1AJ4A

Structure of calcium-saturated cardiac troponin c, nmr, 1 structure
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
160
structure length
160
Chain Sequence
ADIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRSMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Muscle protein
molecule keywords TROPONIN C
publication title Structure of cardiac muscle troponin C unexpectedly reveals a closed regulatory domain.
pubmed doi rcsb
source organism Gallus gallus
total genus 33
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 1997-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1aj4A00
1CFPA 1QXPA 1NIWA 1H8BA 1IG5A 1F54A 2M7LA 3PM8A 4PHMA 1NX1A 4CIDA 1DVIA 1A75B 1K9PA 2BBNA 4Q04A 4YGAA 4YGBB 2O60A 1WRKA 2F2OA 2LM5A 4JWQA 3AKAA 5D7FA 3CR4X 3JVTC 1WDCC 1EL4A 1ZUZA 4MRXA 2L0PA 2JU0A 1UHKA 2JRFA 4IL1A 5I2QA 2E30A 2P6BB 3OX6A 2KSPA 1IJ6A 1R6PA 1B4CA 2LE9B 2ZN8A 1TN4A 5HYDA 2BCXA 1S6IA 1SNLA 4OKHA 4GGNA 1S26D 3EKJA 3BUMB 3NXAA 2JXCA 4OVNF 3LK0A 1KFXS 1CLBA 1KK8B 2LMTA 3NSKA 2KQ6A 4MLWA 3D0YB 2ISDA 5JJGA 2FJUB 1BOCA 2KBMA 5CSJA 1J7OA 1CLLA 3OX5A 3E3RA 2KYCA 1UHNA 1S36A 1SW8A 3SG6A 1G8IA 1DJHA 1Y1UA 1KK7Z 1FW4A 2JNFA 4HRGA 3VRPA 1FI5A 4MSPA 4PCWA 1N2DA 1ODBA 1QS7A 3EKHA 3WHTB 1ZFSA 1M31A 4TNCA 3I5FB 1B8RA 4FTGA 1L7ZA 4QJ4B 1J1EA 2JT0A 2LLSA 1LXFC 2M3WA 5AEQA 2KNEA 4FQOA 1VRKA 3CZTX 1YURA 2MA2A 3NSLA 3SG2A 1PRWA 1MHOA 2ZNDA 3ZWHA 2I7AA 5AFPA 5DKNA 1IH0A 1TNXA 1UHHA 4HSZA 1BLQA 4MZJA 2JTZA 1M46A 2CTNA 5DKQA 2KFHA 1IGVA 1M45A 1K9KA 4XJKB 1AUIB 1B7TY 2BBMA 1DF0B 4XJKA 1QATA 1BODA 3GK1A 4YGDB 1W7IB 1DF0A 1SL8A 4C0JA 2L98A 3HCMA 2KAVA 3CGAA 4AQJA 5K89A 3NSOA 4L9MA 4HREE 2AMIA 1NP8A 1BJFA 2OPOA 1EXRA 2KGRA 1SK6D 1XO5A 1DJWA 1KSMA 3KO0A 2L50A 1CDNA 1J55A 3O4YA 3FWBA 2B1UA 2KHNA 3I5FC 3CR2A 3IQQA 3JVTB 2KAXA 3VRQA 1C7VA 1M63B 4BY5A 4N1GA 1OZOA 3PALA 2H2KA 3VRRA 1QTXA 2BL0C 2SCPA 3KF9A 1TCFA 1RK9A 3GOFA 4QJ5B 1F4OA 1RROA 5HLVA 1IQ5A 3ZNIA 3SG7A 3D10A 5HKWA 1SKTA 2K7CA 1JSAA 3CS1A 2D8NA 3DD4A 2LC5A 4CPVA 4N5XA 1UHIA 1FPWA 1QVIZ 2CXJA 5KU1A 4ICBA 2MRDA 4YBHB 5IBWA 3PLFB 4DRWA 1MWNA 2L5XB 1AVSA 1M39A 1NPQA 2GV5A 2LV7A 2EC6B 3M0WA 2ZKMX 4NDDA 3AAJA 4WQ2A 3LK1A 2E6WA 1NCYA 2PSRA 1CM4A 1N65A 1BR4B 2AAOA 2LAPA 1TRFA 3TS5C 4YGEB 2JULA 5I2LA 2NLNA 1S3PA 1IJ5A 1E8AA 2WCFA 3MSEB 3KPXA 4JPZB 5FYXA 1DT7B 1L2OC 2CNPA 5CSNA 3HX4A 3PN7B 2M0RA 4MZKA 1DGUA 2LANA 1Y1XA 1QIVA 3VGOA 2JQ6A 2KDHA 1S6CA 4I5KA 1FI6A 1PSRA 5PALA 1WRLA 1PK0D 2NCOA 4C0LA 3A4UB 3CR5X 5HKYA 1H4BA 2JNXA 1DJZA 3OB1B 5JOLA 2M8UA 1NSHA 4ORBB 2Q91A 1RECA 1SBJA 3SG3A 1MXEA 4PHJA 2VRGA 2F8PA 1TNWA 2A4JA 3NSIA 2MBXA 1QX2A 1LVCD 4GUKA 3SIAA 2K2AA 3O6BA 2PVBA 2PRUA 1AHRA 5I8NA 1LA3A 1A03A 5HLOA 2JXLA 1K8UA 2EC6C 4U8DA 1JF2A 2Y5IA 3GK2A 1ALWA 3GK4X 1MUXA 4NDBA 1GJYA 4PE7A 1SL7A 1CDPA 1PSBA 1K93D 1N0YA 5AANA 2HETA 2WOSA 2ZN9A 4PDZA 1F71A 1S5GZ 4PE4A 3PN7C 1AJ4A 2WC8A 1NWDA 4I5LB 2BL0B 4MRYA 4DUQA 1YR5A 1MXLC 1EH2A 1TOPA 4GNKB 4GBAA 1CMFA 2R2IA 1YRUB 2LMUA 2O5GA 3H4SE 3ICBA 5D69A 1G4YR 4C0KA 4UPGA 3LLEA 2KOTA 4YGCB 2K2FA 1OE9B 2JC2A 1XFXO 3FS7A 1QLKA 1XA5A 1NCZA 1S6JA 1TCOB 4QJ3B 1W7JB 1QASA 2NZ0A 2PMYA 2JT3A 2ZFDA 4HRHA 1AJ5A 4YI9A 1SCMC 1A29A 4AOMA 3EVRA 1CM1A 3O2PA 2OS8B 3BXKA 1SMGA 1JBAA 2M7NA 2MLFC 1NX0A 1XFYO 1KSOA 1XYDA 1F55A 1IQ3A 1BT6A 2M97A 4PHNA 1LINA 1UP5A 3BOWB 1DTLA 2MHHA 2V53A 3DF0B 3FIAA 2L4IA 3BOWA 3TS5B 4ETOA 3DF0A 3TUYC 4WRIA 1GQMA 2BE6A 4GFTA 2JWWA 1WLZA 1XFWO 1YUSA 2BE4A 3VRNA 2LUXA 1YX8A 1DJXA 1SL9A 2FOTA 1L2OB 1C7WA 2ZRTA 3OB2B 1KFUL 1GGWA 1TTXA 1NYAA 2I2RE 1PVAA 1Y0VH 3TZ1A 1BMOA 2QPTA 2K0JA 3AKBA 4F0ZB 2BCBA 2FCDA 1K9UA 2LHLA 3DVMA 4OR9B 2JPTA 2KI4C 2BCAA 1KK7Y 1B1GA 4ZCVA 2KI6D 1WRZA 3C1VA 4P2YB 5ER4X 2NCPA 2LP3A 2ZRSA 2M1KB 2JT8A 3BUWB 1UUSA 3SIBA 4MEWA 2F3YA 3TDZA 2MAZA 1ZACA 1KCYA 1J7PA 1IKUA 1OMDA 4MVFA 1CMGA 1TIZA 2K7DA 2JZIA 2OTGB 1AP4A 2JOJA 1J7RA 1EG3A 3I5HB 2OS8C 2KFGA 2H61A 1B47A 1K96A 1XK4A 5I2OA 2WCBA 5KTYA 4A4BA 1QJTA 2K8MB 1CLMA 2NXQA 1JF0A 2KFFA 3I5GB 2AUCA 2PASA 2CCMA 5HKZA 1KFUS 1KQVA 2CBLA 1A4PA 1U5IA 2Y1MA 3WXAA 2MLEC 2GGZA 2KGBC 3SG5A 1V1GA 1EG4A 4GGFA 1X02A 3F45A 5B8IB 1YX7A 2M29A 1Q80A 2HQ8A 2L2EA 4JQ0D 4DS7A 4PALA 1CNPA 3OHMB 1RFJA 5KSZA 3EVVA 2KBIA 3PFVA 4MBEA 4N1FA 4I5JA 5CSFA 1OZSA 2LVVA 2LHIA 2EGDA 1J7QA 1SCVA 1ALVA 1MR8A 1OOJA 3EK4A 1HT9A 4ZCUA 3WNXB 2COLB 1B9AA 1R2UA 1A75A 1B8LA 1KQMB 1SCMB 2PALA 3K21A 3TDUA 1PVBA 2KI6C 1XFZO 2LVIA 3I5IB 5J3XA 1HQVA 3PSRA 4R1EA 3JTDB 1K2HA 1B7TZ 2FCEA 3KEVA 2H61C 2OTGC 1XK4C 2Y1NA 2F2PA 1EJ3A 3I5HC 2LNKA 1S1EA 3LL8B 1WLMA 2WCEA 2K7OA 5CPVA 2F33A 2KAYA 1K90D 1YRTB 2WORA 3RLZA 3TUYB 1WY9A 1QIWA 1KWOB 1QV1A 1RTP1 4NDCA 1PALA 1AK8A 1TNQA 3I5GC 1Y6WA 1QX5B 1DJGA 4M2QA 1QVIY 5DKRA 3TDIA 1CFFA 2BKHB 4AQIA 2WNDA 4GGFC 1CDMA 2LLUA 2F3ZA 2KYFA 4ORAB 1SPYA 1YVHA 2MJWB 1CDLA 2BKIB 2KI4B 3VROA 3D0YA 1J1DA 4GPLB 2M9GA 3BUOB 4CLNA 1QX7A 4M2PA 1SRAA 3IF7A 1RJVA 1OMRA 2LVKA 2TN4A 3PATA 1GGZA 1V1FA 1YTZC 1QV0A 1F4QA 2GGMA 5AERA 4USLA 2ZNEA 3CWGA 4XYNA 1F8HA 1CTRA 1UWOA 2L4HA 1KQMC 2K7BA 1SYMA 2I18A 5GQQC 5G08A 3I5IC 3AAKA 3EVUA 3SJSA 5CSIA 3JTDC 1PULA 1QLSA 2JTTA 5ER5A 4CFRA 3FWCA 3BQ3A 4OV2A 4PHKA 5F6TA 2HQWA 2LMVA 1DGVA 1A2XA 1ZMZA 2KQYA 4DIRA 1F70A 1XVJA 2EHBA 3IQOA 3KHEA 4YI8A 1SR6B 1KWOC 4PE1A 1DMOA 3BYAA 1LKJA 2SASA 2LLTA 3A8RA 1JC2A 2K61A 1C07A 4I5NB 1K95A 1NX3A 1CB1A 1NX2A 1KK8C 1OSAA 2CT9A 1TNPA 2G9BA 1FBVA 3RM1A 1JFKA 2L51A 1BR1B 1MF8B 4WQ3A 3WHUB 1XFUO 2LUCA 2I94A 2Q4UA 1G33A 1LA0A 3LCPC 3EK8A 4YRUA 1K94A 1FF1A 1BG1A 1YVLA 2M1UA 2IS9A 1MQ1A 4E68A 1JUOA 1S5GY 1ZOTB 4M2OA 1RWYA 1XFVO 4MN0A 1WDCB 2LP2A 1NCXA 1CKKA 5AXIA 4OCIA 1JWDA 1BF5A 3DVKA 3O78A 4NQGA 4DCKA 4D1EA 2Y4QA 1IRJA 1UHJA 5BPJA 1JFJA 2G2BA 1Y1AA 1U5IB 4ORCB 1CFDA 2HF5A 2RGIA 2LVJA 1CFCA 1DJYA 3DVJA 1OQPA 4PE0A 1SR6C 3BUNB 1DJIA 5TNCA 4A4CA 1IWQA 3EK7A 4CFQA 1D1OA 3CLNA 1YUTA 1B8CA 2HPSA 3DVEA 1BU3A 2QACA 1SY9A 1UURA 2DOQA 4MZLA 3SG4A 3BUXB 2M49B 3CTNA 4BY4A 1YUUA 4GAOA 1OMVA 3QRXA 2BECA 2LCPA 1KFXL 1NUBA 3OP0A 4P5OE
chains in the Genus database with same CATH superfamily
1CFPA 1QXPA 1NIWA 3D75A 1H8BA 1IG5A 1F54A 2M7LA 3PM8A 4PHMA 1LS8A 1NX1A 1DVIA 4CIDA 1A75B 1K9PA 2BBNA 4Q04A 4YGAA 4YGBB 1C3ZA 2O60A 1WRKA 2F2OA 1QWVA 2GTEA 2LM5A 4JWQA 3AKAA 5D7FA 3CR4X 3JVTC 1WDCC 1EL4A 1ZUZA 4MRXA 2L0PA 2JU0A 1UHKA 2JRFA 4IL1A 5I2QA 2E30A 2P6BB 3OX6A 2KSPA 1IJ6A 1R6PA 1B4CA 2LE9B 2ZN8A 3S0BA 1TN4A 2JPOA 5HYDA 2P70A 2BCXA 1S6IA 1SNLA 4OKHA 4GGNA 1S26D 3EKJA 1ORGA 3BUMB 3NXAA 2JXCA 4OVNF 1OOGA 3LK0A 1KFXS 1CLBA 1KK8B 2K60A 2LMTA 2KQ6A 3B7AA 3NSKA 3R1PA 4MLWA 3D0YB 2ISDA 5JJGA 2FJUB 1BOCA 2KBMA 5CSJA 1J7OA 1CLLA 3OX5A 3E3RA 2KPHA 2KYCA 1UHNA 1S36A 3PJIA 1SW8A 3SG6A 1G8IA 1DJHA 1Y1UA 1KK7Z 1FW4A 3CDNA 2JNFA 4HRGA 3VRPA 1FI5A 4MSPA 4PCWA 1N2DA 1ODBA 1QS7A 3DXLA 3EKHA 3WHTB 1ZFSA 1M31A 4TNCA 3I5FB 1B8RA 4FTGA 1L7ZA 4QJ4B 3L4AA 1J1EA 2JT0A 2LLSA 1LXFC 2M3WA 5AEQA 2KNEA 4FQOA 1VRKA 3S0FA 3CZTX 1YURA 2MA2A 3NSLA 5EL2A 1PRWA 3SG2A 4F7FA 3EG5B 1MHOA 2ZNDA 3ZWHA 2I7AA 5AFPA 5DKNA 1IH0A 1TNXA 1UHHA 4HSZA 1BLQA 1DQEA 4MZJA 2JTZA 3D74A 1M46A 2CTNA 5DKQA 2KFHA 1IGVA 1M45A 1K9KA 4XJKB 1AUIB 1B7TY 2BBMA 1DF0B 1OOFA 4XJKA 1QATA 1BODA 3CZ2A 3GK1A 4YGDB 1DELA 1DF0A 1W7IB 1SL8A 4C0JA 2L98A 3HCMA 2KAVA 3CGAA 4AQJA 5K89A 3NSOA 4L9MA 4HREE 2AMIA 1NP8A 1BJFA 1P28A 2OPOA 1EXRA 2KGRA 3OGNA 1SK6D 1XO5A 1DC1A 1DJWA 1KSMA 3KO0A 2L50A 1CDNA 5I94A 1J55A 3O4YA 3FWBA 2B1UA 2KHNA 3SS5A 3I5FC 3CR2A 3IQQA 3JVTB 2KAXA 3VRQA 1C7VA 1M63B 4BY5A 2L2CA 4N1GA 1OZOA 3PALA 2H2KA 3VRRA 1QTXA 2BL0C 2SCPA 3KF9A 1TCFA 1DEKA 1RK9A 3GOFA 4QJ5B 1F4OA 3VB1A 1RROA 5HLVA 1IQ5A 3ZNIA 3SG7A 3D10A 5HKWA 1SKTA 2K7CA 1JSAA 3CS1A 2D8NA 3DD4A 2LC5A 4CPVA 4N5XA 1UHIA 1FPWA 4F0ZB 1QVIZ 2CXJA 5KU1A 4ICBA 2MRDA 4YBHB 3D73A 5IBWA 3PLFB 4DRWA 3K1EA 1MWNA 2L5XB 1AVSA 1M39A 1NPQA 2GV5A 2LV7A 2EC6B 3M0WA 2ZKMX 4NDDA 3AAJA 4WQ2A 1TUZA 2E6WA 3LK1A 1NCYA 2PSRA 1CM4A 1N65A 1BR4B 2AAOA 2LAPA 1TRFA 3CYZA 3TS5C 4YGEB 2JULA 5I2LA 2NLNA 1S3PA 1IJ5A 1E8AA 2WCFA 3MSEB 3KPXA 4JPZB 1SSEB 5FYXA 1Z2CB 1DT7B 1L2OC 2CNPA 5CSNA 3HX4A 3PN7B 2M0RA 1T14A 4MZKA 1DGUA 2LANA 1Y1XA 1QIVA 3VGOA 2JQ6A 2KDHA 3NHTA 1S6CA 2PYQA 4I5KA 3L47A 1FI6A 1PSRA 5PALA 1WRLA 1PK0D 2NCOA 4C0LA 3A4UB 3CR5X 5HKYA 1H4BA 2WCHA 2JNXA 1DJZA 3OB1B 5DICA 5JOLA 2M8UA 1NSHA 4ORBB 2Q91A 1RECA 1SBJA 5FI7A 1MXEA 3SG3A 4PHJA 2VRGA 3D77A 2F8PA 1TNWA 2ERBA 2A4JA 2BNXA 2P71A 3NSIA 1QX2A 2MBXA 1LVCD 4GUKA 3SIAA 2K2AA 3CZ1A 3O6BA 2PVBA 3S0AA 2PRUA 1AHRA 5I8NA 1LA3A 1A03A 5HLOA 2JXLA 1K8UA 2EC6C 4U8DA 1JF2A 2Y5IA 2QDIA 3GK2A 1ALWA 4INWA 2WCMA 1MUXA 3GK4X 4NDBA 3B86A 1GJYA 4PE7A 1SL7A 1CDPA 1PSBA 1K93D 1N0YA 2BAPA 5AANA 2HETA 2WOSA 2ZN9A 4PDZA 3SS3A 1F71A 1S5GZ 4PE4A 3PN7C 3B6XA 1AJ4A 2WC8A 1NWDA 3CABA 2BL0B 4I5LB 4MRYA 1YR5A 1MXLC 4DUQA 1TOPA 4GNKB 1EH2A 4GBAA 1CMFA 2R2IA 1YRUB 2LMUA 2O5GA 3H4SE 3ICBA 5D69A 1G4YR 4C0KA 4UPGA 3LLEA 3R72A 3BFAA 2KOTA 4YGCB 2K2FA 1OE9B 2JC2A 3UNWA 1XFXO 1W9ZA 3FS7A 1QLKA 1XA5A 1NCZA 1S6JA 1TCOB 4QJ3B 1W7JB 1QASA 2NZ0A 2PMYA 2JT3A 2ZFDA 3Q8IA 4HRHA 3PM2A 1AJ5A 4YI9A 2L5YA 1SCMC 1A29A 4AOMA 3EVRA 1CM1A 3O2PA 2OS8B 3BXKA 1SMGA 3V2LA 1JBAA 2H8VA 2M7NA 2MLFC 1NX0A 1XFYO 1KSOA 1XYDA 1F55A 1IQ3A 1BT6A 2M97A 4PHNA 1LINA 1UP5A 3BOWB 1DTLA 2MHHA 2V53A 3DF0B 3FIAA 4FQTA 2L4IA 3BOWA 3TS5B 4ETOA 3DF0A 3O4XA 4WRIA 1GQMA 3TUYC 3N7HA 2BE6A 4GFTA 2JWWA 1WLZA 1XFWO 1YUSA 2BE4A 3VRNA 2LUXA 1YX8A 1DJXA 1SL9A 2FOTA 1L2OB 1C7WA 2ZRTA 3OB2B 2KLDA 1KFUL 1GGWA 1TTXA 1NYAA 2I2RE 1PVAA 1Y0VH 3TZ1A 1BMOA 2QPTA 2K0JA 3AKBA 2QEOA 2BCBA 2FCDA 1K9UA 2LHLA 3DVMA 3IVTA 2JPTA 4OR9B 2KI4C 2BCAA 1KK7Y 1B1GA 4ZCVA 2KI6D 1WRZA 3C1VA 2QEHA 4P2YB 5ER4X 2NCPA 2LP3A 2ZRSA 2M1KB 2JT8A 4INXA 3BUWB 1UUSA 3SIBA 4MEWA 2F3YA 1C3YA 3TDZA 2MAZA 1ZACA 2PQLA 3FE8A 1KCYA 1J7PA 1IKUA 5HL1A 1OMDA 4MVFA 1CMGA 4KYNA 1TIZA 2K7DA 4OZDA 2JZIA 2OTGB 1AP4A 2JOJA 1J7RA 1EG3A 3BFHA 2OS8C 3I5HB 2KFGA 2H61A 1B47A 1K96A 1XK4A 5I2OA 2WCBA 3SS4A 5KTYA 4A4BA 1QJTA 2K8MB 1CLMA 2NXQA 3B88A 3L4LA 1TWOA 1JF0A 2KFFA 3I5GB 2AUCA 3OBVA 2PASA 2CCMA 3DYEA 3NGVA 1KFUS 2YGUA 5FI6A 5HKZA 2CBLA 1KQVA 1A4PA 1U5IA 2Y1MA 3WXAA 2MLEC 2GGZA 2KGBC 3SG5A 1V1GA 1EG4A 4GGFA 1X02A 3F45A 5B8IB 1YX7A 2M29A 1Q80A 2HQ8A 2L2EA 4JQ0D 4DS7A 4PALA 1CNPA 3OHMB 2QEBA 1RFJA 2WCLA 5KSZA 3EVVA 2KBIA 3PFVA 4MBEA 4N1FA 4I5JA 5CSFA 1OZSA 2LVVA 2LHIA 2EGDA 1J7QA 3BJHA 1SCVA 3FE6A 1ALVA 1MR8A 1OOJA 3EK4A 1HT9A 4ZCUA 3WNXB 2COLB 1B9AA 2WCJA 1R2UA 1A75A 1B8LA 1KQMB 1SCMB 2PALA 3K21A 3TDUA 1PVBA 2KI6C 5FI2A 1XFZO 2LVIA 3I5IB 5J3XA 1HQVA 3PSRA 4R1EA 3JTDB 1K2HA 1B7TZ 2FCEA 3KEVA 2H61C 2OTGC 2WC6A 1XK4C 2Y1NA 2F2PA 1EJ3A 3I5HC 1GM0A 2LNKA 1S1EA 3LL8B 1WLMA 2WCEA 2WCKA 2K7OA 5CPVA 2F33A 2KAYA 1K90D 1YRTB 2WORA 3RLZA 3TUYB 1WY9A 1QIWA 1KWOB 1QV1A 1RTP1 3DZTA 1PALA 4NDCA 1TNQA 3I5GC 1AK8A 1Y6WA 1QX5B 1DJGA 4M2QA 1QVIY 5D3OA 5DKRA 3TDIA 2BKHB 3FE9A 1CFFA 4AQIA 2WNDA 4GGFC 1CDMA 2LLUA 2F3ZA 1XFRA 2FJYA 2KYFA 4ORAB 1SPYA 1YVHA 2MJWB 1CDLA 2BKIB 2KI4B 3VROA 3D0YA 1J1DA 4GPLB 3S0EA 2M9GA 3BUOB 4CLNA 1QX7A 4M2PA 1SRAA 3IF7A 1RJVA 3BFBA 1OMRA 2LVKA 2TN4A 3PATA 1GGZA 1V1FA 1YTZC 1QV0A 1F4QA 2GGMA 2WC5A 5AERA 4USLA 2ZNEA 3CWGA 4XYNA 1F8HA 1CTRA 1UWOA 2L4HA 4IJ7A 1KQMC 2K7BA 1SYMA 2I18A 5GQQC 5G08A 3I5IC 4PT1A 3AAKA 3EVUA 3SJSA 3QMEA 5CSIA 3JTDC 1PULA 1QLSA 2JTTA 5ER5A 3S0GA 3FWCA 4CFRA 3BQ3A 4OV2A 4PHKA 5F6TA 2HQWA 2LMVA 3NHIA 1DGVA 1OOHA 1A2XA 1OW4A 1ZMZA 2KQYA 4DIRA 1XVJA 2EHBA 3IQOA 3KHEA 1F70A 4YI8A 1SR6B 1KWOC 4PE1A 1DMOA 3BYAA 1LKJA 2SASA 2LLTA 3A8RA 1JC2A 2K61A 1C07A 4I5NB 2KLEA 1K95A 1NX3A 1CB1A 1NX2A 1KK8C 1OSAA 2CT9A 1TNPA 3D78A 2G9BA 2QEVA 1FBVA 3RM1A 1JFKA 2L51A 3D76A 1BR1B 1MF8B 4WQ3A 3WHUB 1XFUO 4JKTA 2LUCA 2I94A 2Q4UA 1G33A 1LA0A 3LCPC 3CZ0A 1IIOA 3EK8A 4YRUA 1K94A 1FF1A 1BG1A 1YVLA 2M1UA 2IS9A 1MQ1A 4E68A 1JUOA 1S5GY 1ZOTB 4M2OA 1RWYA 1XFVO 4MN0A 3S0DA 1WDCB 2LP2A 1NCXA 1CKKA 5AXIA 4OCIA 1JWDA 1BF5A 3DVKA 3R1VA 3O78A 4NQGA 4DCKA 4D1EA 1Z4HA 2Y4QA 1IRJA 1UHJA 5BPJA 1JFJA 2G2BA 4JD9A 1Y1AA 3DY9A 1TUJA 1U5IB 4ORCB 3RZSA 1CFDA 2HF5A 2RGIA 2LVJA 3B87A 1CFCA 1DJYA 3DVJA 1OQPA 4PE0A 1SR6C 3UO9A 3BUNB 1DJIA 5TNCA 4A4CA 1IWQA 3EK7A 4CFQA 1D1OA 3CLNA 1YUTA 1B8CA 2HPSA 3DVEA 1BU3A 2QACA 1SY9A 1UURA 3R1OA 2DOQA 4MZLA 3SG4A 3BUXB 2M49B 1OOIX 3CTNA 4BY4A 1YUUA 4GAOA 1OMVA 3QRXA 2BECA 2LCPA 1KFXL 1NUBA 3OP0A 4P5OE
chains in the Genus database with same CATH topology
1CFPA 1QXPA 1NIWA 1H8BA 1IG5A 1F54A 2M7LA 3PM8A 4PHMA 1NX1A 4CIDA 1DVIA 1A75B 1K9PA 2BBNA 4Q04A 4YGAA 4YGBB 2O60A 1WRKA 2F2OA 2LM5A 4JWQA 3AKAA 5D7FA 3CR4X 3JVTC 1WDCC 1EL4A 1ZUZA 4MRXA 2L0PA 2JU0A 1UHKA 2JRFA 4IL1A 5I2QA 2E30A 2P6BB 3OX6A 2KSPA 1IJ6A 1R6PA 1B4CA 2LE9B 2ZN8A 1TN4A 5HYDA 2BCXA 1S6IA 1SNLA 4OKHA 4GGNA 1S26D 3EKJA 3BUMB 3NXAA 2JXCA 4OVNF 3LK0A 1KFXS 1CLBA 1KK8B 2LMTA 3NSKA 2KQ6A 4MLWA 3D0YB 2ISDA 5JJGA 2FJUB 1BOCA 2KBMA 5CSJA 1J7OA 1CLLA 3OX5A 3E3RA 2KYCA 1UHNA 1S36A 1SW8A 3SG6A 1G8IA 1DJHA 1Y1UA 1KK7Z 1FW4A 2JNFA 4HRGA 3VRPA 1FI5A 4MSPA 4PCWA 1N2DA 1ODBA 1QS7A 3EKHA 3WHTB 1ZFSA 1M31A 4TNCA 3I5FB 1B8RA 4FTGA 1L7ZA 4QJ4B 1J1EA 2JT0A 2LLSA 1LXFC 2M3WA 5AEQA 2KNEA 4FQOA 1VRKA 3CZTX 1YURA 2MA2A 3NSLA 3SG2A 1PRWA 1MHOA 2ZNDA 3ZWHA 2I7AA 5AFPA 5DKNA 1IH0A 1TNXA 1UHHA 4HSZA 1BLQA 4MZJA 2JTZA 1M46A 2CTNA 5DKQA 2KFHA 1IGVA 1M45A 1K9KA 4XJKB 1AUIB 1B7TY 2BBMA 1DF0B 4XJKA 1QATA 1BODA 3GK1A 4YGDB 1W7IB 1DF0A 1SL8A 4C0JA 2L98A 3HCMA 2KAVA 3CGAA 4AQJA 5K89A 3NSOA 4L9MA 4HREE 2AMIA 1NP8A 1BJFA 2OPOA 1EXRA 2KGRA 1SK6D 1XO5A 1DJWA 1KSMA 3KO0A 2L50A 1CDNA 1J55A 3O4YA 3FWBA 2B1UA 2KHNA 3I5FC 3CR2A 3IQQA 3JVTB 2KAXA 3VRQA 1C7VA 1M63B 4BY5A 4N1GA 1OZOA 3PALA 2H2KA 3VRRA 1QTXA 2BL0C 2SCPA 3KF9A 1TCFA 1RK9A 3GOFA 4QJ5B 1F4OA 1RROA 5HLVA 1IQ5A 3ZNIA 3SG7A 3D10A 5HKWA 1SKTA 2K7CA 1JSAA 3CS1A 2D8NA 3DD4A 2LC5A 4CPVA 4N5XA 1UHIA 1FPWA 1QVIZ 2CXJA 5KU1A 4ICBA 2MRDA 4YBHB 5IBWA 3PLFB 4DRWA 1MWNA 2L5XB 1AVSA 1M39A 1NPQA 2GV5A 2LV7A 2EC6B 3M0WA 2ZKMX 4NDDA 3AAJA 4WQ2A 3LK1A 2E6WA 1NCYA 2PSRA 1CM4A 1N65A 1BR4B 2AAOA 2LAPA 1TRFA 3TS5C 4YGEB 2JULA 5I2LA 2NLNA 1S3PA 1IJ5A 1E8AA 2WCFA 3MSEB 3KPXA 4JPZB 5FYXA 1DT7B 1L2OC 2CNPA 5CSNA 3HX4A 3PN7B 2M0RA 4MZKA 1DGUA 2LANA 1Y1XA 1QIVA 3VGOA 2JQ6A 2KDHA 1S6CA 4I5KA 1FI6A 1PSRA 5PALA 1WRLA 1PK0D 2NCOA 4C0LA 3A4UB 3CR5X 5HKYA 1H4BA 2JNXA 1DJZA 3OB1B 5JOLA 2M8UA 1NSHA 4ORBB 2Q91A 1RECA 1SBJA 3SG3A 1MXEA 4PHJA 2VRGA 2F8PA 1TNWA 2A4JA 3NSIA 2MBXA 1QX2A 1LVCD 4GUKA 3SIAA 2K2AA 3O6BA 2PVBA 2PRUA 1AHRA 5I8NA 1LA3A 1A03A 5HLOA 2JXLA 1K8UA 2EC6C 4U8DA 1JF2A 2Y5IA 3GK2A 1ALWA 3GK4X 1MUXA 4NDBA 1GJYA 4PE7A 1SL7A 1CDPA 1PSBA 1K93D 1N0YA 5AANA 2HETA 2WOSA 2ZN9A 4PDZA 1F71A 1S5GZ 4PE4A 3PN7C 1AJ4A 2WC8A 1NWDA 4I5LB 2BL0B 4MRYA 4DUQA 1YR5A 1MXLC 1EH2A 1TOPA 4GNKB 4GBAA 1CMFA 2R2IA 1YRUB 2LMUA 2O5GA 3H4SE 3ICBA 5D69A 1G4YR 4C0KA 4UPGA 3LLEA 2KOTA 4YGCB 2K2FA 1OE9B 2JC2A 1XFXO 3FS7A 1QLKA 1XA5A 1NCZA 1S6JA 1TCOB 4QJ3B 1W7JB 1QASA 2NZ0A 2PMYA 2JT3A 2ZFDA 4HRHA 1AJ5A 4YI9A 1SCMC 1A29A 4AOMA 3EVRA 1CM1A 3O2PA 2OS8B 3BXKA 1SMGA 1JBAA 2M7NA 2MLFC 1NX0A 1XFYO 1KSOA 1XYDA 1F55A 1IQ3A 1BT6A 2M97A 4PHNA 1LINA 1UP5A 3BOWB 1DTLA 2MHHA 2V53A 3DF0B 3FIAA 2L4IA 3BOWA 3TS5B 4ETOA 3DF0A 3TUYC 4WRIA 1GQMA 2BE6A 4GFTA 2JWWA 1WLZA 1XFWO 1YUSA 2BE4A 3VRNA 2LUXA 1YX8A 1DJXA 1SL9A 2FOTA 1L2OB 1C7WA 2ZRTA 3OB2B 1KFUL 1GGWA 1TTXA 1NYAA 2I2RE 1PVAA 1Y0VH 3TZ1A 1BMOA 2QPTA 2K0JA 3AKBA 4F0ZB 2BCBA 2FCDA 1K9UA 2LHLA 3DVMA 4OR9B 2JPTA 2KI4C 2BCAA 1KK7Y 1B1GA 4ZCVA 2KI6D 1WRZA 3C1VA 4P2YB 5ER4X 2NCPA 2LP3A 2ZRSA 2M1KB 2JT8A 3BUWB 1UUSA 3SIBA 4MEWA 2F3YA 3TDZA 2MAZA 1ZACA 1KCYA 1J7PA 1IKUA 1OMDA 4MVFA 1CMGA 1TIZA 2K7DA 2JZIA 2OTGB 1AP4A 2JOJA 1J7RA 1EG3A 3I5HB 2OS8C 2KFGA 2H61A 1B47A 1K96A 1XK4A 5I2OA 2WCBA 5KTYA 4A4BA 1QJTA 2K8MB 1CLMA 2NXQA 1JF0A 2KFFA 3I5GB 2AUCA 2PASA 2CCMA 5HKZA 1KFUS 1KQVA 2CBLA 1A4PA 1U5IA 2Y1MA 3WXAA 2MLEC 2GGZA 2KGBC 3SG5A 1V1GA 1EG4A 4GGFA 1X02A 3F45A 5B8IB 1YX7A 2M29A 1Q80A 2HQ8A 2L2EA 4JQ0D 4DS7A 4PALA 1CNPA 3OHMB 1RFJA 5KSZA 3EVVA 2KBIA 3PFVA 4MBEA 4N1FA 4I5JA 5CSFA 1OZSA 2LVVA 2LHIA 2EGDA 1J7QA 1SCVA 1ALVA 1MR8A 1OOJA 3EK4A 1HT9A 4ZCUA 3WNXB 2COLB 1B9AA 1R2UA 1A75A 1B8LA 1KQMB 1SCMB 2PALA 3K21A 3TDUA 1PVBA 2KI6C 1XFZO 2LVIA 3I5IB 5J3XA 1HQVA 3PSRA 4R1EA 3JTDB 1K2HA 1B7TZ 2FCEA 3KEVA 2H61C 2OTGC 1XK4C 2Y1NA 2F2PA 1EJ3A 3I5HC 2LNKA 1S1EA 3LL8B 1WLMA 2WCEA 2K7OA 5CPVA 2F33A 2KAYA 1K90D 1YRTB 2WORA 3RLZA 3TUYB 1WY9A 1QIWA 1KWOB 1QV1A 1RTP1 4NDCA 1PALA 1AK8A 1TNQA 3I5GC 1Y6WA 1QX5B 1DJGA 4M2QA 1QVIY 5DKRA 3TDIA 1CFFA 2BKHB 4AQIA 2WNDA 4GGFC 1CDMA 2LLUA 2F3ZA 2KYFA 4ORAB 1SPYA 1YVHA 2MJWB 1CDLA 2BKIB 2KI4B 3VROA 3D0YA 1J1DA 4GPLB 2M9GA 3BUOB 4CLNA 1QX7A 4M2PA 1SRAA 3IF7A 1RJVA 1OMRA 2LVKA 2TN4A 3PATA 1GGZA 1V1FA 1YTZC 1QV0A 1F4QA 2GGMA 5AERA 4USLA 2ZNEA 3CWGA 4XYNA 1F8HA 1CTRA 1UWOA 2L4HA 1KQMC 2K7BA 1SYMA 2I18A 5GQQC 5G08A 3I5IC 3AAKA 3EVUA 3SJSA 5CSIA 3JTDC 1PULA 1QLSA 2JTTA 5ER5A 4CFRA 3FWCA 3BQ3A 4OV2A 4PHKA 5F6TA 2HQWA 2LMVA 1DGVA 1A2XA 1ZMZA 2KQYA 4DIRA 1F70A 1XVJA 2EHBA 3IQOA 3KHEA 4YI8A 1SR6B 1KWOC 4PE1A 1DMOA 3BYAA 1LKJA 2SASA 2LLTA 3A8RA 1JC2A 2K61A 1C07A 4I5NB 1K95A 1NX3A 1CB1A 1NX2A 1KK8C 1OSAA 2CT9A 1TNPA 2G9BA 1FBVA 3RM1A 1JFKA 2L51A 1BR1B 1MF8B 4WQ3A 3WHUB 1XFUO 2LUCA 2I94A 2Q4UA 1G33A 1LA0A 3LCPC 3EK8A 4YRUA 1K94A 1FF1A 1BG1A 1YVLA 2M1UA 2IS9A 1MQ1A 4E68A 1JUOA 1S5GY 1ZOTB 4M2OA 1RWYA 1XFVO 4MN0A 1WDCB 2LP2A 1NCXA 1CKKA 5AXIA 4OCIA 1JWDA 1BF5A 3DVKA 3O78A 4NQGA 4DCKA 4D1EA 2Y4QA 1IRJA 1UHJA 5BPJA 1JFJA 2G2BA 1Y1AA 1U5IB 4ORCB 1CFDA 2HF5A 2RGIA 2LVJA 1CFCA 1DJYA 3DVJA 1OQPA 4PE0A 1SR6C 3BUNB 1DJIA 5TNCA 4A4CA 1IWQA 3EK7A 4CFQA 1D1OA 3CLNA 1YUTA 1B8CA 2HPSA 3DVEA 1BU3A 2QACA 1SY9A 1UURA 2DOQA 4MZLA 3SG4A 3BUXB 2M49B 3CTNA 4BY4A 1YUUA 4GAOA 1OMVA 3QRXA 2BECA 2LCPA 1KFXL 1NUBA 3OP0A 4P5OE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CFP A;  1QXP A;  1NIW A;  1H8B A;  1IG5 A;  1F54 A;  2M7L A;  3PM8 A;  4PHM A;  1NX1 A;  4CID A;  1DVI A;  1A75 B;  1K9P A;  2BBN A;  4Q04 A;  4YGA A;  4YGB B;  2O60 A;  1WRK A;  2F2O A;  2LM5 A;  4JWQ A;  3AKA A;  5D7F A;  3CR4 X;  3JVT C;  1WDC C;  1EL4 A;  1ZUZ A;  4MRX A;  2L0P A;  2JU0 A;  1UHK A;  2JRF A;  4IL1 A;  5I2Q A;  2E30 A;  2P6B B;  3OX6 A;  2KSP A;  1IJ6 A;  1R6P A;  1B4C A;  2LE9 B;  2ZN8 A;  1TN4 A;  5HYD A;  2BCX A;  1S6I A;  1SNL A;  4OKH A;  4GGN A;  1S26 D;  3EKJ A;  3BUM B;  3NXA A;  2JXC A;  4OVN F;  3LK0 A;  1KFX S;  1CLB A;  1KK8 B;  2LMT A;  3NSK A;  2KQ6 A;  4MLW A;  3D0Y B;  2ISD A;  5JJG A;  2FJU B;  1BOC A;  2KBM A;  5CSJ A;  1J7O A;  1CLL A;  3OX5 A;  3E3R A;  2KYC A;  1UHN A;  1S36 A;  1SW8 A;  3SG6 A;  1G8I A;  1DJH A;  1Y1U A;  1KK7 Z;  1FW4 A;  2JNF A;  4HRG A;  3VRP A;  1FI5 A;  4MSP A;  4PCW A;  1N2D A;  1ODB A;  1QS7 A;  3EKH A;  3WHT B;  1ZFS A;  1M31 A;  4TNC A;  3I5F B;  1B8R A;  4FTG A;  1L7Z A;  4QJ4 B;  1J1E A;  2JT0 A;  2LLS A;  1LXF C;  2M3W A;  5AEQ A;  2KNE A;  4FQO A;  1VRK A;  3CZT X;  1YUR A;  2MA2 A;  3NSL A;  3SG2 A;  1PRW A;  1MHO A;  2ZND A;  3ZWH A;  2I7A A;  5AFP A;  5DKN A;  1IH0 A;  1TNX A;  1UHH A;  4HSZ A;  1BLQ A;  4MZJ A;  2JTZ A;  1M46 A;  2CTN A;  5DKQ A;  2KFH A;  1IGV A;  1M45 A;  1K9K A;  4XJK B;  1AUI B;  1B7T Y;  2BBM A;  1DF0 B;  4XJK A;  1QAT A;  1BOD A;  3GK1 A;  4YGD B;  1W7I B;  1DF0 A;  1SL8 A;  4C0J A;  2L98 A;  3HCM A;  2KAV A;  3CGA A;  4AQJ A;  5K89 A;  3NSO A;  4L9M A;  4HRE E;  2AMI A;  1NP8 A;  1BJF A;  2OPO A;  1EXR A;  2KGR A;  1SK6 D;  1XO5 A;  1DJW A;  1KSM A;  3KO0 A;  2L50 A;  1CDN A;  1J55 A;  3O4Y A;  3FWB A;  2B1U A;  2KHN A;  3I5F C;  3CR2 A;  3IQQ A;  3JVT B;  2KAX A;  3VRQ A;  1C7V A;  1M63 B;  4BY5 A;  4N1G A;  1OZO A;  3PAL A;  2H2K A;  3VRR A;  1QTX A;  2BL0 C;  2SCP A;  3KF9 A;  1TCF A;  1RK9 A;  3GOF A;  4QJ5 B;  1F4O A;  1RRO A;  5HLV A;  1IQ5 A;  3ZNI A;  3SG7 A;  3D10 A;  5HKW A;  1SKT A;  2K7C A;  1JSA A;  3CS1 A;  2D8N A;  3DD4 A;  2LC5 A;  4CPV A;  4N5X A;  1UHI A;  1FPW A;  1QVI Z;  2CXJ A;  5KU1 A;  4ICB A;  2MRD A;  4YBH B;  5IBW A;  3PLF B;  4DRW A;  1MWN A;  2L5X B;  1AVS A;  1M39 A;  1NPQ A;  2GV5 A;  2LV7 A;  2EC6 B;  3M0W A;  2ZKM X;  4NDD A;  3AAJ A;  4WQ2 A;  3LK1 A;  2E6W A;  1NCY A;  2PSR A;  1CM4 A;  1N65 A;  1BR4 B;  2AAO A;  2LAP A;  1TRF A;  3TS5 C;  4YGE B;  2JUL A;  5I2L A;  2NLN A;  1S3P A;  1IJ5 A;  1E8A A;  2WCF A;  3MSE B;  3KPX A;  4JPZ B;  5FYX A;  1DT7 B;  1L2O C;  2CNP A;  5CSN A;  3HX4 A;  3PN7 B;  2M0R A;  4MZK A;  1DGU A;  2LAN A;  1Y1X A;  1QIV A;  3VGO A;  2JQ6 A;  2KDH A;  1S6C A;  4I5K A;  1FI6 A;  1PSR A;  5PAL A;  1WRL A;  1PK0 D;  2NCO A;  4C0L A;  3A4U B;  3CR5 X;  5HKY A;  1H4B A;  2JNX A;  1DJZ A;  3OB1 B;  5JOL A;  2M8U A;  1NSH A;  4ORB B;  2Q91 A;  1REC A;  1SBJ A;  3SG3 A;  1MXE A;  4PHJ A;  2VRG A;  2F8P A;  1TNW A;  2A4J A;  3NSI A;  2MBX A;  1QX2 A;  1LVC D;  4GUK A;  3SIA A;  2K2A A;  3O6B A;  2PVB A;  2PRU A;  1AHR A;  5I8N A;  1LA3 A;  1A03 A;  5HLO A;  2JXL A;  1K8U A;  2EC6 C;  4U8D A;  1JF2 A;  2Y5I A;  3GK2 A;  1ALW A;  3GK4 X;  1MUX A;  4NDB A;  1GJY A;  4PE7 A;  1SL7 A;  1CDP A;  1PSB A;  1K93 D;  1N0Y A;  5AAN A;  2HET A;  2WOS A;  2ZN9 A;  4PDZ A;  1F71 A;  1S5G Z;  4PE4 A;  3PN7 C;  1AJ4 A;  2WC8 A;  1NWD A;  4I5L B;  2BL0 B;  4MRY A;  4DUQ A;  1YR5 A;  1MXL C;  1EH2 A;  1TOP A;  4GNK B;  4GBA A;  1CMF A;  2R2I A;  1YRU B;  2LMU A;  2O5G A;  3H4S E;  3ICB A;  5D69 A;  1G4Y R;  4C0K A;  4UPG A;  3LLE A;  2KOT A;  4YGC B;  2K2F A;  1OE9 B;  2JC2 A;  1XFX O;  3FS7 A;  1QLK A;  1XA5 A;  1NCZ A;  1S6J A;  1TCO B;  4QJ3 B;  1W7J B;  1QAS A;  2NZ0 A;  2PMY A;  2JT3 A;  2ZFD A;  4HRH A;  1AJ5 A;  4YI9 A;  1SCM C;  1A29 A;  4AOM A;  3EVR A;  1CM1 A;  3O2P A;  2OS8 B;  3BXK A;  1SMG A;  1JBA A;  2M7N A;  2MLF C;  1NX0 A;  1XFY O;  1KSO A;  1XYD A;  1F55 A;  1IQ3 A;  1BT6 A;  2M97 A;  4PHN A;  1LIN A;  1UP5 A;  3BOW B;  1DTL A;  2MHH A;  2V53 A;  3DF0 B;  3FIA A;  2L4I A;  3BOW A;  3TS5 B;  4ETO A;  3DF0 A;  3TUY C;  4WRI A;  1GQM A;  2BE6 A;  4GFT A;  2JWW A;  1WLZ A;  1XFW O;  1YUS A;  2BE4 A;  3VRN A;  2LUX A;  1YX8 A;  1DJX A;  1SL9 A;  2FOT A;  1L2O B;  1C7W A;  2ZRT A;  3OB2 B;  1KFU L;  1GGW A;  1TTX A;  1NYA A;  2I2R E;  1PVA A;  1Y0V H;  3TZ1 A;  1BMO A;  2QPT A;  2K0J A;  3AKB A;  4F0Z B;  2BCB A;  2FCD A;  1K9U A;  2LHL A;  3DVM A;  4OR9 B;  2JPT A;  2KI4 C;  2BCA A;  1KK7 Y;  1B1G A;  4ZCV A;  2KI6 D;  1WRZ A;  3C1V A;  4P2Y B;  5ER4 X;  2NCP A;  2LP3 A;  2ZRS A;  2M1K B;  2JT8 A;  3BUW B;  1UUS A;  3SIB A;  4MEW A;  2F3Y A;  3TDZ A;  2MAZ A;  1ZAC A;  1KCY A;  1J7P A;  1IKU A;  1OMD A;  4MVF A;  1CMG A;  1TIZ A;  2K7D A;  2JZI A;  2OTG B;  1AP4 A;  2JOJ A;  1J7R A;  1EG3 A;  3I5H B;  2OS8 C;  2KFG A;  2H61 A;  1B47 A;  1K96 A;  1XK4 A;  5I2O A;  2WCB A;  5KTY A;  4A4B A;  1QJT A;  2K8M B;  1CLM A;  2NXQ A;  1JF0 A;  2KFF A;  3I5G B;  2AUC A;  2PAS A;  2CCM A;  5HKZ A;  1KFU S;  1KQV A;  2CBL A;  1A4P A;  1U5I A;  2Y1M A;  3WXA A;  2MLE C;  2GGZ A;  2KGB C;  3SG5 A;  1V1G A;  1EG4 A;  4GGF A;  1X02 A;  3F45 A;  5B8I B;  1YX7 A;  2M29 A;  1Q80 A;  2HQ8 A;  2L2E A;  4JQ0 D;  4DS7 A;  4PAL A;  1CNP A;  3OHM B;  1RFJ A;  5KSZ A;  3EVV A;  2KBI A;  3PFV A;  4MBE A;  4N1F A;  4I5J A;  5CSF A;  1OZS A;  2LVV A;  2LHI A;  2EGD A;  1J7Q A;  1SCV A;  1ALV A;  1MR8 A;  1OOJ A;  3EK4 A;  1HT9 A;  4ZCU A;  3WNX B;  2COL B;  1B9A A;  1R2U A;  1A75 A;  1B8L A;  1KQM B;  1SCM B;  2PAL A;  3K21 A;  3TDU A;  1PVB A;  2KI6 C;  1XFZ O;  2LVI A;  3I5I B;  5J3X A;  1HQV A;  3PSR A;  4R1E A;  3JTD B;  1K2H A;  1B7T Z;  2FCE A;  3KEV A;  2H61 C;  2OTG C;  1XK4 C;  2Y1N A;  2F2P A;  1EJ3 A;  3I5H C;  2LNK A;  1S1E A;  3LL8 B;  1WLM A;  2WCE A;  2K7O A;  5CPV A;  2F33 A;  2KAY A;  1K90 D;  1YRT B;  2WOR A;  3RLZ A;  3TUY B;  1WY9 A;  1QIW A;  1KWO B;  1QV1 A;  1RTP 1;  4NDC A;  1PAL A;  1AK8 A;  1TNQ A;  3I5G C;  1Y6W A;  1QX5 B;  1DJG A;  4M2Q A;  1QVI Y;  5DKR A;  3TDI A;  1CFF A;  2BKH B;  4AQI A;  2WND A;  4GGF C;  1CDM A;  2LLU A;  2F3Z A;  2KYF A;  4ORA B;  1SPY A;  1YVH A;  2MJW B;  1CDL A;  2BKI B;  2KI4 B;  3VRO A;  3D0Y A;  1J1D A;  4GPL B;  2M9G A;  3BUO B;  4CLN A;  1QX7 A;  4M2P A;  1SRA A;  3IF7 A;  1RJV A;  1OMR A;  2LVK A;  2TN4 A;  3PAT A;  1GGZ A;  1V1F A;  1YTZ C;  1QV0 A;  1F4Q A;  2GGM A;  5AER A;  4USL A;  2ZNE A;  3CWG A;  4XYN A;  1F8H A;  1CTR A;  1UWO A;  2L4H A;  1KQM C;  2K7B A;  1SYM A;  2I18 A;  5GQQ C;  5G08 A;  3I5I C;  3AAK A;  3EVU A;  3SJS A;  5CSI A;  3JTD C;  1PUL A;  1QLS A;  2JTT A;  5ER5 A;  4CFR A;  3FWC A;  3BQ3 A;  4OV2 A;  4PHK A;  5F6T A;  2HQW A;  2LMV A;  1DGV A;  1A2X A;  1ZMZ A;  2KQY A;  4DIR A;  1F70 A;  1XVJ A;  2EHB A;  3IQO A;  3KHE A;  4YI8 A;  1SR6 B;  1KWO C;  4PE1 A;  1DMO A;  3BYA A;  1LKJ A;  2SAS A;  2LLT A;  3A8R A;  1JC2 A;  2K61 A;  1C07 A;  4I5N B;  1K95 A;  1NX3 A;  1CB1 A;  1NX2 A;  1KK8 C;  1OSA A;  2CT9 A;  1TNP A;  2G9B A;  1FBV A;  3RM1 A;  1JFK A;  2L51 A;  1BR1 B;  1MF8 B;  4WQ3 A;  3WHU B;  1XFU O;  2LUC A;  2I94 A;  2Q4U A;  1G33 A;  1LA0 A;  3LCP C;  3EK8 A;  4YRU A;  1K94 A;  1FF1 A;  1BG1 A;  1YVL A;  2M1U A;  2IS9 A;  1MQ1 A;  4E68 A;  1JUO A;  1S5G Y;  1ZOT B;  4M2O A;  1RWY A;  1XFV O;  4MN0 A;  1WDC B;  2LP2 A;  1NCX A;  1CKK A;  5AXI A;  4OCI A;  1JWD A;  1BF5 A;  3DVK A;  3O78 A;  4NQG A;  4DCK A;  4D1E A;  2Y4Q A;  1IRJ A;  1UHJ A;  5BPJ A;  1JFJ A;  2G2B A;  1Y1A A;  1U5I B;  4ORC B;  1CFD A;  2HF5 A;  2RGI A;  2LVJ A;  1CFC A;  1DJY A;  3DVJ A;  1OQP A;  4PE0 A;  1SR6 C;  3BUN B;  1DJI A;  5TNC A;  4A4C A;  1IWQ A;  3EK7 A;  4CFQ A;  1D1O A;  3CLN A;  1YUT A;  1B8C A;  2HPS A;  3DVE A;  1BU3 A;  2QAC A;  1SY9 A;  1UUR A;  2DOQ A;  4MZL A;  3SG4 A;  3BUX B;  2M49 B;  3CTN A;  4BY4 A;  1YUU A;  4GAO A;  1OMV A;  3QRX A;  2BEC A;  2LCP A;  1KFX L;  1NUB A;  3OP0 A;  4P5O E; 
#chains in the Genus database with same CATH topology
 1CFP A;  1QXP A;  1NIW A;  3D75 A;  1H8B A;  1IG5 A;  1F54 A;  2M7L A;  3PM8 A;  4PHM A;  1LS8 A;  1NX1 A;  1DVI A;  4CID A;  1A75 B;  1K9P A;  2BBN A;  4Q04 A;  4YGA A;  4YGB B;  1C3Z A;  2O60 A;  1WRK A;  2F2O A;  1QWV A;  2GTE A;  2LM5 A;  4JWQ A;  3AKA A;  5D7F A;  3CR4 X;  3JVT C;  1WDC C;  1EL4 A;  1ZUZ A;  4MRX A;  2L0P A;  2JU0 A;  1UHK A;  2JRF A;  4IL1 A;  5I2Q A;  2E30 A;  2P6B B;  3OX6 A;  2KSP A;  1IJ6 A;  1R6P A;  1B4C A;  2LE9 B;  2ZN8 A;  3S0B A;  1TN4 A;  2JPO A;  5HYD A;  2P70 A;  2BCX A;  1S6I A;  1SNL A;  4OKH A;  4GGN A;  1S26 D;  3EKJ A;  1ORG A;  3BUM B;  3NXA A;  2JXC A;  4OVN F;  1OOG A;  3LK0 A;  1KFX S;  1CLB A;  1KK8 B;  2K60 A;  2LMT A;  2KQ6 A;  3B7A A;  3NSK A;  3R1P A;  4MLW A;  3D0Y B;  2ISD A;  5JJG A;  2FJU B;  1BOC A;  2KBM A;  5CSJ A;  1J7O A;  1CLL A;  3OX5 A;  3E3R A;  2KPH A;  2KYC A;  1UHN A;  1S36 A;  3PJI A;  1SW8 A;  3SG6 A;  1G8I A;  1DJH A;  1Y1U A;  1KK7 Z;  1FW4 A;  3CDN A;  2JNF A;  4HRG A;  3VRP A;  1FI5 A;  4MSP A;  4PCW A;  1N2D A;  1ODB A;  1QS7 A;  3DXL A;  3EKH A;  3WHT B;  1ZFS A;  1M31 A;  4TNC A;  3I5F B;  1B8R A;  4FTG A;  1L7Z A;  4QJ4 B;  3L4A A;  1J1E A;  2JT0 A;  2LLS A;  1LXF C;  2M3W A;  5AEQ A;  2KNE A;  4FQO A;  1VRK A;  3S0F A;  3CZT X;  1YUR A;  2MA2 A;  3NSL A;  5EL2 A;  1PRW A;  3SG2 A;  4F7F A;  3EG5 B;  1MHO A;  2ZND A;  3ZWH A;  2I7A A;  5AFP A;  5DKN A;  1IH0 A;  1TNX A;  1UHH A;  4HSZ A;  1BLQ A;  1DQE A;  4MZJ A;  2JTZ A;  3D74 A;  1M46 A;  2CTN A;  5DKQ A;  2KFH A;  1IGV A;  1M45 A;  1K9K A;  4XJK B;  1AUI B;  1B7T Y;  2BBM A;  1DF0 B;  1OOF A;  4XJK A;  1QAT A;  1BOD A;  3CZ2 A;  3GK1 A;  4YGD B;  1DEL A;  1DF0 A;  1W7I B;  1SL8 A;  4C0J A;  2L98 A;  3HCM A;  2KAV A;  3CGA A;  4AQJ A;  5K89 A;  3NSO A;  4L9M A;  4HRE E;  2AMI A;  1NP8 A;  1BJF A;  1P28 A;  2OPO A;  1EXR A;  2KGR A;  3OGN A;  1SK6 D;  1XO5 A;  1DC1 A;  1DJW A;  1KSM A;  3KO0 A;  2L50 A;  1CDN A;  5I94 A;  1J55 A;  3O4Y A;  3FWB A;  2B1U A;  2KHN A;  3SS5 A;  3I5F C;  3CR2 A;  3IQQ A;  3JVT B;  2KAX A;  3VRQ A;  1C7V A;  1M63 B;  4BY5 A;  2L2C A;  4N1G A;  1OZO A;  3PAL A;  2H2K A;  3VRR A;  1QTX A;  2BL0 C;  2SCP A;  3KF9 A;  1TCF A;  1DEK A;  1RK9 A;  3GOF A;  4QJ5 B;  1F4O A;  3VB1 A;  1RRO A;  5HLV A;  1IQ5 A;  3ZNI A;  3SG7 A;  3D10 A;  5HKW A;  1SKT A;  2K7C A;  1JSA A;  3CS1 A;  2D8N A;  3DD4 A;  2LC5 A;  4CPV A;  4N5X A;  1UHI A;  1FPW A;  4F0Z B;  1QVI Z;  2CXJ A;  5KU1 A;  4ICB A;  2MRD A;  4YBH B;  3D73 A;  5IBW A;  3PLF B;  4DRW A;  3K1E A;  1MWN A;  2L5X B;  1AVS A;  1M39 A;  1NPQ A;  2GV5 A;  2LV7 A;  2EC6 B;  3M0W A;  2ZKM X;  4NDD A;  3AAJ A;  4WQ2 A;  1TUZ A;  2E6W A;  3LK1 A;  1NCY A;  2PSR A;  1CM4 A;  1N65 A;  1BR4 B;  2AAO A;  2LAP A;  1TRF A;  3CYZ A;  3TS5 C;  4YGE B;  2JUL A;  5I2L A;  2NLN A;  1S3P A;  1IJ5 A;  1E8A A;  2WCF A;  3MSE B;  3KPX A;  4JPZ B;  1SSE B;  5FYX A;  1Z2C B;  1DT7 B;  1L2O C;  2CNP A;  5CSN A;  3HX4 A;  3PN7 B;  2M0R A;  1T14 A;  4MZK A;  1DGU A;  2LAN A;  1Y1X A;  1QIV A;  3VGO A;  2JQ6 A;  2KDH A;  3NHT A;  1S6C A;  2PYQ A;  4I5K A;  3L47 A;  1FI6 A;  1PSR A;  5PAL A;  1WRL A;  1PK0 D;  2NCO A;  4C0L A;  3A4U B;  3CR5 X;  5HKY A;  1H4B A;  2WCH A;  2JNX A;  1DJZ A;  3OB1 B;  5DIC A;  5JOL A;  2M8U A;  1NSH A;  4ORB B;  2Q91 A;  1REC A;  1SBJ A;  5FI7 A;  1MXE A;  3SG3 A;  4PHJ A;  2VRG A;  3D77 A;  2F8P A;  1TNW A;  2ERB A;  2A4J A;  2BNX A;  2P71 A;  3NSI A;  1QX2 A;  2MBX A;  1LVC D;  4GUK A;  3SIA A;  2K2A A;  3CZ1 A;  3O6B A;  2PVB A;  3S0A A;  2PRU A;  1AHR A;  5I8N A;  1LA3 A;  1A03 A;  5HLO A;  2JXL A;  1K8U A;  2EC6 C;  4U8D A;  1JF2 A;  2Y5I A;  2QDI A;  3GK2 A;  1ALW A;  4INW A;  2WCM A;  1MUX A;  3GK4 X;  4NDB A;  3B86 A;  1GJY A;  4PE7 A;  1SL7 A;  1CDP A;  1PSB A;  1K93 D;  1N0Y A;  2BAP A;  5AAN A;  2HET A;  2WOS A;  2ZN9 A;  4PDZ A;  3SS3 A;  1F71 A;  1S5G Z;  4PE4 A;  3PN7 C;  3B6X A;  1AJ4 A;  2WC8 A;  1NWD A;  3CAB A;  2BL0 B;  4I5L B;  4MRY A;  1YR5 A;  1MXL C;  4DUQ A;  1TOP A;  4GNK B;  1EH2 A;  4GBA A;  1CMF A;  2R2I A;  1YRU B;  2LMU A;  2O5G A;  3H4S E;  3ICB A;  5D69 A;  1G4Y R;  4C0K A;  4UPG A;  3LLE A;  3R72 A;  3BFA A;  2KOT A;  4YGC B;  2K2F A;  1OE9 B;  2JC2 A;  3UNW A;  1XFX O;  1W9Z A;  3FS7 A;  1QLK A;  1XA5 A;  1NCZ A;  1S6J A;  1TCO B;  4QJ3 B;  1W7J B;  1QAS A;  2NZ0 A;  2PMY A;  2JT3 A;  2ZFD A;  3Q8I A;  4HRH A;  3PM2 A;  1AJ5 A;  4YI9 A;  2L5Y A;  1SCM C;  1A29 A;  4AOM A;  3EVR A;  1CM1 A;  3O2P A;  2OS8 B;  3BXK A;  1SMG A;  3V2L A;  1JBA A;  2H8V A;  2M7N A;  2MLF C;  1NX0 A;  1XFY O;  1KSO A;  1XYD A;  1F55 A;  1IQ3 A;  1BT6 A;  2M97 A;  4PHN A;  1LIN A;  1UP5 A;  3BOW B;  1DTL A;  2MHH A;  2V53 A;  3DF0 B;  3FIA A;  4FQT A;  2L4I A;  3BOW A;  3TS5 B;  4ETO A;  3DF0 A;  3O4X A;  4WRI A;  1GQM A;  3TUY C;  3N7H A;  2BE6 A;  4GFT A;  2JWW A;  1WLZ A;  1XFW O;  1YUS A;  2BE4 A;  3VRN A;  2LUX A;  1YX8 A;  1DJX A;  1SL9 A;  2FOT A;  1L2O B;  1C7W A;  2ZRT A;  3OB2 B;  2KLD A;  1KFU L;  1GGW A;  1TTX A;  1NYA A;  2I2R E;  1PVA A;  1Y0V H;  3TZ1 A;  1BMO A;  2QPT A;  2K0J A;  3AKB A;  2QEO A;  2BCB A;  2FCD A;  1K9U A;  2LHL A;  3DVM A;  3IVT A;  2JPT A;  4OR9 B;  2KI4 C;  2BCA A;  1KK7 Y;  1B1G A;  4ZCV A;  2KI6 D;  1WRZ A;  3C1V A;  2QEH A;  4P2Y B;  5ER4 X;  2NCP A;  2LP3 A;  2ZRS A;  2M1K B;  2JT8 A;  4INX A;  3BUW B;  1UUS A;  3SIB A;  4MEW A;  2F3Y A;  1C3Y A;  3TDZ A;  2MAZ A;  1ZAC A;  2PQL A;  3FE8 A;  1KCY A;  1J7P A;  1IKU A;  5HL1 A;  1OMD A;  4MVF A;  1CMG A;  4KYN A;  1TIZ A;  2K7D A;  4OZD A;  2JZI A;  2OTG B;  1AP4 A;  2JOJ A;  1J7R A;  1EG3 A;  3BFH A;  2OS8 C;  3I5H B;  2KFG A;  2H61 A;  1B47 A;  1K96 A;  1XK4 A;  5I2O A;  2WCB A;  3SS4 A;  5KTY A;  4A4B A;  1QJT A;  2K8M B;  1CLM A;  2NXQ A;  3B88 A;  3L4L A;  1TWO A;  1JF0 A;  2KFF A;  3I5G B;  2AUC A;  3OBV A;  2PAS A;  2CCM A;  3DYE A;  3NGV A;  1KFU S;  2YGU A;  5FI6 A;  5HKZ A;  2CBL A;  1KQV A;  1A4P A;  1U5I A;  2Y1M A;  3WXA A;  2MLE C;  2GGZ A;  2KGB C;  3SG5 A;  1V1G A;  1EG4 A;  4GGF A;  1X02 A;  3F45 A;  5B8I B;  1YX7 A;  2M29 A;  1Q80 A;  2HQ8 A;  2L2E A;  4JQ0 D;  4DS7 A;  4PAL A;  1CNP A;  3OHM B;  2QEB A;  1RFJ A;  2WCL A;  5KSZ A;  3EVV A;  2KBI A;  3PFV A;  4MBE A;  4N1F A;  4I5J A;  5CSF A;  1OZS A;  2LVV A;  2LHI A;  2EGD A;  1J7Q A;  3BJH A;  1SCV A;  3FE6 A;  1ALV A;  1MR8 A;  1OOJ A;  3EK4 A;  1HT9 A;  4ZCU A;  3WNX B;  2COL B;  1B9A A;  2WCJ A;  1R2U A;  1A75 A;  1B8L A;  1KQM B;  1SCM B;  2PAL A;  3K21 A;  3TDU A;  1PVB A;  2KI6 C;  5FI2 A;  1XFZ O;  2LVI A;  3I5I B;  5J3X A;  1HQV A;  3PSR A;  4R1E A;  3JTD B;  1K2H A;  1B7T Z;  2FCE A;  3KEV A;  2H61 C;  2OTG C;  2WC6 A;  1XK4 C;  2Y1N A;  2F2P A;  1EJ3 A;  3I5H C;  1GM0 A;  2LNK A;  1S1E A;  3LL8 B;  1WLM A;  2WCE A;  2WCK A;  2K7O A;  5CPV A;  2F33 A;  2KAY A;  1K90 D;  1YRT B;  2WOR A;  3RLZ A;  3TUY B;  1WY9 A;  1QIW A;  1KWO B;  1QV1 A;  1RTP 1;  3DZT A;  1PAL A;  4NDC A;  1TNQ A;  3I5G C;  1AK8 A;  1Y6W A;  1QX5 B;  1DJG A;  4M2Q A;  1QVI Y;  5D3O A;  5DKR A;  3TDI A;  2BKH B;  3FE9 A;  1CFF A;  4AQI A;  2WND A;  4GGF C;  1CDM A;  2LLU A;  2F3Z A;  1XFR A;  2FJY A;  2KYF A;  4ORA B;  1SPY A;  1YVH A;  2MJW B;  1CDL A;  2BKI B;  2KI4 B;  3VRO A;  3D0Y A;  1J1D A;  4GPL B;  3S0E A;  2M9G A;  3BUO B;  4CLN A;  1QX7 A;  4M2P A;  1SRA A;  3IF7 A;  1RJV A;  3BFB A;  1OMR A;  2LVK A;  2TN4 A;  3PAT A;  1GGZ A;  1V1F A;  1YTZ C;  1QV0 A;  1F4Q A;  2GGM A;  2WC5 A;  5AER A;  4USL A;  2ZNE A;  3CWG A;  4XYN A;  1F8H A;  1CTR A;  1UWO A;  2L4H A;  4IJ7 A;  1KQM C;  2K7B A;  1SYM A;  2I18 A;  5GQQ C;  5G08 A;  3I5I C;  4PT1 A;  3AAK A;  3EVU A;  3SJS A;  3QME A;  5CSI A;  3JTD C;  1PUL A;  1QLS A;  2JTT A;  5ER5 A;  3S0G A;  3FWC A;  4CFR A;  3BQ3 A;  4OV2 A;  4PHK A;  5F6T A;  2HQW A;  2LMV A;  3NHI A;  1DGV A;  1OOH A;  1A2X A;  1OW4 A;  1ZMZ A;  2KQY A;  4DIR A;  1XVJ A;  2EHB A;  3IQO A;  3KHE A;  1F70 A;  4YI8 A;  1SR6 B;  1KWO C;  4PE1 A;  1DMO A;  3BYA A;  1LKJ A;  2SAS A;  2LLT A;  3A8R A;  1JC2 A;  2K61 A;  1C07 A;  4I5N B;  2KLE A;  1K95 A;  1NX3 A;  1CB1 A;  1NX2 A;  1KK8 C;  1OSA A;  2CT9 A;  1TNP A;  3D78 A;  2G9B A;  2QEV A;  1FBV A;  3RM1 A;  1JFK A;  2L51 A;  3D76 A;  1BR1 B;  1MF8 B;  4WQ3 A;  3WHU B;  1XFU O;  4JKT A;  2LUC A;  2I94 A;  2Q4U A;  1G33 A;  1LA0 A;  3LCP C;  3CZ0 A;  1IIO A;  3EK8 A;  4YRU A;  1K94 A;  1FF1 A;  1BG1 A;  1YVL A;  2M1U A;  2IS9 A;  1MQ1 A;  4E68 A;  1JUO A;  1S5G Y;  1ZOT B;  4M2O A;  1RWY A;  1XFV O;  4MN0 A;  3S0D A;  1WDC B;  2LP2 A;  1NCX A;  1CKK A;  5AXI A;  4OCI A;  1JWD A;  1BF5 A;  3DVK A;  3R1V A;  3O78 A;  4NQG A;  4DCK A;  4D1E A;  1Z4H A;  2Y4Q A;  1IRJ A;  1UHJ A;  5BPJ A;  1JFJ A;  2G2B A;  4JD9 A;  1Y1A A;  3DY9 A;  1TUJ A;  1U5I B;  4ORC B;  3RZS A;  1CFD A;  2HF5 A;  2RGI A;  2LVJ A;  3B87 A;  1CFC A;  1DJY A;  3DVJ A;  1OQP A;  4PE0 A;  1SR6 C;  3UO9 A;  3BUN B;  1DJI A;  5TNC A;  4A4C A;  1IWQ A;  3EK7 A;  4CFQ A;  1D1O A;  3CLN A;  1YUT A;  1B8C A;  2HPS A;  3DVE A;  1BU3 A;  2QAC A;  1SY9 A;  1UUR A;  3R1O A;  2DOQ A;  4MZL A;  3SG4 A;  3BUX B;  2M49 B;  1OOI X;  3CTN A;  4BY4 A;  1YUU A;  4GAO A;  1OMV A;  3QRX A;  2BEC A;  2LCP A;  1KFX L;  1NUB A;  3OP0 A;  4P5O E; 
#chains in the Genus database with same CATH homology
 1CFP A;  1QXP A;  1NIW A;  1H8B A;  1IG5 A;  1F54 A;  2M7L A;  3PM8 A;  4PHM A;  1NX1 A;  4CID A;  1DVI A;  1A75 B;  1K9P A;  2BBN A;  4Q04 A;  4YGA A;  4YGB B;  2O60 A;  1WRK A;  2F2O A;  2LM5 A;  4JWQ A;  3AKA A;  5D7F A;  3CR4 X;  3JVT C;  1WDC C;  1EL4 A;  1ZUZ A;  4MRX A;  2L0P A;  2JU0 A;  1UHK A;  2JRF A;  4IL1 A;  5I2Q A;  2E30 A;  2P6B B;  3OX6 A;  2KSP A;  1IJ6 A;  1R6P A;  1B4C A;  2LE9 B;  2ZN8 A;  1TN4 A;  5HYD A;  2BCX A;  1S6I A;  1SNL A;  4OKH A;  4GGN A;  1S26 D;  3EKJ A;  3BUM B;  3NXA A;  2JXC A;  4OVN F;  3LK0 A;  1KFX S;  1CLB A;  1KK8 B;  2LMT A;  3NSK A;  2KQ6 A;  4MLW A;  3D0Y B;  2ISD A;  5JJG A;  2FJU B;  1BOC A;  2KBM A;  5CSJ A;  1J7O A;  1CLL A;  3OX5 A;  3E3R A;  2KYC A;  1UHN A;  1S36 A;  1SW8 A;  3SG6 A;  1G8I A;  1DJH A;  1Y1U A;  1KK7 Z;  1FW4 A;  2JNF A;  4HRG A;  3VRP A;  1FI5 A;  4MSP A;  4PCW A;  1N2D A;  1ODB A;  1QS7 A;  3EKH A;  3WHT B;  1ZFS A;  1M31 A;  4TNC A;  3I5F B;  1B8R A;  4FTG A;  1L7Z A;  4QJ4 B;  1J1E A;  2JT0 A;  2LLS A;  1LXF C;  2M3W A;  5AEQ A;  2KNE A;  4FQO A;  1VRK A;  3CZT X;  1YUR A;  2MA2 A;  3NSL A;  3SG2 A;  1PRW A;  1MHO A;  2ZND A;  3ZWH A;  2I7A A;  5AFP A;  5DKN A;  1IH0 A;  1TNX A;  1UHH A;  4HSZ A;  1BLQ A;  4MZJ A;  2JTZ A;  1M46 A;  2CTN A;  5DKQ A;  2KFH A;  1IGV A;  1M45 A;  1K9K A;  4XJK B;  1AUI B;  1B7T Y;  2BBM A;  1DF0 B;  4XJK A;  1QAT A;  1BOD A;  3GK1 A;  4YGD B;  1W7I B;  1DF0 A;  1SL8 A;  4C0J A;  2L98 A;  3HCM A;  2KAV A;  3CGA A;  4AQJ A;  5K89 A;  3NSO A;  4L9M A;  4HRE E;  2AMI A;  1NP8 A;  1BJF A;  2OPO A;  1EXR A;  2KGR A;  1SK6 D;  1XO5 A;  1DJW A;  1KSM A;  3KO0 A;  2L50 A;  1CDN A;  1J55 A;  3O4Y A;  3FWB A;  2B1U A;  2KHN A;  3I5F C;  3CR2 A;  3IQQ A;  3JVT B;  2KAX A;  3VRQ A;  1C7V A;  1M63 B;  4BY5 A;  4N1G A;  1OZO A;  3PAL A;  2H2K A;  3VRR A;  1QTX A;  2BL0 C;  2SCP A;  3KF9 A;  1TCF A;  1RK9 A;  3GOF A;  4QJ5 B;  1F4O A;  1RRO A;  5HLV A;  1IQ5 A;  3ZNI A;  3SG7 A;  3D10 A;  5HKW A;  1SKT A;  2K7C A;  1JSA A;  3CS1 A;  2D8N A;  3DD4 A;  2LC5 A;  4CPV A;  4N5X A;  1UHI A;  1FPW A;  1QVI Z;  2CXJ A;  5KU1 A;  4ICB A;  2MRD A;  4YBH B;  5IBW A;  3PLF B;  4DRW A;  1MWN A;  2L5X B;  1AVS A;  1M39 A;  1NPQ A;  2GV5 A;  2LV7 A;  2EC6 B;  3M0W A;  2ZKM X;  4NDD A;  3AAJ A;  4WQ2 A;  3LK1 A;  2E6W A;  1NCY A;  2PSR A;  1CM4 A;  1N65 A;  1BR4 B;  2AAO A;  2LAP A;  1TRF A;  3TS5 C;  4YGE B;  2JUL A;  5I2L A;  2NLN A;  1S3P A;  1IJ5 A;  1E8A A;  2WCF A;  3MSE B;  3KPX A;  4JPZ B;  5FYX A;  1DT7 B;  1L2O C;  2CNP A;  5CSN A;  3HX4 A;  3PN7 B;  2M0R A;  4MZK A;  1DGU A;  2LAN A;  1Y1X A;  1QIV A;  3VGO A;  2JQ6 A;  2KDH A;  1S6C A;  4I5K A;  1FI6 A;  1PSR A;  5PAL A;  1WRL A;  1PK0 D;  2NCO A;  4C0L A;  3A4U B;  3CR5 X;  5HKY A;  1H4B A;  2JNX A;  1DJZ A;  3OB1 B;  5JOL A;  2M8U A;  1NSH A;  4ORB B;  2Q91 A;  1REC A;  1SBJ A;  3SG3 A;  1MXE A;  4PHJ A;  2VRG A;  2F8P A;  1TNW A;  2A4J A;  3NSI A;  2MBX A;  1QX2 A;  1LVC D;  4GUK A;  3SIA A;  2K2A A;  3O6B A;  2PVB A;  2PRU A;  1AHR A;  5I8N A;  1LA3 A;  1A03 A;  5HLO A;  2JXL A;  1K8U A;  2EC6 C;  4U8D A;  1JF2 A;  2Y5I A;  3GK2 A;  1ALW A;  3GK4 X;  1MUX A;  4NDB A;  1GJY A;  4PE7 A;  1SL7 A;  1CDP A;  1PSB A;  1K93 D;  1N0Y A;  5AAN A;  2HET A;  2WOS A;  2ZN9 A;  4PDZ A;  1F71 A;  1S5G Z;  4PE4 A;  3PN7 C;  1AJ4 A;  2WC8 A;  1NWD A;  4I5L B;  2BL0 B;  4MRY A;  4DUQ A;  1YR5 A;  1MXL C;  1EH2 A;  1TOP A;  4GNK B;  4GBA A;  1CMF A;  2R2I A;  1YRU B;  2LMU A;  2O5G A;  3H4S E;  3ICB A;  5D69 A;  1G4Y R;  4C0K A;  4UPG A;  3LLE A;  2KOT A;  4YGC B;  2K2F A;  1OE9 B;  2JC2 A;  1XFX O;  3FS7 A;  1QLK A;  1XA5 A;  1NCZ A;  1S6J A;  1TCO B;  4QJ3 B;  1W7J B;  1QAS A;  2NZ0 A;  2PMY A;  2JT3 A;  2ZFD A;  4HRH A;  1AJ5 A;  4YI9 A;  1SCM C;  1A29 A;  4AOM A;  3EVR A;  1CM1 A;  3O2P A;  2OS8 B;  3BXK A;  1SMG A;  1JBA A;  2M7N A;  2MLF C;  1NX0 A;  1XFY O;  1KSO A;  1XYD A;  1F55 A;  1IQ3 A;  1BT6 A;  2M97 A;  4PHN A;  1LIN A;  1UP5 A;  3BOW B;  1DTL A;  2MHH A;  2V53 A;  3DF0 B;  3FIA A;  2L4I A;  3BOW A;  3TS5 B;  4ETO A;  3DF0 A;  3TUY C;  4WRI A;  1GQM A;  2BE6 A;  4GFT A;  2JWW A;  1WLZ A;  1XFW O;  1YUS A;  2BE4 A;  3VRN A;  2LUX A;  1YX8 A;  1DJX A;  1SL9 A;  2FOT A;  1L2O B;  1C7W A;  2ZRT A;  3OB2 B;  1KFU L;  1GGW A;  1TTX A;  1NYA A;  2I2R E;  1PVA A;  1Y0V H;  3TZ1 A;  1BMO A;  2QPT A;  2K0J A;  3AKB A;  4F0Z B;  2BCB A;  2FCD A;  1K9U A;  2LHL A;  3DVM A;  4OR9 B;  2JPT A;  2KI4 C;  2BCA A;  1KK7 Y;  1B1G A;  4ZCV A;  2KI6 D;  1WRZ A;  3C1V A;  4P2Y B;  5ER4 X;  2NCP A;  2LP3 A;  2ZRS A;  2M1K B;  2JT8 A;  3BUW B;  1UUS A;  3SIB A;  4MEW A;  2F3Y A;  3TDZ A;  2MAZ A;  1ZAC A;  1KCY A;  1J7P A;  1IKU A;  1OMD A;  4MVF A;  1CMG A;  1TIZ A;  2K7D A;  2JZI A;  2OTG B;  1AP4 A;  2JOJ A;  1J7R A;  1EG3 A;  3I5H B;  2OS8 C;  2KFG A;  2H61 A;  1B47 A;  1K96 A;  1XK4 A;  5I2O A;  2WCB A;  5KTY A;  4A4B A;  1QJT A;  2K8M B;  1CLM A;  2NXQ A;  1JF0 A;  2KFF A;  3I5G B;  2AUC A;  2PAS A;  2CCM A;  5HKZ A;  1KFU S;  1KQV A;  2CBL A;  1A4P A;  1U5I A;  2Y1M A;  3WXA A;  2MLE C;  2GGZ A;  2KGB C;  3SG5 A;  1V1G A;  1EG4 A;  4GGF A;  1X02 A;  3F45 A;  5B8I B;  1YX7 A;  2M29 A;  1Q80 A;  2HQ8 A;  2L2E A;  4JQ0 D;  4DS7 A;  4PAL A;  1CNP A;  3OHM B;  1RFJ A;  5KSZ A;  3EVV A;  2KBI A;  3PFV A;  4MBE A;  4N1F A;  4I5J A;  5CSF A;  1OZS A;  2LVV A;  2LHI A;  2EGD A;  1J7Q A;  1SCV A;  1ALV A;  1MR8 A;  1OOJ A;  3EK4 A;  1HT9 A;  4ZCU A;  3WNX B;  2COL B;  1B9A A;  1R2U A;  1A75 A;  1B8L A;  1KQM B;  1SCM B;  2PAL A;  3K21 A;  3TDU A;  1PVB A;  2KI6 C;  1XFZ O;  2LVI A;  3I5I B;  5J3X A;  1HQV A;  3PSR A;  4R1E A;  3JTD B;  1K2H A;  1B7T Z;  2FCE A;  3KEV A;  2H61 C;  2OTG C;  1XK4 C;  2Y1N A;  2F2P A;  1EJ3 A;  3I5H C;  2LNK A;  1S1E A;  3LL8 B;  1WLM A;  2WCE A;  2K7O A;  5CPV A;  2F33 A;  2KAY A;  1K90 D;  1YRT B;  2WOR A;  3RLZ A;  3TUY B;  1WY9 A;  1QIW A;  1KWO B;  1QV1 A;  1RTP 1;  4NDC A;  1PAL A;  1AK8 A;  1TNQ A;  3I5G C;  1Y6W A;  1QX5 B;  1DJG A;  4M2Q A;  1QVI Y;  5DKR A;  3TDI A;  1CFF A;  2BKH B;  4AQI A;  2WND A;  4GGF C;  1CDM A;  2LLU A;  2F3Z A;  2KYF A;  4ORA B;  1SPY A;  1YVH A;  2MJW B;  1CDL A;  2BKI B;  2KI4 B;  3VRO A;  3D0Y A;  1J1D A;  4GPL B;  2M9G A;  3BUO B;  4CLN A;  1QX7 A;  4M2P A;  1SRA A;  3IF7 A;  1RJV A;  1OMR A;  2LVK A;  2TN4 A;  3PAT A;  1GGZ A;  1V1F A;  1YTZ C;  1QV0 A;  1F4Q A;  2GGM A;  5AER A;  4USL A;  2ZNE A;  3CWG A;  4XYN A;  1F8H A;  1CTR A;  1UWO A;  2L4H A;  1KQM C;  2K7B A;  1SYM A;  2I18 A;  5GQQ C;  5G08 A;  3I5I C;  3AAK A;  3EVU A;  3SJS A;  5CSI A;  3JTD C;  1PUL A;  1QLS A;  2JTT A;  5ER5 A;  4CFR A;  3FWC A;  3BQ3 A;  4OV2 A;  4PHK A;  5F6T A;  2HQW A;  2LMV A;  1DGV A;  1A2X A;  1ZMZ A;  2KQY A;  4DIR A;  1F70 A;  1XVJ A;  2EHB A;  3IQO A;  3KHE A;  4YI8 A;  1SR6 B;  1KWO C;  4PE1 A;  1DMO A;  3BYA A;  1LKJ A;  2SAS A;  2LLT A;  3A8R A;  1JC2 A;  2K61 A;  1C07 A;  4I5N B;  1K95 A;  1NX3 A;  1CB1 A;  1NX2 A;  1KK8 C;  1OSA A;  2CT9 A;  1TNP A;  2G9B A;  1FBV A;  3RM1 A;  1JFK A;  2L51 A;  1BR1 B;  1MF8 B;  4WQ3 A;  3WHU B;  1XFU O;  2LUC A;  2I94 A;  2Q4U A;  1G33 A;  1LA0 A;  3LCP C;  3EK8 A;  4YRU A;  1K94 A;  1FF1 A;  1BG1 A;  1YVL A;  2M1U A;  2IS9 A;  1MQ1 A;  4E68 A;  1JUO A;  1S5G Y;  1ZOT B;  4M2O A;  1RWY A;  1XFV O;  4MN0 A;  1WDC B;  2LP2 A;  1NCX A;  1CKK A;  5AXI A;  4OCI A;  1JWD A;  1BF5 A;  3DVK A;  3O78 A;  4NQG A;  4DCK A;  4D1E A;  2Y4Q A;  1IRJ A;  1UHJ A;  5BPJ A;  1JFJ A;  2G2B A;  1Y1A A;  1U5I B;  4ORC B;  1CFD A;  2HF5 A;  2RGI A;  2LVJ A;  1CFC A;  1DJY A;  3DVJ A;  1OQP A;  4PE0 A;  1SR6 C;  3BUN B;  1DJI A;  5TNC A;  4A4C A;  1IWQ A;  3EK7 A;  4CFQ A;  1D1O A;  3CLN A;  1YUT A;  1B8C A;  2HPS A;  3DVE A;  1BU3 A;  2QAC A;  1SY9 A;  1UUR A;  2DOQ A;  4MZL A;  3SG4 A;  3BUX B;  2M49 B;  3CTN A;  4BY4 A;  1YUU A;  4GAO A;  1OMV A;  3QRX A;  2BEC A;  2LCP A;  1KFX L;  1NUB A;  3OP0 A;  4P5O E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...