5JOLA

Calcium-free ef-hand domain of l-plastin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
82
structure length
82
Chain Sequence
b'MARGSVSDEEMMELREAFAKVDTDGNGYISFNELNDLFKAACLPLPGYRVREITENLMATGDLDQDGRISFDEFIKIFHGLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plastin-2
publication title The Calcium-Dependent Switch Helix of L-Plastin Regulates Actin Bundling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 19
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2016-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5jolA00
2H61C 1EG3A 3HX4A 4GPLB 4L9MA 3IQOA 3TS5C 1A75B 3ZWHA 4QJ5B 1CDLA 1V1FA 2NZ0A 1KSOA 1NCZA 1TCFA 1XA5A 1KK7Y 2MLEC 3WHUB 2KFHA 4PE0A 1AVSA 1BLQA 3KEVA 4DRWA 3NSKA 1S1EA 2NCOA 1H8BA 1DJYA 3BUWB 2LMTA 4YGAA 1GJYA 1S6JA 3TS5B 2M1KB 2PALA 3CR4X 1J55A 3LK0A 4E68A 1YR5A 4AOMA 1FBVA 2KYCA 1TIZA 1SBJA 2NLNA 1WDCC 2WNDA 1SL8A 3IF7A 3SIAA 2K7CA 1CFFA 2LHLA 4MEWA 2PMYA 2LANA 1U5IA 3TUYC 1AJ5A 1DF0A 4ORAB 5PALA 1IJ5A 4MZJA 2LVIA 1AUIB 3NSIA 1A03A 1QIWA 1WY9A 1JF2A 1DJWA 1WDCB 3RM1A 4N1GA 1D1OA 2CT9A 2B1UA 3VRRA 3GK2A 1KK7Z 1SMGA 1UHJA 2JC2A 3TUYB 2BCAA 2M1UA 4PHMA 1DJGA 1PULA 3O6BA 4JPZB 1JUOA 3D0YA 1R6PA 2KGBC 2CCMA 3CLNA 4MVFA 2VRGA 2EHBA 1K2HA 3TDIA 1K93D 1JF0A 2FOTA 2BL0B 2MLFC 1CLMA 1M63B 5HYDA 2JU0A 1BF5A 2LMUA 1S5GZ 1ALWA 1NSHA 1L2OC 2F33A 2HF5A 2I2RE 5DKNA 5JOLA 1A75A 4JQ0D 1IRJA 3C1VA 1RWYA 1M45A 2ZRSA 2LV7A 2QACA 1OMRA 4GFTA 3TDZA 2BKHB 2M3WA 1KQMC 1LA3A 2NCPA 5I2QA 4XJKA 2JXCA 2H61A 1MUXA 2Q4UA 2M7LA 4MZLA 3VROA 1EG4A 1EJ3A 4MLWA 3EVRA 5AFPA 4YI9A 1J1EA 4NQGA 3O2PA 1J1DA 1KQMB 2MJWB 3VGOA 4MSPA 5B8IB 2JWWA 2ZRTA 1RECA 4PE1A 3E3RA 3KF9A 1J7RA 5FYXA 1Y1UA 2K8MB 5G08A 1Y1XA 2NXQA 1TNXA 1MF8B 2KQYA 3JVTC 2ZFDA 2LM5A 1OZSA 2KAVA 2I18A 1K90D 1DJZA 4P2YB 4MN0A 1TNWA 1F71A 2KNEA 1TNPA 1UHHA 2LMVA 4NDBA 2L4HA 3JVTB 3QRXA 5D69A 2HETA 1XO5A 3BUOB 1B7TZ 1YVLA 4PE7A 2E6WA 1SKTA 1U5IB 3PN7C 2BE6A 1R2UA 1DF0B 1L7ZA 2HPSA 2F8PA 4N5XA 1UHNA 2LUXA 2L50A 2LP3A 1DVIA 1PSRA 3DVKA 3EK8A 2R2IA 4DIRA 5I2OA 2KSPA 3D10A 2K2FA 1UURA 3OHMB 1B47A 4CIDA 1OZOA 1ALVA 2G2BA 4N1FA 1YRTB 1WRLA 4M2QA 5J3XA 1CDMA 1HQVA 2KOTA 2OTGC 1RJVA 1SYMA 3NSOA 3WXAA 1F4QA 4TNCA 3PM8A 1NWDA 1GGWA 3TZ1A 1OOJA 2ZNEA 4U8DA 1CM1A 2I94A 1TN4A 2M97A 2JXLA 3AAJA 1KCYA 4PCWA 1K8UA 3CGAA 1QLKA 1QS7A 1SCVA 1YX7A 2OTGB 2BE4A 1JSAA 1EXRA 2TN4A 2KI6D 3I5FC 1SCMB 5HKYA 1CKKA 2L51A 2ISDA 1DMOA 4GUKA 3AKBA 1DJIA 4BY5A 3NSLA 3WNXB 2GV5A 4XJKB 4C0LA 1A4PA 1XYDA 1FI5A 5HKWA 1YTZC 1BG1A 1BODA 1F54A 3CWGA 3I5FB 5BPJA 5JJGA 1OQPA 2A4JA 4CPVA 2KDHA 1IQ3A 1QJTA 2JNFA 1B1GA 2MAZA 4P5OE 1XFYO 4MRYA 1S3PA 4NDCA 1SRAA 4PDZA 2JPTA 4CLNA 4ZCUA 1J7QA 4I5LB 1KK8C 1MQ1A 1UUSA 2QPTA 4C0JA 2LLSA 2M49B 3FS7A 4WQ3A 2LP2A 3SG4A 2L2EA 1S36A 2DOQA 2JTZA 1SPYA 1QASA 1AK8A 2ZKMX 1W7IB 3BOWB 3BQ3A 2ZN8A 1EH2A 1PK0D 4Q04A 1QVIY 1KK8B 3EVVA 2AAOA 3JTDC 1CNPA 1JFKA 2EC6C 2LE9B 2FJUB 1UP5A 2BKIB 1J7OA 3LCPC 1J7PA 1WRZA 4I5KA 3H4SE 1CTRA 5KTYA 3EKHA 4WRIA 3A8RA 3AAKA 5K89A 1XVJA 1N65A 3JTDB 2F2PA 2GGMA 2EC6B 5HLVA 1KFXL 1C7WA 4C0KA 2K7DA 1BOCA 2WORA 1IWQA 3IQQA 1YVHA 2O5GA 4PE4A 2MRDA 4ICBA 5CSNA 1DJXA 2KI6C 2M8UA 4MRXA 5D7FA 3KHEA 5I2LA 1F8HA 2LLTA 2KHNA 1FF1A 1OE9B 2K61A 4FQOA 1L2OB 2AUCA 4FTGA 1KFUL 1Q80A 4XYNA 1NX2A 2PASA 1Y1AA 1F4OA 1PVAA 3GK1A 1OSAA 1RROA 2M9GA 2MBXA 4HRGA 2KAXA 2KYFA 3SG2A 1JC2A 4UPGA 3I5HC 1QX5B 4OR9B 1CFPA 1LVCD 3TDUA 5CSFA 2PVBA 3OX5A 5I8NA 1CFDA 1G8IA 1VRKA 1Y6WA 3GK4X 2FCEA 4MZKA 5ER5A 3PATA 1S6IA 3DF0A 2F3ZA 5HKZA 3VRQA 2JT8A 3BOWA 2I7AA 2JT3A 1MXEA 3OB1B 2F2OA 1XFXO 3DD4A 4WQ2A 3I5HB 5DKQA 1CB1A 3F45A 2ZN9A 2MA2A 1RK9A 4GGFA 1CMGA 1ZOTB 1SK6D 2KI4C 3BXKA 1CLLA 2COLB 3DVMA 4ORCB 2CBLA 1UHIA 2PSRA 1YRUB 4JWQA 4A4BA 2M29A 1JFJA 4QJ4B 4HSZA 3PLFB 3LLEA 4MBEA 3SG5A 3M0WA 5DKRA 1NCYA 4GGNA 3RLZA 1N2DA 2KQ6A 2LHIA 1XK4C 3AKAA 5AXIA 2LC5A 1MHOA 1IKUA 3NXAA 3BYAA 1SL7A 3O78A 2OS8C 3SIBA 1C7VA 1AHRA 1N0YA 4YGEB 2KFGA 3MSEB 1Y0VH 1KWOC 3PN7B 1CDNA 3SG6A 5ER4X 3EK7A 2JNXA 2L98A 1XFZO 3BUXB 4I5NB 2FCDA 1QX2A 1S6CA 1TRFA 2LVJA 5AANA 1LKJA 1A2XA 2JULA 1ZACA 3GOFA 2OS8B 1CMFA 2L4IA 1KWOB 1FW4A 3HCMA 4HRHA 1H4BA 1DJHA 2KBMA 1G33A 4BY4A 2E30A 1K96A 1QX7A 1PALA 1RFJA 1QTXA 3DVEA 5HLOA 1SR6C 4YGDB 1UWOA 1K94A 4CFRA 4GNKB 4USLA 5AERA 2SCPA 1KQVA 2WCEA 2K7OA 1PSBA 2JTTA 4M2PA 1JBAA 1SR6B 1PVBA 2Y1NA 1TCOB 1M31A 4D1EA 1NX0A 3BUNB 1C07A 1PRWA 1DGUA 3A4UB 4GGFC 1FPWA 4A4CA 2L5XB 5TNCA 1NCXA 1V1GA 3DF0B 3LL8B 1B8CA 2LAPA 2WC8A 1CLBA 4PHNA 2M0RA 4OV2A 2F3YA 3FWBA 4HREE 3ICBA 1YUSA 1GGZA 3SG3A 1IG5A 2IS9A 4NDDA 2AMIA 2JQ6A 3BUMB 3EK4A 1S5GY 2WCFA 3PFVA 3PSRA 1W7JB 4GAOA 1DTLA 1XK4A 3OB2B 4I5JA 1BR4B 1QATA 4YGBB 2HQ8A 2MHHA 2Y4QA 3I5GC 2BBMA 5AEQA 1MXLC 1YX8A 2PRUA 5KSZA 1DT7B 2RGIA 4QJ3B 4AQJA 4OCIA 1B8RA 2OPOA 4OKHA 3VRPA 1CFCA 1XFVO 4DS7A 2BL0C 2H2KA 2Y5IA 5CSJA 1EL4A 4ZCVA 1JWDA 1TNQA 3FWCA 1LINA 3CZTX 3I5GB 3CTNA 3SG7A 1TTXA 1XFUO 4M2OA 1ZMZA 3KO0A 3VRNA 2M7NA 4ORBB 2P6BB 1M46A 1QVIZ 1WRKA 1K9KA 2EGDA 4AQIA 1KFXS 3PALA 1QV1A 1OMVA 1S26D 1SL9A 1B9AA 3EKJA 3EVUA 1IH0A 5F6TA 2BECA 3DVJA 1B4CA 1G4YR 1NX1A 1LXFC 1BJFA 1MWNA 1B8LA 1KFUS 1WLMA 4YI8A 3CR2A 4ETOA 1IGVA 1NIWA 1BMOA 1B7TY 1X02A 1NP8A 2G9BA 3FIAA 4YBHB 2SASA 1BU3A 2Y1MA 1TOPA 2JRFA 2WCBA 2L0PA 1K95A 1F55A 1DGVA 1QXPA 4GBAA 2CNPA 1ZUZA 4YGCB 1K9UA 2WOSA 3OP0A 1NUBA 1UHKA 1GQMA 3I5IC 5CSIA 4PHKA 1SNLA 2BCBA 4F0ZB 2D8NA 3SJSA 2JOJA 1CM4A 2ZNDA 1NYAA 3WHTB 1IJ6A 2K2AA 1XFWO 1YUTA 4PHJA 2KI4B 2KFFA 3O4YA 5CPVA 1A29A 1HT9A 2CXJA 1IQ5A 1AJ4A 5GQQC 2Q91A 3I5IB 4CFQA 1YUUA 1ZFSA 1BT6A 1NX3A 1M39A 2GGZA 2KGRA 2LCPA 2LVKA 3K21A 1FI6A 2O60A 3CS1A 2KBIA 1K9PA 1WLZA 2K7BA 1QLSA 2BBNA 2KAYA 4DUQA 4PALA 3KPXA 4OVNF 1BR1B 2CTNA 3ZNIA 4DCKA 2LUCA 3LK1A 2BCXA 2JZIA 1CDPA 2HQWA 4YRUA 1KSMA 1E8AA 1F70A 2LLUA 5IBWA 1QIVA 4IL1A 1LA0A 4R1EA 2JT0A 2LVVA 1YURA 3OX6A 1SCMC 2V53A 1SY9A 1RTP1 3D0YB 1QV0A 2K0JA 1SW8A 3CR5X 1MR8A 1NPQA 1OMDA 5KU1A 1AP4A 1ODBA 2LNKA
chains in the Genus database with same CATH superfamily
2H61C 1EG3A 3HX4A 4GPLB 4L9MA 3IQOA 3TS5C 1A75B 3ZWHA 4QJ5B 1CDLA 1V1FA 2NZ0A 1KSOA 1NCZA 1TCFA 1XA5A 1KK7Y 2MLEC 3WHUB 2KFHA 4PE0A 1AVSA 1BLQA 3KEVA 4DRWA 3NSKA 1S1EA 2NCOA 1H8BA 1DJYA 3BUWB 2LMTA 3BFBA 4YGAA 3B6XA 1GJYA 1S6JA 3TS5B 2M1KB 3IVTA 2PALA 3CR4X 3B88A 1J55A 3LK0A 4E68A 1YR5A 4AOMA 1FBVA 2KYCA 1TIZA 1SBJA 2NLNA 1WDCC 2WNDA 1SL8A 3IF7A 3SIAA 2K7CA 1CFFA 2LHLA 4MEWA 2PMYA 2LANA 1U5IA 3TUYC 1AJ5A 1DF0A 4ORAB 5PALA 1IJ5A 4MZJA 2LVIA 1AUIB 3NSIA 1A03A 1QIWA 1WY9A 1JF2A 1DJWA 1WDCB 3RM1A 4N1GA 1D1OA 2CT9A 2B1UA 3VRRA 5FI2A 1DELA 3GK2A 1KK7Z 1SMGA 1JWDA 1UHJA 2JC2A 3TUYB 2BCAA 2M1UA 4PHMA 1DJGA 1PULA 4OZDA 3O6BA 4JPZB 1JUOA 3D0YA 1R6PA 3D78A 2KGBC 2CCMA 3CLNA 4MVFA 2VRGA 2EHBA 2KLDA 1K2HA 3TDIA 1K93D 1JF0A 2FOTA 2BL0B 2MLFC 1CLMA 1M63B 5HYDA 2JU0A 1BF5A 2LMUA 1S5GZ 1ALWA 2KLEA 1NSHA 1L2OC 2F33A 2HF5A 2I2RE 5DKNA 5JOLA 3VB1A 1A75A 4JQ0D 1IRJA 3C1VA 1RWYA 1M45A 1OW4A 2LV7A 2ZRSA 2QACA 1OMRA 4GFTA 3TDZA 2BKHB 2M3WA 1KQMC 1LA3A 4PT1A 2NCPA 5I2QA 4XJKA 2JXCA 2H61A 1MUXA 2Q4UA 2M7LA 4MZLA 3VROA 1EG4A 1EJ3A 1T14A 4MLWA 3EVRA 5AFPA 4YI9A 1J1EA 4NQGA 3O2PA 1J1DA 1KQMB 2MJWB 3FE6A 3VGOA 4MSPA 5B8IB 2JWWA 2ZRTA 1RECA 3D75A 4PE1A 3E3RA 3KF9A 1J7RA 5FYXA 5DICA 3V2LA 3RZSA 3BJHA 1Y1UA 2K8MB 3SS5A 5G08A 1OOFA 1Y1XA 2NXQA 1TNXA 1MF8B 2KQYA 2P70A 3JVTC 2ZFDA 2LM5A 1OZSA 2KAVA 2I18A 1K90D 1DJZA 4P2YB 4MN0A 1TNWA 1F71A 2KNEA 1TNPA 1UHHA 2LMVA 4NDBA 2L4HA 3JVTB 3QRXA 5D69A 2HETA 1XO5A 3BUOB 3FE8A 1B7TZ 1YVLA 4PE7A 2E6WA 1SKTA 1U5IB 3PN7C 2BE6A 1R2UA 1DF0B 1L7ZA 2BAPA 2HPSA 2F8PA 4N5XA 1UHNA 2LUXA 2L50A 2LP3A 1DVIA 1PSRA 3DVKA 3EK8A 2R2IA 3SS4A 4DIRA 2KSPA 3D10A 5I2OA 2K2FA 1UURA 3OHMB 1B47A 4CIDA 2YGUA 2ERBA 1OZOA 1ALVA 2G2BA 3OGNA 4N1FA 1YRTB 1WRLA 4M2QA 5J3XA 1CDMA 1HQVA 2KOTA 2OTGC 1RJVA 1SYMA 3NSOA 3WXAA 1F4QA 4TNCA 3PM8A 1NWDA 1GGWA 3TZ1A 1OOJA 2ZNEA 4U8DA 1CM1A 2I94A 1TN4A 2LNKA 2M97A 2JXLA 3AAJA 1KCYA 4PCWA 1K8UA 3CGAA 1QLKA 1QS7A 1SCVA 1YX7A 2OTGB 2BE4A 1JSAA 1EXRA 2TN4A 2KI6D 4IJ7A 3I5FC 1SCMB 5EL2A 5HKYA 2L51A 2ISDA 1CKKA 1DMOA 4GUKA 3AKBA 1DJIA 4BY5A 3NSLA 3WNXB 3B87A 2GV5A 4XJKB 4C0LA 1A4PA 1XYDA 1FI5A 5HKWA 1YTZC 1BG1A 1BODA 1F54A 3CWGA 3FE9A 3I5FB 5BPJA 5JJGA 1OQPA 2A4JA 4CPVA 2KDHA 1IQ3A 1QJTA 2JNFA 1B1GA 2MAZA 4P5OE 1XFYO 3Q8IA 4MRYA 1S3PA 3L4LA 4NDCA 1SRAA 4PDZA 2JPTA 4CLNA 4ZCUA 1Z4HA 1J7QA 4I5LB 1KK8C 1MQ1A 1UUSA 2QPTA 3N7HA 2LLSA 4C0JA 2M49B 3FS7A 4WQ3A 2LP2A 3SG4A 2L2EA 1S36A 2DOQA 2JTZA 3NHIA 1SPYA 1QASA 1XFRA 2QEOA 2ZKMX 1W7IB 3BOWB 1AK8A 3BQ3A 3O4XA 2ZN8A 1EH2A 1PK0D 4Q04A 1QVIY 1KK8B 3EVVA 2AAOA 3JTDC 4JD9A 3S0AA 1CNPA 3PJIA 1JFKA 2EC6C 2LE9B 2QEHA 2FJUB 1UP5A 2BKIB 1J7OA 3LCPC 1J7PA 1WRZA 4I5KA 3H4SE 1CTRA 3D74A 5KTYA 3EKHA 4WRIA 3A8RA 3AAKA 5K89A 1XVJA 1N65A 3D76A 3JTDB 3D77A 3R1PA 2F2PA 2GGMA 2EC6B 5HLVA 1KFXL 1C7WA 4C0KA 2K7DA 1BOCA 2WORA 1IWQA 3IQQA 1YVHA 2O5GA 4PE4A 2MRDA 4ICBA 5CSNA 1DJXA 2KI6C 2M8UA 4MRXA 5D7FA 3KHEA 5I2LA 1F8HA 2LLTA 2KHNA 1FF1A 1OE9B 2K61A 4FQOA 1L2OB 2PYQA 2PQLA 2AUCA 4FTGA 3CABA 1KFUL 1Q80A 4XYNA 1NX2A 2PASA 2JPOA 1C3YA 1Y1AA 3NGVA 1F4OA 1PVAA 3DZTA 3GK1A 1OSAA 1RROA 2M9GA 2MBXA 3CZ1A 4HRGA 3DXLA 2KAXA 2KYFA 3SG2A 1JC2A 1W9ZA 4UPGA 3I5HC 1QX5B 4OR9B 1CFPA 1LVCD 3TDUA 5CSFA 2PVBA 3OX5A 3SS3A 5I8NA 3R1VA 1CFDA 1G8IA 1VRKA 1Y6WA 3B86A 2FCEA 3GK4X 4MZKA 3PATA 5ER5A 1S6IA 3DF0A 2F3ZA 5HKZA 3VRQA 2JT8A 3BOWA 2I7AA 2JT3A 1MXEA 3OB1B 2F2OA 1XFXO 3DD4A 4WQ2A 3I5HB 5DKQA 1CB1A 3DYEA 2FJYA 3F45A 1OOHA 2ZN9A 2MA2A 1RK9A 4GGFA 1CMGA 1ZOTB 1SK6D 2KI4C 1LS8A 3BXKA 1CLLA 2COLB 3DVMA 4ORCB 2CBLA 3UO9A 1UHIA 3S0GA 2PSRA 4F7FA 1YRUB 4JWQA 4A4BA 2M29A 1JFJA 4QJ4B 4HSZA 3PLFB 1P28A 3LLEA 4MBEA 3M0WA 1TUZA 1NCYA 2QEBA 5DKRA 4GGNA 3L4AA 2QEVA 3RLZA 1N2DA 2KQ6A 2LHIA 1XK4C 3AKAA 5AXIA 2LC5A 1MHOA 1IKUA 3NXAA 3BYAA 1SL7A 3O78A 2OS8C 3SIBA 1C7VA 1AHRA 1N0YA 4YGEB 2KFGA 3MSEB 1Y0VH 1KWOC 3PN7B 2WC6A 2L5YA 3SG6A 1CDNA 5ER4X 3EK7A 2JNXA 2L98A 1XFZO 3BUXB 4I5NB 2FCDA 1QX2A 1S6CA 3SG5A 1TRFA 2LVJA 5AANA 5I94A 1LKJA 1A2XA 2JULA 1ZACA 3GOFA 2OS8B 1CMFA 2QDIA 4FQTA 3S0DA 5FI6A 2L4IA 3BFAA 1KWOB 1FW4A 3HCMA 3R72A 4HRHA 1H4BA 1C3ZA 1DJHA 2KBMA 4KYNA 1G33A 1IIOA 4BY4A 2E30A 1K96A 1QX7A 1PALA 5HL1A 1RFJA 1QTXA 3DVEA 3OBVA 5HLOA 1SR6C 2H8VA 4YGDB 3PM2A 1UWOA 1K94A 4CFRA 4GNKB 4USLA 5AERA 2SCPA 1KQVA 2K60A 3CZ0A 2WCEA 2K7OA 2GTEA 1PSBA 2JTTA 4JKTA 4M2PA 1JBAA 3CDNA 1SR6B 1PVBA 2Y1NA 1TCOB 1M31A 4D1EA 1NX0A 3BUNB 1C07A 1PRWA 1DGUA 3A4UB 4GGFC 1FPWA 4A4CA 1OOGA 2L5XB 5TNCA 1DC1A 1NCXA 1V1GA 3DF0B 3LL8B 1B8CA 2LAPA 2WC8A 1CLBA 4PHNA 2M0RA 2KPHA 4OV2A 2F3YA 3FWBA 4HREE 3ICBA 1YUSA 1GGZA 3SG3A 1IG5A 2IS9A 4NDDA 2AMIA 2JQ6A 3BUMB 3EK4A 1S5GY 2WCFA 3PFVA 3PSRA 1W7JB 4GAOA 3S0FA 1DTLA 1XK4A 3OB2B 4I5JA 2WCKA 1BR4B 1QATA 4YGBB 2HQ8A 3D73A 2MHHA 2Y4QA 3I5GC 2BBMA 5AEQA 1MXLC 1YX8A 2PRUA 5KSZA 1DT7B 1TUJA 1TWOA 2RGIA 4QJ3B 4AQJA 3K1EA 4OCIA 1B8RA 2OPOA 3CYZA 4OKHA 3VRPA 1XFVO 1CFCA 2L2CA 4DS7A 2BL0C 2H2KA 2Y5IA 1Z2CB 1EL4A 3R1OA 5CSJA 1TNQA 3FWCA 4ZCVA 3S0EA 1LINA 3CZTX 3I5GB 3CTNA 3SG7A 3DY9A 1TTXA 1XFUO 4M2OA 1ZMZA 3KO0A 3VRNA 2M7NA 4ORBB 2P6BB 1M46A 3L47A 1QVIZ 1WRKA 1K9KA 2EGDA 4AQIA 1KFXS 2WCLA 3PALA 1QV1A 1OMVA 1S26D 1SL9A 1B9AA 3EKJA 3EVUA 1IH0A 5F6TA 2BECA 3DVJA 1B4CA 1G4YR 1NX1A 1LXFC 1BJFA 1MWNA 3S0BA 1B8LA 1KFUS 1SSEB 1WLMA 4YI8A 3CR2A 4ETOA 1IGVA 1NIWA 1BMOA 1B7TY 1X02A 1NP8A 2G9BA 3FIAA 4YBHB 2SASA 1BU3A 2Y1MA 1TOPA 2JRFA 2WCBA 2L0PA 1K95A 1OOIX 1F55A 1DGVA 1QXPA 4GBAA 2CNPA 1ZUZA 4YGCB 1K9UA 2WOSA 3OP0A 1NUBA 1UHKA 3BFHA 1GQMA 3I5IC 5CSIA 4PHKA 5D3OA 2WCJA 1SNLA 2BCBA 4F0ZB 2D8NA 3SJSA 2JOJA 1CM4A 2ZNDA 1NYAA 3WHTB 1IJ6A 2K2AA 1XFWO 1YUTA 4PHJA 1QWVA 2KI4B 2KFFA 3O4YA 5CPVA 1A29A 1HT9A 2CXJA 2P71A 3EG5B 1IQ5A 1AJ4A 3B7AA 5GQQC 2Q91A 3I5IB 4CFQA 1YUUA 1ZFSA 1BT6A 1NX3A 1M39A 3NHTA 2GGZA 2KGRA 2LCPA 2LVKA 2WC5A 2WCMA 2O60A 3K21A 1FI6A 3CS1A 2KBIA 1K9PA 1WLZA 4INXA 2K7BA 1QLSA 2BBNA 2KAYA 4DUQA 4PALA 2BNXA 3KPXA 4OVNF 1BR1B 2CTNA 3ZNIA 5FI7A 4DCKA 2LUCA 3LK1A 4INWA 3UNWA 2BCXA 2JZIA 1CDPA 2HQWA 4YRUA 1KSMA 1E8AA 1F70A 2LLUA 5IBWA 1QIVA 4IL1A 1LA0A 4R1EA 3QMEA 2JT0A 2LVVA 1YURA 3OX6A 1GM0A 1SCMC 2V53A 1SY9A 1RTP1 3D0YB 2WCHA 1QV0A 2K0JA 1SW8A 1DEKA 3CR5X 1DQEA 1MR8A 1NPQA 1OMDA 5KU1A 1AP4A 1ODBA 3CZ2A 1ORGA
chains in the Genus database with same CATH topology
2H61C 1EG3A 3HX4A 4GPLB 4L9MA 3IQOA 3TS5C 1A75B 3ZWHA 4QJ5B 1CDLA 1V1FA 2NZ0A 1KSOA 1NCZA 1TCFA 1XA5A 1KK7Y 2MLEC 3WHUB 2KFHA 4PE0A 1AVSA 1BLQA 3KEVA 4DRWA 3NSKA 1S1EA 2NCOA 1H8BA 1DJYA 3BUWB 2LMTA 4YGAA 1GJYA 1S6JA 3TS5B 2M1KB 2PALA 3CR4X 1J55A 3LK0A 4E68A 1YR5A 4AOMA 1FBVA 2KYCA 1TIZA 1SBJA 2NLNA 1WDCC 2WNDA 1SL8A 3IF7A 3SIAA 2K7CA 1CFFA 2LHLA 4MEWA 2PMYA 2LANA 1U5IA 3TUYC 1AJ5A 1DF0A 4ORAB 5PALA 1IJ5A 4MZJA 2LVIA 1AUIB 3NSIA 1A03A 1QIWA 1WY9A 1JF2A 1DJWA 1WDCB 3RM1A 4N1GA 1D1OA 2CT9A 2B1UA 3VRRA 3GK2A 1KK7Z 1SMGA 1UHJA 2JC2A 3TUYB 2BCAA 2M1UA 4PHMA 1DJGA 1PULA 3O6BA 4JPZB 1JUOA 3D0YA 1R6PA 2KGBC 2CCMA 3CLNA 4MVFA 2VRGA 2EHBA 1K2HA 3TDIA 1K93D 1JF0A 2FOTA 2BL0B 2MLFC 1CLMA 1M63B 5HYDA 2JU0A 1BF5A 2LMUA 1S5GZ 1ALWA 1NSHA 1L2OC 2F33A 2HF5A 2I2RE 5DKNA 5JOLA 1A75A 4JQ0D 1IRJA 3C1VA 1RWYA 1M45A 2ZRSA 2LV7A 2QACA 1OMRA 4GFTA 3TDZA 2BKHB 2M3WA 1KQMC 1LA3A 2NCPA 5I2QA 4XJKA 2JXCA 2H61A 1MUXA 2Q4UA 2M7LA 4MZLA 3VROA 1EG4A 1EJ3A 4MLWA 3EVRA 5AFPA 4YI9A 1J1EA 4NQGA 3O2PA 1J1DA 1KQMB 2MJWB 3VGOA 4MSPA 5B8IB 2JWWA 2ZRTA 1RECA 4PE1A 3E3RA 3KF9A 1J7RA 5FYXA 1Y1UA 2K8MB 5G08A 1Y1XA 2NXQA 1TNXA 1MF8B 2KQYA 3JVTC 2ZFDA 2LM5A 1OZSA 2KAVA 2I18A 1K90D 1DJZA 4P2YB 4MN0A 1TNWA 1F71A 2KNEA 1TNPA 1UHHA 2LMVA 4NDBA 2L4HA 3JVTB 3QRXA 5D69A 2HETA 1XO5A 3BUOB 1B7TZ 1YVLA 4PE7A 2E6WA 1SKTA 1U5IB 3PN7C 2BE6A 1R2UA 1DF0B 1L7ZA 2HPSA 2F8PA 4N5XA 1UHNA 2LUXA 2L50A 2LP3A 1DVIA 1PSRA 3DVKA 3EK8A 2R2IA 4DIRA 5I2OA 2KSPA 3D10A 2K2FA 1UURA 3OHMB 1B47A 4CIDA 1OZOA 1ALVA 2G2BA 4N1FA 1YRTB 1WRLA 4M2QA 5J3XA 1CDMA 1HQVA 2KOTA 2OTGC 1RJVA 1SYMA 3NSOA 3WXAA 1F4QA 4TNCA 3PM8A 1NWDA 1GGWA 3TZ1A 1OOJA 2ZNEA 4U8DA 1CM1A 2I94A 1TN4A 2M97A 2JXLA 3AAJA 1KCYA 4PCWA 1K8UA 3CGAA 1QLKA 1QS7A 1SCVA 1YX7A 2OTGB 2BE4A 1JSAA 1EXRA 2TN4A 2KI6D 3I5FC 1SCMB 5HKYA 1CKKA 2L51A 2ISDA 1DMOA 4GUKA 3AKBA 1DJIA 4BY5A 3NSLA 3WNXB 2GV5A 4XJKB 4C0LA 1A4PA 1XYDA 1FI5A 5HKWA 1YTZC 1BG1A 1BODA 1F54A 3CWGA 3I5FB 5BPJA 5JJGA 1OQPA 2A4JA 4CPVA 2KDHA 1IQ3A 1QJTA 2JNFA 1B1GA 2MAZA 4P5OE 1XFYO 4MRYA 1S3PA 4NDCA 1SRAA 4PDZA 2JPTA 4CLNA 4ZCUA 1J7QA 4I5LB 1KK8C 1MQ1A 1UUSA 2QPTA 4C0JA 2LLSA 2M49B 3FS7A 4WQ3A 2LP2A 3SG4A 2L2EA 1S36A 2DOQA 2JTZA 1SPYA 1QASA 1AK8A 2ZKMX 1W7IB 3BOWB 3BQ3A 2ZN8A 1EH2A 1PK0D 4Q04A 1QVIY 1KK8B 3EVVA 2AAOA 3JTDC 1CNPA 1JFKA 2EC6C 2LE9B 2FJUB 1UP5A 2BKIB 1J7OA 3LCPC 1J7PA 1WRZA 4I5KA 3H4SE 1CTRA 5KTYA 3EKHA 4WRIA 3A8RA 3AAKA 5K89A 1XVJA 1N65A 3JTDB 2F2PA 2GGMA 2EC6B 5HLVA 1KFXL 1C7WA 4C0KA 2K7DA 1BOCA 2WORA 1IWQA 3IQQA 1YVHA 2O5GA 4PE4A 2MRDA 4ICBA 5CSNA 1DJXA 2KI6C 2M8UA 4MRXA 5D7FA 3KHEA 5I2LA 1F8HA 2LLTA 2KHNA 1FF1A 1OE9B 2K61A 4FQOA 1L2OB 2AUCA 4FTGA 1KFUL 1Q80A 4XYNA 1NX2A 2PASA 1Y1AA 1F4OA 1PVAA 3GK1A 1OSAA 1RROA 2M9GA 2MBXA 4HRGA 2KAXA 2KYFA 3SG2A 1JC2A 4UPGA 3I5HC 1QX5B 4OR9B 1CFPA 1LVCD 3TDUA 5CSFA 2PVBA 3OX5A 5I8NA 1CFDA 1G8IA 1VRKA 1Y6WA 3GK4X 2FCEA 4MZKA 5ER5A 3PATA 1S6IA 3DF0A 2F3ZA 5HKZA 3VRQA 2JT8A 3BOWA 2I7AA 2JT3A 1MXEA 3OB1B 2F2OA 1XFXO 3DD4A 4WQ2A 3I5HB 5DKQA 1CB1A 3F45A 2ZN9A 2MA2A 1RK9A 4GGFA 1CMGA 1ZOTB 1SK6D 2KI4C 3BXKA 1CLLA 2COLB 3DVMA 4ORCB 2CBLA 1UHIA 2PSRA 1YRUB 4JWQA 4A4BA 2M29A 1JFJA 4QJ4B 4HSZA 3PLFB 3LLEA 4MBEA 3SG5A 3M0WA 5DKRA 1NCYA 4GGNA 3RLZA 1N2DA 2KQ6A 2LHIA 1XK4C 3AKAA 5AXIA 2LC5A 1MHOA 1IKUA 3NXAA 3BYAA 1SL7A 3O78A 2OS8C 3SIBA 1C7VA 1AHRA 1N0YA 4YGEB 2KFGA 3MSEB 1Y0VH 1KWOC 3PN7B 1CDNA 3SG6A 5ER4X 3EK7A 2JNXA 2L98A 1XFZO 3BUXB 4I5NB 2FCDA 1QX2A 1S6CA 1TRFA 2LVJA 5AANA 1LKJA 1A2XA 2JULA 1ZACA 3GOFA 2OS8B 1CMFA 2L4IA 1KWOB 1FW4A 3HCMA 4HRHA 1H4BA 1DJHA 2KBMA 1G33A 4BY4A 2E30A 1K96A 1QX7A 1PALA 1RFJA 1QTXA 3DVEA 5HLOA 1SR6C 4YGDB 1UWOA 1K94A 4CFRA 4GNKB 4USLA 5AERA 2SCPA 1KQVA 2WCEA 2K7OA 1PSBA 2JTTA 4M2PA 1JBAA 1SR6B 1PVBA 2Y1NA 1TCOB 1M31A 4D1EA 1NX0A 3BUNB 1C07A 1PRWA 1DGUA 3A4UB 4GGFC 1FPWA 4A4CA 2L5XB 5TNCA 1NCXA 1V1GA 3DF0B 3LL8B 1B8CA 2LAPA 2WC8A 1CLBA 4PHNA 2M0RA 4OV2A 2F3YA 3FWBA 4HREE 3ICBA 1YUSA 1GGZA 3SG3A 1IG5A 2IS9A 4NDDA 2AMIA 2JQ6A 3BUMB 3EK4A 1S5GY 2WCFA 3PFVA 3PSRA 1W7JB 4GAOA 1DTLA 1XK4A 3OB2B 4I5JA 1BR4B 1QATA 4YGBB 2HQ8A 2MHHA 2Y4QA 3I5GC 2BBMA 5AEQA 1MXLC 1YX8A 2PRUA 5KSZA 1DT7B 2RGIA 4QJ3B 4AQJA 4OCIA 1B8RA 2OPOA 4OKHA 3VRPA 1CFCA 1XFVO 4DS7A 2BL0C 2H2KA 2Y5IA 5CSJA 1EL4A 4ZCVA 1JWDA 1TNQA 3FWCA 1LINA 3CZTX 3I5GB 3CTNA 3SG7A 1TTXA 1XFUO 4M2OA 1ZMZA 3KO0A 3VRNA 2M7NA 4ORBB 2P6BB 1M46A 1QVIZ 1WRKA 1K9KA 2EGDA 4AQIA 1KFXS 3PALA 1QV1A 1OMVA 1S26D 1SL9A 1B9AA 3EKJA 3EVUA 1IH0A 5F6TA 2BECA 3DVJA 1B4CA 1G4YR 1NX1A 1LXFC 1BJFA 1MWNA 1B8LA 1KFUS 1WLMA 4YI8A 3CR2A 4ETOA 1IGVA 1NIWA 1BMOA 1B7TY 1X02A 1NP8A 2G9BA 3FIAA 4YBHB 2SASA 1BU3A 2Y1MA 1TOPA 2JRFA 2WCBA 2L0PA 1K95A 1F55A 1DGVA 1QXPA 4GBAA 2CNPA 1ZUZA 4YGCB 1K9UA 2WOSA 3OP0A 1NUBA 1UHKA 1GQMA 3I5IC 5CSIA 4PHKA 1SNLA 2BCBA 4F0ZB 2D8NA 3SJSA 2JOJA 1CM4A 2ZNDA 1NYAA 3WHTB 1IJ6A 2K2AA 1XFWO 1YUTA 4PHJA 2KI4B 2KFFA 3O4YA 5CPVA 1A29A 1HT9A 2CXJA 1IQ5A 1AJ4A 5GQQC 2Q91A 3I5IB 4CFQA 1YUUA 1ZFSA 1BT6A 1NX3A 1M39A 2GGZA 2KGRA 2LCPA 2LVKA 3K21A 1FI6A 2O60A 3CS1A 2KBIA 1K9PA 1WLZA 2K7BA 1QLSA 2BBNA 2KAYA 4DUQA 4PALA 3KPXA 4OVNF 1BR1B 2CTNA 3ZNIA 4DCKA 2LUCA 3LK1A 2BCXA 2JZIA 1CDPA 2HQWA 4YRUA 1KSMA 1E8AA 1F70A 2LLUA 5IBWA 1QIVA 4IL1A 1LA0A 4R1EA 2JT0A 2LVVA 1YURA 3OX6A 1SCMC 2V53A 1SY9A 1RTP1 3D0YB 1QV0A 2K0JA 1SW8A 3CR5X 1MR8A 1NPQA 1OMDA 5KU1A 1AP4A 1ODBA 2LNKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H61 C;  1EG3 A;  3HX4 A;  4GPL B;  4L9M A;  3IQO A;  3TS5 C;  1A75 B;  3ZWH A;  4QJ5 B;  1CDL A;  1V1F A;  2NZ0 A;  1KSO A;  1NCZ A;  1TCF A;  1XA5 A;  1KK7 Y;  2MLE C;  3WHU B;  2KFH A;  4PE0 A;  1AVS A;  1BLQ A;  3KEV A;  4DRW A;  3NSK A;  1S1E A;  2NCO A;  1H8B A;  1DJY A;  3BUW B;  2LMT A;  4YGA A;  1GJY A;  1S6J A;  3TS5 B;  2M1K B;  2PAL A;  3CR4 X;  1J55 A;  3LK0 A;  4E68 A;  1YR5 A;  4AOM A;  1FBV A;  2KYC A;  1TIZ A;  1SBJ A;  2NLN A;  1WDC C;  2WND A;  1SL8 A;  3IF7 A;  3SIA A;  2K7C A;  1CFF A;  2LHL A;  4MEW A;  2PMY A;  2LAN A;  1U5I A;  3TUY C;  1AJ5 A;  1DF0 A;  4ORA B;  5PAL A;  1IJ5 A;  4MZJ A;  2LVI A;  1AUI B;  3NSI A;  1A03 A;  1QIW A;  1WY9 A;  1JF2 A;  1DJW A;  1WDC B;  3RM1 A;  4N1G A;  1D1O A;  2CT9 A;  2B1U A;  3VRR A;  3GK2 A;  1KK7 Z;  1SMG A;  1UHJ A;  2JC2 A;  3TUY B;  2BCA A;  2M1U A;  4PHM A;  1DJG A;  1PUL A;  3O6B A;  4JPZ B;  1JUO A;  3D0Y A;  1R6P A;  2KGB C;  2CCM A;  3CLN A;  4MVF A;  2VRG A;  2EHB A;  1K2H A;  3TDI A;  1K93 D;  1JF0 A;  2FOT A;  2BL0 B;  2MLF C;  1CLM A;  1M63 B;  5HYD A;  2JU0 A;  1BF5 A;  2LMU A;  1S5G Z;  1ALW A;  1NSH A;  1L2O C;  2F33 A;  2HF5 A;  2I2R E;  5DKN A;  5JOL A;  1A75 A;  4JQ0 D;  1IRJ A;  3C1V A;  1RWY A;  1M45 A;  2ZRS A;  2LV7 A;  2QAC A;  1OMR A;  4GFT A;  3TDZ A;  2BKH B;  2M3W A;  1KQM C;  1LA3 A;  2NCP A;  5I2Q A;  4XJK A;  2JXC A;  2H61 A;  1MUX A;  2Q4U A;  2M7L A;  4MZL A;  3VRO A;  1EG4 A;  1EJ3 A;  4MLW A;  3EVR A;  5AFP A;  4YI9 A;  1J1E A;  4NQG A;  3O2P A;  1J1D A;  1KQM B;  2MJW B;  3VGO A;  4MSP A;  5B8I B;  2JWW A;  2ZRT A;  1REC A;  4PE1 A;  3E3R A;  3KF9 A;  1J7R A;  5FYX A;  1Y1U A;  2K8M B;  5G08 A;  1Y1X A;  2NXQ A;  1TNX A;  1MF8 B;  2KQY A;  3JVT C;  2ZFD A;  2LM5 A;  1OZS A;  2KAV A;  2I18 A;  1K90 D;  1DJZ A;  4P2Y B;  4MN0 A;  1TNW A;  1F71 A;  2KNE A;  1TNP A;  1UHH A;  2LMV A;  4NDB A;  2L4H A;  3JVT B;  3QRX A;  5D69 A;  2HET A;  1XO5 A;  3BUO B;  1B7T Z;  1YVL A;  4PE7 A;  2E6W A;  1SKT A;  1U5I B;  3PN7 C;  2BE6 A;  1R2U A;  1DF0 B;  1L7Z A;  2HPS A;  2F8P A;  4N5X A;  1UHN A;  2LUX A;  2L50 A;  2LP3 A;  1DVI A;  1PSR A;  3DVK A;  3EK8 A;  2R2I A;  4DIR A;  5I2O A;  2KSP A;  3D10 A;  2K2F A;  1UUR A;  3OHM B;  1B47 A;  4CID A;  1OZO A;  1ALV A;  2G2B A;  4N1F A;  1YRT B;  1WRL A;  4M2Q A;  5J3X A;  1CDM A;  1HQV A;  2KOT A;  2OTG C;  1RJV A;  1SYM A;  3NSO A;  3WXA A;  1F4Q A;  4TNC A;  3PM8 A;  1NWD A;  1GGW A;  3TZ1 A;  1OOJ A;  2ZNE A;  4U8D A;  1CM1 A;  2I94 A;  1TN4 A;  2M97 A;  2JXL A;  3AAJ A;  1KCY A;  4PCW A;  1K8U A;  3CGA A;  1QLK A;  1QS7 A;  1SCV A;  1YX7 A;  2OTG B;  2BE4 A;  1JSA A;  1EXR A;  2TN4 A;  2KI6 D;  3I5F C;  1SCM B;  5HKY A;  1CKK A;  2L51 A;  2ISD A;  1DMO A;  4GUK A;  3AKB A;  1DJI A;  4BY5 A;  3NSL A;  3WNX B;  2GV5 A;  4XJK B;  4C0L A;  1A4P A;  1XYD A;  1FI5 A;  5HKW A;  1YTZ C;  1BG1 A;  1BOD A;  1F54 A;  3CWG A;  3I5F B;  5BPJ A;  5JJG A;  1OQP A;  2A4J A;  4CPV A;  2KDH A;  1IQ3 A;  1QJT A;  2JNF A;  1B1G A;  2MAZ A;  4P5O E;  1XFY O;  4MRY A;  1S3P A;  4NDC A;  1SRA A;  4PDZ A;  2JPT A;  4CLN A;  4ZCU A;  1J7Q A;  4I5L B;  1KK8 C;  1MQ1 A;  1UUS A;  2QPT A;  4C0J A;  2LLS A;  2M49 B;  3FS7 A;  4WQ3 A;  2LP2 A;  3SG4 A;  2L2E A;  1S36 A;  2DOQ A;  2JTZ A;  1SPY A;  1QAS A;  1AK8 A;  2ZKM X;  1W7I B;  3BOW B;  3BQ3 A;  2ZN8 A;  1EH2 A;  1PK0 D;  4Q04 A;  1QVI Y;  1KK8 B;  3EVV A;  2AAO A;  3JTD C;  1CNP A;  1JFK A;  2EC6 C;  2LE9 B;  2FJU B;  1UP5 A;  2BKI B;  1J7O A;  3LCP C;  1J7P A;  1WRZ A;  4I5K A;  3H4S E;  1CTR A;  5KTY A;  3EKH A;  4WRI A;  3A8R A;  3AAK A;  5K89 A;  1XVJ A;  1N65 A;  3JTD B;  2F2P A;  2GGM A;  2EC6 B;  5HLV A;  1KFX L;  1C7W A;  4C0K A;  2K7D A;  1BOC A;  2WOR A;  1IWQ A;  3IQQ A;  1YVH A;  2O5G A;  4PE4 A;  2MRD A;  4ICB A;  5CSN A;  1DJX A;  2KI6 C;  2M8U A;  4MRX A;  5D7F A;  3KHE A;  5I2L A;  1F8H A;  2LLT A;  2KHN A;  1FF1 A;  1OE9 B;  2K61 A;  4FQO A;  1L2O B;  2AUC A;  4FTG A;  1KFU L;  1Q80 A;  4XYN A;  1NX2 A;  2PAS A;  1Y1A A;  1F4O A;  1PVA A;  3GK1 A;  1OSA A;  1RRO A;  2M9G A;  2MBX A;  4HRG A;  2KAX A;  2KYF A;  3SG2 A;  1JC2 A;  4UPG A;  3I5H C;  1QX5 B;  4OR9 B;  1CFP A;  1LVC D;  3TDU A;  5CSF A;  2PVB A;  3OX5 A;  5I8N A;  1CFD A;  1G8I A;  1VRK A;  1Y6W A;  3GK4 X;  2FCE A;  4MZK A;  5ER5 A;  3PAT A;  1S6I A;  3DF0 A;  2F3Z A;  5HKZ A;  3VRQ A;  2JT8 A;  3BOW A;  2I7A A;  2JT3 A;  1MXE A;  3OB1 B;  2F2O A;  1XFX O;  3DD4 A;  4WQ2 A;  3I5H B;  5DKQ A;  1CB1 A;  3F45 A;  2ZN9 A;  2MA2 A;  1RK9 A;  4GGF A;  1CMG A;  1ZOT B;  1SK6 D;  2KI4 C;  3BXK A;  1CLL A;  2COL B;  3DVM A;  4ORC B;  2CBL A;  1UHI A;  2PSR A;  1YRU B;  4JWQ A;  4A4B A;  2M29 A;  1JFJ A;  4QJ4 B;  4HSZ A;  3PLF B;  3LLE A;  4MBE A;  3SG5 A;  3M0W A;  5DKR A;  1NCY A;  4GGN A;  3RLZ A;  1N2D A;  2KQ6 A;  2LHI A;  1XK4 C;  3AKA A;  5AXI A;  2LC5 A;  1MHO A;  1IKU A;  3NXA A;  3BYA A;  1SL7 A;  3O78 A;  2OS8 C;  3SIB A;  1C7V A;  1AHR A;  1N0Y A;  4YGE B;  2KFG A;  3MSE B;  1Y0V H;  1KWO C;  3PN7 B;  1CDN A;  3SG6 A;  5ER4 X;  3EK7 A;  2JNX A;  2L98 A;  1XFZ O;  3BUX B;  4I5N B;  2FCD A;  1QX2 A;  1S6C A;  1TRF A;  2LVJ A;  5AAN A;  1LKJ A;  1A2X A;  2JUL A;  1ZAC A;  3GOF A;  2OS8 B;  1CMF A;  2L4I A;  1KWO B;  1FW4 A;  3HCM A;  4HRH A;  1H4B A;  1DJH A;  2KBM A;  1G33 A;  4BY4 A;  2E30 A;  1K96 A;  1QX7 A;  1PAL A;  1RFJ A;  1QTX A;  3DVE A;  5HLO A;  1SR6 C;  4YGD B;  1UWO A;  1K94 A;  4CFR A;  4GNK B;  4USL A;  5AER A;  2SCP A;  1KQV A;  2WCE A;  2K7O A;  1PSB A;  2JTT A;  4M2P A;  1JBA A;  1SR6 B;  1PVB A;  2Y1N A;  1TCO B;  1M31 A;  4D1E A;  1NX0 A;  3BUN B;  1C07 A;  1PRW A;  1DGU A;  3A4U B;  4GGF C;  1FPW A;  4A4C A;  2L5X B;  5TNC A;  1NCX A;  1V1G A;  3DF0 B;  3LL8 B;  1B8C A;  2LAP A;  2WC8 A;  1CLB A;  4PHN A;  2M0R A;  4OV2 A;  2F3Y A;  3FWB A;  4HRE E;  3ICB A;  1YUS A;  1GGZ A;  3SG3 A;  1IG5 A;  2IS9 A;  4NDD A;  2AMI A;  2JQ6 A;  3BUM B;  3EK4 A;  1S5G Y;  2WCF A;  3PFV A;  3PSR A;  1W7J B;  4GAO A;  1DTL A;  1XK4 A;  3OB2 B;  4I5J A;  1BR4 B;  1QAT A;  4YGB B;  2HQ8 A;  2MHH A;  2Y4Q A;  3I5G C;  2BBM A;  5AEQ A;  1MXL C;  1YX8 A;  2PRU A;  5KSZ A;  1DT7 B;  2RGI A;  4QJ3 B;  4AQJ A;  4OCI A;  1B8R A;  2OPO A;  4OKH A;  3VRP A;  1CFC A;  1XFV O;  4DS7 A;  2BL0 C;  2H2K A;  2Y5I A;  5CSJ A;  1EL4 A;  4ZCV A;  1JWD A;  1TNQ A;  3FWC A;  1LIN A;  3CZT X;  3I5G B;  3CTN A;  3SG7 A;  1TTX A;  1XFU O;  4M2O A;  1ZMZ A;  3KO0 A;  3VRN A;  2M7N A;  4ORB B;  2P6B B;  1M46 A;  1QVI Z;  1WRK A;  1K9K A;  2EGD A;  4AQI A;  1KFX S;  3PAL A;  1QV1 A;  1OMV A;  1S26 D;  1SL9 A;  1B9A A;  3EKJ A;  3EVU A;  1IH0 A;  5F6T A;  2BEC A;  3DVJ A;  1B4C A;  1G4Y R;  1NX1 A;  1LXF C;  1BJF A;  1MWN A;  1B8L A;  1KFU S;  1WLM A;  4YI8 A;  3CR2 A;  4ETO A;  1IGV A;  1NIW A;  1BMO A;  1B7T Y;  1X02 A;  1NP8 A;  2G9B A;  3FIA A;  4YBH B;  2SAS A;  1BU3 A;  2Y1M A;  1TOP A;  2JRF A;  2WCB A;  2L0P A;  1K95 A;  1F55 A;  1DGV A;  1QXP A;  4GBA A;  2CNP A;  1ZUZ A;  4YGC B;  1K9U A;  2WOS A;  3OP0 A;  1NUB A;  1UHK A;  1GQM A;  3I5I C;  5CSI A;  4PHK A;  1SNL A;  2BCB A;  4F0Z B;  2D8N A;  3SJS A;  2JOJ A;  1CM4 A;  2ZND A;  1NYA A;  3WHT B;  1IJ6 A;  2K2A A;  1XFW O;  1YUT A;  4PHJ A;  2KI4 B;  2KFF A;  3O4Y A;  5CPV A;  1A29 A;  1HT9 A;  2CXJ A;  1IQ5 A;  1AJ4 A;  5GQQ C;  2Q91 A;  3I5I B;  4CFQ A;  1YUU A;  1ZFS A;  1BT6 A;  1NX3 A;  1M39 A;  2GGZ A;  2KGR A;  2LCP A;  2LVK A;  3K21 A;  1FI6 A;  2O60 A;  3CS1 A;  2KBI A;  1K9P A;  1WLZ A;  2K7B A;  1QLS A;  2BBN A;  2KAY A;  4DUQ A;  4PAL A;  3KPX A;  4OVN F;  1BR1 B;  2CTN A;  3ZNI A;  4DCK A;  2LUC A;  3LK1 A;  2BCX A;  2JZI A;  1CDP A;  2HQW A;  4YRU A;  1KSM A;  1E8A A;  1F70 A;  2LLU A;  5IBW A;  1QIV A;  4IL1 A;  1LA0 A;  4R1E A;  2JT0 A;  2LVV A;  1YUR A;  3OX6 A;  1SCM C;  2V53 A;  1SY9 A;  1RTP 1;  3D0Y B;  1QV0 A;  2K0J A;  1SW8 A;  3CR5 X;  1MR8 A;  1NPQ A;  1OMD A;  5KU1 A;  1AP4 A;  1ODB A;  2LNK A; 
#chains in the Genus database with same CATH topology
 2H61 C;  1EG3 A;  3HX4 A;  4GPL B;  4L9M A;  3IQO A;  3TS5 C;  1A75 B;  3ZWH A;  4QJ5 B;  1CDL A;  1V1F A;  2NZ0 A;  1KSO A;  1NCZ A;  1TCF A;  1XA5 A;  1KK7 Y;  2MLE C;  3WHU B;  2KFH A;  4PE0 A;  1AVS A;  1BLQ A;  3KEV A;  4DRW A;  3NSK A;  1S1E A;  2NCO A;  1H8B A;  1DJY A;  3BUW B;  2LMT A;  3BFB A;  4YGA A;  3B6X A;  1GJY A;  1S6J A;  3TS5 B;  2M1K B;  3IVT A;  2PAL A;  3CR4 X;  3B88 A;  1J55 A;  3LK0 A;  4E68 A;  1YR5 A;  4AOM A;  1FBV A;  2KYC A;  1TIZ A;  1SBJ A;  2NLN A;  1WDC C;  2WND A;  1SL8 A;  3IF7 A;  3SIA A;  2K7C A;  1CFF A;  2LHL A;  4MEW A;  2PMY A;  2LAN A;  1U5I A;  3TUY C;  1AJ5 A;  1DF0 A;  4ORA B;  5PAL A;  1IJ5 A;  4MZJ A;  2LVI A;  1AUI B;  3NSI A;  1A03 A;  1QIW A;  1WY9 A;  1JF2 A;  1DJW A;  1WDC B;  3RM1 A;  4N1G A;  1D1O A;  2CT9 A;  2B1U A;  3VRR A;  5FI2 A;  1DEL A;  3GK2 A;  1KK7 Z;  1SMG A;  1JWD A;  1UHJ A;  2JC2 A;  3TUY B;  2BCA A;  2M1U A;  4PHM A;  1DJG A;  1PUL A;  4OZD A;  3O6B A;  4JPZ B;  1JUO A;  3D0Y A;  1R6P A;  3D78 A;  2KGB C;  2CCM A;  3CLN A;  4MVF A;  2VRG A;  2EHB A;  2KLD A;  1K2H A;  3TDI A;  1K93 D;  1JF0 A;  2FOT A;  2BL0 B;  2MLF C;  1CLM A;  1M63 B;  5HYD A;  2JU0 A;  1BF5 A;  2LMU A;  1S5G Z;  1ALW A;  2KLE A;  1NSH A;  1L2O C;  2F33 A;  2HF5 A;  2I2R E;  5DKN A;  5JOL A;  3VB1 A;  1A75 A;  4JQ0 D;  1IRJ A;  3C1V A;  1RWY A;  1M45 A;  1OW4 A;  2LV7 A;  2ZRS A;  2QAC A;  1OMR A;  4GFT A;  3TDZ A;  2BKH B;  2M3W A;  1KQM C;  1LA3 A;  4PT1 A;  2NCP A;  5I2Q A;  4XJK A;  2JXC A;  2H61 A;  1MUX A;  2Q4U A;  2M7L A;  4MZL A;  3VRO A;  1EG4 A;  1EJ3 A;  1T14 A;  4MLW A;  3EVR A;  5AFP A;  4YI9 A;  1J1E A;  4NQG A;  3O2P A;  1J1D A;  1KQM B;  2MJW B;  3FE6 A;  3VGO A;  4MSP A;  5B8I B;  2JWW A;  2ZRT A;  1REC A;  3D75 A;  4PE1 A;  3E3R A;  3KF9 A;  1J7R A;  5FYX A;  5DIC A;  3V2L A;  3RZS A;  3BJH A;  1Y1U A;  2K8M B;  3SS5 A;  5G08 A;  1OOF A;  1Y1X A;  2NXQ A;  1TNX A;  1MF8 B;  2KQY A;  2P70 A;  3JVT C;  2ZFD A;  2LM5 A;  1OZS A;  2KAV A;  2I18 A;  1K90 D;  1DJZ A;  4P2Y B;  4MN0 A;  1TNW A;  1F71 A;  2KNE A;  1TNP A;  1UHH A;  2LMV A;  4NDB A;  2L4H A;  3JVT B;  3QRX A;  5D69 A;  2HET A;  1XO5 A;  3BUO B;  3FE8 A;  1B7T Z;  1YVL A;  4PE7 A;  2E6W A;  1SKT A;  1U5I B;  3PN7 C;  2BE6 A;  1R2U A;  1DF0 B;  1L7Z A;  2BAP A;  2HPS A;  2F8P A;  4N5X A;  1UHN A;  2LUX A;  2L50 A;  2LP3 A;  1DVI A;  1PSR A;  3DVK A;  3EK8 A;  2R2I A;  3SS4 A;  4DIR A;  2KSP A;  3D10 A;  5I2O A;  2K2F A;  1UUR A;  3OHM B;  1B47 A;  4CID A;  2YGU A;  2ERB A;  1OZO A;  1ALV A;  2G2B A;  3OGN A;  4N1F A;  1YRT B;  1WRL A;  4M2Q A;  5J3X A;  1CDM A;  1HQV A;  2KOT A;  2OTG C;  1RJV A;  1SYM A;  3NSO A;  3WXA A;  1F4Q A;  4TNC A;  3PM8 A;  1NWD A;  1GGW A;  3TZ1 A;  1OOJ A;  2ZNE A;  4U8D A;  1CM1 A;  2I94 A;  1TN4 A;  2LNK A;  2M97 A;  2JXL A;  3AAJ A;  1KCY A;  4PCW A;  1K8U A;  3CGA A;  1QLK A;  1QS7 A;  1SCV A;  1YX7 A;  2OTG B;  2BE4 A;  1JSA A;  1EXR A;  2TN4 A;  2KI6 D;  4IJ7 A;  3I5F C;  1SCM B;  5EL2 A;  5HKY A;  2L51 A;  2ISD A;  1CKK A;  1DMO A;  4GUK A;  3AKB A;  1DJI A;  4BY5 A;  3NSL A;  3WNX B;  3B87 A;  2GV5 A;  4XJK B;  4C0L A;  1A4P A;  1XYD A;  1FI5 A;  5HKW A;  1YTZ C;  1BG1 A;  1BOD A;  1F54 A;  3CWG A;  3FE9 A;  3I5F B;  5BPJ A;  5JJG A;  1OQP A;  2A4J A;  4CPV A;  2KDH A;  1IQ3 A;  1QJT A;  2JNF A;  1B1G A;  2MAZ A;  4P5O E;  1XFY O;  3Q8I A;  4MRY A;  1S3P A;  3L4L A;  4NDC A;  1SRA A;  4PDZ A;  2JPT A;  4CLN A;  4ZCU A;  1Z4H A;  1J7Q A;  4I5L B;  1KK8 C;  1MQ1 A;  1UUS A;  2QPT A;  3N7H A;  2LLS A;  4C0J A;  2M49 B;  3FS7 A;  4WQ3 A;  2LP2 A;  3SG4 A;  2L2E A;  1S36 A;  2DOQ A;  2JTZ A;  3NHI A;  1SPY A;  1QAS A;  1XFR A;  2QEO A;  2ZKM X;  1W7I B;  3BOW B;  1AK8 A;  3BQ3 A;  3O4X A;  2ZN8 A;  1EH2 A;  1PK0 D;  4Q04 A;  1QVI Y;  1KK8 B;  3EVV A;  2AAO A;  3JTD C;  4JD9 A;  3S0A A;  1CNP A;  3PJI A;  1JFK A;  2EC6 C;  2LE9 B;  2QEH A;  2FJU B;  1UP5 A;  2BKI B;  1J7O A;  3LCP C;  1J7P A;  1WRZ A;  4I5K A;  3H4S E;  1CTR A;  3D74 A;  5KTY A;  3EKH A;  4WRI A;  3A8R A;  3AAK A;  5K89 A;  1XVJ A;  1N65 A;  3D76 A;  3JTD B;  3D77 A;  3R1P A;  2F2P A;  2GGM A;  2EC6 B;  5HLV A;  1KFX L;  1C7W A;  4C0K A;  2K7D A;  1BOC A;  2WOR A;  1IWQ A;  3IQQ A;  1YVH A;  2O5G A;  4PE4 A;  2MRD A;  4ICB A;  5CSN A;  1DJX A;  2KI6 C;  2M8U A;  4MRX A;  5D7F A;  3KHE A;  5I2L A;  1F8H A;  2LLT A;  2KHN A;  1FF1 A;  1OE9 B;  2K61 A;  4FQO A;  1L2O B;  2PYQ A;  2PQL A;  2AUC A;  4FTG A;  3CAB A;  1KFU L;  1Q80 A;  4XYN A;  1NX2 A;  2PAS A;  2JPO A;  1C3Y A;  1Y1A A;  3NGV A;  1F4O A;  1PVA A;  3DZT A;  3GK1 A;  1OSA A;  1RRO A;  2M9G A;  2MBX A;  3CZ1 A;  4HRG A;  3DXL A;  2KAX A;  2KYF A;  3SG2 A;  1JC2 A;  1W9Z A;  4UPG A;  3I5H C;  1QX5 B;  4OR9 B;  1CFP A;  1LVC D;  3TDU A;  5CSF A;  2PVB A;  3OX5 A;  3SS3 A;  5I8N A;  3R1V A;  1CFD A;  1G8I A;  1VRK A;  1Y6W A;  3B86 A;  2FCE A;  3GK4 X;  4MZK A;  3PAT A;  5ER5 A;  1S6I A;  3DF0 A;  2F3Z A;  5HKZ A;  3VRQ A;  2JT8 A;  3BOW A;  2I7A A;  2JT3 A;  1MXE A;  3OB1 B;  2F2O A;  1XFX O;  3DD4 A;  4WQ2 A;  3I5H B;  5DKQ A;  1CB1 A;  3DYE A;  2FJY A;  3F45 A;  1OOH A;  2ZN9 A;  2MA2 A;  1RK9 A;  4GGF A;  1CMG A;  1ZOT B;  1SK6 D;  2KI4 C;  1LS8 A;  3BXK A;  1CLL A;  2COL B;  3DVM A;  4ORC B;  2CBL A;  3UO9 A;  1UHI A;  3S0G A;  2PSR A;  4F7F A;  1YRU B;  4JWQ A;  4A4B A;  2M29 A;  1JFJ A;  4QJ4 B;  4HSZ A;  3PLF B;  1P28 A;  3LLE A;  4MBE A;  3M0W A;  1TUZ A;  1NCY A;  2QEB A;  5DKR A;  4GGN A;  3L4A A;  2QEV A;  3RLZ A;  1N2D A;  2KQ6 A;  2LHI A;  1XK4 C;  3AKA A;  5AXI A;  2LC5 A;  1MHO A;  1IKU A;  3NXA A;  3BYA A;  1SL7 A;  3O78 A;  2OS8 C;  3SIB A;  1C7V A;  1AHR A;  1N0Y A;  4YGE B;  2KFG A;  3MSE B;  1Y0V H;  1KWO C;  3PN7 B;  2WC6 A;  2L5Y A;  3SG6 A;  1CDN A;  5ER4 X;  3EK7 A;  2JNX A;  2L98 A;  1XFZ O;  3BUX B;  4I5N B;  2FCD A;  1QX2 A;  1S6C A;  3SG5 A;  1TRF A;  2LVJ A;  5AAN A;  5I94 A;  1LKJ A;  1A2X A;  2JUL A;  1ZAC A;  3GOF A;  2OS8 B;  1CMF A;  2QDI A;  4FQT A;  3S0D A;  5FI6 A;  2L4I A;  3BFA A;  1KWO B;  1FW4 A;  3HCM A;  3R72 A;  4HRH A;  1H4B A;  1C3Z A;  1DJH A;  2KBM A;  4KYN A;  1G33 A;  1IIO A;  4BY4 A;  2E30 A;  1K96 A;  1QX7 A;  1PAL A;  5HL1 A;  1RFJ A;  1QTX A;  3DVE A;  3OBV A;  5HLO A;  1SR6 C;  2H8V A;  4YGD B;  3PM2 A;  1UWO A;  1K94 A;  4CFR A;  4GNK B;  4USL A;  5AER A;  2SCP A;  1KQV A;  2K60 A;  3CZ0 A;  2WCE A;  2K7O A;  2GTE A;  1PSB A;  2JTT A;  4JKT A;  4M2P A;  1JBA A;  3CDN A;  1SR6 B;  1PVB A;  2Y1N A;  1TCO B;  1M31 A;  4D1E A;  1NX0 A;  3BUN B;  1C07 A;  1PRW A;  1DGU A;  3A4U B;  4GGF C;  1FPW A;  4A4C A;  1OOG A;  2L5X B;  5TNC A;  1DC1 A;  1NCX A;  1V1G A;  3DF0 B;  3LL8 B;  1B8C A;  2LAP A;  2WC8 A;  1CLB A;  4PHN A;  2M0R A;  2KPH A;  4OV2 A;  2F3Y A;  3FWB A;  4HRE E;  3ICB A;  1YUS A;  1GGZ A;  3SG3 A;  1IG5 A;  2IS9 A;  4NDD A;  2AMI A;  2JQ6 A;  3BUM B;  3EK4 A;  1S5G Y;  2WCF A;  3PFV A;  3PSR A;  1W7J B;  4GAO A;  3S0F A;  1DTL A;  1XK4 A;  3OB2 B;  4I5J A;  2WCK A;  1BR4 B;  1QAT A;  4YGB B;  2HQ8 A;  3D73 A;  2MHH A;  2Y4Q A;  3I5G C;  2BBM A;  5AEQ A;  1MXL C;  1YX8 A;  2PRU A;  5KSZ A;  1DT7 B;  1TUJ A;  1TWO A;  2RGI A;  4QJ3 B;  4AQJ A;  3K1E A;  4OCI A;  1B8R A;  2OPO A;  3CYZ A;  4OKH A;  3VRP A;  1XFV O;  1CFC A;  2L2C A;  4DS7 A;  2BL0 C;  2H2K A;  2Y5I A;  1Z2C B;  1EL4 A;  3R1O A;  5CSJ A;  1TNQ A;  3FWC A;  4ZCV A;  3S0E A;  1LIN A;  3CZT X;  3I5G B;  3CTN A;  3SG7 A;  3DY9 A;  1TTX A;  1XFU O;  4M2O A;  1ZMZ A;  3KO0 A;  3VRN A;  2M7N A;  4ORB B;  2P6B B;  1M46 A;  3L47 A;  1QVI Z;  1WRK A;  1K9K A;  2EGD A;  4AQI A;  1KFX S;  2WCL A;  3PAL A;  1QV1 A;  1OMV A;  1S26 D;  1SL9 A;  1B9A A;  3EKJ A;  3EVU A;  1IH0 A;  5F6T A;  2BEC A;  3DVJ A;  1B4C A;  1G4Y R;  1NX1 A;  1LXF C;  1BJF A;  1MWN A;  3S0B A;  1B8L A;  1KFU S;  1SSE B;  1WLM A;  4YI8 A;  3CR2 A;  4ETO A;  1IGV A;  1NIW A;  1BMO A;  1B7T Y;  1X02 A;  1NP8 A;  2G9B A;  3FIA A;  4YBH B;  2SAS A;  1BU3 A;  2Y1M A;  1TOP A;  2JRF A;  2WCB A;  2L0P A;  1K95 A;  1OOI X;  1F55 A;  1DGV A;  1QXP A;  4GBA A;  2CNP A;  1ZUZ A;  4YGC B;  1K9U A;  2WOS A;  3OP0 A;  1NUB A;  1UHK A;  3BFH A;  1GQM A;  3I5I C;  5CSI A;  4PHK A;  5D3O A;  2WCJ A;  1SNL A;  2BCB A;  4F0Z B;  2D8N A;  3SJS A;  2JOJ A;  1CM4 A;  2ZND A;  1NYA A;  3WHT B;  1IJ6 A;  2K2A A;  1XFW O;  1YUT A;  4PHJ A;  1QWV A;  2KI4 B;  2KFF A;  3O4Y A;  5CPV A;  1A29 A;  1HT9 A;  2CXJ A;  2P71 A;  3EG5 B;  1IQ5 A;  1AJ4 A;  3B7A A;  5GQQ C;  2Q91 A;  3I5I B;  4CFQ A;  1YUU A;  1ZFS A;  1BT6 A;  1NX3 A;  1M39 A;  3NHT A;  2GGZ A;  2KGR A;  2LCP A;  2LVK A;  2WC5 A;  2WCM A;  2O60 A;  3K21 A;  1FI6 A;  3CS1 A;  2KBI A;  1K9P A;  1WLZ A;  4INX A;  2K7B A;  1QLS A;  2BBN A;  2KAY A;  4DUQ A;  4PAL A;  2BNX A;  3KPX A;  4OVN F;  1BR1 B;  2CTN A;  3ZNI A;  5FI7 A;  4DCK A;  2LUC A;  3LK1 A;  4INW A;  3UNW A;  2BCX A;  2JZI A;  1CDP A;  2HQW A;  4YRU A;  1KSM A;  1E8A A;  1F70 A;  2LLU A;  5IBW A;  1QIV A;  4IL1 A;  1LA0 A;  4R1E A;  3QME A;  2JT0 A;  2LVV A;  1YUR A;  3OX6 A;  1GM0 A;  1SCM C;  2V53 A;  1SY9 A;  1RTP 1;  3D0Y B;  2WCH A;  1QV0 A;  2K0J A;  1SW8 A;  1DEK A;  3CR5 X;  1DQE A;  1MR8 A;  1NPQ A;  1OMD A;  5KU1 A;  1AP4 A;  1ODB A;  3CZ2 A;  1ORG A; 
#chains in the Genus database with same CATH homology
 2H61 C;  1EG3 A;  3HX4 A;  4GPL B;  4L9M A;  3IQO A;  3TS5 C;  1A75 B;  3ZWH A;  4QJ5 B;  1CDL A;  1V1F A;  2NZ0 A;  1KSO A;  1NCZ A;  1TCF A;  1XA5 A;  1KK7 Y;  2MLE C;  3WHU B;  2KFH A;  4PE0 A;  1AVS A;  1BLQ A;  3KEV A;  4DRW A;  3NSK A;  1S1E A;  2NCO A;  1H8B A;  1DJY A;  3BUW B;  2LMT A;  4YGA A;  1GJY A;  1S6J A;  3TS5 B;  2M1K B;  2PAL A;  3CR4 X;  1J55 A;  3LK0 A;  4E68 A;  1YR5 A;  4AOM A;  1FBV A;  2KYC A;  1TIZ A;  1SBJ A;  2NLN A;  1WDC C;  2WND A;  1SL8 A;  3IF7 A;  3SIA A;  2K7C A;  1CFF A;  2LHL A;  4MEW A;  2PMY A;  2LAN A;  1U5I A;  3TUY C;  1AJ5 A;  1DF0 A;  4ORA B;  5PAL A;  1IJ5 A;  4MZJ A;  2LVI A;  1AUI B;  3NSI A;  1A03 A;  1QIW A;  1WY9 A;  1JF2 A;  1DJW A;  1WDC B;  3RM1 A;  4N1G A;  1D1O A;  2CT9 A;  2B1U A;  3VRR A;  3GK2 A;  1KK7 Z;  1SMG A;  1UHJ A;  2JC2 A;  3TUY B;  2BCA A;  2M1U A;  4PHM A;  1DJG A;  1PUL A;  3O6B A;  4JPZ B;  1JUO A;  3D0Y A;  1R6P A;  2KGB C;  2CCM A;  3CLN A;  4MVF A;  2VRG A;  2EHB A;  1K2H A;  3TDI A;  1K93 D;  1JF0 A;  2FOT A;  2BL0 B;  2MLF C;  1CLM A;  1M63 B;  5HYD A;  2JU0 A;  1BF5 A;  2LMU A;  1S5G Z;  1ALW A;  1NSH A;  1L2O C;  2F33 A;  2HF5 A;  2I2R E;  5DKN A;  5JOL A;  1A75 A;  4JQ0 D;  1IRJ A;  3C1V A;  1RWY A;  1M45 A;  2ZRS A;  2LV7 A;  2QAC A;  1OMR A;  4GFT A;  3TDZ A;  2BKH B;  2M3W A;  1KQM C;  1LA3 A;  2NCP A;  5I2Q A;  4XJK A;  2JXC A;  2H61 A;  1MUX A;  2Q4U A;  2M7L A;  4MZL A;  3VRO A;  1EG4 A;  1EJ3 A;  4MLW A;  3EVR A;  5AFP A;  4YI9 A;  1J1E A;  4NQG A;  3O2P A;  1J1D A;  1KQM B;  2MJW B;  3VGO A;  4MSP A;  5B8I B;  2JWW A;  2ZRT A;  1REC A;  4PE1 A;  3E3R A;  3KF9 A;  1J7R A;  5FYX A;  1Y1U A;  2K8M B;  5G08 A;  1Y1X A;  2NXQ A;  1TNX A;  1MF8 B;  2KQY A;  3JVT C;  2ZFD A;  2LM5 A;  1OZS A;  2KAV A;  2I18 A;  1K90 D;  1DJZ A;  4P2Y B;  4MN0 A;  1TNW A;  1F71 A;  2KNE A;  1TNP A;  1UHH A;  2LMV A;  4NDB A;  2L4H A;  3JVT B;  3QRX A;  5D69 A;  2HET A;  1XO5 A;  3BUO B;  1B7T Z;  1YVL A;  4PE7 A;  2E6W A;  1SKT A;  1U5I B;  3PN7 C;  2BE6 A;  1R2U A;  1DF0 B;  1L7Z A;  2HPS A;  2F8P A;  4N5X A;  1UHN A;  2LUX A;  2L50 A;  2LP3 A;  1DVI A;  1PSR A;  3DVK A;  3EK8 A;  2R2I A;  4DIR A;  5I2O A;  2KSP A;  3D10 A;  2K2F A;  1UUR A;  3OHM B;  1B47 A;  4CID A;  1OZO A;  1ALV A;  2G2B A;  4N1F A;  1YRT B;  1WRL A;  4M2Q A;  5J3X A;  1CDM A;  1HQV A;  2KOT A;  2OTG C;  1RJV A;  1SYM A;  3NSO A;  3WXA A;  1F4Q A;  4TNC A;  3PM8 A;  1NWD A;  1GGW A;  3TZ1 A;  1OOJ A;  2ZNE A;  4U8D A;  1CM1 A;  2I94 A;  1TN4 A;  2M97 A;  2JXL A;  3AAJ A;  1KCY A;  4PCW A;  1K8U A;  3CGA A;  1QLK A;  1QS7 A;  1SCV A;  1YX7 A;  2OTG B;  2BE4 A;  1JSA A;  1EXR A;  2TN4 A;  2KI6 D;  3I5F C;  1SCM B;  5HKY A;  1CKK A;  2L51 A;  2ISD A;  1DMO A;  4GUK A;  3AKB A;  1DJI A;  4BY5 A;  3NSL A;  3WNX B;  2GV5 A;  4XJK B;  4C0L A;  1A4P A;  1XYD A;  1FI5 A;  5HKW A;  1YTZ C;  1BG1 A;  1BOD A;  1F54 A;  3CWG A;  3I5F B;  5BPJ A;  5JJG A;  1OQP A;  2A4J A;  4CPV A;  2KDH A;  1IQ3 A;  1QJT A;  2JNF A;  1B1G A;  2MAZ A;  4P5O E;  1XFY O;  4MRY A;  1S3P A;  4NDC A;  1SRA A;  4PDZ A;  2JPT A;  4CLN A;  4ZCU A;  1J7Q A;  4I5L B;  1KK8 C;  1MQ1 A;  1UUS A;  2QPT A;  4C0J A;  2LLS A;  2M49 B;  3FS7 A;  4WQ3 A;  2LP2 A;  3SG4 A;  2L2E A;  1S36 A;  2DOQ A;  2JTZ A;  1SPY A;  1QAS A;  1AK8 A;  2ZKM X;  1W7I B;  3BOW B;  3BQ3 A;  2ZN8 A;  1EH2 A;  1PK0 D;  4Q04 A;  1QVI Y;  1KK8 B;  3EVV A;  2AAO A;  3JTD C;  1CNP A;  1JFK A;  2EC6 C;  2LE9 B;  2FJU B;  1UP5 A;  2BKI B;  1J7O A;  3LCP C;  1J7P A;  1WRZ A;  4I5K A;  3H4S E;  1CTR A;  5KTY A;  3EKH A;  4WRI A;  3A8R A;  3AAK A;  5K89 A;  1XVJ A;  1N65 A;  3JTD B;  2F2P A;  2GGM A;  2EC6 B;  5HLV A;  1KFX L;  1C7W A;  4C0K A;  2K7D A;  1BOC A;  2WOR A;  1IWQ A;  3IQQ A;  1YVH A;  2O5G A;  4PE4 A;  2MRD A;  4ICB A;  5CSN A;  1DJX A;  2KI6 C;  2M8U A;  4MRX A;  5D7F A;  3KHE A;  5I2L A;  1F8H A;  2LLT A;  2KHN A;  1FF1 A;  1OE9 B;  2K61 A;  4FQO A;  1L2O B;  2AUC A;  4FTG A;  1KFU L;  1Q80 A;  4XYN A;  1NX2 A;  2PAS A;  1Y1A A;  1F4O A;  1PVA A;  3GK1 A;  1OSA A;  1RRO A;  2M9G A;  2MBX A;  4HRG A;  2KAX A;  2KYF A;  3SG2 A;  1JC2 A;  4UPG A;  3I5H C;  1QX5 B;  4OR9 B;  1CFP A;  1LVC D;  3TDU A;  5CSF A;  2PVB A;  3OX5 A;  5I8N A;  1CFD A;  1G8I A;  1VRK A;  1Y6W A;  3GK4 X;  2FCE A;  4MZK A;  5ER5 A;  3PAT A;  1S6I A;  3DF0 A;  2F3Z A;  5HKZ A;  3VRQ A;  2JT8 A;  3BOW A;  2I7A A;  2JT3 A;  1MXE A;  3OB1 B;  2F2O A;  1XFX O;  3DD4 A;  4WQ2 A;  3I5H B;  5DKQ A;  1CB1 A;  3F45 A;  2ZN9 A;  2MA2 A;  1RK9 A;  4GGF A;  1CMG A;  1ZOT B;  1SK6 D;  2KI4 C;  3BXK A;  1CLL A;  2COL B;  3DVM A;  4ORC B;  2CBL A;  1UHI A;  2PSR A;  1YRU B;  4JWQ A;  4A4B A;  2M29 A;  1JFJ A;  4QJ4 B;  4HSZ A;  3PLF B;  3LLE A;  4MBE A;  3SG5 A;  3M0W A;  5DKR A;  1NCY A;  4GGN A;  3RLZ A;  1N2D A;  2KQ6 A;  2LHI A;  1XK4 C;  3AKA A;  5AXI A;  2LC5 A;  1MHO A;  1IKU A;  3NXA A;  3BYA A;  1SL7 A;  3O78 A;  2OS8 C;  3SIB A;  1C7V A;  1AHR A;  1N0Y A;  4YGE B;  2KFG A;  3MSE B;  1Y0V H;  1KWO C;  3PN7 B;  1CDN A;  3SG6 A;  5ER4 X;  3EK7 A;  2JNX A;  2L98 A;  1XFZ O;  3BUX B;  4I5N B;  2FCD A;  1QX2 A;  1S6C A;  1TRF A;  2LVJ A;  5AAN A;  1LKJ A;  1A2X A;  2JUL A;  1ZAC A;  3GOF A;  2OS8 B;  1CMF A;  2L4I A;  1KWO B;  1FW4 A;  3HCM A;  4HRH A;  1H4B A;  1DJH A;  2KBM A;  1G33 A;  4BY4 A;  2E30 A;  1K96 A;  1QX7 A;  1PAL A;  1RFJ A;  1QTX A;  3DVE A;  5HLO A;  1SR6 C;  4YGD B;  1UWO A;  1K94 A;  4CFR A;  4GNK B;  4USL A;  5AER A;  2SCP A;  1KQV A;  2WCE A;  2K7O A;  1PSB A;  2JTT A;  4M2P A;  1JBA A;  1SR6 B;  1PVB A;  2Y1N A;  1TCO B;  1M31 A;  4D1E A;  1NX0 A;  3BUN B;  1C07 A;  1PRW A;  1DGU A;  3A4U B;  4GGF C;  1FPW A;  4A4C A;  2L5X B;  5TNC A;  1NCX A;  1V1G A;  3DF0 B;  3LL8 B;  1B8C A;  2LAP A;  2WC8 A;  1CLB A;  4PHN A;  2M0R A;  4OV2 A;  2F3Y A;  3FWB A;  4HRE E;  3ICB A;  1YUS A;  1GGZ A;  3SG3 A;  1IG5 A;  2IS9 A;  4NDD A;  2AMI A;  2JQ6 A;  3BUM B;  3EK4 A;  1S5G Y;  2WCF A;  3PFV A;  3PSR A;  1W7J B;  4GAO A;  1DTL A;  1XK4 A;  3OB2 B;  4I5J A;  1BR4 B;  1QAT A;  4YGB B;  2HQ8 A;  2MHH A;  2Y4Q A;  3I5G C;  2BBM A;  5AEQ A;  1MXL C;  1YX8 A;  2PRU A;  5KSZ A;  1DT7 B;  2RGI A;  4QJ3 B;  4AQJ A;  4OCI A;  1B8R A;  2OPO A;  4OKH A;  3VRP A;  1CFC A;  1XFV O;  4DS7 A;  2BL0 C;  2H2K A;  2Y5I A;  5CSJ A;  1EL4 A;  4ZCV A;  1JWD A;  1TNQ A;  3FWC A;  1LIN A;  3CZT X;  3I5G B;  3CTN A;  3SG7 A;  1TTX A;  1XFU O;  4M2O A;  1ZMZ A;  3KO0 A;  3VRN A;  2M7N A;  4ORB B;  2P6B B;  1M46 A;  1QVI Z;  1WRK A;  1K9K A;  2EGD A;  4AQI A;  1KFX S;  3PAL A;  1QV1 A;  1OMV A;  1S26 D;  1SL9 A;  1B9A A;  3EKJ A;  3EVU A;  1IH0 A;  5F6T A;  2BEC A;  3DVJ A;  1B4C A;  1G4Y R;  1NX1 A;  1LXF C;  1BJF A;  1MWN A;  1B8L A;  1KFU S;  1WLM A;  4YI8 A;  3CR2 A;  4ETO A;  1IGV A;  1NIW A;  1BMO A;  1B7T Y;  1X02 A;  1NP8 A;  2G9B A;  3FIA A;  4YBH B;  2SAS A;  1BU3 A;  2Y1M A;  1TOP A;  2JRF A;  2WCB A;  2L0P A;  1K95 A;  1F55 A;  1DGV A;  1QXP A;  4GBA A;  2CNP A;  1ZUZ A;  4YGC B;  1K9U A;  2WOS A;  3OP0 A;  1NUB A;  1UHK A;  1GQM A;  3I5I C;  5CSI A;  4PHK A;  1SNL A;  2BCB A;  4F0Z B;  2D8N A;  3SJS A;  2JOJ A;  1CM4 A;  2ZND A;  1NYA A;  3WHT B;  1IJ6 A;  2K2A A;  1XFW O;  1YUT A;  4PHJ A;  2KI4 B;  2KFF A;  3O4Y A;  5CPV A;  1A29 A;  1HT9 A;  2CXJ A;  1IQ5 A;  1AJ4 A;  5GQQ C;  2Q91 A;  3I5I B;  4CFQ A;  1YUU A;  1ZFS A;  1BT6 A;  1NX3 A;  1M39 A;  2GGZ A;  2KGR A;  2LCP A;  2LVK A;  3K21 A;  1FI6 A;  2O60 A;  3CS1 A;  2KBI A;  1K9P A;  1WLZ A;  2K7B A;  1QLS A;  2BBN A;  2KAY A;  4DUQ A;  4PAL A;  3KPX A;  4OVN F;  1BR1 B;  2CTN A;  3ZNI A;  4DCK A;  2LUC A;  3LK1 A;  2BCX A;  2JZI A;  1CDP A;  2HQW A;  4YRU A;  1KSM A;  1E8A A;  1F70 A;  2LLU A;  5IBW A;  1QIV A;  4IL1 A;  1LA0 A;  4R1E A;  2JT0 A;  2LVV A;  1YUR A;  3OX6 A;  1SCM C;  2V53 A;  1SY9 A;  1RTP 1;  3D0Y B;  1QV0 A;  2K0J A;  1SW8 A;  3CR5 X;  1MR8 A;  1NPQ A;  1OMD A;  5KU1 A;  1AP4 A;  1ODB A;  2LNK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...