1BU3A

Refined crystal structure of calcium-bound silver hake (pi 4.2) parvalbumin at 1.65 a.
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
108
structure length
108
Chain Sequence
AFSGILADADVAAALKACEAADSFNYKAFFAKVGLTAKSADDIKKAFFVIDQDKSGFIEEDELKLFLQVFSAGARALTDAETKAFLKAGDSDGDGAIGVDEWAALVKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray crystal structure and molecular dynamics simulations of silver hake parvalbumin (Isoform B).
pubmed rcsb
molecule tags Calcium binding
molecule keywords CALCIUM-BINDING PROTEIN
total genus 39
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 1998-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1bu3A00
2K7OA 2AAOA 3DVKA 2GV5A 1SYMA 2LV7A 1IGVA 1U5IB 3PLFB 1B8RA 1F55A 2JULA 1CKKA 1WDCC 2LHIA 1QS7A 2EC6B 2LLTA 4N1GA 3DF0B 3WHTB 2COLB 2EC6C 2KI4C 1LINA 1QX2A 3EK8A 4AOMA 4AQJA 1QX5B 1NIWA 2WOSA 1M63B 4MZKA 1AJ4A 3NSKA 1FW4A 1XVJA 3AKBA 4ICBA 1CLBA 1Y1XA 1NCXA 3CR5X 3D0YA 1DVIA 4GAOA 2JPTA 4PE4A 3SJSA 2M9GA 1QXPA 2HQ8A 4QJ3B 1MF8B 3IF7A 2WC8A 2KBMA 5CSIA 1UUSA 2LMUA 1YRUB 3OX6A 1S5GZ 2H61C 4GGFC 1GGWA 1C7WA 4MRYA 1S26D 2CXJA 4M2QA 1WRLA 2K7CA 2MA2A 2ZRTA 1XFZO 3DVJA 4GGFA 1H4BA 1S3PA 1GQMA 2F8PA 3OB1B 3DD4A 3O6BA 2I7AA 5ER4X 1F54A 1KFUL 3H4SE 2MRDA 1NSHA 2ZRSA 3EKJA 4XJKA 2M7LA 1SL9A 1HQVA 1UWOA 1AVSA 1QIWA 2MHHA 5AANA 1OMDA 2LUCA 2JNFA 1YUUA 2L5XB 1V1FA 2D8NA 1G33A 5G08A 2K7BA 1AP4A 1IKUA 4OV2A 5ER5A 1QTXA 1W7IB 3BUNB 5FYXA 2SCPA 5GQQC 2LNKA 4OR9B 3I5HC 1XYDA 2ZN9A 2KAVA 4CFQA 4GGNA 1A2XA 1M46A 1SBJA 3PFVA 4AQIA 1MWNA 3VRPA 1IWQA 2WCBA 1N65A 4CFRA 2H61A 4PE7A 5DKRA 1ZMZA 3OX5A 5AFPA 1PSBA 3AAJA 3GK1A 1B4CA 2JT0A 1J1EA 1TNXA 2M1UA 1C07A 4MN0A 2L98A 1BG1A 1SY9A 1DGUA 2R2IA 1B7TY 1CM1A 5DKNA 5AERA 4N5XA 1PALA 1EL4A 1KSOA 2I94A 2M3WA 3GK2A 3TZ1A 2Y1MA 3HX4A 3NSOA 1OE9B 1S1EA 4YRUA 2P6BB 2BBMA 2V53A 1RTP1 1A29A 3WXAA 2OS8C 1QX7A 3BXKA 1SK6D 2H2KA 4OVNF 4C0LA 5CSNA 4NDBA 1MXEA 1CM4A 4CIDA 1QVIY 1MHOA 2WCEA 4ZCVA 3A4UB 3BUMB 1JSAA 2BBNA 1IG5A 1FI5A 4TNCA 1SCMB 2K8MB 1LA0A 1WRKA 3IQQA 5HKZA 2BE6A 1FPWA 2LM5A 3I5GC 1R2UA 1AJ5A 1TOPA 4IL1A 3AAKA 1YTZC 5K89A 3FWBA 2AUCA 5CSJA 1NX1A 1PK0D 3EVRA 2FJUB 1K93D 1JBAA 1S6IA 3LK0A 1J7OA 2CT9A 3LK1A 3RLZA 2KGRA 1W7JB 4YI8A 4I5NB 1XK4A 2LHLA 5I2LA 4MBEA 4WRIA 2LAPA 5CSFA 1B1GA 2LANA 2KFGA 1CFDA 4YI9A 1QV1A 3NSIA 2WCFA 2EHBA 4M2OA 3I5FB 4DIRA 4WQ3A 2WNDA 1OMVA 2BKIB 2LMVA 4P2YB 1IH0A 1SR6C 4JPZB 1M45A 2BECA 1NPQA 3ZNIA 2M0RA 1YX7A 4C0JA 2GGMA 1V1GA 3E3RA 1OZSA 1CDMA 3I5IC 1DJHA 1B9AA 1CLLA 1TCOB 1QLKA 2JTTA 3CTNA 1BLQA 3BQ3A 4I5KA 1PVBA 3K21A 1YUTA 1JF0A 5AXIA 3OP0A 1AK8A 2LCPA 1OZOA 2KBIA 2L2EA 2JT3A 1IQ3A 1CLMA 4PDZA 1NCYA 1TIZA 2K2FA 4XYNA 2LVKA 1SPYA 4L9MA 2KGBC 1SCVA 1IQ5A 2O60A 4MRXA 1YVHA 3VROA 1A75A 2KFHA 2LUXA 1QVIZ 4YGBB 2G9BA 4NDCA 1DF0A 1SNLA 1EJ3A 1KQVA 3OHMB 4UPGA 1MXLC 2K0JA 1L2OC 2QPTA 1DTLA 3PN7B 4MSPA 2M29A 4PALA 1J7PA 2ZNEA 2KHNA 1B8CA 1KFXS 4MZLA 1RWYA 1SCMC 4PE1A 1ALVA 2PMYA 3KPXA 2LC5A 1B8LA 1F4QA 4PCWA 1BOCA 2Y5IA 1X02A 2TN4A 3BYAA 1CNPA 2PSRA 4I5LB 1KSMA 3VRNA 1HT9A 2JOJA 3TDIA 5I8NA 1KWOC 2JU0A 1EG3A 3FIAA 2K7DA 1G4YR 5HLVA 1ZUZA 3PSRA 2PVBA 5HYDA 1FBVA 5AEQA 3F45A 1Y1UA 3RM1A 4YGDB 3HCMA 1CDPA 1EG4A 2K61A 1DJYA 4Q04A 1KK8B 1RJVA 2JTZA 1BF5A 5D69A 3EVVA 3FWCA 1U5IA 4HSZA 5KSZA 1VRKA 3SIBA 4YBHB 2KQYA 2JNXA 2M8UA 4D1EA 1CDNA 3DF0A 2LVIA 1XA5A 3EKHA 3EK7A 2JZIA 3TUYC 2JXCA 3CLNA 2L0PA 3O2PA 2I18A 1G8IA 2Q91A 1OOJA 4PHNA 3CR2A 3O4YA 1DT7B 4NQGA 1DJZA 2LLSA 2LVVA 2OTGB 2KI6D 5DKQA 2F33A 1CDLA 1SRAA 2ISDA 2QACA 4FTGA 1NYAA 3DVEA 2ZFDA 3DVMA 1YURA 1UHKA 3VRQA 3TS5B 1NUBA 1XFWO 1WRZA 3SG2A 1H8BA 1YUSA 1CFFA 3KEVA 1AUIB 2KOTA 3CS1A 2LE9B 1Y0VH 1C7VA 2G2BA 3KF9A 3TUYB 2I2RE 3KHEA 1K95A 1DF0B 2BL0B 2PASA 1BT6A 2MLEC 3BUOB 1K9PA 1Y6WA 2BL0C 4BY5A 3LCPC 1A4PA 1M39A 3GOFA 4R1EA 1F8HA 4PE0A 4PHKA 5I2OA 1LXFC 4DUQA 1JFKA 1YRTB 2A4JA 2CTNA 2FOTA 2LLUA 1NWDA 1CMFA 1WLMA 3FS7A 1B47A 1K96A 4HRGA 5JJGA 4NDDA 1XFVO 2M49B 4M2PA 2L51A 4U8DA 3CGAA 4OKHA 3TS5C 4HREE 1K2HA 1S36A 1JWDA 5CPVA 4MLWA 4CLNA 3QRXA 1TNWA 1IRJA 2LP2A 1PSRA 2BCAA 2O5GA 3D10A 1YX8A 2PRUA 2EGDA 2K2AA 2L4HA 4MVFA 3PN7C 1UURA 1K94A 1B7TZ 1UHJA 2NLNA 1MUXA 2KI4B 1BU3A 1XFXO 2Q4UA 5BPJA 1FI6A 5HKWA 2JC2A 1OMRA 1SL7A 1KK7Z 3IQOA 3O78A 1WY9A 4FQOA 2KFFA 4GPLB 1D1OA 3KO0A 5TNCA 3I5FC 3JTDC 2ZNDA 3SG5A 2JRFA 3GK4X 4DRWA 1BODA 1LKJA 2OPOA 4USLA 3EK4A 2KSPA 4A4BA 1OSAA 4GBAA 2F3YA 2L4IA 3LL8B 1S6JA 1DJGA 1TCFA 2HETA 2JQ6A 4YGEB 2NXQA 4PHMA 2BCXA 1CMGA 1K8UA 4PHJA 1YVLA 3MSEB 1JFJA 1F4OA 2CNPA 4MZJA 2JWWA 1ODBA 2MLFC 3CZTX 2KDHA 4JQ0D 5HLOA 1RECA 2MJWB 2BE4A 4ORCB 3PATA 1TNPA 1DJIA 1UP5A 4N1FA 2M7NA 1YR5A 2NZ0A 1DGVA 1OQPA 1FF1A 1R6PA 1MR8A 1N2DA 3C1VA 1ZOTB 2HQWA 4ETOA 2HF5A 1J7RA 4QJ5B 1EXRA 2VRGA 3M0WA 5I2QA 2KAXA 5J3XA 2GGZA 1LVCD 1QIVA 2CBLA 2SASA 3ICBA 1XK4C 1GGZA 2M97A 2AMIA 1AHRA 3JVTB 2KAYA 4OCIA 4C0KA 1LA3A 4CPVA 1UHHA 3CR4X 3NXAA 1PULA 1F71A 2PALA 1PRWA 2WORA 1NX2A 1J1DA 2F2PA 1RROA 5D7FA 2KI6C 1IJ6A 1BMOA 3BUWB 1KK8C 2KYCA 2LP3A 1MQ1A 1KCYA 3I5IB 1KQMB 1E8AA 4WQ2A 4BY4A 3OB2B 2RGIA 4GNKB 1KFUS 3WHUB 1NX0A 1TTXA 2DOQA 1ZACA 1F70A 3SG7A 4YGCB 2ZKMX 2CCMA 1KWOB 1SR6B 1KK7Y 1TN4A 1RFJA 1J55A 3NSLA 4XJKB 4ZCUA 1L7ZA 1TNQA 1K9KA 1N0YA 2KNEA 4YGAA 1XFUO 1IJ5A 1K9UA 1QLSA 2OTGC 2Y1NA 4P5OE 3SG4A 2F3ZA 1S5GY 4GFTA 1QV0A 1RK9A 1PVAA 3CWGA 5JOLA 1SMGA 1JUOA 1XO5A 4F0ZB 1UHIA 1ALWA 1BJFA 1SW8A 1CFPA 1TRFA 4MEWA 2NCPA 2Y4QA 2ZN8A 2E6WA 1KQMC 5PALA 2NCOA 1K90D 3VRRA 1DMOA 1XFYO 2M1KB 3D0YB 3PM8A 4DCKA 1BR1B 3WNXB 1Y1AA 2F2OA 1J7QA 3SG6A 4JWQA 2KQ6A 3I5GB 5F6TA 1WLZA 5KU1A 4HRHA 1NP8A 5KTYA 3JVTC 2LVJA 3JTDB 1M31A 1QJTA 1SL8A 4I5JA 3PALA 3I5HB 1S6CA 1DJXA 2FCEA 2IS9A 1A75B 3SG3A 5B8IB 1EH2A 1CTRA 1DJWA 1Q80A 5HKYA 2LMTA 3SIAA 2FCDA 5IBWA 3A8RA 1KFXL 3TDUA 4ORAB 4DS7A 1QASA 2E30A 3BOWB 1BR4B 4ORBB 2BKHB 1JC2A 1L2OB 3LLEA 2MBXA 2JXLA 1SKTA 2BCBA 1NCZA 2JT8A 3VGOA 1ZFSA 4E68A 1WDCB 3AKAA 1QATA 2B1UA 3BUXB 3BOWA 2HPSA 4A4CA 2KYFA 2MAZA 1GJYA 1A03A 1CFCA 1CB1A 1UHNA 4GUKA 1NX3A 2OS8B 3ZWHA 3EVUA 4QJ4B 3TDZA 1JF2A 2L50A
chains in the Genus database with same CATH superfamily
2K7OA 2AAOA 3DVKA 2GV5A 1SYMA 2LV7A 1IGVA 1U5IB 3PLFB 1B8RA 1F55A 2JULA 1CKKA 1WDCC 2LHIA 1QS7A 2EC6B 2LLTA 4N1GA 3DF0B 3WHTB 2COLB 2EC6C 2KI4C 1LINA 1QX2A 3EK8A 4AOMA 4AQJA 1QX5B 1NIWA 2WOSA 1M63B 4MZKA 1AJ4A 3NSKA 3NGVA 1FW4A 1XVJA 3AKBA 4ICBA 1CLBA 1Y1XA 1NCXA 1Z4HA 3CR5X 1DVIA 3D0YA 2JPTA 4GAOA 4PE4A 3SJSA 2M9GA 1IIOA 1QXPA 2HQ8A 4QJ3B 1MF8B 3IF7A 2WC8A 2KBMA 5CSIA 1UUSA 2LMUA 1TUJA 1YRUB 3OX6A 1S5GZ 2H61C 4GGFC 1GGWA 1C7WA 2QEVA 4MRYA 1S26D 2CXJA 4M2QA 1WRLA 2K7CA 2MA2A 2ZRTA 3VB1A 1XFZO 3DVJA 4GGFA 1H4BA 1S3PA 1GQMA 2F8PA 3OB1B 3DD4A 3O6BA 2I7AA 5ER4X 1F54A 1KFUL 3H4SE 2MRDA 1OOIX 1NSHA 2ZRSA 3EKJA 4XJKA 2M7LA 1SL9A 1HQVA 1UWOA 1AVSA 1QIWA 2MHHA 5AANA 1OMDA 2LUCA 2JNFA 1YUUA 2L5XB 1V1FA 2D8NA 1G33A 2WCLA 2K7BA 2WCHA 5G08A 3EG5B 1IKUA 4OV2A 1AP4A 5ER5A 1QTXA 1W7IB 3BUNB 5FYXA 2ERBA 2SCPA 2LNKA 4OR9B 3I5HC 5GQQC 1XYDA 2ZN9A 2KAVA 4CFQA 4GGNA 1A2XA 1M46A 1SBJA 3PFVA 4AQIA 1MWNA 3VRPA 1IWQA 2WCBA 1N65A 4CFRA 2H61A 4PE7A 5DKRA 1ZMZA 2BNXA 3OX5A 3VROA 5AFPA 2WCMA 1PSBA 3AAJA 3GK1A 1B4CA 2JT0A 1J1EA 1TNXA 2M1UA 2KLDA 1C07A 4MN0A 2L98A 1BG1A 1SY9A 1DGUA 2R2IA 1B7TY 3D77A 1CM1A 5DKNA 5AERA 4N5XA 1PALA 1EL4A 1KSOA 2I94A 2M3WA 3GK2A 3TZ1A 2Y1MA 3HX4A 3NSOA 1OE9B 1S1EA 4YRUA 2P6BB 2BBMA 2V53A 1RTP1 3QMEA 1A29A 3WXAA 2OS8C 1QX7A 3BXKA 1SK6D 3DY9A 2H2KA 4OVNF 4C0LA 2QEBA 5CSNA 4NDBA 1C3ZA 1MXEA 1CM4A 4CIDA 1QVIY 1MHOA 2WCEA 3D76A 4ZCVA 2JPOA 3A4UB 3BUMB 1JSAA 2BBNA 1IG5A 1FI5A 4TNCA 1SCMB 2K8MB 2WC6A 1LA0A 1WRKA 3IQQA 5HKZA 2BE6A 3D73A 1FPWA 2LM5A 3I5GC 1R2UA 1AJ5A 1TOPA 3SS5A 4IL1A 3AAKA 1YTZC 5K89A 3FWBA 2AUCA 5CSJA 1NX1A 1PK0D 3EVRA 2FJUB 1K93D 1JBAA 1S6IA 3LK0A 1J7OA 2CT9A 3LK1A 3RLZA 2KGRA 1DEKA 1W7JB 4YI8A 4I5NB 1XK4A 2LHLA 5I2LA 4MBEA 4WRIA 2LAPA 5CSFA 1B1GA 2LANA 2KFGA 1CFDA 1TWOA 1QV1A 4YI9A 3DYEA 3NSIA 2WCFA 2EHBA 4M2OA 2L2CA 3CDNA 2QDIA 3I5FB 4DIRA 4WQ3A 2WNDA 1OMVA 2BKIB 2LMVA 4P2YB 5D3OA 1IH0A 1SR6C 4JPZB 3OGNA 1M45A 3R1VA 2BECA 1NPQA 2K60A 3ZNIA 2M0RA 1YX7A 4C0JA 2GGMA 1V1GA 3E3RA 1OZSA 2PYQA 1CDMA 3I5IC 1DJHA 1B9AA 1CLLA 1TCOB 3B7AA 1QLKA 2JTTA 3CTNA 1BLQA 3BQ3A 4I5KA 1PVBA 3K21A 1YUTA 1JF0A 5AXIA 3B86A 3OP0A 1AK8A 2LCPA 1OZOA 2KBIA 3BFBA 3DXLA 2L2EA 2JT3A 4F7FA 1IQ3A 1CLMA 4PDZA 3D74A 3BFHA 1NCYA 4IJ7A 1TIZA 2K2FA 4XYNA 3NHIA 2LVKA 1SPYA 4L9MA 2KGBC 2WCKA 1SCVA 1IQ5A 2O60A 4MRXA 4PT1A 1YVHA 1OW4A 1P28A 1A75A 2BAPA 2KFHA 2LUXA 1QVIZ 2PQLA 4JD9A 3DZTA 4YGBB 2G9BA 3S0EA 4NDCA 1DF0A 1SNLA 1EJ3A 1KQVA 1ORGA 3OHMB 4UPGA 2P71A 1MXLC 2K0JA 1L2OC 2QPTA 1DTLA 3PN7B 4MSPA 2M29A 4PALA 1J7PA 2ZNEA 2KHNA 1B8CA 1KFXS 4MZLA 3S0FA 1RWYA 1SCMC 4PE1A 1ALVA 2PMYA 3KPXA 3S0GA 2LC5A 1B8LA 1F4QA 4PCWA 1BOCA 2Y5IA 1X02A 2TN4A 3BYAA 1CNPA 2PSRA 4I5LB 1KSMA 3VRNA 1HT9A 2JOJA 3TDIA 5I8NA 1KWOC 3FE8A 3B6XA 2JU0A 2P70A 1EG3A 3FIAA 2K7DA 1G4YR 5HLVA 1ZUZA 3PSRA 2PVBA 5HYDA 1FBVA 5AEQA 3F45A 1Y1UA 3RM1A 3R1OA 4YGDB 2WCJA 3HCMA 1CDPA 1EG4A 2K61A 1DJYA 4Q04A 1KK8B 1RJVA 2JTZA 1BF5A 5D69A 3EVVA 3FWCA 5EL2A 1U5IA 4HSZA 5KSZA 1VRKA 3SIBA 4YBHB 2KQYA 3O4XA 2JNXA 2M8UA 4D1EA 1CDNA 2YGUA 3DF0A 2LVIA 1XA5A 3EKHA 3B87A 2JZIA 3EK7A 2JXCA 3CLNA 2L0PA 4JKTA 3O2PA 2I18A 5I94A 3TUYC 1G8IA 2Q91A 1OOJA 4PHNA 3CR2A 3O4YA 1DT7B 4NQGA 1DJZA 2LLSA 2LVVA 2OTGB 2KI6D 5DKQA 2F33A 1CDLA 1C3YA 2QEOA 1LS8A 1SRAA 2ISDA 2QACA 4FTGA 1NYAA 3DVEA 2ZFDA 3DVMA 1YURA 3SS4A 1UHKA 3VRQA 3TS5B 1NUBA 1XFWO 1WRZA 3SG2A 1H8BA 1YUSA 1CFFA 3KEVA 3L47A 3CYZA 1AUIB 2KOTA 3CS1A 2LE9B 1Y0VH 1C7VA 2G2BA 3KF9A 5FI7A 3TUYB 2I2RE 3RZSA 3KHEA 1K95A 1DF0B 2BL0B 2PASA 1T14A 1BT6A 2MLEC 3BUOB 1K9PA 3CZ1A 1Y6WA 2BL0C 3OBVA 4BY5A 3LCPC 1A4PA 1M39A 3GOFA 4R1EA 1F8HA 4PE0A 4FQTA 4PHKA 5I2OA 1LXFC 4DUQA 1JFKA 1YRTB 2A4JA 2CTNA 2FOTA 2LLUA 1NWDA 3S0DA 1WLMA 1CMFA 3FS7A 1B47A 1K96A 4HRGA 5JJGA 4NDDA 1XFRA 1XFVO 2M49B 4M2PA 2L51A 4U8DA 3CGAA 3CZ0A 4OKHA 3B88A 3BFAA 4HREE 3TS5C 1K2HA 4OZDA 1S36A 1JWDA 5CPVA 4MLWA 3UNWA 4CLNA 3QRXA 1TNWA 1IRJA 2LP2A 1PSRA 2BCAA 2O5GA 3D10A 1YX8A 2PRUA 2EGDA 2K2AA 2L4HA 2L50A 4MVFA 3PN7C 1UURA 1K94A 1B7TZ 1UHJA 2NLNA 1MUXA 3PJIA 2KI4B 1BU3A 1XFXO 2Q4UA 5BPJA 3S0AA 5HKWA 2JC2A 1FI6A 5FI6A 1OMRA 1SL7A 1KK7Z 3IQOA 3V2LA 3O78A 1WY9A 2WC5A 3D75A 4FQOA 2KFFA 4GPLB 1D1OA 3SS3A 3KO0A 2L5YA 5TNCA 3I5FC 3JTDC 2ZNDA 3SG5A 2JRFA 3GK4X 4DRWA 2KLEA 1LKJA 2OPOA 4USLA 1TUZA 3EK4A 1BODA 2KSPA 4A4BA 3R72A 1OSAA 4GBAA 2F3YA 2L4IA 3LL8B 1S6JA 1DJGA 1TCFA 2HETA 2JQ6A 4YGEB 2NXQA 4PHMA 2BCXA 1CMGA 1K8UA 4PHJA 1YVLA 3MSEB 1JFJA 1F4OA 2CNPA 4MZJA 2JWWA 1ODBA 2MLFC 3CZTX 1SSEB 2KDHA 4JQ0D 3UO9A 5HLOA 1RECA 2MJWB 2BE4A 4ORCB 3PATA 1TNPA 5DICA 1DJIA 1UP5A 1QWVA 4N1FA 2M7NA 1YR5A 2NZ0A 1DGVA 1OQPA 1FF1A 1R6PA 1MR8A 1N2DA 3BJHA 3C1VA 1ZOTB 1OOFA 2HQWA 4ETOA 2HF5A 1J7RA 4QJ5B 1EXRA 2VRGA 3M0WA 5I2QA 2KAXA 5J3XA 2GGZA 1LVCD 1QIVA 2CBLA 2SASA 3ICBA 2GTEA 1XK4C 1DQEA 1GGZA 2M97A 2AMIA 3N7HA 1AHRA 3JVTB 2KAYA 4OCIA 4C0KA 1LA3A 2H8VA 4CPVA 4KYNA 1UHHA 3CR4X 3L4LA 1PULA 3NXAA 2PALA 3R1PA 1PRWA 2WORA 1F71A 1NX2A 1J1DA 2F2PA 1RROA 5D7FA 2KI6C 1IJ6A 1BMOA 1W9ZA 3BUWB 1KK8C 1Z2CB 2KYCA 2LP3A 1MQ1A 3NHTA 1KCYA 3I5IB 1KQMB 1E8AA 4WQ2A 4BY4A 3OB2B 2RGIA 4GNKB 1KFUS 3WHUB 1NX0A 1TTXA 2DOQA 1ZACA 1F70A 3SG7A 4YGCB 2ZKMX 2CCMA 1KWOB 1SR6B 1KK7Y 1TN4A 1RFJA 1J55A 3NSLA 4XJKB 4ZCUA 1L7ZA 1TNQA 1K9KA 1N0YA 2KNEA 4YGAA 1XFUO 1IJ5A 1K9UA 1QLSA 2OTGC 2Y1NA 4INXA 4P5OE 3SG4A 2F3ZA 1S5GY 4GFTA 1QV0A 1RK9A 2FJYA 1PVAA 3Q8IA 3CWGA 5JOLA 1SMGA 1JUOA 1XO5A 4F0ZB 1UHIA 1ALWA 1BJFA 1SW8A 1CFPA 1TRFA 4MEWA 2NCPA 4INWA 2Y4QA 2ZN8A 2E6WA 1KQMC 3IVTA 5PALA 2NCOA 1K90D 3PM2A 3VRRA 3CABA 1DMOA 1XFYO 2M1KB 3D0YB 3PM8A 4DCKA 1BR1B 3WNXB 1Y1AA 2F2OA 3CZ2A 1J7QA 3SG6A 4JWQA 2KQ6A 3I5GB 5F6TA 1WLZA 5KU1A 4HRHA 1NP8A 5KTYA 3S0BA 3JVTC 2LVJA 3JTDB 1M31A 1QJTA 1SL8A 4I5JA 3PALA 3I5HB 1S6CA 1DJXA 2FCEA 2IS9A 3L4AA 1A75B 5HL1A 2QEHA 3SG3A 5B8IB 1EH2A 1CTRA 1DJWA 1Q80A 5HKYA 2LMTA 3FE6A 2FCDA 3SIAA 5IBWA 3A8RA 5FI2A 1KFXL 3TDUA 4ORAB 4DS7A 1DC1A 1QASA 2E30A 3BOWB 1BR4B 4ORBB 2BKHB 1JC2A 1L2OB 3LLEA 2MBXA 2JXLA 1DELA 1SKTA 2BCBA 1NCZA 2JT8A 1OOGA 3VGOA 1ZFSA 4E68A 1GM0A 1WDCB 3AKAA 1QATA 2B1UA 3BUXB 3BOWA 3FE9A 2HPSA 4A4CA 2KYFA 2MAZA 1GJYA 2KPHA 1A03A 1CFCA 1CB1A 1UHNA 4GUKA 3K1EA 1NX3A 2OS8B 3ZWHA 3EVUA 4QJ4B 3D78A 3TDZA 1JF2A 1OOHA
chains in the Genus database with same CATH topology
2K7OA 2AAOA 3DVKA 2GV5A 1SYMA 2LV7A 1IGVA 1U5IB 3PLFB 1B8RA 1F55A 2JULA 1CKKA 1WDCC 2LHIA 1QS7A 2EC6B 2LLTA 4N1GA 3DF0B 3WHTB 2COLB 2EC6C 2KI4C 1LINA 1QX2A 3EK8A 4AOMA 4AQJA 1QX5B 1NIWA 2WOSA 1M63B 4MZKA 1AJ4A 3NSKA 1FW4A 1XVJA 3AKBA 4ICBA 1CLBA 1Y1XA 1NCXA 3CR5X 3D0YA 1DVIA 4GAOA 2JPTA 4PE4A 3SJSA 2M9GA 1QXPA 2HQ8A 4QJ3B 1MF8B 3IF7A 2WC8A 2KBMA 5CSIA 1UUSA 2LMUA 1YRUB 3OX6A 1S5GZ 2H61C 4GGFC 1GGWA 1C7WA 4MRYA 1S26D 2CXJA 4M2QA 1WRLA 2K7CA 2MA2A 2ZRTA 1XFZO 3DVJA 4GGFA 1H4BA 1S3PA 1GQMA 2F8PA 3OB1B 3DD4A 3O6BA 2I7AA 5ER4X 1F54A 1KFUL 3H4SE 2MRDA 1NSHA 2ZRSA 3EKJA 4XJKA 2M7LA 1SL9A 1HQVA 1UWOA 1AVSA 1QIWA 2MHHA 5AANA 1OMDA 2LUCA 2JNFA 1YUUA 2L5XB 1V1FA 2D8NA 1G33A 5G08A 2K7BA 1AP4A 1IKUA 4OV2A 5ER5A 1QTXA 1W7IB 3BUNB 5FYXA 2SCPA 5GQQC 2LNKA 4OR9B 3I5HC 1XYDA 2ZN9A 2KAVA 4CFQA 4GGNA 1A2XA 1M46A 1SBJA 3PFVA 4AQIA 1MWNA 3VRPA 1IWQA 2WCBA 1N65A 4CFRA 2H61A 4PE7A 5DKRA 1ZMZA 3OX5A 5AFPA 1PSBA 3AAJA 3GK1A 1B4CA 2JT0A 1J1EA 1TNXA 2M1UA 1C07A 4MN0A 2L98A 1BG1A 1SY9A 1DGUA 2R2IA 1B7TY 1CM1A 5DKNA 5AERA 4N5XA 1PALA 1EL4A 1KSOA 2I94A 2M3WA 3GK2A 3TZ1A 2Y1MA 3HX4A 3NSOA 1OE9B 1S1EA 4YRUA 2P6BB 2BBMA 2V53A 1RTP1 1A29A 3WXAA 2OS8C 1QX7A 3BXKA 1SK6D 2H2KA 4OVNF 4C0LA 5CSNA 4NDBA 1MXEA 1CM4A 4CIDA 1QVIY 1MHOA 2WCEA 4ZCVA 3A4UB 3BUMB 1JSAA 2BBNA 1IG5A 1FI5A 4TNCA 1SCMB 2K8MB 1LA0A 1WRKA 3IQQA 5HKZA 2BE6A 1FPWA 2LM5A 3I5GC 1R2UA 1AJ5A 1TOPA 4IL1A 3AAKA 1YTZC 5K89A 3FWBA 2AUCA 5CSJA 1NX1A 1PK0D 3EVRA 2FJUB 1K93D 1JBAA 1S6IA 3LK0A 1J7OA 2CT9A 3LK1A 3RLZA 2KGRA 1W7JB 4YI8A 4I5NB 1XK4A 2LHLA 5I2LA 4MBEA 4WRIA 2LAPA 5CSFA 1B1GA 2LANA 2KFGA 1CFDA 4YI9A 1QV1A 3NSIA 2WCFA 2EHBA 4M2OA 3I5FB 4DIRA 4WQ3A 2WNDA 1OMVA 2BKIB 2LMVA 4P2YB 1IH0A 1SR6C 4JPZB 1M45A 2BECA 1NPQA 3ZNIA 2M0RA 1YX7A 4C0JA 2GGMA 1V1GA 3E3RA 1OZSA 1CDMA 3I5IC 1DJHA 1B9AA 1CLLA 1TCOB 1QLKA 2JTTA 3CTNA 1BLQA 3BQ3A 4I5KA 1PVBA 3K21A 1YUTA 1JF0A 5AXIA 3OP0A 1AK8A 2LCPA 1OZOA 2KBIA 2L2EA 2JT3A 1IQ3A 1CLMA 4PDZA 1NCYA 1TIZA 2K2FA 4XYNA 2LVKA 1SPYA 4L9MA 2KGBC 1SCVA 1IQ5A 2O60A 4MRXA 1YVHA 3VROA 1A75A 2KFHA 2LUXA 1QVIZ 4YGBB 2G9BA 4NDCA 1DF0A 1SNLA 1EJ3A 1KQVA 3OHMB 4UPGA 1MXLC 2K0JA 1L2OC 2QPTA 1DTLA 3PN7B 4MSPA 2M29A 4PALA 1J7PA 2ZNEA 2KHNA 1B8CA 1KFXS 4MZLA 1RWYA 1SCMC 4PE1A 1ALVA 2PMYA 3KPXA 2LC5A 1B8LA 1F4QA 4PCWA 1BOCA 2Y5IA 1X02A 2TN4A 3BYAA 1CNPA 2PSRA 4I5LB 1KSMA 3VRNA 1HT9A 2JOJA 3TDIA 5I8NA 1KWOC 2JU0A 1EG3A 3FIAA 2K7DA 1G4YR 5HLVA 1ZUZA 3PSRA 2PVBA 5HYDA 1FBVA 5AEQA 3F45A 1Y1UA 3RM1A 4YGDB 3HCMA 1CDPA 1EG4A 2K61A 1DJYA 4Q04A 1KK8B 1RJVA 2JTZA 1BF5A 5D69A 3EVVA 3FWCA 1U5IA 4HSZA 5KSZA 1VRKA 3SIBA 4YBHB 2KQYA 2JNXA 2M8UA 4D1EA 1CDNA 3DF0A 2LVIA 1XA5A 3EKHA 3EK7A 2JZIA 3TUYC 2JXCA 3CLNA 2L0PA 3O2PA 2I18A 1G8IA 2Q91A 1OOJA 4PHNA 3CR2A 3O4YA 1DT7B 4NQGA 1DJZA 2LLSA 2LVVA 2OTGB 2KI6D 5DKQA 2F33A 1CDLA 1SRAA 2ISDA 2QACA 4FTGA 1NYAA 3DVEA 2ZFDA 3DVMA 1YURA 1UHKA 3VRQA 3TS5B 1NUBA 1XFWO 1WRZA 3SG2A 1H8BA 1YUSA 1CFFA 3KEVA 1AUIB 2KOTA 3CS1A 2LE9B 1Y0VH 1C7VA 2G2BA 3KF9A 3TUYB 2I2RE 3KHEA 1K95A 1DF0B 2BL0B 2PASA 1BT6A 2MLEC 3BUOB 1K9PA 1Y6WA 2BL0C 4BY5A 3LCPC 1A4PA 1M39A 3GOFA 4R1EA 1F8HA 4PE0A 4PHKA 5I2OA 1LXFC 4DUQA 1JFKA 1YRTB 2A4JA 2CTNA 2FOTA 2LLUA 1NWDA 1CMFA 1WLMA 3FS7A 1B47A 1K96A 4HRGA 5JJGA 4NDDA 1XFVO 2M49B 4M2PA 2L51A 4U8DA 3CGAA 4OKHA 3TS5C 4HREE 1K2HA 1S36A 1JWDA 5CPVA 4MLWA 4CLNA 3QRXA 1TNWA 1IRJA 2LP2A 1PSRA 2BCAA 2O5GA 3D10A 1YX8A 2PRUA 2EGDA 2K2AA 2L4HA 4MVFA 3PN7C 1UURA 1K94A 1B7TZ 1UHJA 2NLNA 1MUXA 2KI4B 1BU3A 1XFXO 2Q4UA 5BPJA 1FI6A 5HKWA 2JC2A 1OMRA 1SL7A 1KK7Z 3IQOA 3O78A 1WY9A 4FQOA 2KFFA 4GPLB 1D1OA 3KO0A 5TNCA 3I5FC 3JTDC 2ZNDA 3SG5A 2JRFA 3GK4X 4DRWA 1BODA 1LKJA 2OPOA 4USLA 3EK4A 2KSPA 4A4BA 1OSAA 4GBAA 2F3YA 2L4IA 3LL8B 1S6JA 1DJGA 1TCFA 2HETA 2JQ6A 4YGEB 2NXQA 4PHMA 2BCXA 1CMGA 1K8UA 4PHJA 1YVLA 3MSEB 1JFJA 1F4OA 2CNPA 4MZJA 2JWWA 1ODBA 2MLFC 3CZTX 2KDHA 4JQ0D 5HLOA 1RECA 2MJWB 2BE4A 4ORCB 3PATA 1TNPA 1DJIA 1UP5A 4N1FA 2M7NA 1YR5A 2NZ0A 1DGVA 1OQPA 1FF1A 1R6PA 1MR8A 1N2DA 3C1VA 1ZOTB 2HQWA 4ETOA 2HF5A 1J7RA 4QJ5B 1EXRA 2VRGA 3M0WA 5I2QA 2KAXA 5J3XA 2GGZA 1LVCD 1QIVA 2CBLA 2SASA 3ICBA 1XK4C 1GGZA 2M97A 2AMIA 1AHRA 3JVTB 2KAYA 4OCIA 4C0KA 1LA3A 4CPVA 1UHHA 3CR4X 3NXAA 1PULA 1F71A 2PALA 1PRWA 2WORA 1NX2A 1J1DA 2F2PA 1RROA 5D7FA 2KI6C 1IJ6A 1BMOA 3BUWB 1KK8C 2KYCA 2LP3A 1MQ1A 1KCYA 3I5IB 1KQMB 1E8AA 4WQ2A 4BY4A 3OB2B 2RGIA 4GNKB 1KFUS 3WHUB 1NX0A 1TTXA 2DOQA 1ZACA 1F70A 3SG7A 4YGCB 2ZKMX 2CCMA 1KWOB 1SR6B 1KK7Y 1TN4A 1RFJA 1J55A 3NSLA 4XJKB 4ZCUA 1L7ZA 1TNQA 1K9KA 1N0YA 2KNEA 4YGAA 1XFUO 1IJ5A 1K9UA 1QLSA 2OTGC 2Y1NA 4P5OE 3SG4A 2F3ZA 1S5GY 4GFTA 1QV0A 1RK9A 1PVAA 3CWGA 5JOLA 1SMGA 1JUOA 1XO5A 4F0ZB 1UHIA 1ALWA 1BJFA 1SW8A 1CFPA 1TRFA 4MEWA 2NCPA 2Y4QA 2ZN8A 2E6WA 1KQMC 5PALA 2NCOA 1K90D 3VRRA 1DMOA 1XFYO 2M1KB 3D0YB 3PM8A 4DCKA 1BR1B 3WNXB 1Y1AA 2F2OA 1J7QA 3SG6A 4JWQA 2KQ6A 3I5GB 5F6TA 1WLZA 5KU1A 4HRHA 1NP8A 5KTYA 3JVTC 2LVJA 3JTDB 1M31A 1QJTA 1SL8A 4I5JA 3PALA 3I5HB 1S6CA 1DJXA 2FCEA 2IS9A 1A75B 3SG3A 5B8IB 1EH2A 1CTRA 1DJWA 1Q80A 5HKYA 2LMTA 3SIAA 2FCDA 5IBWA 3A8RA 1KFXL 3TDUA 4ORAB 4DS7A 1QASA 2E30A 3BOWB 1BR4B 4ORBB 2BKHB 1JC2A 1L2OB 3LLEA 2MBXA 2JXLA 1SKTA 2BCBA 1NCZA 2JT8A 3VGOA 1ZFSA 4E68A 1WDCB 3AKAA 1QATA 2B1UA 3BUXB 3BOWA 2HPSA 4A4CA 2KYFA 2MAZA 1GJYA 1A03A 1CFCA 1CB1A 1UHNA 4GUKA 1NX3A 2OS8B 3ZWHA 3EVUA 4QJ4B 3TDZA 1JF2A 2L50A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K7O A;  2AAO A;  3DVK A;  2GV5 A;  1SYM A;  2LV7 A;  1IGV A;  1U5I B;  3PLF B;  1B8R A;  1F55 A;  2JUL A;  1CKK A;  1WDC C;  2LHI A;  1QS7 A;  2EC6 B;  2LLT A;  4N1G A;  3DF0 B;  3WHT B;  2COL B;  2EC6 C;  2KI4 C;  1LIN A;  1QX2 A;  3EK8 A;  4AOM A;  4AQJ A;  1QX5 B;  1NIW A;  2WOS A;  1M63 B;  4MZK A;  1AJ4 A;  3NSK A;  1FW4 A;  1XVJ A;  3AKB A;  4ICB A;  1CLB A;  1Y1X A;  1NCX A;  3CR5 X;  3D0Y A;  1DVI A;  4GAO A;  2JPT A;  4PE4 A;  3SJS A;  2M9G A;  1QXP A;  2HQ8 A;  4QJ3 B;  1MF8 B;  3IF7 A;  2WC8 A;  2KBM A;  5CSI A;  1UUS A;  2LMU A;  1YRU B;  3OX6 A;  1S5G Z;  2H61 C;  4GGF C;  1GGW A;  1C7W A;  4MRY A;  1S26 D;  2CXJ A;  4M2Q A;  1WRL A;  2K7C A;  2MA2 A;  2ZRT A;  1XFZ O;  3DVJ A;  4GGF A;  1H4B A;  1S3P A;  1GQM A;  2F8P A;  3OB1 B;  3DD4 A;  3O6B A;  2I7A A;  5ER4 X;  1F54 A;  1KFU L;  3H4S E;  2MRD A;  1NSH A;  2ZRS A;  3EKJ A;  4XJK A;  2M7L A;  1SL9 A;  1HQV A;  1UWO A;  1AVS A;  1QIW A;  2MHH A;  5AAN A;  1OMD A;  2LUC A;  2JNF A;  1YUU A;  2L5X B;  1V1F A;  2D8N A;  1G33 A;  5G08 A;  2K7B A;  1AP4 A;  1IKU A;  4OV2 A;  5ER5 A;  1QTX A;  1W7I B;  3BUN B;  5FYX A;  2SCP A;  5GQQ C;  2LNK A;  4OR9 B;  3I5H C;  1XYD A;  2ZN9 A;  2KAV A;  4CFQ A;  4GGN A;  1A2X A;  1M46 A;  1SBJ A;  3PFV A;  4AQI A;  1MWN A;  3VRP A;  1IWQ A;  2WCB A;  1N65 A;  4CFR A;  2H61 A;  4PE7 A;  5DKR A;  1ZMZ A;  3OX5 A;  5AFP A;  1PSB A;  3AAJ A;  3GK1 A;  1B4C A;  2JT0 A;  1J1E A;  1TNX A;  2M1U A;  1C07 A;  4MN0 A;  2L98 A;  1BG1 A;  1SY9 A;  1DGU A;  2R2I A;  1B7T Y;  1CM1 A;  5DKN A;  5AER A;  4N5X A;  1PAL A;  1EL4 A;  1KSO A;  2I94 A;  2M3W A;  3GK2 A;  3TZ1 A;  2Y1M A;  3HX4 A;  3NSO A;  1OE9 B;  1S1E A;  4YRU A;  2P6B B;  2BBM A;  2V53 A;  1RTP 1;  1A29 A;  3WXA A;  2OS8 C;  1QX7 A;  3BXK A;  1SK6 D;  2H2K A;  4OVN F;  4C0L A;  5CSN A;  4NDB A;  1MXE A;  1CM4 A;  4CID A;  1QVI Y;  1MHO A;  2WCE A;  4ZCV A;  3A4U B;  3BUM B;  1JSA A;  2BBN A;  1IG5 A;  1FI5 A;  4TNC A;  1SCM B;  2K8M B;  1LA0 A;  1WRK A;  3IQQ A;  5HKZ A;  2BE6 A;  1FPW A;  2LM5 A;  3I5G C;  1R2U A;  1AJ5 A;  1TOP A;  4IL1 A;  3AAK A;  1YTZ C;  5K89 A;  3FWB A;  2AUC A;  5CSJ A;  1NX1 A;  1PK0 D;  3EVR A;  2FJU B;  1K93 D;  1JBA A;  1S6I A;  3LK0 A;  1J7O A;  2CT9 A;  3LK1 A;  3RLZ A;  2KGR A;  1W7J B;  4YI8 A;  4I5N B;  1XK4 A;  2LHL A;  5I2L A;  4MBE A;  4WRI A;  2LAP A;  5CSF A;  1B1G A;  2LAN A;  2KFG A;  1CFD A;  4YI9 A;  1QV1 A;  3NSI A;  2WCF A;  2EHB A;  4M2O A;  3I5F B;  4DIR A;  4WQ3 A;  2WND A;  1OMV A;  2BKI B;  2LMV A;  4P2Y B;  1IH0 A;  1SR6 C;  4JPZ B;  1M45 A;  2BEC A;  1NPQ A;  3ZNI A;  2M0R A;  1YX7 A;  4C0J A;  2GGM A;  1V1G A;  3E3R A;  1OZS A;  1CDM A;  3I5I C;  1DJH A;  1B9A A;  1CLL A;  1TCO B;  1QLK A;  2JTT A;  3CTN A;  1BLQ A;  3BQ3 A;  4I5K A;  1PVB A;  3K21 A;  1YUT A;  1JF0 A;  5AXI A;  3OP0 A;  1AK8 A;  2LCP A;  1OZO A;  2KBI A;  2L2E A;  2JT3 A;  1IQ3 A;  1CLM A;  4PDZ A;  1NCY A;  1TIZ A;  2K2F A;  4XYN A;  2LVK A;  1SPY A;  4L9M A;  2KGB C;  1SCV A;  1IQ5 A;  2O60 A;  4MRX A;  1YVH A;  3VRO A;  1A75 A;  2KFH A;  2LUX A;  1QVI Z;  4YGB B;  2G9B A;  4NDC A;  1DF0 A;  1SNL A;  1EJ3 A;  1KQV A;  3OHM B;  4UPG A;  1MXL C;  2K0J A;  1L2O C;  2QPT A;  1DTL A;  3PN7 B;  4MSP A;  2M29 A;  4PAL A;  1J7P A;  2ZNE A;  2KHN A;  1B8C A;  1KFX S;  4MZL A;  1RWY A;  1SCM C;  4PE1 A;  1ALV A;  2PMY A;  3KPX A;  2LC5 A;  1B8L A;  1F4Q A;  4PCW A;  1BOC A;  2Y5I A;  1X02 A;  2TN4 A;  3BYA A;  1CNP A;  2PSR A;  4I5L B;  1KSM A;  3VRN A;  1HT9 A;  2JOJ A;  3TDI A;  5I8N A;  1KWO C;  2JU0 A;  1EG3 A;  3FIA A;  2K7D A;  1G4Y R;  5HLV A;  1ZUZ A;  3PSR A;  2PVB A;  5HYD A;  1FBV A;  5AEQ A;  3F45 A;  1Y1U A;  3RM1 A;  4YGD B;  3HCM A;  1CDP A;  1EG4 A;  2K61 A;  1DJY A;  4Q04 A;  1KK8 B;  1RJV A;  2JTZ A;  1BF5 A;  5D69 A;  3EVV A;  3FWC A;  1U5I A;  4HSZ A;  5KSZ A;  1VRK A;  3SIB A;  4YBH B;  2KQY A;  2JNX A;  2M8U A;  4D1E A;  1CDN A;  3DF0 A;  2LVI A;  1XA5 A;  3EKH A;  3EK7 A;  2JZI A;  3TUY C;  2JXC A;  3CLN A;  2L0P A;  3O2P A;  2I18 A;  1G8I A;  2Q91 A;  1OOJ A;  4PHN A;  3CR2 A;  3O4Y A;  1DT7 B;  4NQG A;  1DJZ A;  2LLS A;  2LVV A;  2OTG B;  2KI6 D;  5DKQ A;  2F33 A;  1CDL A;  1SRA A;  2ISD A;  2QAC A;  4FTG A;  1NYA A;  3DVE A;  2ZFD A;  3DVM A;  1YUR A;  1UHK A;  3VRQ A;  3TS5 B;  1NUB A;  1XFW O;  1WRZ A;  3SG2 A;  1H8B A;  1YUS A;  1CFF A;  3KEV A;  1AUI B;  2KOT A;  3CS1 A;  2LE9 B;  1Y0V H;  1C7V A;  2G2B A;  3KF9 A;  3TUY B;  2I2R E;  3KHE A;  1K95 A;  1DF0 B;  2BL0 B;  2PAS A;  1BT6 A;  2MLE C;  3BUO B;  1K9P A;  1Y6W A;  2BL0 C;  4BY5 A;  3LCP C;  1A4P A;  1M39 A;  3GOF A;  4R1E A;  1F8H A;  4PE0 A;  4PHK A;  5I2O A;  1LXF C;  4DUQ A;  1JFK A;  1YRT B;  2A4J A;  2CTN A;  2FOT A;  2LLU A;  1NWD A;  1CMF A;  1WLM A;  3FS7 A;  1B47 A;  1K96 A;  4HRG A;  5JJG A;  4NDD A;  1XFV O;  2M49 B;  4M2P A;  2L51 A;  4U8D A;  3CGA A;  4OKH A;  3TS5 C;  4HRE E;  1K2H A;  1S36 A;  1JWD A;  5CPV A;  4MLW A;  4CLN A;  3QRX A;  1TNW A;  1IRJ A;  2LP2 A;  1PSR A;  2BCA A;  2O5G A;  3D10 A;  1YX8 A;  2PRU A;  2EGD A;  2K2A A;  2L4H A;  4MVF A;  3PN7 C;  1UUR A;  1K94 A;  1B7T Z;  1UHJ A;  2NLN A;  1MUX A;  2KI4 B;  1BU3 A;  1XFX O;  2Q4U A;  5BPJ A;  1FI6 A;  5HKW A;  2JC2 A;  1OMR A;  1SL7 A;  1KK7 Z;  3IQO A;  3O78 A;  1WY9 A;  4FQO A;  2KFF A;  4GPL B;  1D1O A;  3KO0 A;  5TNC A;  3I5F C;  3JTD C;  2ZND A;  3SG5 A;  2JRF A;  3GK4 X;  4DRW A;  1BOD A;  1LKJ A;  2OPO A;  4USL A;  3EK4 A;  2KSP A;  4A4B A;  1OSA A;  4GBA A;  2F3Y A;  2L4I A;  3LL8 B;  1S6J A;  1DJG A;  1TCF A;  2HET A;  2JQ6 A;  4YGE B;  2NXQ A;  4PHM A;  2BCX A;  1CMG A;  1K8U A;  4PHJ A;  1YVL A;  3MSE B;  1JFJ A;  1F4O A;  2CNP A;  4MZJ A;  2JWW A;  1ODB A;  2MLF C;  3CZT X;  2KDH A;  4JQ0 D;  5HLO A;  1REC A;  2MJW B;  2BE4 A;  4ORC B;  3PAT A;  1TNP A;  1DJI A;  1UP5 A;  4N1F A;  2M7N A;  1YR5 A;  2NZ0 A;  1DGV A;  1OQP A;  1FF1 A;  1R6P A;  1MR8 A;  1N2D A;  3C1V A;  1ZOT B;  2HQW A;  4ETO A;  2HF5 A;  1J7R A;  4QJ5 B;  1EXR A;  2VRG A;  3M0W A;  5I2Q A;  2KAX A;  5J3X A;  2GGZ A;  1LVC D;  1QIV A;  2CBL A;  2SAS A;  3ICB A;  1XK4 C;  1GGZ A;  2M97 A;  2AMI A;  1AHR A;  3JVT B;  2KAY A;  4OCI A;  4C0K A;  1LA3 A;  4CPV A;  1UHH A;  3CR4 X;  3NXA A;  1PUL A;  1F71 A;  2PAL A;  1PRW A;  2WOR A;  1NX2 A;  1J1D A;  2F2P A;  1RRO A;  5D7F A;  2KI6 C;  1IJ6 A;  1BMO A;  3BUW B;  1KK8 C;  2KYC A;  2LP3 A;  1MQ1 A;  1KCY A;  3I5I B;  1KQM B;  1E8A A;  4WQ2 A;  4BY4 A;  3OB2 B;  2RGI A;  4GNK B;  1KFU S;  3WHU B;  1NX0 A;  1TTX A;  2DOQ A;  1ZAC A;  1F70 A;  3SG7 A;  4YGC B;  2ZKM X;  2CCM A;  1KWO B;  1SR6 B;  1KK7 Y;  1TN4 A;  1RFJ A;  1J55 A;  3NSL A;  4XJK B;  4ZCU A;  1L7Z A;  1TNQ A;  1K9K A;  1N0Y A;  2KNE A;  4YGA A;  1XFU O;  1IJ5 A;  1K9U A;  1QLS A;  2OTG C;  2Y1N A;  4P5O E;  3SG4 A;  2F3Z A;  1S5G Y;  4GFT A;  1QV0 A;  1RK9 A;  1PVA A;  3CWG A;  5JOL A;  1SMG A;  1JUO A;  1XO5 A;  4F0Z B;  1UHI A;  1ALW A;  1BJF A;  1SW8 A;  1CFP A;  1TRF A;  4MEW A;  2NCP A;  2Y4Q A;  2ZN8 A;  2E6W A;  1KQM C;  5PAL A;  2NCO A;  1K90 D;  3VRR A;  1DMO A;  1XFY O;  2M1K B;  3D0Y B;  3PM8 A;  4DCK A;  1BR1 B;  3WNX B;  1Y1A A;  2F2O A;  1J7Q A;  3SG6 A;  4JWQ A;  2KQ6 A;  3I5G B;  5F6T A;  1WLZ A;  5KU1 A;  4HRH A;  1NP8 A;  5KTY A;  3JVT C;  2LVJ A;  3JTD B;  1M31 A;  1QJT A;  1SL8 A;  4I5J A;  3PAL A;  3I5H B;  1S6C A;  1DJX A;  2FCE A;  2IS9 A;  1A75 B;  3SG3 A;  5B8I B;  1EH2 A;  1CTR A;  1DJW A;  1Q80 A;  5HKY A;  2LMT A;  3SIA A;  2FCD A;  5IBW A;  3A8R A;  1KFX L;  3TDU A;  4ORA B;  4DS7 A;  1QAS A;  2E30 A;  3BOW B;  1BR4 B;  4ORB B;  2BKH B;  1JC2 A;  1L2O B;  3LLE A;  2MBX A;  2JXL A;  1SKT A;  2BCB A;  1NCZ A;  2JT8 A;  3VGO A;  1ZFS A;  4E68 A;  1WDC B;  3AKA A;  1QAT A;  2B1U A;  3BUX B;  3BOW A;  2HPS A;  4A4C A;  2KYF A;  2MAZ A;  1GJY A;  1A03 A;  1CFC A;  1CB1 A;  1UHN A;  4GUK A;  1NX3 A;  2OS8 B;  3ZWH A;  3EVU A;  4QJ4 B;  3TDZ A;  1JF2 A;  2L50 A; 
#chains in the Genus database with same CATH topology
 2K7O A;  2AAO A;  3DVK A;  2GV5 A;  1SYM A;  2LV7 A;  1IGV A;  1U5I B;  3PLF B;  1B8R A;  1F55 A;  2JUL A;  1CKK A;  1WDC C;  2LHI A;  1QS7 A;  2EC6 B;  2LLT A;  4N1G A;  3DF0 B;  3WHT B;  2COL B;  2EC6 C;  2KI4 C;  1LIN A;  1QX2 A;  3EK8 A;  4AOM A;  4AQJ A;  1QX5 B;  1NIW A;  2WOS A;  1M63 B;  4MZK A;  1AJ4 A;  3NSK A;  3NGV A;  1FW4 A;  1XVJ A;  3AKB A;  4ICB A;  1CLB A;  1Y1X A;  1NCX A;  1Z4H A;  3CR5 X;  1DVI A;  3D0Y A;  2JPT A;  4GAO A;  4PE4 A;  3SJS A;  2M9G A;  1IIO A;  1QXP A;  2HQ8 A;  4QJ3 B;  1MF8 B;  3IF7 A;  2WC8 A;  2KBM A;  5CSI A;  1UUS A;  2LMU A;  1TUJ A;  1YRU B;  3OX6 A;  1S5G Z;  2H61 C;  4GGF C;  1GGW A;  1C7W A;  2QEV A;  4MRY A;  1S26 D;  2CXJ A;  4M2Q A;  1WRL A;  2K7C A;  2MA2 A;  2ZRT A;  3VB1 A;  1XFZ O;  3DVJ A;  4GGF A;  1H4B A;  1S3P A;  1GQM A;  2F8P A;  3OB1 B;  3DD4 A;  3O6B A;  2I7A A;  5ER4 X;  1F54 A;  1KFU L;  3H4S E;  2MRD A;  1OOI X;  1NSH A;  2ZRS A;  3EKJ A;  4XJK A;  2M7L A;  1SL9 A;  1HQV A;  1UWO A;  1AVS A;  1QIW A;  2MHH A;  5AAN A;  1OMD A;  2LUC A;  2JNF A;  1YUU A;  2L5X B;  1V1F A;  2D8N A;  1G33 A;  2WCL A;  2K7B A;  2WCH A;  5G08 A;  3EG5 B;  1IKU A;  4OV2 A;  1AP4 A;  5ER5 A;  1QTX A;  1W7I B;  3BUN B;  5FYX A;  2ERB A;  2SCP A;  2LNK A;  4OR9 B;  3I5H C;  5GQQ C;  1XYD A;  2ZN9 A;  2KAV A;  4CFQ A;  4GGN A;  1A2X A;  1M46 A;  1SBJ A;  3PFV A;  4AQI A;  1MWN A;  3VRP A;  1IWQ A;  2WCB A;  1N65 A;  4CFR A;  2H61 A;  4PE7 A;  5DKR A;  1ZMZ A;  2BNX A;  3OX5 A;  3VRO A;  5AFP A;  2WCM A;  1PSB A;  3AAJ A;  3GK1 A;  1B4C A;  2JT0 A;  1J1E A;  1TNX A;  2M1U A;  2KLD A;  1C07 A;  4MN0 A;  2L98 A;  1BG1 A;  1SY9 A;  1DGU A;  2R2I A;  1B7T Y;  3D77 A;  1CM1 A;  5DKN A;  5AER A;  4N5X A;  1PAL A;  1EL4 A;  1KSO A;  2I94 A;  2M3W A;  3GK2 A;  3TZ1 A;  2Y1M A;  3HX4 A;  3NSO A;  1OE9 B;  1S1E A;  4YRU A;  2P6B B;  2BBM A;  2V53 A;  1RTP 1;  3QME A;  1A29 A;  3WXA A;  2OS8 C;  1QX7 A;  3BXK A;  1SK6 D;  3DY9 A;  2H2K A;  4OVN F;  4C0L A;  2QEB A;  5CSN A;  4NDB A;  1C3Z A;  1MXE A;  1CM4 A;  4CID A;  1QVI Y;  1MHO A;  2WCE A;  3D76 A;  4ZCV A;  2JPO A;  3A4U B;  3BUM B;  1JSA A;  2BBN A;  1IG5 A;  1FI5 A;  4TNC A;  1SCM B;  2K8M B;  2WC6 A;  1LA0 A;  1WRK A;  3IQQ A;  5HKZ A;  2BE6 A;  3D73 A;  1FPW A;  2LM5 A;  3I5G C;  1R2U A;  1AJ5 A;  1TOP A;  3SS5 A;  4IL1 A;  3AAK A;  1YTZ C;  5K89 A;  3FWB A;  2AUC A;  5CSJ A;  1NX1 A;  1PK0 D;  3EVR A;  2FJU B;  1K93 D;  1JBA A;  1S6I A;  3LK0 A;  1J7O A;  2CT9 A;  3LK1 A;  3RLZ A;  2KGR A;  1DEK A;  1W7J B;  4YI8 A;  4I5N B;  1XK4 A;  2LHL A;  5I2L A;  4MBE A;  4WRI A;  2LAP A;  5CSF A;  1B1G A;  2LAN A;  2KFG A;  1CFD A;  1TWO A;  1QV1 A;  4YI9 A;  3DYE A;  3NSI A;  2WCF A;  2EHB A;  4M2O A;  2L2C A;  3CDN A;  2QDI A;  3I5F B;  4DIR A;  4WQ3 A;  2WND A;  1OMV A;  2BKI B;  2LMV A;  4P2Y B;  5D3O A;  1IH0 A;  1SR6 C;  4JPZ B;  3OGN A;  1M45 A;  3R1V A;  2BEC A;  1NPQ A;  2K60 A;  3ZNI A;  2M0R A;  1YX7 A;  4C0J A;  2GGM A;  1V1G A;  3E3R A;  1OZS A;  2PYQ A;  1CDM A;  3I5I C;  1DJH A;  1B9A A;  1CLL A;  1TCO B;  3B7A A;  1QLK A;  2JTT A;  3CTN A;  1BLQ A;  3BQ3 A;  4I5K A;  1PVB A;  3K21 A;  1YUT A;  1JF0 A;  5AXI A;  3B86 A;  3OP0 A;  1AK8 A;  2LCP A;  1OZO A;  2KBI A;  3BFB A;  3DXL A;  2L2E A;  2JT3 A;  4F7F A;  1IQ3 A;  1CLM A;  4PDZ A;  3D74 A;  3BFH A;  1NCY A;  4IJ7 A;  1TIZ A;  2K2F A;  4XYN A;  3NHI A;  2LVK A;  1SPY A;  4L9M A;  2KGB C;  2WCK A;  1SCV A;  1IQ5 A;  2O60 A;  4MRX A;  4PT1 A;  1YVH A;  1OW4 A;  1P28 A;  1A75 A;  2BAP A;  2KFH A;  2LUX A;  1QVI Z;  2PQL A;  4JD9 A;  3DZT A;  4YGB B;  2G9B A;  3S0E A;  4NDC A;  1DF0 A;  1SNL A;  1EJ3 A;  1KQV A;  1ORG A;  3OHM B;  4UPG A;  2P71 A;  1MXL C;  2K0J A;  1L2O C;  2QPT A;  1DTL A;  3PN7 B;  4MSP A;  2M29 A;  4PAL A;  1J7P A;  2ZNE A;  2KHN A;  1B8C A;  1KFX S;  4MZL A;  3S0F A;  1RWY A;  1SCM C;  4PE1 A;  1ALV A;  2PMY A;  3KPX A;  3S0G A;  2LC5 A;  1B8L A;  1F4Q A;  4PCW A;  1BOC A;  2Y5I A;  1X02 A;  2TN4 A;  3BYA A;  1CNP A;  2PSR A;  4I5L B;  1KSM A;  3VRN A;  1HT9 A;  2JOJ A;  3TDI A;  5I8N A;  1KWO C;  3FE8 A;  3B6X A;  2JU0 A;  2P70 A;  1EG3 A;  3FIA A;  2K7D A;  1G4Y R;  5HLV A;  1ZUZ A;  3PSR A;  2PVB A;  5HYD A;  1FBV A;  5AEQ A;  3F45 A;  1Y1U A;  3RM1 A;  3R1O A;  4YGD B;  2WCJ A;  3HCM A;  1CDP A;  1EG4 A;  2K61 A;  1DJY A;  4Q04 A;  1KK8 B;  1RJV A;  2JTZ A;  1BF5 A;  5D69 A;  3EVV A;  3FWC A;  5EL2 A;  1U5I A;  4HSZ A;  5KSZ A;  1VRK A;  3SIB A;  4YBH B;  2KQY A;  3O4X A;  2JNX A;  2M8U A;  4D1E A;  1CDN A;  2YGU A;  3DF0 A;  2LVI A;  1XA5 A;  3EKH A;  3B87 A;  2JZI A;  3EK7 A;  2JXC A;  3CLN A;  2L0P A;  4JKT A;  3O2P A;  2I18 A;  5I94 A;  3TUY C;  1G8I A;  2Q91 A;  1OOJ A;  4PHN A;  3CR2 A;  3O4Y A;  1DT7 B;  4NQG A;  1DJZ A;  2LLS A;  2LVV A;  2OTG B;  2KI6 D;  5DKQ A;  2F33 A;  1CDL A;  1C3Y A;  2QEO A;  1LS8 A;  1SRA A;  2ISD A;  2QAC A;  4FTG A;  1NYA A;  3DVE A;  2ZFD A;  3DVM A;  1YUR A;  3SS4 A;  1UHK A;  3VRQ A;  3TS5 B;  1NUB A;  1XFW O;  1WRZ A;  3SG2 A;  1H8B A;  1YUS A;  1CFF A;  3KEV A;  3L47 A;  3CYZ A;  1AUI B;  2KOT A;  3CS1 A;  2LE9 B;  1Y0V H;  1C7V A;  2G2B A;  3KF9 A;  5FI7 A;  3TUY B;  2I2R E;  3RZS A;  3KHE A;  1K95 A;  1DF0 B;  2BL0 B;  2PAS A;  1T14 A;  1BT6 A;  2MLE C;  3BUO B;  1K9P A;  3CZ1 A;  1Y6W A;  2BL0 C;  3OBV A;  4BY5 A;  3LCP C;  1A4P A;  1M39 A;  3GOF A;  4R1E A;  1F8H A;  4PE0 A;  4FQT A;  4PHK A;  5I2O A;  1LXF C;  4DUQ A;  1JFK A;  1YRT B;  2A4J A;  2CTN A;  2FOT A;  2LLU A;  1NWD A;  3S0D A;  1WLM A;  1CMF A;  3FS7 A;  1B47 A;  1K96 A;  4HRG A;  5JJG A;  4NDD A;  1XFR A;  1XFV O;  2M49 B;  4M2P A;  2L51 A;  4U8D A;  3CGA A;  3CZ0 A;  4OKH A;  3B88 A;  3BFA A;  4HRE E;  3TS5 C;  1K2H A;  4OZD A;  1S36 A;  1JWD A;  5CPV A;  4MLW A;  3UNW A;  4CLN A;  3QRX A;  1TNW A;  1IRJ A;  2LP2 A;  1PSR A;  2BCA A;  2O5G A;  3D10 A;  1YX8 A;  2PRU A;  2EGD A;  2K2A A;  2L4H A;  2L50 A;  4MVF A;  3PN7 C;  1UUR A;  1K94 A;  1B7T Z;  1UHJ A;  2NLN A;  1MUX A;  3PJI A;  2KI4 B;  1BU3 A;  1XFX O;  2Q4U A;  5BPJ A;  3S0A A;  5HKW A;  2JC2 A;  1FI6 A;  5FI6 A;  1OMR A;  1SL7 A;  1KK7 Z;  3IQO A;  3V2L A;  3O78 A;  1WY9 A;  2WC5 A;  3D75 A;  4FQO A;  2KFF A;  4GPL B;  1D1O A;  3SS3 A;  3KO0 A;  2L5Y A;  5TNC A;  3I5F C;  3JTD C;  2ZND A;  3SG5 A;  2JRF A;  3GK4 X;  4DRW A;  2KLE A;  1LKJ A;  2OPO A;  4USL A;  1TUZ A;  3EK4 A;  1BOD A;  2KSP A;  4A4B A;  3R72 A;  1OSA A;  4GBA A;  2F3Y A;  2L4I A;  3LL8 B;  1S6J A;  1DJG A;  1TCF A;  2HET A;  2JQ6 A;  4YGE B;  2NXQ A;  4PHM A;  2BCX A;  1CMG A;  1K8U A;  4PHJ A;  1YVL A;  3MSE B;  1JFJ A;  1F4O A;  2CNP A;  4MZJ A;  2JWW A;  1ODB A;  2MLF C;  3CZT X;  1SSE B;  2KDH A;  4JQ0 D;  3UO9 A;  5HLO A;  1REC A;  2MJW B;  2BE4 A;  4ORC B;  3PAT A;  1TNP A;  5DIC A;  1DJI A;  1UP5 A;  1QWV A;  4N1F A;  2M7N A;  1YR5 A;  2NZ0 A;  1DGV A;  1OQP A;  1FF1 A;  1R6P A;  1MR8 A;  1N2D A;  3BJH A;  3C1V A;  1ZOT B;  1OOF A;  2HQW A;  4ETO A;  2HF5 A;  1J7R A;  4QJ5 B;  1EXR A;  2VRG A;  3M0W A;  5I2Q A;  2KAX A;  5J3X A;  2GGZ A;  1LVC D;  1QIV A;  2CBL A;  2SAS A;  3ICB A;  2GTE A;  1XK4 C;  1DQE A;  1GGZ A;  2M97 A;  2AMI A;  3N7H A;  1AHR A;  3JVT B;  2KAY A;  4OCI A;  4C0K A;  1LA3 A;  2H8V A;  4CPV A;  4KYN A;  1UHH A;  3CR4 X;  3L4L A;  1PUL A;  3NXA A;  2PAL A;  3R1P A;  1PRW A;  2WOR A;  1F71 A;  1NX2 A;  1J1D A;  2F2P A;  1RRO A;  5D7F A;  2KI6 C;  1IJ6 A;  1BMO A;  1W9Z A;  3BUW B;  1KK8 C;  1Z2C B;  2KYC A;  2LP3 A;  1MQ1 A;  3NHT A;  1KCY A;  3I5I B;  1KQM B;  1E8A A;  4WQ2 A;  4BY4 A;  3OB2 B;  2RGI A;  4GNK B;  1KFU S;  3WHU B;  1NX0 A;  1TTX A;  2DOQ A;  1ZAC A;  1F70 A;  3SG7 A;  4YGC B;  2ZKM X;  2CCM A;  1KWO B;  1SR6 B;  1KK7 Y;  1TN4 A;  1RFJ A;  1J55 A;  3NSL A;  4XJK B;  4ZCU A;  1L7Z A;  1TNQ A;  1K9K A;  1N0Y A;  2KNE A;  4YGA A;  1XFU O;  1IJ5 A;  1K9U A;  1QLS A;  2OTG C;  2Y1N A;  4INX A;  4P5O E;  3SG4 A;  2F3Z A;  1S5G Y;  4GFT A;  1QV0 A;  1RK9 A;  2FJY A;  1PVA A;  3Q8I A;  3CWG A;  5JOL A;  1SMG A;  1JUO A;  1XO5 A;  4F0Z B;  1UHI A;  1ALW A;  1BJF A;  1SW8 A;  1CFP A;  1TRF A;  4MEW A;  2NCP A;  4INW A;  2Y4Q A;  2ZN8 A;  2E6W A;  1KQM C;  3IVT A;  5PAL A;  2NCO A;  1K90 D;  3PM2 A;  3VRR A;  3CAB A;  1DMO A;  1XFY O;  2M1K B;  3D0Y B;  3PM8 A;  4DCK A;  1BR1 B;  3WNX B;  1Y1A A;  2F2O A;  3CZ2 A;  1J7Q A;  3SG6 A;  4JWQ A;  2KQ6 A;  3I5G B;  5F6T A;  1WLZ A;  5KU1 A;  4HRH A;  1NP8 A;  5KTY A;  3S0B A;  3JVT C;  2LVJ A;  3JTD B;  1M31 A;  1QJT A;  1SL8 A;  4I5J A;  3PAL A;  3I5H B;  1S6C A;  1DJX A;  2FCE A;  2IS9 A;  3L4A A;  1A75 B;  5HL1 A;  2QEH A;  3SG3 A;  5B8I B;  1EH2 A;  1CTR A;  1DJW A;  1Q80 A;  5HKY A;  2LMT A;  3FE6 A;  2FCD A;  3SIA A;  5IBW A;  3A8R A;  5FI2 A;  1KFX L;  3TDU A;  4ORA B;  4DS7 A;  1DC1 A;  1QAS A;  2E30 A;  3BOW B;  1BR4 B;  4ORB B;  2BKH B;  1JC2 A;  1L2O B;  3LLE A;  2MBX A;  2JXL A;  1DEL A;  1SKT A;  2BCB A;  1NCZ A;  2JT8 A;  1OOG A;  3VGO A;  1ZFS A;  4E68 A;  1GM0 A;  1WDC B;  3AKA A;  1QAT A;  2B1U A;  3BUX B;  3BOW A;  3FE9 A;  2HPS A;  4A4C A;  2KYF A;  2MAZ A;  1GJY A;  2KPH A;  1A03 A;  1CFC A;  1CB1 A;  1UHN A;  4GUK A;  3K1E A;  1NX3 A;  2OS8 B;  3ZWH A;  3EVU A;  4QJ4 B;  3D78 A;  3TDZ A;  1JF2 A;  1OOH A; 
#chains in the Genus database with same CATH homology
 2K7O A;  2AAO A;  3DVK A;  2GV5 A;  1SYM A;  2LV7 A;  1IGV A;  1U5I B;  3PLF B;  1B8R A;  1F55 A;  2JUL A;  1CKK A;  1WDC C;  2LHI A;  1QS7 A;  2EC6 B;  2LLT A;  4N1G A;  3DF0 B;  3WHT B;  2COL B;  2EC6 C;  2KI4 C;  1LIN A;  1QX2 A;  3EK8 A;  4AOM A;  4AQJ A;  1QX5 B;  1NIW A;  2WOS A;  1M63 B;  4MZK A;  1AJ4 A;  3NSK A;  1FW4 A;  1XVJ A;  3AKB A;  4ICB A;  1CLB A;  1Y1X A;  1NCX A;  3CR5 X;  3D0Y A;  1DVI A;  4GAO A;  2JPT A;  4PE4 A;  3SJS A;  2M9G A;  1QXP A;  2HQ8 A;  4QJ3 B;  1MF8 B;  3IF7 A;  2WC8 A;  2KBM A;  5CSI A;  1UUS A;  2LMU A;  1YRU B;  3OX6 A;  1S5G Z;  2H61 C;  4GGF C;  1GGW A;  1C7W A;  4MRY A;  1S26 D;  2CXJ A;  4M2Q A;  1WRL A;  2K7C A;  2MA2 A;  2ZRT A;  1XFZ O;  3DVJ A;  4GGF A;  1H4B A;  1S3P A;  1GQM A;  2F8P A;  3OB1 B;  3DD4 A;  3O6B A;  2I7A A;  5ER4 X;  1F54 A;  1KFU L;  3H4S E;  2MRD A;  1NSH A;  2ZRS A;  3EKJ A;  4XJK A;  2M7L A;  1SL9 A;  1HQV A;  1UWO A;  1AVS A;  1QIW A;  2MHH A;  5AAN A;  1OMD A;  2LUC A;  2JNF A;  1YUU A;  2L5X B;  1V1F A;  2D8N A;  1G33 A;  5G08 A;  2K7B A;  1AP4 A;  1IKU A;  4OV2 A;  5ER5 A;  1QTX A;  1W7I B;  3BUN B;  5FYX A;  2SCP A;  5GQQ C;  2LNK A;  4OR9 B;  3I5H C;  1XYD A;  2ZN9 A;  2KAV A;  4CFQ A;  4GGN A;  1A2X A;  1M46 A;  1SBJ A;  3PFV A;  4AQI A;  1MWN A;  3VRP A;  1IWQ A;  2WCB A;  1N65 A;  4CFR A;  2H61 A;  4PE7 A;  5DKR A;  1ZMZ A;  3OX5 A;  5AFP A;  1PSB A;  3AAJ A;  3GK1 A;  1B4C A;  2JT0 A;  1J1E A;  1TNX A;  2M1U A;  1C07 A;  4MN0 A;  2L98 A;  1BG1 A;  1SY9 A;  1DGU A;  2R2I A;  1B7T Y;  1CM1 A;  5DKN A;  5AER A;  4N5X A;  1PAL A;  1EL4 A;  1KSO A;  2I94 A;  2M3W A;  3GK2 A;  3TZ1 A;  2Y1M A;  3HX4 A;  3NSO A;  1OE9 B;  1S1E A;  4YRU A;  2P6B B;  2BBM A;  2V53 A;  1RTP 1;  1A29 A;  3WXA A;  2OS8 C;  1QX7 A;  3BXK A;  1SK6 D;  2H2K A;  4OVN F;  4C0L A;  5CSN A;  4NDB A;  1MXE A;  1CM4 A;  4CID A;  1QVI Y;  1MHO A;  2WCE A;  4ZCV A;  3A4U B;  3BUM B;  1JSA A;  2BBN A;  1IG5 A;  1FI5 A;  4TNC A;  1SCM B;  2K8M B;  1LA0 A;  1WRK A;  3IQQ A;  5HKZ A;  2BE6 A;  1FPW A;  2LM5 A;  3I5G C;  1R2U A;  1AJ5 A;  1TOP A;  4IL1 A;  3AAK A;  1YTZ C;  5K89 A;  3FWB A;  2AUC A;  5CSJ A;  1NX1 A;  1PK0 D;  3EVR A;  2FJU B;  1K93 D;  1JBA A;  1S6I A;  3LK0 A;  1J7O A;  2CT9 A;  3LK1 A;  3RLZ A;  2KGR A;  1W7J B;  4YI8 A;  4I5N B;  1XK4 A;  2LHL A;  5I2L A;  4MBE A;  4WRI A;  2LAP A;  5CSF A;  1B1G A;  2LAN A;  2KFG A;  1CFD A;  4YI9 A;  1QV1 A;  3NSI A;  2WCF A;  2EHB A;  4M2O A;  3I5F B;  4DIR A;  4WQ3 A;  2WND A;  1OMV A;  2BKI B;  2LMV A;  4P2Y B;  1IH0 A;  1SR6 C;  4JPZ B;  1M45 A;  2BEC A;  1NPQ A;  3ZNI A;  2M0R A;  1YX7 A;  4C0J A;  2GGM A;  1V1G A;  3E3R A;  1OZS A;  1CDM A;  3I5I C;  1DJH A;  1B9A A;  1CLL A;  1TCO B;  1QLK A;  2JTT A;  3CTN A;  1BLQ A;  3BQ3 A;  4I5K A;  1PVB A;  3K21 A;  1YUT A;  1JF0 A;  5AXI A;  3OP0 A;  1AK8 A;  2LCP A;  1OZO A;  2KBI A;  2L2E A;  2JT3 A;  1IQ3 A;  1CLM A;  4PDZ A;  1NCY A;  1TIZ A;  2K2F A;  4XYN A;  2LVK A;  1SPY A;  4L9M A;  2KGB C;  1SCV A;  1IQ5 A;  2O60 A;  4MRX A;  1YVH A;  3VRO A;  1A75 A;  2KFH A;  2LUX A;  1QVI Z;  4YGB B;  2G9B A;  4NDC A;  1DF0 A;  1SNL A;  1EJ3 A;  1KQV A;  3OHM B;  4UPG A;  1MXL C;  2K0J A;  1L2O C;  2QPT A;  1DTL A;  3PN7 B;  4MSP A;  2M29 A;  4PAL A;  1J7P A;  2ZNE A;  2KHN A;  1B8C A;  1KFX S;  4MZL A;  1RWY A;  1SCM C;  4PE1 A;  1ALV A;  2PMY A;  3KPX A;  2LC5 A;  1B8L A;  1F4Q A;  4PCW A;  1BOC A;  2Y5I A;  1X02 A;  2TN4 A;  3BYA A;  1CNP A;  2PSR A;  4I5L B;  1KSM A;  3VRN A;  1HT9 A;  2JOJ A;  3TDI A;  5I8N A;  1KWO C;  2JU0 A;  1EG3 A;  3FIA A;  2K7D A;  1G4Y R;  5HLV A;  1ZUZ A;  3PSR A;  2PVB A;  5HYD A;  1FBV A;  5AEQ A;  3F45 A;  1Y1U A;  3RM1 A;  4YGD B;  3HCM A;  1CDP A;  1EG4 A;  2K61 A;  1DJY A;  4Q04 A;  1KK8 B;  1RJV A;  2JTZ A;  1BF5 A;  5D69 A;  3EVV A;  3FWC A;  1U5I A;  4HSZ A;  5KSZ A;  1VRK A;  3SIB A;  4YBH B;  2KQY A;  2JNX A;  2M8U A;  4D1E A;  1CDN A;  3DF0 A;  2LVI A;  1XA5 A;  3EKH A;  3EK7 A;  2JZI A;  3TUY C;  2JXC A;  3CLN A;  2L0P A;  3O2P A;  2I18 A;  1G8I A;  2Q91 A;  1OOJ A;  4PHN A;  3CR2 A;  3O4Y A;  1DT7 B;  4NQG A;  1DJZ A;  2LLS A;  2LVV A;  2OTG B;  2KI6 D;  5DKQ A;  2F33 A;  1CDL A;  1SRA A;  2ISD A;  2QAC A;  4FTG A;  1NYA A;  3DVE A;  2ZFD A;  3DVM A;  1YUR A;  1UHK A;  3VRQ A;  3TS5 B;  1NUB A;  1XFW O;  1WRZ A;  3SG2 A;  1H8B A;  1YUS A;  1CFF A;  3KEV A;  1AUI B;  2KOT A;  3CS1 A;  2LE9 B;  1Y0V H;  1C7V A;  2G2B A;  3KF9 A;  3TUY B;  2I2R E;  3KHE A;  1K95 A;  1DF0 B;  2BL0 B;  2PAS A;  1BT6 A;  2MLE C;  3BUO B;  1K9P A;  1Y6W A;  2BL0 C;  4BY5 A;  3LCP C;  1A4P A;  1M39 A;  3GOF A;  4R1E A;  1F8H A;  4PE0 A;  4PHK A;  5I2O A;  1LXF C;  4DUQ A;  1JFK A;  1YRT B;  2A4J A;  2CTN A;  2FOT A;  2LLU A;  1NWD A;  1CMF A;  1WLM A;  3FS7 A;  1B47 A;  1K96 A;  4HRG A;  5JJG A;  4NDD A;  1XFV O;  2M49 B;  4M2P A;  2L51 A;  4U8D A;  3CGA A;  4OKH A;  3TS5 C;  4HRE E;  1K2H A;  1S36 A;  1JWD A;  5CPV A;  4MLW A;  4CLN A;  3QRX A;  1TNW A;  1IRJ A;  2LP2 A;  1PSR A;  2BCA A;  2O5G A;  3D10 A;  1YX8 A;  2PRU A;  2EGD A;  2K2A A;  2L4H A;  4MVF A;  3PN7 C;  1UUR A;  1K94 A;  1B7T Z;  1UHJ A;  2NLN A;  1MUX A;  2KI4 B;  1BU3 A;  1XFX O;  2Q4U A;  5BPJ A;  1FI6 A;  5HKW A;  2JC2 A;  1OMR A;  1SL7 A;  1KK7 Z;  3IQO A;  3O78 A;  1WY9 A;  4FQO A;  2KFF A;  4GPL B;  1D1O A;  3KO0 A;  5TNC A;  3I5F C;  3JTD C;  2ZND A;  3SG5 A;  2JRF A;  3GK4 X;  4DRW A;  1BOD A;  1LKJ A;  2OPO A;  4USL A;  3EK4 A;  2KSP A;  4A4B A;  1OSA A;  4GBA A;  2F3Y A;  2L4I A;  3LL8 B;  1S6J A;  1DJG A;  1TCF A;  2HET A;  2JQ6 A;  4YGE B;  2NXQ A;  4PHM A;  2BCX A;  1CMG A;  1K8U A;  4PHJ A;  1YVL A;  3MSE B;  1JFJ A;  1F4O A;  2CNP A;  4MZJ A;  2JWW A;  1ODB A;  2MLF C;  3CZT X;  2KDH A;  4JQ0 D;  5HLO A;  1REC A;  2MJW B;  2BE4 A;  4ORC B;  3PAT A;  1TNP A;  1DJI A;  1UP5 A;  4N1F A;  2M7N A;  1YR5 A;  2NZ0 A;  1DGV A;  1OQP A;  1FF1 A;  1R6P A;  1MR8 A;  1N2D A;  3C1V A;  1ZOT B;  2HQW A;  4ETO A;  2HF5 A;  1J7R A;  4QJ5 B;  1EXR A;  2VRG A;  3M0W A;  5I2Q A;  2KAX A;  5J3X A;  2GGZ A;  1LVC D;  1QIV A;  2CBL A;  2SAS A;  3ICB A;  1XK4 C;  1GGZ A;  2M97 A;  2AMI A;  1AHR A;  3JVT B;  2KAY A;  4OCI A;  4C0K A;  1LA3 A;  4CPV A;  1UHH A;  3CR4 X;  3NXA A;  1PUL A;  1F71 A;  2PAL A;  1PRW A;  2WOR A;  1NX2 A;  1J1D A;  2F2P A;  1RRO A;  5D7F A;  2KI6 C;  1IJ6 A;  1BMO A;  3BUW B;  1KK8 C;  2KYC A;  2LP3 A;  1MQ1 A;  1KCY A;  3I5I B;  1KQM B;  1E8A A;  4WQ2 A;  4BY4 A;  3OB2 B;  2RGI A;  4GNK B;  1KFU S;  3WHU B;  1NX0 A;  1TTX A;  2DOQ A;  1ZAC A;  1F70 A;  3SG7 A;  4YGC B;  2ZKM X;  2CCM A;  1KWO B;  1SR6 B;  1KK7 Y;  1TN4 A;  1RFJ A;  1J55 A;  3NSL A;  4XJK B;  4ZCU A;  1L7Z A;  1TNQ A;  1K9K A;  1N0Y A;  2KNE A;  4YGA A;  1XFU O;  1IJ5 A;  1K9U A;  1QLS A;  2OTG C;  2Y1N A;  4P5O E;  3SG4 A;  2F3Z A;  1S5G Y;  4GFT A;  1QV0 A;  1RK9 A;  1PVA A;  3CWG A;  5JOL A;  1SMG A;  1JUO A;  1XO5 A;  4F0Z B;  1UHI A;  1ALW A;  1BJF A;  1SW8 A;  1CFP A;  1TRF A;  4MEW A;  2NCP A;  2Y4Q A;  2ZN8 A;  2E6W A;  1KQM C;  5PAL A;  2NCO A;  1K90 D;  3VRR A;  1DMO A;  1XFY O;  2M1K B;  3D0Y B;  3PM8 A;  4DCK A;  1BR1 B;  3WNX B;  1Y1A A;  2F2O A;  1J7Q A;  3SG6 A;  4JWQ A;  2KQ6 A;  3I5G B;  5F6T A;  1WLZ A;  5KU1 A;  4HRH A;  1NP8 A;  5KTY A;  3JVT C;  2LVJ A;  3JTD B;  1M31 A;  1QJT A;  1SL8 A;  4I5J A;  3PAL A;  3I5H B;  1S6C A;  1DJX A;  2FCE A;  2IS9 A;  1A75 B;  3SG3 A;  5B8I B;  1EH2 A;  1CTR A;  1DJW A;  1Q80 A;  5HKY A;  2LMT A;  3SIA A;  2FCD A;  5IBW A;  3A8R A;  1KFX L;  3TDU A;  4ORA B;  4DS7 A;  1QAS A;  2E30 A;  3BOW B;  1BR4 B;  4ORB B;  2BKH B;  1JC2 A;  1L2O B;  3LLE A;  2MBX A;  2JXL A;  1SKT A;  2BCB A;  1NCZ A;  2JT8 A;  3VGO A;  1ZFS A;  4E68 A;  1WDC B;  3AKA A;  1QAT A;  2B1U A;  3BUX B;  3BOW A;  2HPS A;  4A4C A;  2KYF A;  2MAZ A;  1GJY A;  1A03 A;  1CFC A;  1CB1 A;  1UHN A;  4GUK A;  1NX3 A;  2OS8 B;  3ZWH A;  3EVU A;  4QJ4 B;  3TDZ A;  1JF2 A;  2L50 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...