1BU3A

Refined crystal structure of calcium-bound silver hake (pi 4.2) parvalbumin at 1.65 a.
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
108
structure length
108
Chain Sequence
AFSGILADADVAAALKACEAADSFNYKAFFAKVGLTAKSADDIKKAFFVIDQDKSGFIEEDELKLFLQVFSAGARALTDAETKAFLKAGDSDGDGAIGVDEWAALVKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALCIUM-BINDING PROTEIN
publication title X-Ray crystal structure and molecular dynamics simulations of silver hake parvalbumin (Isoform B).
pubmed rcsb
molecule tags Calcium binding
total genus 39
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 1998-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1bu3A00
1G4YR 1S26D 2KFGA 2ZNEA 1XVJA 3D0YB 1SBJA 2LP2A 4A4BA 1OMVA 1YUTA 2PVBA 5D69A 2I2RE 1M39A 1NX3A 3OX6A 2H2KA 1IJ6A 2BCBA 4HREE 1X02A 1YURA 4PHMA 1EJ3A 2LHIA 3IF7A 3PN7B 2M9GA 1XFXO 4JWQA 1Y1UA 1ZMZA 3WHTB 1DF0A 1XFVO 3LCPC 4A4CA 4MSPA 4U8DA 3WNXB 5CPVA 3AKAA 4GFTA 4ETOA 3TDUA 3A8RA 3O78A 1JUOA 4L9MA 1QX2A 1S5GY 2KQYA 4I5JA 1UUSA 4QJ4B 4P2YB 3LLEA 2KAYA 2L5XB 1YRTB 2OS8C 1PSBA 4I5LB 1ALVA 1EL4A 1KK7Y 2GGMA 1BR1B 3K21A 1W7IB 3EK4A 4PHKA 3TUYB 1SCVA 1SRAA 1K93D 3BYAA 2ZNDA 5CSFA 3EKHA 2B1UA 1WRKA 4ZCUA 4XJKB 2F3YA 2DOQA 2CCMA 1V1FA 1EG3A 2KI6D 3FWBA 1OE9B 1YTZC 2HPSA 1MF8B 2JWWA 5AANA 4BY5A 3CS1A 2JC2A 3NXAA 1KQMC 2GGZA 2I94A 4GAOA 3JVTB 1MWNA 1LVCD 1B7TY 4UPGA 2LHLA 2Y5IA 4JPZB 1AK8A 1A2XA 1SR6C 1YUSA 3FIAA 3CR5X 3BUOB 1UURA 1B8CA 4P5OE 1IRJA 1UHJA 5GQQC 2D8NA 1PALA 1OMRA 2PSRA 1SR6B 3DD4A 3TZ1A 5D7FA 4N5XA 1N2DA 1FI6A 2ZKMX 2SASA 2BKHB 4OR9B 4PHJA 1K8UA 1CB1A 3NSOA 1K90D 2LMUA 4XYNA 2BCAA 2K7BA 4Q04A 2JU0A 4ICBA 1S3PA 4MRXA 1QS7A 3BUMB 1QJTA 1QX7A 1NPQA 1DTLA 1XK4C 2L50A 2LANA 1JBAA 3O6BA 1U5IB 2HQ8A 2O60A 2EHBA 1QTXA 1NWDA 2RGIA 1H8BA 1CDMA 3A4UB 3HX4A 4MZLA 3GK4X 1K9KA 2LUXA 3VRNA 4WRIA 4DUQA 2MAZA 1PVBA 1S6IA 1TCFA 1EH2A 3AAKA 2CXJA 4E68A 2K2AA 3EKJA 1KK8C 1DMOA 1SK6D 1GGZA 1M45A 2KAXA 4I5KA 2MHHA 5HKZA 1SL9A 1R6PA 4DS7A 1QASA 2OTGB 3CWGA 1A4PA 4TNCA 2KI4C 4PE7A 1Y1AA 1BJFA 4HRGA 1DT7B 4MLWA 2K2FA 2WNDA 1RK9A 1TIZA 2JOJA 4AOMA 4PHNA 1IQ3A 4CPVA 1C7WA 1EG4A 3OB1B 2JXCA 2JT3A 2Y1NA 2BL0C 2KYCA 1AJ4A 1OZSA 2JXLA 1SL8A 2F8PA 4D1EA 2Q4UA 1JF0A 2KAVA 2F3ZA 1R2UA 2JRFA 3D0YA 4PCWA 2VRGA 3SIAA 1FW4A 4MBEA 1NX1A 3O2PA 1MQ1A 4ZCVA 4M2OA 5JOLA 1BODA 1F71A 1W7JB 1DJGA 2BCXA 4IL1A 1KSOA 1HT9A 2LUCA 3M0WA 3I5IC 1QVIY 4YGAA 1KFUS 2JNXA 1NX2A 2QPTA 4PE4A 3PN7C 1TOPA 3WXAA 2EC6B 2ZFDA 5ER4X 2K8MB 3PM8A 1A75B 4MZJA 1TRFA 1JC2A 2V53A 3DF0B 3I5IB 1BU3A 1NCYA 5K89A 4N1FA 2H61C 2E30A 3C1VA 1CM4A 4PE0A 3CGAA 2M7LA 1NCXA 1CFDA 2JZIA 3SG6A 1L2OC 2PALA 4MRYA 5HYDA 4CFRA 1YX8A 2LVVA 5CSIA 3DVKA 4DRWA 1S36A 3PALA 4N1GA 1M63B 1BF5A 2LLSA 4PALA 1L2OB 3BOWB 1ZFSA 3TUYC 5JJGA 1KQVA 2LMTA 2CT9A 1RROA 3TDZA 1DJWA 4YRUA 1QV0A 1OZOA 2JQ6A 4C0KA 1BG1A 1Y0VH 2LCPA 3NSIA 3VRQA 1BOCA 1YX7A 2JT0A 3GK2A 2KFHA 1Y6WA 1LXFC 3JVTC 1GGWA 3EK7A 1KSMA 1XFYO 4MEWA 1CTRA 5KU1A 3CTNA 1F70A 3BUNB 5I2LA 2MJWB 2KFFA 2KOTA 3AKBA 1QIWA 1OSAA 4AQIA 1WLMA 2KGRA 2MA2A 2BKIB 2O5GA 3OP0A 4CLNA 1KFXS 2KDHA 4PDZA 1JSAA 5TNCA 2JT8A 1G33A 1SKTA 4ORAB 3SG4A 1XA5A 3GOFA 2I18A 2BECA 4M2PA 1DVIA 3EVRA 4GGFC 3RM1A 1NCZA 3OHMB 1KCYA 1XFZO 2K7OA 2ZRSA 4NDCA 2F2OA 2SCPA 1U5IA 2BBMA 1CFFA 1XK4A 1N0YA 4NQGA 4CIDA 1UHIA 1WDCC 2HETA 2K61A 2HF5A 1SYMA 1PRWA 2FCEA 1EXRA 1UP5A 2LLTA 2M1KB 1CDNA 4DIRA 2M1UA 3WHUB 2L4IA 4DCKA 1K9UA 3EVUA 1NUBA 1L7ZA 5I2OA 1WDCB 2CBLA 1HQVA 1NX0A 4MVFA 1KWOB 3PSRA 1N65A 1SCMB 1TNWA 2P6BB 1CM1A 2KNEA 1SNLA 1MR8A 4M2QA 5IBWA 5KTYA 3JTDB 2OTGC 2LNKA 3LL8B 3EK8A 4OCIA 2CTNA 1BMOA 1MXLC 5G08A 1MXEA 1CKKA 2QACA 3TS5B 1K2HA 1BLQA 4YI8A 1OOJA 2LVJA 2Q91A 4MN0A 1BR4B 3SG5A 4AQJA 5BPJA 1MHOA 3BUXB 5CSNA 1B8LA 1ZOTB 1TTXA 1M46A 1YR5A 2FJUB 1S5GZ 1B8RA 1SW8A 1RFJA 2MRDA 1LA3A 2L98A 3I5GC 1JFJA 1K95A 2COLB 4GGNA 2JTZA 4CFQA 1FBVA 1A75A 2EC6C 1WRLA 2WCEA 5AERA 2F33A 2KBMA 3I5GB 3LK0A 5J3XA 2OPOA 2Y1MA 4JQ0D 1TN4A 1FF1A 3ICBA 1QLSA 4C0JA 3MSEB 4YGBB 2MBXA 1B9AA 2G9BA 1ODBA 1CMGA 1Q80A 1SY9A 1QIVA 1ZUZA 1Y1XA 2H61A 3KEVA 1FI5A 2L51A 2FCDA 1RTP1 2WCBA 3KF9A 3BUWB 3FWCA 1ZACA 1SL7A 1D1OA 1E8AA 2WC8A 1QATA 5KSZA 2LVIA 1UWOA 5F6TA 1CFPA 2KQ6A 2BE6A 2LC5A 1LINA 5B8IB 1YVLA 2TN4A 2NXQA 1CLBA 2AAOA 5AFPA 1RWYA 1TNPA 1IWQA 1DJIA 1PVAA 2JULA 2K0JA 3CR2A 4OV2A 2PRUA 3SIBA 4XJKA 1WRZA 2NCPA 2Y4QA 1CMFA 3TDIA 1V1GA 1J7RA 1KFUL 4R1EA 4HSZA 3PFVA 1TCOB 3DVMA 4BY4A 5I2QA 3OB2B 4C0LA 3DVJA 2MLEC 2E6WA 4NDBA 2KHNA 5AXIA 3KO0A 1J55A 3O4YA 1YUUA 4YI9A 1IQ5A 1IH0A 1DF0B 3SG3A 1F55A 1AJ5A 1YVHA 1JWDA 4YGEB 2JTTA 5AEQA 5DKRA 3RLZA 1OQPA 2FOTA 4FQOA 2LM5A 2G2BA 4GUKA 2F2PA 2NLNA 3GK1A 1AP4A 1XYDA 2OS8B 5FYXA 4OVNF 3VGOA 1DGUA 3LK1A 3DVEA 2L4HA 2M0RA 3PATA 2LMVA 1F8HA 2PASA 4PE1A 2MLFC 1XFUO 2LV7A 1SMGA 4GGFA 4HRHA 1DJZA 1B4CA 3CR4X 1J1EA 2JNFA 3KPXA 5PALA 3F45A 3VRPA 1NYAA 5ER5A 1YRUB 1DGVA 1B1GA 3NSLA 3EVVA 2AMIA 2AUCA 1F4OA 4QJ5B 3KHEA 5HLVA 2LVKA 3ZNIA 1J7QA 1XO5A 2GV5A 1PSRA 2ZN8A 1CDLA 1KWOC 3SJSA 1KQMB 1ALWA 2A4JA 2HQWA 2KGBC 1SCMC 4ORBB 3SG7A 1IKUA 1LA0A 3BXKA 5I8NA 1RJVA 3JTDC 1AHRA 1A29A 1WLZA 2K7DA 5HKWA 1JFKA 1S6CA 5HLOA 4YBHB 3IQQA 1OMDA 2M49B 1KFXL 2M29A 1K94A 2EGDA 3CZTX 4QJ3B 3TS5C 3VROA 5CSJA 2KBIA 1F54A 1AUIB 1IJ5A 1QV1A 1CNPA 1SPYA 4I5NB 1QVIZ 2CNPA 1IGVA 2NCOA 2R2IA 3BQ3A 3IQOA 3QRXA 1S6JA 5DKNA 2ZRTA 4FTGA 4F0ZB 2KI6C 2M97A 2L2EA 3I5FC 1XFWO 2IS9A 3FS7A 1NIWA 2L0PA 2NZ0A 1JF2A 2KYFA 3HCMA 1BT6A 2LLUA 1GQMA 4OKHA 1QLKA 1B47A 3I5FB 1CLLA 1PULA 1WY9A 2I7AA 3PLFB 4YGDB 1C07A 4GBAA 2WOSA 1G8IA 2ZN9A 1AVSA 3E3RA 4NDDA 2K7CA 2BE4A 1H4BA 1S1EA 3I5HC 1PK0D 2LAPA 1GJYA 1UHKA 1DJYA 3VRRA 1M31A 1RECA 4GPLB 2JPTA 2M3WA 1NP8A 4WQ3A 3NSKA 5DKQA 4USLA 3CLNA 1IG5A 3I5HB 2M8UA 1KK7Z 2KSPA 1VRKA 1MUXA 3D10A 1J7OA 1FPWA 1KK8B 1DJXA 2WCFA 1J1DA 3DF0A 4YGCB 1CLMA 2WORA 1K96A 1UHNA 3AAJA 4MZKA 4WQ2A 3SG2A 1LKJA 2PMYA 3ZWHA 1CFCA 2KI4B 1CDPA 2LE9B 2LP3A 1QXPA 1J7PA 4ORCB 1QX5B 1K9PA 5HKYA 1DJHA 1A03A 3OX5A 1TNXA 2M7NA 1UHHA 3H4SE 1B7TZ 2BL0B 4GNKB 1TNQA 2ISDA 1F4QA 3BOWA 1NSHA 1C7VA 2BBNA
chains in the Genus database with same CATH superfamily
1G4YR 1S26D 2KFGA 3BFAA 2ZNEA 1XVJA 3D0YB 1SBJA 2LP2A 4A4BA 1OMVA 1YUTA 2PVBA 3NGVA 5D69A 2I2RE 1M39A 1NX3A 3B7AA 3OX6A 2H2KA 1IJ6A 2BCBA 4HREE 3R1OA 1X02A 1YURA 4PHMA 4PT1A 1EJ3A 2LHIA 3IF7A 3PN7B 2M9GA 1XFXO 4JWQA 2L2CA 1Y1UA 2WCMA 1ZMZA 3WHTB 1DF0A 1TUZA 1XFVO 3B6XA 3LCPC 4A4CA 4MSPA 3FE9A 4U8DA 5CPVA 3WNXB 3UNWA 3D73A 1T14A 3AKAA 4GFTA 4ETOA 3TDUA 3A8RA 3O78A 1JUOA 4L9MA 1QX2A 1S5GY 2KQYA 4I5JA 5EL2A 1UUSA 4QJ4B 4P2YB 2FJYA 3LLEA 2KAYA 2L5XB 1YRTB 2GTEA 2QEVA 2OS8C 1PSBA 4I5LB 1ALVA 1EL4A 1KK7Y 2GGMA 3D77A 1P28A 1BR1B 3K21A 1W7IB 3EK4A 4PHKA 3TUYB 1SCVA 3B88A 1SRAA 1K93D 3BYAA 3O4XA 2ZNDA 5CSFA 5DICA 3EKHA 2B1UA 1WRKA 4ZCUA 4XJKB 2F3YA 2DOQA 2CCMA 1V1FA 3EG5B 1EG3A 2KI6D 3FWBA 1OE9B 1YTZC 2HPSA 1MF8B 2JWWA 5AANA 4BY5A 3B86A 3CS1A 2JC2A 3NXAA 1KQMC 2GGZA 2I94A 4GAOA 3JVTB 1MWNA 1LVCD 1B7TY 2H8VA 2LHLA 4UPGA 2Y5IA 4JPZB 1AK8A 1A2XA 1SR6C 1YUSA 3FIAA 3CR5X 3BUOB 1UURA 1B8CA 4P5OE 1IRJA 1UHJA 5GQQC 2D8NA 1PALA 1OMRA 2PSRA 1SR6B 3DD4A 4JKTA 3TZ1A 1DC1A 5D7FA 4N5XA 1N2DA 1FI6A 2ZKMX 2SASA 2BKHB 4OR9B 4PHJA 1K8UA 1CB1A 3NSOA 1K90D 2LMUA 4XYNA 2BCAA 2K7BA 4Q04A 2JU0A 2PQLA 1S3PA 4ICBA 1C3YA 4MRXA 1QS7A 3BUMB 1QJTA 1QX7A 1NPQA 1DTLA 1XK4C 2L50A 2LANA 3IVTA 3K1EA 1JBAA 3V2LA 3O6BA 1U5IB 2HQ8A 3PM2A 3CZ1A 2O60A 1XFRA 2EHBA 1QTXA 1NWDA 2RGIA 1H8BA 1CDMA 3A4UB 3D76A 3HX4A 3N7HA 4MZLA 3GK4X 1K9KA 2LUXA 3VRNA 4WRIA 4DUQA 2MAZA 3S0DA 1PVBA 1S6IA 1TCFA 1EH2A 3B87A 3AAKA 2CXJA 4E68A 2K2AA 3EKJA 1TUJA 1KK8C 2PYQA 1DMOA 1SK6D 1GGZA 1M45A 2KAXA 4I5KA 2MHHA 5HKZA 1SL9A 1R6PA 4DS7A 1QASA 2OTGB 3CWGA 3OBVA 1A4PA 4JD9A 4TNCA 1OW4A 5FI7A 2KI4C 4PE7A 1Y1AA 1BJFA 4HRGA 1DT7B 4MLWA 2K2FA 2WNDA 1RK9A 1TIZA 2JOJA 4AOMA 3SS5A 4PHNA 1IQ3A 4CPVA 1C7WA 1EG4A 3OB1B 2JXCA 2JT3A 2Y1NA 2BL0C 2KYCA 1AJ4A 2WCLA 3VB1A 1OZSA 2JXLA 1SL8A 4INXA 2F8PA 4D1EA 2Q4UA 1JF0A 2KAVA 2F3ZA 1R2UA 2BAPA 2JRFA 3D0YA 4PCWA 2VRGA 2P70A 3BFHA 3SIAA 1FW4A 4MBEA 1NX1A 3O2PA 1MQ1A 4ZCVA 4M2OA 5JOLA 1BODA 1F71A 1W7JB 5FI2A 1DJGA 2BCXA 4IL1A 1KSOA 1HT9A 2LUCA 3L4AA 3M0WA 3D75A 3I5IC 1QVIY 4YGAA 1KFUS 2JNXA 1NX2A 2QPTA 2JPOA 3PN7C 1TOPA 4PE4A 3WXAA 2EC6B 2ZFDA 5ER4X 2ERBA 2K8MB 1A75B 3PM8A 4MZJA 1TRFA 1JC2A 2V53A 3DF0B 3I5IB 1BU3A 1NCYA 5K89A 4N1FA 2H61C 2E30A 1OOHA 3C1VA 1CM4A 2WCJA 4PE0A 3CGAA 2M7LA 1NCXA 1CFDA 2JZIA 3SG6A 1L2OC 2PALA 4MRYA 5HYDA 4CFRA 1YX8A 2LVVA 4IJ7A 5CSIA 1OOFA 3DVKA 2WC6A 1S36A 4KYNA 4DRWA 3PALA 4N1GA 1M63B 1BF5A 2LLSA 1Z2CB 4PALA 1L2OB 3BOWB 3D78A 1ZFSA 3TUYC 2KPHA 5JJGA 1KQVA 2LMTA 2CT9A 1RROA 3TDZA 1DJWA 4YRUA 1QV0A 1OZOA 2JQ6A 4C0KA 1BG1A 3R1VA 1Y0VH 2LCPA 3NSIA 3VRQA 1BOCA 1YX7A 2JT0A 3GK2A 2KFHA 1Y6WA 1LXFC 3JVTC 1GGWA 3EK7A 1KSMA 3QMEA 1XFYO 4MEWA 1CTRA 5KU1A 3CTNA 1F70A 3BUNB 5I2LA 2MJWB 2KFFA 2KOTA 3AKBA 1QIWA 1OSAA 4AQIA 1WLMA 2KGRA 2MA2A 3CYZA 2BKIB 2O5GA 3OGNA 3SS3A 3OP0A 4CLNA 1KFXS 2KDHA 4PDZA 1JSAA 2K60A 5TNCA 2JT8A 1G33A 1SKTA 4ORAB 3SG4A 1XA5A 3GOFA 2I18A 2BECA 4M2PA 1DVIA 3EVRA 4GGFC 3RM1A 1NCZA 3OHMB 1DQEA 1KCYA 1XFZO 2K7OA 2ZRSA 4NDCA 2F2OA 2SCPA 1U5IA 2BBMA 3S0AA 1CFFA 1XK4A 1N0YA 4NQGA 4CIDA 1UHIA 1WDCC 2HETA 2K61A 2HF5A 1SYMA 1PRWA 2FCEA 1EXRA 1UP5A 2LLTA 2M1KB 3FE6A 1CDNA 4DIRA 2M1UA 3WHUB 2L4IA 4DCKA 1K9UA 3EVUA 1NUBA 1L7ZA 1GM0A 5I2OA 1WDCB 2CBLA 2KLDA 1HQVA 1NX0A 4MVFA 3S0FA 1KWOB 3PSRA 1N65A 1SCMB 1TNWA 2P6BB 1ORGA 1CM1A 2KNEA 1SNLA 1MR8A 4M2QA 5D3OA 5IBWA 5KTYA 3JTDB 3DXLA 2OTGC 2LNKA 3LL8B 3EK8A 5FI6A 1SSEB 4OCIA 2CTNA 1BMOA 1MXLC 5G08A 1MXEA 1CKKA 2QACA 3TS5B 1K2HA 1BLQA 4YI8A 1OOJA 2LVJA 2Q91A 2QEBA 4MN0A 1BR4B 3SG5A 4AQJA 5BPJA 1MHOA 2KLEA 3BUXB 5CSNA 1B8LA 1ZOTB 1TTXA 1M46A 4INWA 3BJHA 3CDNA 1YR5A 2FJUB 2WCKA 1S5GZ 1B8RA 1SW8A 3S0EA 1RFJA 2MRDA 1LA3A 2L98A 3I5GC 1IIOA 1JFJA 1K95A 2COLB 4GGNA 2JTZA 4CFQA 1FBVA 1A75A 2EC6C 1WRLA 2WCEA 5AERA 2F33A 2KBMA 3I5GB 3LK0A 5J3XA 1LS8A 2OPOA 2Y1MA 4JQ0D 1TN4A 1FF1A 3ICBA 1QLSA 4C0JA 3MSEB 4YGBB 2MBXA 1B9AA 2G9BA 1ODBA 2QDIA 1CMGA 1Q80A 1SY9A 1QIVA 1ZUZA 1Y1XA 2H61A 3CZ2A 3KEVA 1FI5A 2L51A 2FCDA 1RTP1 2WCBA 3KF9A 3BUWB 3FWCA 1ZACA 1SL7A 1D1OA 1E8AA 2WC8A 1QATA 5KSZA 2LVIA 1UWOA 5F6TA 2P71A 1CFPA 2KQ6A 2BE6A 2LC5A 1LINA 5B8IB 1YVLA 2TN4A 2NXQA 4OZDA 2AAOA 1CLBA 5AFPA 1RWYA 1TNPA 1IWQA 1DJIA 1PVAA 2JULA 2K0JA 3CR2A 4OV2A 2PRUA 3SIBA 4XJKA 1WRZA 2NCPA 2Y4QA 1CMFA 3TDIA 1V1GA 2WCHA 1J7RA 1KFUL 4R1EA 4HSZA 3PFVA 1TCOB 3DVMA 4BY4A 5I2QA 3OB2B 4C0LA 3DVJA 2MLEC 2E6WA 4NDBA 3R1PA 3R72A 2KHNA 1OOIX 5AXIA 4F7FA 3KO0A 1J55A 3O4YA 1YUUA 4YI9A 1IQ5A 1IH0A 1DF0B 3Q8IA 3SG3A 1F55A 1AJ5A 1YVHA 1JWDA 4YGEB 2JTTA 5AEQA 5DKRA 3RLZA 1OQPA 2FOTA 4FQOA 2LM5A 2G2BA 4GUKA 2F2PA 2NLNA 3GK1A 1AP4A 1XYDA 2OS8B 5FYXA 4OVNF 3VGOA 1DGUA 3LK1A 3NHIA 5I94A 3DVEA 2L4HA 2M0RA 3PATA 2LMVA 1F8HA 2PASA 4PE1A 2MLFC 1XFUO 2LV7A 1SMGA 4GGFA 4HRHA 1DJZA 1B4CA 3CR4X 1J1EA 2JNFA 3KPXA 5PALA 3F45A 3VRPA 1NYAA 5ER5A 1YRUB 1DGVA 1B1GA 3NSLA 3EVVA 1W9ZA 2AMIA 3S0GA 2YGUA 2AUCA 1F4OA 4QJ5B 3FE8A 3KHEA 5HLVA 1F54A 2LVKA 3ZNIA 1J7QA 1DELA 1XO5A 2GV5A 1PSRA 3NHTA 2ZN8A 1CDLA 1KWOC 3SJSA 1KQMB 1ALWA 2A4JA 2HQWA 2KGBC 1DEKA 1SCMC 4ORBB 3UO9A 3SG7A 3L4LA 1IKUA 1LA0A 3BXKA 5I8NA 1RJVA 3JTDC 1AHRA 1A29A 3CABA 1WLZA 2K7DA 4FQTA 5HKWA 1JFKA 1S6CA 5HLOA 4YBHB 3IQQA 2BNXA 1OMDA 2M49B 1KFXL 2M29A 1K94A 2EGDA 3CZTX 1C3ZA 4QJ3B 3TS5C 5CSJA 2KBIA 3VROA 1AUIB 1IJ5A 1QV1A 1CNPA 1SPYA 4I5NB 1QVIZ 2CNPA 1IGVA 2NCOA 2R2IA 3BQ3A 3IQOA 3PJIA 3DY9A 3QRXA 5HL1A 1S6JA 5DKNA 2ZRTA 4FTGA 3DZTA 2KI6C 4F0ZB 2M97A 2L2EA 3I5FC 1XFWO 2IS9A 3FS7A 1NIWA 2L0PA 2NZ0A 1JF2A 2KYFA 3HCMA 1BT6A 2LLUA 1GQMA 3S0BA 4OKHA 1QLKA 1Z4HA 1B47A 3I5FB 1CLLA 1PULA 1WY9A 2I7AA 3PLFB 4YGDB 1C07A 4GBAA 2QEHA 2WOSA 1G8IA 2ZN9A 1AVSA 3E3RA 4NDDA 2K7CA 2BE4A 1H4BA 1S1EA 3I5HC 2WC5A 1PK0D 2LAPA 1GJYA 1UHKA 1DJYA 3BFBA 3VRRA 1M31A 1RECA 4GPLB 1QWVA 2JPTA 2M3WA 1NP8A 2QEOA 3CZ0A 4WQ3A 3NSKA 5DKQA 4USLA 3CLNA 1IG5A 3I5HB 2M8UA 1KK7Z 2KSPA 1VRKA 1MUXA 3D10A 1J7OA 1FPWA 3D74A 1KK8B 1DJXA 2WCFA 1J1DA 3DF0A 4YGCB 3SS4A 1CLMA 2WORA 1K96A 1UHNA 3DYEA 3AAJA 4MZKA 3RZSA 4WQ2A 3SG2A 1LKJA 2PMYA 3ZWHA 1CFCA 2KI4B 1CDPA 1TWOA 2LE9B 2LP3A 1QXPA 1J7PA 4ORCB 2L5YA 1QX5B 1K9PA 1OOGA 1DJHA 5HKYA 1A03A 3OX5A 1TNXA 2M7NA 1UHHA 3H4SE 1B7TZ 2BL0B 4GNKB 1TNQA 2ISDA 1F4QA 3L47A 3BOWA 1NSHA 1C7VA 2BBNA
chains in the Genus database with same CATH topology
1G4YR 1S26D 2KFGA 2ZNEA 1XVJA 3D0YB 1SBJA 2LP2A 4A4BA 1OMVA 1YUTA 2PVBA 5D69A 2I2RE 1M39A 1NX3A 3OX6A 2H2KA 1IJ6A 2BCBA 4HREE 1X02A 1YURA 4PHMA 1EJ3A 2LHIA 3IF7A 3PN7B 2M9GA 1XFXO 4JWQA 1Y1UA 1ZMZA 3WHTB 1DF0A 1XFVO 3LCPC 4A4CA 4MSPA 4U8DA 3WNXB 5CPVA 3AKAA 4GFTA 4ETOA 3TDUA 3A8RA 3O78A 1JUOA 4L9MA 1QX2A 1S5GY 2KQYA 4I5JA 1UUSA 4QJ4B 4P2YB 3LLEA 2KAYA 2L5XB 1YRTB 2OS8C 1PSBA 4I5LB 1ALVA 1EL4A 1KK7Y 2GGMA 1BR1B 3K21A 1W7IB 3EK4A 4PHKA 3TUYB 1SCVA 1SRAA 1K93D 3BYAA 2ZNDA 5CSFA 3EKHA 2B1UA 1WRKA 4ZCUA 4XJKB 2F3YA 2DOQA 2CCMA 1V1FA 1EG3A 2KI6D 3FWBA 1OE9B 1YTZC 2HPSA 1MF8B 2JWWA 5AANA 4BY5A 3CS1A 2JC2A 3NXAA 1KQMC 2GGZA 2I94A 4GAOA 3JVTB 1MWNA 1LVCD 1B7TY 4UPGA 2LHLA 2Y5IA 4JPZB 1AK8A 1A2XA 1SR6C 1YUSA 3FIAA 3CR5X 3BUOB 1UURA 1B8CA 4P5OE 1IRJA 1UHJA 5GQQC 2D8NA 1PALA 1OMRA 2PSRA 1SR6B 3DD4A 3TZ1A 5D7FA 4N5XA 1N2DA 1FI6A 2ZKMX 2SASA 2BKHB 4OR9B 4PHJA 1K8UA 1CB1A 3NSOA 1K90D 2LMUA 4XYNA 2BCAA 2K7BA 4Q04A 2JU0A 4ICBA 1S3PA 4MRXA 1QS7A 3BUMB 1QJTA 1QX7A 1NPQA 1DTLA 1XK4C 2L50A 2LANA 1JBAA 3O6BA 1U5IB 2HQ8A 2O60A 2EHBA 1QTXA 1NWDA 2RGIA 1H8BA 1CDMA 3A4UB 3HX4A 4MZLA 3GK4X 1K9KA 2LUXA 3VRNA 4WRIA 4DUQA 2MAZA 1PVBA 1S6IA 1TCFA 1EH2A 3AAKA 2CXJA 4E68A 2K2AA 3EKJA 1KK8C 1DMOA 1SK6D 1GGZA 1M45A 2KAXA 4I5KA 2MHHA 5HKZA 1SL9A 1R6PA 4DS7A 1QASA 2OTGB 3CWGA 1A4PA 4TNCA 2KI4C 4PE7A 1Y1AA 1BJFA 4HRGA 1DT7B 4MLWA 2K2FA 2WNDA 1RK9A 1TIZA 2JOJA 4AOMA 4PHNA 1IQ3A 4CPVA 1C7WA 1EG4A 3OB1B 2JXCA 2JT3A 2Y1NA 2BL0C 2KYCA 1AJ4A 1OZSA 2JXLA 1SL8A 2F8PA 4D1EA 2Q4UA 1JF0A 2KAVA 2F3ZA 1R2UA 2JRFA 3D0YA 4PCWA 2VRGA 3SIAA 1FW4A 4MBEA 1NX1A 3O2PA 1MQ1A 4ZCVA 4M2OA 5JOLA 1BODA 1F71A 1W7JB 1DJGA 2BCXA 4IL1A 1KSOA 1HT9A 2LUCA 3M0WA 3I5IC 1QVIY 4YGAA 1KFUS 2JNXA 1NX2A 2QPTA 4PE4A 3PN7C 1TOPA 3WXAA 2EC6B 2ZFDA 5ER4X 2K8MB 3PM8A 1A75B 4MZJA 1TRFA 1JC2A 2V53A 3DF0B 3I5IB 1BU3A 1NCYA 5K89A 4N1FA 2H61C 2E30A 3C1VA 1CM4A 4PE0A 3CGAA 2M7LA 1NCXA 1CFDA 2JZIA 3SG6A 1L2OC 2PALA 4MRYA 5HYDA 4CFRA 1YX8A 2LVVA 5CSIA 3DVKA 4DRWA 1S36A 3PALA 4N1GA 1M63B 1BF5A 2LLSA 4PALA 1L2OB 3BOWB 1ZFSA 3TUYC 5JJGA 1KQVA 2LMTA 2CT9A 1RROA 3TDZA 1DJWA 4YRUA 1QV0A 1OZOA 2JQ6A 4C0KA 1BG1A 1Y0VH 2LCPA 3NSIA 3VRQA 1BOCA 1YX7A 2JT0A 3GK2A 2KFHA 1Y6WA 1LXFC 3JVTC 1GGWA 3EK7A 1KSMA 1XFYO 4MEWA 1CTRA 5KU1A 3CTNA 1F70A 3BUNB 5I2LA 2MJWB 2KFFA 2KOTA 3AKBA 1QIWA 1OSAA 4AQIA 1WLMA 2KGRA 2MA2A 2BKIB 2O5GA 3OP0A 4CLNA 1KFXS 2KDHA 4PDZA 1JSAA 5TNCA 2JT8A 1G33A 1SKTA 4ORAB 3SG4A 1XA5A 3GOFA 2I18A 2BECA 4M2PA 1DVIA 3EVRA 4GGFC 3RM1A 1NCZA 3OHMB 1KCYA 1XFZO 2K7OA 2ZRSA 4NDCA 2F2OA 2SCPA 1U5IA 2BBMA 1CFFA 1XK4A 1N0YA 4NQGA 4CIDA 1UHIA 1WDCC 2HETA 2K61A 2HF5A 1SYMA 1PRWA 2FCEA 1EXRA 1UP5A 2LLTA 2M1KB 1CDNA 4DIRA 2M1UA 3WHUB 2L4IA 4DCKA 1K9UA 3EVUA 1NUBA 1L7ZA 5I2OA 1WDCB 2CBLA 1HQVA 1NX0A 4MVFA 1KWOB 3PSRA 1N65A 1SCMB 1TNWA 2P6BB 1CM1A 2KNEA 1SNLA 1MR8A 4M2QA 5IBWA 5KTYA 3JTDB 2OTGC 2LNKA 3LL8B 3EK8A 4OCIA 2CTNA 1BMOA 1MXLC 5G08A 1MXEA 1CKKA 2QACA 3TS5B 1K2HA 1BLQA 4YI8A 1OOJA 2LVJA 2Q91A 4MN0A 1BR4B 3SG5A 4AQJA 5BPJA 1MHOA 3BUXB 5CSNA 1B8LA 1ZOTB 1TTXA 1M46A 1YR5A 2FJUB 1S5GZ 1B8RA 1SW8A 1RFJA 2MRDA 1LA3A 2L98A 3I5GC 1JFJA 1K95A 2COLB 4GGNA 2JTZA 4CFQA 1FBVA 1A75A 2EC6C 1WRLA 2WCEA 5AERA 2F33A 2KBMA 3I5GB 3LK0A 5J3XA 2OPOA 2Y1MA 4JQ0D 1TN4A 1FF1A 3ICBA 1QLSA 4C0JA 3MSEB 4YGBB 2MBXA 1B9AA 2G9BA 1ODBA 1CMGA 1Q80A 1SY9A 1QIVA 1ZUZA 1Y1XA 2H61A 3KEVA 1FI5A 2L51A 2FCDA 1RTP1 2WCBA 3KF9A 3BUWB 3FWCA 1ZACA 1SL7A 1D1OA 1E8AA 2WC8A 1QATA 5KSZA 2LVIA 1UWOA 5F6TA 1CFPA 2KQ6A 2BE6A 2LC5A 1LINA 5B8IB 1YVLA 2TN4A 2NXQA 1CLBA 2AAOA 5AFPA 1RWYA 1TNPA 1IWQA 1DJIA 1PVAA 2JULA 2K0JA 3CR2A 4OV2A 2PRUA 3SIBA 4XJKA 1WRZA 2NCPA 2Y4QA 1CMFA 3TDIA 1V1GA 1J7RA 1KFUL 4R1EA 4HSZA 3PFVA 1TCOB 3DVMA 4BY4A 5I2QA 3OB2B 4C0LA 3DVJA 2MLEC 2E6WA 4NDBA 2KHNA 5AXIA 3KO0A 1J55A 3O4YA 1YUUA 4YI9A 1IQ5A 1IH0A 1DF0B 3SG3A 1F55A 1AJ5A 1YVHA 1JWDA 4YGEB 2JTTA 5AEQA 5DKRA 3RLZA 1OQPA 2FOTA 4FQOA 2LM5A 2G2BA 4GUKA 2F2PA 2NLNA 3GK1A 1AP4A 1XYDA 2OS8B 5FYXA 4OVNF 3VGOA 1DGUA 3LK1A 3DVEA 2L4HA 2M0RA 3PATA 2LMVA 1F8HA 2PASA 4PE1A 2MLFC 1XFUO 2LV7A 1SMGA 4GGFA 4HRHA 1DJZA 1B4CA 3CR4X 1J1EA 2JNFA 3KPXA 5PALA 3F45A 3VRPA 1NYAA 5ER5A 1YRUB 1DGVA 1B1GA 3NSLA 3EVVA 2AMIA 2AUCA 1F4OA 4QJ5B 3KHEA 5HLVA 2LVKA 3ZNIA 1J7QA 1XO5A 2GV5A 1PSRA 2ZN8A 1CDLA 1KWOC 3SJSA 1KQMB 1ALWA 2A4JA 2HQWA 2KGBC 1SCMC 4ORBB 3SG7A 1IKUA 1LA0A 3BXKA 5I8NA 1RJVA 3JTDC 1AHRA 1A29A 1WLZA 2K7DA 5HKWA 1JFKA 1S6CA 5HLOA 4YBHB 3IQQA 1OMDA 2M49B 1KFXL 2M29A 1K94A 2EGDA 3CZTX 4QJ3B 3TS5C 3VROA 5CSJA 2KBIA 1F54A 1AUIB 1IJ5A 1QV1A 1CNPA 1SPYA 4I5NB 1QVIZ 2CNPA 1IGVA 2NCOA 2R2IA 3BQ3A 3IQOA 3QRXA 1S6JA 5DKNA 2ZRTA 4FTGA 4F0ZB 2KI6C 2M97A 2L2EA 3I5FC 1XFWO 2IS9A 3FS7A 1NIWA 2L0PA 2NZ0A 1JF2A 2KYFA 3HCMA 1BT6A 2LLUA 1GQMA 4OKHA 1QLKA 1B47A 3I5FB 1CLLA 1PULA 1WY9A 2I7AA 3PLFB 4YGDB 1C07A 4GBAA 2WOSA 1G8IA 2ZN9A 1AVSA 3E3RA 4NDDA 2K7CA 2BE4A 1H4BA 1S1EA 3I5HC 1PK0D 2LAPA 1GJYA 1UHKA 1DJYA 3VRRA 1M31A 1RECA 4GPLB 2JPTA 2M3WA 1NP8A 4WQ3A 3NSKA 5DKQA 4USLA 3CLNA 1IG5A 3I5HB 2M8UA 1KK7Z 2KSPA 1VRKA 1MUXA 3D10A 1J7OA 1FPWA 1KK8B 1DJXA 2WCFA 1J1DA 3DF0A 4YGCB 1CLMA 2WORA 1K96A 1UHNA 3AAJA 4MZKA 4WQ2A 3SG2A 1LKJA 2PMYA 3ZWHA 1CFCA 2KI4B 1CDPA 2LE9B 2LP3A 1QXPA 1J7PA 4ORCB 1QX5B 1K9PA 5HKYA 1DJHA 1A03A 3OX5A 1TNXA 2M7NA 1UHHA 3H4SE 1B7TZ 2BL0B 4GNKB 1TNQA 2ISDA 1F4QA 3BOWA 1NSHA 1C7VA 2BBNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G4Y R;  1S26 D;  2KFG A;  2ZNE A;  1XVJ A;  3D0Y B;  1SBJ A;  2LP2 A;  4A4B A;  1OMV A;  1YUT A;  2PVB A;  5D69 A;  2I2R E;  1M39 A;  1NX3 A;  3OX6 A;  2H2K A;  1IJ6 A;  2BCB A;  4HRE E;  1X02 A;  1YUR A;  4PHM A;  1EJ3 A;  2LHI A;  3IF7 A;  3PN7 B;  2M9G A;  1XFX O;  4JWQ A;  1Y1U A;  1ZMZ A;  3WHT B;  1DF0 A;  1XFV O;  3LCP C;  4A4C A;  4MSP A;  4U8D A;  3WNX B;  5CPV A;  3AKA A;  4GFT A;  4ETO A;  3TDU A;  3A8R A;  3O78 A;  1JUO A;  4L9M A;  1QX2 A;  1S5G Y;  2KQY A;  4I5J A;  1UUS A;  4QJ4 B;  4P2Y B;  3LLE A;  2KAY A;  2L5X B;  1YRT B;  2OS8 C;  1PSB A;  4I5L B;  1ALV A;  1EL4 A;  1KK7 Y;  2GGM A;  1BR1 B;  3K21 A;  1W7I B;  3EK4 A;  4PHK A;  3TUY B;  1SCV A;  1SRA A;  1K93 D;  3BYA A;  2ZND A;  5CSF A;  3EKH A;  2B1U A;  1WRK A;  4ZCU A;  4XJK B;  2F3Y A;  2DOQ A;  2CCM A;  1V1F A;  1EG3 A;  2KI6 D;  3FWB A;  1OE9 B;  1YTZ C;  2HPS A;  1MF8 B;  2JWW A;  5AAN A;  4BY5 A;  3CS1 A;  2JC2 A;  3NXA A;  1KQM C;  2GGZ A;  2I94 A;  4GAO A;  3JVT B;  1MWN A;  1LVC D;  1B7T Y;  4UPG A;  2LHL A;  2Y5I A;  4JPZ B;  1AK8 A;  1A2X A;  1SR6 C;  1YUS A;  3FIA A;  3CR5 X;  3BUO B;  1UUR A;  1B8C A;  4P5O E;  1IRJ A;  1UHJ A;  5GQQ C;  2D8N A;  1PAL A;  1OMR A;  2PSR A;  1SR6 B;  3DD4 A;  3TZ1 A;  5D7F A;  4N5X A;  1N2D A;  1FI6 A;  2ZKM X;  2SAS A;  2BKH B;  4OR9 B;  4PHJ A;  1K8U A;  1CB1 A;  3NSO A;  1K90 D;  2LMU A;  4XYN A;  2BCA A;  2K7B A;  4Q04 A;  2JU0 A;  4ICB A;  1S3P A;  4MRX A;  1QS7 A;  3BUM B;  1QJT A;  1QX7 A;  1NPQ A;  1DTL A;  1XK4 C;  2L50 A;  2LAN A;  1JBA A;  3O6B A;  1U5I B;  2HQ8 A;  2O60 A;  2EHB A;  1QTX A;  1NWD A;  2RGI A;  1H8B A;  1CDM A;  3A4U B;  3HX4 A;  4MZL A;  3GK4 X;  1K9K A;  2LUX A;  3VRN A;  4WRI A;  4DUQ A;  2MAZ A;  1PVB A;  1S6I A;  1TCF A;  1EH2 A;  3AAK A;  2CXJ A;  4E68 A;  2K2A A;  3EKJ A;  1KK8 C;  1DMO A;  1SK6 D;  1GGZ A;  1M45 A;  2KAX A;  4I5K A;  2MHH A;  5HKZ A;  1SL9 A;  1R6P A;  4DS7 A;  1QAS A;  2OTG B;  3CWG A;  1A4P A;  4TNC A;  2KI4 C;  4PE7 A;  1Y1A A;  1BJF A;  4HRG A;  1DT7 B;  4MLW A;  2K2F A;  2WND A;  1RK9 A;  1TIZ A;  2JOJ A;  4AOM A;  4PHN A;  1IQ3 A;  4CPV A;  1C7W A;  1EG4 A;  3OB1 B;  2JXC A;  2JT3 A;  2Y1N A;  2BL0 C;  2KYC A;  1AJ4 A;  1OZS A;  2JXL A;  1SL8 A;  2F8P A;  4D1E A;  2Q4U A;  1JF0 A;  2KAV A;  2F3Z A;  1R2U A;  2JRF A;  3D0Y A;  4PCW A;  2VRG A;  3SIA A;  1FW4 A;  4MBE A;  1NX1 A;  3O2P A;  1MQ1 A;  4ZCV A;  4M2O A;  5JOL A;  1BOD A;  1F71 A;  1W7J B;  1DJG A;  2BCX A;  4IL1 A;  1KSO A;  1HT9 A;  2LUC A;  3M0W A;  3I5I C;  1QVI Y;  4YGA A;  1KFU S;  2JNX A;  1NX2 A;  2QPT A;  4PE4 A;  3PN7 C;  1TOP A;  3WXA A;  2EC6 B;  2ZFD A;  5ER4 X;  2K8M B;  3PM8 A;  1A75 B;  4MZJ A;  1TRF A;  1JC2 A;  2V53 A;  3DF0 B;  3I5I B;  1BU3 A;  1NCY A;  5K89 A;  4N1F A;  2H61 C;  2E30 A;  3C1V A;  1CM4 A;  4PE0 A;  3CGA A;  2M7L A;  1NCX A;  1CFD A;  2JZI A;  3SG6 A;  1L2O C;  2PAL A;  4MRY A;  5HYD A;  4CFR A;  1YX8 A;  2LVV A;  5CSI A;  3DVK A;  4DRW A;  1S36 A;  3PAL A;  4N1G A;  1M63 B;  1BF5 A;  2LLS A;  4PAL A;  1L2O B;  3BOW B;  1ZFS A;  3TUY C;  5JJG A;  1KQV A;  2LMT A;  2CT9 A;  1RRO A;  3TDZ A;  1DJW A;  4YRU A;  1QV0 A;  1OZO A;  2JQ6 A;  4C0K A;  1BG1 A;  1Y0V H;  2LCP A;  3NSI A;  3VRQ A;  1BOC A;  1YX7 A;  2JT0 A;  3GK2 A;  2KFH A;  1Y6W A;  1LXF C;  3JVT C;  1GGW A;  3EK7 A;  1KSM A;  1XFY O;  4MEW A;  1CTR A;  5KU1 A;  3CTN A;  1F70 A;  3BUN B;  5I2L A;  2MJW B;  2KFF A;  2KOT A;  3AKB A;  1QIW A;  1OSA A;  4AQI A;  1WLM A;  2KGR A;  2MA2 A;  2BKI B;  2O5G A;  3OP0 A;  4CLN A;  1KFX S;  2KDH A;  4PDZ A;  1JSA A;  5TNC A;  2JT8 A;  1G33 A;  1SKT A;  4ORA B;  3SG4 A;  1XA5 A;  3GOF A;  2I18 A;  2BEC A;  4M2P A;  1DVI A;  3EVR A;  4GGF C;  3RM1 A;  1NCZ A;  3OHM B;  1KCY A;  1XFZ O;  2K7O A;  2ZRS A;  4NDC A;  2F2O A;  2SCP A;  1U5I A;  2BBM A;  1CFF A;  1XK4 A;  1N0Y A;  4NQG A;  4CID A;  1UHI A;  1WDC C;  2HET A;  2K61 A;  2HF5 A;  1SYM A;  1PRW A;  2FCE A;  1EXR A;  1UP5 A;  2LLT A;  2M1K B;  1CDN A;  4DIR A;  2M1U A;  3WHU B;  2L4I A;  4DCK A;  1K9U A;  3EVU A;  1NUB A;  1L7Z A;  5I2O A;  1WDC B;  2CBL A;  1HQV A;  1NX0 A;  4MVF A;  1KWO B;  3PSR A;  1N65 A;  1SCM B;  1TNW A;  2P6B B;  1CM1 A;  2KNE A;  1SNL A;  1MR8 A;  4M2Q A;  5IBW A;  5KTY A;  3JTD B;  2OTG C;  2LNK A;  3LL8 B;  3EK8 A;  4OCI A;  2CTN A;  1BMO A;  1MXL C;  5G08 A;  1MXE A;  1CKK A;  2QAC A;  3TS5 B;  1K2H A;  1BLQ A;  4YI8 A;  1OOJ A;  2LVJ A;  2Q91 A;  4MN0 A;  1BR4 B;  3SG5 A;  4AQJ A;  5BPJ A;  1MHO A;  3BUX B;  5CSN A;  1B8L A;  1ZOT B;  1TTX A;  1M46 A;  1YR5 A;  2FJU B;  1S5G Z;  1B8R A;  1SW8 A;  1RFJ A;  2MRD A;  1LA3 A;  2L98 A;  3I5G C;  1JFJ A;  1K95 A;  2COL B;  4GGN A;  2JTZ A;  4CFQ A;  1FBV A;  1A75 A;  2EC6 C;  1WRL A;  2WCE A;  5AER A;  2F33 A;  2KBM A;  3I5G B;  3LK0 A;  5J3X A;  2OPO A;  2Y1M A;  4JQ0 D;  1TN4 A;  1FF1 A;  3ICB A;  1QLS A;  4C0J A;  3MSE B;  4YGB B;  2MBX A;  1B9A A;  2G9B A;  1ODB A;  1CMG A;  1Q80 A;  1SY9 A;  1QIV A;  1ZUZ A;  1Y1X A;  2H61 A;  3KEV A;  1FI5 A;  2L51 A;  2FCD A;  1RTP 1;  2WCB A;  3KF9 A;  3BUW B;  3FWC A;  1ZAC A;  1SL7 A;  1D1O A;  1E8A A;  2WC8 A;  1QAT A;  5KSZ A;  2LVI A;  1UWO A;  5F6T A;  1CFP A;  2KQ6 A;  2BE6 A;  2LC5 A;  1LIN A;  5B8I B;  1YVL A;  2TN4 A;  2NXQ A;  1CLB A;  2AAO A;  5AFP A;  1RWY A;  1TNP A;  1IWQ A;  1DJI A;  1PVA A;  2JUL A;  2K0J A;  3CR2 A;  4OV2 A;  2PRU A;  3SIB A;  4XJK A;  1WRZ A;  2NCP A;  2Y4Q A;  1CMF A;  3TDI A;  1V1G A;  1J7R A;  1KFU L;  4R1E A;  4HSZ A;  3PFV A;  1TCO B;  3DVM A;  4BY4 A;  5I2Q A;  3OB2 B;  4C0L A;  3DVJ A;  2MLE C;  2E6W A;  4NDB A;  2KHN A;  5AXI A;  3KO0 A;  1J55 A;  3O4Y A;  1YUU A;  4YI9 A;  1IQ5 A;  1IH0 A;  1DF0 B;  3SG3 A;  1F55 A;  1AJ5 A;  1YVH A;  1JWD A;  4YGE B;  2JTT A;  5AEQ A;  5DKR A;  3RLZ A;  1OQP A;  2FOT A;  4FQO A;  2LM5 A;  2G2B A;  4GUK A;  2F2P A;  2NLN A;  3GK1 A;  1AP4 A;  1XYD A;  2OS8 B;  5FYX A;  4OVN F;  3VGO A;  1DGU A;  3LK1 A;  3DVE A;  2L4H A;  2M0R A;  3PAT A;  2LMV A;  1F8H A;  2PAS A;  4PE1 A;  2MLF C;  1XFU O;  2LV7 A;  1SMG A;  4GGF A;  4HRH A;  1DJZ A;  1B4C A;  3CR4 X;  1J1E A;  2JNF A;  3KPX A;  5PAL A;  3F45 A;  3VRP A;  1NYA A;  5ER5 A;  1YRU B;  1DGV A;  1B1G A;  3NSL A;  3EVV A;  2AMI A;  2AUC A;  1F4O A;  4QJ5 B;  3KHE A;  5HLV A;  2LVK A;  3ZNI A;  1J7Q A;  1XO5 A;  2GV5 A;  1PSR A;  2ZN8 A;  1CDL A;  1KWO C;  3SJS A;  1KQM B;  1ALW A;  2A4J A;  2HQW A;  2KGB C;  1SCM C;  4ORB B;  3SG7 A;  1IKU A;  1LA0 A;  3BXK A;  5I8N A;  1RJV A;  3JTD C;  1AHR A;  1A29 A;  1WLZ A;  2K7D A;  5HKW A;  1JFK A;  1S6C A;  5HLO A;  4YBH B;  3IQQ A;  1OMD A;  2M49 B;  1KFX L;  2M29 A;  1K94 A;  2EGD A;  3CZT X;  4QJ3 B;  3TS5 C;  3VRO A;  5CSJ A;  2KBI A;  1F54 A;  1AUI B;  1IJ5 A;  1QV1 A;  1CNP A;  1SPY A;  4I5N B;  1QVI Z;  2CNP A;  1IGV A;  2NCO A;  2R2I A;  3BQ3 A;  3IQO A;  3QRX A;  1S6J A;  5DKN A;  2ZRT A;  4FTG A;  4F0Z B;  2KI6 C;  2M97 A;  2L2E A;  3I5F C;  1XFW O;  2IS9 A;  3FS7 A;  1NIW A;  2L0P A;  2NZ0 A;  1JF2 A;  2KYF A;  3HCM A;  1BT6 A;  2LLU A;  1GQM A;  4OKH A;  1QLK A;  1B47 A;  3I5F B;  1CLL A;  1PUL A;  1WY9 A;  2I7A A;  3PLF B;  4YGD B;  1C07 A;  4GBA A;  2WOS A;  1G8I A;  2ZN9 A;  1AVS A;  3E3R A;  4NDD A;  2K7C A;  2BE4 A;  1H4B A;  1S1E A;  3I5H C;  1PK0 D;  2LAP A;  1GJY A;  1UHK A;  1DJY A;  3VRR A;  1M31 A;  1REC A;  4GPL B;  2JPT A;  2M3W A;  1NP8 A;  4WQ3 A;  3NSK A;  5DKQ A;  4USL A;  3CLN A;  1IG5 A;  3I5H B;  2M8U A;  1KK7 Z;  2KSP A;  1VRK A;  1MUX A;  3D10 A;  1J7O A;  1FPW A;  1KK8 B;  1DJX A;  2WCF A;  1J1D A;  3DF0 A;  4YGC B;  1CLM A;  2WOR A;  1K96 A;  1UHN A;  3AAJ A;  4MZK A;  4WQ2 A;  3SG2 A;  1LKJ A;  2PMY A;  3ZWH A;  1CFC A;  2KI4 B;  1CDP A;  2LE9 B;  2LP3 A;  1QXP A;  1J7P A;  4ORC B;  1QX5 B;  1K9P A;  5HKY A;  1DJH A;  1A03 A;  3OX5 A;  1TNX A;  2M7N A;  1UHH A;  3H4S E;  1B7T Z;  2BL0 B;  4GNK B;  1TNQ A;  2ISD A;  1F4Q A;  3BOW A;  1NSH A;  1C7V A;  2BBN A; 
#chains in the Genus database with same CATH topology
 1G4Y R;  1S26 D;  2KFG A;  3BFA A;  2ZNE A;  1XVJ A;  3D0Y B;  1SBJ A;  2LP2 A;  4A4B A;  1OMV A;  1YUT A;  2PVB A;  3NGV A;  5D69 A;  2I2R E;  1M39 A;  1NX3 A;  3B7A A;  3OX6 A;  2H2K A;  1IJ6 A;  2BCB A;  4HRE E;  3R1O A;  1X02 A;  1YUR A;  4PHM A;  4PT1 A;  1EJ3 A;  2LHI A;  3IF7 A;  3PN7 B;  2M9G A;  1XFX O;  4JWQ A;  2L2C A;  1Y1U A;  2WCM A;  1ZMZ A;  3WHT B;  1DF0 A;  1TUZ A;  1XFV O;  3B6X A;  3LCP C;  4A4C A;  4MSP A;  3FE9 A;  4U8D A;  5CPV A;  3WNX B;  3UNW A;  3D73 A;  1T14 A;  3AKA A;  4GFT A;  4ETO A;  3TDU A;  3A8R A;  3O78 A;  1JUO A;  4L9M A;  1QX2 A;  1S5G Y;  2KQY A;  4I5J A;  5EL2 A;  1UUS A;  4QJ4 B;  4P2Y B;  2FJY A;  3LLE A;  2KAY A;  2L5X B;  1YRT B;  2GTE A;  2QEV A;  2OS8 C;  1PSB A;  4I5L B;  1ALV A;  1EL4 A;  1KK7 Y;  2GGM A;  3D77 A;  1P28 A;  1BR1 B;  3K21 A;  1W7I B;  3EK4 A;  4PHK A;  3TUY B;  1SCV A;  3B88 A;  1SRA A;  1K93 D;  3BYA A;  3O4X A;  2ZND A;  5CSF A;  5DIC A;  3EKH A;  2B1U A;  1WRK A;  4ZCU A;  4XJK B;  2F3Y A;  2DOQ A;  2CCM A;  1V1F A;  3EG5 B;  1EG3 A;  2KI6 D;  3FWB A;  1OE9 B;  1YTZ C;  2HPS A;  1MF8 B;  2JWW A;  5AAN A;  4BY5 A;  3B86 A;  3CS1 A;  2JC2 A;  3NXA A;  1KQM C;  2GGZ A;  2I94 A;  4GAO A;  3JVT B;  1MWN A;  1LVC D;  1B7T Y;  2H8V A;  2LHL A;  4UPG A;  2Y5I A;  4JPZ B;  1AK8 A;  1A2X A;  1SR6 C;  1YUS A;  3FIA A;  3CR5 X;  3BUO B;  1UUR A;  1B8C A;  4P5O E;  1IRJ A;  1UHJ A;  5GQQ C;  2D8N A;  1PAL A;  1OMR A;  2PSR A;  1SR6 B;  3DD4 A;  4JKT A;  3TZ1 A;  1DC1 A;  5D7F A;  4N5X A;  1N2D A;  1FI6 A;  2ZKM X;  2SAS A;  2BKH B;  4OR9 B;  4PHJ A;  1K8U A;  1CB1 A;  3NSO A;  1K90 D;  2LMU A;  4XYN A;  2BCA A;  2K7B A;  4Q04 A;  2JU0 A;  2PQL A;  1S3P A;  4ICB A;  1C3Y A;  4MRX A;  1QS7 A;  3BUM B;  1QJT A;  1QX7 A;  1NPQ A;  1DTL A;  1XK4 C;  2L50 A;  2LAN A;  3IVT A;  3K1E A;  1JBA A;  3V2L A;  3O6B A;  1U5I B;  2HQ8 A;  3PM2 A;  3CZ1 A;  2O60 A;  1XFR A;  2EHB A;  1QTX A;  1NWD A;  2RGI A;  1H8B A;  1CDM A;  3A4U B;  3D76 A;  3HX4 A;  3N7H A;  4MZL A;  3GK4 X;  1K9K A;  2LUX A;  3VRN A;  4WRI A;  4DUQ A;  2MAZ A;  3S0D A;  1PVB A;  1S6I A;  1TCF A;  1EH2 A;  3B87 A;  3AAK A;  2CXJ A;  4E68 A;  2K2A A;  3EKJ A;  1TUJ A;  1KK8 C;  2PYQ A;  1DMO A;  1SK6 D;  1GGZ A;  1M45 A;  2KAX A;  4I5K A;  2MHH A;  5HKZ A;  1SL9 A;  1R6P A;  4DS7 A;  1QAS A;  2OTG B;  3CWG A;  3OBV A;  1A4P A;  4JD9 A;  4TNC A;  1OW4 A;  5FI7 A;  2KI4 C;  4PE7 A;  1Y1A A;  1BJF A;  4HRG A;  1DT7 B;  4MLW A;  2K2F A;  2WND A;  1RK9 A;  1TIZ A;  2JOJ A;  4AOM A;  3SS5 A;  4PHN A;  1IQ3 A;  4CPV A;  1C7W A;  1EG4 A;  3OB1 B;  2JXC A;  2JT3 A;  2Y1N A;  2BL0 C;  2KYC A;  1AJ4 A;  2WCL A;  3VB1 A;  1OZS A;  2JXL A;  1SL8 A;  4INX A;  2F8P A;  4D1E A;  2Q4U A;  1JF0 A;  2KAV A;  2F3Z A;  1R2U A;  2BAP A;  2JRF A;  3D0Y A;  4PCW A;  2VRG A;  2P70 A;  3BFH A;  3SIA A;  1FW4 A;  4MBE A;  1NX1 A;  3O2P A;  1MQ1 A;  4ZCV A;  4M2O A;  5JOL A;  1BOD A;  1F71 A;  1W7J B;  5FI2 A;  1DJG A;  2BCX A;  4IL1 A;  1KSO A;  1HT9 A;  2LUC A;  3L4A A;  3M0W A;  3D75 A;  3I5I C;  1QVI Y;  4YGA A;  1KFU S;  2JNX A;  1NX2 A;  2QPT A;  2JPO A;  3PN7 C;  1TOP A;  4PE4 A;  3WXA A;  2EC6 B;  2ZFD A;  5ER4 X;  2ERB A;  2K8M B;  1A75 B;  3PM8 A;  4MZJ A;  1TRF A;  1JC2 A;  2V53 A;  3DF0 B;  3I5I B;  1BU3 A;  1NCY A;  5K89 A;  4N1F A;  2H61 C;  2E30 A;  1OOH A;  3C1V A;  1CM4 A;  2WCJ A;  4PE0 A;  3CGA A;  2M7L A;  1NCX A;  1CFD A;  2JZI A;  3SG6 A;  1L2O C;  2PAL A;  4MRY A;  5HYD A;  4CFR A;  1YX8 A;  2LVV A;  4IJ7 A;  5CSI A;  1OOF A;  3DVK A;  2WC6 A;  1S36 A;  4KYN A;  4DRW A;  3PAL A;  4N1G A;  1M63 B;  1BF5 A;  2LLS A;  1Z2C B;  4PAL A;  1L2O B;  3BOW B;  3D78 A;  1ZFS A;  3TUY C;  2KPH A;  5JJG A;  1KQV A;  2LMT A;  2CT9 A;  1RRO A;  3TDZ A;  1DJW A;  4YRU A;  1QV0 A;  1OZO A;  2JQ6 A;  4C0K A;  1BG1 A;  3R1V A;  1Y0V H;  2LCP A;  3NSI A;  3VRQ A;  1BOC A;  1YX7 A;  2JT0 A;  3GK2 A;  2KFH A;  1Y6W A;  1LXF C;  3JVT C;  1GGW A;  3EK7 A;  1KSM A;  3QME A;  1XFY O;  4MEW A;  1CTR A;  5KU1 A;  3CTN A;  1F70 A;  3BUN B;  5I2L A;  2MJW B;  2KFF A;  2KOT A;  3AKB A;  1QIW A;  1OSA A;  4AQI A;  1WLM A;  2KGR A;  2MA2 A;  3CYZ A;  2BKI B;  2O5G A;  3OGN A;  3SS3 A;  3OP0 A;  4CLN A;  1KFX S;  2KDH A;  4PDZ A;  1JSA A;  2K60 A;  5TNC A;  2JT8 A;  1G33 A;  1SKT A;  4ORA B;  3SG4 A;  1XA5 A;  3GOF A;  2I18 A;  2BEC A;  4M2P A;  1DVI A;  3EVR A;  4GGF C;  3RM1 A;  1NCZ A;  3OHM B;  1DQE A;  1KCY A;  1XFZ O;  2K7O A;  2ZRS A;  4NDC A;  2F2O A;  2SCP A;  1U5I A;  2BBM A;  3S0A A;  1CFF A;  1XK4 A;  1N0Y A;  4NQG A;  4CID A;  1UHI A;  1WDC C;  2HET A;  2K61 A;  2HF5 A;  1SYM A;  1PRW A;  2FCE A;  1EXR A;  1UP5 A;  2LLT A;  2M1K B;  3FE6 A;  1CDN A;  4DIR A;  2M1U A;  3WHU B;  2L4I A;  4DCK A;  1K9U A;  3EVU A;  1NUB A;  1L7Z A;  1GM0 A;  5I2O A;  1WDC B;  2CBL A;  2KLD A;  1HQV A;  1NX0 A;  4MVF A;  3S0F A;  1KWO B;  3PSR A;  1N65 A;  1SCM B;  1TNW A;  2P6B B;  1ORG A;  1CM1 A;  2KNE A;  1SNL A;  1MR8 A;  4M2Q A;  5D3O A;  5IBW A;  5KTY A;  3JTD B;  3DXL A;  2OTG C;  2LNK A;  3LL8 B;  3EK8 A;  5FI6 A;  1SSE B;  4OCI A;  2CTN A;  1BMO A;  1MXL C;  5G08 A;  1MXE A;  1CKK A;  2QAC A;  3TS5 B;  1K2H A;  1BLQ A;  4YI8 A;  1OOJ A;  2LVJ A;  2Q91 A;  2QEB A;  4MN0 A;  1BR4 B;  3SG5 A;  4AQJ A;  5BPJ A;  1MHO A;  2KLE A;  3BUX B;  5CSN A;  1B8L A;  1ZOT B;  1TTX A;  1M46 A;  4INW A;  3BJH A;  3CDN A;  1YR5 A;  2FJU B;  2WCK A;  1S5G Z;  1B8R A;  1SW8 A;  3S0E A;  1RFJ A;  2MRD A;  1LA3 A;  2L98 A;  3I5G C;  1IIO A;  1JFJ A;  1K95 A;  2COL B;  4GGN A;  2JTZ A;  4CFQ A;  1FBV A;  1A75 A;  2EC6 C;  1WRL A;  2WCE A;  5AER A;  2F33 A;  2KBM A;  3I5G B;  3LK0 A;  5J3X A;  1LS8 A;  2OPO A;  2Y1M A;  4JQ0 D;  1TN4 A;  1FF1 A;  3ICB A;  1QLS A;  4C0J A;  3MSE B;  4YGB B;  2MBX A;  1B9A A;  2G9B A;  1ODB A;  2QDI A;  1CMG A;  1Q80 A;  1SY9 A;  1QIV A;  1ZUZ A;  1Y1X A;  2H61 A;  3CZ2 A;  3KEV A;  1FI5 A;  2L51 A;  2FCD A;  1RTP 1;  2WCB A;  3KF9 A;  3BUW B;  3FWC A;  1ZAC A;  1SL7 A;  1D1O A;  1E8A A;  2WC8 A;  1QAT A;  5KSZ A;  2LVI A;  1UWO A;  5F6T A;  2P71 A;  1CFP A;  2KQ6 A;  2BE6 A;  2LC5 A;  1LIN A;  5B8I B;  1YVL A;  2TN4 A;  2NXQ A;  4OZD A;  2AAO A;  1CLB A;  5AFP A;  1RWY A;  1TNP A;  1IWQ A;  1DJI A;  1PVA A;  2JUL A;  2K0J A;  3CR2 A;  4OV2 A;  2PRU A;  3SIB A;  4XJK A;  1WRZ A;  2NCP A;  2Y4Q A;  1CMF A;  3TDI A;  1V1G A;  2WCH A;  1J7R A;  1KFU L;  4R1E A;  4HSZ A;  3PFV A;  1TCO B;  3DVM A;  4BY4 A;  5I2Q A;  3OB2 B;  4C0L A;  3DVJ A;  2MLE C;  2E6W A;  4NDB A;  3R1P A;  3R72 A;  2KHN A;  1OOI X;  5AXI A;  4F7F A;  3KO0 A;  1J55 A;  3O4Y A;  1YUU A;  4YI9 A;  1IQ5 A;  1IH0 A;  1DF0 B;  3Q8I A;  3SG3 A;  1F55 A;  1AJ5 A;  1YVH A;  1JWD A;  4YGE B;  2JTT A;  5AEQ A;  5DKR A;  3RLZ A;  1OQP A;  2FOT A;  4FQO A;  2LM5 A;  2G2B A;  4GUK A;  2F2P A;  2NLN A;  3GK1 A;  1AP4 A;  1XYD A;  2OS8 B;  5FYX A;  4OVN F;  3VGO A;  1DGU A;  3LK1 A;  3NHI A;  5I94 A;  3DVE A;  2L4H A;  2M0R A;  3PAT A;  2LMV A;  1F8H A;  2PAS A;  4PE1 A;  2MLF C;  1XFU O;  2LV7 A;  1SMG A;  4GGF A;  4HRH A;  1DJZ A;  1B4C A;  3CR4 X;  1J1E A;  2JNF A;  3KPX A;  5PAL A;  3F45 A;  3VRP A;  1NYA A;  5ER5 A;  1YRU B;  1DGV A;  1B1G A;  3NSL A;  3EVV A;  1W9Z A;  2AMI A;  3S0G A;  2YGU A;  2AUC A;  1F4O A;  4QJ5 B;  3FE8 A;  3KHE A;  5HLV A;  1F54 A;  2LVK A;  3ZNI A;  1J7Q A;  1DEL A;  1XO5 A;  2GV5 A;  1PSR A;  3NHT A;  2ZN8 A;  1CDL A;  1KWO C;  3SJS A;  1KQM B;  1ALW A;  2A4J A;  2HQW A;  2KGB C;  1DEK A;  1SCM C;  4ORB B;  3UO9 A;  3SG7 A;  3L4L A;  1IKU A;  1LA0 A;  3BXK A;  5I8N A;  1RJV A;  3JTD C;  1AHR A;  1A29 A;  3CAB A;  1WLZ A;  2K7D A;  4FQT A;  5HKW A;  1JFK A;  1S6C A;  5HLO A;  4YBH B;  3IQQ A;  2BNX A;  1OMD A;  2M49 B;  1KFX L;  2M29 A;  1K94 A;  2EGD A;  3CZT X;  1C3Z A;  4QJ3 B;  3TS5 C;  5CSJ A;  2KBI A;  3VRO A;  1AUI B;  1IJ5 A;  1QV1 A;  1CNP A;  1SPY A;  4I5N B;  1QVI Z;  2CNP A;  1IGV A;  2NCO A;  2R2I A;  3BQ3 A;  3IQO A;  3PJI A;  3DY9 A;  3QRX A;  5HL1 A;  1S6J A;  5DKN A;  2ZRT A;  4FTG A;  3DZT A;  2KI6 C;  4F0Z B;  2M97 A;  2L2E A;  3I5F C;  1XFW O;  2IS9 A;  3FS7 A;  1NIW A;  2L0P A;  2NZ0 A;  1JF2 A;  2KYF A;  3HCM A;  1BT6 A;  2LLU A;  1GQM A;  3S0B A;  4OKH A;  1QLK A;  1Z4H A;  1B47 A;  3I5F B;  1CLL A;  1PUL A;  1WY9 A;  2I7A A;  3PLF B;  4YGD B;  1C07 A;  4GBA A;  2QEH A;  2WOS A;  1G8I A;  2ZN9 A;  1AVS A;  3E3R A;  4NDD A;  2K7C A;  2BE4 A;  1H4B A;  1S1E A;  3I5H C;  2WC5 A;  1PK0 D;  2LAP A;  1GJY A;  1UHK A;  1DJY A;  3BFB A;  3VRR A;  1M31 A;  1REC A;  4GPL B;  1QWV A;  2JPT A;  2M3W A;  1NP8 A;  2QEO A;  3CZ0 A;  4WQ3 A;  3NSK A;  5DKQ A;  4USL A;  3CLN A;  1IG5 A;  3I5H B;  2M8U A;  1KK7 Z;  2KSP A;  1VRK A;  1MUX A;  3D10 A;  1J7O A;  1FPW A;  3D74 A;  1KK8 B;  1DJX A;  2WCF A;  1J1D A;  3DF0 A;  4YGC B;  3SS4 A;  1CLM A;  2WOR A;  1K96 A;  1UHN A;  3DYE A;  3AAJ A;  4MZK A;  3RZS A;  4WQ2 A;  3SG2 A;  1LKJ A;  2PMY A;  3ZWH A;  1CFC A;  2KI4 B;  1CDP A;  1TWO A;  2LE9 B;  2LP3 A;  1QXP A;  1J7P A;  4ORC B;  2L5Y A;  1QX5 B;  1K9P A;  1OOG A;  1DJH A;  5HKY A;  1A03 A;  3OX5 A;  1TNX A;  2M7N A;  1UHH A;  3H4S E;  1B7T Z;  2BL0 B;  4GNK B;  1TNQ A;  2ISD A;  1F4Q A;  3L47 A;  3BOW A;  1NSH A;  1C7V A;  2BBN A; 
#chains in the Genus database with same CATH homology
 1G4Y R;  1S26 D;  2KFG A;  2ZNE A;  1XVJ A;  3D0Y B;  1SBJ A;  2LP2 A;  4A4B A;  1OMV A;  1YUT A;  2PVB A;  5D69 A;  2I2R E;  1M39 A;  1NX3 A;  3OX6 A;  2H2K A;  1IJ6 A;  2BCB A;  4HRE E;  1X02 A;  1YUR A;  4PHM A;  1EJ3 A;  2LHI A;  3IF7 A;  3PN7 B;  2M9G A;  1XFX O;  4JWQ A;  1Y1U A;  1ZMZ A;  3WHT B;  1DF0 A;  1XFV O;  3LCP C;  4A4C A;  4MSP A;  4U8D A;  3WNX B;  5CPV A;  3AKA A;  4GFT A;  4ETO A;  3TDU A;  3A8R A;  3O78 A;  1JUO A;  4L9M A;  1QX2 A;  1S5G Y;  2KQY A;  4I5J A;  1UUS A;  4QJ4 B;  4P2Y B;  3LLE A;  2KAY A;  2L5X B;  1YRT B;  2OS8 C;  1PSB A;  4I5L B;  1ALV A;  1EL4 A;  1KK7 Y;  2GGM A;  1BR1 B;  3K21 A;  1W7I B;  3EK4 A;  4PHK A;  3TUY B;  1SCV A;  1SRA A;  1K93 D;  3BYA A;  2ZND A;  5CSF A;  3EKH A;  2B1U A;  1WRK A;  4ZCU A;  4XJK B;  2F3Y A;  2DOQ A;  2CCM A;  1V1F A;  1EG3 A;  2KI6 D;  3FWB A;  1OE9 B;  1YTZ C;  2HPS A;  1MF8 B;  2JWW A;  5AAN A;  4BY5 A;  3CS1 A;  2JC2 A;  3NXA A;  1KQM C;  2GGZ A;  2I94 A;  4GAO A;  3JVT B;  1MWN A;  1LVC D;  1B7T Y;  4UPG A;  2LHL A;  2Y5I A;  4JPZ B;  1AK8 A;  1A2X A;  1SR6 C;  1YUS A;  3FIA A;  3CR5 X;  3BUO B;  1UUR A;  1B8C A;  4P5O E;  1IRJ A;  1UHJ A;  5GQQ C;  2D8N A;  1PAL A;  1OMR A;  2PSR A;  1SR6 B;  3DD4 A;  3TZ1 A;  5D7F A;  4N5X A;  1N2D A;  1FI6 A;  2ZKM X;  2SAS A;  2BKH B;  4OR9 B;  4PHJ A;  1K8U A;  1CB1 A;  3NSO A;  1K90 D;  2LMU A;  4XYN A;  2BCA A;  2K7B A;  4Q04 A;  2JU0 A;  4ICB A;  1S3P A;  4MRX A;  1QS7 A;  3BUM B;  1QJT A;  1QX7 A;  1NPQ A;  1DTL A;  1XK4 C;  2L50 A;  2LAN A;  1JBA A;  3O6B A;  1U5I B;  2HQ8 A;  2O60 A;  2EHB A;  1QTX A;  1NWD A;  2RGI A;  1H8B A;  1CDM A;  3A4U B;  3HX4 A;  4MZL A;  3GK4 X;  1K9K A;  2LUX A;  3VRN A;  4WRI A;  4DUQ A;  2MAZ A;  1PVB A;  1S6I A;  1TCF A;  1EH2 A;  3AAK A;  2CXJ A;  4E68 A;  2K2A A;  3EKJ A;  1KK8 C;  1DMO A;  1SK6 D;  1GGZ A;  1M45 A;  2KAX A;  4I5K A;  2MHH A;  5HKZ A;  1SL9 A;  1R6P A;  4DS7 A;  1QAS A;  2OTG B;  3CWG A;  1A4P A;  4TNC A;  2KI4 C;  4PE7 A;  1Y1A A;  1BJF A;  4HRG A;  1DT7 B;  4MLW A;  2K2F A;  2WND A;  1RK9 A;  1TIZ A;  2JOJ A;  4AOM A;  4PHN A;  1IQ3 A;  4CPV A;  1C7W A;  1EG4 A;  3OB1 B;  2JXC A;  2JT3 A;  2Y1N A;  2BL0 C;  2KYC A;  1AJ4 A;  1OZS A;  2JXL A;  1SL8 A;  2F8P A;  4D1E A;  2Q4U A;  1JF0 A;  2KAV A;  2F3Z A;  1R2U A;  2JRF A;  3D0Y A;  4PCW A;  2VRG A;  3SIA A;  1FW4 A;  4MBE A;  1NX1 A;  3O2P A;  1MQ1 A;  4ZCV A;  4M2O A;  5JOL A;  1BOD A;  1F71 A;  1W7J B;  1DJG A;  2BCX A;  4IL1 A;  1KSO A;  1HT9 A;  2LUC A;  3M0W A;  3I5I C;  1QVI Y;  4YGA A;  1KFU S;  2JNX A;  1NX2 A;  2QPT A;  4PE4 A;  3PN7 C;  1TOP A;  3WXA A;  2EC6 B;  2ZFD A;  5ER4 X;  2K8M B;  3PM8 A;  1A75 B;  4MZJ A;  1TRF A;  1JC2 A;  2V53 A;  3DF0 B;  3I5I B;  1BU3 A;  1NCY A;  5K89 A;  4N1F A;  2H61 C;  2E30 A;  3C1V A;  1CM4 A;  4PE0 A;  3CGA A;  2M7L A;  1NCX A;  1CFD A;  2JZI A;  3SG6 A;  1L2O C;  2PAL A;  4MRY A;  5HYD A;  4CFR A;  1YX8 A;  2LVV A;  5CSI A;  3DVK A;  4DRW A;  1S36 A;  3PAL A;  4N1G A;  1M63 B;  1BF5 A;  2LLS A;  4PAL A;  1L2O B;  3BOW B;  1ZFS A;  3TUY C;  5JJG A;  1KQV A;  2LMT A;  2CT9 A;  1RRO A;  3TDZ A;  1DJW A;  4YRU A;  1QV0 A;  1OZO A;  2JQ6 A;  4C0K A;  1BG1 A;  1Y0V H;  2LCP A;  3NSI A;  3VRQ A;  1BOC A;  1YX7 A;  2JT0 A;  3GK2 A;  2KFH A;  1Y6W A;  1LXF C;  3JVT C;  1GGW A;  3EK7 A;  1KSM A;  1XFY O;  4MEW A;  1CTR A;  5KU1 A;  3CTN A;  1F70 A;  3BUN B;  5I2L A;  2MJW B;  2KFF A;  2KOT A;  3AKB A;  1QIW A;  1OSA A;  4AQI A;  1WLM A;  2KGR A;  2MA2 A;  2BKI B;  2O5G A;  3OP0 A;  4CLN A;  1KFX S;  2KDH A;  4PDZ A;  1JSA A;  5TNC A;  2JT8 A;  1G33 A;  1SKT A;  4ORA B;  3SG4 A;  1XA5 A;  3GOF A;  2I18 A;  2BEC A;  4M2P A;  1DVI A;  3EVR A;  4GGF C;  3RM1 A;  1NCZ A;  3OHM B;  1KCY A;  1XFZ O;  2K7O A;  2ZRS A;  4NDC A;  2F2O A;  2SCP A;  1U5I A;  2BBM A;  1CFF A;  1XK4 A;  1N0Y A;  4NQG A;  4CID A;  1UHI A;  1WDC C;  2HET A;  2K61 A;  2HF5 A;  1SYM A;  1PRW A;  2FCE A;  1EXR A;  1UP5 A;  2LLT A;  2M1K B;  1CDN A;  4DIR A;  2M1U A;  3WHU B;  2L4I A;  4DCK A;  1K9U A;  3EVU A;  1NUB A;  1L7Z A;  5I2O A;  1WDC B;  2CBL A;  1HQV A;  1NX0 A;  4MVF A;  1KWO B;  3PSR A;  1N65 A;  1SCM B;  1TNW A;  2P6B B;  1CM1 A;  2KNE A;  1SNL A;  1MR8 A;  4M2Q A;  5IBW A;  5KTY A;  3JTD B;  2OTG C;  2LNK A;  3LL8 B;  3EK8 A;  4OCI A;  2CTN A;  1BMO A;  1MXL C;  5G08 A;  1MXE A;  1CKK A;  2QAC A;  3TS5 B;  1K2H A;  1BLQ A;  4YI8 A;  1OOJ A;  2LVJ A;  2Q91 A;  4MN0 A;  1BR4 B;  3SG5 A;  4AQJ A;  5BPJ A;  1MHO A;  3BUX B;  5CSN A;  1B8L A;  1ZOT B;  1TTX A;  1M46 A;  1YR5 A;  2FJU B;  1S5G Z;  1B8R A;  1SW8 A;  1RFJ A;  2MRD A;  1LA3 A;  2L98 A;  3I5G C;  1JFJ A;  1K95 A;  2COL B;  4GGN A;  2JTZ A;  4CFQ A;  1FBV A;  1A75 A;  2EC6 C;  1WRL A;  2WCE A;  5AER A;  2F33 A;  2KBM A;  3I5G B;  3LK0 A;  5J3X A;  2OPO A;  2Y1M A;  4JQ0 D;  1TN4 A;  1FF1 A;  3ICB A;  1QLS A;  4C0J A;  3MSE B;  4YGB B;  2MBX A;  1B9A A;  2G9B A;  1ODB A;  1CMG A;  1Q80 A;  1SY9 A;  1QIV A;  1ZUZ A;  1Y1X A;  2H61 A;  3KEV A;  1FI5 A;  2L51 A;  2FCD A;  1RTP 1;  2WCB A;  3KF9 A;  3BUW B;  3FWC A;  1ZAC A;  1SL7 A;  1D1O A;  1E8A A;  2WC8 A;  1QAT A;  5KSZ A;  2LVI A;  1UWO A;  5F6T A;  1CFP A;  2KQ6 A;  2BE6 A;  2LC5 A;  1LIN A;  5B8I B;  1YVL A;  2TN4 A;  2NXQ A;  1CLB A;  2AAO A;  5AFP A;  1RWY A;  1TNP A;  1IWQ A;  1DJI A;  1PVA A;  2JUL A;  2K0J A;  3CR2 A;  4OV2 A;  2PRU A;  3SIB A;  4XJK A;  1WRZ A;  2NCP A;  2Y4Q A;  1CMF A;  3TDI A;  1V1G A;  1J7R A;  1KFU L;  4R1E A;  4HSZ A;  3PFV A;  1TCO B;  3DVM A;  4BY4 A;  5I2Q A;  3OB2 B;  4C0L A;  3DVJ A;  2MLE C;  2E6W A;  4NDB A;  2KHN A;  5AXI A;  3KO0 A;  1J55 A;  3O4Y A;  1YUU A;  4YI9 A;  1IQ5 A;  1IH0 A;  1DF0 B;  3SG3 A;  1F55 A;  1AJ5 A;  1YVH A;  1JWD A;  4YGE B;  2JTT A;  5AEQ A;  5DKR A;  3RLZ A;  1OQP A;  2FOT A;  4FQO A;  2LM5 A;  2G2B A;  4GUK A;  2F2P A;  2NLN A;  3GK1 A;  1AP4 A;  1XYD A;  2OS8 B;  5FYX A;  4OVN F;  3VGO A;  1DGU A;  3LK1 A;  3DVE A;  2L4H A;  2M0R A;  3PAT A;  2LMV A;  1F8H A;  2PAS A;  4PE1 A;  2MLF C;  1XFU O;  2LV7 A;  1SMG A;  4GGF A;  4HRH A;  1DJZ A;  1B4C A;  3CR4 X;  1J1E A;  2JNF A;  3KPX A;  5PAL A;  3F45 A;  3VRP A;  1NYA A;  5ER5 A;  1YRU B;  1DGV A;  1B1G A;  3NSL A;  3EVV A;  2AMI A;  2AUC A;  1F4O A;  4QJ5 B;  3KHE A;  5HLV A;  2LVK A;  3ZNI A;  1J7Q A;  1XO5 A;  2GV5 A;  1PSR A;  2ZN8 A;  1CDL A;  1KWO C;  3SJS A;  1KQM B;  1ALW A;  2A4J A;  2HQW A;  2KGB C;  1SCM C;  4ORB B;  3SG7 A;  1IKU A;  1LA0 A;  3BXK A;  5I8N A;  1RJV A;  3JTD C;  1AHR A;  1A29 A;  1WLZ A;  2K7D A;  5HKW A;  1JFK A;  1S6C A;  5HLO A;  4YBH B;  3IQQ A;  1OMD A;  2M49 B;  1KFX L;  2M29 A;  1K94 A;  2EGD A;  3CZT X;  4QJ3 B;  3TS5 C;  3VRO A;  5CSJ A;  2KBI A;  1F54 A;  1AUI B;  1IJ5 A;  1QV1 A;  1CNP A;  1SPY A;  4I5N B;  1QVI Z;  2CNP A;  1IGV A;  2NCO A;  2R2I A;  3BQ3 A;  3IQO A;  3QRX A;  1S6J A;  5DKN A;  2ZRT A;  4FTG A;  4F0Z B;  2KI6 C;  2M97 A;  2L2E A;  3I5F C;  1XFW O;  2IS9 A;  3FS7 A;  1NIW A;  2L0P A;  2NZ0 A;  1JF2 A;  2KYF A;  3HCM A;  1BT6 A;  2LLU A;  1GQM A;  4OKH A;  1QLK A;  1B47 A;  3I5F B;  1CLL A;  1PUL A;  1WY9 A;  2I7A A;  3PLF B;  4YGD B;  1C07 A;  4GBA A;  2WOS A;  1G8I A;  2ZN9 A;  1AVS A;  3E3R A;  4NDD A;  2K7C A;  2BE4 A;  1H4B A;  1S1E A;  3I5H C;  1PK0 D;  2LAP A;  1GJY A;  1UHK A;  1DJY A;  3VRR A;  1M31 A;  1REC A;  4GPL B;  2JPT A;  2M3W A;  1NP8 A;  4WQ3 A;  3NSK A;  5DKQ A;  4USL A;  3CLN A;  1IG5 A;  3I5H B;  2M8U A;  1KK7 Z;  2KSP A;  1VRK A;  1MUX A;  3D10 A;  1J7O A;  1FPW A;  1KK8 B;  1DJX A;  2WCF A;  1J1D A;  3DF0 A;  4YGC B;  1CLM A;  2WOR A;  1K96 A;  1UHN A;  3AAJ A;  4MZK A;  4WQ2 A;  3SG2 A;  1LKJ A;  2PMY A;  3ZWH A;  1CFC A;  2KI4 B;  1CDP A;  2LE9 B;  2LP3 A;  1QXP A;  1J7P A;  4ORC B;  1QX5 B;  1K9P A;  5HKY A;  1DJH A;  1A03 A;  3OX5 A;  1TNX A;  2M7N A;  1UHH A;  3H4S E;  1B7T Z;  2BL0 B;  4GNK B;  1TNQ A;  2ISD A;  1F4Q A;  3BOW A;  1NSH A;  1C7V A;  2BBN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...