1BU3A

Refined crystal structure of calcium-bound silver hake (pi 4.2) parvalbumin at 1.65 a.
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
108
structure length
108
Chain Sequence
b'AFSGILADADVAAALKACEAADSFNYKAFFAKVGLTAKSADDIKKAFFVIDQDKSGFIEEDELKLFLQVFSAGARALTDAETKAFLKAGDSDGDGAIGVDEWAALVKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALCIUM-BINDING PROTEIN
molecule tags Calcium binding
publication title X-Ray crystal structure and molecular dynamics simulations of silver hake parvalbumin (Isoform B).
pubmed rcsb
total genus 39
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 1998-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1bu3A00
1F8HA 1TIZA 1W7IB 1KWOB 1OMVA 3DVJA 3DVMA 2LP2A 4YGBB 5AANA 4GAOA 4MRXA 4PHKA 2L4HA 1A2XA 3BUNB 1OZOA 1KK8B 1BT6A 1Y1XA 4WRIA 5CSIA 3NSLA 2F2PA 3SG6A 1LVCD 1NPQA 3WXAA 1AJ5A 1H4BA 3LK1A 1FBVA 1KFXS 1NIWA 1LINA 1G4YR 5I2LA 2NCOA 5CSJA 3GK2A 2EGDA 1AJ4A 3TDIA 4CFRA 2H61C 1SL7A 1YURA 1CMGA 1ALWA 1SK6D 2L2EA 2CCMA 2EHBA 5GQQC 3FIAA 3WHTB 4YBHB 1WDCB 2KI6C 1QV1A 1MXEA 2KHNA 1OOJA 2OTGC 2PVBA 2KQ6A 3PATA 4MN0A 1AP4A 3I5HB 4L9MA 5AXIA 1MR8A 1NCXA 1CLBA 4WQ2A 1K2HA 2LHLA 2M29A 5G08A 3FWCA 2OTGB 1C07A 2LV7A 2ZNDA 3PM8A 2O60A 3BQ3A 4GBAA 5BPJA 1B47A 2COLB 1JF2A 1N65A 1XK4A 2LLSA 1XFUO 1UHHA 2HQ8A 3SG5A 4OKHA 1K8UA 2Q4UA 1SY9A 2KI4B 2KFGA 1NYAA 2HQWA 2WC8A 2M3WA 5ER5A 1IG5A 1SCMB 4QJ4B 2FJUB 2MLFC 2B1UA 4PE7A 1DMOA 5JJGA 1NCYA 2JT0A 2KAYA 2VRGA 1XVJA 4MBEA 3HX4A 1SBJA 2LC5A 3ZWHA 5K89A 1KQVA 1XYDA 2F2OA 2K0JA 4OR9B 4PE1A 2GGMA 1FI6A 3AAJA 1NP8A 5ER4X 1Y6WA 4P2YB 1QATA 1BU3A 2BBNA 3FS7A 4JPZB 1AVSA 1CFPA 2JC2A 4JWQA 5I8NA 4FQOA 1CFDA 2M49B 3H4SE 4GPLB 4E68A 1J7RA 2JT8A 3CGAA 3WNXB 2H2KA 1DJHA 3SG4A 1JFJA 2L51A 3EVVA 2TN4A 4PHJA 1KQMC 2JQ6A 4GFTA 4PALA 1AHRA 3DD4A 1YUSA 1LA0A 1L2OC 3I5IC 1A03A 1IWQA 4M2QA 1NX2A 4ZCVA 1KK7Y 1B9AA 1BG1A 4AOMA 2WCEA 2SASA 4XYNA 2D8NA 1XO5A 2BCXA 4AQIA 1BF5A 4M2OA 2ZRSA 4A4CA 1QIWA 1GGWA 2FCEA 1KFUL 2HETA 1XFWO 1TTXA 1ZMZA 1UHIA 2M9GA 3AKBA 4PHMA 1YR5A 4QJ5B 1U5IB 1JFKA 2LVJA 3BUXB 4QJ3B 2PASA 1CNPA 1TOPA 2KSPA 1MF8B 2AUCA 1KSMA 4FTGA 1DJGA 1A4PA 1YX7A 4HREE 1B1GA 2QACA 2FCDA 2M1KB 4PE0A 1TCFA 1YVHA 1W7JB 2KFHA 3SIAA 2CT9A 2LM5A 3D10A 2V53A 3NSKA 5DKRA 3OP0A 1XFYO 1NUBA 1DJZA 1XA5A 3JTDC 1CDLA 1QVIZ 3E3RA 1K96A 1F4OA 1V1GA 2OPOA 3VGOA 5IBWA 5KSZA 1CTRA 3QRXA 4CPVA 3GOFA 2I7AA 2NZ0A 2ZKMX 3RLZA 3CWGA 2LANA 3DF0A 1WLZA 2PRUA 3EK7A 4UPGA 1U5IA 1C7VA 2LMUA 1N2DA 1Y1UA 2WORA 3TUYB 4YI8A 1QS7A 3CZTX 2P6BB 2EC6C 2KOTA 2G2BA 1KFXL 3ZNIA 3OX5A 1QVIY 2ZN9A 2JT3A 1SNLA 3AAKA 1PSRA 2KAXA 1J1EA 2WOSA 1DJWA 1PULA 1YRTB 1YUUA 2LCPA 1A29A 4ORAB 1F4QA 1S3PA 1S5GY 1KK7Z 1WRZA 1KK8C 1ZOTB 3VRRA 1JC2A 1EG4A 3OX6A 2A4JA 2NXQA 2H61A 3CLNA 1BLQA 5HKZA 2JOJA 4MVFA 1X02A 1R6PA 2I2RE 2GV5A 3D0YB 2MBXA 4NDCA 3LLEA 1DJIA 1NX1A 4HRHA 5JOLA 1BOCA 3DVEA 3VRNA 1QXPA 4YRUA 3SIBA 2F33A 2OS8B 3CR2A 2KDHA 1PALA 2ISDA 1SR6B 1IQ3A 1R2UA 1OE9B 3EK8A 4WQ3A 3OB1B 1F71A 2ZRTA 2ZNEA 3HCMA 2F3YA 1BR1B 2KAVA 2L4IA 4NQGA 3NXAA 5J3XA 3I5FC 4PDZA 2Y5IA 2JU0A 2MRDA 3PLFB 2CTNA 2HPSA 2ZFDA 1J7QA 1H8BA 3TDZA 1DF0A 4JQ0D 1QX2A 2HF5A 1MUXA 1VRKA 2BBMA 3TUYC 2Y1MA 2BKIB 1NCZA 2I94A 1XFZO 1A75A 1J7OA 1OQPA 3I5FB 1GGZA 2LMVA 3IQQA 2JXCA 3SG2A 2JPTA 3LK0A 2JTZA 1JSAA 3TS5C 1IJ6A 4F0ZB 1QX5B 2L5XB 5F6TA 1TRFA 3F45A 4MEWA 3KHEA 3BOWA 1K9KA 3A4UB 4ICBA 2KFFA 1LA3A 2NCPA 1M63B 1UWOA 2K8MB 3IF7A 1CB1A 3CS1A 3CTNA 1CFFA 4N1GA 1M45A 3DVKA 1AK8A 1S6JA 2AAOA 1LKJA 2R2IA 3AKAA 1Y1AA 2LUCA 1BJFA 2WCBA 1OZSA 3JVTB 1YVLA 3O4YA 1KSOA 4DCKA 4C0LA 2K2FA 2K7DA 2OS8C 5HYDA 2E6WA 2BECA 2LAPA 3VROA 4ETOA 1DTLA 1CFCA 1EL4A 1DGVA 4GUKA 1EXRA 1ZACA 2PMYA 1LXFC 3CR5X 3KPXA 1G8IA 2KI4C 1IGVA 3EK4A 5HLVA 2LUXA 1KQMB 1SMGA 2FOTA 4BY5A 2DOQA 3EKHA 2WNDA 2M97A 3VRQA 3D0YA 3TZ1A 1Q80A 4USLA 1ODBA 1C7WA 4DUQA 4XJKB 1HT9A 1BODA 5HKYA 4IL1A 1CDNA 3A8RA 4BY4A 2BL0C 1QASA 1N0YA 1TNPA 2SCPA 2LHIA 4P5OE 1YUTA 4PHNA 3EVUA 4Q04A 4AQJA 2LVKA 1M46A 2M7NA 4MZKA 1WDCC 2Y4QA 4MRYA 4HSZA 2EC6B 3RM1A 1SKTA 1GJYA 4HRGA 4I5JA 2KBIA 4M2PA 1S26D 5PALA 1DT7B 2LMTA 3I5GB 1F70A 2KGBC 3GK4X 5AEQA 2LNKA 4I5KA 1QV0A 4MZJA 5CPVA 2NLNA 1FF1A 4NDDA 1TNWA 2BE6A 2MHHA 1PVAA 1QTXA 1XFVO 2MJWB 2IS9A 1CDPA 1FI5A 1KWOC 1DJYA 1B8RA 1JUOA 4DRWA 3KO0A 4GGNA 1ZFSA 4XJKA 1SPYA 1K94A 5I2OA 4PE4A 1HQVA 4I5LB 3KEVA 2BCAA 1MXLC 1NX0A 1RROA 3O2PA 3OHMB 1NX3A 2MAZA 2LLTA 1J7PA 2Y1NA 3PN7C 4CFQA 1SR6C 1OMDA 1UUSA 2JZIA 2KYCA 2BKHB 3C1VA 3M0WA 5D7FA 1K9PA 3MSEB 1JF0A 4A4BA 4CIDA 3EKJA 2K7BA 1IQ5A 2K61A 3ICBA 1KCYA 1J55A 1ZUZA 1S6IA 1E8AA 2KI6D 3BYAA 4YGEB 1G33A 2LE9B 2KYFA 2L50A 2BCBA 4OV2A 4OCIA 2PALA 3TDUA 2L0PA 3JTDB 1M39A 1MWNA 2G9BA 3I5IB 3O78A 1CLMA 1QLKA 2MLEC 2PSRA 3SG7A 1IRJA 1CM1A 1MQ1A 1RECA 1UURA 4GGFA 1NWDA 2O5GA 3I5HC 1J1DA 1L7ZA 2JTTA 2M0RA 2Q91A 5B8IB 1XFXO 4D1EA 4GGFC 1QJTA 5D69A 1DJXA 4OVNF 1IJ5A 2KBMA 2K7OA 3BXKA 3K21A 4ORBB 1GQMA 2KQYA 1K95A 1S1EA 3GK1A 4YGCB 4I5NB 3O6BA 2ZN8A 1RTP1 1YTZC 1D1OA 1SCMC 1JWDA 1V1FA 1MHOA 3PN7B 5KU1A 3SJSA 3VRPA 3EVRA 1DVIA 5AFPA 4ORCB 3BUOB 2M1UA 3PFVA 1PK0D 3OB2B 1PVBA 2GGZA 1L2OB 1UHKA 2RGIA 4PCWA 1UHNA 1YRUB 2I18A 4CLNA 1PSBA 3TS5B 2BL0B 1XK4C 1RFJA 1EG3A 1SRAA 2JXLA 3WHUB 1WRKA 5HLOA 1S5GZ 2JULA 1B7TZ 1RWYA 1K90D 1AUIB 1DGUA 1WLMA 2F8PA 3BOWB 2KNEA 4N1FA 4YI9A 3CR4X 4ZCUA 3NSIA 1Y0VH 2LLUA 4MLWA 5KTYA 2K7CA 4MZLA 1IH0A 2LVVA 1BR4B 1B8CA 1K9UA 1CM4A 1A75B 1QX7A 1QIVA 1F55A 1EJ3A 3DF0B 2E30A 2L98A 1S36A 3PSRA 5CSNA 1CDMA 2JRFA 2M8UA 1DF0B 1RK9A 2BE4A 1CMFA 5TNCA 1QLSA 2F3ZA 2CNPA 2KGRA 1WY9A 3BUMB 1TNXA 1B4CA 1SYMA 2CXJA 1SCVA 2LVIA 4DS7A 5I2QA 1S6CA 1NSHA 1KFUS 2WCFA 1TN4A 4YGAA 5HKWA 1EH2A 1CKKA 3KF9A 4MSPA 4U8DA 3SG3A 4C0JA 4C0KA 3JVTC 2JNXA 5FYXA 1ALVA 2MA2A 1TCOB 4NDBA 1BMOA 2CBLA 2K2AA 1PRWA 1TNQA 1IKUA 4DIRA 3IQOA 3BUWB 1FPWA 1B8LA 3NSOA 5DKQA 1RJVA 3LL8B 2AMIA 1FW4A 2LP3A 1JBAA 1K93D 1UHJA 1SL9A 1UP5A 2M7LA 4R1EA 1F54A 3PALA 3LCPC 2JNFA 1CLLA 1M31A 2QPTA 1YX8A 4N5XA 5CSFA 4TNCA 5AERA 1WRLA 3FWBA 4GNKB 1B7TY 2JWWA 1OSAA 1SL8A 4YGDB 5DKNA 3I5GC 1OMRA 1SW8A
chains in the Genus database with same CATH superfamily
1F8HA 1TIZA 1W7IB 1KWOB 1OMVA 3DVJA 3DVMA 2LP2A 4YGBB 5AANA 4GAOA 4MRXA 4PHKA 3DYEA 2L4HA 1A2XA 3BUNB 1OZOA 1KK8B 1BT6A 2WCMA 1Z4HA 3V2LA 1Y1XA 2P70A 4WRIA 3L47A 5CSIA 3NSLA 2F2PA 3SG6A 1LVCD 1NPQA 3WXAA 1AJ5A 1H4BA 3LK1A 3FE6A 2P71A 1FBVA 1KFXS 1NIWA 1LINA 1G4YR 5I2LA 2NCOA 5CSJA 3GK2A 3S0EA 2EGDA 1AJ4A 3D77A 3NHTA 3TDIA 4CFRA 2H61C 1SL7A 1YURA 1CMGA 4KYNA 1ALWA 1SK6D 2L2EA 2CCMA 2EHBA 3D75A 3FIAA 5GQQC 3WHTB 4YBHB 5I94A 1WDCB 2KI6C 1QV1A 1MXEA 2KHNA 1OOJA 3DXLA 2OTGC 2PVBA 2KQ6A 3PATA 2JPOA 4MN0A 1AP4A 3I5HB 4L9MA 5AXIA 1MR8A 1NCXA 1CLBA 4WQ2A 1K2HA 2LHLA 2M29A 2QEOA 5G08A 3FWCA 2OTGB 3Q8IA 1C07A 2LV7A 2ZNDA 3PM8A 2O60A 3BQ3A 4GBAA 3O4XA 5BPJA 1B47A 2COLB 1JF2A 1XK4A 1N65A 2LLSA 3FE9A 1XFUO 1UHHA 2HQ8A 3SG5A 4OKHA 4F7FA 1K8UA 2Q4UA 1SY9A 2KI4B 2KFGA 1NYAA 2HQWA 2WC8A 2M3WA 5ER5A 1IG5A 1SCMB 4QJ4B 2FJUB 3N7HA 4IJ7A 2MLFC 2QDIA 2B1UA 3CDNA 4PE7A 1OOFA 1DMOA 5JJGA 1NCYA 2JT0A 1C3YA 2KAYA 2VRGA 1XVJA 1TWOA 4MBEA 3HX4A 1SBJA 2LC5A 2KLDA 3CYZA 3L4LA 3ZWHA 5K89A 1XYDA 2F2OA 2K0JA 3CZ0A 4OR9B 2GGMA 4PE1A 3AAJA 1NP8A 1FI6A 5ER4X 1Y6WA 4P2YB 1W9ZA 1QATA 1BU3A 1TUJA 2BBNA 3FS7A 3OGNA 4JPZB 1AVSA 2GTEA 2JC2A 4JWQA 5I8NA 1CFPA 4FQOA 1CFDA 2M49B 3H4SE 4GPLB 4E68A 1J7RA 2JT8A 3CGAA 3WNXB 2H2KA 1DJHA 2ERBA 1LS8A 3SG4A 1JFJA 2L51A 3EVVA 4INWA 2TN4A 4PHJA 1KQMC 2JQ6A 3D73A 4GFTA 4PALA 1AHRA 3DD4A 1YUSA 1KQVA 1LA0A 1L2OC 3I5IC 1A03A 1IWQA 4M2QA 1NX2A 4ZCVA 1KK7Y 1B9AA 1BG1A 4AOMA 2WCEA 2SASA 4XYNA 2D8NA 1XO5A 2BCXA 3FE8A 4AQIA 1BF5A 4M2OA 2ZRSA 1DQEA 4A4CA 1QIWA 1GGWA 1KFUL 2FCEA 2HETA 5FI6A 1XFWO 1TTXA 1ZMZA 1UHIA 2M9GA 3AKBA 4PHMA 1YR5A 4QJ5B 1U5IB 1JFKA 2LVJA 2QEVA 3BUXB 4QJ3B 2PASA 2WC6A 1CNPA 1TOPA 2KSPA 1MF8B 2AUCA 1KSMA 4FTGA 1DJGA 1A4PA 1YX7A 4HREE 3B7AA 1B1GA 2QACA 2FCDA 2M1KB 4PE0A 1TCFA 3NGVA 1YVHA 1W7JB 2KFHA 3SIAA 2CT9A 2LM5A 3D10A 2FJYA 2V53A 3NSKA 3B87A 5DKRA 3OP0A 1XFYO 1NUBA 1DJZA 1XFRA 1XA5A 2WCLA 3JTDC 1CDLA 1QVIZ 3E3RA 1K96A 1F4OA 1V1GA 2OPOA 3VGOA 5IBWA 5KSZA 1CTRA 3QRXA 2PQLA 4CPVA 3GOFA 2I7AA 2NZ0A 2ZKMX 3RLZA 3CWGA 2LANA 3DF0A 1WLZA 2PRUA 3EK7A 4UPGA 1U5IA 1SSEB 2LMUA 1C7VA 1N2DA 1Y1UA 2WORA 4PT1A 4YI8A 1QS7A 3CZTX 2P6BB 3TUYB 2EC6C 3CZ2A 5D3OA 2KOTA 2G2BA 1KFXL 5FI2A 3OX5A 1QVIY 2ZN9A 2JT3A 3ZNIA 3SS4A 2KLEA 1SNLA 3AAKA 5FI7A 3UO9A 1PSRA 2KAXA 1J1EA 2WOSA 1DJWA 1PULA 5DICA 1OOIX 1YRTB 1YUUA 2LCPA 1A29A 4ORAB 1F4QA 1S3PA 1S5GY 1KK7Z 1IIOA 1OOGA 1WRZA 1KK8C 1ZOTB 3VRRA 1JC2A 1EG4A 3OX6A 2A4JA 2YGUA 2NXQA 2H61A 3CLNA 2KPHA 1BLQA 5HKZA 2JOJA 4MVFA 1X02A 1R6PA 2I2RE 2GV5A 3D0YB 2MBXA 4NDCA 3LLEA 1DJIA 1NX1A 4HRHA 5JOLA 1BOCA 3DVEA 3VRNA 1QXPA 4YRUA 3SIBA 2F33A 2OS8B 3OBVA 3CR2A 2KDHA 1PALA 2ISDA 1SR6B 1IQ3A 1R2UA 1OE9B 3EK8A 4WQ3A 3OB1B 2L5YA 4OZDA 2ZRTA 1F71A 2ZNEA 3HCMA 3S0GA 2F3YA 1BR1B 2KAVA 2L4IA 2QEHA 3NXAA 4NQGA 5J3XA 3I5FC 3BFHA 4PDZA 2Y5IA 2JU0A 2L2CA 2MRDA 2CTNA 2HPSA 2ZFDA 3PLFB 1J7QA 1H8BA 3TDZA 1DF0A 4JQ0D 3IVTA 1QX2A 2HF5A 1MUXA 1VRKA 2BBMA 3TUYC 2Y1MA 2BKIB 1NCZA 2I94A 1XFZO 1A75A 1J7OA 1OQPA 3I5FB 1GGZA 3R72A 2LMVA 3IQQA 2JXCA 3SG2A 2JPTA 3LK0A 2JTZA 1JSAA 3TS5C 1IJ6A 4F0ZB 1QX5B 2L5XB 5F6TA 1TRFA 3D78A 3F45A 4MEWA 3KHEA 3BOWA 1K9KA 3D76A 3A4UB 4ICBA 2KFFA 1LA3A 3B86A 3D74A 2NCPA 1M63B 1UWOA 2K8MB 3IF7A 1CB1A 3CS1A 1OW4A 1Z2CB 3CTNA 1CFFA 4N1GA 1M45A 3DVKA 1AK8A 1S6JA 2AAOA 1LKJA 2R2IA 3AKAA 1Y1AA 4FQTA 2LUCA 1BJFA 2WCBA 1OZSA 3JVTB 1YVLA 3O4YA 1KSOA 4DCKA 4C0LA 2K2FA 2K7DA 2OS8C 5HYDA 2E6WA 2BECA 2LAPA 3VROA 4ETOA 1DTLA 1CFCA 1EL4A 1DGVA 4GUKA 1EXRA 1ZACA 2PMYA 1LXFC 3CR5X 3KPXA 1G8IA 2KI4C 1IGVA 3EK4A 5EL2A 2LUXA 1KQMB 1SMGA 2FOTA 3QMEA 2DOQA 3DZTA 4BY5A 3EKHA 2WNDA 2M97A 3CABA 3VRQA 3D0YA 3TZ1A 1Q80A 4USLA 1DC1A 1ODBA 1C7WA 4DUQA 4XJKB 1T14A 1HT9A 1BODA 5HKYA 4IL1A 1CDNA 1DELA 3A8RA 4BY4A 2BL0C 1QASA 1N0YA 1TNPA 2SCPA 2LHIA 4P5OE 1YUTA 1DEKA 4PHNA 3EVUA 4Q04A 4JD9A 4AQJA 2LVKA 1M46A 2M7NA 4MZKA 1WDCC 2Y4QA 4MRYA 4HSZA 2EC6B 3RM1A 1SKTA 1GJYA 2QEBA 4HRGA 4I5JA 2KBIA 4M2PA 1S26D 5PALA 3S0FA 1DT7B 2LMTA 3I5GB 1F70A 2KGBC 3GK4X 5AEQA 2LNKA 4I5KA 1QV0A 4MZJA 5CPVA 1C3ZA 2NLNA 1FF1A 4NDDA 1TNWA 3BJHA 2BE6A 2MHHA 1PVAA 1QTXA 1XFVO 2MJWB 2IS9A 1CDPA 1FI5A 1KWOC 1DJYA 1B8RA 1JUOA 4DRWA 3KO0A 4GGNA 1ZFSA 4XJKA 1SPYA 1K94A 5I2OA 4PE4A 1HQVA 4I5LB 3KEVA 2BCAA 3S0DA 3S0AA 1MXLC 1NX0A 1RROA 3O2PA 3OHMB 1NX3A 2MAZA 2LLTA 1J7PA 1QWVA 2Y1NA 3PN7C 4CFQA 1SR6C 1OMDA 3CZ1A 1UUSA 3K1EA 2JZIA 2KYCA 2BKHB 3C1VA 3M0WA 5D7FA 1K9PA 5HL1A 3MSEB 1JF0A 4A4BA 4CIDA 3EKJA 2K7BA 1IQ5A 2K61A 2WC5A 3ICBA 1KCYA 1J55A 1ZUZA 3BFBA 1S6IA 1E8AA 2KI6D 2WCHA 3BYAA 4YGEB 1G33A 2LE9B 2KYFA 2L50A 2BCBA 4OV2A 4OCIA 2PALA 3TDUA 3PM2A 2L0PA 2PYQA 3JTDB 2WCJA 1M39A 1MWNA 2G9BA 3I5IB 3O78A 3UNWA 1CLMA 1QLKA 2MLEC 2PSRA 3SG7A 2BAPA 1IRJA 1CM1A 1MQ1A 1RECA 1UURA 4GGFA 1NWDA 2O5GA 3I5HC 1J1DA 1L7ZA 2JTTA 2M0RA 2Q91A 5B8IB 1XFXO 4D1EA 4GGFC 1QJTA 5D69A 1DJXA 4OVNF 3NHIA 1IJ5A 2KBMA 2K7OA 3BXKA 3K21A 4ORBB 1GQMA 2KQYA 1K95A 1S1EA 3GK1A 3R1OA 4YGCB 3S0BA 4I5NB 3B88A 3O6BA 3RZSA 2ZN8A 1RTP1 1YTZC 1D1OA 1SCMC 2K60A 1JWDA 1V1FA 1MHOA 3PN7B 1TUZA 5KU1A 3SJSA 3VRPA 3EVRA 1DVIA 5AFPA 4ORCB 3BUOB 2M1UA 2WCKA 3PFVA 1PK0D 3OB2B 3R1PA 1OOHA 1PVBA 2GGZA 1L2OB 1UHKA 4INXA 2RGIA 4PCWA 1UHNA 1YRUB 2I18A 4CLNA 1PSBA 3TS5B 2BL0B 1XK4C 1RFJA 1EG3A 1SRAA 2JXLA 3WHUB 1WRKA 5HLOA 1S5GZ 2JULA 1B7TZ 1RWYA 1K90D 1AUIB 1DGUA 1WLMA 3SS3A 2F8PA 3BOWB 2KNEA 4N1FA 4YI9A 1ORGA 3CR4X 4ZCUA 3EG5B 3NSIA 1Y0VH 2LLUA 4MLWA 5KTYA 2K7CA 4MZLA 1IH0A 1P28A 2LVVA 1BR4B 1B8CA 3B6XA 1K9UA 1CM4A 1A75B 5HLVA 1QX7A 1QIVA 1F55A 1EJ3A 3DF0B 2E30A 2L98A 1S36A 3PSRA 5CSNA 1CDMA 2JRFA 2M8UA 1DF0B 1RK9A 2BE4A 1CMFA 5TNCA 1QLSA 1GM0A 3BFAA 2F3ZA 2CNPA 2KGRA 1WY9A 3BUMB 1TNXA 2BNXA 1B4CA 1SYMA 2CXJA 1SCVA 2LVIA 4DS7A 5I2QA 1S6CA 1NSHA 1KFUS 2WCFA 1TN4A 4YGAA 5HKWA 1EH2A 1CKKA 3KF9A 4MSPA 4U8DA 3SG3A 3VB1A 4C0JA 4C0KA 2H8VA 3JVTC 2JNXA 5FYXA 1ALVA 2MA2A 1TCOB 4NDBA 1BMOA 2CBLA 2K2AA 1PRWA 1TNQA 1IKUA 4DIRA 3IQOA 3BUWB 1FPWA 3PJIA 1B8LA 3NSOA 5DKQA 1RJVA 3LL8B 2AMIA 1FW4A 2LP3A 3SS5A 1JBAA 1K93D 1UHJA 1SL9A 1UP5A 2M7LA 4JKTA 4R1EA 1F54A 3PALA 3LCPC 3L4AA 2JNFA 1CLLA 1M31A 2QPTA 1YX8A 4N5XA 5CSFA 4TNCA 5AERA 3DY9A 1WRLA 3FWBA 3R1VA 1B7TY 2JWWA 1OSAA 1SL8A 4GNKB 4YGDB 5DKNA 3I5GC 1OMRA 1SW8A
chains in the Genus database with same CATH topology
1F8HA 1TIZA 1W7IB 1KWOB 1OMVA 3DVJA 3DVMA 2LP2A 4YGBB 5AANA 4GAOA 4MRXA 4PHKA 2L4HA 1A2XA 3BUNB 1OZOA 1KK8B 1BT6A 1Y1XA 4WRIA 5CSIA 3NSLA 2F2PA 3SG6A 1LVCD 1NPQA 3WXAA 1AJ5A 1H4BA 3LK1A 1FBVA 1KFXS 1NIWA 1LINA 1G4YR 5I2LA 2NCOA 5CSJA 3GK2A 2EGDA 1AJ4A 3TDIA 4CFRA 2H61C 1SL7A 1YURA 1CMGA 1ALWA 1SK6D 2L2EA 2CCMA 2EHBA 5GQQC 3FIAA 3WHTB 4YBHB 1WDCB 2KI6C 1QV1A 1MXEA 2KHNA 1OOJA 2OTGC 2PVBA 2KQ6A 3PATA 4MN0A 1AP4A 3I5HB 4L9MA 5AXIA 1MR8A 1NCXA 1CLBA 4WQ2A 1K2HA 2LHLA 2M29A 5G08A 3FWCA 2OTGB 1C07A 2LV7A 2ZNDA 3PM8A 2O60A 3BQ3A 4GBAA 5BPJA 1B47A 2COLB 1JF2A 1N65A 1XK4A 2LLSA 1XFUO 1UHHA 2HQ8A 3SG5A 4OKHA 1K8UA 2Q4UA 1SY9A 2KI4B 2KFGA 1NYAA 2HQWA 2WC8A 2M3WA 5ER5A 1IG5A 1SCMB 4QJ4B 2FJUB 2MLFC 2B1UA 4PE7A 1DMOA 5JJGA 1NCYA 2JT0A 2KAYA 2VRGA 1XVJA 4MBEA 3HX4A 1SBJA 2LC5A 3ZWHA 5K89A 1KQVA 1XYDA 2F2OA 2K0JA 4OR9B 4PE1A 2GGMA 1FI6A 3AAJA 1NP8A 5ER4X 1Y6WA 4P2YB 1QATA 1BU3A 2BBNA 3FS7A 4JPZB 1AVSA 1CFPA 2JC2A 4JWQA 5I8NA 4FQOA 1CFDA 2M49B 3H4SE 4GPLB 4E68A 1J7RA 2JT8A 3CGAA 3WNXB 2H2KA 1DJHA 3SG4A 1JFJA 2L51A 3EVVA 2TN4A 4PHJA 1KQMC 2JQ6A 4GFTA 4PALA 1AHRA 3DD4A 1YUSA 1LA0A 1L2OC 3I5IC 1A03A 1IWQA 4M2QA 1NX2A 4ZCVA 1KK7Y 1B9AA 1BG1A 4AOMA 2WCEA 2SASA 4XYNA 2D8NA 1XO5A 2BCXA 4AQIA 1BF5A 4M2OA 2ZRSA 4A4CA 1QIWA 1GGWA 2FCEA 1KFUL 2HETA 1XFWO 1TTXA 1ZMZA 1UHIA 2M9GA 3AKBA 4PHMA 1YR5A 4QJ5B 1U5IB 1JFKA 2LVJA 3BUXB 4QJ3B 2PASA 1CNPA 1TOPA 2KSPA 1MF8B 2AUCA 1KSMA 4FTGA 1DJGA 1A4PA 1YX7A 4HREE 1B1GA 2QACA 2FCDA 2M1KB 4PE0A 1TCFA 1YVHA 1W7JB 2KFHA 3SIAA 2CT9A 2LM5A 3D10A 2V53A 3NSKA 5DKRA 3OP0A 1XFYO 1NUBA 1DJZA 1XA5A 3JTDC 1CDLA 1QVIZ 3E3RA 1K96A 1F4OA 1V1GA 2OPOA 3VGOA 5IBWA 5KSZA 1CTRA 3QRXA 4CPVA 3GOFA 2I7AA 2NZ0A 2ZKMX 3RLZA 3CWGA 2LANA 3DF0A 1WLZA 2PRUA 3EK7A 4UPGA 1U5IA 1C7VA 2LMUA 1N2DA 1Y1UA 2WORA 3TUYB 4YI8A 1QS7A 3CZTX 2P6BB 2EC6C 2KOTA 2G2BA 1KFXL 3ZNIA 3OX5A 1QVIY 2ZN9A 2JT3A 1SNLA 3AAKA 1PSRA 2KAXA 1J1EA 2WOSA 1DJWA 1PULA 1YRTB 1YUUA 2LCPA 1A29A 4ORAB 1F4QA 1S3PA 1S5GY 1KK7Z 1WRZA 1KK8C 1ZOTB 3VRRA 1JC2A 1EG4A 3OX6A 2A4JA 2NXQA 2H61A 3CLNA 1BLQA 5HKZA 2JOJA 4MVFA 1X02A 1R6PA 2I2RE 2GV5A 3D0YB 2MBXA 4NDCA 3LLEA 1DJIA 1NX1A 4HRHA 5JOLA 1BOCA 3DVEA 3VRNA 1QXPA 4YRUA 3SIBA 2F33A 2OS8B 3CR2A 2KDHA 1PALA 2ISDA 1SR6B 1IQ3A 1R2UA 1OE9B 3EK8A 4WQ3A 3OB1B 1F71A 2ZRTA 2ZNEA 3HCMA 2F3YA 1BR1B 2KAVA 2L4IA 4NQGA 3NXAA 5J3XA 3I5FC 4PDZA 2Y5IA 2JU0A 2MRDA 3PLFB 2CTNA 2HPSA 2ZFDA 1J7QA 1H8BA 3TDZA 1DF0A 4JQ0D 1QX2A 2HF5A 1MUXA 1VRKA 2BBMA 3TUYC 2Y1MA 2BKIB 1NCZA 2I94A 1XFZO 1A75A 1J7OA 1OQPA 3I5FB 1GGZA 2LMVA 3IQQA 2JXCA 3SG2A 2JPTA 3LK0A 2JTZA 1JSAA 3TS5C 1IJ6A 4F0ZB 1QX5B 2L5XB 5F6TA 1TRFA 3F45A 4MEWA 3KHEA 3BOWA 1K9KA 3A4UB 4ICBA 2KFFA 1LA3A 2NCPA 1M63B 1UWOA 2K8MB 3IF7A 1CB1A 3CS1A 3CTNA 1CFFA 4N1GA 1M45A 3DVKA 1AK8A 1S6JA 2AAOA 1LKJA 2R2IA 3AKAA 1Y1AA 2LUCA 1BJFA 2WCBA 1OZSA 3JVTB 1YVLA 3O4YA 1KSOA 4DCKA 4C0LA 2K2FA 2K7DA 2OS8C 5HYDA 2E6WA 2BECA 2LAPA 3VROA 4ETOA 1DTLA 1CFCA 1EL4A 1DGVA 4GUKA 1EXRA 1ZACA 2PMYA 1LXFC 3CR5X 3KPXA 1G8IA 2KI4C 1IGVA 3EK4A 5HLVA 2LUXA 1KQMB 1SMGA 2FOTA 4BY5A 2DOQA 3EKHA 2WNDA 2M97A 3VRQA 3D0YA 3TZ1A 1Q80A 4USLA 1ODBA 1C7WA 4DUQA 4XJKB 1HT9A 1BODA 5HKYA 4IL1A 1CDNA 3A8RA 4BY4A 2BL0C 1QASA 1N0YA 1TNPA 2SCPA 2LHIA 4P5OE 1YUTA 4PHNA 3EVUA 4Q04A 4AQJA 2LVKA 1M46A 2M7NA 4MZKA 1WDCC 2Y4QA 4MRYA 4HSZA 2EC6B 3RM1A 1SKTA 1GJYA 4HRGA 4I5JA 2KBIA 4M2PA 1S26D 5PALA 1DT7B 2LMTA 3I5GB 1F70A 2KGBC 3GK4X 5AEQA 2LNKA 4I5KA 1QV0A 4MZJA 5CPVA 2NLNA 1FF1A 4NDDA 1TNWA 2BE6A 2MHHA 1PVAA 1QTXA 1XFVO 2MJWB 2IS9A 1CDPA 1FI5A 1KWOC 1DJYA 1B8RA 1JUOA 4DRWA 3KO0A 4GGNA 1ZFSA 4XJKA 1SPYA 1K94A 5I2OA 4PE4A 1HQVA 4I5LB 3KEVA 2BCAA 1MXLC 1NX0A 1RROA 3O2PA 3OHMB 1NX3A 2MAZA 2LLTA 1J7PA 2Y1NA 3PN7C 4CFQA 1SR6C 1OMDA 1UUSA 2JZIA 2KYCA 2BKHB 3C1VA 3M0WA 5D7FA 1K9PA 3MSEB 1JF0A 4A4BA 4CIDA 3EKJA 2K7BA 1IQ5A 2K61A 3ICBA 1KCYA 1J55A 1ZUZA 1S6IA 1E8AA 2KI6D 3BYAA 4YGEB 1G33A 2LE9B 2KYFA 2L50A 2BCBA 4OV2A 4OCIA 2PALA 3TDUA 2L0PA 3JTDB 1M39A 1MWNA 2G9BA 3I5IB 3O78A 1CLMA 1QLKA 2MLEC 2PSRA 3SG7A 1IRJA 1CM1A 1MQ1A 1RECA 1UURA 4GGFA 1NWDA 2O5GA 3I5HC 1J1DA 1L7ZA 2JTTA 2M0RA 2Q91A 5B8IB 1XFXO 4D1EA 4GGFC 1QJTA 5D69A 1DJXA 4OVNF 1IJ5A 2KBMA 2K7OA 3BXKA 3K21A 4ORBB 1GQMA 2KQYA 1K95A 1S1EA 3GK1A 4YGCB 4I5NB 3O6BA 2ZN8A 1RTP1 1YTZC 1D1OA 1SCMC 1JWDA 1V1FA 1MHOA 3PN7B 5KU1A 3SJSA 3VRPA 3EVRA 1DVIA 5AFPA 4ORCB 3BUOB 2M1UA 3PFVA 1PK0D 3OB2B 1PVBA 2GGZA 1L2OB 1UHKA 2RGIA 4PCWA 1UHNA 1YRUB 2I18A 4CLNA 1PSBA 3TS5B 2BL0B 1XK4C 1RFJA 1EG3A 1SRAA 2JXLA 3WHUB 1WRKA 5HLOA 1S5GZ 2JULA 1B7TZ 1RWYA 1K90D 1AUIB 1DGUA 1WLMA 2F8PA 3BOWB 2KNEA 4N1FA 4YI9A 3CR4X 4ZCUA 3NSIA 1Y0VH 2LLUA 4MLWA 5KTYA 2K7CA 4MZLA 1IH0A 2LVVA 1BR4B 1B8CA 1K9UA 1CM4A 1A75B 1QX7A 1QIVA 1F55A 1EJ3A 3DF0B 2E30A 2L98A 1S36A 3PSRA 5CSNA 1CDMA 2JRFA 2M8UA 1DF0B 1RK9A 2BE4A 1CMFA 5TNCA 1QLSA 2F3ZA 2CNPA 2KGRA 1WY9A 3BUMB 1TNXA 1B4CA 1SYMA 2CXJA 1SCVA 2LVIA 4DS7A 5I2QA 1S6CA 1NSHA 1KFUS 2WCFA 1TN4A 4YGAA 5HKWA 1EH2A 1CKKA 3KF9A 4MSPA 4U8DA 3SG3A 4C0JA 4C0KA 3JVTC 2JNXA 5FYXA 1ALVA 2MA2A 1TCOB 4NDBA 1BMOA 2CBLA 2K2AA 1PRWA 1TNQA 1IKUA 4DIRA 3IQOA 3BUWB 1FPWA 1B8LA 3NSOA 5DKQA 1RJVA 3LL8B 2AMIA 1FW4A 2LP3A 1JBAA 1K93D 1UHJA 1SL9A 1UP5A 2M7LA 4R1EA 1F54A 3PALA 3LCPC 2JNFA 1CLLA 1M31A 2QPTA 1YX8A 4N5XA 5CSFA 4TNCA 5AERA 1WRLA 3FWBA 4GNKB 1B7TY 2JWWA 1OSAA 1SL8A 4YGDB 5DKNA 3I5GC 1OMRA 1SW8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F8H A;  1TIZ A;  1W7I B;  1KWO B;  1OMV A;  3DVJ A;  3DVM A;  2LP2 A;  4YGB B;  5AAN A;  4GAO A;  4MRX A;  4PHK A;  2L4H A;  1A2X A;  3BUN B;  1OZO A;  1KK8 B;  1BT6 A;  1Y1X A;  4WRI A;  5CSI A;  3NSL A;  2F2P A;  3SG6 A;  1LVC D;  1NPQ A;  3WXA A;  1AJ5 A;  1H4B A;  3LK1 A;  1FBV A;  1KFX S;  1NIW A;  1LIN A;  1G4Y R;  5I2L A;  2NCO A;  5CSJ A;  3GK2 A;  2EGD A;  1AJ4 A;  3TDI A;  4CFR A;  2H61 C;  1SL7 A;  1YUR A;  1CMG A;  1ALW A;  1SK6 D;  2L2E A;  2CCM A;  2EHB A;  5GQQ C;  3FIA A;  3WHT B;  4YBH B;  1WDC B;  2KI6 C;  1QV1 A;  1MXE A;  2KHN A;  1OOJ A;  2OTG C;  2PVB A;  2KQ6 A;  3PAT A;  4MN0 A;  1AP4 A;  3I5H B;  4L9M A;  5AXI A;  1MR8 A;  1NCX A;  1CLB A;  4WQ2 A;  1K2H A;  2LHL A;  2M29 A;  5G08 A;  3FWC A;  2OTG B;  1C07 A;  2LV7 A;  2ZND A;  3PM8 A;  2O60 A;  3BQ3 A;  4GBA A;  5BPJ A;  1B47 A;  2COL B;  1JF2 A;  1N65 A;  1XK4 A;  2LLS A;  1XFU O;  1UHH A;  2HQ8 A;  3SG5 A;  4OKH A;  1K8U A;  2Q4U A;  1SY9 A;  2KI4 B;  2KFG A;  1NYA A;  2HQW A;  2WC8 A;  2M3W A;  5ER5 A;  1IG5 A;  1SCM B;  4QJ4 B;  2FJU B;  2MLF C;  2B1U A;  4PE7 A;  1DMO A;  5JJG A;  1NCY A;  2JT0 A;  2KAY A;  2VRG A;  1XVJ A;  4MBE A;  3HX4 A;  1SBJ A;  2LC5 A;  3ZWH A;  5K89 A;  1KQV A;  1XYD A;  2F2O A;  2K0J A;  4OR9 B;  4PE1 A;  2GGM A;  1FI6 A;  3AAJ A;  1NP8 A;  5ER4 X;  1Y6W A;  4P2Y B;  1QAT A;  1BU3 A;  2BBN A;  3FS7 A;  4JPZ B;  1AVS A;  1CFP A;  2JC2 A;  4JWQ A;  5I8N A;  4FQO A;  1CFD A;  2M49 B;  3H4S E;  4GPL B;  4E68 A;  1J7R A;  2JT8 A;  3CGA A;  3WNX B;  2H2K A;  1DJH A;  3SG4 A;  1JFJ A;  2L51 A;  3EVV A;  2TN4 A;  4PHJ A;  1KQM C;  2JQ6 A;  4GFT A;  4PAL A;  1AHR A;  3DD4 A;  1YUS A;  1LA0 A;  1L2O C;  3I5I C;  1A03 A;  1IWQ A;  4M2Q A;  1NX2 A;  4ZCV A;  1KK7 Y;  1B9A A;  1BG1 A;  4AOM A;  2WCE A;  2SAS A;  4XYN A;  2D8N A;  1XO5 A;  2BCX A;  4AQI A;  1BF5 A;  4M2O A;  2ZRS A;  4A4C A;  1QIW A;  1GGW A;  2FCE A;  1KFU L;  2HET A;  1XFW O;  1TTX A;  1ZMZ A;  1UHI A;  2M9G A;  3AKB A;  4PHM A;  1YR5 A;  4QJ5 B;  1U5I B;  1JFK A;  2LVJ A;  3BUX B;  4QJ3 B;  2PAS A;  1CNP A;  1TOP A;  2KSP A;  1MF8 B;  2AUC A;  1KSM A;  4FTG A;  1DJG A;  1A4P A;  1YX7 A;  4HRE E;  1B1G A;  2QAC A;  2FCD A;  2M1K B;  4PE0 A;  1TCF A;  1YVH A;  1W7J B;  2KFH A;  3SIA A;  2CT9 A;  2LM5 A;  3D10 A;  2V53 A;  3NSK A;  5DKR A;  3OP0 A;  1XFY O;  1NUB A;  1DJZ A;  1XA5 A;  3JTD C;  1CDL A;  1QVI Z;  3E3R A;  1K96 A;  1F4O A;  1V1G A;  2OPO A;  3VGO A;  5IBW A;  5KSZ A;  1CTR A;  3QRX A;  4CPV A;  3GOF A;  2I7A A;  2NZ0 A;  2ZKM X;  3RLZ A;  3CWG A;  2LAN A;  3DF0 A;  1WLZ A;  2PRU A;  3EK7 A;  4UPG A;  1U5I A;  1C7V A;  2LMU A;  1N2D A;  1Y1U A;  2WOR A;  3TUY B;  4YI8 A;  1QS7 A;  3CZT X;  2P6B B;  2EC6 C;  2KOT A;  2G2B A;  1KFX L;  3ZNI A;  3OX5 A;  1QVI Y;  2ZN9 A;  2JT3 A;  1SNL A;  3AAK A;  1PSR A;  2KAX A;  1J1E A;  2WOS A;  1DJW A;  1PUL A;  1YRT B;  1YUU A;  2LCP A;  1A29 A;  4ORA B;  1F4Q A;  1S3P A;  1S5G Y;  1KK7 Z;  1WRZ A;  1KK8 C;  1ZOT B;  3VRR A;  1JC2 A;  1EG4 A;  3OX6 A;  2A4J A;  2NXQ A;  2H61 A;  3CLN A;  1BLQ A;  5HKZ A;  2JOJ A;  4MVF A;  1X02 A;  1R6P A;  2I2R E;  2GV5 A;  3D0Y B;  2MBX A;  4NDC A;  3LLE A;  1DJI A;  1NX1 A;  4HRH A;  5JOL A;  1BOC A;  3DVE A;  3VRN A;  1QXP A;  4YRU A;  3SIB A;  2F33 A;  2OS8 B;  3CR2 A;  2KDH A;  1PAL A;  2ISD A;  1SR6 B;  1IQ3 A;  1R2U A;  1OE9 B;  3EK8 A;  4WQ3 A;  3OB1 B;  1F71 A;  2ZRT A;  2ZNE A;  3HCM A;  2F3Y A;  1BR1 B;  2KAV A;  2L4I A;  4NQG A;  3NXA A;  5J3X A;  3I5F C;  4PDZ A;  2Y5I A;  2JU0 A;  2MRD A;  3PLF B;  2CTN A;  2HPS A;  2ZFD A;  1J7Q A;  1H8B A;  3TDZ A;  1DF0 A;  4JQ0 D;  1QX2 A;  2HF5 A;  1MUX A;  1VRK A;  2BBM A;  3TUY C;  2Y1M A;  2BKI B;  1NCZ A;  2I94 A;  1XFZ O;  1A75 A;  1J7O A;  1OQP A;  3I5F B;  1GGZ A;  2LMV A;  3IQQ A;  2JXC A;  3SG2 A;  2JPT A;  3LK0 A;  2JTZ A;  1JSA A;  3TS5 C;  1IJ6 A;  4F0Z B;  1QX5 B;  2L5X B;  5F6T A;  1TRF A;  3F45 A;  4MEW A;  3KHE A;  3BOW A;  1K9K A;  3A4U B;  4ICB A;  2KFF A;  1LA3 A;  2NCP A;  1M63 B;  1UWO A;  2K8M B;  3IF7 A;  1CB1 A;  3CS1 A;  3CTN A;  1CFF A;  4N1G A;  1M45 A;  3DVK A;  1AK8 A;  1S6J A;  2AAO A;  1LKJ A;  2R2I A;  3AKA A;  1Y1A A;  2LUC A;  1BJF A;  2WCB A;  1OZS A;  3JVT B;  1YVL A;  3O4Y A;  1KSO A;  4DCK A;  4C0L A;  2K2F A;  2K7D A;  2OS8 C;  5HYD A;  2E6W A;  2BEC A;  2LAP A;  3VRO A;  4ETO A;  1DTL A;  1CFC A;  1EL4 A;  1DGV A;  4GUK A;  1EXR A;  1ZAC A;  2PMY A;  1LXF C;  3CR5 X;  3KPX A;  1G8I A;  2KI4 C;  1IGV A;  3EK4 A;  5HLV A;  2LUX A;  1KQM B;  1SMG A;  2FOT A;  4BY5 A;  2DOQ A;  3EKH A;  2WND A;  2M97 A;  3VRQ A;  3D0Y A;  3TZ1 A;  1Q80 A;  4USL A;  1ODB A;  1C7W A;  4DUQ A;  4XJK B;  1HT9 A;  1BOD A;  5HKY A;  4IL1 A;  1CDN A;  3A8R A;  4BY4 A;  2BL0 C;  1QAS A;  1N0Y A;  1TNP A;  2SCP A;  2LHI A;  4P5O E;  1YUT A;  4PHN A;  3EVU A;  4Q04 A;  4AQJ A;  2LVK A;  1M46 A;  2M7N A;  4MZK A;  1WDC C;  2Y4Q A;  4MRY A;  4HSZ A;  2EC6 B;  3RM1 A;  1SKT A;  1GJY A;  4HRG A;  4I5J A;  2KBI A;  4M2P A;  1S26 D;  5PAL A;  1DT7 B;  2LMT A;  3I5G B;  1F70 A;  2KGB C;  3GK4 X;  5AEQ A;  2LNK A;  4I5K A;  1QV0 A;  4MZJ A;  5CPV A;  2NLN A;  1FF1 A;  4NDD A;  1TNW A;  2BE6 A;  2MHH A;  1PVA A;  1QTX A;  1XFV O;  2MJW B;  2IS9 A;  1CDP A;  1FI5 A;  1KWO C;  1DJY A;  1B8R A;  1JUO A;  4DRW A;  3KO0 A;  4GGN A;  1ZFS A;  4XJK A;  1SPY A;  1K94 A;  5I2O A;  4PE4 A;  1HQV A;  4I5L B;  3KEV A;  2BCA A;  1MXL C;  1NX0 A;  1RRO A;  3O2P A;  3OHM B;  1NX3 A;  2MAZ A;  2LLT A;  1J7P A;  2Y1N A;  3PN7 C;  4CFQ A;  1SR6 C;  1OMD A;  1UUS A;  2JZI A;  2KYC A;  2BKH B;  3C1V A;  3M0W A;  5D7F A;  1K9P A;  3MSE B;  1JF0 A;  4A4B A;  4CID A;  3EKJ A;  2K7B A;  1IQ5 A;  2K61 A;  3ICB A;  1KCY A;  1J55 A;  1ZUZ A;  1S6I A;  1E8A A;  2KI6 D;  3BYA A;  4YGE B;  1G33 A;  2LE9 B;  2KYF A;  2L50 A;  2BCB A;  4OV2 A;  4OCI A;  2PAL A;  3TDU A;  2L0P A;  3JTD B;  1M39 A;  1MWN A;  2G9B A;  3I5I B;  3O78 A;  1CLM A;  1QLK A;  2MLE C;  2PSR A;  3SG7 A;  1IRJ A;  1CM1 A;  1MQ1 A;  1REC A;  1UUR A;  4GGF A;  1NWD A;  2O5G A;  3I5H C;  1J1D A;  1L7Z A;  2JTT A;  2M0R A;  2Q91 A;  5B8I B;  1XFX O;  4D1E A;  4GGF C;  1QJT A;  5D69 A;  1DJX A;  4OVN F;  1IJ5 A;  2KBM A;  2K7O A;  3BXK A;  3K21 A;  4ORB B;  1GQM A;  2KQY A;  1K95 A;  1S1E A;  3GK1 A;  4YGC B;  4I5N B;  3O6B A;  2ZN8 A;  1RTP 1;  1YTZ C;  1D1O A;  1SCM C;  1JWD A;  1V1F A;  1MHO A;  3PN7 B;  5KU1 A;  3SJS A;  3VRP A;  3EVR A;  1DVI A;  5AFP A;  4ORC B;  3BUO B;  2M1U A;  3PFV A;  1PK0 D;  3OB2 B;  1PVB A;  2GGZ A;  1L2O B;  1UHK A;  2RGI A;  4PCW A;  1UHN A;  1YRU B;  2I18 A;  4CLN A;  1PSB A;  3TS5 B;  2BL0 B;  1XK4 C;  1RFJ A;  1EG3 A;  1SRA A;  2JXL A;  3WHU B;  1WRK A;  5HLO A;  1S5G Z;  2JUL A;  1B7T Z;  1RWY A;  1K90 D;  1AUI B;  1DGU A;  1WLM A;  2F8P A;  3BOW B;  2KNE A;  4N1F A;  4YI9 A;  3CR4 X;  4ZCU A;  3NSI A;  1Y0V H;  2LLU A;  4MLW A;  5KTY A;  2K7C A;  4MZL A;  1IH0 A;  2LVV A;  1BR4 B;  1B8C A;  1K9U A;  1CM4 A;  1A75 B;  1QX7 A;  1QIV A;  1F55 A;  1EJ3 A;  3DF0 B;  2E30 A;  2L98 A;  1S36 A;  3PSR A;  5CSN A;  1CDM A;  2JRF A;  2M8U A;  1DF0 B;  1RK9 A;  2BE4 A;  1CMF A;  5TNC A;  1QLS A;  2F3Z A;  2CNP A;  2KGR A;  1WY9 A;  3BUM B;  1TNX A;  1B4C A;  1SYM A;  2CXJ A;  1SCV A;  2LVI A;  4DS7 A;  5I2Q A;  1S6C A;  1NSH A;  1KFU S;  2WCF A;  1TN4 A;  4YGA A;  5HKW A;  1EH2 A;  1CKK A;  3KF9 A;  4MSP A;  4U8D A;  3SG3 A;  4C0J A;  4C0K A;  3JVT C;  2JNX A;  5FYX A;  1ALV A;  2MA2 A;  1TCO B;  4NDB A;  1BMO A;  2CBL A;  2K2A A;  1PRW A;  1TNQ A;  1IKU A;  4DIR A;  3IQO A;  3BUW B;  1FPW A;  1B8L A;  3NSO A;  5DKQ A;  1RJV A;  3LL8 B;  2AMI A;  1FW4 A;  2LP3 A;  1JBA A;  1K93 D;  1UHJ A;  1SL9 A;  1UP5 A;  2M7L A;  4R1E A;  1F54 A;  3PAL A;  3LCP C;  2JNF A;  1CLL A;  1M31 A;  2QPT A;  1YX8 A;  4N5X A;  5CSF A;  4TNC A;  5AER A;  1WRL A;  3FWB A;  4GNK B;  1B7T Y;  2JWW A;  1OSA A;  1SL8 A;  4YGD B;  5DKN A;  3I5G C;  1OMR A;  1SW8 A; 
#chains in the Genus database with same CATH topology
 1F8H A;  1TIZ A;  1W7I B;  1KWO B;  1OMV A;  3DVJ A;  3DVM A;  2LP2 A;  4YGB B;  5AAN A;  4GAO A;  4MRX A;  4PHK A;  3DYE A;  2L4H A;  1A2X A;  3BUN B;  1OZO A;  1KK8 B;  1BT6 A;  2WCM A;  1Z4H A;  3V2L A;  1Y1X A;  2P70 A;  4WRI A;  3L47 A;  5CSI A;  3NSL A;  2F2P A;  3SG6 A;  1LVC D;  1NPQ A;  3WXA A;  1AJ5 A;  1H4B A;  3LK1 A;  3FE6 A;  2P71 A;  1FBV A;  1KFX S;  1NIW A;  1LIN A;  1G4Y R;  5I2L A;  2NCO A;  5CSJ A;  3GK2 A;  3S0E A;  2EGD A;  1AJ4 A;  3D77 A;  3NHT A;  3TDI A;  4CFR A;  2H61 C;  1SL7 A;  1YUR A;  1CMG A;  4KYN A;  1ALW A;  1SK6 D;  2L2E A;  2CCM A;  2EHB A;  3D75 A;  3FIA A;  5GQQ C;  3WHT B;  4YBH B;  5I94 A;  1WDC B;  2KI6 C;  1QV1 A;  1MXE A;  2KHN A;  1OOJ A;  3DXL A;  2OTG C;  2PVB A;  2KQ6 A;  3PAT A;  2JPO A;  4MN0 A;  1AP4 A;  3I5H B;  4L9M A;  5AXI A;  1MR8 A;  1NCX A;  1CLB A;  4WQ2 A;  1K2H A;  2LHL A;  2M29 A;  2QEO A;  5G08 A;  3FWC A;  2OTG B;  3Q8I A;  1C07 A;  2LV7 A;  2ZND A;  3PM8 A;  2O60 A;  3BQ3 A;  4GBA A;  3O4X A;  5BPJ A;  1B47 A;  2COL B;  1JF2 A;  1XK4 A;  1N65 A;  2LLS A;  3FE9 A;  1XFU O;  1UHH A;  2HQ8 A;  3SG5 A;  4OKH A;  4F7F A;  1K8U A;  2Q4U A;  1SY9 A;  2KI4 B;  2KFG A;  1NYA A;  2HQW A;  2WC8 A;  2M3W A;  5ER5 A;  1IG5 A;  1SCM B;  4QJ4 B;  2FJU B;  3N7H A;  4IJ7 A;  2MLF C;  2QDI A;  2B1U A;  3CDN A;  4PE7 A;  1OOF A;  1DMO A;  5JJG A;  1NCY A;  2JT0 A;  1C3Y A;  2KAY A;  2VRG A;  1XVJ A;  1TWO A;  4MBE A;  3HX4 A;  1SBJ A;  2LC5 A;  2KLD A;  3CYZ A;  3L4L A;  3ZWH A;  5K89 A;  1XYD A;  2F2O A;  2K0J A;  3CZ0 A;  4OR9 B;  2GGM A;  4PE1 A;  3AAJ A;  1NP8 A;  1FI6 A;  5ER4 X;  1Y6W A;  4P2Y B;  1W9Z A;  1QAT A;  1BU3 A;  1TUJ A;  2BBN A;  3FS7 A;  3OGN A;  4JPZ B;  1AVS A;  2GTE A;  2JC2 A;  4JWQ A;  5I8N A;  1CFP A;  4FQO A;  1CFD A;  2M49 B;  3H4S E;  4GPL B;  4E68 A;  1J7R A;  2JT8 A;  3CGA A;  3WNX B;  2H2K A;  1DJH A;  2ERB A;  1LS8 A;  3SG4 A;  1JFJ A;  2L51 A;  3EVV A;  4INW A;  2TN4 A;  4PHJ A;  1KQM C;  2JQ6 A;  3D73 A;  4GFT A;  4PAL A;  1AHR A;  3DD4 A;  1YUS A;  1KQV A;  1LA0 A;  1L2O C;  3I5I C;  1A03 A;  1IWQ A;  4M2Q A;  1NX2 A;  4ZCV A;  1KK7 Y;  1B9A A;  1BG1 A;  4AOM A;  2WCE A;  2SAS A;  4XYN A;  2D8N A;  1XO5 A;  2BCX A;  3FE8 A;  4AQI A;  1BF5 A;  4M2O A;  2ZRS A;  1DQE A;  4A4C A;  1QIW A;  1GGW A;  1KFU L;  2FCE A;  2HET A;  5FI6 A;  1XFW O;  1TTX A;  1ZMZ A;  1UHI A;  2M9G A;  3AKB A;  4PHM A;  1YR5 A;  4QJ5 B;  1U5I B;  1JFK A;  2LVJ A;  2QEV A;  3BUX B;  4QJ3 B;  2PAS A;  2WC6 A;  1CNP A;  1TOP A;  2KSP A;  1MF8 B;  2AUC A;  1KSM A;  4FTG A;  1DJG A;  1A4P A;  1YX7 A;  4HRE E;  3B7A A;  1B1G A;  2QAC A;  2FCD A;  2M1K B;  4PE0 A;  1TCF A;  3NGV A;  1YVH A;  1W7J B;  2KFH A;  3SIA A;  2CT9 A;  2LM5 A;  3D10 A;  2FJY A;  2V53 A;  3NSK A;  3B87 A;  5DKR A;  3OP0 A;  1XFY O;  1NUB A;  1DJZ A;  1XFR A;  1XA5 A;  2WCL A;  3JTD C;  1CDL A;  1QVI Z;  3E3R A;  1K96 A;  1F4O A;  1V1G A;  2OPO A;  3VGO A;  5IBW A;  5KSZ A;  1CTR A;  3QRX A;  2PQL A;  4CPV A;  3GOF A;  2I7A A;  2NZ0 A;  2ZKM X;  3RLZ A;  3CWG A;  2LAN A;  3DF0 A;  1WLZ A;  2PRU A;  3EK7 A;  4UPG A;  1U5I A;  1SSE B;  2LMU A;  1C7V A;  1N2D A;  1Y1U A;  2WOR A;  4PT1 A;  4YI8 A;  1QS7 A;  3CZT X;  2P6B B;  3TUY B;  2EC6 C;  3CZ2 A;  5D3O A;  2KOT A;  2G2B A;  1KFX L;  5FI2 A;  3OX5 A;  1QVI Y;  2ZN9 A;  2JT3 A;  3ZNI A;  3SS4 A;  2KLE A;  1SNL A;  3AAK A;  5FI7 A;  3UO9 A;  1PSR A;  2KAX A;  1J1E A;  2WOS A;  1DJW A;  1PUL A;  5DIC A;  1OOI X;  1YRT B;  1YUU A;  2LCP A;  1A29 A;  4ORA B;  1F4Q A;  1S3P A;  1S5G Y;  1KK7 Z;  1IIO A;  1OOG A;  1WRZ A;  1KK8 C;  1ZOT B;  3VRR A;  1JC2 A;  1EG4 A;  3OX6 A;  2A4J A;  2YGU A;  2NXQ A;  2H61 A;  3CLN A;  2KPH A;  1BLQ A;  5HKZ A;  2JOJ A;  4MVF A;  1X02 A;  1R6P A;  2I2R E;  2GV5 A;  3D0Y B;  2MBX A;  4NDC A;  3LLE A;  1DJI A;  1NX1 A;  4HRH A;  5JOL A;  1BOC A;  3DVE A;  3VRN A;  1QXP A;  4YRU A;  3SIB A;  2F33 A;  2OS8 B;  3OBV A;  3CR2 A;  2KDH A;  1PAL A;  2ISD A;  1SR6 B;  1IQ3 A;  1R2U A;  1OE9 B;  3EK8 A;  4WQ3 A;  3OB1 B;  2L5Y A;  4OZD A;  2ZRT A;  1F71 A;  2ZNE A;  3HCM A;  3S0G A;  2F3Y A;  1BR1 B;  2KAV A;  2L4I A;  2QEH A;  3NXA A;  4NQG A;  5J3X A;  3I5F C;  3BFH A;  4PDZ A;  2Y5I A;  2JU0 A;  2L2C A;  2MRD A;  2CTN A;  2HPS A;  2ZFD A;  3PLF B;  1J7Q A;  1H8B A;  3TDZ A;  1DF0 A;  4JQ0 D;  3IVT A;  1QX2 A;  2HF5 A;  1MUX A;  1VRK A;  2BBM A;  3TUY C;  2Y1M A;  2BKI B;  1NCZ A;  2I94 A;  1XFZ O;  1A75 A;  1J7O A;  1OQP A;  3I5F B;  1GGZ A;  3R72 A;  2LMV A;  3IQQ A;  2JXC A;  3SG2 A;  2JPT A;  3LK0 A;  2JTZ A;  1JSA A;  3TS5 C;  1IJ6 A;  4F0Z B;  1QX5 B;  2L5X B;  5F6T A;  1TRF A;  3D78 A;  3F45 A;  4MEW A;  3KHE A;  3BOW A;  1K9K A;  3D76 A;  3A4U B;  4ICB A;  2KFF A;  1LA3 A;  3B86 A;  3D74 A;  2NCP A;  1M63 B;  1UWO A;  2K8M B;  3IF7 A;  1CB1 A;  3CS1 A;  1OW4 A;  1Z2C B;  3CTN A;  1CFF A;  4N1G A;  1M45 A;  3DVK A;  1AK8 A;  1S6J A;  2AAO A;  1LKJ A;  2R2I A;  3AKA A;  1Y1A A;  4FQT A;  2LUC A;  1BJF A;  2WCB A;  1OZS A;  3JVT B;  1YVL A;  3O4Y A;  1KSO A;  4DCK A;  4C0L A;  2K2F A;  2K7D A;  2OS8 C;  5HYD A;  2E6W A;  2BEC A;  2LAP A;  3VRO A;  4ETO A;  1DTL A;  1CFC A;  1EL4 A;  1DGV A;  4GUK A;  1EXR A;  1ZAC A;  2PMY A;  1LXF C;  3CR5 X;  3KPX A;  1G8I A;  2KI4 C;  1IGV A;  3EK4 A;  5EL2 A;  2LUX A;  1KQM B;  1SMG A;  2FOT A;  3QME A;  2DOQ A;  3DZT A;  4BY5 A;  3EKH A;  2WND A;  2M97 A;  3CAB A;  3VRQ A;  3D0Y A;  3TZ1 A;  1Q80 A;  4USL A;  1DC1 A;  1ODB A;  1C7W A;  4DUQ A;  4XJK B;  1T14 A;  1HT9 A;  1BOD A;  5HKY A;  4IL1 A;  1CDN A;  1DEL A;  3A8R A;  4BY4 A;  2BL0 C;  1QAS A;  1N0Y A;  1TNP A;  2SCP A;  2LHI A;  4P5O E;  1YUT A;  1DEK A;  4PHN A;  3EVU A;  4Q04 A;  4JD9 A;  4AQJ A;  2LVK A;  1M46 A;  2M7N A;  4MZK A;  1WDC C;  2Y4Q A;  4MRY A;  4HSZ A;  2EC6 B;  3RM1 A;  1SKT A;  1GJY A;  2QEB A;  4HRG A;  4I5J A;  2KBI A;  4M2P A;  1S26 D;  5PAL A;  3S0F A;  1DT7 B;  2LMT A;  3I5G B;  1F70 A;  2KGB C;  3GK4 X;  5AEQ A;  2LNK A;  4I5K A;  1QV0 A;  4MZJ A;  5CPV A;  1C3Z A;  2NLN A;  1FF1 A;  4NDD A;  1TNW A;  3BJH A;  2BE6 A;  2MHH A;  1PVA A;  1QTX A;  1XFV O;  2MJW B;  2IS9 A;  1CDP A;  1FI5 A;  1KWO C;  1DJY A;  1B8R A;  1JUO A;  4DRW A;  3KO0 A;  4GGN A;  1ZFS A;  4XJK A;  1SPY A;  1K94 A;  5I2O A;  4PE4 A;  1HQV A;  4I5L B;  3KEV A;  2BCA A;  3S0D A;  3S0A A;  1MXL C;  1NX0 A;  1RRO A;  3O2P A;  3OHM B;  1NX3 A;  2MAZ A;  2LLT A;  1J7P A;  1QWV A;  2Y1N A;  3PN7 C;  4CFQ A;  1SR6 C;  1OMD A;  3CZ1 A;  1UUS A;  3K1E A;  2JZI A;  2KYC A;  2BKH B;  3C1V A;  3M0W A;  5D7F A;  1K9P A;  5HL1 A;  3MSE B;  1JF0 A;  4A4B A;  4CID A;  3EKJ A;  2K7B A;  1IQ5 A;  2K61 A;  2WC5 A;  3ICB A;  1KCY A;  1J55 A;  1ZUZ A;  3BFB A;  1S6I A;  1E8A A;  2KI6 D;  2WCH A;  3BYA A;  4YGE B;  1G33 A;  2LE9 B;  2KYF A;  2L50 A;  2BCB A;  4OV2 A;  4OCI A;  2PAL A;  3TDU A;  3PM2 A;  2L0P A;  2PYQ A;  3JTD B;  2WCJ A;  1M39 A;  1MWN A;  2G9B A;  3I5I B;  3O78 A;  3UNW A;  1CLM A;  1QLK A;  2MLE C;  2PSR A;  3SG7 A;  2BAP A;  1IRJ A;  1CM1 A;  1MQ1 A;  1REC A;  1UUR A;  4GGF A;  1NWD A;  2O5G A;  3I5H C;  1J1D A;  1L7Z A;  2JTT A;  2M0R A;  2Q91 A;  5B8I B;  1XFX O;  4D1E A;  4GGF C;  1QJT A;  5D69 A;  1DJX A;  4OVN F;  3NHI A;  1IJ5 A;  2KBM A;  2K7O A;  3BXK A;  3K21 A;  4ORB B;  1GQM A;  2KQY A;  1K95 A;  1S1E A;  3GK1 A;  3R1O A;  4YGC B;  3S0B A;  4I5N B;  3B88 A;  3O6B A;  3RZS A;  2ZN8 A;  1RTP 1;  1YTZ C;  1D1O A;  1SCM C;  2K60 A;  1JWD A;  1V1F A;  1MHO A;  3PN7 B;  1TUZ A;  5KU1 A;  3SJS A;  3VRP A;  3EVR A;  1DVI A;  5AFP A;  4ORC B;  3BUO B;  2M1U A;  2WCK A;  3PFV A;  1PK0 D;  3OB2 B;  3R1P A;  1OOH A;  1PVB A;  2GGZ A;  1L2O B;  1UHK A;  4INX A;  2RGI A;  4PCW A;  1UHN A;  1YRU B;  2I18 A;  4CLN A;  1PSB A;  3TS5 B;  2BL0 B;  1XK4 C;  1RFJ A;  1EG3 A;  1SRA A;  2JXL A;  3WHU B;  1WRK A;  5HLO A;  1S5G Z;  2JUL A;  1B7T Z;  1RWY A;  1K90 D;  1AUI B;  1DGU A;  1WLM A;  3SS3 A;  2F8P A;  3BOW B;  2KNE A;  4N1F A;  4YI9 A;  1ORG A;  3CR4 X;  4ZCU A;  3EG5 B;  3NSI A;  1Y0V H;  2LLU A;  4MLW A;  5KTY A;  2K7C A;  4MZL A;  1IH0 A;  1P28 A;  2LVV A;  1BR4 B;  1B8C A;  3B6X A;  1K9U A;  1CM4 A;  1A75 B;  5HLV A;  1QX7 A;  1QIV A;  1F55 A;  1EJ3 A;  3DF0 B;  2E30 A;  2L98 A;  1S36 A;  3PSR A;  5CSN A;  1CDM A;  2JRF A;  2M8U A;  1DF0 B;  1RK9 A;  2BE4 A;  1CMF A;  5TNC A;  1QLS A;  1GM0 A;  3BFA A;  2F3Z A;  2CNP A;  2KGR A;  1WY9 A;  3BUM B;  1TNX A;  2BNX A;  1B4C A;  1SYM A;  2CXJ A;  1SCV A;  2LVI A;  4DS7 A;  5I2Q A;  1S6C A;  1NSH A;  1KFU S;  2WCF A;  1TN4 A;  4YGA A;  5HKW A;  1EH2 A;  1CKK A;  3KF9 A;  4MSP A;  4U8D A;  3SG3 A;  3VB1 A;  4C0J A;  4C0K A;  2H8V A;  3JVT C;  2JNX A;  5FYX A;  1ALV A;  2MA2 A;  1TCO B;  4NDB A;  1BMO A;  2CBL A;  2K2A A;  1PRW A;  1TNQ A;  1IKU A;  4DIR A;  3IQO A;  3BUW B;  1FPW A;  3PJI A;  1B8L A;  3NSO A;  5DKQ A;  1RJV A;  3LL8 B;  2AMI A;  1FW4 A;  2LP3 A;  3SS5 A;  1JBA A;  1K93 D;  1UHJ A;  1SL9 A;  1UP5 A;  2M7L A;  4JKT A;  4R1E A;  1F54 A;  3PAL A;  3LCP C;  3L4A A;  2JNF A;  1CLL A;  1M31 A;  2QPT A;  1YX8 A;  4N5X A;  5CSF A;  4TNC A;  5AER A;  3DY9 A;  1WRL A;  3FWB A;  3R1V A;  1B7T Y;  2JWW A;  1OSA A;  1SL8 A;  4GNK B;  4YGD B;  5DKN A;  3I5G C;  1OMR A;  1SW8 A; 
#chains in the Genus database with same CATH homology
 1F8H A;  1TIZ A;  1W7I B;  1KWO B;  1OMV A;  3DVJ A;  3DVM A;  2LP2 A;  4YGB B;  5AAN A;  4GAO A;  4MRX A;  4PHK A;  2L4H A;  1A2X A;  3BUN B;  1OZO A;  1KK8 B;  1BT6 A;  1Y1X A;  4WRI A;  5CSI A;  3NSL A;  2F2P A;  3SG6 A;  1LVC D;  1NPQ A;  3WXA A;  1AJ5 A;  1H4B A;  3LK1 A;  1FBV A;  1KFX S;  1NIW A;  1LIN A;  1G4Y R;  5I2L A;  2NCO A;  5CSJ A;  3GK2 A;  2EGD A;  1AJ4 A;  3TDI A;  4CFR A;  2H61 C;  1SL7 A;  1YUR A;  1CMG A;  1ALW A;  1SK6 D;  2L2E A;  2CCM A;  2EHB A;  5GQQ C;  3FIA A;  3WHT B;  4YBH B;  1WDC B;  2KI6 C;  1QV1 A;  1MXE A;  2KHN A;  1OOJ A;  2OTG C;  2PVB A;  2KQ6 A;  3PAT A;  4MN0 A;  1AP4 A;  3I5H B;  4L9M A;  5AXI A;  1MR8 A;  1NCX A;  1CLB A;  4WQ2 A;  1K2H A;  2LHL A;  2M29 A;  5G08 A;  3FWC A;  2OTG B;  1C07 A;  2LV7 A;  2ZND A;  3PM8 A;  2O60 A;  3BQ3 A;  4GBA A;  5BPJ A;  1B47 A;  2COL B;  1JF2 A;  1N65 A;  1XK4 A;  2LLS A;  1XFU O;  1UHH A;  2HQ8 A;  3SG5 A;  4OKH A;  1K8U A;  2Q4U A;  1SY9 A;  2KI4 B;  2KFG A;  1NYA A;  2HQW A;  2WC8 A;  2M3W A;  5ER5 A;  1IG5 A;  1SCM B;  4QJ4 B;  2FJU B;  2MLF C;  2B1U A;  4PE7 A;  1DMO A;  5JJG A;  1NCY A;  2JT0 A;  2KAY A;  2VRG A;  1XVJ A;  4MBE A;  3HX4 A;  1SBJ A;  2LC5 A;  3ZWH A;  5K89 A;  1KQV A;  1XYD A;  2F2O A;  2K0J A;  4OR9 B;  4PE1 A;  2GGM A;  1FI6 A;  3AAJ A;  1NP8 A;  5ER4 X;  1Y6W A;  4P2Y B;  1QAT A;  1BU3 A;  2BBN A;  3FS7 A;  4JPZ B;  1AVS A;  1CFP A;  2JC2 A;  4JWQ A;  5I8N A;  4FQO A;  1CFD A;  2M49 B;  3H4S E;  4GPL B;  4E68 A;  1J7R A;  2JT8 A;  3CGA A;  3WNX B;  2H2K A;  1DJH A;  3SG4 A;  1JFJ A;  2L51 A;  3EVV A;  2TN4 A;  4PHJ A;  1KQM C;  2JQ6 A;  4GFT A;  4PAL A;  1AHR A;  3DD4 A;  1YUS A;  1LA0 A;  1L2O C;  3I5I C;  1A03 A;  1IWQ A;  4M2Q A;  1NX2 A;  4ZCV A;  1KK7 Y;  1B9A A;  1BG1 A;  4AOM A;  2WCE A;  2SAS A;  4XYN A;  2D8N A;  1XO5 A;  2BCX A;  4AQI A;  1BF5 A;  4M2O A;  2ZRS A;  4A4C A;  1QIW A;  1GGW A;  2FCE A;  1KFU L;  2HET A;  1XFW O;  1TTX A;  1ZMZ A;  1UHI A;  2M9G A;  3AKB A;  4PHM A;  1YR5 A;  4QJ5 B;  1U5I B;  1JFK A;  2LVJ A;  3BUX B;  4QJ3 B;  2PAS A;  1CNP A;  1TOP A;  2KSP A;  1MF8 B;  2AUC A;  1KSM A;  4FTG A;  1DJG A;  1A4P A;  1YX7 A;  4HRE E;  1B1G A;  2QAC A;  2FCD A;  2M1K B;  4PE0 A;  1TCF A;  1YVH A;  1W7J B;  2KFH A;  3SIA A;  2CT9 A;  2LM5 A;  3D10 A;  2V53 A;  3NSK A;  5DKR A;  3OP0 A;  1XFY O;  1NUB A;  1DJZ A;  1XA5 A;  3JTD C;  1CDL A;  1QVI Z;  3E3R A;  1K96 A;  1F4O A;  1V1G A;  2OPO A;  3VGO A;  5IBW A;  5KSZ A;  1CTR A;  3QRX A;  4CPV A;  3GOF A;  2I7A A;  2NZ0 A;  2ZKM X;  3RLZ A;  3CWG A;  2LAN A;  3DF0 A;  1WLZ A;  2PRU A;  3EK7 A;  4UPG A;  1U5I A;  1C7V A;  2LMU A;  1N2D A;  1Y1U A;  2WOR A;  3TUY B;  4YI8 A;  1QS7 A;  3CZT X;  2P6B B;  2EC6 C;  2KOT A;  2G2B A;  1KFX L;  3ZNI A;  3OX5 A;  1QVI Y;  2ZN9 A;  2JT3 A;  1SNL A;  3AAK A;  1PSR A;  2KAX A;  1J1E A;  2WOS A;  1DJW A;  1PUL A;  1YRT B;  1YUU A;  2LCP A;  1A29 A;  4ORA B;  1F4Q A;  1S3P A;  1S5G Y;  1KK7 Z;  1WRZ A;  1KK8 C;  1ZOT B;  3VRR A;  1JC2 A;  1EG4 A;  3OX6 A;  2A4J A;  2NXQ A;  2H61 A;  3CLN A;  1BLQ A;  5HKZ A;  2JOJ A;  4MVF A;  1X02 A;  1R6P A;  2I2R E;  2GV5 A;  3D0Y B;  2MBX A;  4NDC A;  3LLE A;  1DJI A;  1NX1 A;  4HRH A;  5JOL A;  1BOC A;  3DVE A;  3VRN A;  1QXP A;  4YRU A;  3SIB A;  2F33 A;  2OS8 B;  3CR2 A;  2KDH A;  1PAL A;  2ISD A;  1SR6 B;  1IQ3 A;  1R2U A;  1OE9 B;  3EK8 A;  4WQ3 A;  3OB1 B;  1F71 A;  2ZRT A;  2ZNE A;  3HCM A;  2F3Y A;  1BR1 B;  2KAV A;  2L4I A;  4NQG A;  3NXA A;  5J3X A;  3I5F C;  4PDZ A;  2Y5I A;  2JU0 A;  2MRD A;  3PLF B;  2CTN A;  2HPS A;  2ZFD A;  1J7Q A;  1H8B A;  3TDZ A;  1DF0 A;  4JQ0 D;  1QX2 A;  2HF5 A;  1MUX A;  1VRK A;  2BBM A;  3TUY C;  2Y1M A;  2BKI B;  1NCZ A;  2I94 A;  1XFZ O;  1A75 A;  1J7O A;  1OQP A;  3I5F B;  1GGZ A;  2LMV A;  3IQQ A;  2JXC A;  3SG2 A;  2JPT A;  3LK0 A;  2JTZ A;  1JSA A;  3TS5 C;  1IJ6 A;  4F0Z B;  1QX5 B;  2L5X B;  5F6T A;  1TRF A;  3F45 A;  4MEW A;  3KHE A;  3BOW A;  1K9K A;  3A4U B;  4ICB A;  2KFF A;  1LA3 A;  2NCP A;  1M63 B;  1UWO A;  2K8M B;  3IF7 A;  1CB1 A;  3CS1 A;  3CTN A;  1CFF A;  4N1G A;  1M45 A;  3DVK A;  1AK8 A;  1S6J A;  2AAO A;  1LKJ A;  2R2I A;  3AKA A;  1Y1A A;  2LUC A;  1BJF A;  2WCB A;  1OZS A;  3JVT B;  1YVL A;  3O4Y A;  1KSO A;  4DCK A;  4C0L A;  2K2F A;  2K7D A;  2OS8 C;  5HYD A;  2E6W A;  2BEC A;  2LAP A;  3VRO A;  4ETO A;  1DTL A;  1CFC A;  1EL4 A;  1DGV A;  4GUK A;  1EXR A;  1ZAC A;  2PMY A;  1LXF C;  3CR5 X;  3KPX A;  1G8I A;  2KI4 C;  1IGV A;  3EK4 A;  5HLV A;  2LUX A;  1KQM B;  1SMG A;  2FOT A;  4BY5 A;  2DOQ A;  3EKH A;  2WND A;  2M97 A;  3VRQ A;  3D0Y A;  3TZ1 A;  1Q80 A;  4USL A;  1ODB A;  1C7W A;  4DUQ A;  4XJK B;  1HT9 A;  1BOD A;  5HKY A;  4IL1 A;  1CDN A;  3A8R A;  4BY4 A;  2BL0 C;  1QAS A;  1N0Y A;  1TNP A;  2SCP A;  2LHI A;  4P5O E;  1YUT A;  4PHN A;  3EVU A;  4Q04 A;  4AQJ A;  2LVK A;  1M46 A;  2M7N A;  4MZK A;  1WDC C;  2Y4Q A;  4MRY A;  4HSZ A;  2EC6 B;  3RM1 A;  1SKT A;  1GJY A;  4HRG A;  4I5J A;  2KBI A;  4M2P A;  1S26 D;  5PAL A;  1DT7 B;  2LMT A;  3I5G B;  1F70 A;  2KGB C;  3GK4 X;  5AEQ A;  2LNK A;  4I5K A;  1QV0 A;  4MZJ A;  5CPV A;  2NLN A;  1FF1 A;  4NDD A;  1TNW A;  2BE6 A;  2MHH A;  1PVA A;  1QTX A;  1XFV O;  2MJW B;  2IS9 A;  1CDP A;  1FI5 A;  1KWO C;  1DJY A;  1B8R A;  1JUO A;  4DRW A;  3KO0 A;  4GGN A;  1ZFS A;  4XJK A;  1SPY A;  1K94 A;  5I2O A;  4PE4 A;  1HQV A;  4I5L B;  3KEV A;  2BCA A;  1MXL C;  1NX0 A;  1RRO A;  3O2P A;  3OHM B;  1NX3 A;  2MAZ A;  2LLT A;  1J7P A;  2Y1N A;  3PN7 C;  4CFQ A;  1SR6 C;  1OMD A;  1UUS A;  2JZI A;  2KYC A;  2BKH B;  3C1V A;  3M0W A;  5D7F A;  1K9P A;  3MSE B;  1JF0 A;  4A4B A;  4CID A;  3EKJ A;  2K7B A;  1IQ5 A;  2K61 A;  3ICB A;  1KCY A;  1J55 A;  1ZUZ A;  1S6I A;  1E8A A;  2KI6 D;  3BYA A;  4YGE B;  1G33 A;  2LE9 B;  2KYF A;  2L50 A;  2BCB A;  4OV2 A;  4OCI A;  2PAL A;  3TDU A;  2L0P A;  3JTD B;  1M39 A;  1MWN A;  2G9B A;  3I5I B;  3O78 A;  1CLM A;  1QLK A;  2MLE C;  2PSR A;  3SG7 A;  1IRJ A;  1CM1 A;  1MQ1 A;  1REC A;  1UUR A;  4GGF A;  1NWD A;  2O5G A;  3I5H C;  1J1D A;  1L7Z A;  2JTT A;  2M0R A;  2Q91 A;  5B8I B;  1XFX O;  4D1E A;  4GGF C;  1QJT A;  5D69 A;  1DJX A;  4OVN F;  1IJ5 A;  2KBM A;  2K7O A;  3BXK A;  3K21 A;  4ORB B;  1GQM A;  2KQY A;  1K95 A;  1S1E A;  3GK1 A;  4YGC B;  4I5N B;  3O6B A;  2ZN8 A;  1RTP 1;  1YTZ C;  1D1O A;  1SCM C;  1JWD A;  1V1F A;  1MHO A;  3PN7 B;  5KU1 A;  3SJS A;  3VRP A;  3EVR A;  1DVI A;  5AFP A;  4ORC B;  3BUO B;  2M1U A;  3PFV A;  1PK0 D;  3OB2 B;  1PVB A;  2GGZ A;  1L2O B;  1UHK A;  2RGI A;  4PCW A;  1UHN A;  1YRU B;  2I18 A;  4CLN A;  1PSB A;  3TS5 B;  2BL0 B;  1XK4 C;  1RFJ A;  1EG3 A;  1SRA A;  2JXL A;  3WHU B;  1WRK A;  5HLO A;  1S5G Z;  2JUL A;  1B7T Z;  1RWY A;  1K90 D;  1AUI B;  1DGU A;  1WLM A;  2F8P A;  3BOW B;  2KNE A;  4N1F A;  4YI9 A;  3CR4 X;  4ZCU A;  3NSI A;  1Y0V H;  2LLU A;  4MLW A;  5KTY A;  2K7C A;  4MZL A;  1IH0 A;  2LVV A;  1BR4 B;  1B8C A;  1K9U A;  1CM4 A;  1A75 B;  1QX7 A;  1QIV A;  1F55 A;  1EJ3 A;  3DF0 B;  2E30 A;  2L98 A;  1S36 A;  3PSR A;  5CSN A;  1CDM A;  2JRF A;  2M8U A;  1DF0 B;  1RK9 A;  2BE4 A;  1CMF A;  5TNC A;  1QLS A;  2F3Z A;  2CNP A;  2KGR A;  1WY9 A;  3BUM B;  1TNX A;  1B4C A;  1SYM A;  2CXJ A;  1SCV A;  2LVI A;  4DS7 A;  5I2Q A;  1S6C A;  1NSH A;  1KFU S;  2WCF A;  1TN4 A;  4YGA A;  5HKW A;  1EH2 A;  1CKK A;  3KF9 A;  4MSP A;  4U8D A;  3SG3 A;  4C0J A;  4C0K A;  3JVT C;  2JNX A;  5FYX A;  1ALV A;  2MA2 A;  1TCO B;  4NDB A;  1BMO A;  2CBL A;  2K2A A;  1PRW A;  1TNQ A;  1IKU A;  4DIR A;  3IQO A;  3BUW B;  1FPW A;  1B8L A;  3NSO A;  5DKQ A;  1RJV A;  3LL8 B;  2AMI A;  1FW4 A;  2LP3 A;  1JBA A;  1K93 D;  1UHJ A;  1SL9 A;  1UP5 A;  2M7L A;  4R1E A;  1F54 A;  3PAL A;  3LCP C;  2JNF A;  1CLL A;  1M31 A;  2QPT A;  1YX8 A;  4N5X A;  5CSF A;  4TNC A;  5AER A;  1WRL A;  3FWB A;  4GNK B;  1B7T Y;  2JWW A;  1OSA A;  1SL8 A;  4YGD B;  5DKN A;  3I5G C;  1OMR A;  1SW8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...