1AJ4A

Structure of calcium-saturated cardiac troponin c, nmr, 1 structure
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
160
structure length
160
Chain Sequence
ADIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRSMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TROPONIN C
publication title Structure of cardiac muscle troponin C unexpectedly reveals a closed regulatory domain.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Muscle protein
total genus 33
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 1997-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1aj4A00
1KFXL 2KAXA 2LC5A 1TTXA 3DVJA 1TNPA 1J7OA 1PK0D 3AKAA 3WXAA 1DJHA 4OCIA 2JU0A 1SK6D 3LLEA 2LLSA 1CFPA 1SW8A 2K7CA 2KQYA 3A8RA 3MSEB 3EK4A 1WRZA 3DVKA 4D1EA 1ZOTB 2E30A 2WNDA 1GQMA 5G08A 1J1EA 1F55A 1YUUA 1QX2A 1IJ5A 2O5GA 3PSRA 3O78A 4WRIA 2M29A 1A75A 3JTDB 1M46A 3NSOA 1ZUZA 1UURA 2WCBA 4DCKA 1L7ZA 4DS7A 2GGZA 4A4BA 1N65A 1IGVA 3PM8A 2LCPA 5CPVA 3EVUA 2NZ0A 2BCAA 2L4IA 4OV2A 2BBMA 2LUCA 2LAPA 2ISDA 4C0LA 1H4BA 1NIWA 4AQIA 2E6WA 2PRUA 1KK8C 1C07A 1PSRA 3IQOA 3PFVA 2MA2A 2CBLA 1Q80A 5JOLA 1N2DA 4UPGA 2M1KB 1HT9A 1W7JB 3CR2A 1UHNA 1WRKA 1ALWA 2FJUB 1AVSA 1LA0A 3TUYB 1R2UA 2JRFA 3RM1A 4GFTA 2JTZA 1XVJA 2LHIA 3H4SE 4JPZB 1YR5A 5I2QA 1K8UA 2KGRA 2LVVA 1YRUB 3QRXA 1LA3A 1OMDA 1CLMA 1SCMC 4DUQA 2BE4A 4JQ0D 1J7PA 2KI4B 3F45A 1OOJA 2JXCA 4YGCB 2FCEA 1JFJA 2KFGA 3PLFB 1KSOA 1XK4A 3KPXA 1J7QA 1K9PA 2NXQA 2JULA 2L0PA 4C0KA 5HLVA 1KQMC 1VRKA 3EK8A 2M49B 2ZRTA 4CIDA 3OB2B 1BOCA 2FOTA 1HQVA 2LM5A 1AUIB 1FF1A 2F3YA 1K90D 2MBXA 1SKTA 1QS7A 2OTGB 3KHEA 1B7TZ 4CLNA 3PALA 2KHNA 4XJKA 1BJFA 1UWOA 2Q91A 3I5HC 1L2OC 1RWYA 4YGBB 1BR4B 1MXLC 2JNXA 1NCXA 2DOQA 5AXIA 5ER5A 1BF5A 2HQ8A 2M7NA 4U8DA 1BT6A 2MRDA 2JPTA 4R1EA 4P2YB 1XFWO 3GK1A 2KYFA 4TNCA 2OS8C 4HRHA 2PVBA 3BUOB 5AERA 4GNKB 3TS5B 1QATA 4YRUA 1PRWA 2AAOA 2JNFA 1F71A 2ZNDA 1KFXS 4C0JA 1AJ5A 3WHTB 1FBVA 1EG3A 3E3RA 1MHOA 1TN4A 4BY4A 2R2IA 5CSFA 3I5FC 5CSNA 5I2LA 1B7TY 5B8IB 1XO5A 2OPOA 3C1VA 1TCOB 2JQ6A 1AHRA 1CM1A 1SCVA 2KGBC 1AK8A 3IQQA 2BKHB 1FI6A 2LUXA 2LE9B 3FS7A 3I5GC 3O2PA 2K61A 1CMFA 1LVCD 1RECA 1SL7A 2LANA 3LL8B 3JVTC 3SG5A 1WY9A 2L50A 3ICBA 2KDHA 1A03A 4N1FA 2Y1MA 1YURA 2L4HA 2BL0C 1SR6B 3FWCA 2WOSA 1RFJA 4M2QA 1F54A 1TNXA 1B8CA 4MRYA 2M3WA 2KBIA 1IKUA 1Y0VH 2LVIA 1JF0A 4PE0A 4AOMA 1KQVA 2PASA 3VRNA 1A4PA 1SBJA 1K9UA 4MZKA 1MWNA 3KO0A 4NDBA 1DF0B 1SNLA 2LLTA 2G2BA 2H61C 4N5XA 5HYDA 5DKNA 3FWBA 1KK7Z 1AJ4A 3GOFA 3O6BA 4ORBB 1KK8B 3LCPC 4NQGA 3CWGA 1CDNA 1V1FA 1YUSA 1QJTA 1QV1A 3CS1A 1NX2A 1XFVO 2WCFA 3CGAA 1B4CA 1Y1UA 4GGNA 2Y1NA 1JWDA 3TZ1A 4A4CA 3TDUA 1G4YR 2I94A 4HRGA 2M7LA 2SASA 3GK4X 2MLFC 1GGWA 3SG4A 1EG4A 1NPQA 1UP5A 5CSJA 4CFQA 2K2FA 3LK0A 5I8NA 3HX4A 1SY9A 4WQ2A 2LMTA 1S5GZ 1CDLA 2LV7A 4HREE 1KK7Y 1OQPA 3BUNB 2WCEA 2EC6C 1B9AA 1DJGA 1DF0A 1NP8A 2JC2A 2L98A 1KFUL 4XJKB 2BCXA 5I2OA 1MF8B 2LP2A 1BG1A 1OE9B 1EL4A 1SYMA 2MHHA 4PE4A 4FQOA 3CR4X 4IL1A 1RJVA 1C7WA 4N1GA 4ZCVA 1NWDA 3I5HB 3I5IC 1L2OB 1S36A 1M63B 2BBNA 2ZFDA 3BUMB 4I5JA 3BOWB 2MJWB 4GPLB 3KEVA 2F8PA 1F4OA 1H8BA 3NSLA 1J1DA 1SMGA 2K7BA 3AAKA 3EKJA 2LNKA 1WDCC 1F4QA 1S5GY 2D8NA 4CFRA 2OS8B 1OMVA 2JZIA 1YX7A 1SL9A 1XFXO 5AEQA 2I18A 3BYAA 1CFDA 4MN0A 3EVRA 1W7IB 1S6IA 2GV5A 3OHMB 5J3XA 5PALA 2K8MB 1K2HA 2LP3A 1B8LA 1OZSA 1DVIA 2NCPA 4NDDA 3I5FB 1S6JA 2TN4A 2NLNA 2KFFA 1EJ3A 1KWOB 4P5OE 2JXLA 1OZOA 1QLKA 2WORA 1CDPA 1K93D 1TCFA 2CXJA 3VRRA 4ETOA 3CLNA 1AP4A 4ICBA 3SIBA 1IQ3A 2KFHA 3EKHA 4I5LB 3I5GB 1SRAA 2QPTA 1B1GA 2M8UA 3BOWA 4QJ5B 3DD4A 1IRJA 3EVVA 3JVTB 5HLOA 3SG3A 2PSRA 1NX0A 1PSBA 1TIZA 1LKJA 2BL0B 3VRQA 1JSAA 3TDIA 2LMUA 4PALA 1BLQA 2BCBA 4PHNA 3WHUB 1QASA 2KI4C 4GGFC 2ZN9A 1NSHA 1JF2A 5KSZA 1JC2A 1NUBA 4MLWA 3A4UB 5AANA 3SIAA 1NCZA 5F6TA 1IG5A 2PMYA 1TOPA 1FPWA 2Q4UA 1DJYA 3LK1A 4MVFA 1CFCA 1S26D 2ZN8A 1QVIZ 5TNCA 1XFZO 1YTZC 2V53A 1A29A 4CPVA 1XFYO 4QJ4B 4E68A 1GJYA 2L51A 1B8RA 1UUSA 2BECA 2JT3A 2K2AA 3VGOA 1CLBA 4NDCA 1DGVA 2KOTA 3DF0B 2KSPA 1QIVA 4MBEA 3KF9A 1M31A 2F2OA 3D0YB 1BU3A 1UHJA 5KTYA 3WNXB 1LXFC 1CFFA 1MUXA 3PN7C 2O60A 3NSKA 2HF5A 1BODA 2JWWA 2A4JA 4PE1A 4ORCB 3VRPA 5HKYA 1J7RA 1KFUS 4DRWA 2P6BB 1FI5A 3ZWHA 1DJXA 1DJZA 2LMVA 4PCWA 5KU1A 5ER4X 3K21A 1QVIY 2KAVA 2L5XB 4OR9B 4BY5A 2EC6B 1CM4A 1WRLA 1X02A 2KAYA 1GGZA 1BR1B 1IJ6A 1K95A 1U5IB 2COLB 2H61A 5FYXA 1YVHA 1M45A 3VROA 4GUKA 3ZNIA 4FTGA 1G33A 3OB1B 1S3PA 2HPSA 2F3ZA 4I5NB 1C7VA 1CMGA 1DTLA 1ODBA 3BUWB 1E8AA 2B1UA 1QLSA 5AFPA 5HKWA 4DIRA 1SCMB 3DF0A 2KQ6A 1N0YA 2KNEA 1UHIA 1XYDA 3I5IB 3O4YA 2AUCA 3AAJA 3GK2A 4GAOA 3DVEA 1PVAA 1NX3A 2Y4QA 4YBHB 4AQJA 3D0YA 4MRXA 3RLZA 1PULA 4HSZA 2LLUA 1KSMA 1XA5A 2JT0A 4YI9A 5GQQC 1QIWA 3BQ3A 1QV0A 1DJWA 1WDCB 1KQMB 3BXKA 1FW4A 4PE7A 1MQ1A 1SR6C 1OSAA 2JOJA 2HQWA 1K9KA 4I5KA 2I2RE 1QX5B 1NX1A 3CZTX 1DGUA 1J55A 2LVJA 2WC8A 3NSIA 4PHMA 2BE6A 4USLA 2KYCA 5D7FA 4M2OA 3NXAA 2GGMA 1IQ5A 1S6CA 1U5IA 1F70A 2G9BA 1CNPA 1K96A 1R6PA 1CLLA 2CT9A 3SG2A 1UHKA 3TDZA 4PDZA 1YX8A 3SJSA 1DJIA 5IBWA 4PHJA 1DT7B 4OKHA 1ALVA 1CKKA 1M39A 1MR8A 4MZJA 4XYNA 1IWQA 3PATA 1CTRA 4OVNF 2EHBA 1KCYA 3JTDC 1XK4C 2ZRSA 1WLMA 2H2KA 1DMOA 2CTNA 1RROA 2MLEC 1EH2A 4M2PA 1PVBA 1NCYA 1TRFA 1D1OA 5HKZA 1ZFSA 2JTTA 1YVLA 5DKRA 1A2XA 2ZKMX 4PHKA 3M0WA 3SG7A 1TNWA 4YGEB 2I7AA 2IS9A 1S1EA 4ORAB 3TUYC 1B47A 1JFKA 2CCMA 1JBAA 1EXRA 2L2EA 2VRGA 3D10A 1TNQA 5BPJA 3AKBA 1WLZA 2NCOA 3CTNA 5D69A 2F2PA 2F33A 1UHHA 2K7OA 2QACA 2HETA 2FCDA 1G8IA 2LVKA 2MAZA 4YGDB 1K94A 1SPYA 1V1GA 2KI6D 3PN7B 3EK7A 5DKQA 4YGAA 4F0ZB 1Y1XA 4Q04A 1IH0A 2M0RA 1JUOA 5JJGA 4JWQA 2LHLA 4MZLA 4GGFA 1SL8A 1Y1AA 3CR5X 3OX6A 2OTGC 4MEWA 4MSPA 4YI8A 5K89A 1OMRA 2BKIB 4L9MA 4ZCUA 4GBAA 1Y6WA 2RGIA 2ZNEA 3HCMA 1MXEA 1ZMZA 1KWOC 3IF7A 2M97A 5CSIA 4QJ3B 3SG6A 2M9GA 2M1UA 2CNPA 1PALA 2Y5IA 1F8HA 2JT8A 1BMOA 1YRTB 2PALA 2SCPA 3OX5A 3OP0A 4WQ3A 1A75B 2KI6C 2EGDA 3TS5C 1CDMA 1RK9A 1YUTA 2KBMA 3DVMA 3FIAA 1CB1A 1QTXA 1QXPA 1QX7A 2K7DA 3BUXB 1ZACA 1NYAA 1LINA 2K0JA 1XFUO 1RTP1 2AMIA
chains in the Genus database with same CATH superfamily
1KFXL 2KAXA 2LC5A 3B86A 1TTXA 3DVJA 1TNPA 1J7OA 1PK0D 3AKAA 3WXAA 1DJHA 4OCIA 2JU0A 1SK6D 3LLEA 2LLSA 1CFPA 1SW8A 2K7CA 2KQYA 3A8RA 3MSEB 3EK4A 1WRZA 3DVKA 4D1EA 5FI2A 1ZOTB 2E30A 2WNDA 1GQMA 5G08A 1J1EA 1F55A 1YUUA 1QX2A 3D77A 1IJ5A 2O5GA 3PSRA 3BFHA 3O78A 4WRIA 2M29A 1A75A 3JTDB 2WC5A 3R1PA 1M46A 3NSOA 3B88A 1ZUZA 1UURA 2WCBA 4DCKA 1L7ZA 4DS7A 2GGZA 4A4BA 1N65A 1IGVA 3PM8A 2LCPA 4FQTA 3EVUA 4INXA 5CPVA 2WCHA 2NZ0A 2BCAA 2L4IA 4OV2A 2BBMA 2LUCA 2LAPA 2ISDA 4C0LA 1H4BA 1NIWA 4AQIA 2E6WA 2PRUA 1KK8C 1C07A 1PSRA 3IQOA 3PFVA 2MA2A 1GM0A 2CBLA 1Q80A 1OOFA 5JOLA 1N2DA 4KYNA 2KLEA 4UPGA 2M1KB 1HT9A 1W7JB 3CR2A 1UHNA 1WRKA 1ALWA 2FJUB 1AVSA 1LA0A 3TUYB 1R2UA 2JRFA 3RM1A 4GFTA 3FE8A 2JTZA 1XVJA 1LS8A 2LHIA 3H4SE 2KPHA 4JPZB 1YR5A 5FI6A 5I2QA 1Z2CB 1K8UA 2KGRA 2LVVA 1YRUB 3QRXA 1LA3A 3S0DA 1OMDA 1CLMA 1SCMC 5DICA 4DUQA 2BE4A 4JQ0D 1J7PA 2KI4B 3F45A 1OOJA 2JXCA 4YGCB 2FCEA 1JFJA 2KFGA 4IJ7A 3PLFB 1KSOA 1XK4A 3KPXA 1J7QA 1K9PA 2NXQA 1XFRA 2JULA 2L0PA 4C0KA 5HLVA 1KQMC 1VRKA 3EK8A 2M49B 2ZRTA 4CIDA 1OOGA 3OB2B 2FOTA 1BOCA 1HQVA 2LM5A 1AUIB 3DXLA 1FF1A 2F3YA 1K90D 2MBXA 1SKTA 3R1VA 1QS7A 2WCLA 2OTGB 3KHEA 1B7TZ 4CLNA 3PALA 2KHNA 3PJIA 4XJKA 1BJFA 1UWOA 2Q91A 3I5HC 2P71A 1L2OC 1RWYA 4YGBB 1BR4B 1MXLC 2JNXA 1NCXA 2DOQA 5AXIA 5ER5A 1BF5A 2HQ8A 2GTEA 2M7NA 4U8DA 1BT6A 2MRDA 2JPTA 4R1EA 4P2YB 1XFWO 3GK1A 2KYFA 4TNCA 2OS8C 4HRHA 2PVBA 3BUOB 1DQEA 5AERA 4GNKB 3NHTA 3TS5B 1QATA 4YRUA 1PRWA 2AAOA 2FJYA 2JNFA 1F71A 2ZNDA 1KFXS 4C0JA 1AJ5A 3WHTB 2P70A 1FBVA 3QMEA 1EG3A 3E3RA 1MHOA 1TN4A 4BY4A 2R2IA 5CSFA 3I5FC 5CSNA 5I2LA 1B7TY 1TWOA 5B8IB 1XO5A 3SS5A 2OPOA 3C1VA 1TCOB 3FE6A 2JQ6A 1AHRA 1CM1A 1SCVA 2KGBC 3O4XA 3SS4A 1AK8A 3IQQA 2BKHB 2L2CA 3DZTA 1FI6A 2LUXA 1OOHA 2LE9B 3FS7A 3L4LA 3I5GC 3O2PA 2K61A 1CMFA 1LVCD 2BNXA 1RECA 1SL7A 2LANA 3LL8B 3OBVA 3JVTC 3SG5A 1WY9A 2L50A 3ICBA 2KDHA 1A03A 4N1FA 2Y1MA 1YURA 2L4HA 2QEHA 2BL0C 1SR6B 3FWCA 1C3ZA 1RFJA 2WOSA 2YGUA 4M2QA 1F54A 1TNXA 1B8CA 4MRYA 2M3WA 2KBIA 1IKUA 1Y0VH 2LVIA 1JF0A 4INWA 4PE0A 4AOMA 1KQVA 2PASA 3VRNA 1A4PA 1SBJA 1K9UA 4MZKA 1MWNA 3KO0A 4NDBA 1DF0B 1SNLA 2LLTA 2G2BA 2H61C 4N5XA 5HYDA 5DKNA 3FWBA 1KK7Z 3S0BA 1AJ4A 3GOFA 3O6BA 4ORBB 1KK8B 3LCPC 4NQGA 3CWGA 1CDNA 1V1FA 5HL1A 1YUSA 3NGVA 1QJTA 1QV1A 3CS1A 1NX2A 1XFVO 2WCFA 5EL2A 3CGAA 1B4CA 1Y1UA 4GGNA 2Y1NA 1JWDA 3TZ1A 3N7HA 4A4CA 3TDUA 1G4YR 2I94A 3K1EA 4HRGA 2M7LA 2SASA 3CYZA 3GK4X 2MLFC 1DELA 4PT1A 3S0AA 1GGWA 3SG4A 1EG4A 1NPQA 1UP5A 3B87A 4JD9A 2K2FA 3LK0A 5CSJA 4CFQA 3HX4A 1SY9A 4WQ2A 2LMTA 5FI7A 1DEKA 1S5GZ 1CDLA 2LV7A 4HREE 1KK7Y 1OQPA 3BUNB 2WCEA 2EC6C 1B9AA 1DJGA 1DF0A 1NP8A 2JC2A 2L98A 1KFUL 4XJKB 2BCXA 5I2OA 1MF8B 2LP2A 1BG1A 1OE9B 2KLDA 1EL4A 1SYMA 3R1OA 2MHHA 4PE4A 4FQOA 3CR4X 3IVTA 4IL1A 1RJVA 1C7WA 4N1GA 3D73A 1ORGA 4ZCVA 1NWDA 1TUJA 3I5HB 3I5IC 1L2OB 1SSEB 1S36A 1M63B 2BBNA 2ZFDA 3BUMB 3CZ1A 3BOWB 4I5JA 2MJWB 3UNWA 4GPLB 3KEVA 2F8PA 1F4OA 1H8BA 3NSLA 1J1DA 3L4AA 1SMGA 2K7BA 3AAKA 3EKJA 2LNKA 1WDCC 1F4QA 1S5GY 2D8NA 4CFRA 2OS8B 1OMVA 2JZIA 1YX7A 1SL9A 1XFXO 5AEQA 2I18A 3BYAA 1CFDA 3PM2A 3EVRA 1W7IB 1S6IA 2GV5A 3OHMB 3DYEA 4MN0A 2K8MB 5J3XA 1K2HA 2LP3A 1B8LA 1OZSA 1DVIA 2H8VA 2NCPA 1QWVA 4NDDA 2PYQA 1S6JA 2TN4A 3I5FB 2NLNA 2KFFA 3RZSA 1EJ3A 1KWOB 4P5OE 2JXLA 3SS3A 1OZOA 1QLKA 2WORA 1CDPA 1K93D 1TCFA 2CXJA 3VRRA 4ETOA 3CLNA 3B6XA 1AP4A 4ICBA 3S0EA 3SIBA 1IQ3A 2KFHA 3EKHA 4I5LB 3I5GB 1SRAA 2QPTA 1TUZA 1B1GA 2M8UA 2WC6A 3BOWA 4QJ5B 3DD4A 1IRJA 3EVVA 3JVTB 5HLOA 3SG3A 2PSRA 5PALA 1NX0A 1PSBA 1TIZA 1LKJA 2BL0B 3VRQA 1JSAA 3TDIA 2LMUA 4PALA 1BLQA 2BCBA 4PHNA 3WHUB 1QASA 2KI4C 4GGFC 1T14A 2ZN9A 1NSHA 1JF2A 5KSZA 1JC2A 1NUBA 4MLWA 3A4UB 5AANA 3SIAA 1NCZA 5F6TA 1IG5A 2PMYA 1TOPA 4JKTA 1FPWA 2Q4UA 1DJYA 3LK1A 4MVFA 1CFCA 1S26D 2ZN8A 1QVIZ 5TNCA 1XFZO 1YTZC 2V53A 1A29A 4CPVA 1XFYO 4QJ4B 4E68A 1GJYA 2L51A 3D78A 3Q8IA 1B8RA 1UUSA 2BECA 2JT3A 2K2AA 3VGOA 1CLBA 4NDCA 1DGVA 2KOTA 3DF0B 2KSPA 1QIVA 4MBEA 2QDIA 2PQLA 3KF9A 1M31A 1W9ZA 5I94A 2F2OA 3D0YB 1BU3A 1UHJA 5KTYA 3WNXB 1LXFC 1CFFA 1OOIX 1MUXA 3PN7C 2ERBA 2O60A 3NSKA 2HF5A 3S0GA 1BODA 2JWWA 2A4JA 4PE1A 4ORCB 3VRPA 5HKYA 1J7RA 1KFUS 4DRWA 2P6BB 1FI5A 3ZWHA 1DJXA 1DJZA 2LMVA 4PCWA 5KU1A 5ER4X 3K21A 1QVIY 2KAVA 2L5XB 4OR9B 4BY5A 2EC6B 1CM4A 1WRLA 1X02A 2KAYA 1GGZA 3BJHA 1BR1B 1IJ6A 1K95A 1U5IB 2COLB 2H61A 2QEVA 5FYXA 1YVHA 3V2LA 1M45A 3VROA 4GUKA 3ZNIA 4FTGA 1G33A 3OB1B 1S3PA 2HPSA 2F3ZA 4I5NB 1C7VA 1CMGA 1DTLA 1ODBA 3BUWB 1E8AA 2B1UA 1QLSA 5AFPA 5HKWA 4DIRA 1SCMB 3DF0A 2KQ6A 1N0YA 2KNEA 1UHIA 1XYDA 3CDNA 3I5IB 3O4YA 2AUCA 3AAJA 3GK2A 4GAOA 1P28A 3DVEA 1PVAA 1NX3A 2Y4QA 4YBHB 4AQJA 3D0YA 4MRXA 3RLZA 1PULA 3R72A 4HSZA 2LLUA 1KSMA 1XA5A 2JT0A 4YI9A 5GQQC 1QIWA 3BQ3A 1QV0A 1DJWA 4F7FA 1WDCB 2L5YA 1KQMB 3BXKA 1FW4A 4PE7A 1MQ1A 1SR6C 1OSAA 2JOJA 3L47A 2HQWA 1K9KA 4I5KA 2I2RE 1QX5B 1NX1A 3CZTX 1DGUA 3D75A 1J55A 2LVJA 2WC8A 3NSIA 4PHMA 2BE6A 4USLA 2K60A 2KYCA 5D7FA 4M2OA 2JPOA 2GGMA 1IQ5A 1S6CA 1U5IA 3NXAA 1F70A 2G9BA 1CNPA 1K96A 1R6PA 3NHIA 4OZDA 1CLLA 2CT9A 1DC1A 3SG2A 1UHKA 3TDZA 4PDZA 1YX8A 3SJSA 1DJIA 5IBWA 4PHJA 1DT7B 4OKHA 1ALVA 1CKKA 1M39A 1MR8A 4MZJA 4XYNA 1IWQA 3PATA 1CTRA 4OVNF 2EHBA 3CABA 1KCYA 3JTDC 3CZ0A 1XK4C 2ZRSA 1WLMA 2H2KA 1DMOA 3D76A 3OGNA 2CTNA 1RROA 2MLEC 1EH2A 4M2PA 1PVBA 1NCYA 1TRFA 1D1OA 5HKZA 1ZFSA 2JTTA 1YVLA 3BFBA 5DKRA 1A2XA 2ZKMX 4PHKA 3DY9A 3M0WA 3SG7A 1TNWA 4YGEB 1C3YA 2I7AA 2IS9A 1S1EA 4ORAB 3TUYC 1B47A 1JFKA 2CCMA 1JBAA 1EXRA 2L2EA 2VRGA 3D10A 3S0FA 3FE9A 1TNQA 5BPJA 3AKBA 1WLZA 2NCOA 3CTNA 2BAPA 2F2PA 5D69A 2F33A 1UHHA 2K7OA 2QACA 2HETA 2FCDA 1G8IA 5D3OA 2LVKA 2MAZA 4YGDB 1K94A 1SPYA 1V1GA 2KI6D 3BFAA 3PN7B 3EK7A 5DKQA 4YGAA 4F0ZB 1Y1XA 4Q04A 1IH0A 2M0RA 1JUOA 2WCMA 5JJGA 4JWQA 2LHLA 4MZLA 4GGFA 1SL8A 1Y1AA 3CR5X 3UO9A 1Z4HA 3CZ2A 3OX6A 3VB1A 2OTGC 4MEWA 4MSPA 4YI8A 5K89A 1OMRA 2BKIB 4L9MA 4ZCUA 3D74A 4GBAA 1Y6WA 2RGIA 2ZNEA 2QEBA 1IIOA 3EG5B 2WCJA 3HCMA 1MXEA 1ZMZA 1KWOC 3IF7A 2M97A 5CSIA 4QJ3B 5I8NA 3SG6A 2QEOA 2M9GA 2M1UA 2CNPA 1PALA 2Y5IA 1F8HA 2JT8A 1BMOA 1YRTB 2PALA 2SCPA 3OX5A 3OP0A 4WQ3A 1A75B 2KI6C 2EGDA 3TS5C 1CDMA 1RK9A 1YUTA 2KBMA 3DVMA 3FIAA 1CB1A 1QTXA 1QXPA 1QX7A 2K7DA 3BUXB 1OW4A 1ZACA 1NYAA 1LINA 2K0JA 3B7AA 1XFUO 2WCKA 1RTP1 2AMIA
chains in the Genus database with same CATH topology
1KFXL 2KAXA 2LC5A 1TTXA 3DVJA 1TNPA 1J7OA 1PK0D 3AKAA 3WXAA 1DJHA 4OCIA 2JU0A 1SK6D 3LLEA 2LLSA 1CFPA 1SW8A 2K7CA 2KQYA 3A8RA 3MSEB 3EK4A 1WRZA 3DVKA 4D1EA 1ZOTB 2E30A 2WNDA 1GQMA 5G08A 1J1EA 1F55A 1YUUA 1QX2A 1IJ5A 2O5GA 3PSRA 3O78A 4WRIA 2M29A 1A75A 3JTDB 1M46A 3NSOA 1ZUZA 1UURA 2WCBA 4DCKA 1L7ZA 4DS7A 2GGZA 4A4BA 1N65A 1IGVA 3PM8A 2LCPA 5CPVA 3EVUA 2NZ0A 2BCAA 2L4IA 4OV2A 2BBMA 2LUCA 2LAPA 2ISDA 4C0LA 1H4BA 1NIWA 4AQIA 2E6WA 2PRUA 1KK8C 1C07A 1PSRA 3IQOA 3PFVA 2MA2A 2CBLA 1Q80A 5JOLA 1N2DA 4UPGA 2M1KB 1HT9A 1W7JB 3CR2A 1UHNA 1WRKA 1ALWA 2FJUB 1AVSA 1LA0A 3TUYB 1R2UA 2JRFA 3RM1A 4GFTA 2JTZA 1XVJA 2LHIA 3H4SE 4JPZB 1YR5A 5I2QA 1K8UA 2KGRA 2LVVA 1YRUB 3QRXA 1LA3A 1OMDA 1CLMA 1SCMC 4DUQA 2BE4A 4JQ0D 1J7PA 2KI4B 3F45A 1OOJA 2JXCA 4YGCB 2FCEA 1JFJA 2KFGA 3PLFB 1KSOA 1XK4A 3KPXA 1J7QA 1K9PA 2NXQA 2JULA 2L0PA 4C0KA 5HLVA 1KQMC 1VRKA 3EK8A 2M49B 2ZRTA 4CIDA 3OB2B 1BOCA 2FOTA 1HQVA 2LM5A 1AUIB 1FF1A 2F3YA 1K90D 2MBXA 1SKTA 1QS7A 2OTGB 3KHEA 1B7TZ 4CLNA 3PALA 2KHNA 4XJKA 1BJFA 1UWOA 2Q91A 3I5HC 1L2OC 1RWYA 4YGBB 1BR4B 1MXLC 2JNXA 1NCXA 2DOQA 5AXIA 5ER5A 1BF5A 2HQ8A 2M7NA 4U8DA 1BT6A 2MRDA 2JPTA 4R1EA 4P2YB 1XFWO 3GK1A 2KYFA 4TNCA 2OS8C 4HRHA 2PVBA 3BUOB 5AERA 4GNKB 3TS5B 1QATA 4YRUA 1PRWA 2AAOA 2JNFA 1F71A 2ZNDA 1KFXS 4C0JA 1AJ5A 3WHTB 1FBVA 1EG3A 3E3RA 1MHOA 1TN4A 4BY4A 2R2IA 5CSFA 3I5FC 5CSNA 5I2LA 1B7TY 5B8IB 1XO5A 2OPOA 3C1VA 1TCOB 2JQ6A 1AHRA 1CM1A 1SCVA 2KGBC 1AK8A 3IQQA 2BKHB 1FI6A 2LUXA 2LE9B 3FS7A 3I5GC 3O2PA 2K61A 1CMFA 1LVCD 1RECA 1SL7A 2LANA 3LL8B 3JVTC 3SG5A 1WY9A 2L50A 3ICBA 2KDHA 1A03A 4N1FA 2Y1MA 1YURA 2L4HA 2BL0C 1SR6B 3FWCA 2WOSA 1RFJA 4M2QA 1F54A 1TNXA 1B8CA 4MRYA 2M3WA 2KBIA 1IKUA 1Y0VH 2LVIA 1JF0A 4PE0A 4AOMA 1KQVA 2PASA 3VRNA 1A4PA 1SBJA 1K9UA 4MZKA 1MWNA 3KO0A 4NDBA 1DF0B 1SNLA 2LLTA 2G2BA 2H61C 4N5XA 5HYDA 5DKNA 3FWBA 1KK7Z 1AJ4A 3GOFA 3O6BA 4ORBB 1KK8B 3LCPC 4NQGA 3CWGA 1CDNA 1V1FA 1YUSA 1QJTA 1QV1A 3CS1A 1NX2A 1XFVO 2WCFA 3CGAA 1B4CA 1Y1UA 4GGNA 2Y1NA 1JWDA 3TZ1A 4A4CA 3TDUA 1G4YR 2I94A 4HRGA 2M7LA 2SASA 3GK4X 2MLFC 1GGWA 3SG4A 1EG4A 1NPQA 1UP5A 5CSJA 4CFQA 2K2FA 3LK0A 5I8NA 3HX4A 1SY9A 4WQ2A 2LMTA 1S5GZ 1CDLA 2LV7A 4HREE 1KK7Y 1OQPA 3BUNB 2WCEA 2EC6C 1B9AA 1DJGA 1DF0A 1NP8A 2JC2A 2L98A 1KFUL 4XJKB 2BCXA 5I2OA 1MF8B 2LP2A 1BG1A 1OE9B 1EL4A 1SYMA 2MHHA 4PE4A 4FQOA 3CR4X 4IL1A 1RJVA 1C7WA 4N1GA 4ZCVA 1NWDA 3I5HB 3I5IC 1L2OB 1S36A 1M63B 2BBNA 2ZFDA 3BUMB 4I5JA 3BOWB 2MJWB 4GPLB 3KEVA 2F8PA 1F4OA 1H8BA 3NSLA 1J1DA 1SMGA 2K7BA 3AAKA 3EKJA 2LNKA 1WDCC 1F4QA 1S5GY 2D8NA 4CFRA 2OS8B 1OMVA 2JZIA 1YX7A 1SL9A 1XFXO 5AEQA 2I18A 3BYAA 1CFDA 4MN0A 3EVRA 1W7IB 1S6IA 2GV5A 3OHMB 5J3XA 5PALA 2K8MB 1K2HA 2LP3A 1B8LA 1OZSA 1DVIA 2NCPA 4NDDA 3I5FB 1S6JA 2TN4A 2NLNA 2KFFA 1EJ3A 1KWOB 4P5OE 2JXLA 1OZOA 1QLKA 2WORA 1CDPA 1K93D 1TCFA 2CXJA 3VRRA 4ETOA 3CLNA 1AP4A 4ICBA 3SIBA 1IQ3A 2KFHA 3EKHA 4I5LB 3I5GB 1SRAA 2QPTA 1B1GA 2M8UA 3BOWA 4QJ5B 3DD4A 1IRJA 3EVVA 3JVTB 5HLOA 3SG3A 2PSRA 1NX0A 1PSBA 1TIZA 1LKJA 2BL0B 3VRQA 1JSAA 3TDIA 2LMUA 4PALA 1BLQA 2BCBA 4PHNA 3WHUB 1QASA 2KI4C 4GGFC 2ZN9A 1NSHA 1JF2A 5KSZA 1JC2A 1NUBA 4MLWA 3A4UB 5AANA 3SIAA 1NCZA 5F6TA 1IG5A 2PMYA 1TOPA 1FPWA 2Q4UA 1DJYA 3LK1A 4MVFA 1CFCA 1S26D 2ZN8A 1QVIZ 5TNCA 1XFZO 1YTZC 2V53A 1A29A 4CPVA 1XFYO 4QJ4B 4E68A 1GJYA 2L51A 1B8RA 1UUSA 2BECA 2JT3A 2K2AA 3VGOA 1CLBA 4NDCA 1DGVA 2KOTA 3DF0B 2KSPA 1QIVA 4MBEA 3KF9A 1M31A 2F2OA 3D0YB 1BU3A 1UHJA 5KTYA 3WNXB 1LXFC 1CFFA 1MUXA 3PN7C 2O60A 3NSKA 2HF5A 1BODA 2JWWA 2A4JA 4PE1A 4ORCB 3VRPA 5HKYA 1J7RA 1KFUS 4DRWA 2P6BB 1FI5A 3ZWHA 1DJXA 1DJZA 2LMVA 4PCWA 5KU1A 5ER4X 3K21A 1QVIY 2KAVA 2L5XB 4OR9B 4BY5A 2EC6B 1CM4A 1WRLA 1X02A 2KAYA 1GGZA 1BR1B 1IJ6A 1K95A 1U5IB 2COLB 2H61A 5FYXA 1YVHA 1M45A 3VROA 4GUKA 3ZNIA 4FTGA 1G33A 3OB1B 1S3PA 2HPSA 2F3ZA 4I5NB 1C7VA 1CMGA 1DTLA 1ODBA 3BUWB 1E8AA 2B1UA 1QLSA 5AFPA 5HKWA 4DIRA 1SCMB 3DF0A 2KQ6A 1N0YA 2KNEA 1UHIA 1XYDA 3I5IB 3O4YA 2AUCA 3AAJA 3GK2A 4GAOA 3DVEA 1PVAA 1NX3A 2Y4QA 4YBHB 4AQJA 3D0YA 4MRXA 3RLZA 1PULA 4HSZA 2LLUA 1KSMA 1XA5A 2JT0A 4YI9A 5GQQC 1QIWA 3BQ3A 1QV0A 1DJWA 1WDCB 1KQMB 3BXKA 1FW4A 4PE7A 1MQ1A 1SR6C 1OSAA 2JOJA 2HQWA 1K9KA 4I5KA 2I2RE 1QX5B 1NX1A 3CZTX 1DGUA 1J55A 2LVJA 2WC8A 3NSIA 4PHMA 2BE6A 4USLA 2KYCA 5D7FA 4M2OA 3NXAA 2GGMA 1IQ5A 1S6CA 1U5IA 1F70A 2G9BA 1CNPA 1K96A 1R6PA 1CLLA 2CT9A 3SG2A 1UHKA 3TDZA 4PDZA 1YX8A 3SJSA 1DJIA 5IBWA 4PHJA 1DT7B 4OKHA 1ALVA 1CKKA 1M39A 1MR8A 4MZJA 4XYNA 1IWQA 3PATA 1CTRA 4OVNF 2EHBA 1KCYA 3JTDC 1XK4C 2ZRSA 1WLMA 2H2KA 1DMOA 2CTNA 1RROA 2MLEC 1EH2A 4M2PA 1PVBA 1NCYA 1TRFA 1D1OA 5HKZA 1ZFSA 2JTTA 1YVLA 5DKRA 1A2XA 2ZKMX 4PHKA 3M0WA 3SG7A 1TNWA 4YGEB 2I7AA 2IS9A 1S1EA 4ORAB 3TUYC 1B47A 1JFKA 2CCMA 1JBAA 1EXRA 2L2EA 2VRGA 3D10A 1TNQA 5BPJA 3AKBA 1WLZA 2NCOA 3CTNA 5D69A 2F2PA 2F33A 1UHHA 2K7OA 2QACA 2HETA 2FCDA 1G8IA 2LVKA 2MAZA 4YGDB 1K94A 1SPYA 1V1GA 2KI6D 3PN7B 3EK7A 5DKQA 4YGAA 4F0ZB 1Y1XA 4Q04A 1IH0A 2M0RA 1JUOA 5JJGA 4JWQA 2LHLA 4MZLA 4GGFA 1SL8A 1Y1AA 3CR5X 3OX6A 2OTGC 4MEWA 4MSPA 4YI8A 5K89A 1OMRA 2BKIB 4L9MA 4ZCUA 4GBAA 1Y6WA 2RGIA 2ZNEA 3HCMA 1MXEA 1ZMZA 1KWOC 3IF7A 2M97A 5CSIA 4QJ3B 3SG6A 2M9GA 2M1UA 2CNPA 1PALA 2Y5IA 1F8HA 2JT8A 1BMOA 1YRTB 2PALA 2SCPA 3OX5A 3OP0A 4WQ3A 1A75B 2KI6C 2EGDA 3TS5C 1CDMA 1RK9A 1YUTA 2KBMA 3DVMA 3FIAA 1CB1A 1QTXA 1QXPA 1QX7A 2K7DA 3BUXB 1ZACA 1NYAA 1LINA 2K0JA 1XFUO 1RTP1 2AMIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KFX L;  2KAX A;  2LC5 A;  1TTX A;  3DVJ A;  1TNP A;  1J7O A;  1PK0 D;  3AKA A;  3WXA A;  1DJH A;  4OCI A;  2JU0 A;  1SK6 D;  3LLE A;  2LLS A;  1CFP A;  1SW8 A;  2K7C A;  2KQY A;  3A8R A;  3MSE B;  3EK4 A;  1WRZ A;  3DVK A;  4D1E A;  1ZOT B;  2E30 A;  2WND A;  1GQM A;  5G08 A;  1J1E A;  1F55 A;  1YUU A;  1QX2 A;  1IJ5 A;  2O5G A;  3PSR A;  3O78 A;  4WRI A;  2M29 A;  1A75 A;  3JTD B;  1M46 A;  3NSO A;  1ZUZ A;  1UUR A;  2WCB A;  4DCK A;  1L7Z A;  4DS7 A;  2GGZ A;  4A4B A;  1N65 A;  1IGV A;  3PM8 A;  2LCP A;  5CPV A;  3EVU A;  2NZ0 A;  2BCA A;  2L4I A;  4OV2 A;  2BBM A;  2LUC A;  2LAP A;  2ISD A;  4C0L A;  1H4B A;  1NIW A;  4AQI A;  2E6W A;  2PRU A;  1KK8 C;  1C07 A;  1PSR A;  3IQO A;  3PFV A;  2MA2 A;  2CBL A;  1Q80 A;  5JOL A;  1N2D A;  4UPG A;  2M1K B;  1HT9 A;  1W7J B;  3CR2 A;  1UHN A;  1WRK A;  1ALW A;  2FJU B;  1AVS A;  1LA0 A;  3TUY B;  1R2U A;  2JRF A;  3RM1 A;  4GFT A;  2JTZ A;  1XVJ A;  2LHI A;  3H4S E;  4JPZ B;  1YR5 A;  5I2Q A;  1K8U A;  2KGR A;  2LVV A;  1YRU B;  3QRX A;  1LA3 A;  1OMD A;  1CLM A;  1SCM C;  4DUQ A;  2BE4 A;  4JQ0 D;  1J7P A;  2KI4 B;  3F45 A;  1OOJ A;  2JXC A;  4YGC B;  2FCE A;  1JFJ A;  2KFG A;  3PLF B;  1KSO A;  1XK4 A;  3KPX A;  1J7Q A;  1K9P A;  2NXQ A;  2JUL A;  2L0P A;  4C0K A;  5HLV A;  1KQM C;  1VRK A;  3EK8 A;  2M49 B;  2ZRT A;  4CID A;  3OB2 B;  1BOC A;  2FOT A;  1HQV A;  2LM5 A;  1AUI B;  1FF1 A;  2F3Y A;  1K90 D;  2MBX A;  1SKT A;  1QS7 A;  2OTG B;  3KHE A;  1B7T Z;  4CLN A;  3PAL A;  2KHN A;  4XJK A;  1BJF A;  1UWO A;  2Q91 A;  3I5H C;  1L2O C;  1RWY A;  4YGB B;  1BR4 B;  1MXL C;  2JNX A;  1NCX A;  2DOQ A;  5AXI A;  5ER5 A;  1BF5 A;  2HQ8 A;  2M7N A;  4U8D A;  1BT6 A;  2MRD A;  2JPT A;  4R1E A;  4P2Y B;  1XFW O;  3GK1 A;  2KYF A;  4TNC A;  2OS8 C;  4HRH A;  2PVB A;  3BUO B;  5AER A;  4GNK B;  3TS5 B;  1QAT A;  4YRU A;  1PRW A;  2AAO A;  2JNF A;  1F71 A;  2ZND A;  1KFX S;  4C0J A;  1AJ5 A;  3WHT B;  1FBV A;  1EG3 A;  3E3R A;  1MHO A;  1TN4 A;  4BY4 A;  2R2I A;  5CSF A;  3I5F C;  5CSN A;  5I2L A;  1B7T Y;  5B8I B;  1XO5 A;  2OPO A;  3C1V A;  1TCO B;  2JQ6 A;  1AHR A;  1CM1 A;  1SCV A;  2KGB C;  1AK8 A;  3IQQ A;  2BKH B;  1FI6 A;  2LUX A;  2LE9 B;  3FS7 A;  3I5G C;  3O2P A;  2K61 A;  1CMF A;  1LVC D;  1REC A;  1SL7 A;  2LAN A;  3LL8 B;  3JVT C;  3SG5 A;  1WY9 A;  2L50 A;  3ICB A;  2KDH A;  1A03 A;  4N1F A;  2Y1M A;  1YUR A;  2L4H A;  2BL0 C;  1SR6 B;  3FWC A;  2WOS A;  1RFJ A;  4M2Q A;  1F54 A;  1TNX A;  1B8C A;  4MRY A;  2M3W A;  2KBI A;  1IKU A;  1Y0V H;  2LVI A;  1JF0 A;  4PE0 A;  4AOM A;  1KQV A;  2PAS A;  3VRN A;  1A4P A;  1SBJ A;  1K9U A;  4MZK A;  1MWN A;  3KO0 A;  4NDB A;  1DF0 B;  1SNL A;  2LLT A;  2G2B A;  2H61 C;  4N5X A;  5HYD A;  5DKN A;  3FWB A;  1KK7 Z;  1AJ4 A;  3GOF A;  3O6B A;  4ORB B;  1KK8 B;  3LCP C;  4NQG A;  3CWG A;  1CDN A;  1V1F A;  1YUS A;  1QJT A;  1QV1 A;  3CS1 A;  1NX2 A;  1XFV O;  2WCF A;  3CGA A;  1B4C A;  1Y1U A;  4GGN A;  2Y1N A;  1JWD A;  3TZ1 A;  4A4C A;  3TDU A;  1G4Y R;  2I94 A;  4HRG A;  2M7L A;  2SAS A;  3GK4 X;  2MLF C;  1GGW A;  3SG4 A;  1EG4 A;  1NPQ A;  1UP5 A;  5CSJ A;  4CFQ A;  2K2F A;  3LK0 A;  5I8N A;  3HX4 A;  1SY9 A;  4WQ2 A;  2LMT A;  1S5G Z;  1CDL A;  2LV7 A;  4HRE E;  1KK7 Y;  1OQP A;  3BUN B;  2WCE A;  2EC6 C;  1B9A A;  1DJG A;  1DF0 A;  1NP8 A;  2JC2 A;  2L98 A;  1KFU L;  4XJK B;  2BCX A;  5I2O A;  1MF8 B;  2LP2 A;  1BG1 A;  1OE9 B;  1EL4 A;  1SYM A;  2MHH A;  4PE4 A;  4FQO A;  3CR4 X;  4IL1 A;  1RJV A;  1C7W A;  4N1G A;  4ZCV A;  1NWD A;  3I5H B;  3I5I C;  1L2O B;  1S36 A;  1M63 B;  2BBN A;  2ZFD A;  3BUM B;  4I5J A;  3BOW B;  2MJW B;  4GPL B;  3KEV A;  2F8P A;  1F4O A;  1H8B A;  3NSL A;  1J1D A;  1SMG A;  2K7B A;  3AAK A;  3EKJ A;  2LNK A;  1WDC C;  1F4Q A;  1S5G Y;  2D8N A;  4CFR A;  2OS8 B;  1OMV A;  2JZI A;  1YX7 A;  1SL9 A;  1XFX O;  5AEQ A;  2I18 A;  3BYA A;  1CFD A;  4MN0 A;  3EVR A;  1W7I B;  1S6I A;  2GV5 A;  3OHM B;  5J3X A;  5PAL A;  2K8M B;  1K2H A;  2LP3 A;  1B8L A;  1OZS A;  1DVI A;  2NCP A;  4NDD A;  3I5F B;  1S6J A;  2TN4 A;  2NLN A;  2KFF A;  1EJ3 A;  1KWO B;  4P5O E;  2JXL A;  1OZO A;  1QLK A;  2WOR A;  1CDP A;  1K93 D;  1TCF A;  2CXJ A;  3VRR A;  4ETO A;  3CLN A;  1AP4 A;  4ICB A;  3SIB A;  1IQ3 A;  2KFH A;  3EKH A;  4I5L B;  3I5G B;  1SRA A;  2QPT A;  1B1G A;  2M8U A;  3BOW A;  4QJ5 B;  3DD4 A;  1IRJ A;  3EVV A;  3JVT B;  5HLO A;  3SG3 A;  2PSR A;  1NX0 A;  1PSB A;  1TIZ A;  1LKJ A;  2BL0 B;  3VRQ A;  1JSA A;  3TDI A;  2LMU A;  4PAL A;  1BLQ A;  2BCB A;  4PHN A;  3WHU B;  1QAS A;  2KI4 C;  4GGF C;  2ZN9 A;  1NSH A;  1JF2 A;  5KSZ A;  1JC2 A;  1NUB A;  4MLW A;  3A4U B;  5AAN A;  3SIA A;  1NCZ A;  5F6T A;  1IG5 A;  2PMY A;  1TOP A;  1FPW A;  2Q4U A;  1DJY A;  3LK1 A;  4MVF A;  1CFC A;  1S26 D;  2ZN8 A;  1QVI Z;  5TNC A;  1XFZ O;  1YTZ C;  2V53 A;  1A29 A;  4CPV A;  1XFY O;  4QJ4 B;  4E68 A;  1GJY A;  2L51 A;  1B8R A;  1UUS A;  2BEC A;  2JT3 A;  2K2A A;  3VGO A;  1CLB A;  4NDC A;  1DGV A;  2KOT A;  3DF0 B;  2KSP A;  1QIV A;  4MBE A;  3KF9 A;  1M31 A;  2F2O A;  3D0Y B;  1BU3 A;  1UHJ A;  5KTY A;  3WNX B;  1LXF C;  1CFF A;  1MUX A;  3PN7 C;  2O60 A;  3NSK A;  2HF5 A;  1BOD A;  2JWW A;  2A4J A;  4PE1 A;  4ORC B;  3VRP A;  5HKY A;  1J7R A;  1KFU S;  4DRW A;  2P6B B;  1FI5 A;  3ZWH A;  1DJX A;  1DJZ A;  2LMV A;  4PCW A;  5KU1 A;  5ER4 X;  3K21 A;  1QVI Y;  2KAV A;  2L5X B;  4OR9 B;  4BY5 A;  2EC6 B;  1CM4 A;  1WRL A;  1X02 A;  2KAY A;  1GGZ A;  1BR1 B;  1IJ6 A;  1K95 A;  1U5I B;  2COL B;  2H61 A;  5FYX A;  1YVH A;  1M45 A;  3VRO A;  4GUK A;  3ZNI A;  4FTG A;  1G33 A;  3OB1 B;  1S3P A;  2HPS A;  2F3Z A;  4I5N B;  1C7V A;  1CMG A;  1DTL A;  1ODB A;  3BUW B;  1E8A A;  2B1U A;  1QLS A;  5AFP A;  5HKW A;  4DIR A;  1SCM B;  3DF0 A;  2KQ6 A;  1N0Y A;  2KNE A;  1UHI A;  1XYD A;  3I5I B;  3O4Y A;  2AUC A;  3AAJ A;  3GK2 A;  4GAO A;  3DVE A;  1PVA A;  1NX3 A;  2Y4Q A;  4YBH B;  4AQJ A;  3D0Y A;  4MRX A;  3RLZ A;  1PUL A;  4HSZ A;  2LLU A;  1KSM A;  1XA5 A;  2JT0 A;  4YI9 A;  5GQQ C;  1QIW A;  3BQ3 A;  1QV0 A;  1DJW A;  1WDC B;  1KQM B;  3BXK A;  1FW4 A;  4PE7 A;  1MQ1 A;  1SR6 C;  1OSA A;  2JOJ A;  2HQW A;  1K9K A;  4I5K A;  2I2R E;  1QX5 B;  1NX1 A;  3CZT X;  1DGU A;  1J55 A;  2LVJ A;  2WC8 A;  3NSI A;  4PHM A;  2BE6 A;  4USL A;  2KYC A;  5D7F A;  4M2O A;  3NXA A;  2GGM A;  1IQ5 A;  1S6C A;  1U5I A;  1F70 A;  2G9B A;  1CNP A;  1K96 A;  1R6P A;  1CLL A;  2CT9 A;  3SG2 A;  1UHK A;  3TDZ A;  4PDZ A;  1YX8 A;  3SJS A;  1DJI A;  5IBW A;  4PHJ A;  1DT7 B;  4OKH A;  1ALV A;  1CKK A;  1M39 A;  1MR8 A;  4MZJ A;  4XYN A;  1IWQ A;  3PAT A;  1CTR A;  4OVN F;  2EHB A;  1KCY A;  3JTD C;  1XK4 C;  2ZRS A;  1WLM A;  2H2K A;  1DMO A;  2CTN A;  1RRO A;  2MLE C;  1EH2 A;  4M2P A;  1PVB A;  1NCY A;  1TRF A;  1D1O A;  5HKZ A;  1ZFS A;  2JTT A;  1YVL A;  5DKR A;  1A2X A;  2ZKM X;  4PHK A;  3M0W A;  3SG7 A;  1TNW A;  4YGE B;  2I7A A;  2IS9 A;  1S1E A;  4ORA B;  3TUY C;  1B47 A;  1JFK A;  2CCM A;  1JBA A;  1EXR A;  2L2E A;  2VRG A;  3D10 A;  1TNQ A;  5BPJ A;  3AKB A;  1WLZ A;  2NCO A;  3CTN A;  5D69 A;  2F2P A;  2F33 A;  1UHH A;  2K7O A;  2QAC A;  2HET A;  2FCD A;  1G8I A;  2LVK A;  2MAZ A;  4YGD B;  1K94 A;  1SPY A;  1V1G A;  2KI6 D;  3PN7 B;  3EK7 A;  5DKQ A;  4YGA A;  4F0Z B;  1Y1X A;  4Q04 A;  1IH0 A;  2M0R A;  1JUO A;  5JJG A;  4JWQ A;  2LHL A;  4MZL A;  4GGF A;  1SL8 A;  1Y1A A;  3CR5 X;  3OX6 A;  2OTG C;  4MEW A;  4MSP A;  4YI8 A;  5K89 A;  1OMR A;  2BKI B;  4L9M A;  4ZCU A;  4GBA A;  1Y6W A;  2RGI A;  2ZNE A;  3HCM A;  1MXE A;  1ZMZ A;  1KWO C;  3IF7 A;  2M97 A;  5CSI A;  4QJ3 B;  3SG6 A;  2M9G A;  2M1U A;  2CNP A;  1PAL A;  2Y5I A;  1F8H A;  2JT8 A;  1BMO A;  1YRT B;  2PAL A;  2SCP A;  3OX5 A;  3OP0 A;  4WQ3 A;  1A75 B;  2KI6 C;  2EGD A;  3TS5 C;  1CDM A;  1RK9 A;  1YUT A;  2KBM A;  3DVM A;  3FIA A;  1CB1 A;  1QTX A;  1QXP A;  1QX7 A;  2K7D A;  3BUX B;  1ZAC A;  1NYA A;  1LIN A;  2K0J A;  1XFU O;  1RTP 1;  2AMI A; 
#chains in the Genus database with same CATH topology
 1KFX L;  2KAX A;  2LC5 A;  3B86 A;  1TTX A;  3DVJ A;  1TNP A;  1J7O A;  1PK0 D;  3AKA A;  3WXA A;  1DJH A;  4OCI A;  2JU0 A;  1SK6 D;  3LLE A;  2LLS A;  1CFP A;  1SW8 A;  2K7C A;  2KQY A;  3A8R A;  3MSE B;  3EK4 A;  1WRZ A;  3DVK A;  4D1E A;  5FI2 A;  1ZOT B;  2E30 A;  2WND A;  1GQM A;  5G08 A;  1J1E A;  1F55 A;  1YUU A;  1QX2 A;  3D77 A;  1IJ5 A;  2O5G A;  3PSR A;  3BFH A;  3O78 A;  4WRI A;  2M29 A;  1A75 A;  3JTD B;  2WC5 A;  3R1P A;  1M46 A;  3NSO A;  3B88 A;  1ZUZ A;  1UUR A;  2WCB A;  4DCK A;  1L7Z A;  4DS7 A;  2GGZ A;  4A4B A;  1N65 A;  1IGV A;  3PM8 A;  2LCP A;  4FQT A;  3EVU A;  4INX A;  5CPV A;  2WCH A;  2NZ0 A;  2BCA A;  2L4I A;  4OV2 A;  2BBM A;  2LUC A;  2LAP A;  2ISD A;  4C0L A;  1H4B A;  1NIW A;  4AQI A;  2E6W A;  2PRU A;  1KK8 C;  1C07 A;  1PSR A;  3IQO A;  3PFV A;  2MA2 A;  1GM0 A;  2CBL A;  1Q80 A;  1OOF A;  5JOL A;  1N2D A;  4KYN A;  2KLE A;  4UPG A;  2M1K B;  1HT9 A;  1W7J B;  3CR2 A;  1UHN A;  1WRK A;  1ALW A;  2FJU B;  1AVS A;  1LA0 A;  3TUY B;  1R2U A;  2JRF A;  3RM1 A;  4GFT A;  3FE8 A;  2JTZ A;  1XVJ A;  1LS8 A;  2LHI A;  3H4S E;  2KPH A;  4JPZ B;  1YR5 A;  5FI6 A;  5I2Q A;  1Z2C B;  1K8U A;  2KGR A;  2LVV A;  1YRU B;  3QRX A;  1LA3 A;  3S0D A;  1OMD A;  1CLM A;  1SCM C;  5DIC A;  4DUQ A;  2BE4 A;  4JQ0 D;  1J7P A;  2KI4 B;  3F45 A;  1OOJ A;  2JXC A;  4YGC B;  2FCE A;  1JFJ A;  2KFG A;  4IJ7 A;  3PLF B;  1KSO A;  1XK4 A;  3KPX A;  1J7Q A;  1K9P A;  2NXQ A;  1XFR A;  2JUL A;  2L0P A;  4C0K A;  5HLV A;  1KQM C;  1VRK A;  3EK8 A;  2M49 B;  2ZRT A;  4CID A;  1OOG A;  3OB2 B;  2FOT A;  1BOC A;  1HQV A;  2LM5 A;  1AUI B;  3DXL A;  1FF1 A;  2F3Y A;  1K90 D;  2MBX A;  1SKT A;  3R1V A;  1QS7 A;  2WCL A;  2OTG B;  3KHE A;  1B7T Z;  4CLN A;  3PAL A;  2KHN A;  3PJI A;  4XJK A;  1BJF A;  1UWO A;  2Q91 A;  3I5H C;  2P71 A;  1L2O C;  1RWY A;  4YGB B;  1BR4 B;  1MXL C;  2JNX A;  1NCX A;  2DOQ A;  5AXI A;  5ER5 A;  1BF5 A;  2HQ8 A;  2GTE A;  2M7N A;  4U8D A;  1BT6 A;  2MRD A;  2JPT A;  4R1E A;  4P2Y B;  1XFW O;  3GK1 A;  2KYF A;  4TNC A;  2OS8 C;  4HRH A;  2PVB A;  3BUO B;  1DQE A;  5AER A;  4GNK B;  3NHT A;  3TS5 B;  1QAT A;  4YRU A;  1PRW A;  2AAO A;  2FJY A;  2JNF A;  1F71 A;  2ZND A;  1KFX S;  4C0J A;  1AJ5 A;  3WHT B;  2P70 A;  1FBV A;  3QME A;  1EG3 A;  3E3R A;  1MHO A;  1TN4 A;  4BY4 A;  2R2I A;  5CSF A;  3I5F C;  5CSN A;  5I2L A;  1B7T Y;  1TWO A;  5B8I B;  1XO5 A;  3SS5 A;  2OPO A;  3C1V A;  1TCO B;  3FE6 A;  2JQ6 A;  1AHR A;  1CM1 A;  1SCV A;  2KGB C;  3O4X A;  3SS4 A;  1AK8 A;  3IQQ A;  2BKH B;  2L2C A;  3DZT A;  1FI6 A;  2LUX A;  1OOH A;  2LE9 B;  3FS7 A;  3L4L A;  3I5G C;  3O2P A;  2K61 A;  1CMF A;  1LVC D;  2BNX A;  1REC A;  1SL7 A;  2LAN A;  3LL8 B;  3OBV A;  3JVT C;  3SG5 A;  1WY9 A;  2L50 A;  3ICB A;  2KDH A;  1A03 A;  4N1F A;  2Y1M A;  1YUR A;  2L4H A;  2QEH A;  2BL0 C;  1SR6 B;  3FWC A;  1C3Z A;  1RFJ A;  2WOS A;  2YGU A;  4M2Q A;  1F54 A;  1TNX A;  1B8C A;  4MRY A;  2M3W A;  2KBI A;  1IKU A;  1Y0V H;  2LVI A;  1JF0 A;  4INW A;  4PE0 A;  4AOM A;  1KQV A;  2PAS A;  3VRN A;  1A4P A;  1SBJ A;  1K9U A;  4MZK A;  1MWN A;  3KO0 A;  4NDB A;  1DF0 B;  1SNL A;  2LLT A;  2G2B A;  2H61 C;  4N5X A;  5HYD A;  5DKN A;  3FWB A;  1KK7 Z;  3S0B A;  1AJ4 A;  3GOF A;  3O6B A;  4ORB B;  1KK8 B;  3LCP C;  4NQG A;  3CWG A;  1CDN A;  1V1F A;  5HL1 A;  1YUS A;  3NGV A;  1QJT A;  1QV1 A;  3CS1 A;  1NX2 A;  1XFV O;  2WCF A;  5EL2 A;  3CGA A;  1B4C A;  1Y1U A;  4GGN A;  2Y1N A;  1JWD A;  3TZ1 A;  3N7H A;  4A4C A;  3TDU A;  1G4Y R;  2I94 A;  3K1E A;  4HRG A;  2M7L A;  2SAS A;  3CYZ A;  3GK4 X;  2MLF C;  1DEL A;  4PT1 A;  3S0A A;  1GGW A;  3SG4 A;  1EG4 A;  1NPQ A;  1UP5 A;  3B87 A;  4JD9 A;  2K2F A;  3LK0 A;  5CSJ A;  4CFQ A;  3HX4 A;  1SY9 A;  4WQ2 A;  2LMT A;  5FI7 A;  1DEK A;  1S5G Z;  1CDL A;  2LV7 A;  4HRE E;  1KK7 Y;  1OQP A;  3BUN B;  2WCE A;  2EC6 C;  1B9A A;  1DJG A;  1DF0 A;  1NP8 A;  2JC2 A;  2L98 A;  1KFU L;  4XJK B;  2BCX A;  5I2O A;  1MF8 B;  2LP2 A;  1BG1 A;  1OE9 B;  2KLD A;  1EL4 A;  1SYM A;  3R1O A;  2MHH A;  4PE4 A;  4FQO A;  3CR4 X;  3IVT A;  4IL1 A;  1RJV A;  1C7W A;  4N1G A;  3D73 A;  1ORG A;  4ZCV A;  1NWD A;  1TUJ A;  3I5H B;  3I5I C;  1L2O B;  1SSE B;  1S36 A;  1M63 B;  2BBN A;  2ZFD A;  3BUM B;  3CZ1 A;  3BOW B;  4I5J A;  2MJW B;  3UNW A;  4GPL B;  3KEV A;  2F8P A;  1F4O A;  1H8B A;  3NSL A;  1J1D A;  3L4A A;  1SMG A;  2K7B A;  3AAK A;  3EKJ A;  2LNK A;  1WDC C;  1F4Q A;  1S5G Y;  2D8N A;  4CFR A;  2OS8 B;  1OMV A;  2JZI A;  1YX7 A;  1SL9 A;  1XFX O;  5AEQ A;  2I18 A;  3BYA A;  1CFD A;  3PM2 A;  3EVR A;  1W7I B;  1S6I A;  2GV5 A;  3OHM B;  3DYE A;  4MN0 A;  2K8M B;  5J3X A;  1K2H A;  2LP3 A;  1B8L A;  1OZS A;  1DVI A;  2H8V A;  2NCP A;  1QWV A;  4NDD A;  2PYQ A;  1S6J A;  2TN4 A;  3I5F B;  2NLN A;  2KFF A;  3RZS A;  1EJ3 A;  1KWO B;  4P5O E;  2JXL A;  3SS3 A;  1OZO A;  1QLK A;  2WOR A;  1CDP A;  1K93 D;  1TCF A;  2CXJ A;  3VRR A;  4ETO A;  3CLN A;  3B6X A;  1AP4 A;  4ICB A;  3S0E A;  3SIB A;  1IQ3 A;  2KFH A;  3EKH A;  4I5L B;  3I5G B;  1SRA A;  2QPT A;  1TUZ A;  1B1G A;  2M8U A;  2WC6 A;  3BOW A;  4QJ5 B;  3DD4 A;  1IRJ A;  3EVV A;  3JVT B;  5HLO A;  3SG3 A;  2PSR A;  5PAL A;  1NX0 A;  1PSB A;  1TIZ A;  1LKJ A;  2BL0 B;  3VRQ A;  1JSA A;  3TDI A;  2LMU A;  4PAL A;  1BLQ A;  2BCB A;  4PHN A;  3WHU B;  1QAS A;  2KI4 C;  4GGF C;  1T14 A;  2ZN9 A;  1NSH A;  1JF2 A;  5KSZ A;  1JC2 A;  1NUB A;  4MLW A;  3A4U B;  5AAN A;  3SIA A;  1NCZ A;  5F6T A;  1IG5 A;  2PMY A;  1TOP A;  4JKT A;  1FPW A;  2Q4U A;  1DJY A;  3LK1 A;  4MVF A;  1CFC A;  1S26 D;  2ZN8 A;  1QVI Z;  5TNC A;  1XFZ O;  1YTZ C;  2V53 A;  1A29 A;  4CPV A;  1XFY O;  4QJ4 B;  4E68 A;  1GJY A;  2L51 A;  3D78 A;  3Q8I A;  1B8R A;  1UUS A;  2BEC A;  2JT3 A;  2K2A A;  3VGO A;  1CLB A;  4NDC A;  1DGV A;  2KOT A;  3DF0 B;  2KSP A;  1QIV A;  4MBE A;  2QDI A;  2PQL A;  3KF9 A;  1M31 A;  1W9Z A;  5I94 A;  2F2O A;  3D0Y B;  1BU3 A;  1UHJ A;  5KTY A;  3WNX B;  1LXF C;  1CFF A;  1OOI X;  1MUX A;  3PN7 C;  2ERB A;  2O60 A;  3NSK A;  2HF5 A;  3S0G A;  1BOD A;  2JWW A;  2A4J A;  4PE1 A;  4ORC B;  3VRP A;  5HKY A;  1J7R A;  1KFU S;  4DRW A;  2P6B B;  1FI5 A;  3ZWH A;  1DJX A;  1DJZ A;  2LMV A;  4PCW A;  5KU1 A;  5ER4 X;  3K21 A;  1QVI Y;  2KAV A;  2L5X B;  4OR9 B;  4BY5 A;  2EC6 B;  1CM4 A;  1WRL A;  1X02 A;  2KAY A;  1GGZ A;  3BJH A;  1BR1 B;  1IJ6 A;  1K95 A;  1U5I B;  2COL B;  2H61 A;  2QEV A;  5FYX A;  1YVH A;  3V2L A;  1M45 A;  3VRO A;  4GUK A;  3ZNI A;  4FTG A;  1G33 A;  3OB1 B;  1S3P A;  2HPS A;  2F3Z A;  4I5N B;  1C7V A;  1CMG A;  1DTL A;  1ODB A;  3BUW B;  1E8A A;  2B1U A;  1QLS A;  5AFP A;  5HKW A;  4DIR A;  1SCM B;  3DF0 A;  2KQ6 A;  1N0Y A;  2KNE A;  1UHI A;  1XYD A;  3CDN A;  3I5I B;  3O4Y A;  2AUC A;  3AAJ A;  3GK2 A;  4GAO A;  1P28 A;  3DVE A;  1PVA A;  1NX3 A;  2Y4Q A;  4YBH B;  4AQJ A;  3D0Y A;  4MRX A;  3RLZ A;  1PUL A;  3R72 A;  4HSZ A;  2LLU A;  1KSM A;  1XA5 A;  2JT0 A;  4YI9 A;  5GQQ C;  1QIW A;  3BQ3 A;  1QV0 A;  1DJW A;  4F7F A;  1WDC B;  2L5Y A;  1KQM B;  3BXK A;  1FW4 A;  4PE7 A;  1MQ1 A;  1SR6 C;  1OSA A;  2JOJ A;  3L47 A;  2HQW A;  1K9K A;  4I5K A;  2I2R E;  1QX5 B;  1NX1 A;  3CZT X;  1DGU A;  3D75 A;  1J55 A;  2LVJ A;  2WC8 A;  3NSI A;  4PHM A;  2BE6 A;  4USL A;  2K60 A;  2KYC A;  5D7F A;  4M2O A;  2JPO A;  2GGM A;  1IQ5 A;  1S6C A;  1U5I A;  3NXA A;  1F70 A;  2G9B A;  1CNP A;  1K96 A;  1R6P A;  3NHI A;  4OZD A;  1CLL A;  2CT9 A;  1DC1 A;  3SG2 A;  1UHK A;  3TDZ A;  4PDZ A;  1YX8 A;  3SJS A;  1DJI A;  5IBW A;  4PHJ A;  1DT7 B;  4OKH A;  1ALV A;  1CKK A;  1M39 A;  1MR8 A;  4MZJ A;  4XYN A;  1IWQ A;  3PAT A;  1CTR A;  4OVN F;  2EHB A;  3CAB A;  1KCY A;  3JTD C;  3CZ0 A;  1XK4 C;  2ZRS A;  1WLM A;  2H2K A;  1DMO A;  3D76 A;  3OGN A;  2CTN A;  1RRO A;  2MLE C;  1EH2 A;  4M2P A;  1PVB A;  1NCY A;  1TRF A;  1D1O A;  5HKZ A;  1ZFS A;  2JTT A;  1YVL A;  3BFB A;  5DKR A;  1A2X A;  2ZKM X;  4PHK A;  3DY9 A;  3M0W A;  3SG7 A;  1TNW A;  4YGE B;  1C3Y A;  2I7A A;  2IS9 A;  1S1E A;  4ORA B;  3TUY C;  1B47 A;  1JFK A;  2CCM A;  1JBA A;  1EXR A;  2L2E A;  2VRG A;  3D10 A;  3S0F A;  3FE9 A;  1TNQ A;  5BPJ A;  3AKB A;  1WLZ A;  2NCO A;  3CTN A;  2BAP A;  2F2P A;  5D69 A;  2F33 A;  1UHH A;  2K7O A;  2QAC A;  2HET A;  2FCD A;  1G8I A;  5D3O A;  2LVK A;  2MAZ A;  4YGD B;  1K94 A;  1SPY A;  1V1G A;  2KI6 D;  3BFA A;  3PN7 B;  3EK7 A;  5DKQ A;  4YGA A;  4F0Z B;  1Y1X A;  4Q04 A;  1IH0 A;  2M0R A;  1JUO A;  2WCM A;  5JJG A;  4JWQ A;  2LHL A;  4MZL A;  4GGF A;  1SL8 A;  1Y1A A;  3CR5 X;  3UO9 A;  1Z4H A;  3CZ2 A;  3OX6 A;  3VB1 A;  2OTG C;  4MEW A;  4MSP A;  4YI8 A;  5K89 A;  1OMR A;  2BKI B;  4L9M A;  4ZCU A;  3D74 A;  4GBA A;  1Y6W A;  2RGI A;  2ZNE A;  2QEB A;  1IIO A;  3EG5 B;  2WCJ A;  3HCM A;  1MXE A;  1ZMZ A;  1KWO C;  3IF7 A;  2M97 A;  5CSI A;  4QJ3 B;  5I8N A;  3SG6 A;  2QEO A;  2M9G A;  2M1U A;  2CNP A;  1PAL A;  2Y5I A;  1F8H A;  2JT8 A;  1BMO A;  1YRT B;  2PAL A;  2SCP A;  3OX5 A;  3OP0 A;  4WQ3 A;  1A75 B;  2KI6 C;  2EGD A;  3TS5 C;  1CDM A;  1RK9 A;  1YUT A;  2KBM A;  3DVM A;  3FIA A;  1CB1 A;  1QTX A;  1QXP A;  1QX7 A;  2K7D A;  3BUX B;  1OW4 A;  1ZAC A;  1NYA A;  1LIN A;  2K0J A;  3B7A A;  1XFU O;  2WCK A;  1RTP 1;  2AMI A; 
#chains in the Genus database with same CATH homology
 1KFX L;  2KAX A;  2LC5 A;  1TTX A;  3DVJ A;  1TNP A;  1J7O A;  1PK0 D;  3AKA A;  3WXA A;  1DJH A;  4OCI A;  2JU0 A;  1SK6 D;  3LLE A;  2LLS A;  1CFP A;  1SW8 A;  2K7C A;  2KQY A;  3A8R A;  3MSE B;  3EK4 A;  1WRZ A;  3DVK A;  4D1E A;  1ZOT B;  2E30 A;  2WND A;  1GQM A;  5G08 A;  1J1E A;  1F55 A;  1YUU A;  1QX2 A;  1IJ5 A;  2O5G A;  3PSR A;  3O78 A;  4WRI A;  2M29 A;  1A75 A;  3JTD B;  1M46 A;  3NSO A;  1ZUZ A;  1UUR A;  2WCB A;  4DCK A;  1L7Z A;  4DS7 A;  2GGZ A;  4A4B A;  1N65 A;  1IGV A;  3PM8 A;  2LCP A;  5CPV A;  3EVU A;  2NZ0 A;  2BCA A;  2L4I A;  4OV2 A;  2BBM A;  2LUC A;  2LAP A;  2ISD A;  4C0L A;  1H4B A;  1NIW A;  4AQI A;  2E6W A;  2PRU A;  1KK8 C;  1C07 A;  1PSR A;  3IQO A;  3PFV A;  2MA2 A;  2CBL A;  1Q80 A;  5JOL A;  1N2D A;  4UPG A;  2M1K B;  1HT9 A;  1W7J B;  3CR2 A;  1UHN A;  1WRK A;  1ALW A;  2FJU B;  1AVS A;  1LA0 A;  3TUY B;  1R2U A;  2JRF A;  3RM1 A;  4GFT A;  2JTZ A;  1XVJ A;  2LHI A;  3H4S E;  4JPZ B;  1YR5 A;  5I2Q A;  1K8U A;  2KGR A;  2LVV A;  1YRU B;  3QRX A;  1LA3 A;  1OMD A;  1CLM A;  1SCM C;  4DUQ A;  2BE4 A;  4JQ0 D;  1J7P A;  2KI4 B;  3F45 A;  1OOJ A;  2JXC A;  4YGC B;  2FCE A;  1JFJ A;  2KFG A;  3PLF B;  1KSO A;  1XK4 A;  3KPX A;  1J7Q A;  1K9P A;  2NXQ A;  2JUL A;  2L0P A;  4C0K A;  5HLV A;  1KQM C;  1VRK A;  3EK8 A;  2M49 B;  2ZRT A;  4CID A;  3OB2 B;  1BOC A;  2FOT A;  1HQV A;  2LM5 A;  1AUI B;  1FF1 A;  2F3Y A;  1K90 D;  2MBX A;  1SKT A;  1QS7 A;  2OTG B;  3KHE A;  1B7T Z;  4CLN A;  3PAL A;  2KHN A;  4XJK A;  1BJF A;  1UWO A;  2Q91 A;  3I5H C;  1L2O C;  1RWY A;  4YGB B;  1BR4 B;  1MXL C;  2JNX A;  1NCX A;  2DOQ A;  5AXI A;  5ER5 A;  1BF5 A;  2HQ8 A;  2M7N A;  4U8D A;  1BT6 A;  2MRD A;  2JPT A;  4R1E A;  4P2Y B;  1XFW O;  3GK1 A;  2KYF A;  4TNC A;  2OS8 C;  4HRH A;  2PVB A;  3BUO B;  5AER A;  4GNK B;  3TS5 B;  1QAT A;  4YRU A;  1PRW A;  2AAO A;  2JNF A;  1F71 A;  2ZND A;  1KFX S;  4C0J A;  1AJ5 A;  3WHT B;  1FBV A;  1EG3 A;  3E3R A;  1MHO A;  1TN4 A;  4BY4 A;  2R2I A;  5CSF A;  3I5F C;  5CSN A;  5I2L A;  1B7T Y;  5B8I B;  1XO5 A;  2OPO A;  3C1V A;  1TCO B;  2JQ6 A;  1AHR A;  1CM1 A;  1SCV A;  2KGB C;  1AK8 A;  3IQQ A;  2BKH B;  1FI6 A;  2LUX A;  2LE9 B;  3FS7 A;  3I5G C;  3O2P A;  2K61 A;  1CMF A;  1LVC D;  1REC A;  1SL7 A;  2LAN A;  3LL8 B;  3JVT C;  3SG5 A;  1WY9 A;  2L50 A;  3ICB A;  2KDH A;  1A03 A;  4N1F A;  2Y1M A;  1YUR A;  2L4H A;  2BL0 C;  1SR6 B;  3FWC A;  2WOS A;  1RFJ A;  4M2Q A;  1F54 A;  1TNX A;  1B8C A;  4MRY A;  2M3W A;  2KBI A;  1IKU A;  1Y0V H;  2LVI A;  1JF0 A;  4PE0 A;  4AOM A;  1KQV A;  2PAS A;  3VRN A;  1A4P A;  1SBJ A;  1K9U A;  4MZK A;  1MWN A;  3KO0 A;  4NDB A;  1DF0 B;  1SNL A;  2LLT A;  2G2B A;  2H61 C;  4N5X A;  5HYD A;  5DKN A;  3FWB A;  1KK7 Z;  1AJ4 A;  3GOF A;  3O6B A;  4ORB B;  1KK8 B;  3LCP C;  4NQG A;  3CWG A;  1CDN A;  1V1F A;  1YUS A;  1QJT A;  1QV1 A;  3CS1 A;  1NX2 A;  1XFV O;  2WCF A;  3CGA A;  1B4C A;  1Y1U A;  4GGN A;  2Y1N A;  1JWD A;  3TZ1 A;  4A4C A;  3TDU A;  1G4Y R;  2I94 A;  4HRG A;  2M7L A;  2SAS A;  3GK4 X;  2MLF C;  1GGW A;  3SG4 A;  1EG4 A;  1NPQ A;  1UP5 A;  5CSJ A;  4CFQ A;  2K2F A;  3LK0 A;  5I8N A;  3HX4 A;  1SY9 A;  4WQ2 A;  2LMT A;  1S5G Z;  1CDL A;  2LV7 A;  4HRE E;  1KK7 Y;  1OQP A;  3BUN B;  2WCE A;  2EC6 C;  1B9A A;  1DJG A;  1DF0 A;  1NP8 A;  2JC2 A;  2L98 A;  1KFU L;  4XJK B;  2BCX A;  5I2O A;  1MF8 B;  2LP2 A;  1BG1 A;  1OE9 B;  1EL4 A;  1SYM A;  2MHH A;  4PE4 A;  4FQO A;  3CR4 X;  4IL1 A;  1RJV A;  1C7W A;  4N1G A;  4ZCV A;  1NWD A;  3I5H B;  3I5I C;  1L2O B;  1S36 A;  1M63 B;  2BBN A;  2ZFD A;  3BUM B;  4I5J A;  3BOW B;  2MJW B;  4GPL B;  3KEV A;  2F8P A;  1F4O A;  1H8B A;  3NSL A;  1J1D A;  1SMG A;  2K7B A;  3AAK A;  3EKJ A;  2LNK A;  1WDC C;  1F4Q A;  1S5G Y;  2D8N A;  4CFR A;  2OS8 B;  1OMV A;  2JZI A;  1YX7 A;  1SL9 A;  1XFX O;  5AEQ A;  2I18 A;  3BYA A;  1CFD A;  4MN0 A;  3EVR A;  1W7I B;  1S6I A;  2GV5 A;  3OHM B;  5J3X A;  5PAL A;  2K8M B;  1K2H A;  2LP3 A;  1B8L A;  1OZS A;  1DVI A;  2NCP A;  4NDD A;  3I5F B;  1S6J A;  2TN4 A;  2NLN A;  2KFF A;  1EJ3 A;  1KWO B;  4P5O E;  2JXL A;  1OZO A;  1QLK A;  2WOR A;  1CDP A;  1K93 D;  1TCF A;  2CXJ A;  3VRR A;  4ETO A;  3CLN A;  1AP4 A;  4ICB A;  3SIB A;  1IQ3 A;  2KFH A;  3EKH A;  4I5L B;  3I5G B;  1SRA A;  2QPT A;  1B1G A;  2M8U A;  3BOW A;  4QJ5 B;  3DD4 A;  1IRJ A;  3EVV A;  3JVT B;  5HLO A;  3SG3 A;  2PSR A;  1NX0 A;  1PSB A;  1TIZ A;  1LKJ A;  2BL0 B;  3VRQ A;  1JSA A;  3TDI A;  2LMU A;  4PAL A;  1BLQ A;  2BCB A;  4PHN A;  3WHU B;  1QAS A;  2KI4 C;  4GGF C;  2ZN9 A;  1NSH A;  1JF2 A;  5KSZ A;  1JC2 A;  1NUB A;  4MLW A;  3A4U B;  5AAN A;  3SIA A;  1NCZ A;  5F6T A;  1IG5 A;  2PMY A;  1TOP A;  1FPW A;  2Q4U A;  1DJY A;  3LK1 A;  4MVF A;  1CFC A;  1S26 D;  2ZN8 A;  1QVI Z;  5TNC A;  1XFZ O;  1YTZ C;  2V53 A;  1A29 A;  4CPV A;  1XFY O;  4QJ4 B;  4E68 A;  1GJY A;  2L51 A;  1B8R A;  1UUS A;  2BEC A;  2JT3 A;  2K2A A;  3VGO A;  1CLB A;  4NDC A;  1DGV A;  2KOT A;  3DF0 B;  2KSP A;  1QIV A;  4MBE A;  3KF9 A;  1M31 A;  2F2O A;  3D0Y B;  1BU3 A;  1UHJ A;  5KTY A;  3WNX B;  1LXF C;  1CFF A;  1MUX A;  3PN7 C;  2O60 A;  3NSK A;  2HF5 A;  1BOD A;  2JWW A;  2A4J A;  4PE1 A;  4ORC B;  3VRP A;  5HKY A;  1J7R A;  1KFU S;  4DRW A;  2P6B B;  1FI5 A;  3ZWH A;  1DJX A;  1DJZ A;  2LMV A;  4PCW A;  5KU1 A;  5ER4 X;  3K21 A;  1QVI Y;  2KAV A;  2L5X B;  4OR9 B;  4BY5 A;  2EC6 B;  1CM4 A;  1WRL A;  1X02 A;  2KAY A;  1GGZ A;  1BR1 B;  1IJ6 A;  1K95 A;  1U5I B;  2COL B;  2H61 A;  5FYX A;  1YVH A;  1M45 A;  3VRO A;  4GUK A;  3ZNI A;  4FTG A;  1G33 A;  3OB1 B;  1S3P A;  2HPS A;  2F3Z A;  4I5N B;  1C7V A;  1CMG A;  1DTL A;  1ODB A;  3BUW B;  1E8A A;  2B1U A;  1QLS A;  5AFP A;  5HKW A;  4DIR A;  1SCM B;  3DF0 A;  2KQ6 A;  1N0Y A;  2KNE A;  1UHI A;  1XYD A;  3I5I B;  3O4Y A;  2AUC A;  3AAJ A;  3GK2 A;  4GAO A;  3DVE A;  1PVA A;  1NX3 A;  2Y4Q A;  4YBH B;  4AQJ A;  3D0Y A;  4MRX A;  3RLZ A;  1PUL A;  4HSZ A;  2LLU A;  1KSM A;  1XA5 A;  2JT0 A;  4YI9 A;  5GQQ C;  1QIW A;  3BQ3 A;  1QV0 A;  1DJW A;  1WDC B;  1KQM B;  3BXK A;  1FW4 A;  4PE7 A;  1MQ1 A;  1SR6 C;  1OSA A;  2JOJ A;  2HQW A;  1K9K A;  4I5K A;  2I2R E;  1QX5 B;  1NX1 A;  3CZT X;  1DGU A;  1J55 A;  2LVJ A;  2WC8 A;  3NSI A;  4PHM A;  2BE6 A;  4USL A;  2KYC A;  5D7F A;  4M2O A;  3NXA A;  2GGM A;  1IQ5 A;  1S6C A;  1U5I A;  1F70 A;  2G9B A;  1CNP A;  1K96 A;  1R6P A;  1CLL A;  2CT9 A;  3SG2 A;  1UHK A;  3TDZ A;  4PDZ A;  1YX8 A;  3SJS A;  1DJI A;  5IBW A;  4PHJ A;  1DT7 B;  4OKH A;  1ALV A;  1CKK A;  1M39 A;  1MR8 A;  4MZJ A;  4XYN A;  1IWQ A;  3PAT A;  1CTR A;  4OVN F;  2EHB A;  1KCY A;  3JTD C;  1XK4 C;  2ZRS A;  1WLM A;  2H2K A;  1DMO A;  2CTN A;  1RRO A;  2MLE C;  1EH2 A;  4M2P A;  1PVB A;  1NCY A;  1TRF A;  1D1O A;  5HKZ A;  1ZFS A;  2JTT A;  1YVL A;  5DKR A;  1A2X A;  2ZKM X;  4PHK A;  3M0W A;  3SG7 A;  1TNW A;  4YGE B;  2I7A A;  2IS9 A;  1S1E A;  4ORA B;  3TUY C;  1B47 A;  1JFK A;  2CCM A;  1JBA A;  1EXR A;  2L2E A;  2VRG A;  3D10 A;  1TNQ A;  5BPJ A;  3AKB A;  1WLZ A;  2NCO A;  3CTN A;  5D69 A;  2F2P A;  2F33 A;  1UHH A;  2K7O A;  2QAC A;  2HET A;  2FCD A;  1G8I A;  2LVK A;  2MAZ A;  4YGD B;  1K94 A;  1SPY A;  1V1G A;  2KI6 D;  3PN7 B;  3EK7 A;  5DKQ A;  4YGA A;  4F0Z B;  1Y1X A;  4Q04 A;  1IH0 A;  2M0R A;  1JUO A;  5JJG A;  4JWQ A;  2LHL A;  4MZL A;  4GGF A;  1SL8 A;  1Y1A A;  3CR5 X;  3OX6 A;  2OTG C;  4MEW A;  4MSP A;  4YI8 A;  5K89 A;  1OMR A;  2BKI B;  4L9M A;  4ZCU A;  4GBA A;  1Y6W A;  2RGI A;  2ZNE A;  3HCM A;  1MXE A;  1ZMZ A;  1KWO C;  3IF7 A;  2M97 A;  5CSI A;  4QJ3 B;  3SG6 A;  2M9G A;  2M1U A;  2CNP A;  1PAL A;  2Y5I A;  1F8H A;  2JT8 A;  1BMO A;  1YRT B;  2PAL A;  2SCP A;  3OX5 A;  3OP0 A;  4WQ3 A;  1A75 B;  2KI6 C;  2EGD A;  3TS5 C;  1CDM A;  1RK9 A;  1YUT A;  2KBM A;  3DVM A;  3FIA A;  1CB1 A;  1QTX A;  1QXP A;  1QX7 A;  2K7D A;  3BUX B;  1ZAC A;  1NYA A;  1LIN A;  2K0J A;  1XFU O;  1RTP 1;  2AMI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...