BG1 A;  3D0Y B;  3NXA A;  1YTZ C;  3PLF B;  1NCY A;  1S5G Z;  1B9A A;  1IG5 A;  2F8P A;  1KK7 Z;  2HPS A;  4JQ0 D;  1SBJ A;  1YUS A;  1S6C A;  2QPT A;  1G33 A;  2EHB A;  3K21 A;  2Y4Q A;  4I5L B;  5I2Q A;  2LP2 A;  1CFD A;  2JZI A;  5TNC A;  2NCO A;  1DMO A;  2K2A A;  1S3P A;  1KSM A;  1WLM A;  3EVR A;  2PRU A;  1F54 A;  1CLB A;  1SY9 A;  2GV5 A;  1IH0 A;  2JUL A;  4PE7 A;  2PMY A;  1AUI B;  1MQ1 A;  1K90 D;  2GGZ A;  3ZWH A;  1H4B A;  1S5G Y;  1YVH A;  2M3W A;  3ICB A;  1PAL A;  4MEW A;  1XFZ O;  5JOL A;  4DRW A;  4QJ5 B;  2KFG A;  1CMF A;  1WRZ A;  3JTD B;  4OCI A;  1GGW A;  4CPV A;  1PRW A;  2OS8 C;  2CXJ A;  1F8H A;  4HRE E;  1OE9 B;  3PFV A;  3PN7 B;  1KK8 B;  5CSJ A;  1OZS A;  1DF0 A;  2K7C A;  1JBA A;  4YI9 A;  2BKI B;  1IWQ A;  2KFH A;  1QS7 A;  1PVA A;  3LLE A;  2I2R E;  4XYN A;  1QIW A;  1DGU A;  3OP0 A;  3JVT C;  2F3Y A;  1LA3 A;  3TDI A;  2JXL A;  5CPV A;  2JT3 A;  3D10 A;  4MRY A;  4UPG A;  1CFF A;  1MF8 B;  1CM1 A;  1NPQ A;  2L4I A;  2M49 B;  1EJ3 A;  1M39 A;  1AP4 A;  3SG2 A;  2KYF A;  1S6I A;  3VRO A;  4I5N B;  1A4P A;  1B8C A;  1S36 A;  1BF5 A;  3FS7 A;  4PHN A;  5D69 A;  2BBM A;  3DD4 A;  4F0Z B;  1Y1X A;  5CSN A;  5B8I B;  2NXQ A;  2BCB A;  1PSR A;  3EKJ A;  3SIA A;  2ZND A;  3KHE A;  4DS7 A;  1HQV A;  2M97 A;  2LC5 A;  1CM4 A;  2LLU A;  1OSA A;  1J7R A;  5BPJ A;  1XFY O;  3A4U B;  1ZOT B;  2BKH B;  2LP3 A;  5ER4 X;  2F2P A;  1J55 A;  1DJW A;  1A29 A;  3DF0 B;  2IS9 A;  4GGN A;  2KAY A;  1DGV A;  4JWQ A;  4YGA A;  4XJK B;  3SJS A;  4DUQ A;  1TTX A;  3FWB A;  3BUN B;  2RGI A;  3BOW B;  1R2U A;  4PDZ A;  2KNE A;  4XJK A;  4AQI A;  2HET A;  1DVI A;  2PAL A;  3EKH A;  3NSK A;  2LV7 A;  3SG6 A;  3ZNI A;  5K89 A;  3CS1 A;  1FBV A;  5DKN A;  3KPX A;  2KAV A;  4C0K A;  3HX4 A;  2CT9 A;  2LHI A;  2MLF C;  2G2B A;  2JPT A;  1XK4 C;  2ZFD A;  1U5I B;  1PK0 D;  4GFT A;  3AAK A;  1NWD A;  4CLN A;  2L98 A;  3I5F B;  3BQ3 A;  3DVE A;  1E8A A;  1K9K A;  2LM5 A;  1R6P A;  3OX5 A;  3NSO A;  1JFK A;  1UHJ A;  2H61 C;  1UP5 A;  2JC2 A;  2E6W A;  2PVB A;  4USL A;  1S26 D;  2EGD A;  2M7L A;  3IF7 A;  2L0P A;  1K9U A;  4IL1 A;  1MXL C;  1D1O A;  1N0Y A;  2L4H A;  3O4Y A;  1JSA A;  1QVI Y;  3AKA A;  2BCX A;  1TN4 A;  2I94 A;  1RK9 A;  3EK7 A;  1M45 A;  2KOT A;  1BLQ A;  1GQM A;  4GPL B;  5J3X A;  2LMT A;  2KSP A;  5AAN A;  1DF0 B;  1Q80 A;  3WHT B;  1QX5 B;  2M0R A;  4U8D A;  2BL0 C;  1M63 B;  1EL4 A;  2ZRS A;  4GAO A;  1QXP A;  3GK4 X;  2F2O A;  3OB2 B;  3AAJ A;  2NZ0 A;  5I2O A;  1Y1A A;  1TCO B;  4HRG A;  1WDC B;  2JTT A;  3EVU A;  1Y6W A;  1YX7 A;  1J7O A;  1SPY A;  2HQ8 A;  1RWY A;  1IKU A;  1IQ5 A;  2BBN A;  4YGD B;  1Y0V H;  3I5G C;  1M46 A;  1K8U A;  1L2O B;  1CKK A;  1JWD A;  3FWC A;  2BL0 B;  2I7A A;  5FYX A;  1LXF C;  2LUC A;  3WHU B;  2CTN A;  3RM1 A;  4PAL A;  1YUU A;  2PAS A;  1WY9 A;  2LLT A;  4NDC A;  1LIN A;  1K96 A;  1A03 A;  1SYM A;  3MSE B;  2LVK A;  2O5G A;  4NQG A;  2FOT A;  4M2O A;  5HKY A;  1SCV A;  1ALW A;  1UUR A;  1GGZ A;  1OMV A;  1KK7 Y;  1MUX A;  1KQM C;  1NIW A;  2KAX A;  1J7Q A;  4WQ3 A;  2ISD A;  1NUB A;  2K7O A;  3SG3 A;  3TS5 B;  4BY4 A;  1FPW A;  1CDP A;  3DVJ A;  1XK4 A;  1VRK A;  1U5I A;  1YUT A;  2M8U A;  1BR1 B;  2JT0 A;  3BXK A;  1OMR A;  2CNP A;  2LMU A;  3CZT X;  2ZN8 A;  1J7P A;  4D1E A;  3OX6 A;  2HQW A;  3AKB A;  3O6B A;  2SCP A;  3SG5 A;  1YX8 A;  1NCX A;  2ZKM X;  1S1E A;  1CDM A;  3CTN A;  4MZL A;  1B8L A;  2KHN A;  2L5X B;  4OKH A;  1TNX A;  2M1U A;  4Q04 A;  4PE0 A;  1B47 A;  1YVL A;  2WCE A;  1DJX A;  4ZCV A;  4L9M A;  1CTR A;  3DVM A;  5HYD A;  2WND A;  3CGA A;  1JFJ A;  2JT8 A;  4GUK A;  1SRA A;  2Q4U A;  1TIZ A;  4MZK A;  1M31 A;  2LVJ A;  4R1E A;  3SIB A;  1WRL A;  5KU1 A;  2KGR A;  3NSL A;  3TDU A;  1FW4 A;  4DCK A;  1AHR A;  4PCW A;  1WRK A;  3BUM B;  3D0Y A;  1DJZ A;  4BY5 A;  2JU0 A;  2KDH A;  2SAS A;  3VRP A;  2D8N A;  1XFW O;  1F70 A;  2Q91 A;  1KWO C;  3I5I C;  5AXI A;  1SL9 A;  1KQV A;  5F6T A;  1QLK A;  2KI6 D;  4AQJ A;  3I5H C;  5KTY A;  1F4O A;  1ZFS A;  2M7N A;  5ER5 A;  1BOC A;  3CLN A;  4GGF A;  1F4Q A;  2QAC A;  2COL B;  1PSB A;  2OPO A;  3BUO B;  2CCM A;  3NSI A;  2A4J A;  2K61 A;  3CR2 A;  3TZ1 A;  2MAZ A;  1XYD A;  4MZJ A;  2L50 A;  3RLZ A;  1QJT A;  3GK2 A;  1NYA A;  1KQM B;  3PN7 C;  3CR5 X;  4ICB A;  1BR4 B;  1B7T Z;  2KBM A;  3CR4 X;  1QTX A;  1SL7 A;  3PAT A;  4YI8 A;  3KF9 A;  1MHO A;  2JRF A;  3SG4 A;  1CNP A;  2K7B A;  1K2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...