5JOLA

Calcium-free ef-hand domain of l-plastin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
82
structure length
82
Chain Sequence
MARGSVSDEEMMELREAFAKVDTDGNGYISFNELNDLFKAACLPLPGYRVREITENLMATGDLDQDGRISFDEFIKIFHGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Calcium-Dependent Switch Helix of L-Plastin Regulates Actin Bundling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Plastin-2
total genus 19
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2016-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5jolA00
2ZNDA 2LMTA 3PFVA 4A4CA 2K7CA 1KCYA 1F55A 2M9GA 4OVNF 1KFUL 4MLWA 4DIRA 4XYNA 2MBXA 4MEWA 4YI9A 1JC2A 1QXPA 1M63B 1CFCA 1BR4B 1KK8C 2NXQA 1B9AA 4I5JA 5AFPA 4MRYA 2LHIA 1TTXA 1S3PA 1AK8A 2NCPA 1NUBA 1AP4A 2F8PA 2K2FA 2O5GA 2M97A 1S1EA 1K94A 3K21A 2LNKA 1F4QA 1JF0A 1MHOA 1FBVA 5CSIA 2M8UA 1UUSA 1LKJA 2JOJA 1L2OB 2M3WA 4CLNA 1BJFA 1XFYO 1KFXL 2L98A 3BUMB 2KOTA 3EK8A 4PHNA 1BF5A 3EKHA 1AHRA 2G2BA 2HQ8A 1GGZA 4BY4A 2M1UA 1MXEA 1LXFC 4UPGA 2GV5A 1QLSA 1OE9B 1YVLA 2BBMA 4NQGA 4YRUA 4PALA 2KGRA 1K8UA 1A4PA 1NYAA 1WY9A 4I5KA 3JTDB 3H4SE 1UP5A 3QRXA 1S5GY 2KBIA 1L2OC 1DMOA 2LANA 1NX2A 2M7NA 3NSIA 3OP0A 1N0YA 2E30A 5JJGA 3OHMB 1ZUZA 1DT7B 4HRHA 5DKNA 1LA0A 1NIWA 4MZLA 3M0WA 2PASA 1RJVA 4CFRA 1RFJA 3EVRA 4U8DA 1EH2A 1PRWA 4GPLB 1QASA 2KQ6A 1XYDA 3I5FC 3TS5B 4IL1A 5I8NA 1YURA 1BMOA 2LV7A 3TDZA 1SNLA 1MR8A 1UHKA 2LAPA 4WRIA 1J7OA 2VRGA 3KEVA 4YGBB 5I2OA 1B1GA 2BE4A 3VRNA 1NSHA 2KI6C 1BR1B 3CTNA 1QLKA 1BT6A 4I5NB 1UHIA 1K93D 5HLVA 3LLEA 3BUNB 1HQVA 5PALA 1SCVA 1H8BA 1WRZA 1YX8A 2EC6B 5AXIA 4GGNA 2Y1MA 3ICBA 2JT0A 3SG4A 2JNXA 2LMVA 2BKHB 3AAKA 4CIDA 1ODBA 1KWOC 2JTTA 2K0JA 3BUOB 1CB1A 3PN7B 4JWQA 1IH0A 4N1FA 2BCBA 1QJTA 2K2AA 1KQMC 5FYXA 1RECA 2LVIA 4ORBB 5G08A 1YUTA 1WRKA 4GGFC 2FCEA 3SG2A 1D1OA 1WDCC 2COLB 1A75B 1ZOTB 1NX1A 2KFGA 3CZTX 2KYFA 1A75A 2K7OA 5HYDA 1QATA 4DS7A 2V53A 2L4IA 2JULA 2OTGB 3BOWA 1CNPA 2LUCA 1CLLA 2ZFDA 2F2PA 2TN4A 2WC8A 1XFUO 1PVAA 3CR5X 1UHHA 3WXAA 2HETA 1J1DA 5GQQC 4GAOA 1PVBA 1G8IA 3IF7A 1L7ZA 1XA5A 3DD4A 2SCPA 2WNDA 1EL4A 2D8NA 1DGUA 1B7TY 2PVBA 2OPOA 4USLA 3WHUB 3C1VA 1KSMA 2Y5IA 1F4OA 1XFVO 1GQMA 2F3ZA 1RTP1 3I5HB 4ICBA 4XJKA 1K9KA 2WCFA 4OKHA 4PE7A 1FI5A 3GK1A 4MVFA 4C0LA 1TN4A 1FPWA 1S6IA 2M29A 1UHNA 1SCMC 4M2QA 2LVVA 3EVUA 4OV2A 4ZCUA 3JVTC 2WOSA 3OB1B 3O4YA 5CSJA 3OB2B 1QS7A 2KI6D 3SG7A 2NZ0A 2PSRA 1A2XA 1KQMB 5B8IB 2RGIA 1OZOA 1IGVA 2BBNA 2JNFA 2MHHA 4ETOA 4OCIA 2OS8C 4E68A 4L9MA 1OZSA 1FF1A 1B8LA 1N65A 1SMGA 4F0ZB 1SCMB 1LINA 1SR6B 1SL9A 2IS9A 1JFJA 1CFDA 1CTRA 2MRDA 3BXKA 3VRPA 1J7QA 1M31A 1NCXA 1ZFSA 1RWYA 4FQOA 1SL8A 3DVKA 1DF0A 1V1FA 4GUKA 1CM1A 2WORA 4PE0A 1XFXO 1NX0A 1SKTA 1OMVA 1YR5A 3O78A 1PK0D 1JBAA 3VGOA 2Q4UA 2M0RA 1R6PA 1ALVA 4AOMA 1AVSA 1SPYA 3SIAA 2ZRSA 2LC5A 2KQYA 1IQ3A 2AMIA 1F8HA 5AANA 1KQVA 3I5IC 1EJ3A 4MZKA 1NCZA 3I5FB 1DJXA 1VRKA 4YI8A 1DJHA 3GOFA 2Y4QA 3IQQA 2KFHA 2FJUB 1Y0VH 2MJWB 1U5IB 3JTDC 1UHJA 4YGEB 2F33A 2CBLA 4D1EA 3SIBA 5DKQA 1TCOB 1J7RA 1RROA 4GGFA 4MRXA 4YGDB 2EHBA 2MA2A 4HREE 5HKWA 1CDPA 1NPQA 2MLEC 2JQ6A 1UURA 3I5GC 5IBWA 1YVHA 4QJ3B 1DJZA 1H4BA 1UWOA 2EC6C 1DVIA 1A29A 2BCAA 3RLZA 2FOTA 3SG6A 1K9PA 1ZACA 1F71A 3FWCA 1KK7Z 5CPVA 1LVCD 3TS5C 4HSZA 5KU1A 2QACA 4XJKB 3VRQA 3BUXB 1WLMA 2JT8A 2LUXA 1KFXS 2JU0A 5KTYA 1QTXA 2ZKMX 5D7FA 5JOLA 1K95A 4BY5A 1TNQA 3KO0A 1S36A 1SYMA 3LK1A 3DF0B 1KK8B 2ZN9A 3CGAA 2KDHA 2KNEA 1BOCA 2K7DA 2JPTA 1SRAA 2Q91A 4ORAB 3I5IB 3F45A 2AAOA 2M1KB 2O60A 2LLTA 2F2OA 2LMUA 1PALA 2NCOA 1CFFA 2MLFC 1XVJA 3MSEB 1C07A 3FIAA 4R1EA 4PDZA 2KBMA 1AJ5A 1DJGA 1K9UA 1AJ4A 4FTGA 2WCEA 4PHMA 3KF9A 3O6BA 1CDMA 5I2QA 2ZN8A 2L50A 3PALA 1GGWA 1MF8B 3PM8A 2LP3A 1QV0A 2BE6A 3I5HC 2L2EA 4M2OA 5AERA 2K8MB 2JTZA 3NSOA 1G33A 3PLFB 3SG3A 1QVIZ 1KK7Y 2BL0C 2CCMA 4M2PA 3EK4A 2K61A 3DF0A 4CFQA 1CKKA 2HQWA 2H61A 1FW4A 1B47A 3GK2A 2JWWA 2P6BB 5CSNA 2WCBA 2KAVA 5ER5A 3JVTB 3TDIA 3E3RA 1JF2A 2FCDA 1PULA 2I2RE 1DTLA 2PRUA 4NDCA 1V1GA 2H2KA 2KHNA 4JQ0D 1B7TZ 2JC2A 1XFWO 4WQ3A 1S6CA 2L0PA 3VRRA 1IWQA 1S6JA 4C0KA 2BKIB 1K2HA 2KAYA 1DGVA 4I5LB 1YTZC 1J55A 2LHLA 2K7BA 4CPVA 2LVJA 2R2IA 1G4YR 1OMDA 2KI4C 1TNXA 2CXJA 1OQPA 2L4HA 1C7VA 5KSZA 1CM4A 3BYAA 1OSAA 5J3XA 1QIWA 1PSRA 1PSBA 1JUOA 1EG3A 2F3YA 1BLQA 5D69A 3EKJA 1U5IA 1WDCB 3LCPC 1BU3A 1CFPA 4MN0A 2JZIA 3DVMA 1IJ5A 2QPTA 5CSFA 1K90D 1OMRA 1CDLA 1JFKA 2B1UA 1QIVA 2M7LA 3CWGA 2OTGC 3CLNA 3OX6A 1JSAA 2M49B 1Y6WA 1JWDA 4JPZB 1TIZA 4ORCB 5K89A 1BG1A 1NX3A 1WLZA 1OOJA 4OR9B 1YRTB 2BECA 2HF5A 2KYCA 1YRUB 3FWBA 1MXLC 3PN7C 4P5OE 4AQIA 2LLSA 1XFZO 1XK4A 5DKRA 2E6WA 1E8AA 3LL8B 3BUWB 4PHKA 1NP8A 2KFFA 5TNCA 3D10A 1S26D 4GFTA 4HRGA 2MAZA 1CMGA 3ZNIA 2I18A 1KSOA 4DCKA 1QV1A 2KAXA 4PE4A 4N1GA 4MZJA 1F54A 5ER4X 1YUUA 2KSPA 4C0JA 1B4CA 1TNWA 1ZMZA 1Y1UA 1EXRA 2NLNA 1QX7A 1ALWA 1WRLA 1B8CA 1TNPA 4NDDA 2G9BA 4PHJA 1M46A 2GGMA 1BODA 2OS8B 4MBEA 5HKZA 2LE9B 2I7AA 5F6TA 3DVEA 1DJIA 1NCYA 4MSPA 1TRFA 3GK4X 1SR6C 1W7JB 1DF0B 3I5GB 2LM5A 3AAJA 5AEQA 1CLBA 1YUSA 1LA3A 3EVVA 4DUQA 1XK4C 3TUYC 1F70A 1TCFA 2LCPA 3SJSA 3NSLA 3PSRA 1RK9A 3LK0A 4Q04A 1Y1XA 1SK6D 3NSKA 4QJ5B 3IQOA 4A4BA 2SASA 3O2PA 1NWDA 5BPJA 1C7WA 1IKUA 1CMFA 3NXAA 3KPXA 1N2DA 2A4JA 1J1EA 1IRJA 2AUCA 3BQ3A 3D0YB 4GBAA 4YGAA 3WNXB 1J7PA 1AUIB 2ISDA 2JRFA 3KHEA 1QX2A 1GJYA 4PE1A 3EK7A 1SBJA 1DJWA 3RM1A 2GGZA 4DRWA 1QVIY 1MWNA 2BCXA 4P2YB 3CR4X 5HKYA 2LLUA 2LVKA 1IJ6A 1IG5A 2LP2A 4GNKB 3SG5A 1EG4A 2PMYA 1MUXA 4YBHB 1DJYA 4WQ2A 1B8RA 3A4UB 3HX4A 1M39A 1XO5A 2ZRTA 1MQ1A 1SW8A 4TNCA 3PATA 2ZNEA 3TUYB 3FS7A 2KI4B 1CLMA 3AKBA 2CT9A 3CS1A 1R2UA 3AKAA 1TOPA 2BL0B 1K96A 2L5XB 3BOWB 4ZCVA 4YGCB 4N5XA 1M45A 2H61C 3HCMA 3CR2A 3TDUA 1HT9A 2EGDA 2KGBC 3TZ1A 1KWOB 4PCWA 3VROA 2CNPA 3D0YA 2I94A 2HPSA 1IQ5A 2PALA 3WHTB 3DVJA 4AQJA 1X02A 1Y1AA 1SL7A 1Q80A 3A8RA 1S5GZ 1KFUS 1W7IB 2L51A 4QJ4B 5I2LA 2JXLA 1QX5B 3OX5A 2Y1NA 4NDBA 1FI6A 1SY9A 1YX7A 2JXCA 3ZWHA 1CDNA 1A03A 2DOQA 5HLOA 2JT3A 2CTNA
chains in the Genus database with same CATH superfamily
2ZNDA 2LMTA 3PFVA 3NGVA 4A4CA 2K7CA 1KCYA 1F55A 2M9GA 4OVNF 1C3ZA 1KFUL 2QEOA 4MLWA 4DIRA 4XYNA 2MBXA 4MEWA 4YI9A 3B88A 1JC2A 1QXPA 1M63B 1CFCA 1BR4B 1KK8C 2NXQA 1B9AA 4I5JA 5AFPA 4MRYA 2LHIA 5EL2A 1TTXA 1S3PA 1AK8A 2NCPA 1NUBA 3R72A 1AP4A 2F8PA 2K2FA 2O5GA 1GM0A 2M97A 1S1EA 1K94A 3K21A 2LNKA 3SS5A 1F4QA 1JF0A 1MHOA 1FBVA 5CSIA 2M8UA 1UUSA 1LKJA 2JOJA 1L2OB 2M3WA 1IIOA 4CLNA 1BJFA 1OOHA 1XFYO 1KFXL 2L98A 2KOTA 3BUMB 3EK8A 4PHNA 1BF5A 3EKHA 1AHRA 2G2BA 2HQ8A 1GGZA 3FE8A 4BY4A 2M1UA 1MXEA 1LXFC 4UPGA 2GV5A 1QLSA 1OE9B 1YVLA 2BBMA 4NQGA 4YRUA 4PALA 2KGRA 3O4XA 1K8UA 3UO9A 1A4PA 1NYAA 1WY9A 4I5KA 3JTDB 3H4SE 1UP5A 3QRXA 1S5GY 2KBIA 1L2OC 1DMOA 3Q8IA 2LANA 1NX2A 2M7NA 3NSIA 2H8VA 3OP0A 4KYNA 1N0YA 2E30A 3FE9A 5JJGA 3OHMB 1ZUZA 1DT7B 4HRHA 5DKNA 1LA0A 1NIWA 4MZLA 4INWA 3M0WA 2PASA 1RJVA 4CFRA 1RFJA 3EVRA 4U8DA 1EH2A 1PRWA 4GPLB 1QASA 2KQ6A 1TUZA 1XYDA 3I5FC 3TS5B 4IL1A 5I8NA 2K60A 1YURA 1BMOA 2LV7A 3NHTA 3TDZA 2KLDA 1SNLA 1MR8A 1UHKA 2LAPA 4WRIA 3DY9A 1J7OA 2VRGA 3KEVA 4YGBB 5I2OA 3D77A 3PM2A 1B1GA 2BE4A 3VRNA 5I94A 1NSHA 2KI6C 1BR1B 3CTNA 1OOIX 1QLKA 1BT6A 4I5NB 1UHIA 1K93D 5HLVA 3LLEA 3BUNB 1HQVA 2KLEA 3CDNA 5PALA 1SCVA 1H8BA 1WRZA 1YX8A 2EC6B 5AXIA 4GGNA 2Y1MA 3ICBA 3CZ1A 2JT0A 3SG4A 2JNXA 2LMVA 2BKHB 1DELA 3AAKA 4CIDA 1ODBA 1KWOC 2JTTA 2K0JA 3BUOB 3NHIA 1CB1A 3BJHA 3PN7B 4JWQA 1IH0A 4N1FA 2BCBA 1QJTA 2K2AA 1KQMC 3CZ0A 5FYXA 1RECA 2LVIA 2QEBA 4ORBB 5G08A 1YUTA 1WRKA 2JPOA 3L4LA 4GGFC 2FCEA 3SG2A 1D1OA 1WDCC 2COLB 1A75B 1ZOTB 1NX1A 2KFGA 3CZTX 2KYFA 1A75A 2K7OA 1T14A 5HYDA 1QATA 4DS7A 2V53A 2L4IA 2JULA 2OTGB 3BOWA 1CNPA 2LUCA 1CLLA 2ZFDA 2F2PA 2TN4A 2WC8A 3D73A 1XFUO 1PVAA 3CR5X 1UHHA 3WXAA 2HETA 1J1DA 5GQQC 4GAOA 1PVBA 1G8IA 3IF7A 1L7ZA 1XA5A 3DD4A 2SCPA 2WNDA 1EL4A 2D8NA 1DGUA 1B7TY 2PVBA 2OPOA 4USLA 3WHUB 3C1VA 1KSMA 2Y5IA 1F4OA 3V2LA 1XFVO 1GQMA 2F3ZA 5FI2A 1RTP1 3I5HB 4ICBA 4XJKA 1K9KA 2WCFA 4OKHA 4PE7A 1FI5A 3GK1A 3IVTA 4MVFA 4OZDA 4C0LA 1TN4A 1FPWA 1S6IA 2M29A 3CYZA 1UHNA 2WCMA 1SCMC 4M2QA 2LVVA 3EVUA 4OV2A 3QMEA 4ZCUA 4PT1A 3JVTC 5HL1A 2WOSA 5FI6A 3OB1B 3O4YA 3BFAA 3OB2B 5CSJA 1QS7A 2KI6D 3SG7A 2NZ0A 2PSRA 1A2XA 1KQMB 5B8IB 2BAPA 1OZOA 2RGIA 1SSEB 1IGVA 2BBNA 2JNFA 2MHHA 3SS4A 4ETOA 4OCIA 2OS8C 4E68A 4L9MA 1OZSA 1FF1A 1B8LA 3S0GA 1N65A 1SMGA 3S0AA 3S0DA 4F0ZB 1OOFA 1SCMB 1LINA 1SR6B 2WCJA 3D76A 1SL9A 2IS9A 1JFJA 1CFDA 1CTRA 2MRDA 3BXKA 3VRPA 1J7QA 1M31A 1NCXA 1ZFSA 1RWYA 3D74A 2WCLA 4FQOA 2QEVA 1SL8A 3DVKA 1DF0A 1V1FA 2PYQA 3PJIA 4GUKA 1CM1A 2WORA 4PE0A 2QEHA 3BFBA 1XFXO 1NX0A 1SKTA 1OMVA 1YR5A 3B86A 1PK0D 3O78A 3VGOA 1JBAA 2Q4UA 2M0RA 1R6PA 1ALVA 4AOMA 1AVSA 1SPYA 3S0BA 3SIAA 2ZRSA 2LC5A 2KQYA 1IQ3A 2AMIA 1F8HA 5AANA 1KQVA 3I5IC 2BNXA 1EJ3A 4MZKA 1NCZA 3I5FB 1DJXA 1VRKA 4YI8A 1DJHA 3GOFA 2Y4QA 3IQQA 2KFHA 2FJUB 1Y0VH 2MJWB 1U5IB 3JTDC 1UHJA 4YGEB 3VB1A 2F33A 2CBLA 4D1EA 3SIBA 5DKQA 1TCOB 1J7RA 1RROA 4GGFA 4MRXA 4YGDB 2EHBA 2MA2A 4HREE 5HKWA 1CDPA 1NPQA 2MLEC 2JQ6A 1UURA 3I5GC 5IBWA 1YVHA 4IJ7A 4QJ3B 1DJZA 1H4BA 1UWOA 2EC6C 1DVIA 1A29A 1XFRA 2BCAA 3RLZA 2FOTA 3SG6A 1TWOA 1K9PA 1ZACA 1F71A 3FWCA 1KK7Z 5CPVA 1TUJA 1LVCD 3TS5C 4HSZA 5KU1A 2QACA 4XJKB 3VRQA 3BUXB 1WLMA 3OBVA 3B6XA 2JT8A 2LUXA 1KFXS 2JU0A 5KTYA 1QTXA 2ZKMX 5D7FA 5JOLA 1K95A 4JD9A 4BY5A 1TNQA 3KO0A 1S36A 2WCKA 1SYMA 3LK1A 3DF0B 1OOGA 1KK8B 2ZN9A 3CGAA 3S0FA 2KDHA 2KNEA 1BOCA 3B87A 2K7DA 1W9ZA 1SRAA 2JPTA 2Q91A 3R1OA 4ORAB 3I5IB 3S0EA 3F45A 2AAOA 2M1KB 2O60A 2LLTA 2F2OA 2LMUA 1PALA 2NCOA 1CFFA 2MLFC 1XVJA 3MSEB 1C07A 3FIAA 4R1EA 3OGNA 4PDZA 2KBMA 1AJ5A 1DJGA 1K9UA 1AJ4A 4FTGA 3RZSA 2WCEA 2P71A 3FE6A 3KF9A 4PHMA 3O6BA 1CDMA 5I2QA 2ZN8A 2L50A 3PALA 3DZTA 1GGWA 1MF8B 3PM8A 2LP3A 4INXA 1QV0A 2BE6A 3I5HC 2L2EA 4M2OA 5AERA 2K8MB 2JTZA 3NSOA 1G33A 3PLFB 3SG3A 1QVIZ 1KK7Y 2BL0C 2CCMA 4M2PA 3EK4A 2K61A 3DF0A 4CFQA 1CKKA 2HQWA 2H61A 1FW4A 1B47A 3GK2A 2JWWA 2P6BB 5CSNA 2WCBA 2KAVA 5ER5A 3JVTB 3TDIA 3E3RA 5DICA 1JF2A 3UNWA 2FCDA 1PULA 1ORGA 2I2RE 1DTLA 2PRUA 4NDCA 1V1GA 2H2KA 2KHNA 4JQ0D 1B7TZ 2JC2A 1XFWO 4WQ3A 1S6CA 2L0PA 3VRRA 1IWQA 1S6JA 3L47A 4C0KA 1Z4HA 2BKIB 1K2HA 3R1VA 2KAYA 1DGVA 4I5LB 1YTZC 1J55A 2LHLA 2K7BA 4CPVA 2LVJA 2R2IA 1G4YR 1OMDA 2KI4C 1TNXA 2CXJA 1OQPA 2L4HA 1C7VA 5KSZA 1CM4A 3BYAA 1OW4A 1OSAA 3K1EA 1QIWA 5J3XA 1PSRA 1PSBA 1JUOA 1EG3A 2F3YA 1BLQA 5D69A 3EKJA 1U5IA 1WDCB 3LCPC 1BU3A 1CFPA 4MN0A 2JZIA 3DVMA 1IJ5A 2QPTA 3D75A 5CSFA 1K90D 1OMRA 1CDLA 1JFKA 2B1UA 1QIVA 2M7LA 3CWGA 2OTGC 3CLNA 3OX6A 1JSAA 2M49B 1Y6WA 1JWDA 4JPZB 1TIZA 2YGUA 4ORCB 5K89A 1BG1A 1NX3A 3L4AA 1WLZA 2FJYA 1OOJA 3D78A 1YRTB 2BECA 2HF5A 2KYCA 3R1PA 4OR9B 1YRUB 3FWBA 1MXLC 3PN7C 4P5OE 4AQIA 2LLSA 1XFZO 1XK4A 2QDIA 5DKRA 2E6WA 1E8AA 3CABA 2WC5A 3LL8B 3BUWB 4PHKA 1NP8A 2KFFA 5TNCA 3D10A 1S26D 4GFTA 4HRGA 3B7AA 2MAZA 4JKTA 3ZNIA 1CMGA 2I18A 1KSOA 4DCKA 1QV1A 4FQTA 2KAXA 4PE4A 3SS3A 4N1GA 4MZJA 1F54A 5ER4X 1YUUA 2KSPA 3DXLA 4C0JA 1B4CA 1TNWA 1ZMZA 1Y1UA 1EXRA 2NLNA 1QX7A 1ALWA 1WRLA 1B8CA 3BFHA 1TNPA 4NDDA 2G9BA 4PHJA 1M46A 2GGMA 2WCHA 2OS8B 4MBEA 5HKZA 1BODA 2LE9B 2I7AA 5F6TA 3DVEA 1DJIA 1NCYA 2L5YA 4MSPA 1TRFA 3GK4X 1SR6C 1DQEA 1W7JB 1DF0B 1LS8A 3I5GB 2LM5A 3AAJA 5AEQA 1DC1A 1CLBA 1YUSA 1LA3A 3EVVA 4DUQA 1XK4C 3TUYC 1F70A 1TCFA 1Z2CB 2ERBA 2LCPA 3SJSA 3NSLA 2L2CA 3PSRA 1RK9A 3EG5B 1QWVA 3LK0A 4Q04A 1Y1XA 4F7FA 1SK6D 3NSKA 4QJ5B 3IQOA 4A4BA 2SASA 3O2PA 1NWDA 5BPJA 1C7WA 1IKUA 1CMFA 3NXAA 3KPXA 1N2DA 2A4JA 1J1EA 1IRJA 2AUCA 3BQ3A 3D0YB 4GBAA 4YGAA 3WNXB 1J7PA 1AUIB 2PQLA 2ISDA 2JRFA 1DEKA 3KHEA 3N7HA 1QX2A 1GJYA 4PE1A 3EK7A 1SBJA 1DJWA 3RM1A 2GGZA 4DRWA 1QVIY 1MWNA 1P28A 2BCXA 4P2YB 3CR4X 5HKYA 2LLUA 2LVKA 1IJ6A 1IG5A 2LP2A 4GNKB 5FI7A 3SG5A 1EG4A 2PMYA 1MUXA 4YBHB 1DJYA 3CZ2A 4WQ2A 1C3YA 1B8RA 3A4UB 3HX4A 1M39A 1XO5A 2ZRTA 2WC6A 1MQ1A 1SW8A 2KPHA 4TNCA 3PATA 2ZNEA 3TUYB 3FS7A 2KI4B 1CLMA 3AKBA 2CT9A 3CS1A 1R2UA 3AKAA 2BL0B 1TOPA 1K96A 2L5XB 3BOWB 4ZCVA 4YGCB 2P70A 4N5XA 1M45A 2H61C 3HCMA 3CR2A 3TDUA 1HT9A 2GTEA 2EGDA 2KGBC 3TZ1A 1KWOB 4PCWA 3VROA 2CNPA 3D0YA 2I94A 2HPSA 1IQ5A 2PALA 3WHTB 3DVJA 4AQJA 1X02A 1Y1AA 1SL7A 1Q80A 3A8RA 1S5GZ 1KFUS 1W7IB 2L51A 4QJ4B 5I2LA 2JXLA 1QX5B 3OX5A 2Y1NA 4NDBA 1FI6A 3DYEA 1SY9A 1YX7A 2JXCA 5D3OA 3ZWHA 1CDNA 1A03A 2DOQA 5HLOA 2JT3A 2CTNA
chains in the Genus database with same CATH topology
2ZNDA 2LMTA 3PFVA 4A4CA 2K7CA 1KCYA 1F55A 2M9GA 4OVNF 1KFUL 4MLWA 4DIRA 4XYNA 2MBXA 4MEWA 4YI9A 1JC2A 1QXPA 1M63B 1CFCA 1BR4B 1KK8C 2NXQA 1B9AA 4I5JA 5AFPA 4MRYA 2LHIA 1TTXA 1S3PA 1AK8A 2NCPA 1NUBA 1AP4A 2F8PA 2K2FA 2O5GA 2M97A 1S1EA 1K94A 3K21A 2LNKA 1F4QA 1JF0A 1MHOA 1FBVA 5CSIA 2M8UA 1UUSA 1LKJA 2JOJA 1L2OB 2M3WA 4CLNA 1BJFA 1XFYO 1KFXL 2L98A 3BUMB 2KOTA 3EK8A 4PHNA 1BF5A 3EKHA 1AHRA 2G2BA 2HQ8A 1GGZA 4BY4A 2M1UA 1MXEA 1LXFC 4UPGA 2GV5A 1QLSA 1OE9B 1YVLA 2BBMA 4NQGA 4YRUA 4PALA 2KGRA 1K8UA 1A4PA 1NYAA 1WY9A 4I5KA 3JTDB 3H4SE 1UP5A 3QRXA 1S5GY 2KBIA 1L2OC 1DMOA 2LANA 1NX2A 2M7NA 3NSIA 3OP0A 1N0YA 2E30A 5JJGA 3OHMB 1ZUZA 1DT7B 4HRHA 5DKNA 1LA0A 1NIWA 4MZLA 3M0WA 2PASA 1RJVA 4CFRA 1RFJA 3EVRA 4U8DA 1EH2A 1PRWA 4GPLB 1QASA 2KQ6A 1XYDA 3I5FC 3TS5B 4IL1A 5I8NA 1YURA 1BMOA 2LV7A 3TDZA 1SNLA 1MR8A 1UHKA 2LAPA 4WRIA 1J7OA 2VRGA 3KEVA 4YGBB 5I2OA 1B1GA 2BE4A 3VRNA 1NSHA 2KI6C 1BR1B 3CTNA 1QLKA 1BT6A 4I5NB 1UHIA 1K93D 5HLVA 3LLEA 3BUNB 1HQVA 5PALA 1SCVA 1H8BA 1WRZA 1YX8A 2EC6B 5AXIA 4GGNA 2Y1MA 3ICBA 2JT0A 3SG4A 2JNXA 2LMVA 2BKHB 3AAKA 4CIDA 1ODBA 1KWOC 2JTTA 2K0JA 3BUOB 1CB1A 3PN7B 4JWQA 1IH0A 4N1FA 2BCBA 1QJTA 2K2AA 1KQMC 5FYXA 1RECA 2LVIA 4ORBB 5G08A 1YUTA 1WRKA 4GGFC 2FCEA 3SG2A 1D1OA 1WDCC 2COLB 1A75B 1ZOTB 1NX1A 2KFGA 3CZTX 2KYFA 1A75A 2K7OA 5HYDA 1QATA 4DS7A 2V53A 2L4IA 2JULA 2OTGB 3BOWA 1CNPA 2LUCA 1CLLA 2ZFDA 2F2PA 2TN4A 2WC8A 1XFUO 1PVAA 3CR5X 1UHHA 3WXAA 2HETA 1J1DA 5GQQC 4GAOA 1PVBA 1G8IA 3IF7A 1L7ZA 1XA5A 3DD4A 2SCPA 2WNDA 1EL4A 2D8NA 1DGUA 1B7TY 2PVBA 2OPOA 4USLA 3WHUB 3C1VA 1KSMA 2Y5IA 1F4OA 1XFVO 1GQMA 2F3ZA 1RTP1 3I5HB 4ICBA 4XJKA 1K9KA 2WCFA 4OKHA 4PE7A 1FI5A 3GK1A 4MVFA 4C0LA 1TN4A 1FPWA 1S6IA 2M29A 1UHNA 1SCMC 4M2QA 2LVVA 3EVUA 4OV2A 4ZCUA 3JVTC 2WOSA 3OB1B 3O4YA 5CSJA 3OB2B 1QS7A 2KI6D 3SG7A 2NZ0A 2PSRA 1A2XA 1KQMB 5B8IB 2RGIA 1OZOA 1IGVA 2BBNA 2JNFA 2MHHA 4ETOA 4OCIA 2OS8C 4E68A 4L9MA 1OZSA 1FF1A 1B8LA 1N65A 1SMGA 4F0ZB 1SCMB 1LINA 1SR6B 1SL9A 2IS9A 1JFJA 1CFDA 1CTRA 2MRDA 3BXKA 3VRPA 1J7QA 1M31A 1NCXA 1ZFSA 1RWYA 4FQOA 1SL8A 3DVKA 1DF0A 1V1FA 4GUKA 1CM1A 2WORA 4PE0A 1XFXO 1NX0A 1SKTA 1OMVA 1YR5A 3O78A 1PK0D 1JBAA 3VGOA 2Q4UA 2M0RA 1R6PA 1ALVA 4AOMA 1AVSA 1SPYA 3SIAA 2ZRSA 2LC5A 2KQYA 1IQ3A 2AMIA 1F8HA 5AANA 1KQVA 3I5IC 1EJ3A 4MZKA 1NCZA 3I5FB 1DJXA 1VRKA 4YI8A 1DJHA 3GOFA 2Y4QA 3IQQA 2KFHA 2FJUB 1Y0VH 2MJWB 1U5IB 3JTDC 1UHJA 4YGEB 2F33A 2CBLA 4D1EA 3SIBA 5DKQA 1TCOB 1J7RA 1RROA 4GGFA 4MRXA 4YGDB 2EHBA 2MA2A 4HREE 5HKWA 1CDPA 1NPQA 2MLEC 2JQ6A 1UURA 3I5GC 5IBWA 1YVHA 4QJ3B 1DJZA 1H4BA 1UWOA 2EC6C 1DVIA 1A29A 2BCAA 3RLZA 2FOTA 3SG6A 1K9PA 1ZACA 1F71A 3FWCA 1KK7Z 5CPVA 1LVCD 3TS5C 4HSZA 5KU1A 2QACA 4XJKB 3VRQA 3BUXB 1WLMA 2JT8A 2LUXA 1KFXS 2JU0A 5KTYA 1QTXA 2ZKMX 5D7FA 5JOLA 1K95A 4BY5A 1TNQA 3KO0A 1S36A 1SYMA 3LK1A 3DF0B 1KK8B 2ZN9A 3CGAA 2KDHA 2KNEA 1BOCA 2K7DA 2JPTA 1SRAA 2Q91A 4ORAB 3I5IB 3F45A 2AAOA 2M1KB 2O60A 2LLTA 2F2OA 2LMUA 1PALA 2NCOA 1CFFA 2MLFC 1XVJA 3MSEB 1C07A 3FIAA 4R1EA 4PDZA 2KBMA 1AJ5A 1DJGA 1K9UA 1AJ4A 4FTGA 2WCEA 4PHMA 3KF9A 3O6BA 1CDMA 5I2QA 2ZN8A 2L50A 3PALA 1GGWA 1MF8B 3PM8A 2LP3A 1QV0A 2BE6A 3I5HC 2L2EA 4M2OA 5AERA 2K8MB 2JTZA 3NSOA 1G33A 3PLFB 3SG3A 1QVIZ 1KK7Y 2BL0C 2CCMA 4M2PA 3EK4A 2K61A 3DF0A 4CFQA 1CKKA 2HQWA 2H61A 1FW4A 1B47A 3GK2A 2JWWA 2P6BB 5CSNA 2WCBA 2KAVA 5ER5A 3JVTB 3TDIA 3E3RA 1JF2A 2FCDA 1PULA 2I2RE 1DTLA 2PRUA 4NDCA 1V1GA 2H2KA 2KHNA 4JQ0D 1B7TZ 2JC2A 1XFWO 4WQ3A 1S6CA 2L0PA 3VRRA 1IWQA 1S6JA 4C0KA 2BKIB 1K2HA 2KAYA 1DGVA 4I5LB 1YTZC 1J55A 2LHLA 2K7BA 4CPVA 2LVJA 2R2IA 1G4YR 1OMDA 2KI4C 1TNXA 2CXJA 1OQPA 2L4HA 1C7VA 5KSZA 1CM4A 3BYAA 1OSAA 5J3XA 1QIWA 1PSRA 1PSBA 1JUOA 1EG3A 2F3YA 1BLQA 5D69A 3EKJA 1U5IA 1WDCB 3LCPC 1BU3A 1CFPA 4MN0A 2JZIA 3DVMA 1IJ5A 2QPTA 5CSFA 1K90D 1OMRA 1CDLA 1JFKA 2B1UA 1QIVA 2M7LA 3CWGA 2OTGC 3CLNA 3OX6A 1JSAA 2M49B 1Y6WA 1JWDA 4JPZB 1TIZA 4ORCB 5K89A 1BG1A 1NX3A 1WLZA 1OOJA 4OR9B 1YRTB 2BECA 2HF5A 2KYCA 1YRUB 3FWBA 1MXLC 3PN7C 4P5OE 4AQIA 2LLSA 1XFZO 1XK4A 5DKRA 2E6WA 1E8AA 3LL8B 3BUWB 4PHKA 1NP8A 2KFFA 5TNCA 3D10A 1S26D 4GFTA 4HRGA 2MAZA 1CMGA 3ZNIA 2I18A 1KSOA 4DCKA 1QV1A 2KAXA 4PE4A 4N1GA 4MZJA 1F54A 5ER4X 1YUUA 2KSPA 4C0JA 1B4CA 1TNWA 1ZMZA 1Y1UA 1EXRA 2NLNA 1QX7A 1ALWA 1WRLA 1B8CA 1TNPA 4NDDA 2G9BA 4PHJA 1M46A 2GGMA 1BODA 2OS8B 4MBEA 5HKZA 2LE9B 2I7AA 5F6TA 3DVEA 1DJIA 1NCYA 4MSPA 1TRFA 3GK4X 1SR6C 1W7JB 1DF0B 3I5GB 2LM5A 3AAJA 5AEQA 1CLBA 1YUSA 1LA3A 3EVVA 4DUQA 1XK4C 3TUYC 1F70A 1TCFA 2LCPA 3SJSA 3NSLA 3PSRA 1RK9A 3LK0A 4Q04A 1Y1XA 1SK6D 3NSKA 4QJ5B 3IQOA 4A4BA 2SASA 3O2PA 1NWDA 5BPJA 1C7WA 1IKUA 1CMFA 3NXAA 3KPXA 1N2DA 2A4JA 1J1EA 1IRJA 2AUCA 3BQ3A 3D0YB 4GBAA 4YGAA 3WNXB 1J7PA 1AUIB 2ISDA 2JRFA 3KHEA 1QX2A 1GJYA 4PE1A 3EK7A 1SBJA 1DJWA 3RM1A 2GGZA 4DRWA 1QVIY 1MWNA 2BCXA 4P2YB 3CR4X 5HKYA 2LLUA 2LVKA 1IJ6A 1IG5A 2LP2A 4GNKB 3SG5A 1EG4A 2PMYA 1MUXA 4YBHB 1DJYA 4WQ2A 1B8RA 3A4UB 3HX4A 1M39A 1XO5A 2ZRTA 1MQ1A 1SW8A 4TNCA 3PATA 2ZNEA 3TUYB 3FS7A 2KI4B 1CLMA 3AKBA 2CT9A 3CS1A 1R2UA 3AKAA 1TOPA 2BL0B 1K96A 2L5XB 3BOWB 4ZCVA 4YGCB 4N5XA 1M45A 2H61C 3HCMA 3CR2A 3TDUA 1HT9A 2EGDA 2KGBC 3TZ1A 1KWOB 4PCWA 3VROA 2CNPA 3D0YA 2I94A 2HPSA 1IQ5A 2PALA 3WHTB 3DVJA 4AQJA 1X02A 1Y1AA 1SL7A 1Q80A 3A8RA 1S5GZ 1KFUS 1W7IB 2L51A 4QJ4B 5I2LA 2JXLA 1QX5B 3OX5A 2Y1NA 4NDBA 1FI6A 1SY9A 1YX7A 2JXCA 3ZWHA 1CDNA 1A03A 2DOQA 5HLOA 2JT3A 2CTNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZND A;  2LMT A;  3PFV A;  4A4C A;  2K7C A;  1KCY A;  1F55 A;  2M9G A;  4OVN F;  1KFU L;  4MLW A;  4DIR A;  4XYN A;  2MBX A;  4MEW A;  4YI9 A;  1JC2 A;  1QXP A;  1M63 B;  1CFC A;  1BR4 B;  1KK8 C;  2NXQ A;  1B9A A;  4I5J A;  5AFP A;  4MRY A;  2LHI A;  1TTX A;  1S3P A;  1AK8 A;  2NCP A;  1NUB A;  1AP4 A;  2F8P A;  2K2F A;  2O5G A;  2M97 A;  1S1E A;  1K94 A;  3K21 A;  2LNK A;  1F4Q A;  1JF0 A;  1MHO A;  1FBV A;  5CSI A;  2M8U A;  1UUS A;  1LKJ A;  2JOJ A;  1L2O B;  2M3W A;  4CLN A;  1BJF A;  1XFY O;  1KFX L;  2L98 A;  3BUM B;  2KOT A;  3EK8 A;  4PHN A;  1BF5 A;  3EKH A;  1AHR A;  2G2B A;  2HQ8 A;  1GGZ A;  4BY4 A;  2M1U A;  1MXE A;  1LXF C;  4UPG A;  2GV5 A;  1QLS A;  1OE9 B;  1YVL A;  2BBM A;  4NQG A;  4YRU A;  4PAL A;  2KGR A;  1K8U A;  1A4P A;  1NYA A;  1WY9 A;  4I5K A;  3JTD B;  3H4S E;  1UP5 A;  3QRX A;  1S5G Y;  2KBI A;  1L2O C;  1DMO A;  2LAN A;  1NX2 A;  2M7N A;  3NSI A;  3OP0 A;  1N0Y A;  2E30 A;  5JJG A;  3OHM B;  1ZUZ A;  1DT7 B;  4HRH A;  5DKN A;  1LA0 A;  1NIW A;  4MZL A;  3M0W A;  2PAS A;  1RJV A;  4CFR A;  1RFJ A;  3EVR A;  4U8D A;  1EH2 A;  1PRW A;  4GPL B;  1QAS A;  2KQ6 A;  1XYD A;  3I5F C;  3TS5 B;  4IL1 A;  5I8N A;  1YUR A;  1BMO A;  2LV7 A;  3TDZ A;  1SNL A;  1MR8 A;  1UHK A;  2LAP A;  4WRI A;  1J7O A;  2VRG A;  3KEV A;  4YGB B;  5I2O A;  1B1G A;  2BE4 A;  3VRN A;  1NSH A;  2KI6 C;  1BR1 B;  3CTN A;  1QLK A;  1BT6 A;  4I5N B;  1UHI A;  1K93 D;  5HLV A;  3LLE A;  3BUN B;  1HQV A;  5PAL A;  1SCV A;  1H8B A;  1WRZ A;  1YX8 A;  2EC6 B;  5AXI A;  4GGN A;  2Y1M A;  3ICB A;  2JT0 A;  3SG4 A;  2JNX A;  2LMV A;  2BKH B;  3AAK A;  4CID A;  1ODB A;  1KWO C;  2JTT A;  2K0J A;  3BUO B;  1CB1 A;  3PN7 B;  4JWQ A;  1IH0 A;  4N1F A;  2BCB A;  1QJT A;  2K2A A;  1KQM C;  5FYX A;  1REC A;  2LVI A;  4ORB B;  5G08 A;  1YUT A;  1WRK A;  4GGF C;  2FCE A;  3SG2 A;  1D1O A;  1WDC C;  2COL B;  1A75 B;  1ZOT B;  1NX1 A;  2KFG A;  3CZT X;  2KYF A;  1A75 A;  2K7O A;  5HYD A;  1QAT A;  4DS7 A;  2V53 A;  2L4I A;  2JUL A;  2OTG B;  3BOW A;  1CNP A;  2LUC A;  1CLL A;  2ZFD A;  2F2P A;  2TN4 A;  2WC8 A;  1XFU O;  1PVA A;  3CR5 X;  1UHH A;  3WXA A;  2HET A;  1J1D A;  5GQQ C;  4GAO A;  1PVB A;  1G8I A;  3IF7 A;  1L7Z A;  1XA5 A;  3DD4 A;  2SCP A;  2WND A;  1EL4 A;  2D8N A;  1DGU A;  1B7T Y;  2PVB A;  2OPO A;  4USL A;  3WHU B;  3C1V A;  1KSM A;  2Y5I A;  1F4O A;  1XFV O;  1GQM A;  2F3Z A;  1RTP 1;  3I5H B;  4ICB A;  4XJK A;  1K9K A;  2WCF A;  4OKH A;  4PE7 A;  1FI5 A;  3GK1 A;  4MVF A;  4C0L A;  1TN4 A;  1FPW A;  1S6I A;  2M29 A;  1UHN A;  1SCM C;  4M2Q A;  2LVV A;  3EVU A;  4OV2 A;  4ZCU A;  3JVT C;  2WOS A;  3OB1 B;  3O4Y A;  5CSJ A;  3OB2 B;  1QS7 A;  2KI6 D;  3SG7 A;  2NZ0 A;  2PSR A;  1A2X A;  1KQM B;  5B8I B;  2RGI A;  1OZO A;  1IGV A;  2BBN A;  2JNF A;  2MHH A;  4ETO A;  4OCI A;  2OS8 C;  4E68 A;  4L9M A;  1OZS A;  1FF1 A;  1B8L A;  1N65 A;  1SMG A;  4F0Z B;  1SCM B;  1LIN A;  1SR6 B;  1SL9 A;  2IS9 A;  1JFJ A;  1CFD A;  1CTR A;  2MRD A;  3BXK A;  3VRP A;  1J7Q A;  1M31 A;  1NCX A;  1ZFS A;  1RWY A;  4FQO A;  1SL8 A;  3DVK A;  1DF0 A;  1V1F A;  4GUK A;  1CM1 A;  2WOR A;  4PE0 A;  1XFX O;  1NX0 A;  1SKT A;  1OMV A;  1YR5 A;  3O78 A;  1PK0 D;  1JBA A;  3VGO A;  2Q4U A;  2M0R A;  1R6P A;  1ALV A;  4AOM A;  1AVS A;  1SPY A;  3SIA A;  2ZRS A;  2LC5 A;  2KQY A;  1IQ3 A;  2AMI A;  1F8H A;  5AAN A;  1KQV A;  3I5I C;  1EJ3 A;  4MZK A;  1NCZ A;  3I5F B;  1DJX A;  1VRK A;  4YI8 A;  1DJH A;  3GOF A;  2Y4Q A;  3IQQ A;  2KFH A;  2FJU B;  1Y0V H;  2MJW B;  1U5I B;  3JTD C;  1UHJ A;  4YGE B;  2F33 A;  2CBL A;  4D1E A;  3SIB A;  5DKQ A;  1TCO B;  1J7R A;  1RRO A;  4GGF A;  4MRX A;  4YGD B;  2EHB A;  2MA2 A;  4HRE E;  5HKW A;  1CDP A;  1NPQ A;  2MLE C;  2JQ6 A;  1UUR A;  3I5G C;  5IBW A;  1YVH A;  4QJ3 B;  1DJZ A;  1H4B A;  1UWO A;  2EC6 C;  1DVI A;  1A29 A;  2BCA A;  3RLZ A;  2FOT A;  3SG6 A;  1K9P A;  1ZAC A;  1F71 A;  3FWC A;  1KK7 Z;  5CPV A;  1LVC D;  3TS5 C;  4HSZ A;  5KU1 A;  2QAC A;  4XJK B;  3VRQ A;  3BUX B;  1WLM A;  2JT8 A;  2LUX A;  1KFX S;  2JU0 A;  5KTY A;  1QTX A;  2ZKM X;  5D7F A;  5JOL A;  1K95 A;  4BY5 A;  1TNQ A;  3KO0 A;  1S36 A;  1SYM A;  3LK1 A;  3DF0 B;  1KK8 B;  2ZN9 A;  3CGA A;  2KDH A;  2KNE A;  1BOC A;  2K7D A;  2JPT A;  1SRA A;  2Q91 A;  4ORA B;  3I5I B;  3F45 A;  2AAO A;  2M1K B;  2O60 A;  2LLT A;  2F2O A;  2LMU A;  1PAL A;  2NCO A;  1CFF A;  2MLF C;  1XVJ A;  3MSE B;  1C07 A;  3FIA A;  4R1E A;  4PDZ A;  2KBM A;  1AJ5 A;  1DJG A;  1K9U A;  1AJ4 A;  4FTG A;  2WCE A;  4PHM A;  3KF9 A;  3O6B A;  1CDM A;  5I2Q A;  2ZN8 A;  2L50 A;  3PAL A;  1GGW A;  1MF8 B;  3PM8 A;  2LP3 A;  1QV0 A;  2BE6 A;  3I5H C;  2L2E A;  4M2O A;  5AER A;  2K8M B;  2JTZ A;  3NSO A;  1G33 A;  3PLF B;  3SG3 A;  1QVI Z;  1KK7 Y;  2BL0 C;  2CCM A;  4M2P A;  3EK4 A;  2K61 A;  3DF0 A;  4CFQ A;  1CKK A;  2HQW A;  2H61 A;  1FW4 A;  1B47 A;  3GK2 A;  2JWW A;  2P6B B;  5CSN A;  2WCB A;  2KAV A;  5ER5 A;  3JVT B;  3TDI A;  3E3R A;  1JF2 A;  2FCD A;  1PUL A;  2I2R E;  1DTL A;  2PRU A;  4NDC A;  1V1G A;  2H2K A;  2KHN A;  4JQ0 D;  1B7T Z;  2JC2 A;  1XFW O;  4WQ3 A;  1S6C A;  2L0P A;  3VRR A;  1IWQ A;  1S6J A;  4C0K A;  2BKI B;  1K2H A;  2KAY A;  1DGV A;  4I5L B;  1YTZ C;  1J55 A;  2LHL A;  2K7B A;  4CPV A;  2LVJ A;  2R2I A;  1G4Y R;  1OMD A;  2KI4 C;  1TNX A;  2CXJ A;  1OQP A;  2L4H A;  1C7V A;  5KSZ A;  1CM4 A;  3BYA A;  1OSA A;  5J3X A;  1QIW A;  1PSR A;  1PSB A;  1JUO A;  1EG3 A;  2F3Y A;  1BLQ A;  5D69 A;  3EKJ A;  1U5I A;  1WDC B;  3LCP C;  1BU3 A;  1CFP A;  4MN0 A;  2JZI A;  3DVM A;  1IJ5 A;  2QPT A;  5CSF A;  1K90 D;  1OMR A;  1CDL A;  1JFK A;  2B1U A;  1QIV A;  2M7L A;  3CWG A;  2OTG C;  3CLN A;  3OX6 A;  1JSA A;  2M49 B;  1Y6W A;  1JWD A;  4JPZ B;  1TIZ A;  4ORC B;  5K89 A;  1BG1 A;  1NX3 A;  1WLZ A;  1OOJ A;  4OR9 B;  1YRT B;  2BEC A;  2HF5 A;  2KYC A;  1YRU B;  3FWB A;  1MXL C;  3PN7 C;  4P5O E;  4AQI A;  2LLS A;  1XFZ O;  1XK4 A;  5DKR A;  2E6W A;  1E8A A;  3LL8 B;  3BUW B;  4PHK A;  1NP8 A;  2KFF A;  5TNC A;  3D10 A;  1S26 D;  4GFT A;  4HRG A;  2MAZ A;  1CMG A;  3ZNI A;  2I18 A;  1KSO A;  4DCK A;  1QV1 A;  2KAX A;  4PE4 A;  4N1G A;  4MZJ A;  1F54 A;  5ER4 X;  1YUU A;  2KSP A;  4C0J A;  1B4C A;  1TNW A;  1ZMZ A;  1Y1U A;  1EXR A;  2NLN A;  1QX7 A;  1ALW A;  1WRL A;  1B8C A;  1TNP A;  4NDD A;  2G9B A;  4PHJ A;  1M46 A;  2GGM A;  1BOD A;  2OS8 B;  4MBE A;  5HKZ A;  2LE9 B;  2I7A A;  5F6T A;  3DVE A;  1DJI A;  1NCY A;  4MSP A;  1TRF A;  3GK4 X;  1SR6 C;  1W7J B;  1DF0 B;  3I5G B;  2LM5 A;  3AAJ A;  5AEQ A;  1CLB A;  1YUS A;  1LA3 A;  3EVV A;  4DUQ A;  1XK4 C;  3TUY C;  1F70 A;  1TCF A;  2LCP A;  3SJS A;  3NSL A;  3PSR A;  1RK9 A;  3LK0 A;  4Q04 A;  1Y1X A;  1SK6 D;  3NSK A;  4QJ5 B;  3IQO A;  4A4B A;  2SAS A;  3O2P A;  1NWD A;  5BPJ A;  1C7W A;  1IKU A;  1CMF A;  3NXA A;  3KPX A;  1N2D A;  2A4J A;  1J1E A;  1IRJ A;  2AUC A;  3BQ3 A;  3D0Y B;  4GBA A;  4YGA A;  3WNX B;  1J7P A;  1AUI B;  2ISD A;  2JRF A;  3KHE A;  1QX2 A;  1GJY A;  4PE1 A;  3EK7 A;  1SBJ A;  1DJW A;  3RM1 A;  2GGZ A;  4DRW A;  1QVI Y;  1MWN A;  2BCX A;  4P2Y B;  3CR4 X;  5HKY A;  2LLU A;  2LVK A;  1IJ6 A;  1IG5 A;  2LP2 A;  4GNK B;  3SG5 A;  1EG4 A;  2PMY A;  1MUX A;  4YBH B;  1DJY A;  4WQ2 A;  1B8R A;  3A4U B;  3HX4 A;  1M39 A;  1XO5 A;  2ZRT A;  1MQ1 A;  1SW8 A;  4TNC A;  3PAT A;  2ZNE A;  3TUY B;  3FS7 A;  2KI4 B;  1CLM A;  3AKB A;  2CT9 A;  3CS1 A;  1R2U A;  3AKA A;  1TOP A;  2BL0 B;  1K96 A;  2L5X B;  3BOW B;  4ZCV A;  4YGC B;  4N5X A;  1M45 A;  2H61 C;  3HCM A;  3CR2 A;  3TDU A;  1HT9 A;  2EGD A;  2KGB C;  3TZ1 A;  1KWO B;  4PCW A;  3VRO A;  2CNP A;  3D0Y A;  2I94 A;  2HPS A;  1IQ5 A;  2PAL A;  3WHT B;  3DVJ A;  4AQJ A;  1X02 A;  1Y1A A;  1SL7 A;  1Q80 A;  3A8R A;  1S5G Z;  1KFU S;  1W7I B;  2L51 A;  4QJ4 B;  5I2L A;  2JXL A;  1QX5 B;  3OX5 A;  2Y1N A;  4NDB A;  1FI6 A;  1SY9 A;  1YX7 A;  2JXC A;  3ZWH A;  1CDN A;  1A03 A;  2DOQ A;  5HLO A;  2JT3 A;  2CTN A; 
#chains in the Genus database with same CATH topology
 2ZND A;  2LMT A;  3PFV A;  3NGV A;  4A4C A;  2K7C A;  1KCY A;  1F55 A;  2M9G A;  4OVN F;  1C3Z A;  1KFU L;  2QEO A;  4MLW A;  4DIR A;  4XYN A;  2MBX A;  4MEW A;  4YI9 A;  3B88 A;  1JC2 A;  1QXP A;  1M63 B;  1CFC A;  1BR4 B;  1KK8 C;  2NXQ A;  1B9A A;  4I5J A;  5AFP A;  4MRY A;  2LHI A;  5EL2 A;  1TTX A;  1S3P A;  1AK8 A;  2NCP A;  1NUB A;  3R72 A;  1AP4 A;  2F8P A;  2K2F A;  2O5G A;  1GM0 A;  2M97 A;  1S1E A;  1K94 A;  3K21 A;  2LNK A;  3SS5 A;  1F4Q A;  1JF0 A;  1MHO A;  1FBV A;  5CSI A;  2M8U A;  1UUS A;  1LKJ A;  2JOJ A;  1L2O B;  2M3W A;  1IIO A;  4CLN A;  1BJF A;  1OOH A;  1XFY O;  1KFX L;  2L98 A;  2KOT A;  3BUM B;  3EK8 A;  4PHN A;  1BF5 A;  3EKH A;  1AHR A;  2G2B A;  2HQ8 A;  1GGZ A;  3FE8 A;  4BY4 A;  2M1U A;  1MXE A;  1LXF C;  4UPG A;  2GV5 A;  1QLS A;  1OE9 B;  1YVL A;  2BBM A;  4NQG A;  4YRU A;  4PAL A;  2KGR A;  3O4X A;  1K8U A;  3UO9 A;  1A4P A;  1NYA A;  1WY9 A;  4I5K A;  3JTD B;  3H4S E;  1UP5 A;  3QRX A;  1S5G Y;  2KBI A;  1L2O C;  1DMO A;  3Q8I A;  2LAN A;  1NX2 A;  2M7N A;  3NSI A;  2H8V A;  3OP0 A;  4KYN A;  1N0Y A;  2E30 A;  3FE9 A;  5JJG A;  3OHM B;  1ZUZ A;  1DT7 B;  4HRH A;  5DKN A;  1LA0 A;  1NIW A;  4MZL A;  4INW A;  3M0W A;  2PAS A;  1RJV A;  4CFR A;  1RFJ A;  3EVR A;  4U8D A;  1EH2 A;  1PRW A;  4GPL B;  1QAS A;  2KQ6 A;  1TUZ A;  1XYD A;  3I5F C;  3TS5 B;  4IL1 A;  5I8N A;  2K60 A;  1YUR A;  1BMO A;  2LV7 A;  3NHT A;  3TDZ A;  2KLD A;  1SNL A;  1MR8 A;  1UHK A;  2LAP A;  4WRI A;  3DY9 A;  1J7O A;  2VRG A;  3KEV A;  4YGB B;  5I2O A;  3D77 A;  3PM2 A;  1B1G A;  2BE4 A;  3VRN A;  5I94 A;  1NSH A;  2KI6 C;  1BR1 B;  3CTN A;  1OOI X;  1QLK A;  1BT6 A;  4I5N B;  1UHI A;  1K93 D;  5HLV A;  3LLE A;  3BUN B;  1HQV A;  2KLE A;  3CDN A;  5PAL A;  1SCV A;  1H8B A;  1WRZ A;  1YX8 A;  2EC6 B;  5AXI A;  4GGN A;  2Y1M A;  3ICB A;  3CZ1 A;  2JT0 A;  3SG4 A;  2JNX A;  2LMV A;  2BKH B;  1DEL A;  3AAK A;  4CID A;  1ODB A;  1KWO C;  2JTT A;  2K0J A;  3BUO B;  3NHI A;  1CB1 A;  3BJH A;  3PN7 B;  4JWQ A;  1IH0 A;  4N1F A;  2BCB A;  1QJT A;  2K2A A;  1KQM C;  3CZ0 A;  5FYX A;  1REC A;  2LVI A;  2QEB A;  4ORB B;  5G08 A;  1YUT A;  1WRK A;  2JPO A;  3L4L A;  4GGF C;  2FCE A;  3SG2 A;  1D1O A;  1WDC C;  2COL B;  1A75 B;  1ZOT B;  1NX1 A;  2KFG A;  3CZT X;  2KYF A;  1A75 A;  2K7O A;  1T14 A;  5HYD A;  1QAT A;  4DS7 A;  2V53 A;  2L4I A;  2JUL A;  2OTG B;  3BOW A;  1CNP A;  2LUC A;  1CLL A;  2ZFD A;  2F2P A;  2TN4 A;  2WC8 A;  3D73 A;  1XFU O;  1PVA A;  3CR5 X;  1UHH A;  3WXA A;  2HET A;  1J1D A;  5GQQ C;  4GAO A;  1PVB A;  1G8I A;  3IF7 A;  1L7Z A;  1XA5 A;  3DD4 A;  2SCP A;  2WND A;  1EL4 A;  2D8N A;  1DGU A;  1B7T Y;  2PVB A;  2OPO A;  4USL A;  3WHU B;  3C1V A;  1KSM A;  2Y5I A;  1F4O A;  3V2L A;  1XFV O;  1GQM A;  2F3Z A;  5FI2 A;  1RTP 1;  3I5H B;  4ICB A;  4XJK A;  1K9K A;  2WCF A;  4OKH A;  4PE7 A;  1FI5 A;  3GK1 A;  3IVT A;  4MVF A;  4OZD A;  4C0L A;  1TN4 A;  1FPW A;  1S6I A;  2M29 A;  3CYZ A;  1UHN A;  2WCM A;  1SCM C;  4M2Q A;  2LVV A;  3EVU A;  4OV2 A;  3QME A;  4ZCU A;  4PT1 A;  3JVT C;  5HL1 A;  2WOS A;  5FI6 A;  3OB1 B;  3O4Y A;  3BFA A;  3OB2 B;  5CSJ A;  1QS7 A;  2KI6 D;  3SG7 A;  2NZ0 A;  2PSR A;  1A2X A;  1KQM B;  5B8I B;  2BAP A;  1OZO A;  2RGI A;  1SSE B;  1IGV A;  2BBN A;  2JNF A;  2MHH A;  3SS4 A;  4ETO A;  4OCI A;  2OS8 C;  4E68 A;  4L9M A;  1OZS A;  1FF1 A;  1B8L A;  3S0G A;  1N65 A;  1SMG A;  3S0A A;  3S0D A;  4F0Z B;  1OOF A;  1SCM B;  1LIN A;  1SR6 B;  2WCJ A;  3D76 A;  1SL9 A;  2IS9 A;  1JFJ A;  1CFD A;  1CTR A;  2MRD A;  3BXK A;  3VRP A;  1J7Q A;  1M31 A;  1NCX A;  1ZFS A;  1RWY A;  3D74 A;  2WCL A;  4FQO A;  2QEV A;  1SL8 A;  3DVK A;  1DF0 A;  1V1F A;  2PYQ A;  3PJI A;  4GUK A;  1CM1 A;  2WOR A;  4PE0 A;  2QEH A;  3BFB A;  1XFX O;  1NX0 A;  1SKT A;  1OMV A;  1YR5 A;  3B86 A;  1PK0 D;  3O78 A;  3VGO A;  1JBA A;  2Q4U A;  2M0R A;  1R6P A;  1ALV A;  4AOM A;  1AVS A;  1SPY A;  3S0B A;  3SIA A;  2ZRS A;  2LC5 A;  2KQY A;  1IQ3 A;  2AMI A;  1F8H A;  5AAN A;  1KQV A;  3I5I C;  2BNX A;  1EJ3 A;  4MZK A;  1NCZ A;  3I5F B;  1DJX A;  1VRK A;  4YI8 A;  1DJH A;  3GOF A;  2Y4Q A;  3IQQ A;  2KFH A;  2FJU B;  1Y0V H;  2MJW B;  1U5I B;  3JTD C;  1UHJ A;  4YGE B;  3VB1 A;  2F33 A;  2CBL A;  4D1E A;  3SIB A;  5DKQ A;  1TCO B;  1J7R A;  1RRO A;  4GGF A;  4MRX A;  4YGD B;  2EHB A;  2MA2 A;  4HRE E;  5HKW A;  1CDP A;  1NPQ A;  2MLE C;  2JQ6 A;  1UUR A;  3I5G C;  5IBW A;  1YVH A;  4IJ7 A;  4QJ3 B;  1DJZ A;  1H4B A;  1UWO A;  2EC6 C;  1DVI A;  1A29 A;  1XFR A;  2BCA A;  3RLZ A;  2FOT A;  3SG6 A;  1TWO A;  1K9P A;  1ZAC A;  1F71 A;  3FWC A;  1KK7 Z;  5CPV A;  1TUJ A;  1LVC D;  3TS5 C;  4HSZ A;  5KU1 A;  2QAC A;  4XJK B;  3VRQ A;  3BUX B;  1WLM A;  3OBV A;  3B6X A;  2JT8 A;  2LUX A;  1KFX S;  2JU0 A;  5KTY A;  1QTX A;  2ZKM X;  5D7F A;  5JOL A;  1K95 A;  4JD9 A;  4BY5 A;  1TNQ A;  3KO0 A;  1S36 A;  2WCK A;  1SYM A;  3LK1 A;  3DF0 B;  1OOG A;  1KK8 B;  2ZN9 A;  3CGA A;  3S0F A;  2KDH A;  2KNE A;  1BOC A;  3B87 A;  2K7D A;  1W9Z A;  1SRA A;  2JPT A;  2Q91 A;  3R1O A;  4ORA B;  3I5I B;  3S0E A;  3F45 A;  2AAO A;  2M1K B;  2O60 A;  2LLT A;  2F2O A;  2LMU A;  1PAL A;  2NCO A;  1CFF A;  2MLF C;  1XVJ A;  3MSE B;  1C07 A;  3FIA A;  4R1E A;  3OGN A;  4PDZ A;  2KBM A;  1AJ5 A;  1DJG A;  1K9U A;  1AJ4 A;  4FTG A;  3RZS A;  2WCE A;  2P71 A;  3FE6 A;  3KF9 A;  4PHM A;  3O6B A;  1CDM A;  5I2Q A;  2ZN8 A;  2L50 A;  3PAL A;  3DZT A;  1GGW A;  1MF8 B;  3PM8 A;  2LP3 A;  4INX A;  1QV0 A;  2BE6 A;  3I5H C;  2L2E A;  4M2O A;  5AER A;  2K8M B;  2JTZ A;  3NSO A;  1G33 A;  3PLF B;  3SG3 A;  1QVI Z;  1KK7 Y;  2BL0 C;  2CCM A;  4M2P A;  3EK4 A;  2K61 A;  3DF0 A;  4CFQ A;  1CKK A;  2HQW A;  2H61 A;  1FW4 A;  1B47 A;  3GK2 A;  2JWW A;  2P6B B;  5CSN A;  2WCB A;  2KAV A;  5ER5 A;  3JVT B;  3TDI A;  3E3R A;  5DIC A;  1JF2 A;  3UNW A;  2FCD A;  1PUL A;  1ORG A;  2I2R E;  1DTL A;  2PRU A;  4NDC A;  1V1G A;  2H2K A;  2KHN A;  4JQ0 D;  1B7T Z;  2JC2 A;  1XFW O;  4WQ3 A;  1S6C A;  2L0P A;  3VRR A;  1IWQ A;  1S6J A;  3L47 A;  4C0K A;  1Z4H A;  2BKI B;  1K2H A;  3R1V A;  2KAY A;  1DGV A;  4I5L B;  1YTZ C;  1J55 A;  2LHL A;  2K7B A;  4CPV A;  2LVJ A;  2R2I A;  1G4Y R;  1OMD A;  2KI4 C;  1TNX A;  2CXJ A;  1OQP A;  2L4H A;  1C7V A;  5KSZ A;  1CM4 A;  3BYA A;  1OW4 A;  1OSA A;  3K1E A;  1QIW A;  5J3X A;  1PSR A;  1PSB A;  1JUO A;  1EG3 A;  2F3Y A;  1BLQ A;  5D69 A;  3EKJ A;  1U5I A;  1WDC B;  3LCP C;  1BU3 A;  1CFP A;  4MN0 A;  2JZI A;  3DVM A;  1IJ5 A;  2QPT A;  3D75 A;  5CSF A;  1K90 D;  1OMR A;  1CDL A;  1JFK A;  2B1U A;  1QIV A;  2M7L A;  3CWG A;  2OTG C;  3CLN A;  3OX6 A;  1JSA A;  2M49 B;  1Y6W A;  1JWD A;  4JPZ B;  1TIZ A;  2YGU A;  4ORC B;  5K89 A;  1BG1 A;  1NX3 A;  3L4A A;  1WLZ A;  2FJY A;  1OOJ A;  3D78 A;  1YRT B;  2BEC A;  2HF5 A;  2KYC A;  3R1P A;  4OR9 B;  1YRU B;  3FWB A;  1MXL C;  3PN7 C;  4P5O E;  4AQI A;  2LLS A;  1XFZ O;  1XK4 A;  2QDI A;  5DKR A;  2E6W A;  1E8A A;  3CAB A;  2WC5 A;  3LL8 B;  3BUW B;  4PHK A;  1NP8 A;  2KFF A;  5TNC A;  3D10 A;  1S26 D;  4GFT A;  4HRG A;  3B7A A;  2MAZ A;  4JKT A;  3ZNI A;  1CMG A;  2I18 A;  1KSO A;  4DCK A;  1QV1 A;  4FQT A;  2KAX A;  4PE4 A;  3SS3 A;  4N1G A;  4MZJ A;  1F54 A;  5ER4 X;  1YUU A;  2KSP A;  3DXL A;  4C0J A;  1B4C A;  1TNW A;  1ZMZ A;  1Y1U A;  1EXR A;  2NLN A;  1QX7 A;  1ALW A;  1WRL A;  1B8C A;  3BFH A;  1TNP A;  4NDD A;  2G9B A;  4PHJ A;  1M46 A;  2GGM A;  2WCH A;  2OS8 B;  4MBE A;  5HKZ A;  1BOD A;  2LE9 B;  2I7A A;  5F6T A;  3DVE A;  1DJI A;  1NCY A;  2L5Y A;  4MSP A;  1TRF A;  3GK4 X;  1SR6 C;  1DQE A;  1W7J B;  1DF0 B;  1LS8 A;  3I5G B;  2LM5 A;  3AAJ A;  5AEQ A;  1DC1 A;  1CLB A;  1YUS A;  1LA3 A;  3EVV A;  4DUQ A;  1XK4 C;  3TUY C;  1F70 A;  1TCF A;  1Z2C B;  2ERB A;  2LCP A;  3SJS A;  3NSL A;  2L2C A;  3PSR A;  1RK9 A;  3EG5 B;  1QWV A;  3LK0 A;  4Q04 A;  1Y1X A;  4F7F A;  1SK6 D;  3NSK A;  4QJ5 B;  3IQO A;  4A4B A;  2SAS A;  3O2P A;  1NWD A;  5BPJ A;  1C7W A;  1IKU A;  1CMF A;  3NXA A;  3KPX A;  1N2D A;  2A4J A;  1J1E A;  1IRJ A;  2AUC A;  3BQ3 A;  3D0Y B;  4GBA A;  4YGA A;  3WNX B;  1J7P A;  1AUI B;  2PQL A;  2ISD A;  2JRF A;  1DEK A;  3KHE A;  3N7H A;  1QX2 A;  1GJY A;  4PE1 A;  3EK7 A;  1SBJ A;  1DJW A;  3RM1 A;  2GGZ A;  4DRW A;  1QVI Y;  1MWN A;  1P28 A;  2BCX A;  4P2Y B;  3CR4 X;  5HKY A;  2LLU A;  2LVK A;  1IJ6 A;  1IG5 A;  2LP2 A;  4GNK B;  5FI7 A;  3SG5 A;  1EG4 A;  2PMY A;  1MUX A;  4YBH B;  1DJY A;  3CZ2 A;  4WQ2 A;  1C3Y A;  1B8R A;  3A4U B;  3HX4 A;  1M39 A;  1XO5 A;  2ZRT A;  2WC6 A;  1MQ1 A;  1SW8 A;  2KPH A;  4TNC A;  3PAT A;  2ZNE A;  3TUY B;  3FS7 A;  2KI4 B;  1CLM A;  3AKB A;  2CT9 A;  3CS1 A;  1R2U A;  3AKA A;  2BL0 B;  1TOP A;  1K96 A;  2L5X B;  3BOW B;  4ZCV A;  4YGC B;  2P70 A;  4N5X A;  1M45 A;  2H61 C;  3HCM A;  3CR2 A;  3TDU A;  1HT9 A;  2GTE A;  2EGD A;  2KGB C;  3TZ1 A;  1KWO B;  4PCW A;  3VRO A;  2CNP A;  3D0Y A;  2I94 A;  2HPS A;  1IQ5 A;  2PAL A;  3WHT B;  3DVJ A;  4AQJ A;  1X02 A;  1Y1A A;  1SL7 A;  1Q80 A;  3A8R A;  1S5G Z;  1KFU S;  1W7I B;  2L51 A;  4QJ4 B;  5I2L A;  2JXL A;  1QX5 B;  3OX5 A;  2Y1N A;  4NDB A;  1FI6 A;  3DYE A;  1SY9 A;  1YX7 A;  2JXC A;  5D3O A;  3ZWH A;  1CDN A;  1A03 A;  2DOQ A;  5HLO A;  2JT3 A;  2CTN A; 
#chains in the Genus database with same CATH homology
 2ZND A;  2LMT A;  3PFV A;  4A4C A;  2K7C A;  1KCY A;  1F55 A;  2M9G A;  4OVN F;  1KFU L;  4MLW A;  4DIR A;  4XYN A;  2MBX A;  4MEW A;  4YI9 A;  1JC2 A;  1QXP A;  1M63 B;  1CFC A;  1BR4 B;  1KK8 C;  2NXQ A;  1B9A A;  4I5J A;  5AFP A;  4MRY A;  2LHI A;  1TTX A;  1S3P A;  1AK8 A;  2NCP A;  1NUB A;  1AP4 A;  2F8P A;  2K2F A;  2O5G A;  2M97 A;  1S1E A;  1K94 A;  3K21 A;  2LNK A;  1F4Q A;  1JF0 A;  1MHO A;  1FBV A;  5CSI A;  2M8U A;  1UUS A;  1LKJ A;  2JOJ A;  1L2O B;  2M3W A;  4CLN A;  1BJF A;  1XFY O;  1KFX L;  2L98 A;  3BUM B;  2KOT A;  3EK8 A;  4PHN A;  1BF5 A;  3EKH A;  1AHR A;  2G2B A;  2HQ8 A;  1GGZ A;  4BY4 A;  2M1U A;  1MXE A;  1LXF C;  4UPG A;  2GV5 A;  1QLS A;  1OE9 B;  1YVL A;  2BBM A;  4NQG A;  4YRU A;  4PAL A;  2KGR A;  1K8U A;  1A4P A;  1NYA A;  1WY9 A;  4I5K A;  3JTD B;  3H4S E;  1UP5 A;  3QRX A;  1S5G Y;  2KBI A;  1L2O C;  1DMO A;  2LAN A;  1NX2 A;  2M7N A;  3NSI A;  3OP0 A;  1N0Y A;  2E30 A;  5JJG A;  3OHM B;  1ZUZ A;  1DT7 B;  4HRH A;  5DKN A;  1LA0 A;  1NIW A;  4MZL A;  3M0W A;  2PAS A;  1RJV A;  4CFR A;  1RFJ A;  3EVR A;  4U8D A;  1EH2 A;  1PRW A;  4GPL B;  1QAS A;  2KQ6 A;  1XYD A;  3I5F C;  3TS5 B;  4IL1 A;  5I8N A;  1YUR A;  1BMO A;  2LV7 A;  3TDZ A;  1SNL A;  1MR8 A;  1UHK A;  2LAP A;  4WRI A;  1J7O A;  2VRG A;  3KEV A;  4YGB B;  5I2O A;  1B1G A;  2BE4 A;  3VRN A;  1NSH A;  2KI6 C;  1BR1 B;  3CTN A;  1QLK A;  1BT6 A;  4I5N B;  1UHI A;  1K93 D;  5HLV A;  3LLE A;  3BUN B;  1HQV A;  5PAL A;  1SCV A;  1H8B A;  1WRZ A;  1YX8 A;  2EC6 B;  5AXI A;  4GGN A;  2Y1M A;  3ICB A;  2JT0 A;  3SG4 A;  2JNX A;  2LMV A;  2BKH B;  3AAK A;  4CID A;  1ODB A;  1KWO C;  2JTT A;  2K0J A;  3BUO B;  1CB1 A;  3PN7 B;  4JWQ A;  1IH0 A;  4N1F A;  2BCB A;  1QJT A;  2K2A A;  1KQM C;  5FYX A;  1REC A;  2LVI A;  4ORB B;  5G08 A;  1YUT A;  1WRK A;  4GGF C;  2FCE A;  3SG2 A;  1D1O A;  1WDC C;  2COL B;  1A75 B;  1ZOT B;  1NX1 A;  2KFG A;  3CZT X;  2KYF A;  1A75 A;  2K7O A;  5HYD A;  1QAT A;  4DS7 A;  2V53 A;  2L4I A;  2JUL A;  2OTG B;  3BOW A;  1CNP A;  2LUC A;  1CLL A;  2ZFD A;  2F2P A;  2TN4 A;  2WC8 A;  1XFU O;  1PVA A;  3CR5 X;  1UHH A;  3WXA A;  2HET A;  1J1D A;  5GQQ C;  4GAO A;  1PVB A;  1G8I A;  3IF7 A;  1L7Z A;  1XA5 A;  3DD4 A;  2SCP A;  2WND A;  1EL4 A;  2D8N A;  1DGU A;  1B7T Y;  2PVB A;  2OPO A;  4USL A;  3WHU B;  3C1V A;  1KSM A;  2Y5I A;  1F4O A;  1XFV O;  1GQM A;  2F3Z A;  1RTP 1;  3I5H B;  4ICB A;  4XJK A;  1K9K A;  2WCF A;  4OKH A;  4PE7 A;  1FI5 A;  3GK1 A;  4MVF A;  4C0L A;  1TN4 A;  1FPW A;  1S6I A;  2M29 A;  1UHN A;  1SCM C;  4M2Q A;  2LVV A;  3EVU A;  4OV2 A;  4ZCU A;  3JVT C;  2WOS A;  3OB1 B;  3O4Y A;  5CSJ A;  3OB2 B;  1QS7 A;  2KI6 D;  3SG7 A;  2NZ0 A;  2PSR A;  1A2X A;  1KQM B;  5B8I B;  2RGI A;  1OZO A;  1IGV A;  2BBN A;  2JNF A;  2MHH A;  4ETO A;  4OCI A;  2OS8 C;  4E68 A;  4L9M A;  1OZS A;  1FF1 A;  1B8L A;  1N65 A;  1SMG A;  4F0Z B;  1SCM B;  1LIN A;  1SR6 B;  1SL9 A;  2IS9 A;  1JFJ A;  1CFD A;  1CTR A;  2MRD A;  3BXK A;  3VRP A;  1J7Q A;  1M31 A;  1NCX A;  1ZFS A;  1RWY A;  4FQO A;  1SL8 A;  3DVK A;  1DF0 A;  1V1F A;  4GUK A;  1CM1 A;  2WOR A;  4PE0 A;  1XFX O;  1NX0 A;  1SKT A;  1OMV A;  1YR5 A;  3O78 A;  1PK0 D;  1JBA A;  3VGO A;  2Q4U A;  2M0R A;  1R6P A;  1ALV A;  4AOM A;  1AVS A;  1SPY A;  3SIA A;  2ZRS A;  2LC5 A;  2KQY A;  1IQ3 A;  2AMI A;  1F8H A;  5AAN A;  1KQV A;  3I5I C;  1EJ3 A;  4MZK A;  1NCZ A;  3I5F B;  1DJX A;  1VRK A;  4YI8 A;  1DJH A;  3GOF A;  2Y4Q A;  3IQQ A;  2KFH A;  2FJU B;  1Y0V H;  2MJW B;  1U5I B;  3JTD C;  1UHJ A;  4YGE B;  2F33 A;  2CBL A;  4D1E A;  3SIB A;  5DKQ A;  1TCO B;  1J7R A;  1RRO A;  4GGF A;  4MRX A;  4YGD B;  2EHB A;  2MA2 A;  4HRE E;  5HKW A;  1CDP A;  1NPQ A;  2MLE C;  2JQ6 A;  1UUR A;  3I5G C;  5IBW A;  1YVH A;  4QJ3 B;  1DJZ A;  1H4B A;  1UWO A;  2EC6 C;  1DVI A;  1A29 A;  2BCA A;  3RLZ A;  2FOT A;  3SG6 A;  1K9P A;  1ZAC A;  1F71 A;  3FWC A;  1KK7 Z;  5CPV A;  1LVC D;  3TS5 C;  4HSZ A;  5KU1 A;  2QAC A;  4XJK B;  3VRQ A;  3BUX B;  1WLM A;  2JT8 A;  2LUX A;  1KFX S;  2JU0 A;  5KTY A;  1QTX A;  2ZKM X;  5D7F A;  5JOL A;  1K95 A;  4BY5 A;  1TNQ A;  3KO0 A;  1S36 A;  1SYM A;  3LK1 A;  3DF0 B;  1KK8 B;  2ZN9 A;  3CGA A;  2KDH A;  2KNE A;  1BOC A;  2K7D A;  2JPT A;  1SRA A;  2Q91 A;  4ORA B;  3I5I B;  3F45 A;  2AAO A;  2M1K B;  2O60 A;  2LLT A;  2F2O A;  2LMU A;  1PAL A;  2NCO A;  1CFF A;  2MLF C;  1XVJ A;  3MSE B;  1C07 A;  3FIA A;  4R1E A;  4PDZ A;  2KBM A;  1AJ5 A;  1DJG A;  1K9U A;  1AJ4 A;  4FTG A;  2WCE A;  4PHM A;  3KF9 A;  3O6B A;  1CDM A;  5I2Q A;  2ZN8 A;  2L50 A;  3PAL A;  1GGW A;  1MF8 B;  3PM8 A;  2LP3 A;  1QV0 A;  2BE6 A;  3I5H C;  2L2E A;  4M2O A;  5AER A;  2K8M B;  2JTZ A;  3NSO A;  1G33 A;  3PLF B;  3SG3 A;  1QVI Z;  1KK7 Y;  2BL0 C;  2CCM A;  4M2P A;  3EK4 A;  2K61 A;  3DF0 A;  4CFQ A;  1CKK A;  2HQW A;  2H61 A;  1FW4 A;  1B47 A;  3GK2 A;  2JWW A;  2P6B B;  5CSN A;  2WCB A;  2KAV A;  5ER5 A;  3JVT B;  3TDI A;  3E3R A;  1JF2 A;  2FCD A;  1PUL A;  2I2R E;  1DTL A;  2PRU A;  4NDC A;  1V1G A;  2H2K A;  2KHN A;  4JQ0 D;  1B7T Z;  2JC2 A;  1XFW O;  4WQ3 A;  1S6C A;  2L0P A;  3VRR A;  1IWQ A;  1S6J A;  4C0K A;  2BKI B;  1K2H A;  2KAY A;  1DGV A;  4I5L B;  1YTZ C;  1J55 A;  2LHL A;  2K7B A;  4CPV A;  2LVJ A;  2R2I A;  1G4Y R;  1OMD A;  2KI4 C;  1TNX A;  2CXJ A;  1OQP A;  2L4H A;  1C7V A;  5KSZ A;  1CM4 A;  3BYA A;  1OSA A;  5J3X A;  1QIW A;  1PSR A;  1PSB A;  1JUO A;  1EG3 A;  2F3Y A;  1BLQ A;  5D69 A;  3EKJ A;  1U5I A;  1WDC B;  3LCP C;  1BU3 A;  1CFP A;  4MN0 A;  2JZI A;  3DVM A;  1IJ5 A;  2QPT A;  5CSF A;  1K90 D;  1OMR A;  1CDL A;  1JFK A;  2B1U A;  1QIV A;  2M7L A;  3CWG A;  2OTG C;  3CLN A;  3OX6 A;  1JSA A;  2M49 B;  1Y6W A;  1JWD A;  4JPZ B;  1TIZ A;  4ORC B;  5K89 A;  1BG1 A;  1NX3 A;  1WLZ A;  1OOJ A;  4OR9 B;  1YRT B;  2BEC A;  2HF5 A;  2KYC A;  1YRU B;  3FWB A;  1MXL C;  3PN7 C;  4P5O E;  4AQI A;  2LLS A;  1XFZ O;  1XK4 A;  5DKR A;  2E6W A;  1E8A A;  3LL8 B;  3BUW B;  4PHK A;  1NP8 A;  2KFF A;  5TNC A;  3D10 A;  1S26 D;  4GFT A;  4HRG A;  2MAZ A;  1CMG A;  3ZNI A;  2I18 A;  1KSO A;  4DCK A;  1QV1 A;  2KAX A;  4PE4 A;  4N1G A;  4MZJ A;  1F54 A;  5ER4 X;  1YUU A;  2KSP A;  4C0J A;  1B4C A;  1TNW A;  1ZMZ A;  1Y1U A;  1EXR A;  2NLN A;  1QX7 A;  1ALW A;  1WRL A;  1B8C A;  1TNP A;  4NDD A;  2G9B A;  4PHJ A;  1M46 A;  2GGM A;  1BOD A;  2OS8 B;  4MBE A;  5HKZ A;  2LE9 B;  2I7A A;  5F6T A;  3DVE A;  1DJI A;  1NCY A;  4MSP A;  1TRF A;  3GK4 X;  1SR6 C;  1W7J B;  1DF0 B;  3I5G B;  2LM5 A;  3AAJ A;  5AEQ A;  1CLB A;  1YUS A;  1LA3 A;  3EVV A;  4DUQ A;  1XK4 C;  3TUY C;  1F70 A;  1TCF A;  2LCP A;  3SJS A;  3NSL A;  3PSR A;  1RK9 A;  3LK0 A;  4Q04 A;  1Y1X A;  1SK6 D;  3NSK A;  4QJ5 B;  3IQO A;  4A4B A;  2SAS A;  3O2P A;  1NWD A;  5BPJ A;  1C7W A;  1IKU A;  1CMF A;  3NXA A;  3KPX A;  1N2D A;  2A4J A;  1J1E A;  1IRJ A;  2AUC A;  3BQ3 A;  3D0Y B;  4GBA A;  4YGA A;  3WNX B;  1J7P A;  1AUI B;  2ISD A;  2JRF A;  3KHE A;  1QX2 A;  1GJY A;  4PE1 A;  3EK7 A;  1SBJ A;  1DJW A;  3RM1 A;  2GGZ A;  4DRW A;  1QVI Y;  1MWN A;  2BCX A;  4P2Y B;  3CR4 X;  5HKY A;  2LLU A;  2LVK A;  1IJ6 A;  1IG5 A;  2LP2 A;  4GNK B;  3SG5 A;  1EG4 A;  2PMY A;  1MUX A;  4YBH B;  1DJY A;  4WQ2 A;  1B8R A;  3A4U B;  3HX4 A;  1M39 A;  1XO5 A;  2ZRT A;  1MQ1 A;  1SW8 A;  4TNC A;  3PAT A;  2ZNE A;  3TUY B;  3FS7 A;  2KI4 B;  1CLM A;  3AKB A;  2CT9 A;  3CS1 A;  1R2U A;  3AKA A;  1TOP A;  2BL0 B;  1K96 A;  2L5X B;  3BOW B;  4ZCV A;  4YGC B;  4N5X A;  1M45 A;  2H61 C;  3HCM A;  3CR2 A;  3TDU A;  1HT9 A;  2EGD A;  2KGB C;  3TZ1 A;  1KWO B;  4PCW A;  3VRO A;  2CNP A;  3D0Y A;  2I94 A;  2HPS A;  1IQ5 A;  2PAL A;  3WHT B;  3DVJ A;  4AQJ A;  1X02 A;  1Y1A A;  1SL7 A;  1Q80 A;  3A8R A;  1S5G Z;  1KFU S;  1W7I B;  2L51 A;  4QJ4 B;  5I2L A;  2JXL A;  1QX5 B;  3OX5 A;  2Y1N A;  4NDB A;  1FI6 A;  1SY9 A;  1YX7 A;  2JXC A;  3ZWH A;  1CDN A;  1A03 A;  2DOQ A;  5HLO A;  2JT3 A;  2CTN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...