1AJ4A

Structure of calcium-saturated cardiac troponin c, nmr, 1 structure
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
160
structure length
160
Chain Sequence
b'ADIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRSMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TROPONIN C
publication title Structure of cardiac muscle troponin C unexpectedly reveals a closed regulatory domain.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Muscle protein
total genus 33
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 1997-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1aj4A00
1J55A 4A4CA 1CLMA 2G9BA 1KSMA 2GGMA 4MRXA 1MR8A 2BE4A 1MQ1A 4N5XA 2JWWA 4R1EA 4DUQA 1BR4B 1M31A 1NX1A 1RECA 4C0JA 1CDNA 1B9AA 1F8HA 3SG6A 3IQQA 5F6TA 1GQMA 1SR6C 1WDCC 2WCEA 1SK6D 1BOCA 3DVKA 1NWDA 2BKIB 2F3YA 2NCOA 1OMDA 2KHNA 2LP2A 1IQ3A 4MN0A 1MHOA 1RWYA 2EGDA 1TRFA 2M3WA 2LC5A 1SRAA 2I2RE 3D0YA 2M1UA 1XFUO 1IJ5A 1JWDA 3NSKA 3VRQA 2WNDA 1LA3A 4OCIA 4AOMA 4CPVA 1XFZO 2K7CA 1OE9B 3CLNA 5AERA 2F33A 1NX3A 4XJKB 1QIWA 1PULA 1Q80A 2LMUA 1UHKA 2NCPA 2R2IA 1QX5B 3SIAA 4GFTA 1KWOC 3O6BA 3KPXA 3WHTB 1DJHA 3LL8B 2EC6B 4L9MA 4UPGA 4NQGA 1DF0B 3LK0A 3RM1A 1DJGA 4CFRA 1B1GA 1F4QA 1QX7A 2Y1NA 1DMOA 4WQ2A 1Y6WA 2HETA 2M7NA 2ISDA 4M2PA 1YX8A 2IS9A 4CLNA 1JUOA 4M2QA 1JBAA 2PALA 2KSPA 2O5GA 3LK1A 3OX6A 4OKHA 3TZ1A 2L2EA 3EVUA 3TS5B 2Y4QA 2KGRA 1QVIZ 3NSOA 2JRFA 3I5HB 5CSFA 2JOJA 2M0RA 3NSIA 1C7WA 2SCPA 2ZRTA 4OR9B 1E8AA 4GGNA 2JQ6A 5DKNA 1YURA 1BT6A 1NSHA 2HF5A 2L4IA 3KF9A 2M97A 4QJ4B 5B8IB 2DOQA 1KFUL 1TN4A 5J3XA 2MRDA 3DF0B 1M63B 5HKWA 2V53A 2JU0A 1N0YA 1CLLA 2E30A 2LHIA 3CGAA 1CM1A 2Q91A 3VRNA 1Y0VH 2KAXA 2ZN9A 2LM5A 2PVBA 1TNWA 2F3ZA 2LCPA 3SG5A 1XA5A 2AUCA 1ODBA 1GGZA 1SNLA 3JTDB 4YI8A 4YGAA 3GOFA 5G08A 1K93D 1H4BA 2WORA 2I94A 1B8CA 1HT9A 1PRWA 2LVIA 4D1EA 5KSZA 2PMYA 1KQVA 1MXLC 1BF5A 4HRGA 4DCKA 2NXQA 4PHJA 4C0LA 1XO5A 1XVJA 2JTZA 1QX2A 3EK7A 4MSPA 1CNPA 5I2OA 4MVFA 2COLB 1S6JA 1KCYA 1LVCD 4ORAB 2GGZA 4MRYA 4XJKA 2L0PA 1QLSA 4HREE 2M49B 4YI9A 1YVLA 1OOJA 2I18A 1KK8B 3C1VA 3ICBA 1A4PA 2LMTA 1YX7A 3PATA 4GGFC 3AKAA 1QIVA 1DTLA 1W7IB 2A4JA 3I5GC 1YRTB 3JVTC 1CB1A 1JC2A 1NCXA 2JZIA 2JNXA 2K8MB 3PN7B 1AK8A 5D69A 1JF2A 1B8RA 1TOPA 2OS8B 1VRKA 2CBLA 2NZ0A 1A75B 1DF0A 4PE0A 3ZWHA 2KYCA 1KFUS 2LAPA 1CM4A 4BY5A 5I2QA 1W7JB 1J7PA 2F2PA 1WLMA 2KQ6A 1G33A 1R6PA 2L50A 3CZTX 2BBNA 2OPOA 3PALA 4YGDB 1DT7B 3I5FC 2LNKA 1NX0A 1NCYA 2LV7A 3VROA 5PALA 1CTRA 1B47A 1PSBA 1CFFA 1CKKA 3WXAA 1BODA 3F45A 5CPVA 4OV2A 1X02A 4ETOA 4N1FA 4PHKA 5CSIA 2BL0C 1FF1A 2NLNA 2KI6C 1LA0A 1QS7A 5IBWA 2L5XB 1EG3A 1NCZA 2MA2A 1MUXA 2K2AA 1QXPA 1RTP1 1IQ5A 1A03A 3CS1A 1EJ3A 2F8PA 1U5IB 3O2PA 3OB2B 5AFPA 3HX4A 4P5OE 1AP4A 1J7RA 1IG5A 4PDZA 3AKBA 2CNPA 2KI4B 1PK0D 1XFWO 3DF0A 1CDMA 3SG3A 5CSJA 1NYAA 4NDBA 2JTTA 2LP3A 1CDPA 4IL1A 3PFVA 3E3RA 1QVIY 1TCFA 1J1EA 4I5JA 3BOWA 1K9UA 1EL4A 4FQOA 2PSRA 2SASA 1QTXA 3KHEA 1PVAA 3FIAA 4ZCVA 1TIZA 4MLWA 4GGFA 2JT0A 4FTGA 4QJ5B 1RFJA 2LANA 4U8DA 1ZMZA 4YRUA 1B4CA 1GJYA 1A2XA 1UHHA 2PASA 3LCPC 1SCMB 4QJ3B 1NPQA 1YUTA 4A4BA 2KAVA 2KFFA 2KBIA 1BU3A 1OMRA 4HRHA 3IF7A 1QV0A 1CDLA 2ZNDA 2JT8A 2EC6C 1SW8A 3BUWB 3SG7A 4AQIA 1S6CA 2ZNEA 5ER5A 1FPWA 3IQOA 2KAYA 1C7VA 1BJFA 4MEWA 4YGCB 3VRRA 1S3PA 4MBEA 1ZUZA 3TUYB 3O78A 1F54A 1FI5A 2H2KA 2JXCA 1ZACA 1WY9A 1YUSA 1FW4A 1NX2A 2MLFC 3O4YA 4PHMA 5AANA 1L2OB 1DJWA 3A4UB 1SCVA 3K21A 3TS5C 2K7OA 3KO0A 3HCMA 1M46A 3I5HC 1K2HA 1TCOB 1XYDA 3CWGA 3EVRA 1L7ZA 2P6BB 1SKTA 1PSRA 2KNEA 1B7TY 1D1OA 3BYAA 1RROA 5HKZA 2M7LA 4PE7A 1IRJA 3CR4X 2HPSA 2TN4A 3VRPA 1CMFA 2LVJA 1BMOA 3FWBA 4OVNF 1OZSA 1BG1A 1L2OC 3BUXB 1XK4C 3D0YB 3FS7A 3H4SE 1WRKA 1KQMB 4I5KA 1LKJA 2MAZA 3EK4A 1SMGA 1LINA 3I5IB 1SY9A 1K96A 4E68A 2FCEA 1N2DA 2KOTA 3EK8A 2JULA 1AJ4A 3JTDC 2D8NA 1QATA 1UP5A 2F2OA 2OTGB 4YGEB 1UHIA 1B7TZ 2VRGA 4ORCB 3GK4X 1ALWA 4I5NB 3ZNIA 1PVBA 4NDDA 1DGUA 1QLKA 1UHJA 1JF0A 1S5GY 3BQ3A 4CIDA 5ER4X 3AAKA 5KU1A 1DJIA 2FCDA 2JT3A 5HKYA 2O60A 1KK8C 2BKHB 2FJUB 2KQYA 5HLVA 5JJGA 3CTNA 5HYDA 3PM8A 2Y5IA 3PN7C 4F0ZB 4Q04A 4TNCA 2OS8C 1N65A 1K8UA 1DJYA 3DVEA 3EVVA 1FBVA 2JC2A 4USLA 2K0JA 4DS7A 1JFJA 1G8IA 4YBHB 1GGWA 1AUIB 2LVVA 2MJWB 2MLEC 1J1DA 1CLBA 1K95A 3CR2A 4WRIA 3TDUA 1G4YR 1MWNA 3BXKA 2KFGA 1RJVA 2M1KB 3VGOA 1SR6B 5CSNA 1FI6A 2WOSA 2PRUA 4P2YB 1EH2A 4BY4A 1S5GZ 1WRLA 4GPLB 1S26D 1DVIA 1WRZA 2K7BA 5BPJA 2KDHA 1Y1XA 1XK4A 1KK7Y 3FWCA 5D7FA 1SL9A 3PLFB 4GBAA 3TDIA 4GAOA 2MHHA 3SG4A 1OQPA 2KFHA 4ICBA 4XYNA 2BCXA 1KFXS 5AEQA 1TNQA 2LHLA 1AHRA 3DD4A 1ZFSA 4YGBB 1C07A 1SBJA 4ORBB 4I5LB 1UUSA 3A8RA 1KWOB 1S6IA 1IJ6A 3SJSA 3WHUB 1IWQA 1YR5A 4GNKB 3DVMA 1TNPA 2CCMA 3RLZA 1H8BA 2KI4C 2L4HA 1K9PA 1UURA 2M29A 5KTYA 2ZN8A 1PALA 3AAJA 2JPTA 2BE6A 1K90D 2K61A 5GQQC 1LXFC 3WNXB 1CMGA 2BCBA 3BUMB 2LLTA 5TNCA 2LUXA 4PE1A 2LE9B 3EKHA 4HSZA 4MZLA 4DIRA 4GUKA 1OZOA 1KK7Z 3LLEA 2QACA 1KSOA 2EHBA 2JNFA 3GK1A 4PHNA 4M2OA 1V1FA 2BBMA 2FOTA 5K89A 2M8UA 1UHNA 2LLSA 2KYFA 3PSRA 2RGIA 1HQVA 3OX5A 2BECA 1SCMC 2L98A 3NSLA 2H61C 1A75A 2K2FA 2ZFDA 1QJTA 1JFKA 1AVSA 1DGVA 2CT9A 4JPZB 2HQWA 1EXRA 3NXAA 3GK2A 2BCAA 5I8NA 2M9GA 2WC8A 2LUCA 1SL8A 2KBMA 4MZJA 3MSEB 2AAOA 1J7QA 2WCBA 1JSAA 2K7DA 1MXEA 1XFVO 1OMVA 1XFXO 1M39A 1QASA 3TUYC 3OB1B 1F70A 3TDZA 1UWOA 4MZKA 2LVKA 1K94A 4JQ0D 5DKQA 2AMIA 4WQ3A 1CFPA 1AJ5A 1S1EA 2Y1MA 3BUNB 5HLOA 1CFCA 1K9KA 3QRXA 4AQJA 1YRUB 2L51A 1U5IA 1DJZA 1ZOTB 3EKJA 4PCWA 1B8LA 1YVHA 4N1GA 1RK9A 3SIBA 1OSAA 4PALA 3CR5X 3BOWB 1CFDA 5AXIA 1NUBA 2LMVA 1NIWA 1R2UA 1NP8A 3DVJA 2Q4UA 1J7OA 5I2LA 1KQMC 1IH0A 1KFXL 4ZCUA 3I5GB 3D10A 2QPTA 2KGBC 2HQ8A 2B1UA 3JVTB 2GV5A 1F55A 2MBXA 1F71A 3BUOB 3I5IC 4C0KA 1MF8B 2E6WA 1TNXA 1SPYA 1BLQA 1M45A 1YUUA 3SG2A 1XFYO 5FYXA 1F4OA 4JWQA 2I7AA 3OP0A 1ALVA 2H61A 2ZRSA 3KEVA 2G2BA 2CXJA 2OTGC 1Y1AA 1QV1A 2WCFA 3I5FB 2ZKMX 3M0WA 4NDCA 2CTNA 2LLUA 1YTZC 1A29A 5DKRA 1DJXA 1Y1UA 1S36A 3OHMB 1SL7A 5JOLA 4DRWA 1V1GA 1TTXA 2BL0B 4PE4A 1SYMA 2JXLA 1BR1B 1WDCB 2KI6D 1IKUA 1WLZA 1IGVA 1EG4A 4CFQA
chains in the Genus database with same CATH superfamily
1J55A 4A4CA 1CLMA 2G9BA 1KSMA 2GGMA 4MRXA 1MR8A 2BE4A 1MQ1A 4N5XA 2JWWA 4R1EA 1DQEA 4DUQA 1BR4B 1M31A 1NX1A 1RECA 3R1VA 4C0JA 1CDNA 1B9AA 3NGVA 1F8HA 3SG6A 4PT1A 3IQQA 5F6TA 1GQMA 1SR6C 1WDCC 1OOGA 5DICA 3FE9A 2WCEA 1SK6D 1BOCA 3DVKA 1NWDA 2BKIB 2F3YA 2NCOA 1OMDA 2KHNA 1OOFA 2LP2A 3S0BA 4MN0A 1IQ3A 1MHOA 1RWYA 2EGDA 1TRFA 2M3WA 2LC5A 1SRAA 2QEBA 2I2RE 3D0YA 2M1UA 1XFUO 1IJ5A 1JWDA 3NSKA 3VRQA 3CABA 2WNDA 2JPOA 1LA3A 4OCIA 4AOMA 4CPVA 1XFZO 2K7CA 1OE9B 3CLNA 5AERA 2F33A 4INXA 1NX3A 4XJKB 1QIWA 1PULA 1Q80A 2LMUA 1UHKA 2NCPA 2R2IA 1QX5B 3SIAA 4GFTA 1KWOC 3O6BA 3KPXA 3D76A 3WHTB 1DJHA 2KPHA 1ORGA 2EC6B 3LL8B 4L9MA 4UPGA 3DZTA 4NQGA 1DF0B 3LK0A 3RM1A 1DJGA 4CFRA 1B1GA 1F4QA 1QX7A 2Y1NA 2L2CA 1DMOA 4WQ2A 1Y6WA 2HETA 1Z2CB 2M7NA 2ISDA 4M2PA 1YX8A 2IS9A 1GM0A 4CLNA 1JUOA 4M2QA 1JBAA 2PALA 3B6XA 5HL1A 2KSPA 2O5GA 2P70A 3LK1A 3OX6A 4OKHA 3TZ1A 2L2EA 3D74A 3EVUA 3TS5B 2Y4QA 2KGRA 1QVIZ 3NSOA 2JRFA 3I5HB 5CSFA 2H8VA 2JOJA 2M0RA 3NSIA 1C7WA 2SCPA 2ZRTA 4OR9B 1E8AA 4GGNA 2JQ6A 5DKNA 1YURA 1BT6A 1NSHA 3SS4A 2HF5A 2L4IA 3KF9A 3BJHA 3UNWA 1C3ZA 2M97A 2BNXA 4QJ4B 5B8IB 1XFRA 2DOQA 1KFUL 1TN4A 5J3XA 2MRDA 3DF0B 3B7AA 1M63B 5HKWA 2V53A 2JU0A 3B86A 1N0YA 1CLLA 2E30A 2L5YA 2LHIA 1CM1A 2Q91A 3CGAA 1Y0VH 2KAXA 2ZN9A 2LM5A 3VRNA 2PVBA 1TNWA 2F3ZA 3CZ2A 2LCPA 3SG5A 1XA5A 3FE8A 2AUCA 1ODBA 1GGZA 1SNLA 3JTDB 4YI8A 1DEKA 4YGAA 3GOFA 5G08A 3R1OA 1K93D 1H4BA 2WORA 2I94A 3CDNA 3O4XA 5I94A 1B8CA 3RZSA 1HT9A 1PRWA 2LVIA 3L4AA 4D1EA 2PMYA 5KSZA 1KQVA 1MXLC 1BF5A 4HRGA 4DCKA 2NXQA 4PHJA 4C0LA 5D3OA 1XO5A 1XVJA 2FJYA 2JTZA 1QX2A 3EK7A 3PJIA 1TWOA 4MSPA 1CNPA 5I2OA 1QWVA 4MVFA 2COLB 1S6JA 4JKTA 1KCYA 1LVCD 4ORAB 2GGZA 4MRYA 4XJKA 2L0PA 1QLSA 4HREE 2M49B 4YI9A 1YVLA 1OOJA 2I18A 1KK8B 3C1VA 3ICBA 1A4PA 2LMTA 1YX7A 3PATA 4GGFC 3AKAA 1QIVA 1DTLA 1W7IB 2A4JA 3I5GC 1YRTB 1OOHA 3JVTC 1CB1A 1JC2A 1NCXA 2JZIA 2JNXA 2K8MB 3PN7B 1AK8A 5D69A 1JF2A 1B8RA 1TOPA 2OS8B 1VRKA 3EG5B 2CBLA 2NZ0A 1A75B 1DF0A 4PE0A 3ZWHA 2KYCA 1KFUS 2LAPA 1CM4A 4BY5A 5I2QA 1W7JB 1J7PA 2F2PA 1WLMA 2KQ6A 1G33A 1R6PA 2L50A 3CZTX 2BBNA 2OPOA 3PALA 2KLEA 4YGDB 3PM2A 1DT7B 3I5FC 2LNKA 3S0EA 1NX0A 1NCYA 2BAPA 1W9ZA 3DYEA 2LV7A 3VROA 5PALA 1CTRA 1B47A 1PSBA 1CFFA 1CKKA 3WXAA 2QEVA 1BODA 3F45A 5CPVA 4OV2A 1X02A 4ETOA 4N1FA 4PHKA 5CSIA 2BL0C 1FF1A 2NLNA 2KI6C 1LA0A 1QS7A 5IBWA 2L5XB 1EG3A 1NCZA 3BFBA 2MA2A 1MUXA 2K2AA 1QXPA 3BFAA 1RTP1 1IQ5A 5FI6A 1A03A 3CS1A 1EJ3A 2F8PA 1U5IB 3O2PA 3OB2B 5AFPA 3HX4A 4P5OE 1AP4A 1J7RA 1IG5A 1LS8A 4PDZA 3AKBA 2CNPA 2KI4B 3S0GA 1PK0D 1XFWO 3DF0A 3N7HA 4JD9A 1CDMA 3SG3A 3S0FA 5CSJA 1NYAA 4NDBA 2JTTA 2LP3A 1CDPA 3DXLA 4IL1A 3PFVA 3E3RA 1QVIY 1TCFA 1J1EA 4I5JA 3BOWA 1K9UA 1EL4A 4FQOA 2PSRA 1C3YA 2SASA 1QTXA 3KHEA 1PVAA 3FIAA 4ZCVA 1TIZA 2WC5A 2WCKA 4MLWA 4GGFA 2JT0A 4FTGA 2WCLA 4QJ5B 1RFJA 2LANA 4U8DA 1ZMZA 4YRUA 1B4CA 1GJYA 1A2XA 1UHHA 2PASA 3LCPC 1SCMB 4QJ3B 1NPQA 1YUTA 4A4BA 2KAVA 2KFFA 2KBIA 1BU3A 1OMRA 4HRHA 3IF7A 1QV0A 1CDLA 2ZNDA 2JT8A 2EC6C 1SW8A 3BUWB 3SG7A 3D78A 4AQIA 4IJ7A 1S6CA 3FE6A 2ZNEA 5ER5A 1FPWA 3IQOA 2KAYA 1C7VA 1BJFA 4MEWA 4YGCB 3VRRA 1S3PA 4MBEA 1ZUZA 3TUYB 3O78A 3SS3A 1F54A 3D73A 1FI5A 2H2KA 2JXCA 1ZACA 1WY9A 1YUSA 1FW4A 1NX2A 2MLFC 3O4YA 4PHMA 5AANA 1L2OB 1DJWA 3A4UB 1SCVA 3L47A 3K21A 3TS5C 2K7OA 3KO0A 3HCMA 2ERBA 1M46A 1Z4HA 3I5HC 1K2HA 1TCOB 1XYDA 3CWGA 3EVRA 3QMEA 1L7ZA 2P6BB 1SKTA 1PSRA 2KNEA 1B7TY 1TUZA 1D1OA 3BYAA 1RROA 5HKZA 2M7LA 4PE7A 1IRJA 3CR4X 2HPSA 2TN4A 3VRPA 1CMFA 3B88A 2LVJA 1BMOA 3FWBA 4OVNF 1OZSA 1BG1A 1L2OC 3BUXB 1XK4C 3D0YB 3FS7A 3H4SE 1WRKA 1KQMB 4I5KA 1LKJA 2MAZA 3EK4A 1SMGA 1LINA 3I5IB 1SY9A 1K96A 4E68A 2FCEA 5FI7A 1N2DA 2KOTA 3EK8A 2JULA 3OGNA 1AJ4A 3JTDC 2D8NA 1QATA 1UP5A 2F2OA 2OTGB 4YGEB 1UHIA 1B7TZ 3B87A 2VRGA 4ORCB 3GK4X 1ALWA 4I5NB 3ZNIA 1PVBA 4NDDA 1DGUA 1QLKA 1UHJA 1JF0A 1S5GY 3BQ3A 4CIDA 5ER4X 3S0DA 3AAKA 5KU1A 1DJIA 2FCDA 2JT3A 4INWA 5HKYA 2O60A 1KK8C 2BKHB 2FJUB 2KQYA 4FQTA 5HLVA 5JJGA 3CTNA 5HYDA 3PM8A 2Y5IA 3PN7C 4F0ZB 4Q04A 4TNCA 2OS8C 1N65A 1K8UA 1DJYA 3DVEA 3EVVA 1FBVA 2JC2A 4USLA 2K0JA 4DS7A 1JFJA 1G8IA 4YBHB 1GGWA 1AUIB 2LVVA 2MJWB 2MLEC 1J1DA 1CLBA 1K95A 3CR2A 4WRIA 3TDUA 1G4YR 1MWNA 3BXKA 2KFGA 1RJVA 2M1KB 3VGOA 1SR6B 5CSNA 1FI6A 2WOSA 2PRUA 4P2YB 1EH2A 5EL2A 4BY4A 1TUJA 1S5GZ 1WRLA 4GPLB 1S26D 1DVIA 1WRZA 2K7BA 5BPJA 2KDHA 1Y1XA 1XK4A 1KK7Y 3FWCA 5D7FA 1SL9A 3PLFB 4GBAA 3TDIA 4GAOA 2MHHA 3UO9A 3SG4A 1OQPA 2KFHA 4ICBA 4XYNA 2BCXA 3R72A 1KFXS 5AEQA 1TNQA 2LHLA 1AHRA 3S0AA 3DD4A 1ZFSA 3CZ0A 4YGBB 1C07A 1SBJA 4ORBB 4I5LB 1UUSA 3A8RA 1KWOB 1S6IA 1IJ6A 3SJSA 3WHUB 1IWQA 1YR5A 4GNKB 3DVMA 1TNPA 2CCMA 3IVTA 3RLZA 3Q8IA 1H8BA 2KI4C 2L4HA 1K9PA 1UURA 2M29A 5KTYA 2ZN8A 1PALA 3AAJA 2JPTA 1K90D 2BE6A 3VB1A 2K61A 5GQQC 1LXFC 3WNXB 1CMGA 2BCBA 3BUMB 2LLTA 5TNCA 2LUXA 4PE1A 2LE9B 3EKHA 4HSZA 4MZLA 4DIRA 4GUKA 1OZOA 1KK7Z 3LLEA 2QACA 1KSOA 2EHBA 2JNFA 3GK1A 4PHNA 4M2OA 1V1FA 2BBMA 2FOTA 2GTEA 5K89A 2M8UA 1UHNA 1OW4A 2KYFA 2LLSA 2WCJA 3PSRA 1DC1A 2RGIA 1HQVA 3OX5A 3CYZA 2BECA 1SCMC 2L98A 3NSLA 2H61C 1A75A 2K2FA 2ZFDA 1QJTA 1JFKA 1AVSA 1DGVA 2CT9A 3BFHA 2HQWA 4JPZB 1EXRA 3NXAA 1DELA 3R1PA 3GK2A 2BCAA 5I8NA 2M9GA 2WC8A 1SSEB 2LUCA 1SL8A 2KBMA 2QEHA 3MSEB 4MZJA 2AAOA 3V2LA 1J7QA 2WCBA 1JSAA 2K7DA 1MXEA 1XFVO 1OMVA 1XFXO 1M39A 1QASA 3TUYC 3OB1B 1F70A 2K60A 3TDZA 2QEOA 1UWOA 4MZKA 2LVKA 2YGUA 1K94A 4JQ0D 5DKQA 3SS5A 2AMIA 3K1EA 4WQ3A 1CFPA 1AJ5A 1S1EA 2WCMA 2Y1MA 3BUNB 5HLOA 1CFCA 3OBVA 5FI2A 1K9KA 3QRXA 4AQJA 1YRUB 2L51A 1P28A 1U5IA 1OOIX 1DJZA 1ZOTB 2P71A 3EKJA 4PCWA 4KYNA 1B8LA 1YVHA 4N1GA 1RK9A 3SIBA 1OSAA 4PALA 1IIOA 3CR5X 3BOWB 1CFDA 2QDIA 5AXIA 1NUBA 2LMVA 1NIWA 1R2UA 1NP8A 3DVJA 2Q4UA 1J7OA 5I2LA 1KQMC 1IH0A 1KFXL 4ZCUA 3I5GB 3D10A 2QPTA 2KGBC 2HQ8A 2B1UA 2WC6A 3JVTB 2GV5A 1F55A 2MBXA 3NHTA 1F71A 3BUOB 3I5IC 4C0KA 1MF8B 2E6WA 1TNXA 1SPYA 1BLQA 1M45A 1YUUA 3SG2A 1XFYO 5FYXA 1F4OA 4JWQA 2I7AA 3OP0A 3L4LA 3D77A 1ALVA 2H61A 2ZRSA 3KEVA 2G2BA 2CXJA 2OTGC 1Y1AA 1QV1A 2PYQA 2WCFA 4F7FA 3I5FB 2ZKMX 3M0WA 4NDCA 2CTNA 3NHIA 2LLUA 1T14A 1YTZC 1A29A 2KLDA 5DKRA 1DJXA 1Y1UA 3DY9A 3CZ1A 1S36A 2PQLA 3OHMB 1SL7A 5JOLA 4DRWA 1V1GA 1TTXA 4OZDA 2WCHA 2BL0B 4PE4A 1SYMA 2JXLA 1BR1B 1WDCB 2KI6D 1IKUA 1WLZA 1IGVA 1EG4A 4CFQA 3D75A
chains in the Genus database with same CATH topology
1J55A 4A4CA 1CLMA 2G9BA 1KSMA 2GGMA 4MRXA 1MR8A 2BE4A 1MQ1A 4N5XA 2JWWA 4R1EA 4DUQA 1BR4B 1M31A 1NX1A 1RECA 4C0JA 1CDNA 1B9AA 1F8HA 3SG6A 3IQQA 5F6TA 1GQMA 1SR6C 1WDCC 2WCEA 1SK6D 1BOCA 3DVKA 1NWDA 2BKIB 2F3YA 2NCOA 1OMDA 2KHNA 2LP2A 1IQ3A 4MN0A 1MHOA 1RWYA 2EGDA 1TRFA 2M3WA 2LC5A 1SRAA 2I2RE 3D0YA 2M1UA 1XFUO 1IJ5A 1JWDA 3NSKA 3VRQA 2WNDA 1LA3A 4OCIA 4AOMA 4CPVA 1XFZO 2K7CA 1OE9B 3CLNA 5AERA 2F33A 1NX3A 4XJKB 1QIWA 1PULA 1Q80A 2LMUA 1UHKA 2NCPA 2R2IA 1QX5B 3SIAA 4GFTA 1KWOC 3O6BA 3KPXA 3WHTB 1DJHA 3LL8B 2EC6B 4L9MA 4UPGA 4NQGA 1DF0B 3LK0A 3RM1A 1DJGA 4CFRA 1B1GA 1F4QA 1QX7A 2Y1NA 1DMOA 4WQ2A 1Y6WA 2HETA 2M7NA 2ISDA 4M2PA 1YX8A 2IS9A 4CLNA 1JUOA 4M2QA 1JBAA 2PALA 2KSPA 2O5GA 3LK1A 3OX6A 4OKHA 3TZ1A 2L2EA 3EVUA 3TS5B 2Y4QA 2KGRA 1QVIZ 3NSOA 2JRFA 3I5HB 5CSFA 2JOJA 2M0RA 3NSIA 1C7WA 2SCPA 2ZRTA 4OR9B 1E8AA 4GGNA 2JQ6A 5DKNA 1YURA 1BT6A 1NSHA 2HF5A 2L4IA 3KF9A 2M97A 4QJ4B 5B8IB 2DOQA 1KFUL 1TN4A 5J3XA 2MRDA 3DF0B 1M63B 5HKWA 2V53A 2JU0A 1N0YA 1CLLA 2E30A 2LHIA 3CGAA 1CM1A 2Q91A 3VRNA 1Y0VH 2KAXA 2ZN9A 2LM5A 2PVBA 1TNWA 2F3ZA 2LCPA 3SG5A 1XA5A 2AUCA 1ODBA 1GGZA 1SNLA 3JTDB 4YI8A 4YGAA 3GOFA 5G08A 1K93D 1H4BA 2WORA 2I94A 1B8CA 1HT9A 1PRWA 2LVIA 4D1EA 5KSZA 2PMYA 1KQVA 1MXLC 1BF5A 4HRGA 4DCKA 2NXQA 4PHJA 4C0LA 1XO5A 1XVJA 2JTZA 1QX2A 3EK7A 4MSPA 1CNPA 5I2OA 4MVFA 2COLB 1S6JA 1KCYA 1LVCD 4ORAB 2GGZA 4MRYA 4XJKA 2L0PA 1QLSA 4HREE 2M49B 4YI9A 1YVLA 1OOJA 2I18A 1KK8B 3C1VA 3ICBA 1A4PA 2LMTA 1YX7A 3PATA 4GGFC 3AKAA 1QIVA 1DTLA 1W7IB 2A4JA 3I5GC 1YRTB 3JVTC 1CB1A 1JC2A 1NCXA 2JZIA 2JNXA 2K8MB 3PN7B 1AK8A 5D69A 1JF2A 1B8RA 1TOPA 2OS8B 1VRKA 2CBLA 2NZ0A 1A75B 1DF0A 4PE0A 3ZWHA 2KYCA 1KFUS 2LAPA 1CM4A 4BY5A 5I2QA 1W7JB 1J7PA 2F2PA 1WLMA 2KQ6A 1G33A 1R6PA 2L50A 3CZTX 2BBNA 2OPOA 3PALA 4YGDB 1DT7B 3I5FC 2LNKA 1NX0A 1NCYA 2LV7A 3VROA 5PALA 1CTRA 1B47A 1PSBA 1CFFA 1CKKA 3WXAA 1BODA 3F45A 5CPVA 4OV2A 1X02A 4ETOA 4N1FA 4PHKA 5CSIA 2BL0C 1FF1A 2NLNA 2KI6C 1LA0A 1QS7A 5IBWA 2L5XB 1EG3A 1NCZA 2MA2A 1MUXA 2K2AA 1QXPA 1RTP1 1IQ5A 1A03A 3CS1A 1EJ3A 2F8PA 1U5IB 3O2PA 3OB2B 5AFPA 3HX4A 4P5OE 1AP4A 1J7RA 1IG5A 4PDZA 3AKBA 2CNPA 2KI4B 1PK0D 1XFWO 3DF0A 1CDMA 3SG3A 5CSJA 1NYAA 4NDBA 2JTTA 2LP3A 1CDPA 4IL1A 3PFVA 3E3RA 1QVIY 1TCFA 1J1EA 4I5JA 3BOWA 1K9UA 1EL4A 4FQOA 2PSRA 2SASA 1QTXA 3KHEA 1PVAA 3FIAA 4ZCVA 1TIZA 4MLWA 4GGFA 2JT0A 4FTGA 4QJ5B 1RFJA 2LANA 4U8DA 1ZMZA 4YRUA 1B4CA 1GJYA 1A2XA 1UHHA 2PASA 3LCPC 1SCMB 4QJ3B 1NPQA 1YUTA 4A4BA 2KAVA 2KFFA 2KBIA 1BU3A 1OMRA 4HRHA 3IF7A 1QV0A 1CDLA 2ZNDA 2JT8A 2EC6C 1SW8A 3BUWB 3SG7A 4AQIA 1S6CA 2ZNEA 5ER5A 1FPWA 3IQOA 2KAYA 1C7VA 1BJFA 4MEWA 4YGCB 3VRRA 1S3PA 4MBEA 1ZUZA 3TUYB 3O78A 1F54A 1FI5A 2H2KA 2JXCA 1ZACA 1WY9A 1YUSA 1FW4A 1NX2A 2MLFC 3O4YA 4PHMA 5AANA 1L2OB 1DJWA 3A4UB 1SCVA 3K21A 3TS5C 2K7OA 3KO0A 3HCMA 1M46A 3I5HC 1K2HA 1TCOB 1XYDA 3CWGA 3EVRA 1L7ZA 2P6BB 1SKTA 1PSRA 2KNEA 1B7TY 1D1OA 3BYAA 1RROA 5HKZA 2M7LA 4PE7A 1IRJA 3CR4X 2HPSA 2TN4A 3VRPA 1CMFA 2LVJA 1BMOA 3FWBA 4OVNF 1OZSA 1BG1A 1L2OC 3BUXB 1XK4C 3D0YB 3FS7A 3H4SE 1WRKA 1KQMB 4I5KA 1LKJA 2MAZA 3EK4A 1SMGA 1LINA 3I5IB 1SY9A 1K96A 4E68A 2FCEA 1N2DA 2KOTA 3EK8A 2JULA 1AJ4A 3JTDC 2D8NA 1QATA 1UP5A 2F2OA 2OTGB 4YGEB 1UHIA 1B7TZ 2VRGA 4ORCB 3GK4X 1ALWA 4I5NB 3ZNIA 1PVBA 4NDDA 1DGUA 1QLKA 1UHJA 1JF0A 1S5GY 3BQ3A 4CIDA 5ER4X 3AAKA 5KU1A 1DJIA 2FCDA 2JT3A 5HKYA 2O60A 1KK8C 2BKHB 2FJUB 2KQYA 5HLVA 5JJGA 3CTNA 5HYDA 3PM8A 2Y5IA 3PN7C 4F0ZB 4Q04A 4TNCA 2OS8C 1N65A 1K8UA 1DJYA 3DVEA 3EVVA 1FBVA 2JC2A 4USLA 2K0JA 4DS7A 1JFJA 1G8IA 4YBHB 1GGWA 1AUIB 2LVVA 2MJWB 2MLEC 1J1DA 1CLBA 1K95A 3CR2A 4WRIA 3TDUA 1G4YR 1MWNA 3BXKA 2KFGA 1RJVA 2M1KB 3VGOA 1SR6B 5CSNA 1FI6A 2WOSA 2PRUA 4P2YB 1EH2A 4BY4A 1S5GZ 1WRLA 4GPLB 1S26D 1DVIA 1WRZA 2K7BA 5BPJA 2KDHA 1Y1XA 1XK4A 1KK7Y 3FWCA 5D7FA 1SL9A 3PLFB 4GBAA 3TDIA 4GAOA 2MHHA 3SG4A 1OQPA 2KFHA 4ICBA 4XYNA 2BCXA 1KFXS 5AEQA 1TNQA 2LHLA 1AHRA 3DD4A 1ZFSA 4YGBB 1C07A 1SBJA 4ORBB 4I5LB 1UUSA 3A8RA 1KWOB 1S6IA 1IJ6A 3SJSA 3WHUB 1IWQA 1YR5A 4GNKB 3DVMA 1TNPA 2CCMA 3RLZA 1H8BA 2KI4C 2L4HA 1K9PA 1UURA 2M29A 5KTYA 2ZN8A 1PALA 3AAJA 2JPTA 2BE6A 1K90D 2K61A 5GQQC 1LXFC 3WNXB 1CMGA 2BCBA 3BUMB 2LLTA 5TNCA 2LUXA 4PE1A 2LE9B 3EKHA 4HSZA 4MZLA 4DIRA 4GUKA 1OZOA 1KK7Z 3LLEA 2QACA 1KSOA 2EHBA 2JNFA 3GK1A 4PHNA 4M2OA 1V1FA 2BBMA 2FOTA 5K89A 2M8UA 1UHNA 2LLSA 2KYFA 3PSRA 2RGIA 1HQVA 3OX5A 2BECA 1SCMC 2L98A 3NSLA 2H61C 1A75A 2K2FA 2ZFDA 1QJTA 1JFKA 1AVSA 1DGVA 2CT9A 4JPZB 2HQWA 1EXRA 3NXAA 3GK2A 2BCAA 5I8NA 2M9GA 2WC8A 2LUCA 1SL8A 2KBMA 4MZJA 3MSEB 2AAOA 1J7QA 2WCBA 1JSAA 2K7DA 1MXEA 1XFVO 1OMVA 1XFXO 1M39A 1QASA 3TUYC 3OB1B 1F70A 3TDZA 1UWOA 4MZKA 2LVKA 1K94A 4JQ0D 5DKQA 2AMIA 4WQ3A 1CFPA 1AJ5A 1S1EA 2Y1MA 3BUNB 5HLOA 1CFCA 1K9KA 3QRXA 4AQJA 1YRUB 2L51A 1U5IA 1DJZA 1ZOTB 3EKJA 4PCWA 1B8LA 1YVHA 4N1GA 1RK9A 3SIBA 1OSAA 4PALA 3CR5X 3BOWB 1CFDA 5AXIA 1NUBA 2LMVA 1NIWA 1R2UA 1NP8A 3DVJA 2Q4UA 1J7OA 5I2LA 1KQMC 1IH0A 1KFXL 4ZCUA 3I5GB 3D10A 2QPTA 2KGBC 2HQ8A 2B1UA 3JVTB 2GV5A 1F55A 2MBXA 1F71A 3BUOB 3I5IC 4C0KA 1MF8B 2E6WA 1TNXA 1SPYA 1BLQA 1M45A 1YUUA 3SG2A 1XFYO 5FYXA 1F4OA 4JWQA 2I7AA 3OP0A 1ALVA 2H61A 2ZRSA 3KEVA 2G2BA 2CXJA 2OTGC 1Y1AA 1QV1A 2WCFA 3I5FB 2ZKMX 3M0WA 4NDCA 2CTNA 2LLUA 1YTZC 1A29A 5DKRA 1DJXA 1Y1UA 1S36A 3OHMB 1SL7A 5JOLA 4DRWA 1V1GA 1TTXA 2BL0B 4PE4A 1SYMA 2JXLA 1BR1B 1WDCB 2KI6D 1IKUA 1WLZA 1IGVA 1EG4A 4CFQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J55 A;  4A4C A;  1CLM A;  2G9B A;  1KSM A;  2GGM A;  4MRX A;  1MR8 A;  2BE4 A;  1MQ1 A;  4N5X A;  2JWW A;  4R1E A;  4DUQ A;  1BR4 B;  1M31 A;  1NX1 A;  1REC A;  4C0J A;  1CDN A;  1B9A A;  1F8H A;  3SG6 A;  3IQQ A;  5F6T A;  1GQM A;  1SR6 C;  1WDC C;  2WCE A;  1SK6 D;  1BOC A;  3DVK A;  1NWD A;  2BKI B;  2F3Y A;  2NCO A;  1OMD A;  2KHN A;  2LP2 A;  1IQ3 A;  4MN0 A;  1MHO A;  1RWY A;  2EGD A;  1TRF A;  2M3W A;  2LC5 A;  1SRA A;  2I2R E;  3D0Y A;  2M1U A;  1XFU O;  1IJ5 A;  1JWD A;  3NSK A;  3VRQ A;  2WND A;  1LA3 A;  4OCI A;  4AOM A;  4CPV A;  1XFZ O;  2K7C A;  1OE9 B;  3CLN A;  5AER A;  2F33 A;  1NX3 A;  4XJK B;  1QIW A;  1PUL A;  1Q80 A;  2LMU A;  1UHK A;  2NCP A;  2R2I A;  1QX5 B;  3SIA A;  4GFT A;  1KWO C;  3O6B A;  3KPX A;  3WHT B;  1DJH A;  3LL8 B;  2EC6 B;  4L9M A;  4UPG A;  4NQG A;  1DF0 B;  3LK0 A;  3RM1 A;  1DJG A;  4CFR A;  1B1G A;  1F4Q A;  1QX7 A;  2Y1N A;  1DMO A;  4WQ2 A;  1Y6W A;  2HET A;  2M7N A;  2ISD A;  4M2P A;  1YX8 A;  2IS9 A;  4CLN A;  1JUO A;  4M2Q A;  1JBA A;  2PAL A;  2KSP A;  2O5G A;  3LK1 A;  3OX6 A;  4OKH A;  3TZ1 A;  2L2E A;  3EVU A;  3TS5 B;  2Y4Q A;  2KGR A;  1QVI Z;  3NSO A;  2JRF A;  3I5H B;  5CSF A;  2JOJ A;  2M0R A;  3NSI A;  1C7W A;  2SCP A;  2ZRT A;  4OR9 B;  1E8A A;  4GGN A;  2JQ6 A;  5DKN A;  1YUR A;  1BT6 A;  1NSH A;  2HF5 A;  2L4I A;  3KF9 A;  2M97 A;  4QJ4 B;  5B8I B;  2DOQ A;  1KFU L;  1TN4 A;  5J3X A;  2MRD A;  3DF0 B;  1M63 B;  5HKW A;  2V53 A;  2JU0 A;  1N0Y A;  1CLL A;  2E30 A;  2LHI A;  3CGA A;  1CM1 A;  2Q91 A;  3VRN A;  1Y0V H;  2KAX A;  2ZN9 A;  2LM5 A;  2PVB A;  1TNW A;  2F3Z A;  2LCP A;  3SG5 A;  1XA5 A;  2AUC A;  1ODB A;  1GGZ A;  1SNL A;  3JTD B;  4YI8 A;  4YGA A;  3GOF A;  5G08 A;  1K93 D;  1H4B A;  2WOR A;  2I94 A;  1B8C A;  1HT9 A;  1PRW A;  2LVI A;  4D1E A;  5KSZ A;  2PMY A;  1KQV A;  1MXL C;  1BF5 A;  4HRG A;  4DCK A;  2NXQ A;  4PHJ A;  4C0L A;  1XO5 A;  1XVJ A;  2JTZ A;  1QX2 A;  3EK7 A;  4MSP A;  1CNP A;  5I2O A;  4MVF A;  2COL B;  1S6J A;  1KCY A;  1LVC D;  4ORA B;  2GGZ A;  4MRY A;  4XJK A;  2L0P A;  1QLS A;  4HRE E;  2M49 B;  4YI9 A;  1YVL A;  1OOJ A;  2I18 A;  1KK8 B;  3C1V A;  3ICB A;  1A4P A;  2LMT A;  1YX7 A;  3PAT A;  4GGF C;  3AKA A;  1QIV A;  1DTL A;  1W7I B;  2A4J A;  3I5G C;  1YRT B;  3JVT C;  1CB1 A;  1JC2 A;  1NCX A;  2JZI A;  2JNX A;  2K8M B;  3PN7 B;  1AK8 A;  5D69 A;  1JF2 A;  1B8R A;  1TOP A;  2OS8 B;  1VRK A;  2CBL A;  2NZ0 A;  1A75 B;  1DF0 A;  4PE0 A;  3ZWH A;  2KYC A;  1KFU S;  2LAP A;  1CM4 A;  4BY5 A;  5I2Q A;  1W7J B;  1J7P A;  2F2P A;  1WLM A;  2KQ6 A;  1G33 A;  1R6P A;  2L50 A;  3CZT X;  2BBN A;  2OPO A;  3PAL A;  4YGD B;  1DT7 B;  3I5F C;  2LNK A;  1NX0 A;  1NCY A;  2LV7 A;  3VRO A;  5PAL A;  1CTR A;  1B47 A;  1PSB A;  1CFF A;  1CKK A;  3WXA A;  1BOD A;  3F45 A;  5CPV A;  4OV2 A;  1X02 A;  4ETO A;  4N1F A;  4PHK A;  5CSI A;  2BL0 C;  1FF1 A;  2NLN A;  2KI6 C;  1LA0 A;  1QS7 A;  5IBW A;  2L5X B;  1EG3 A;  1NCZ A;  2MA2 A;  1MUX A;  2K2A A;  1QXP A;  1RTP 1;  1IQ5 A;  1A03 A;  3CS1 A;  1EJ3 A;  2F8P A;  1U5I B;  3O2P A;  3OB2 B;  5AFP A;  3HX4 A;  4P5O E;  1AP4 A;  1J7R A;  1IG5 A;  4PDZ A;  3AKB A;  2CNP A;  2KI4 B;  1PK0 D;  1XFW O;  3DF0 A;  1CDM A;  3SG3 A;  5CSJ A;  1NYA A;  4NDB A;  2JTT A;  2LP3 A;  1CDP A;  4IL1 A;  3PFV A;  3E3R A;  1QVI Y;  1TCF A;  1J1E A;  4I5J A;  3BOW A;  1K9U A;  1EL4 A;  4FQO A;  2PSR A;  2SAS A;  1QTX A;  3KHE A;  1PVA A;  3FIA A;  4ZCV A;  1TIZ A;  4MLW A;  4GGF A;  2JT0 A;  4FTG A;  4QJ5 B;  1RFJ A;  2LAN A;  4U8D A;  1ZMZ A;  4YRU A;  1B4C A;  1GJY A;  1A2X A;  1UHH A;  2PAS A;  3LCP C;  1SCM B;  4QJ3 B;  1NPQ A;  1YUT A;  4A4B A;  2KAV A;  2KFF A;  2KBI A;  1BU3 A;  1OMR A;  4HRH A;  3IF7 A;  1QV0 A;  1CDL A;  2ZND A;  2JT8 A;  2EC6 C;  1SW8 A;  3BUW B;  3SG7 A;  4AQI A;  1S6C A;  2ZNE A;  5ER5 A;  1FPW A;  3IQO A;  2KAY A;  1C7V A;  1BJF A;  4MEW A;  4YGC B;  3VRR A;  1S3P A;  4MBE A;  1ZUZ A;  3TUY B;  3O78 A;  1F54 A;  1FI5 A;  2H2K A;  2JXC A;  1ZAC A;  1WY9 A;  1YUS A;  1FW4 A;  1NX2 A;  2MLF C;  3O4Y A;  4PHM A;  5AAN A;  1L2O B;  1DJW A;  3A4U B;  1SCV A;  3K21 A;  3TS5 C;  2K7O A;  3KO0 A;  3HCM A;  1M46 A;  3I5H C;  1K2H A;  1TCO B;  1XYD A;  3CWG A;  3EVR A;  1L7Z A;  2P6B B;  1SKT A;  1PSR A;  2KNE A;  1B7T Y;  1D1O A;  3BYA A;  1RRO A;  5HKZ A;  2M7L A;  4PE7 A;  1IRJ A;  3CR4 X;  2HPS A;  2TN4 A;  3VRP A;  1CMF A;  2LVJ A;  1BMO A;  3FWB A;  4OVN F;  1OZS A;  1BG1 A;  1L2O C;  3BUX B;  1XK4 C;  3D0Y B;  3FS7 A;  3H4S E;  1WRK A;  1KQM B;  4I5K A;  1LKJ A;  2MAZ A;  3EK4 A;  1SMG A;  1LIN A;  3I5I B;  1SY9 A;  1K96 A;  4E68 A;  2FCE A;  1N2D A;  2KOT A;  3EK8 A;  2JUL A;  1AJ4 A;  3JTD C;  2D8N A;  1QAT A;  1UP5 A;  2F2O A;  2OTG B;  4YGE B;  1UHI A;  1B7T Z;  2VRG A;  4ORC B;  3GK4 X;  1ALW A;  4I5N B;  3ZNI A;  1PVB A;  4NDD A;  1DGU A;  1QLK A;  1UHJ A;  1JF0 A;  1S5G Y;  3BQ3 A;  4CID A;  5ER4 X;  3AAK A;  5KU1 A;  1DJI A;  2FCD A;  2JT3 A;  5HKY A;  2O60 A;  1KK8 C;  2BKH B;  2FJU B;  2KQY A;  5HLV A;  5JJG A;  3CTN A;  5HYD A;  3PM8 A;  2Y5I A;  3PN7 C;  4F0Z B;  4Q04 A;  4TNC A;  2OS8 C;  1N65 A;  1K8U A;  1DJY A;  3DVE A;  3EVV A;  1FBV A;  2JC2 A;  4USL A;  2K0J A;  4DS7 A;  1JFJ A;  1G8I A;  4YBH B;  1GGW A;  1AUI B;  2LVV A;  2MJW B;  2MLE C;  1J1D A;  1CLB A;  1K95 A;  3CR2 A;  4WRI A;  3TDU A;  1G4Y R;  1MWN A;  3BXK A;  2KFG A;  1RJV A;  2M1K B;  3VGO A;  1SR6 B;  5CSN A;  1FI6 A;  2WOS A;  2PRU A;  4P2Y B;  1EH2 A;  4BY4 A;  1S5G Z;  1WRL A;  4GPL B;  1S26 D;  1DVI A;  1WRZ A;  2K7B A;  5BPJ A;  2KDH A;  1Y1X A;  1XK4 A;  1KK7 Y;  3FWC A;  5D7F A;  1SL9 A;  3PLF B;  4GBA A;  3TDI A;  4GAO A;  2MHH A;  3SG4 A;  1OQP A;  2KFH A;  4ICB A;  4XYN A;  2BCX A;  1KFX S;  5AEQ A;  1TNQ A;  2LHL A;  1AHR A;  3DD4 A;  1ZFS A;  4YGB B;  1C07 A;  1SBJ A;  4ORB B;  4I5L B;  1UUS A;  3A8R A;  1KWO B;  1S6I A;  1IJ6 A;  3SJS A;  3WHU B;  1IWQ A;  1YR5 A;  4GNK B;  3DVM A;  1TNP A;  2CCM A;  3RLZ A;  1H8B A;  2KI4 C;  2L4H A;  1K9P A;  1UUR A;  2M29 A;  5KTY A;  2ZN8 A;  1PAL A;  3AAJ A;  2JPT A;  2BE6 A;  1K90 D;  2K61 A;  5GQQ C;  1LXF C;  3WNX B;  1CMG A;  2BCB A;  3BUM B;  2LLT A;  5TNC A;  2LUX A;  4PE1 A;  2LE9 B;  3EKH A;  4HSZ A;  4MZL A;  4DIR A;  4GUK A;  1OZO A;  1KK7 Z;  3LLE A;  2QAC A;  1KSO A;  2EHB A;  2JNF A;  3GK1 A;  4PHN A;  4M2O A;  1V1F A;  2BBM A;  2FOT A;  5K89 A;  2M8U A;  1UHN A;  2LLS A;  2KYF A;  3PSR A;  2RGI A;  1HQV A;  3OX5 A;  2BEC A;  1SCM C;  2L98 A;  3NSL A;  2H61 C;  1A75 A;  2K2F A;  2ZFD A;  1QJT A;  1JFK A;  1AVS A;  1DGV A;  2CT9 A;  4JPZ B;  2HQW A;  1EXR A;  3NXA A;  3GK2 A;  2BCA A;  5I8N A;  2M9G A;  2WC8 A;  2LUC A;  1SL8 A;  2KBM A;  4MZJ A;  3MSE B;  2AAO A;  1J7Q A;  2WCB A;  1JSA A;  2K7D A;  1MXE A;  1XFV O;  1OMV A;  1XFX O;  1M39 A;  1QAS A;  3TUY C;  3OB1 B;  1F70 A;  3TDZ A;  1UWO A;  4MZK A;  2LVK A;  1K94 A;  4JQ0 D;  5DKQ A;  2AMI A;  4WQ3 A;  1CFP A;  1AJ5 A;  1S1E A;  2Y1M A;  3BUN B;  5HLO A;  1CFC A;  1K9K A;  3QRX A;  4AQJ A;  1YRU B;  2L51 A;  1U5I A;  1DJZ A;  1ZOT B;  3EKJ A;  4PCW A;  1B8L A;  1YVH A;  4N1G A;  1RK9 A;  3SIB A;  1OSA A;  4PAL A;  3CR5 X;  3BOW B;  1CFD A;  5AXI A;  1NUB A;  2LMV A;  1NIW A;  1R2U A;  1NP8 A;  3DVJ A;  2Q4U A;  1J7O A;  5I2L A;  1KQM C;  1IH0 A;  1KFX L;  4ZCU A;  3I5G B;  3D10 A;  2QPT A;  2KGB C;  2HQ8 A;  2B1U A;  3JVT B;  2GV5 A;  1F55 A;  2MBX A;  1F71 A;  3BUO B;  3I5I C;  4C0K A;  1MF8 B;  2E6W A;  1TNX A;  1SPY A;  1BLQ A;  1M45 A;  1YUU A;  3SG2 A;  1XFY O;  5FYX A;  1F4O A;  4JWQ A;  2I7A A;  3OP0 A;  1ALV A;  2H61 A;  2ZRS A;  3KEV A;  2G2B A;  2CXJ A;  2OTG C;  1Y1A A;  1QV1 A;  2WCF A;  3I5F B;  2ZKM X;  3M0W A;  4NDC A;  2CTN A;  2LLU A;  1YTZ C;  1A29 A;  5DKR A;  1DJX A;  1Y1U A;  1S36 A;  3OHM B;  1SL7 A;  5JOL A;  4DRW A;  1V1G A;  1TTX A;  2BL0 B;  4PE4 A;  1SYM A;  2JXL A;  1BR1 B;  1WDC B;  2KI6 D;  1IKU A;  1WLZ A;  1IGV A;  1EG4 A;  4CFQ A; 
#chains in the Genus database with same CATH topology
 1J55 A;  4A4C A;  1CLM A;  2G9B A;  1KSM A;  2GGM A;  4MRX A;  1MR8 A;  2BE4 A;  1MQ1 A;  4N5X A;  2JWW A;  4R1E A;  1DQE A;  4DUQ A;  1BR4 B;  1M31 A;  1NX1 A;  1REC A;  3R1V A;  4C0J A;  1CDN A;  1B9A A;  3NGV A;  1F8H A;  3SG6 A;  4PT1 A;  3IQQ A;  5F6T A;  1GQM A;  1SR6 C;  1WDC C;  1OOG A;  5DIC A;  3FE9 A;  2WCE A;  1SK6 D;  1BOC A;  3DVK A;  1NWD A;  2BKI B;  2F3Y A;  2NCO A;  1OMD A;  2KHN A;  1OOF A;  2LP2 A;  3S0B A;  4MN0 A;  1IQ3 A;  1MHO A;  1RWY A;  2EGD A;  1TRF A;  2M3W A;  2LC5 A;  1SRA A;  2QEB A;  2I2R E;  3D0Y A;  2M1U A;  1XFU O;  1IJ5 A;  1JWD A;  3NSK A;  3VRQ A;  3CAB A;  2WND A;  2JPO A;  1LA3 A;  4OCI A;  4AOM A;  4CPV A;  1XFZ O;  2K7C A;  1OE9 B;  3CLN A;  5AER A;  2F33 A;  4INX A;  1NX3 A;  4XJK B;  1QIW A;  1PUL A;  1Q80 A;  2LMU A;  1UHK A;  2NCP A;  2R2I A;  1QX5 B;  3SIA A;  4GFT A;  1KWO C;  3O6B A;  3KPX A;  3D76 A;  3WHT B;  1DJH A;  2KPH A;  1ORG A;  2EC6 B;  3LL8 B;  4L9M A;  4UPG A;  3DZT A;  4NQG A;  1DF0 B;  3LK0 A;  3RM1 A;  1DJG A;  4CFR A;  1B1G A;  1F4Q A;  1QX7 A;  2Y1N A;  2L2C A;  1DMO A;  4WQ2 A;  1Y6W A;  2HET A;  1Z2C B;  2M7N A;  2ISD A;  4M2P A;  1YX8 A;  2IS9 A;  1GM0 A;  4CLN A;  1JUO A;  4M2Q A;  1JBA A;  2PAL A;  3B6X A;  5HL1 A;  2KSP A;  2O5G A;  2P70 A;  3LK1 A;  3OX6 A;  4OKH A;  3TZ1 A;  2L2E A;  3D74 A;  3EVU A;  3TS5 B;  2Y4Q A;  2KGR A;  1QVI Z;  3NSO A;  2JRF A;  3I5H B;  5CSF A;  2H8V A;  2JOJ A;  2M0R A;  3NSI A;  1C7W A;  2SCP A;  2ZRT A;  4OR9 B;  1E8A A;  4GGN A;  2JQ6 A;  5DKN A;  1YUR A;  1BT6 A;  1NSH A;  3SS4 A;  2HF5 A;  2L4I A;  3KF9 A;  3BJH A;  3UNW A;  1C3Z A;  2M97 A;  2BNX A;  4QJ4 B;  5B8I B;  1XFR A;  2DOQ A;  1KFU L;  1TN4 A;  5J3X A;  2MRD A;  3DF0 B;  3B7A A;  1M63 B;  5HKW A;  2V53 A;  2JU0 A;  3B86 A;  1N0Y A;  1CLL A;  2E30 A;  2L5Y A;  2LHI A;  1CM1 A;  2Q91 A;  3CGA A;  1Y0V H;  2KAX A;  2ZN9 A;  2LM5 A;  3VRN A;  2PVB A;  1TNW A;  2F3Z A;  3CZ2 A;  2LCP A;  3SG5 A;  1XA5 A;  3FE8 A;  2AUC A;  1ODB A;  1GGZ A;  1SNL A;  3JTD B;  4YI8 A;  1DEK A;  4YGA A;  3GOF A;  5G08 A;  3R1O A;  1K93 D;  1H4B A;  2WOR A;  2I94 A;  3CDN A;  3O4X A;  5I94 A;  1B8C A;  3RZS A;  1HT9 A;  1PRW A;  2LVI A;  3L4A A;  4D1E A;  2PMY A;  5KSZ A;  1KQV A;  1MXL C;  1BF5 A;  4HRG A;  4DCK A;  2NXQ A;  4PHJ A;  4C0L A;  5D3O A;  1XO5 A;  1XVJ A;  2FJY A;  2JTZ A;  1QX2 A;  3EK7 A;  3PJI A;  1TWO A;  4MSP A;  1CNP A;  5I2O A;  1QWV A;  4MVF A;  2COL B;  1S6J A;  4JKT A;  1KCY A;  1LVC D;  4ORA B;  2GGZ A;  4MRY A;  4XJK A;  2L0P A;  1QLS A;  4HRE E;  2M49 B;  4YI9 A;  1YVL A;  1OOJ A;  2I18 A;  1KK8 B;  3C1V A;  3ICB A;  1A4P A;  2LMT A;  1YX7 A;  3PAT A;  4GGF C;  3AKA A;  1QIV A;  1DTL A;  1W7I B;  2A4J A;  3I5G C;  1YRT B;  1OOH A;  3JVT C;  1CB1 A;  1JC2 A;  1NCX A;  2JZI A;  2JNX A;  2K8M B;  3PN7 B;  1AK8 A;  5D69 A;  1JF2 A;  1B8R A;  1TOP A;  2OS8 B;  1VRK A;  3EG5 B;  2CBL A;  2NZ0 A;  1A75 B;  1DF0 A;  4PE0 A;  3ZWH A;  2KYC A;  1KFU S;  2LAP A;  1CM4 A;  4BY5 A;  5I2Q A;  1W7J B;  1J7P A;  2F2P A;  1WLM A;  2KQ6 A;  1G33 A;  1R6P A;  2L50 A;  3CZT X;  2BBN A;  2OPO A;  3PAL A;  2KLE A;  4YGD B;  3PM2 A;  1DT7 B;  3I5F C;  2LNK A;  3S0E A;  1NX0 A;  1NCY A;  2BAP A;  1W9Z A;  3DYE A;  2LV7 A;  3VRO A;  5PAL A;  1CTR A;  1B47 A;  1PSB A;  1CFF A;  1CKK A;  3WXA A;  2QEV A;  1BOD A;  3F45 A;  5CPV A;  4OV2 A;  1X02 A;  4ETO A;  4N1F A;  4PHK A;  5CSI A;  2BL0 C;  1FF1 A;  2NLN A;  2KI6 C;  1LA0 A;  1QS7 A;  5IBW A;  2L5X B;  1EG3 A;  1NCZ A;  3BFB A;  2MA2 A;  1MUX A;  2K2A A;  1QXP A;  3BFA A;  1RTP 1;  1IQ5 A;  5FI6 A;  1A03 A;  3CS1 A;  1EJ3 A;  2F8P A;  1U5I B;  3O2P A;  3OB2 B;  5AFP A;  3HX4 A;  4P5O E;  1AP4 A;  1J7R A;  1IG5 A;  1LS8 A;  4PDZ A;  3AKB A;  2CNP A;  2KI4 B;  3S0G A;  1PK0 D;  1XFW O;  3DF0 A;  3N7H A;  4JD9 A;  1CDM A;  3SG3 A;  3S0F A;  5CSJ A;  1NYA A;  4NDB A;  2JTT A;  2LP3 A;  1CDP A;  3DXL A;  4IL1 A;  3PFV A;  3E3R A;  1QVI Y;  1TCF A;  1J1E A;  4I5J A;  3BOW A;  1K9U A;  1EL4 A;  4FQO A;  2PSR A;  1C3Y A;  2SAS A;  1QTX A;  3KHE A;  1PVA A;  3FIA A;  4ZCV A;  1TIZ A;  2WC5 A;  2WCK A;  4MLW A;  4GGF A;  2JT0 A;  4FTG A;  2WCL A;  4QJ5 B;  1RFJ A;  2LAN A;  4U8D A;  1ZMZ A;  4YRU A;  1B4C A;  1GJY A;  1A2X A;  1UHH A;  2PAS A;  3LCP C;  1SCM B;  4QJ3 B;  1NPQ A;  1YUT A;  4A4B A;  2KAV A;  2KFF A;  2KBI A;  1BU3 A;  1OMR A;  4HRH A;  3IF7 A;  1QV0 A;  1CDL A;  2ZND A;  2JT8 A;  2EC6 C;  1SW8 A;  3BUW B;  3SG7 A;  3D78 A;  4AQI A;  4IJ7 A;  1S6C A;  3FE6 A;  2ZNE A;  5ER5 A;  1FPW A;  3IQO A;  2KAY A;  1C7V A;  1BJF A;  4MEW A;  4YGC B;  3VRR A;  1S3P A;  4MBE A;  1ZUZ A;  3TUY B;  3O78 A;  3SS3 A;  1F54 A;  3D73 A;  1FI5 A;  2H2K A;  2JXC A;  1ZAC A;  1WY9 A;  1YUS A;  1FW4 A;  1NX2 A;  2MLF C;  3O4Y A;  4PHM A;  5AAN A;  1L2O B;  1DJW A;  3A4U B;  1SCV A;  3L47 A;  3K21 A;  3TS5 C;  2K7O A;  3KO0 A;  3HCM A;  2ERB A;  1M46 A;  1Z4H A;  3I5H C;  1K2H A;  1TCO B;  1XYD A;  3CWG A;  3EVR A;  3QME A;  1L7Z A;  2P6B B;  1SKT A;  1PSR A;  2KNE A;  1B7T Y;  1TUZ A;  1D1O A;  3BYA A;  1RRO A;  5HKZ A;  2M7L A;  4PE7 A;  1IRJ A;  3CR4 X;  2HPS A;  2TN4 A;  3VRP A;  1CMF A;  3B88 A;  2LVJ A;  1BMO A;  3FWB A;  4OVN F;  1OZS A;  1BG1 A;  1L2O C;  3BUX B;  1XK4 C;  3D0Y B;  3FS7 A;  3H4S E;  1WRK A;  1KQM B;  4I5K A;  1LKJ A;  2MAZ A;  3EK4 A;  1SMG A;  1LIN A;  3I5I B;  1SY9 A;  1K96 A;  4E68 A;  2FCE A;  5FI7 A;  1N2D A;  2KOT A;  3EK8 A;  2JUL A;  3OGN A;  1AJ4 A;  3JTD C;  2D8N A;  1QAT A;  1UP5 A;  2F2O A;  2OTG B;  4YGE B;  1UHI A;  1B7T Z;  3B87 A;  2VRG A;  4ORC B;  3GK4 X;  1ALW A;  4I5N B;  3ZNI A;  1PVB A;  4NDD A;  1DGU A;  1QLK A;  1UHJ A;  1JF0 A;  1S5G Y;  3BQ3 A;  4CID A;  5ER4 X;  3S0D A;  3AAK A;  5KU1 A;  1DJI A;  2FCD A;  2JT3 A;  4INW A;  5HKY A;  2O60 A;  1KK8 C;  2BKH B;  2FJU B;  2KQY A;  4FQT A;  5HLV A;  5JJG A;  3CTN A;  5HYD A;  3PM8 A;  2Y5I A;  3PN7 C;  4F0Z B;  4Q04 A;  4TNC A;  2OS8 C;  1N65 A;  1K8U A;  1DJY A;  3DVE A;  3EVV A;  1FBV A;  2JC2 A;  4USL A;  2K0J A;  4DS7 A;  1JFJ A;  1G8I A;  4YBH B;  1GGW A;  1AUI B;  2LVV A;  2MJW B;  2MLE C;  1J1D A;  1CLB A;  1K95 A;  3CR2 A;  4WRI A;  3TDU A;  1G4Y R;  1MWN A;  3BXK A;  2KFG A;  1RJV A;  2M1K B;  3VGO A;  1SR6 B;  5CSN A;  1FI6 A;  2WOS A;  2PRU A;  4P2Y B;  1EH2 A;  5EL2 A;  4BY4 A;  1TUJ A;  1S5G Z;  1WRL A;  4GPL B;  1S26 D;  1DVI A;  1WRZ A;  2K7B A;  5BPJ A;  2KDH A;  1Y1X A;  1XK4 A;  1KK7 Y;  3FWC A;  5D7F A;  1SL9 A;  3PLF B;  4GBA A;  3TDI A;  4GAO A;  2MHH A;  3UO9 A;  3SG4 A;  1OQP A;  2KFH A;  4ICB A;  4XYN A;  2BCX A;  3R72 A;  1KFX S;  5AEQ A;  1TNQ A;  2LHL A;  1AHR A;  3S0A A;  3DD4 A;  1ZFS A;  3CZ0 A;  4YGB B;  1C07 A;  1SBJ A;  4ORB B;  4I5L B;  1UUS A;  3A8R A;  1KWO B;  1S6I A;  1IJ6 A;  3SJS A;  3WHU B;  1IWQ A;  1YR5 A;  4GNK B;  3DVM A;  1TNP A;  2CCM A;  3IVT A;  3RLZ A;  3Q8I A;  1H8B A;  2KI4 C;  2L4H A;  1K9P A;  1UUR A;  2M29 A;  5KTY A;  2ZN8 A;  1PAL A;  3AAJ A;  2JPT A;  1K90 D;  2BE6 A;  3VB1 A;  2K61 A;  5GQQ C;  1LXF C;  3WNX B;  1CMG A;  2BCB A;  3BUM B;  2LLT A;  5TNC A;  2LUX A;  4PE1 A;  2LE9 B;  3EKH A;  4HSZ A;  4MZL A;  4DIR A;  4GUK A;  1OZO A;  1KK7 Z;  3LLE A;  2QAC A;  1KSO A;  2EHB A;  2JNF A;  3GK1 A;  4PHN A;  4M2O A;  1V1F A;  2BBM A;  2FOT A;  2GTE A;  5K89 A;  2M8U A;  1UHN A;  1OW4 A;  2KYF A;  2LLS A;  2WCJ A;  3PSR A;  1DC1 A;  2RGI A;  1HQV A;  3OX5 A;  3CYZ A;  2BEC A;  1SCM C;  2L98 A;  3NSL A;  2H61 C;  1A75 A;  2K2F A;  2ZFD A;  1QJT A;  1JFK A;  1AVS A;  1DGV A;  2CT9 A;  3BFH A;  2HQW A;  4JPZ B;  1EXR A;  3NXA A;  1DEL A;  3R1P A;  3GK2 A;  2BCA A;  5I8N A;  2M9G A;  2WC8 A;  1SSE B;  2LUC A;  1SL8 A;  2KBM A;  2QEH A;  3MSE B;  4MZJ A;  2AAO A;  3V2L A;  1J7Q A;  2WCB A;  1JSA A;  2K7D A;  1MXE A;  1XFV O;  1OMV A;  1XFX O;  1M39 A;  1QAS A;  3TUY C;  3OB1 B;  1F70 A;  2K60 A;  3TDZ A;  2QEO A;  1UWO A;  4MZK A;  2LVK A;  2YGU A;  1K94 A;  4JQ0 D;  5DKQ A;  3SS5 A;  2AMI A;  3K1E A;  4WQ3 A;  1CFP A;  1AJ5 A;  1S1E A;  2WCM A;  2Y1M A;  3BUN B;  5HLO A;  1CFC A;  3OBV A;  5FI2 A;  1K9K A;  3QRX A;  4AQJ A;  1YRU B;  2L51 A;  1P28 A;  1U5I A;  1OOI X;  1DJZ A;  1ZOT B;  2P71 A;  3EKJ A;  4PCW A;  4KYN A;  1B8L A;  1YVH A;  4N1G A;  1RK9 A;  3SIB A;  1OSA A;  4PAL A;  1IIO A;  3CR5 X;  3BOW B;  1CFD A;  2QDI A;  5AXI A;  1NUB A;  2LMV A;  1NIW A;  1R2U A;  1NP8 A;  3DVJ A;  2Q4U A;  1J7O A;  5I2L A;  1KQM C;  1IH0 A;  1KFX L;  4ZCU A;  3I5G B;  3D10 A;  2QPT A;  2KGB C;  2HQ8 A;  2B1U A;  2WC6 A;  3JVT B;  2GV5 A;  1F55 A;  2MBX A;  3NHT A;  1F71 A;  3BUO B;  3I5I C;  4C0K A;  1MF8 B;  2E6W A;  1TNX A;  1SPY A;  1BLQ A;  1M45 A;  1YUU A;  3SG2 A;  1XFY O;  5FYX A;  1F4O A;  4JWQ A;  2I7A A;  3OP0 A;  3L4L A;  3D77 A;  1ALV A;  2H61 A;  2ZRS A;  3KEV A;  2G2B A;  2CXJ A;  2OTG C;  1Y1A A;  1QV1 A;  2PYQ A;  2WCF A;  4F7F A;  3I5F B;  2ZKM X;  3M0W A;  4NDC A;  2CTN A;  3NHI A;  2LLU A;  1T14 A;  1YTZ C;  1A29 A;  2KLD A;  5DKR A;  1DJX A;  1Y1U A;  3DY9 A;  3CZ1 A;  1S36 A;  2PQL A;  3OHM B;  1SL7 A;  5JOL A;  4DRW A;  1V1G A;  1TTX A;  4OZD A;  2WCH A;  2BL0 B;  4PE4 A;  1SYM A;  2JXL A;  1BR1 B;  1WDC B;  2KI6 D;  1IKU A;  1WLZ A;  1IGV A;  1EG4 A;  4CFQ A;  3D75 A; 
#chains in the Genus database with same CATH homology
 1J55 A;  4A4C A;  1CLM A;  2G9B A;  1KSM A;  2GGM A;  4MRX A;  1MR8 A;  2BE4 A;  1MQ1 A;  4N5X A;  2JWW A;  4R1E A;  4DUQ A;  1BR4 B;  1M31 A;  1NX1 A;  1REC A;  4C0J A;  1CDN A;  1B9A A;  1F8H A;  3SG6 A;  3IQQ A;  5F6T A;  1GQM A;  1SR6 C;  1WDC C;  2WCE A;  1SK6 D;  1BOC A;  3DVK A;  1NWD A;  2BKI B;  2F3Y A;  2NCO A;  1OMD A;  2KHN A;  2LP2 A;  1IQ3 A;  4MN0 A;  1MHO A;  1RWY A;  2EGD A;  1TRF A;  2M3W A;  2LC5 A;  1SRA A;  2I2R E;  3D0Y A;  2M1U A;  1XFU O;  1IJ5 A;  1JWD A;  3NSK A;  3VRQ A;  2WND A;  1LA3 A;  4OCI A;  4AOM A;  4CPV A;  1XFZ O;  2K7C A;  1OE9 B;  3CLN A;  5AER A;  2F33 A;  1NX3 A;  4XJK B;  1QIW A;  1PUL A;  1Q80 A;  2LMU A;  1UHK A;  2NCP A;  2R2I A;  1QX5 B;  3SIA A;  4GFT A;  1KWO C;  3O6B A;  3KPX A;  3WHT B;  1DJH A;  3LL8 B;  2EC6 B;  4L9M A;  4UPG A;  4NQG A;  1DF0 B;  3LK0 A;  3RM1 A;  1DJG A;  4CFR A;  1B1G A;  1F4Q A;  1QX7 A;  2Y1N A;  1DMO A;  4WQ2 A;  1Y6W A;  2HET A;  2M7N A;  2ISD A;  4M2P A;  1YX8 A;  2IS9 A;  4CLN A;  1JUO A;  4M2Q A;  1JBA A;  2PAL A;  2KSP A;  2O5G A;  3LK1 A;  3OX6 A;  4OKH A;  3TZ1 A;  2L2E A;  3EVU A;  3TS5 B;  2Y4Q A;  2KGR A;  1QVI Z;  3NSO A;  2JRF A;  3I5H B;  5CSF A;  2JOJ A;  2M0R A;  3NSI A;  1C7W A;  2SCP A;  2ZRT A;  4OR9 B;  1E8A A;  4GGN A;  2JQ6 A;  5DKN A;  1YUR A;  1BT6 A;  1NSH A;  2HF5 A;  2L4I A;  3KF9 A;  2M97 A;  4QJ4 B;  5B8I B;  2DOQ A;  1KFU L;  1TN4 A;  5J3X A;  2MRD A;  3DF0 B;  1M63 B;  5HKW A;  2V53 A;  2JU0 A;  1N0Y A;  1CLL A;  2E30 A;  2LHI A;  3CGA A;  1CM1 A;  2Q91 A;  3VRN A;  1Y0V H;  2KAX A;  2ZN9 A;  2LM5 A;  2PVB A;  1TNW A;  2F3Z A;  2LCP A;  3SG5 A;  1XA5 A;  2AUC A;  1ODB A;  1GGZ A;  1SNL A;  3JTD B;  4YI8 A;  4YGA A;  3GOF A;  5G08 A;  1K93 D;  1H4B A;  2WOR A;  2I94 A;  1B8C A;  1HT9 A;  1PRW A;  2LVI A;  4D1E A;  5KSZ A;  2PMY A;  1KQV A;  1MXL C;  1BF5 A;  4HRG A;  4DCK A;  2NXQ A;  4PHJ A;  4C0L A;  1XO5 A;  1XVJ A;  2JTZ A;  1QX2 A;  3EK7 A;  4MSP A;  1CNP A;  5I2O A;  4MVF A;  2COL B;  1S6J A;  1KCY A;  1LVC D;  4ORA B;  2GGZ A;  4MRY A;  4XJK A;  2L0P A;  1QLS A;  4HRE E;  2M49 B;  4YI9 A;  1YVL A;  1OOJ A;  2I18 A;  1KK8 B;  3C1V A;  3ICB A;  1A4P A;  2LMT A;  1YX7 A;  3PAT A;  4GGF C;  3AKA A;  1QIV A;  1DTL A;  1W7I B;  2A4J A;  3I5G C;  1YRT B;  3JVT C;  1CB1 A;  1JC2 A;  1NCX A;  2JZI A;  2JNX A;  2K8M B;  3PN7 B;  1AK8 A;  5D69 A;  1JF2 A;  1B8R A;  1TOP A;  2OS8 B;  1VRK A;  2CBL A;  2NZ0 A;  1A75 B;  1DF0 A;  4PE0 A;  3ZWH A;  2KYC A;  1KFU S;  2LAP A;  1CM4 A;  4BY5 A;  5I2Q A;  1W7J B;  1J7P A;  2F2P A;  1WLM A;  2KQ6 A;  1G33 A;  1R6P A;  2L50 A;  3CZT X;  2BBN A;  2OPO A;  3PAL A;  4YGD B;  1DT7 B;  3I5F C;  2LNK A;  1NX0 A;  1NCY A;  2LV7 A;  3VRO A;  5PAL A;  1CTR A;  1B47 A;  1PSB A;  1CFF A;  1CKK A;  3WXA A;  1BOD A;  3F45 A;  5CPV A;  4OV2 A;  1X02 A;  4ETO A;  4N1F A;  4PHK A;  5CSI A;  2BL0 C;  1FF1 A;  2NLN A;  2KI6 C;  1LA0 A;  1QS7 A;  5IBW A;  2L5X B;  1EG3 A;  1NCZ A;  2MA2 A;  1MUX A;  2K2A A;  1QXP A;  1RTP 1;  1IQ5 A;  1A03 A;  3CS1 A;  1EJ3 A;  2F8P A;  1U5I B;  3O2P A;  3OB2 B;  5AFP A;  3HX4 A;  4P5O E;  1AP4 A;  1J7R A;  1IG5 A;  4PDZ A;  3AKB A;  2CNP A;  2KI4 B;  1PK0 D;  1XFW O;  3DF0 A;  1CDM A;  3SG3 A;  5CSJ A;  1NYA A;  4NDB A;  2JTT A;  2LP3 A;  1CDP A;  4IL1 A;  3PFV A;  3E3R A;  1QVI Y;  1TCF A;  1J1E A;  4I5J A;  3BOW A;  1K9U A;  1EL4 A;  4FQO A;  2PSR A;  2SAS A;  1QTX A;  3KHE A;  1PVA A;  3FIA A;  4ZCV A;  1TIZ A;  4MLW A;  4GGF A;  2JT0 A;  4FTG A;  4QJ5 B;  1RFJ A;  2LAN A;  4U8D A;  1ZMZ A;  4YRU A;  1B4C A;  1GJY A;  1A2X A;  1UHH A;  2PAS A;  3LCP C;  1SCM B;  4QJ3 B;  1NPQ A;  1YUT A;  4A4B A;  2KAV A;  2KFF A;  2KBI A;  1BU3 A;  1OMR A;  4HRH A;  3IF7 A;  1QV0 A;  1CDL A;  2ZND A;  2JT8 A;  2EC6 C;  1SW8 A;  3BUW B;  3SG7 A;  4AQI A;  1S6C A;  2ZNE A;  5ER5 A;  1FPW A;  3IQO A;  2KAY A;  1C7V A;  1BJF A;  4MEW A;  4YGC B;  3VRR A;  1S3P A;  4MBE A;  1ZUZ A;  3TUY B;  3O78 A;  1F54 A;  1FI5 A;  2H2K A;  2JXC A;  1ZAC A;  1WY9 A;  1YUS A;  1FW4 A;  1NX2 A;  2MLF C;  3O4Y A;  4PHM A;  5AAN A;  1L2O B;  1DJW A;  3A4U B;  1SCV A;  3K21 A;  3TS5 C;  2K7O A;  3KO0 A;  3HCM A;  1M46 A;  3I5H C;  1K2H A;  1TCO B;  1XYD A;  3CWG A;  3EVR A;  1L7Z A;  2P6B B;  1SKT A;  1PSR A;  2KNE A;  1B7T Y;  1D1O A;  3BYA A;  1RRO A;  5HKZ A;  2M7L A;  4PE7 A;  1IRJ A;  3CR4 X;  2HPS A;  2TN4 A;  3VRP A;  1CMF A;  2LVJ A;  1BMO A;  3FWB A;  4OVN F;  1OZS A;  1BG1 A;  1L2O C;  3BUX B;  1XK4 C;  3D0Y B;  3FS7 A;  3H4S E;  1WRK A;  1KQM B;  4I5K A;  1LKJ A;  2MAZ A;  3EK4 A;  1SMG A;  1LIN A;  3I5I B;  1SY9 A;  1K96 A;  4E68 A;  2FCE A;  1N2D A;  2KOT A;  3EK8 A;  2JUL A;  1AJ4 A;  3JTD C;  2D8N A;  1QAT A;  1UP5 A;  2F2O A;  2OTG B;  4YGE B;  1UHI A;  1B7T Z;  2VRG A;  4ORC B;  3GK4 X;  1ALW A;  4I5N B;  3ZNI A;  1PVB A;  4NDD A;  1DGU A;  1QLK A;  1UHJ A;  1JF0 A;  1S5G Y;  3BQ3 A;  4CID A;  5ER4 X;  3AAK A;  5KU1 A;  1DJI A;  2FCD A;  2JT3 A;  5HKY A;  2O60 A;  1KK8 C;  2BKH B;  2FJU B;  2KQY A;  5HLV A;  5JJG A;  3CTN A;  5HYD A;  3PM8 A;  2Y5I A;  3PN7 C;  4F0Z B;  4Q04 A;  4TNC A;  2OS8 C;  1N65 A;  1K8U A;  1DJY A;  3DVE A;  3EVV A;  1FBV A;  2JC2 A;  4USL A;  2K0J A;  4DS7 A;  1JFJ A;  1G8I A;  4YBH B;  1GGW A;  1AUI B;  2LVV A;  2MJW B;  2MLE C;  1J1D A;  1CLB A;  1K95 A;  3CR2 A;  4WRI A;  3TDU A;  1G4Y R;  1MWN A;  3BXK A;  2KFG A;  1RJV A;  2M1K B;  3VGO A;  1SR6 B;  5CSN A;  1FI6 A;  2WOS A;  2PRU A;  4P2Y B;  1EH2 A;  4BY4 A;  1S5G Z;  1WRL A;  4GPL B;  1S26 D;  1DVI A;  1WRZ A;  2K7B A;  5BPJ A;  2KDH A;  1Y1X A;  1XK4 A;  1KK7 Y;  3FWC A;  5D7F A;  1SL9 A;  3PLF B;  4GBA A;  3TDI A;  4GAO A;  2MHH A;  3SG4 A;  1OQP A;  2KFH A;  4ICB A;  4XYN A;  2BCX A;  1KFX S;  5AEQ A;  1TNQ A;  2LHL A;  1AHR A;  3DD4 A;  1ZFS A;  4YGB B;  1C07 A;  1SBJ A;  4ORB B;  4I5L B;  1UUS A;  3A8R A;  1KWO B;  1S6I A;  1IJ6 A;  3SJS A;  3WHU B;  1IWQ A;  1YR5 A;  4GNK B;  3DVM A;  1TNP A;  2CCM A;  3RLZ A;  1H8B A;  2KI4 C;  2L4H A;  1K9P A;  1UUR A;  2M29 A;  5KTY A;  2ZN8 A;  1PAL A;  3AAJ A;  2JPT A;  2BE6 A;  1K90 D;  2K61 A;  5GQQ C;  1LXF C;  3WNX B;  1CMG A;  2BCB A;  3BUM B;  2LLT A;  5TNC A;  2LUX A;  4PE1 A;  2LE9 B;  3EKH A;  4HSZ A;  4MZL A;  4DIR A;  4GUK A;  1OZO A;  1KK7 Z;  3LLE A;  2QAC A;  1KSO A;  2EHB A;  2JNF A;  3GK1 A;  4PHN A;  4M2O A;  1V1F A;  2BBM A;  2FOT A;  5K89 A;  2M8U A;  1UHN A;  2LLS A;  2KYF A;  3PSR A;  2RGI A;  1HQV A;  3OX5 A;  2BEC A;  1SCM C;  2L98 A;  3NSL A;  2H61 C;  1A75 A;  2K2F A;  2ZFD A;  1QJT A;  1JFK A;  1AVS A;  1DGV A;  2CT9 A;  4JPZ B;  2HQW A;  1EXR A;  3NXA A;  3GK2 A;  2BCA A;  5I8N A;  2M9G A;  2WC8 A;  2LUC A;  1SL8 A;  2KBM A;  4MZJ A;  3MSE B;  2AAO A;  1J7Q A;  2WCB A;  1JSA A;  2K7D A;  1MXE A;  1XFV O;  1OMV A;  1XFX O;  1M39 A;  1QAS A;  3TUY C;  3OB1 B;  1F70 A;  3TDZ A;  1UWO A;  4MZK A;  2LVK A;  1K94 A;  4JQ0 D;  5DKQ A;  2AMI A;  4WQ3 A;  1CFP A;  1AJ5 A;  1S1E A;  2Y1M A;  3BUN B;  5HLO A;  1CFC A;  1K9K A;  3QRX A;  4AQJ A;  1YRU B;  2L51 A;  1U5I A;  1DJZ A;  1ZOT B;  3EKJ A;  4PCW A;  1B8L A;  1YVH A;  4N1G A;  1RK9 A;  3SIB A;  1OSA A;  4PAL A;  3CR5 X;  3BOW B;  1CFD A;  5AXI A;  1NUB A;  2LMV A;  1NIW A;  1R2U A;  1NP8 A;  3DVJ A;  2Q4U A;  1J7O A;  5I2L A;  1KQM C;  1IH0 A;  1KFX L;  4ZCU A;  3I5G B;  3D10 A;  2QPT A;  2KGB C;  2HQ8 A;  2B1U A;  3JVT B;  2GV5 A;  1F55 A;  2MBX A;  1F71 A;  3BUO B;  3I5I C;  4C0K A;  1MF8 B;  2E6W A;  1TNX A;  1SPY A;  1BLQ A;  1M45 A;  1YUU A;  3SG2 A;  1XFY O;  5FYX A;  1F4O A;  4JWQ A;  2I7A A;  3OP0 A;  1ALV A;  2H61 A;  2ZRS A;  3KEV A;  2G2B A;  2CXJ A;  2OTG C;  1Y1A A;  1QV1 A;  2WCF A;  3I5F B;  2ZKM X;  3M0W A;  4NDC A;  2CTN A;  2LLU A;  1YTZ C;  1A29 A;  5DKR A;  1DJX A;  1Y1U A;  1S36 A;  3OHM B;  1SL7 A;  5JOL A;  4DRW A;  1V1G A;  1TTX A;  2BL0 B;  4PE4 A;  1SYM A;  2JXL A;  1BR1 B;  1WDC B;  2KI6 D;  1IKU A;  1WLZ A;  1IGV A;  1EG4 A;  4CFQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...