1AJ4A

Structure of calcium-saturated cardiac troponin c, nmr, 1 structure
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
160
structure length
160
Chain Sequence
ADIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRSMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of cardiac muscle troponin C unexpectedly reveals a closed regulatory domain.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Muscle protein
molecule keywords TROPONIN C
total genus 33
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 1997-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1aj4A00
3SG6A 2BE4A 4JPZB 1PK0D 1GJYA 3JVTB 4YGCB 4PALA 2KHNA 4PCWA 1EH2A 3O2PA 2LNKA 2GGZA 3NSIA 1TIZA 2KQ6A 1NSHA 2H61C 2M97A 4ZCUA 5JOLA 3PALA 1KCYA 4QJ3B 1IGVA 1V1FA 4MZLA 4YBHB 1A4PA 1DF0A 2WNDA 2MA2A 1FPWA 2V53A 2WORA 2B1UA 2KFGA 2K61A 1FBVA 2KI4B 3DVMA 5ER4X 1QX7A 3KHEA 2K7BA 1SNLA 1PSBA 5AEQA 4PE4A 1B8RA 1JC2A 2LM5A 4OVNF 1WRLA 1WDCC 5D7FA 1JBAA 1NX0A 1PULA 1RK9A 1RROA 1Y1XA 3QRXA 1CFDA 2M8UA 3CS1A 2KOTA 4CPVA 1IQ5A 4QJ5B 1N0YA 4GGFA 2LVVA 3VGOA 3CTNA 3VRNA 2LVKA 3BUNB 1SY9A 1BJFA 1YUUA 2MHHA 4GFTA 4ICBA 1K95A 4YGEB 1B4CA 2WOSA 1CM4A 1CFFA 1KFXL 2KI4C 5HKWA 3DVEA 1L7ZA 1SRAA 3SG7A 1SCMB 3OX5A 3KEVA 2CCMA 4ORCB 1KFXS 2M0RA 1S1EA 3PN7B 1AUIB 3H4SE 1C07A 1TRFA 1S36A 4CFRA 1KWOC 1QASA 1SL7A 1TNPA 3BQ3A 5HKZA 1SKTA 2KAVA 5AERA 1D1OA 2E6WA 1NX2A 2K2AA 1RECA 3PFVA 1NP8A 2L0PA 4ORAB 1B1GA 1CFCA 1BLQA 1SR6C 2CXJA 4YI8A 4HSZA 4MSPA 1XFYO 1YR5A 3C1VA 4HRHA 1DT7B 1DMOA 1U5IA 1SBJA 3GK4X 2RGIA 1YRUB 3ZNIA 2JPTA 3LK1A 2K7OA 1YRTB 2G2BA 2HF5A 2HETA 3ZWHA 1YUTA 5B8IB 5PALA 1AVSA 4F0ZB 2L5XB 4A4BA 1OMDA 1BT6A 1QV1A 1ALVA 2KBMA 2L98A 3VRPA 1WDCB 5F6TA 5I2OA 1YVLA 4JQ0D 4M2PA 2SASA 2LAPA 1PRWA 4NQGA 4TNCA 1XFZO 2KFHA 2KGBC 1SW8A 2NCPA 1UHJA 4GGFC 2ZNEA 2EC6C 1ZMZA 4XJKA 2LE9B 1LVCD 3SJSA 4WRIA 2JTZA 3GK1A 1ALWA 5HLOA 5KSZA 3BXKA 4CLNA 1FI6A 4HRGA 1SK6D 1NX3A 3OX6A 1AP4A 1J7RA 2KAXA 2L4IA 1OE9B 1NCYA 1NWDA 3A8RA 2L4HA 2JT3A 2M29A 4MN0A 4GAOA 2TN4A 1B9AA 1QLSA 3HCMA 3IF7A 1JSAA 2K0JA 3TUYC 1ODBA 4MZJA 3FWBA 5K89A 3DF0A 1XK4A 3D10A 1RWYA 1OSAA 2P6BB 1Y0VH 4ZCVA 1C7VA 2M1KB 1HT9A 3EKJA 4M2OA 1IQ3A 1N2DA 1SR6B 3MSEB 5CPVA 1YVHA 5CSNA 5AXIA 1CFPA 3EK7A 1BOCA 2CTNA 1K90D 1UWOA 1YUSA 2KAYA 3AKBA 1S6IA 4GPLB 4CIDA 1SL9A 1IWQA 2JWWA 5DKRA 2AUCA 3O6BA 5ER5A 1DGVA 3RM1A 1EG4A 1UHIA 1OZSA 1WLMA 1X02A 2D8NA 1KSMA 1CDPA 2R2IA 3LCPC 3TDIA 3BUOB 2E30A 3I5GC 1J7QA 3EK4A 1CMFA 4N1GA 5I8NA 1S3PA 1BMOA 1YX8A 3TS5B 1N65A 3JTDB 4PE0A 3DF0B 2M9GA 4PDZA 2BCAA 1AJ4A 2LHIA 2GV5A 2LP3A 4N5XA 1EXRA 1DGUA 1GQMA 3CR4X 1KK7Z 4OCIA 3EVVA 4BY4A 1XFXO 1ZOTB 4YGDB 2NXQA 2A4JA 2F33A 1LA0A 2BL0B 1LINA 4GNKB 2COLB 1M31A 1SCVA 1M39A 4I5KA 1XVJA 4PHNA 1GGWA 1FI5A 3LLEA 1XFUO 1R6PA 2AMIA 2ZN9A 3NSOA 2DOQA 4R1EA 2KI6C 1G8IA 2HPSA 1TNXA 1UHKA 2Y1NA 4YI9A 2VRGA 1SL8A 1PVAA 2JRFA 2JZIA 1QIWA 2F3YA 2MJWB 1IH0A 4I5JA 1UURA 1TN4A 1B7TY 1Y1UA 1Q80A 2I94A 1A29A 2Y5IA 2PRUA 1YTZC 3PLFB 3LL8B 1CNPA 1WRKA 1V1GA 1QJTA 2BCXA 4XYNA 1B8CA 2HQWA 2LLUA 4DUQA 4DCKA 1L2OC 2MAZA 3PATA 3BUMB 1MXLC 2KYCA 1J1EA 1TCFA 3EVRA 3SG4A 2KI6D 1CM1A 2CT9A 4Q04A 5CSIA 1BODA 4FTGA 2HQ8A 4OR9B 2JNXA 3TZ1A 2BKHB 1U5IB 3WNXB 2AAOA 3CWGA 3IQOA 1BG1A 4GUKA 5D69A 1DTLA 2PSRA 1R2UA 1NIWA 1XFVO 1UHHA 2BE6A 2JXCA 3I5HB 4A4CA 1H8BA 1CTRA 3WHTB 3BYAA 2BECA 1CB1A 1YX7A 4PHMA 2FOTA 1RFJA 2NLNA 1DJHA 2OPOA 4C0KA 2PVBA 3IQQA 5IBWA 1QLKA 2LCPA 2JT8A 2I2RE 3DD4A 1KK8B 1PSRA 1DJIA 3PSRA 2H61A 4JWQA 1KK7Y 1KQMB 1GGZA 1IG5A 1F70A 1JWDA 1NX1A 2EHBA 2LMTA 1BR4B 1XO5A 2KDHA 2K7DA 4I5NB 2WCBA 2JT0A 1K9UA 3JVTC 3FIAA 2BL0C 3CLNA 1W7IB 3PN7C 1M45A 2MBXA 4PE7A 4PHKA 2KSPA 1A03A 1QVIY 3SIBA 4NDBA 1QXPA 3RLZA 1F54A 1NUBA 1B7TZ 1ZACA 3CGAA 3OHMB 1S26D 3WXAA 2M1UA 3AAJA 5KU1A 1G4YR 1KK8C 3NXAA 4AOMA 3CZTX 5HKYA 1TNQA 1M63B 1JFKA 1JF2A 1QX2A 3OP0A 2OS8B 1XK4C 4YRUA 3CR2A 1EG3A 4CFQA 4UPGA 3I5IC 3A4UB 5BPJA 1BR1B 4MVFA 2MRDA 1KSOA 1ZUZA 1JF0A 4E68A 1QVIZ 2NZ0A 1NYAA 2L50A 1UHNA 2OTGC 4PE1A 1SMGA 3NSLA 1IJ5A 2FJUB 3SG3A 1NCZA 1KQVA 3EVUA 1S6CA 1IKUA 3I5GB 1KWOB 5TNCA 1CLMA 5J3XA 4YGAA 4D1EA 3DVKA 3JTDC 2BCBA 1VRKA 1M46A 1SPYA 2K7CA 3O4YA 2OS8C 4M2QA 3BUWB 1DJGA 1J7PA 1CLBA 3E3RA 1MHOA 2M3WA 3OB1B 1QS7A 1B8LA 1DJYA 2K8MB 3OB2B 1OQPA 3I5IB 5I2QA 2EGDA 2F3ZA 3O78A 2PALA 2LHLA 1LA3A 1SYMA 2JXLA 4I5LB 2LMVA 3TUYB 3SG2A 1UUSA 2NCOA 4PHJA 2KGRA 1G33A 1MF8B 1CDLA 2PMYA 4MLWA 4C0LA 4MRXA 1IJ6A 4IL1A 2JQ6A 1RJVA 3GOFA 2ISDA 2KFFA 2SCPA 1QV0A 1WY9A 2M7NA 1AJ5A 1CDMA 3BOWB 1LKJA 3AAKA 1TOPA 2WCEA 5HLVA 1MQ1A 4NDCA 1QIVA 1MUXA 4MZKA 1F55A 1W7JB 1CLLA 3D0YB 3F45A 3BOWA 1CMGA 1MR8A 1K96A 2H2KA 4AQJA 2KYFA 1DVIA 1SCMC 1HQVA 4AQIA 3FS7A 1F8HA 1AHRA 1A75A 4N1FA 1NCXA 3KF9A 5DKNA 4ORBB 1DF0B 3I5FB 1WRZA 3PM8A 1KQMC 1TCOB 1BF5A 3I5FC 1CKKA 1PVBA 2LV7A 4MRYA 3LK0A 4YGBB 1OMVA 2ZFDA 4DS7A 1NPQA 1XFWO 2BBMA 1DJZA 4BY5A 1S5GY 1A2XA 2Q91A 1OMRA 2WCFA 4USLA 2G9BA 2PASA 3KPXA 2MLEC 1TTXA 2ZRTA 4GBAA 4DIRA 2BKIB 2I7AA 3I5HC 4P5OE 1MXEA 1H4BA 2Y1MA 2ZKMX 1PALA 3VRRA 1FW4A 4U8DA 2OTGB 1F4QA 5GQQC 1K8UA 5I2LA 2M7LA 2QPTA 2WC8A 3KO0A 2FCDA 5CSFA 4DRWA 2LP2A 2ZNDA 1RTP1 2BBNA 3FWCA 1DJXA 4L9MA 2I18A 4OV2A 3WHUB 1BU3A 3TDUA 2LUXA 1UP5A 4GGNA 1QATA 3DVJA 2LLTA 2JOJA 2GGMA 1ZFSA 3AKAA 1E8AA 2JC2A 1EL4A 1S6JA 2F2PA 1K2HA 1YURA 4P2YB 1MWNA 5KTYA 2FCEA 3BUXB 3TDZA 2KQYA 1Y6WA 2F2OA 2L51A 2QACA 4HREE 1FF1A 4NDDA 1TNWA 3M0WA 3VROA 2JTTA 4C0JA 4XJKB 2LVIA 1A75B 3EK8A 5DKQA 5FYXA 1EJ3A 4ETOA 1J55A 2MLFC 3ICBA 1L2OB 2KBIA 3VRQA 4QJ4B 3GK2A 5G08A 1Y1AA 1C7WA 1XA5A 3D0YA 1CDNA 1K9PA 2LVJA 1IRJA 2O5GA 2JNFA 3SG5A 2M49B 5CSJA 2ZN8A 2LUCA 3CR5X 1J1DA 1XYDA 1K9KA 2CBLA 2O60A 5AFPA 1K93D 1OZOA 3HX4A 4WQ2A 1F71A 2LMUA 1QTXA 1AK8A 1QX5B 2IS9A 2LLSA 3EKHA 5AANA 3SIAA 4FQOA 1KFUS 2L2EA 1J7OA 2JULA 1B47A 1JUOA 2Y4QA 3NSKA 2CNPA 4WQ3A 1S5GZ 2K2FA 4MEWA 4OKHA 3TS5C 1KFUL 1JFJA 5HYDA 2Q4UA 2LC5A 2F8PA 2ZRSA 5JJGA 2JU0A 2LANA 2KNEA 4MBEA 1OOJA 1DJWA 3K21A 1K94A 1LXFC 1WLZA 1F4OA 2EC6B
chains in the Genus database with same CATH superfamily
4JKTA 3SG6A 2BE4A 4JPZB 1PK0D 1GJYA 1GM0A 3JVTB 4YGCB 4PALA 3CZ0A 2KHNA 4PCWA 1EH2A 5DICA 3O2PA 2LNKA 2GGZA 1DEKA 3NSIA 3S0FA 1TIZA 2KQ6A 1NSHA 2H61C 2M97A 2QEOA 4ZCUA 3B7AA 3OBVA 5JOLA 3PALA 1KCYA 1DQEA 4QJ3B 3N7HA 1IGVA 1V1FA 4MZLA 4YBHB 1A4PA 1DF0A 2WNDA 3QMEA 2MA2A 1FPWA 2V53A 2WORA 2B1UA 3D73A 2H8VA 2KFGA 2K61A 1FBVA 2KI4B 3DVMA 5ER4X 1QX7A 3KHEA 2K7BA 1SNLA 1PSBA 5AEQA 3R1OA 4PE4A 1B8RA 1JC2A 2LM5A 4OVNF 1WRLA 1WDCC 5D7FA 1JBAA 1NX0A 1PULA 1RK9A 1RROA 1Y1XA 3QRXA 1CFDA 2M8UA 3CS1A 2KOTA 3NHIA 4CPVA 1IQ5A 3FE8A 1N0YA 4QJ5B 4GGFA 2L2CA 2LVVA 3VGOA 3CTNA 3VRNA 2LVKA 3BUNB 1SY9A 1BJFA 1YUUA 2MHHA 4GFTA 4ICBA 1K95A 4YGEB 1B4CA 2PQLA 5I94A 2WOSA 1CM4A 1CFFA 1KFXL 2KI4C 5HKWA 3DVEA 1L7ZA 1SRAA 3SG7A 1SCMB 3OX5A 3KEVA 1BOCA 4INWA 2CCMA 4ORCB 1KFXS 2M0RA 1S1EA 3PN7B 1AUIB 3H4SE 1C07A 1TRFA 1S36A 4CFRA 1KWOC 1QASA 3S0DA 1SL7A 1TNPA 3BQ3A 5HKZA 1SKTA 2KAVA 5AERA 1D1OA 2E6WA 1NX2A 2K2AA 1RECA 3PFVA 1T14A 3CZ2A 1NP8A 2L0PA 1QWVA 2WCHA 4ORAB 1B1GA 1CFCA 1SSEB 1BLQA 1SR6C 2CXJA 4YI8A 4HSZA 4MSPA 1XFYO 1YR5A 3C1VA 4HRHA 1DT7B 1DMOA 1U5IA 1SBJA 3GK4X 2RGIA 1YRUB 3ZNIA 2K60A 2JPTA 3LK1A 2K7OA 1YRTB 2G2BA 2HF5A 2HETA 3ZWHA 1YUTA 5B8IB 5PALA 1AVSA 4F0ZB 2L5XB 4A4BA 1OMDA 1BT6A 1QV1A 1ALVA 2KBMA 2L98A 3VRPA 1WDCB 5F6TA 2GTEA 5I2OA 3BFHA 1YVLA 2FJYA 4JQ0D 4M2PA 2SASA 2LAPA 3RZSA 1PRWA 4NQGA 4TNCA 1XFZO 2KFHA 2KGBC 2QEVA 1SW8A 2NCPA 1UHJA 4GGFC 2ZNEA 2EC6C 1ZMZA 4XJKA 2LE9B 1LVCD 3SJSA 4WRIA 2JTZA 3GK1A 1ALWA 5HLOA 5KSZA 2BNXA 3BXKA 4CLNA 1FI6A 4HRGA 1SK6D 1NX3A 3OX6A 1AP4A 1IIOA 1J7RA 3UO9A 2KAXA 2L4IA 1OE9B 3DZTA 1NCYA 1NWDA 3A8RA 1C3ZA 2L4HA 2JT3A 2M29A 4JD9A 4GAOA 4MN0A 2TN4A 4IJ7A 1B9AA 1QLSA 3HCMA 3IF7A 2WCLA 1JSAA 2K0JA 3TUYC 1ODBA 4MZJA 3FWBA 5K89A 3DF0A 1XK4A 1DELA 1RWYA 3D10A 1OSAA 2P6BB 1Y0VH 4ZCVA 1C7VA 2M1KB 1HT9A 3EKJA 4M2OA 1IQ3A 1N2DA 3B6XA 1SR6B 3MSEB 5CPVA 1YVHA 5CSNA 3D77A 5AXIA 3EK7A 3PJIA 2CTNA 1CFPA 1K90D 1UWOA 1YUSA 2KAYA 3AKBA 1S6IA 2P71A 4GPLB 1SL9A 5FI7A 4CIDA 1IWQA 2JWWA 5DKRA 2AUCA 3O6BA 5ER5A 1DGVA 3RM1A 1EG4A 1UHIA 1OZSA 1WLMA 1X02A 2D8NA 1KSMA 1CDPA 2R2IA 3LCPC 3TDIA 3BUOB 2E30A 3I5GC 1J7QA 3EK4A 3L4LA 5FI2A 1CMFA 4N1GA 5I8NA 1S3PA 5HL1A 1BMOA 1YX8A 3TS5B 1N65A 3JTDB 4PE0A 3DF0B 2M9GA 4PDZA 2BCAA 1AJ4A 2LHIA 3NGVA 3Q8IA 1LS8A 2GV5A 2LP3A 4N5XA 1EXRA 3SS5A 1DGUA 1GQMA 3CR4X 1KK7Z 4OCIA 3EVVA 2YGUA 4BY4A 1XFXO 1ZOTB 3FE9A 2NXQA 4YGDB 2A4JA 2F33A 1LA0A 2BL0B 1LINA 4GNKB 2COLB 1M31A 1SCVA 1M39A 4I5KA 1TUZA 1XVJA 4PHNA 5EL2A 1GGWA 5D3OA 3BFBA 3LLEA 1FI5A 1XFUO 1R6PA 2AMIA 2ZN9A 3NSOA 2DOQA 4R1EA 2KI6C 1G8IA 2HPSA 1TNXA 1UHKA 2Y1NA 4YI9A 2VRGA 1SL8A 1OOGA 1PVAA 2JRFA 2JZIA 1QIWA 2F3YA 2MJWB 1IH0A 4I5JA 1UURA 1TN4A 1B7TY 3D78A 1Y1UA 1Q80A 2I94A 1A29A 2Y5IA 2PRUA 3IVTA 1YTZC 3PLFB 3LL8B 1CNPA 1WRKA 4F7FA 3UNWA 1V1GA 1QJTA 2BCXA 4PT1A 4XYNA 1B8CA 2HQWA 2LLUA 4DUQA 4DCKA 1L2OC 2MAZA 3PATA 3BUMB 1MXLC 2ERBA 2KYCA 1J1EA 2PYQA 1TCFA 3EVRA 3SG4A 2KI6D 2QEBA 1CM1A 3S0EA 2CT9A 4Q04A 5CSIA 1BODA 4FTGA 2HQ8A 4OR9B 2JNXA 2WCJA 2BKHB 1U5IB 3TZ1A 3WNXB 2AAOA 2KPHA 3CWGA 4KYNA 3IQOA 1BG1A 4GUKA 5D69A 3SS3A 1DTLA 2PSRA 3DXLA 1R2UA 1NIWA 3V2LA 1XFVO 1UHHA 2BE6A 1C3YA 2JXCA 3I5HB 1TUJA 4A4CA 1H8BA 1CTRA 3WHTB 3BYAA 2BECA 1CB1A 1YX7A 4PHMA 2FOTA 1RFJA 2NLNA 1DJHA 2OPOA 4C0KA 2PVBA 3IQQA 5IBWA 1QLKA 2LCPA 2KLDA 2JT8A 2I2RE 3L4AA 3DD4A 1KK8B 1PSRA 1DJIA 3PSRA 2H61A 4JWQA 1KK7Y 1KQMB 1GGZA 1IG5A 1F70A 1JWDA 1Z4HA 1NX1A 2EHBA 2LMTA 1BR4B 1XO5A 2KDHA 2KLEA 2K7DA 4I5NB 2WCBA 2JT0A 4OZDA 1K9UA 3JVTC 3FIAA 2BL0C 3CLNA 1W7IB 3PN7C 1M45A 5FI6A 4PE7A 4PHKA 2KSPA 2MBXA 1A03A 1QVIY 3SIBA 4NDBA 2QDIA 1QXPA 3RLZA 1F54A 3D74A 1NUBA 1B7TZ 1ZACA 3CGAA 3OHMB 1S26D 3WXAA 1Z2CB 2M1UA 3AAJA 3B87A 5KU1A 1G4YR 1KK8C 3O4XA 3NXAA 4AOMA 3CZTX 5HKYA 1TNQA 1M63B 2QEHA 1P28A 1JFKA 1JF2A 1QX2A 3OP0A 2WC6A 2OS8B 1XK4C 4YRUA 3CR2A 1EG3A 4CFQA 4UPGA 3I5IC 3A4UB 5BPJA 1BR1B 4MVFA 2MRDA 1KSOA 1ZUZA 1JF0A 4E68A 1QVIZ 2NZ0A 4FQTA 3CDNA 1NYAA 2L50A 1UHNA 2OTGC 4PE1A 1SMGA 3NSLA 1IJ5A 2FJUB 3SG3A 1NCZA 1KQVA 3EVUA 1S6CA 2WC5A 3I5GB 1KWOB 1IKUA 1OW4A 5TNCA 1CLMA 5J3XA 4YGAA 4D1EA 3FE6A 3DVKA 3OGNA 3JTDC 2BCBA 1VRKA 1M46A 1SPYA 2K7CA 3O4YA 2OS8C 4M2QA 3BUWB 1DJGA 1J7PA 1CLBA 3E3RA 1MHOA 2M3WA 3OB1B 2JPOA 1QS7A 1B8LA 1DJYA 2K8MB 3OB2B 1OQPA 3I5IB 5I2QA 2EGDA 2F3ZA 3O78A 2PALA 3SS4A 2LHLA 1LA3A 1SYMA 2JXLA 4I5LB 2LMVA 3TUYB 3D76A 1UUSA 2NCOA 4PHJA 2KGRA 3SG2A 1G33A 1MF8B 1CDLA 2PMYA 4MLWA 4C0LA 4MRXA 1IJ6A 4IL1A 2JQ6A 1RJVA 3GOFA 2ISDA 2KFFA 2SCPA 1QV0A 1WY9A 2M7NA 1AJ5A 1CDMA 3BOWB 1LKJA 3AAKA 2WCKA 1TOPA 2WCEA 5HLVA 1MQ1A 4NDCA 1QIVA 1MUXA 4MZKA 1F55A 1W7JB 1CLLA 1OOFA 3D0YB 3F45A 1OOHA 3BOWA 1CMGA 1MR8A 1K96A 1OOIX 2H2KA 4AQJA 2KYFA 1DVIA 1SCMC 1HQVA 4AQIA 3FS7A 1F8HA 1AHRA 1A75A 3PM2A 1NCXA 1W9ZA 4N1FA 3KF9A 5DKNA 4ORBB 1DF0B 2WCMA 1WRZA 3I5FB 1KQMC 3PM8A 1TCOB 3R72A 3B88A 1BF5A 3I5FC 1CKKA 1PVBA 2LV7A 4MRYA 3LK0A 4YGBB 1OMVA 2ZFDA 4DS7A 1NPQA 1XFWO 2BBMA 1DJZA 3NHTA 4BY5A 1S5GY 3EG5B 1A2XA 2Q91A 1OMRA 2BAPA 2WCFA 4USLA 2G9BA 2PASA 3KPXA 2MLEC 1TTXA 2ZRTA 4GBAA 4DIRA 2BKIB 2I7AA 3I5HC 4P5OE 1MXEA 1H4BA 2Y1MA 2ZKMX 1PALA 3VRRA 1FW4A 4U8DA 2OTGB 1F4QA 5GQQC 1K8UA 1ORGA 5I2LA 2QPTA 2M7LA 2WC8A 3KO0A 2FCDA 3D75A 5CSFA 2LP2A 2ZNDA 4DRWA 1RTP1 2BBNA 3FWCA 1DJXA 4L9MA 2I18A 4OV2A 3WHUB 1BU3A 3R1PA 3TDUA 2LUXA 1UP5A 4GGNA 1QATA 3DVJA 2LLTA 2JOJA 2GGMA 3B86A 1ZFSA 3AKAA 1E8AA 2JC2A 1EL4A 1S6JA 3L47A 3R1VA 2F2PA 1K2HA 1YURA 4P2YB 1MWNA 5KTYA 2FCEA 3BUXB 3TDZA 2KQYA 1Y6WA 2F2OA 2L51A 2QACA 4HREE 1FF1A 4NDDA 1TNWA 3M0WA 3VROA 2JTTA 4C0JA 4XJKB 2LVIA 1A75B 3EK8A 5DKQA 5FYXA 1EJ3A 4ETOA 1J55A 2MLFC 3ICBA 1L2OB 2KBIA 3BFAA 3VRQA 1XFRA 3DYEA 4QJ4B 1DC1A 3GK2A 5G08A 1Y1AA 1C7WA 3CZ1A 1XA5A 3D0YA 1CDNA 1K9PA 2LVJA 3VB1A 1IRJA 2O5GA 2JNFA 3SG5A 2M49B 5CSJA 2ZN8A 2LUCA 3CR5X 1J1DA 2L5YA 1XYDA 1K9KA 2CBLA 2O60A 5AFPA 1K93D 1OZOA 3HX4A 4WQ2A 1F71A 2LMUA 1QTXA 1AK8A 1QX5B 3CYZA 2IS9A 2LLSA 3EKHA 4INXA 5AANA 3SIAA 4FQOA 1KFUS 2L2EA 1J7OA 2JULA 3CABA 1B47A 3S0BA 1JUOA 2Y4QA 3NSKA 2CNPA 3BJHA 2P70A 4WQ3A 1S5GZ 2K2FA 4MEWA 4OKHA 3K1EA 3TS5C 1KFUL 1JFJA 5HYDA 2Q4UA 2LC5A 2F8PA 2ZRSA 5JJGA 1TWOA 3S0AA 2JU0A 2LANA 2KNEA 4MBEA 3DY9A 3S0GA 1OOJA 1DJWA 3K21A 1K94A 1LXFC 1WLZA 1F4OA 2EC6B
chains in the Genus database with same CATH topology
3SG6A 2BE4A 4JPZB 1PK0D 1GJYA 3JVTB 4YGCB 4PALA 2KHNA 4PCWA 1EH2A 3O2PA 2LNKA 2GGZA 3NSIA 1TIZA 2KQ6A 1NSHA 2H61C 2M97A 4ZCUA 5JOLA 3PALA 1KCYA 4QJ3B 1IGVA 1V1FA 4MZLA 4YBHB 1A4PA 1DF0A 2WNDA 2MA2A 1FPWA 2V53A 2WORA 2B1UA 2KFGA 2K61A 1FBVA 2KI4B 3DVMA 5ER4X 1QX7A 3KHEA 2K7BA 1SNLA 1PSBA 5AEQA 4PE4A 1B8RA 1JC2A 2LM5A 4OVNF 1WRLA 1WDCC 5D7FA 1JBAA 1NX0A 1PULA 1RK9A 1RROA 1Y1XA 3QRXA 1CFDA 2M8UA 3CS1A 2KOTA 4CPVA 1IQ5A 4QJ5B 1N0YA 4GGFA 2LVVA 3VGOA 3CTNA 3VRNA 2LVKA 3BUNB 1SY9A 1BJFA 1YUUA 2MHHA 4GFTA 4ICBA 1K95A 4YGEB 1B4CA 2WOSA 1CM4A 1CFFA 1KFXL 2KI4C 5HKWA 3DVEA 1L7ZA 1SRAA 3SG7A 1SCMB 3OX5A 3KEVA 2CCMA 4ORCB 1KFXS 2M0RA 1S1EA 3PN7B 1AUIB 3H4SE 1C07A 1TRFA 1S36A 4CFRA 1KWOC 1QASA 1SL7A 1TNPA 3BQ3A 5HKZA 1SKTA 2KAVA 5AERA 1D1OA 2E6WA 1NX2A 2K2AA 1RECA 3PFVA 1NP8A 2L0PA 4ORAB 1B1GA 1CFCA 1BLQA 1SR6C 2CXJA 4YI8A 4HSZA 4MSPA 1XFYO 1YR5A 3C1VA 4HRHA 1DT7B 1DMOA 1U5IA 1SBJA 3GK4X 2RGIA 1YRUB 3ZNIA 2JPTA 3LK1A 2K7OA 1YRTB 2G2BA 2HF5A 2HETA 3ZWHA 1YUTA 5B8IB 5PALA 1AVSA 4F0ZB 2L5XB 4A4BA 1OMDA 1BT6A 1QV1A 1ALVA 2KBMA 2L98A 3VRPA 1WDCB 5F6TA 5I2OA 1YVLA 4JQ0D 4M2PA 2SASA 2LAPA 1PRWA 4NQGA 4TNCA 1XFZO 2KFHA 2KGBC 1SW8A 2NCPA 1UHJA 4GGFC 2ZNEA 2EC6C 1ZMZA 4XJKA 2LE9B 1LVCD 3SJSA 4WRIA 2JTZA 3GK1A 1ALWA 5HLOA 5KSZA 3BXKA 4CLNA 1FI6A 4HRGA 1SK6D 1NX3A 3OX6A 1AP4A 1J7RA 2KAXA 2L4IA 1OE9B 1NCYA 1NWDA 3A8RA 2L4HA 2JT3A 2M29A 4MN0A 4GAOA 2TN4A 1B9AA 1QLSA 3HCMA 3IF7A 1JSAA 2K0JA 3TUYC 1ODBA 4MZJA 3FWBA 5K89A 3DF0A 1XK4A 3D10A 1RWYA 1OSAA 2P6BB 1Y0VH 4ZCVA 1C7VA 2M1KB 1HT9A 3EKJA 4M2OA 1IQ3A 1N2DA 1SR6B 3MSEB 5CPVA 1YVHA 5CSNA 5AXIA 1CFPA 3EK7A 1BOCA 2CTNA 1K90D 1UWOA 1YUSA 2KAYA 3AKBA 1S6IA 4GPLB 4CIDA 1SL9A 1IWQA 2JWWA 5DKRA 2AUCA 3O6BA 5ER5A 1DGVA 3RM1A 1EG4A 1UHIA 1OZSA 1WLMA 1X02A 2D8NA 1KSMA 1CDPA 2R2IA 3LCPC 3TDIA 3BUOB 2E30A 3I5GC 1J7QA 3EK4A 1CMFA 4N1GA 5I8NA 1S3PA 1BMOA 1YX8A 3TS5B 1N65A 3JTDB 4PE0A 3DF0B 2M9GA 4PDZA 2BCAA 1AJ4A 2LHIA 2GV5A 2LP3A 4N5XA 1EXRA 1DGUA 1GQMA 3CR4X 1KK7Z 4OCIA 3EVVA 4BY4A 1XFXO 1ZOTB 4YGDB 2NXQA 2A4JA 2F33A 1LA0A 2BL0B 1LINA 4GNKB 2COLB 1M31A 1SCVA 1M39A 4I5KA 1XVJA 4PHNA 1GGWA 1FI5A 3LLEA 1XFUO 1R6PA 2AMIA 2ZN9A 3NSOA 2DOQA 4R1EA 2KI6C 1G8IA 2HPSA 1TNXA 1UHKA 2Y1NA 4YI9A 2VRGA 1SL8A 1PVAA 2JRFA 2JZIA 1QIWA 2F3YA 2MJWB 1IH0A 4I5JA 1UURA 1TN4A 1B7TY 1Y1UA 1Q80A 2I94A 1A29A 2Y5IA 2PRUA 1YTZC 3PLFB 3LL8B 1CNPA 1WRKA 1V1GA 1QJTA 2BCXA 4XYNA 1B8CA 2HQWA 2LLUA 4DUQA 4DCKA 1L2OC 2MAZA 3PATA 3BUMB 1MXLC 2KYCA 1J1EA 1TCFA 3EVRA 3SG4A 2KI6D 1CM1A 2CT9A 4Q04A 5CSIA 1BODA 4FTGA 2HQ8A 4OR9B 2JNXA 3TZ1A 2BKHB 1U5IB 3WNXB 2AAOA 3CWGA 3IQOA 1BG1A 4GUKA 5D69A 1DTLA 2PSRA 1R2UA 1NIWA 1XFVO 1UHHA 2BE6A 2JXCA 3I5HB 4A4CA 1H8BA 1CTRA 3WHTB 3BYAA 2BECA 1CB1A 1YX7A 4PHMA 2FOTA 1RFJA 2NLNA 1DJHA 2OPOA 4C0KA 2PVBA 3IQQA 5IBWA 1QLKA 2LCPA 2JT8A 2I2RE 3DD4A 1KK8B 1PSRA 1DJIA 3PSRA 2H61A 4JWQA 1KK7Y 1KQMB 1GGZA 1IG5A 1F70A 1JWDA 1NX1A 2EHBA 2LMTA 1BR4B 1XO5A 2KDHA 2K7DA 4I5NB 2WCBA 2JT0A 1K9UA 3JVTC 3FIAA 2BL0C 3CLNA 1W7IB 3PN7C 1M45A 2MBXA 4PE7A 4PHKA 2KSPA 1A03A 1QVIY 3SIBA 4NDBA 1QXPA 3RLZA 1F54A 1NUBA 1B7TZ 1ZACA 3CGAA 3OHMB 1S26D 3WXAA 2M1UA 3AAJA 5KU1A 1G4YR 1KK8C 3NXAA 4AOMA 3CZTX 5HKYA 1TNQA 1M63B 1JFKA 1JF2A 1QX2A 3OP0A 2OS8B 1XK4C 4YRUA 3CR2A 1EG3A 4CFQA 4UPGA 3I5IC 3A4UB 5BPJA 1BR1B 4MVFA 2MRDA 1KSOA 1ZUZA 1JF0A 4E68A 1QVIZ 2NZ0A 1NYAA 2L50A 1UHNA 2OTGC 4PE1A 1SMGA 3NSLA 1IJ5A 2FJUB 3SG3A 1NCZA 1KQVA 3EVUA 1S6CA 1IKUA 3I5GB 1KWOB 5TNCA 1CLMA 5J3XA 4YGAA 4D1EA 3DVKA 3JTDC 2BCBA 1VRKA 1M46A 1SPYA 2K7CA 3O4YA 2OS8C 4M2QA 3BUWB 1DJGA 1J7PA 1CLBA 3E3RA 1MHOA 2M3WA 3OB1B 1QS7A 1B8LA 1DJYA 2K8MB 3OB2B 1OQPA 3I5IB 5I2QA 2EGDA 2F3ZA 3O78A 2PALA 2LHLA 1LA3A 1SYMA 2JXLA 4I5LB 2LMVA 3TUYB 3SG2A 1UUSA 2NCOA 4PHJA 2KGRA 1G33A 1MF8B 1CDLA 2PMYA 4MLWA 4C0LA 4MRXA 1IJ6A 4IL1A 2JQ6A 1RJVA 3GOFA 2ISDA 2KFFA 2SCPA 1QV0A 1WY9A 2M7NA 1AJ5A 1CDMA 3BOWB 1LKJA 3AAKA 1TOPA 2WCEA 5HLVA 1MQ1A 4NDCA 1QIVA 1MUXA 4MZKA 1F55A 1W7JB 1CLLA 3D0YB 3F45A 3BOWA 1CMGA 1MR8A 1K96A 2H2KA 4AQJA 2KYFA 1DVIA 1SCMC 1HQVA 4AQIA 3FS7A 1F8HA 1AHRA 1A75A 4N1FA 1NCXA 3KF9A 5DKNA 4ORBB 1DF0B 3I5FB 1WRZA 3PM8A 1KQMC 1TCOB 1BF5A 3I5FC 1CKKA 1PVBA 2LV7A 4MRYA 3LK0A 4YGBB 1OMVA 2ZFDA 4DS7A 1NPQA 1XFWO 2BBMA 1DJZA 4BY5A 1S5GY 1A2XA 2Q91A 1OMRA 2WCFA 4USLA 2G9BA 2PASA 3KPXA 2MLEC 1TTXA 2ZRTA 4GBAA 4DIRA 2BKIB 2I7AA 3I5HC 4P5OE 1MXEA 1H4BA 2Y1MA 2ZKMX 1PALA 3VRRA 1FW4A 4U8DA 2OTGB 1F4QA 5GQQC 1K8UA 5I2LA 2M7LA 2QPTA 2WC8A 3KO0A 2FCDA 5CSFA 4DRWA 2LP2A 2ZNDA 1RTP1 2BBNA 3FWCA 1DJXA 4L9MA 2I18A 4OV2A 3WHUB 1BU3A 3TDUA 2LUXA 1UP5A 4GGNA 1QATA 3DVJA 2LLTA 2JOJA 2GGMA 1ZFSA 3AKAA 1E8AA 2JC2A 1EL4A 1S6JA 2F2PA 1K2HA 1YURA 4P2YB 1MWNA 5KTYA 2FCEA 3BUXB 3TDZA 2KQYA 1Y6WA 2F2OA 2L51A 2QACA 4HREE 1FF1A 4NDDA 1TNWA 3M0WA 3VROA 2JTTA 4C0JA 4XJKB 2LVIA 1A75B 3EK8A 5DKQA 5FYXA 1EJ3A 4ETOA 1J55A 2MLFC 3ICBA 1L2OB 2KBIA 3VRQA 4QJ4B 3GK2A 5G08A 1Y1AA 1C7WA 1XA5A 3D0YA 1CDNA 1K9PA 2LVJA 1IRJA 2O5GA 2JNFA 3SG5A 2M49B 5CSJA 2ZN8A 2LUCA 3CR5X 1J1DA 1XYDA 1K9KA 2CBLA 2O60A 5AFPA 1K93D 1OZOA 3HX4A 4WQ2A 1F71A 2LMUA 1QTXA 1AK8A 1QX5B 2IS9A 2LLSA 3EKHA 5AANA 3SIAA 4FQOA 1KFUS 2L2EA 1J7OA 2JULA 1B47A 1JUOA 2Y4QA 3NSKA 2CNPA 4WQ3A 1S5GZ 2K2FA 4MEWA 4OKHA 3TS5C 1KFUL 1JFJA 5HYDA 2Q4UA 2LC5A 2F8PA 2ZRSA 5JJGA 2JU0A 2LANA 2KNEA 4MBEA 1OOJA 1DJWA 3K21A 1K94A 1LXFC 1WLZA 1F4OA 2EC6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SG6 A;  2BE4 A;  4JPZ B;  1PK0 D;  1GJY A;  3JVT B;  4YGC B;  4PAL A;  2KHN A;  4PCW A;  1EH2 A;  3O2P A;  2LNK A;  2GGZ A;  3NSI A;  1TIZ A;  2KQ6 A;  1NSH A;  2H61 C;  2M97 A;  4ZCU A;  5JOL A;  3PAL A;  1KCY A;  4QJ3 B;  1IGV A;  1V1F A;  4MZL A;  4YBH B;  1A4P A;  1DF0 A;  2WND A;  2MA2 A;  1FPW A;  2V53 A;  2WOR A;  2B1U A;  2KFG A;  2K61 A;  1FBV A;  2KI4 B;  3DVM A;  5ER4 X;  1QX7 A;  3KHE A;  2K7B A;  1SNL A;  1PSB A;  5AEQ A;  4PE4 A;  1B8R A;  1JC2 A;  2LM5 A;  4OVN F;  1WRL A;  1WDC C;  5D7F A;  1JBA A;  1NX0 A;  1PUL A;  1RK9 A;  1RRO A;  1Y1X A;  3QRX A;  1CFD A;  2M8U A;  3CS1 A;  2KOT A;  4CPV A;  1IQ5 A;  4QJ5 B;  1N0Y A;  4GGF A;  2LVV A;  3VGO A;  3CTN A;  3VRN A;  2LVK A;  3BUN B;  1SY9 A;  1BJF A;  1YUU A;  2MHH A;  4GFT A;  4ICB A;  1K95 A;  4YGE B;  1B4C A;  2WOS A;  1CM4 A;  1CFF A;  1KFX L;  2KI4 C;  5HKW A;  3DVE A;  1L7Z A;  1SRA A;  3SG7 A;  1SCM B;  3OX5 A;  3KEV A;  2CCM A;  4ORC B;  1KFX S;  2M0R A;  1S1E A;  3PN7 B;  1AUI B;  3H4S E;  1C07 A;  1TRF A;  1S36 A;  4CFR A;  1KWO C;  1QAS A;  1SL7 A;  1TNP A;  3BQ3 A;  5HKZ A;  1SKT A;  2KAV A;  5AER A;  1D1O A;  2E6W A;  1NX2 A;  2K2A A;  1REC A;  3PFV A;  1NP8 A;  2L0P A;  4ORA B;  1B1G A;  1CFC A;  1BLQ A;  1SR6 C;  2CXJ A;  4YI8 A;  4HSZ A;  4MSP A;  1XFY O;  1YR5 A;  3C1V A;  4HRH A;  1DT7 B;  1DMO A;  1U5I A;  1SBJ A;  3GK4 X;  2RGI A;  1YRU B;  3ZNI A;  2JPT A;  3LK1 A;  2K7O A;  1YRT B;  2G2B A;  2HF5 A;  2HET A;  3ZWH A;  1YUT A;  5B8I B;  5PAL A;  1AVS A;  4F0Z B;  2L5X B;  4A4B A;  1OMD A;  1BT6 A;  1QV1 A;  1ALV A;  2KBM A;  2L98 A;  3VRP A;  1WDC B;  5F6T A;  5I2O A;  1YVL A;  4JQ0 D;  4M2P A;  2SAS A;  2LAP A;  1PRW A;  4NQG A;  4TNC A;  1XFZ O;  2KFH A;  2KGB C;  1SW8 A;  2NCP A;  1UHJ A;  4GGF C;  2ZNE A;  2EC6 C;  1ZMZ A;  4XJK A;  2LE9 B;  1LVC D;  3SJS A;  4WRI A;  2JTZ A;  3GK1 A;  1ALW A;  5HLO A;  5KSZ A;  3BXK A;  4CLN A;  1FI6 A;  4HRG A;  1SK6 D;  1NX3 A;  3OX6 A;  1AP4 A;  1J7R A;  2KAX A;  2L4I A;  1OE9 B;  1NCY A;  1NWD A;  3A8R A;  2L4H A;  2JT3 A;  2M29 A;  4MN0 A;  4GAO A;  2TN4 A;  1B9A A;  1QLS A;  3HCM A;  3IF7 A;  1JSA A;  2K0J A;  3TUY C;  1ODB A;  4MZJ A;  3FWB A;  5K89 A;  3DF0 A;  1XK4 A;  3D10 A;  1RWY A;  1OSA A;  2P6B B;  1Y0V H;  4ZCV A;  1C7V A;  2M1K B;  1HT9 A;  3EKJ A;  4M2O A;  1IQ3 A;  1N2D A;  1SR6 B;  3MSE B;  5CPV A;  1YVH A;  5CSN A;  5AXI A;  1CFP A;  3EK7 A;  1BOC A;  2CTN A;  1K90 D;  1UWO A;  1YUS A;  2KAY A;  3AKB A;  1S6I A;  4GPL B;  4CID A;  1SL9 A;  1IWQ A;  2JWW A;  5DKR A;  2AUC A;  3O6B A;  5ER5 A;  1DGV A;  3RM1 A;  1EG4 A;  1UHI A;  1OZS A;  1WLM A;  1X02 A;  2D8N A;  1KSM A;  1CDP A;  2R2I A;  3LCP C;  3TDI A;  3BUO B;  2E30 A;  3I5G C;  1J7Q A;  3EK4 A;  1CMF A;  4N1G A;  5I8N A;  1S3P A;  1BMO A;  1YX8 A;  3TS5 B;  1N65 A;  3JTD B;  4PE0 A;  3DF0 B;  2M9G A;  4PDZ A;  2BCA A;  1AJ4 A;  2LHI A;  2GV5 A;  2LP3 A;  4N5X A;  1EXR A;  1DGU A;  1GQM A;  3CR4 X;  1KK7 Z;  4OCI A;  3EVV A;  4BY4 A;  1XFX O;  1ZOT B;  4YGD B;  2NXQ A;  2A4J A;  2F33 A;  1LA0 A;  2BL0 B;  1LIN A;  4GNK B;  2COL B;  1M31 A;  1SCV A;  1M39 A;  4I5K A;  1XVJ A;  4PHN A;  1GGW A;  1FI5 A;  3LLE A;  1XFU O;  1R6P A;  2AMI A;  2ZN9 A;  3NSO A;  2DOQ A;  4R1E A;  2KI6 C;  1G8I A;  2HPS A;  1TNX A;  1UHK A;  2Y1N A;  4YI9 A;  2VRG A;  1SL8 A;  1PVA A;  2JRF A;  2JZI A;  1QIW A;  2F3Y A;  2MJW B;  1IH0 A;  4I5J A;  1UUR A;  1TN4 A;  1B7T Y;  1Y1U A;  1Q80 A;  2I94 A;  1A29 A;  2Y5I A;  2PRU A;  1YTZ C;  3PLF B;  3LL8 B;  1CNP A;  1WRK A;  1V1G A;  1QJT A;  2BCX A;  4XYN A;  1B8C A;  2HQW A;  2LLU A;  4DUQ A;  4DCK A;  1L2O C;  2MAZ A;  3PAT A;  3BUM B;  1MXL C;  2KYC A;  1J1E A;  1TCF A;  3EVR A;  3SG4 A;  2KI6 D;  1CM1 A;  2CT9 A;  4Q04 A;  5CSI A;  1BOD A;  4FTG A;  2HQ8 A;  4OR9 B;  2JNX A;  3TZ1 A;  2BKH B;  1U5I B;  3WNX B;  2AAO A;  3CWG A;  3IQO A;  1BG1 A;  4GUK A;  5D69 A;  1DTL A;  2PSR A;  1R2U A;  1NIW A;  1XFV O;  1UHH A;  2BE6 A;  2JXC A;  3I5H B;  4A4C A;  1H8B A;  1CTR A;  3WHT B;  3BYA A;  2BEC A;  1CB1 A;  1YX7 A;  4PHM A;  2FOT A;  1RFJ A;  2NLN A;  1DJH A;  2OPO A;  4C0K A;  2PVB A;  3IQQ A;  5IBW A;  1QLK A;  2LCP A;  2JT8 A;  2I2R E;  3DD4 A;  1KK8 B;  1PSR A;  1DJI A;  3PSR A;  2H61 A;  4JWQ A;  1KK7 Y;  1KQM B;  1GGZ A;  1IG5 A;  1F70 A;  1JWD A;  1NX1 A;  2EHB A;  2LMT A;  1BR4 B;  1XO5 A;  2KDH A;  2K7D A;  4I5N B;  2WCB A;  2JT0 A;  1K9U A;  3JVT C;  3FIA A;  2BL0 C;  3CLN A;  1W7I B;  3PN7 C;  1M45 A;  2MBX A;  4PE7 A;  4PHK A;  2KSP A;  1A03 A;  1QVI Y;  3SIB A;  4NDB A;  1QXP A;  3RLZ A;  1F54 A;  1NUB A;  1B7T Z;  1ZAC A;  3CGA A;  3OHM B;  1S26 D;  3WXA A;  2M1U A;  3AAJ A;  5KU1 A;  1G4Y R;  1KK8 C;  3NXA A;  4AOM A;  3CZT X;  5HKY A;  1TNQ A;  1M63 B;  1JFK A;  1JF2 A;  1QX2 A;  3OP0 A;  2OS8 B;  1XK4 C;  4YRU A;  3CR2 A;  1EG3 A;  4CFQ A;  4UPG A;  3I5I C;  3A4U B;  5BPJ A;  1BR1 B;  4MVF A;  2MRD A;  1KSO A;  1ZUZ A;  1JF0 A;  4E68 A;  1QVI Z;  2NZ0 A;  1NYA A;  2L50 A;  1UHN A;  2OTG C;  4PE1 A;  1SMG A;  3NSL A;  1IJ5 A;  2FJU B;  3SG3 A;  1NCZ A;  1KQV A;  3EVU A;  1S6C A;  1IKU A;  3I5G B;  1KWO B;  5TNC A;  1CLM A;  5J3X A;  4YGA A;  4D1E A;  3DVK A;  3JTD C;  2BCB A;  1VRK A;  1M46 A;  1SPY A;  2K7C A;  3O4Y A;  2OS8 C;  4M2Q A;  3BUW B;  1DJG A;  1J7P A;  1CLB A;  3E3R A;  1MHO A;  2M3W A;  3OB1 B;  1QS7 A;  1B8L A;  1DJY A;  2K8M B;  3OB2 B;  1OQP A;  3I5I B;  5I2Q A;  2EGD A;  2F3Z A;  3O78 A;  2PAL A;  2LHL A;  1LA3 A;  1SYM A;  2JXL A;  4I5L B;  2LMV A;  3TUY B;  3SG2 A;  1UUS A;  2NCO A;  4PHJ A;  2KGR A;  1G33 A;  1MF8 B;  1CDL A;  2PMY A;  4MLW A;  4C0L A;  4MRX A;  1IJ6 A;  4IL1 A;  2JQ6 A;  1RJV A;  3GOF A;  2ISD A;  2KFF A;  2SCP A;  1QV0 A;  1WY9 A;  2M7N A;  1AJ5 A;  1CDM A;  3BOW B;  1LKJ A;  3AAK A;  1TOP A;  2WCE A;  5HLV A;  1MQ1 A;  4NDC A;  1QIV A;  1MUX A;  4MZK A;  1F55 A;  1W7J B;  1CLL A;  3D0Y B;  3F45 A;  3BOW A;  1CMG A;  1MR8 A;  1K96 A;  2H2K A;  4AQJ A;  2KYF A;  1DVI A;  1SCM C;  1HQV A;  4AQI A;  3FS7 A;  1F8H A;  1AHR A;  1A75 A;  4N1F A;  1NCX A;  3KF9 A;  5DKN A;  4ORB B;  1DF0 B;  3I5F B;  1WRZ A;  3PM8 A;  1KQM C;  1TCO B;  1BF5 A;  3I5F C;  1CKK A;  1PVB A;  2LV7 A;  4MRY A;  3LK0 A;  4YGB B;  1OMV A;  2ZFD A;  4DS7 A;  1NPQ A;  1XFW O;  2BBM A;  1DJZ A;  4BY5 A;  1S5G Y;  1A2X A;  2Q91 A;  1OMR A;  2WCF A;  4USL A;  2G9B A;  2PAS A;  3KPX A;  2MLE C;  1TTX A;  2ZRT A;  4GBA A;  4DIR A;  2BKI B;  2I7A A;  3I5H C;  4P5O E;  1MXE A;  1H4B A;  2Y1M A;  2ZKM X;  1PAL A;  3VRR A;  1FW4 A;  4U8D A;  2OTG B;  1F4Q A;  5GQQ C;  1K8U A;  5I2L A;  2M7L A;  2QPT A;  2WC8 A;  3KO0 A;  2FCD A;  5CSF A;  4DRW A;  2LP2 A;  2ZND A;  1RTP 1;  2BBN A;  3FWC A;  1DJX A;  4L9M A;  2I18 A;  4OV2 A;  3WHU B;  1BU3 A;  3TDU A;  2LUX A;  1UP5 A;  4GGN A;  1QAT A;  3DVJ A;  2LLT A;  2JOJ A;  2GGM A;  1ZFS A;  3AKA A;  1E8A A;  2JC2 A;  1EL4 A;  1S6J A;  2F2P A;  1K2H A;  1YUR A;  4P2Y B;  1MWN A;  5KTY A;  2FCE A;  3BUX B;  3TDZ A;  2KQY A;  1Y6W A;  2F2O A;  2L51 A;  2QAC A;  4HRE E;  1FF1 A;  4NDD A;  1TNW A;  3M0W A;  3VRO A;  2JTT A;  4C0J A;  4XJK B;  2LVI A;  1A75 B;  3EK8 A;  5DKQ A;  5FYX A;  1EJ3 A;  4ETO A;  1J55 A;  2MLF C;  3ICB A;  1L2O B;  2KBI A;  3VRQ A;  4QJ4 B;  3GK2 A;  5G08 A;  1Y1A A;  1C7W A;  1XA5 A;  3D0Y A;  1CDN A;  1K9P A;  2LVJ A;  1IRJ A;  2O5G A;  2JNF A;  3SG5 A;  2M49 B;  5CSJ A;  2ZN8 A;  2LUC A;  3CR5 X;  1J1D A;  1XYD A;  1K9K A;  2CBL A;  2O60 A;  5AFP A;  1K93 D;  1OZO A;  3HX4 A;  4WQ2 A;  1F71 A;  2LMU A;  1QTX A;  1AK8 A;  1QX5 B;  2IS9 A;  2LLS A;  3EKH A;  5AAN A;  3SIA A;  4FQO A;  1KFU S;  2L2E A;  1J7O A;  2JUL A;  1B47 A;  1JUO A;  2Y4Q A;  3NSK A;  2CNP A;  4WQ3 A;  1S5G Z;  2K2F A;  4MEW A;  4OKH A;  3TS5 C;  1KFU L;  1JFJ A;  5HYD A;  2Q4U A;  2LC5 A;  2F8P A;  2ZRS A;  5JJG A;  2JU0 A;  2LAN A;  2KNE A;  4MBE A;  1OOJ A;  1DJW A;  3K21 A;  1K94 A;  1LXF C;  1WLZ A;  1F4O A;  2EC6 B; 
#chains in the Genus database with same CATH topology
 4JKT A;  3SG6 A;  2BE4 A;  4JPZ B;  1PK0 D;  1GJY A;  1GM0 A;  3JVT B;  4YGC B;  4PAL A;  3CZ0 A;  2KHN A;  4PCW A;  1EH2 A;  5DIC A;  3O2P A;  2LNK A;  2GGZ A;  1DEK A;  3NSI A;  3S0F A;  1TIZ A;  2KQ6 A;  1NSH A;  2H61 C;  2M97 A;  2QEO A;  4ZCU A;  3B7A A;  3OBV A;  5JOL A;  3PAL A;  1KCY A;  1DQE A;  4QJ3 B;  3N7H A;  1IGV A;  1V1F A;  4MZL A;  4YBH B;  1A4P A;  1DF0 A;  2WND A;  3QME A;  2MA2 A;  1FPW A;  2V53 A;  2WOR A;  2B1U A;  3D73 A;  2H8V A;  2KFG A;  2K61 A;  1FBV A;  2KI4 B;  3DVM A;  5ER4 X;  1QX7 A;  3KHE A;  2K7B A;  1SNL A;  1PSB A;  5AEQ A;  3R1O A;  4PE4 A;  1B8R A;  1JC2 A;  2LM5 A;  4OVN F;  1WRL A;  1WDC C;  5D7F A;  1JBA A;  1NX0 A;  1PUL A;  1RK9 A;  1RRO A;  1Y1X A;  3QRX A;  1CFD A;  2M8U A;  3CS1 A;  2KOT A;  3NHI A;  4CPV A;  1IQ5 A;  3FE8 A;  1N0Y A;  4QJ5 B;  4GGF A;  2L2C A;  2LVV A;  3VGO A;  3CTN A;  3VRN A;  2LVK A;  3BUN B;  1SY9 A;  1BJF A;  1YUU A;  2MHH A;  4GFT A;  4ICB A;  1K95 A;  4YGE B;  1B4C A;  2PQL A;  5I94 A;  2WOS A;  1CM4 A;  1CFF A;  1KFX L;  2KI4 C;  5HKW A;  3DVE A;  1L7Z A;  1SRA A;  3SG7 A;  1SCM B;  3OX5 A;  3KEV A;  1BOC A;  4INW A;  2CCM A;  4ORC B;  1KFX S;  2M0R A;  1S1E A;  3PN7 B;  1AUI B;  3H4S E;  1C07 A;  1TRF A;  1S36 A;  4CFR A;  1KWO C;  1QAS A;  3S0D A;  1SL7 A;  1TNP A;  3BQ3 A;  5HKZ A;  1SKT A;  2KAV A;  5AER A;  1D1O A;  2E6W A;  1NX2 A;  2K2A A;  1REC A;  3PFV A;  1T14 A;  3CZ2 A;  1NP8 A;  2L0P A;  1QWV A;  2WCH A;  4ORA B;  1B1G A;  1CFC A;  1SSE B;  1BLQ A;  1SR6 C;  2CXJ A;  4YI8 A;  4HSZ A;  4MSP A;  1XFY O;  1YR5 A;  3C1V A;  4HRH A;  1DT7 B;  1DMO A;  1U5I A;  1SBJ A;  3GK4 X;  2RGI A;  1YRU B;  3ZNI A;  2K60 A;  2JPT A;  3LK1 A;  2K7O A;  1YRT B;  2G2B A;  2HF5 A;  2HET A;  3ZWH A;  1YUT A;  5B8I B;  5PAL A;  1AVS A;  4F0Z B;  2L5X B;  4A4B A;  1OMD A;  1BT6 A;  1QV1 A;  1ALV A;  2KBM A;  2L98 A;  3VRP A;  1WDC B;  5F6T A;  2GTE A;  5I2O A;  3BFH A;  1YVL A;  2FJY A;  4JQ0 D;  4M2P A;  2SAS A;  2LAP A;  3RZS A;  1PRW A;  4NQG A;  4TNC A;  1XFZ O;  2KFH A;  2KGB C;  2QEV A;  1SW8 A;  2NCP A;  1UHJ A;  4GGF C;  2ZNE A;  2EC6 C;  1ZMZ A;  4XJK A;  2LE9 B;  1LVC D;  3SJS A;  4WRI A;  2JTZ A;  3GK1 A;  1ALW A;  5HLO A;  5KSZ A;  2BNX A;  3BXK A;  4CLN A;  1FI6 A;  4HRG A;  1SK6 D;  1NX3 A;  3OX6 A;  1AP4 A;  1IIO A;  1J7R A;  3UO9 A;  2KAX A;  2L4I A;  1OE9 B;  3DZT A;  1NCY A;  1NWD A;  3A8R A;  1C3Z A;  2L4H A;  2JT3 A;  2M29 A;  4JD9 A;  4GAO A;  4MN0 A;  2TN4 A;  4IJ7 A;  1B9A A;  1QLS A;  3HCM A;  3IF7 A;  2WCL A;  1JSA A;  2K0J A;  3TUY C;  1ODB A;  4MZJ A;  3FWB A;  5K89 A;  3DF0 A;  1XK4 A;  1DEL A;  1RWY A;  3D10 A;  1OSA A;  2P6B B;  1Y0V H;  4ZCV A;  1C7V A;  2M1K B;  1HT9 A;  3EKJ A;  4M2O A;  1IQ3 A;  1N2D A;  3B6X A;  1SR6 B;  3MSE B;  5CPV A;  1YVH A;  5CSN A;  3D77 A;  5AXI A;  3EK7 A;  3PJI A;  2CTN A;  1CFP A;  1K90 D;  1UWO A;  1YUS A;  2KAY A;  3AKB A;  1S6I A;  2P71 A;  4GPL B;  1SL9 A;  5FI7 A;  4CID A;  1IWQ A;  2JWW A;  5DKR A;  2AUC A;  3O6B A;  5ER5 A;  1DGV A;  3RM1 A;  1EG4 A;  1UHI A;  1OZS A;  1WLM A;  1X02 A;  2D8N A;  1KSM A;  1CDP A;  2R2I A;  3LCP C;  3TDI A;  3BUO B;  2E30 A;  3I5G C;  1J7Q A;  3EK4 A;  3L4L A;  5FI2 A;  1CMF A;  4N1G A;  5I8N A;  1S3P A;  5HL1 A;  1BMO A;  1YX8 A;  3TS5 B;  1N65 A;  3JTD B;  4PE0 A;  3DF0 B;  2M9G A;  4PDZ A;  2BCA A;  1AJ4 A;  2LHI A;  3NGV A;  3Q8I A;  1LS8 A;  2GV5 A;  2LP3 A;  4N5X A;  1EXR A;  3SS5 A;  1DGU A;  1GQM A;  3CR4 X;  1KK7 Z;  4OCI A;  3EVV A;  2YGU A;  4BY4 A;  1XFX O;  1ZOT B;  3FE9 A;  2NXQ A;  4YGD B;  2A4J A;  2F33 A;  1LA0 A;  2BL0 B;  1LIN A;  4GNK B;  2COL B;  1M31 A;  1SCV A;  1M39 A;  4I5K A;  1TUZ A;  1XVJ A;  4PHN A;  5EL2 A;  1GGW A;  5D3O A;  3BFB A;  3LLE A;  1FI5 A;  1XFU O;  1R6P A;  2AMI A;  2ZN9 A;  3NSO A;  2DOQ A;  4R1E A;  2KI6 C;  1G8I A;  2HPS A;  1TNX A;  1UHK A;  2Y1N A;  4YI9 A;  2VRG A;  1SL8 A;  1OOG A;  1PVA A;  2JRF A;  2JZI A;  1QIW A;  2F3Y A;  2MJW B;  1IH0 A;  4I5J A;  1UUR A;  1TN4 A;  1B7T Y;  3D78 A;  1Y1U A;  1Q80 A;  2I94 A;  1A29 A;  2Y5I A;  2PRU A;  3IVT A;  1YTZ C;  3PLF B;  3LL8 B;  1CNP A;  1WRK A;  4F7F A;  3UNW A;  1V1G A;  1QJT A;  2BCX A;  4PT1 A;  4XYN A;  1B8C A;  2HQW A;  2LLU A;  4DUQ A;  4DCK A;  1L2O C;  2MAZ A;  3PAT A;  3BUM B;  1MXL C;  2ERB A;  2KYC A;  1J1E A;  2PYQ A;  1TCF A;  3EVR A;  3SG4 A;  2KI6 D;  2QEB A;  1CM1 A;  3S0E A;  2CT9 A;  4Q04 A;  5CSI A;  1BOD A;  4FTG A;  2HQ8 A;  4OR9 B;  2JNX A;  2WCJ A;  2BKH B;  1U5I B;  3TZ1 A;  3WNX B;  2AAO A;  2KPH A;  3CWG A;  4KYN A;  3IQO A;  1BG1 A;  4GUK A;  5D69 A;  3SS3 A;  1DTL A;  2PSR A;  3DXL A;  1R2U A;  1NIW A;  3V2L A;  1XFV O;  1UHH A;  2BE6 A;  1C3Y A;  2JXC A;  3I5H B;  1TUJ A;  4A4C A;  1H8B A;  1CTR A;  3WHT B;  3BYA A;  2BEC A;  1CB1 A;  1YX7 A;  4PHM A;  2FOT A;  1RFJ A;  2NLN A;  1DJH A;  2OPO A;  4C0K A;  2PVB A;  3IQQ A;  5IBW A;  1QLK A;  2LCP A;  2KLD A;  2JT8 A;  2I2R E;  3L4A A;  3DD4 A;  1KK8 B;  1PSR A;  1DJI A;  3PSR A;  2H61 A;  4JWQ A;  1KK7 Y;  1KQM B;  1GGZ A;  1IG5 A;  1F70 A;  1JWD A;  1Z4H A;  1NX1 A;  2EHB A;  2LMT A;  1BR4 B;  1XO5 A;  2KDH A;  2KLE A;  2K7D A;  4I5N B;  2WCB A;  2JT0 A;  4OZD A;  1K9U A;  3JVT C;  3FIA A;  2BL0 C;  3CLN A;  1W7I B;  3PN7 C;  1M45 A;  5FI6 A;  4PE7 A;  4PHK A;  2KSP A;  2MBX A;  1A03 A;  1QVI Y;  3SIB A;  4NDB A;  2QDI A;  1QXP A;  3RLZ A;  1F54 A;  3D74 A;  1NUB A;  1B7T Z;  1ZAC A;  3CGA A;  3OHM B;  1S26 D;  3WXA A;  1Z2C B;  2M1U A;  3AAJ A;  3B87 A;  5KU1 A;  1G4Y R;  1KK8 C;  3O4X A;  3NXA A;  4AOM A;  3CZT X;  5HKY A;  1TNQ A;  1M63 B;  2QEH A;  1P28 A;  1JFK A;  1JF2 A;  1QX2 A;  3OP0 A;  2WC6 A;  2OS8 B;  1XK4 C;  4YRU A;  3CR2 A;  1EG3 A;  4CFQ A;  4UPG A;  3I5I C;  3A4U B;  5BPJ A;  1BR1 B;  4MVF A;  2MRD A;  1KSO A;  1ZUZ A;  1JF0 A;  4E68 A;  1QVI Z;  2NZ0 A;  4FQT A;  3CDN A;  1NYA A;  2L50 A;  1UHN A;  2OTG C;  4PE1 A;  1SMG A;  3NSL A;  1IJ5 A;  2FJU B;  3SG3 A;  1NCZ A;  1KQV A;  3EVU A;  1S6C A;  2WC5 A;  3I5G B;  1KWO B;  1IKU A;  1OW4 A;  5TNC A;  1CLM A;  5J3X A;  4YGA A;  4D1E A;  3FE6 A;  3DVK A;  3OGN A;  3JTD C;  2BCB A;  1VRK A;  1M46 A;  1SPY A;  2K7C A;  3O4Y A;  2OS8 C;  4M2Q A;  3BUW B;  1DJG A;  1J7P A;  1CLB A;  3E3R A;  1MHO A;  2M3W A;  3OB1 B;  2JPO A;  1QS7 A;  1B8L A;  1DJY A;  2K8M B;  3OB2 B;  1OQP A;  3I5I B;  5I2Q A;  2EGD A;  2F3Z A;  3O78 A;  2PAL A;  3SS4 A;  2LHL A;  1LA3 A;  1SYM A;  2JXL A;  4I5L B;  2LMV A;  3TUY B;  3D76 A;  1UUS A;  2NCO A;  4PHJ A;  2KGR A;  3SG2 A;  1G33 A;  1MF8 B;  1CDL A;  2PMY A;  4MLW A;  4C0L A;  4MRX A;  1IJ6 A;  4IL1 A;  2JQ6 A;  1RJV A;  3GOF A;  2ISD A;  2KFF A;  2SCP A;  1QV0 A;  1WY9 A;  2M7N A;  1AJ5 A;  1CDM A;  3BOW B;  1LKJ A;  3AAK A;  2WCK A;  1TOP A;  2WCE A;  5HLV A;  1MQ1 A;  4NDC A;  1QIV A;  1MUX A;  4MZK A;  1F55 A;  1W7J B;  1CLL A;  1OOF A;  3D0Y B;  3F45 A;  1OOH A;  3BOW A;  1CMG A;  1MR8 A;  1K96 A;  1OOI X;  2H2K A;  4AQJ A;  2KYF A;  1DVI A;  1SCM C;  1HQV A;  4AQI A;  3FS7 A;  1F8H A;  1AHR A;  1A75 A;  3PM2 A;  1NCX A;  1W9Z A;  4N1F A;  3KF9 A;  5DKN A;  4ORB B;  1DF0 B;  2WCM A;  1WRZ A;  3I5F B;  1KQM C;  3PM8 A;  1TCO B;  3R72 A;  3B88 A;  1BF5 A;  3I5F C;  1CKK A;  1PVB A;  2LV7 A;  4MRY A;  3LK0 A;  4YGB B;  1OMV A;  2ZFD A;  4DS7 A;  1NPQ A;  1XFW O;  2BBM A;  1DJZ A;  3NHT A;  4BY5 A;  1S5G Y;  3EG5 B;  1A2X A;  2Q91 A;  1OMR A;  2BAP A;  2WCF A;  4USL A;  2G9B A;  2PAS A;  3KPX A;  2MLE C;  1TTX A;  2ZRT A;  4GBA A;  4DIR A;  2BKI B;  2I7A A;  3I5H C;  4P5O E;  1MXE A;  1H4B A;  2Y1M A;  2ZKM X;  1PAL A;  3VRR A;  1FW4 A;  4U8D A;  2OTG B;  1F4Q A;  5GQQ C;  1K8U A;  1ORG A;  5I2L A;  2QPT A;  2M7L A;  2WC8 A;  3KO0 A;  2FCD A;  3D75 A;  5CSF A;  2LP2 A;  2ZND A;  4DRW A;  1RTP 1;  2BBN A;  3FWC A;  1DJX A;  4L9M A;  2I18 A;  4OV2 A;  3WHU B;  1BU3 A;  3R1P A;  3TDU A;  2LUX A;  1UP5 A;  4GGN A;  1QAT A;  3DVJ A;  2LLT A;  2JOJ A;  2GGM A;  3B86 A;  1ZFS A;  3AKA A;  1E8A A;  2JC2 A;  1EL4 A;  1S6J A;  3L47 A;  3R1V A;  2F2P A;  1K2H A;  1YUR A;  4P2Y B;  1MWN A;  5KTY A;  2FCE A;  3BUX B;  3TDZ A;  2KQY A;  1Y6W A;  2F2O A;  2L51 A;  2QAC A;  4HRE E;  1FF1 A;  4NDD A;  1TNW A;  3M0W A;  3VRO A;  2JTT A;  4C0J A;  4XJK B;  2LVI A;  1A75 B;  3EK8 A;  5DKQ A;  5FYX A;  1EJ3 A;  4ETO A;  1J55 A;  2MLF C;  3ICB A;  1L2O B;  2KBI A;  3BFA A;  3VRQ A;  1XFR A;  3DYE A;  4QJ4 B;  1DC1 A;  3GK2 A;  5G08 A;  1Y1A A;  1C7W A;  3CZ1 A;  1XA5 A;  3D0Y A;  1CDN A;  1K9P A;  2LVJ A;  3VB1 A;  1IRJ A;  2O5G A;  2JNF A;  3SG5 A;  2M49 B;  5CSJ A;  2ZN8 A;  2LUC A;  3CR5 X;  1J1D A;  2L5Y A;  1XYD A;  1K9K A;  2CBL A;  2O60 A;  5AFP A;  1K93 D;  1OZO A;  3HX4 A;  4WQ2 A;  1F71 A;  2LMU A;  1QTX A;  1AK8 A;  1QX5 B;  3CYZ A;  2IS9 A;  2LLS A;  3EKH A;  4INX A;  5AAN A;  3SIA A;  4FQO A;  1KFU S;  2L2E A;  1J7O A;  2JUL A;  3CAB A;  1B47 A;  3S0B A;  1JUO A;  2Y4Q A;  3NSK A;  2CNP A;  3BJH A;  2P70 A;  4WQ3 A;  1S5G Z;  2K2F A;  4MEW A;  4OKH A;  3K1E A;  3TS5 C;  1KFU L;  1JFJ A;  5HYD A;  2Q4U A;  2LC5 A;  2F8P A;  2ZRS A;  5JJG A;  1TWO A;  3S0A A;  2JU0 A;  2LAN A;  2KNE A;  4MBE A;  3DY9 A;  3S0G A;  1OOJ A;  1DJW A;  3K21 A;  1K94 A;  1LXF C;  1WLZ A;  1F4O A;  2EC6 B; 
#chains in the Genus database with same CATH homology
 3SG6 A;  2BE4 A;  4JPZ B;  1PK0 D;  1GJY A;  3JVT B;  4YGC B;  4PAL A;  2KHN A;  4PCW A;  1EH2 A;  3O2P A;  2LNK A;  2GGZ A;  3NSI A;  1TIZ A;  2KQ6 A;  1NSH A;  2H61 C;  2M97 A;  4ZCU A;  5JOL A;  3PAL A;  1KCY A;  4QJ3 B;  1IGV A;  1V1F A;  4MZL A;  4YBH B;  1A4P A;  1DF0 A;  2WND A;  2MA2 A;  1FPW A;  2V53 A;  2WOR A;  2B1U A;  2KFG A;  2K61 A;  1FBV A;  2KI4 B;  3DVM A;  5ER4 X;  1QX7 A;  3KHE A;  2K7B A;  1SNL A;  1PSB A;  5AEQ A;  4PE4 A;  1B8R A;  1JC2 A;  2LM5 A;  4OVN F;  1WRL A;  1WDC C;  5D7F A;  1JBA A;  1NX0 A;  1PUL A;  1RK9 A;  1RRO A;  1Y1X A;  3QRX A;  1CFD A;  2M8U A;  3CS1 A;  2KOT A;  4CPV A;  1IQ5 A;  4QJ5 B;  1N0Y A;  4GGF A;  2LVV A;  3VGO A;  3CTN A;  3VRN A;  2LVK A;  3BUN B;  1SY9 A;  1BJF A;  1YUU A;  2MHH A;  4GFT A;  4ICB A;  1K95 A;  4YGE B;  1B4C A;  2WOS A;  1CM4 A;  1CFF A;  1KFX L;  2KI4 C;  5HKW A;  3DVE A;  1L7Z A;  1SRA A;  3SG7 A;  1SCM B;  3OX5 A;  3KEV A;  2CCM A;  4ORC B;  1KFX S;  2M0R A;  1S1E A;  3PN7 B;  1AUI B;  3H4S E;  1C07 A;  1TRF A;  1S36 A;  4CFR A;  1KWO C;  1QAS A;  1SL7 A;  1TNP A;  3BQ3 A;  5HKZ A;  1SKT A;  2KAV A;  5AER A;  1D1O A;  2E6W A;  1NX2 A;  2K2A A;  1REC A;  3PFV A;  1NP8 A;  2L0P A;  4ORA B;  1B1G A;  1CFC A;  1BLQ A;  1SR6 C;  2CXJ A;  4YI8 A;  4HSZ A;  4MSP A;  1XFY O;  1YR5 A;  3C1V A;  4HRH A;  1DT7 B;  1DMO A;  1U5I A;  1SBJ A;  3GK4 X;  2RGI A;  1YRU B;  3ZNI A;  2JPT A;  3LK1 A;  2K7O A;  1YRT B;  2G2B A;  2HF5 A;  2HET A;  3ZWH A;  1YUT A;  5B8I B;  5PAL A;  1AVS A;  4F0Z B;  2L5X B;  4A4B A;  1OMD A;  1BT6 A;  1QV1 A;  1ALV A;  2KBM A;  2L98 A;  3VRP A;  1WDC B;  5F6T A;  5I2O A;  1YVL A;  4JQ0 D;  4M2P A;  2SAS A;  2LAP A;  1PRW A;  4NQG A;  4TNC A;  1XFZ O;  2KFH A;  2KGB C;  1SW8 A;  2NCP A;  1UHJ A;  4GGF C;  2ZNE A;  2EC6 C;  1ZMZ A;  4XJK A;  2LE9 B;  1LVC D;  3SJS A;  4WRI A;  2JTZ A;  3GK1 A;  1ALW A;  5HLO A;  5KSZ A;  3BXK A;  4CLN A;  1FI6 A;  4HRG A;  1SK6 D;  1NX3 A;  3OX6 A;  1AP4 A;  1J7R A;  2KAX A;  2L4I A;  1OE9 B;  1NCY A;  1NWD A;  3A8R A;  2L4H A;  2JT3 A;  2M29 A;  4MN0 A;  4GAO A;  2TN4 A;  1B9A A;  1QLS A;  3HCM A;  3IF7 A;  1JSA A;  2K0J A;  3TUY C;  1ODB A;  4MZJ A;  3FWB A;  5K89 A;  3DF0 A;  1XK4 A;  3D10 A;  1RWY A;  1OSA A;  2P6B B;  1Y0V H;  4ZCV A;  1C7V A;  2M1K B;  1HT9 A;  3EKJ A;  4M2O A;  1IQ3 A;  1N2D A;  1SR6 B;  3MSE B;  5CPV A;  1YVH A;  5CSN A;  5AXI A;  1CFP A;  3EK7 A;  1BOC A;  2CTN A;  1K90 D;  1UWO A;  1YUS A;  2KAY A;  3AKB A;  1S6I A;  4GPL B;  4CID A;  1SL9 A;  1IWQ A;  2JWW A;  5DKR A;  2AUC A;  3O6B A;  5ER5 A;  1DGV A;  3RM1 A;  1EG4 A;  1UHI A;  1OZS A;  1WLM A;  1X02 A;  2D8N A;  1KSM A;  1CDP A;  2R2I A;  3LCP C;  3TDI A;  3BUO B;  2E30 A;  3I5G C;  1J7Q A;  3EK4 A;  1CMF A;  4N1G A;  5I8N A;  1S3P A;  1BMO A;  1YX8 A;  3TS5 B;  1N65 A;  3JTD B;  4PE0 A;  3DF0 B;  2M9G A;  4PDZ A;  2BCA A;  1AJ4 A;  2LHI A;  2GV5 A;  2LP3 A;  4N5X A;  1EXR A;  1DGU A;  1GQM A;  3CR4 X;  1KK7 Z;  4OCI A;  3EVV A;  4BY4 A;  1XFX O;  1ZOT B;  4YGD B;  2NXQ A;  2A4J A;  2F33 A;  1LA0 A;  2BL0 B;  1LIN A;  4GNK B;  2COL B;  1M31 A;  1SCV A;  1M39 A;  4I5K A;  1XVJ A;  4PHN A;  1GGW A;  1FI5 A;  3LLE A;  1XFU O;  1R6P A;  2AMI A;  2ZN9 A;  3NSO A;  2DOQ A;  4R1E A;  2KI6 C;  1G8I A;  2HPS A;  1TNX A;  1UHK A;  2Y1N A;  4YI9 A;  2VRG A;  1SL8 A;  1PVA A;  2JRF A;  2JZI A;  1QIW A;  2F3Y A;  2MJW B;  1IH0 A;  4I5J A;  1UUR A;  1TN4 A;  1B7T Y;  1Y1U A;  1Q80 A;  2I94 A;  1A29 A;  2Y5I A;  2PRU A;  1YTZ C;  3PLF B;  3LL8 B;  1CNP A;  1WRK A;  1V1G A;  1QJT A;  2BCX A;  4XYN A;  1B8C A;  2HQW A;  2LLU A;  4DUQ A;  4DCK A;  1L2O C;  2MAZ A;  3PAT A;  3BUM B;  1MXL C;  2KYC A;  1J1E A;  1TCF A;  3EVR A;  3SG4 A;  2KI6 D;  1CM1 A;  2CT9 A;  4Q04 A;  5CSI A;  1BOD A;  4FTG A;  2HQ8 A;  4OR9 B;  2JNX A;  3TZ1 A;  2BKH B;  1U5I B;  3WNX B;  2AAO A;  3CWG A;  3IQO A;  1BG1 A;  4GUK A;  5D69 A;  1DTL A;  2PSR A;  1R2U A;  1NIW A;  1XFV O;  1UHH A;  2BE6 A;  2JXC A;  3I5H B;  4A4C A;  1H8B A;  1CTR A;  3WHT B;  3BYA A;  2BEC A;  1CB1 A;  1YX7 A;  4PHM A;  2FOT A;  1RFJ A;  2NLN A;  1DJH A;  2OPO A;  4C0K A;  2PVB A;  3IQQ A;  5IBW A;  1QLK A;  2LCP A;  2JT8 A;  2I2R E;  3DD4 A;  1KK8 B;  1PSR A;  1DJI A;  3PSR A;  2H61 A;  4JWQ A;  1KK7 Y;  1KQM B;  1GGZ A;  1IG5 A;  1F70 A;  1JWD A;  1NX1 A;  2EHB A;  2LMT A;  1BR4 B;  1XO5 A;  2KDH A;  2K7D A;  4I5N B;  2WCB A;  2JT0 A;  1K9U A;  3JVT C;  3FIA A;  2BL0 C;  3CLN A;  1W7I B;  3PN7 C;  1M45 A;  2MBX A;  4PE7 A;  4PHK A;  2KSP A;  1A03 A;  1QVI Y;  3SIB A;  4NDB A;  1QXP A;  3RLZ A;  1F54 A;  1NUB A;  1B7T Z;  1ZAC A;  3CGA A;  3OHM B;  1S26 D;  3WXA A;  2M1U A;  3AAJ A;  5KU1 A;  1G4Y R;  1KK8 C;  3NXA A;  4AOM A;  3CZT X;  5HKY A;  1TNQ A;  1M63 B;  1JFK A;  1JF2 A;  1QX2 A;  3OP0 A;  2OS8 B;  1XK4 C;  4YRU A;  3CR2 A;  1EG3 A;  4CFQ A;  4UPG A;  3I5I C;  3A4U B;  5BPJ A;  1BR1 B;  4MVF A;  2MRD A;  1KSO A;  1ZUZ A;  1JF0 A;  4E68 A;  1QVI Z;  2NZ0 A;  1NYA A;  2L50 A;  1UHN A;  2OTG C;  4PE1 A;  1SMG A;  3NSL A;  1IJ5 A;  2FJU B;  3SG3 A;  1NCZ A;  1KQV A;  3EVU A;  1S6C A;  1IKU A;  3I5G B;  1KWO B;  5TNC A;  1CLM A;  5J3X A;  4YGA A;  4D1E A;  3DVK A;  3JTD C;  2BCB A;  1VRK A;  1M46 A;  1SPY A;  2K7C A;  3O4Y A;  2OS8 C;  4M2Q A;  3BUW B;  1DJG A;  1J7P A;  1CLB A;  3E3R A;  1MHO A;  2M3W A;  3OB1 B;  1QS7 A;  1B8L A;  1DJY A;  2K8M B;  3OB2 B;  1OQP A;  3I5I B;  5I2Q A;  2EGD A;  2F3Z A;  3O78 A;  2PAL A;  2LHL A;  1LA3 A;  1SYM A;  2JXL A;  4I5L B;  2LMV A;  3TUY B;  3SG2 A;  1UUS A;  2NCO A;  4PHJ A;  2KGR A;  1G33 A;  1MF8 B;  1CDL A;  2PMY A;  4MLW A;  4C0L A;  4MRX A;  1IJ6 A;  4IL1 A;  2JQ6 A;  1RJV A;  3GOF A;  2ISD A;  2KFF A;  2SCP A;  1QV0 A;  1WY9 A;  2M7N A;  1AJ5 A;  1CDM A;  3BOW B;  1LKJ A;  3AAK A;  1TOP A;  2WCE A;  5HLV A;  1MQ1 A;  4NDC A;  1QIV A;  1MUX A;  4MZK A;  1F55 A;  1W7J B;  1CLL A;  3D0Y B;  3F45 A;  3BOW A;  1CMG A;  1MR8 A;  1K96 A;  2H2K A;  4AQJ A;  2KYF A;  1DVI A;  1SCM C;  1HQV A;  4AQI A;  3FS7 A;  1F8H A;  1AHR A;  1A75 A;  4N1F A;  1NCX A;  3KF9 A;  5DKN A;  4ORB B;  1DF0 B;  3I5F B;  1WRZ A;  3PM8 A;  1KQM C;  1TCO B;  1BF5 A;  3I5F C;  1CKK A;  1PVB A;  2LV7 A;  4MRY A;  3LK0 A;  4YGB B;  1OMV A;  2ZFD A;  4DS7 A;  1NPQ A;  1XFW O;  2BBM A;  1DJZ A;  4BY5 A;  1S5G Y;  1A2X A;  2Q91 A;  1OMR A;  2WCF A;  4USL A;  2G9B A;  2PAS A;  3KPX A;  2MLE C;  1TTX A;  2ZRT A;  4GBA A;  4DIR A;  2BKI B;  2I7A A;  3I5H C;  4P5O E;  1MXE A;  1H4B A;  2Y1M A;  2ZKM X;  1PAL A;  3VRR A;  1FW4 A;  4U8D A;  2OTG B;  1F4Q A;  5GQQ C;  1K8U A;  5I2L A;  2M7L A;  2QPT A;  2WC8 A;  3KO0 A;  2FCD A;  5CSF A;  4DRW A;  2LP2 A;  2ZND A;  1RTP 1;  2BBN A;  3FWC A;  1DJX A;  4L9M A;  2I18 A;  4OV2 A;  3WHU B;  1BU3 A;  3TDU A;  2LUX A;  1UP5 A;  4GGN A;  1QAT A;  3DVJ A;  2LLT A;  2JOJ A;  2GGM A;  1ZFS A;  3AKA A;  1E8A A;  2JC2 A;  1EL4 A;  1S6J A;  2F2P A;  1K2H A;  1YUR A;  4P2Y B;  1MWN A;  5KTY A;  2FCE A;  3BUX B;  3TDZ A;  2KQY A;  1Y6W A;  2F2O A;  2L51 A;  2QAC A;  4HRE E;  1FF1 A;  4NDD A;  1TNW A;  3M0W A;  3VRO A;  2JTT A;  4C0J A;  4XJK B;  2LVI A;  1A75 B;  3EK8 A;  5DKQ A;  5FYX A;  1EJ3 A;  4ETO A;  1J55 A;  2MLF C;  3ICB A;  1L2O B;  2KBI A;  3VRQ A;  4QJ4 B;  3GK2 A;  5G08 A;  1Y1A A;  1C7W A;  1XA5 A;  3D0Y A;  1CDN A;  1K9P A;  2LVJ A;  1IRJ A;  2O5G A;  2JNF A;  3SG5 A;  2M49 B;  5CSJ A;  2ZN8 A;  2LUC A;  3CR5 X;  1J1D A;  1XYD A;  1K9K A;  2CBL A;  2O60 A;  5AFP A;  1K93 D;  1OZO A;  3HX4 A;  4WQ2 A;  1F71 A;  2LMU A;  1QTX A;  1AK8 A;  1QX5 B;  2IS9 A;  2LLS A;  3EKH A;  5AAN A;  3SIA A;  4FQO A;  1KFU S;  2L2E A;  1J7O A;  2JUL A;  1B47 A;  1JUO A;  2Y4Q A;  3NSK A;  2CNP A;  4WQ3 A;  1S5G Z;  2K2F A;  4MEW A;  4OKH A;  3TS5 C;  1KFU L;  1JFJ A;  5HYD A;  2Q4U A;  2LC5 A;  2F8P A;  2ZRS A;  5JJG A;  2JU0 A;  2LAN A;  2KNE A;  4MBE A;  1OOJ A;  1DJW A;  3K21 A;  1K94 A;  1LXF C;  1WLZ A;  1F4O A;  2EC6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...