1BU3A

Refined crystal structure of calcium-bound silver hake (pi 4.2) parvalbumin at 1.65 a.
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
108
structure length
108
Chain Sequence
AFSGILADADVAAALKACEAADSFNYKAFFAKVGLTAKSADDIKKAFFVIDQDKSGFIEEDELKLFLQVFSAGARALTDAETKAFLKAGDSDGDGAIGVDEWAALVKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium binding
molecule keywords CALCIUM-BINDING PROTEIN
publication title X-Ray crystal structure and molecular dynamics simulations of silver hake parvalbumin (Isoform B).
pubmed rcsb
total genus 39
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 1998-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1bu3A00
2LMTA 1K95A 3PM8A 5GQQC 2LE9B 4C0KA 3VRNA 1OQPA 4I5LB 1YVHA 4I5KA 1CLBA 4IL1A 4M2QA 2L5XB 1DTLA 3GK4X 1L7ZA 1NUBA 2MAZA 4PE1A 1EL4A 2QACA 5I8NA 1JUOA 3D10A 3TS5B 2NZ0A 2WOSA 1CDMA 1JFKA 2AAOA 1PVBA 1YX7A 2K8MB 2ZKMX 2SASA 1SYMA 1IJ6A 1XFUO 1XFYO 3VGOA 1DJHA 1SKTA 1J55A 2KSPA 1SY9A 1JSAA 4YRUA 3TDIA 2JOJA 4YI9A 2JT8A 3SG3A 1QATA 1QXPA 1AUIB 3PATA 3TDUA 2KQ6A 1S5GZ 1BT6A 2O5GA 3WXAA 3D0YB 5I2OA 2A4JA 1FPWA 1S5GY 2JNXA 1CDPA 2E6WA 1SL9A 1MUXA 2PALA 5KU1A 2TN4A 1XYDA 2NLNA 3TUYC 1M63B 1S3PA 2BL0C 5CPVA 1J7QA 2L50A 4CLNA 3FIAA 3PN7B 1AJ5A 1CTRA 2ZFDA 4GGNA 4PHNA 4I5JA 2K61A 4YGEB 1NWDA 4MBEA 1UHKA 1YUUA 3JTDB 4GGFA 5AFPA 4P5OE 1A2XA 1ZACA 2JWWA 2VRGA 2M49B 1J7OA 2M9GA 1S1EA 3FS7A 3FWCA 4DIRA 1BLQA 4YGAA 1V1FA 1GGWA 2PASA 1CM4A 3IQQA 2BCBA 1BJFA 1RTP1 2WORA 1WDCB 4PE0A 3OX6A 1JBAA 2Q91A 3DVKA 2K7OA 1YVLA 3CLNA 4GUKA 1VRKA 1J7PA 4MRYA 2LLUA 1OE9B 2KQYA 3BYAA 2LVKA 5D7FA 1YX8A 3BOWA 1NSHA 1RROA 1PVAA 1XK4C 3EVVA 1OZOA 5IBWA 1SR6B 2HF5A 1L2OC 1DJYA 2LUCA 2JXCA 1MXLC 1DVIA 1QLSA 1F4QA 1KFXS 1B8CA 1OZSA 2MHHA 3EVUA 3SIBA 1QIVA 4AQJA 2KYFA 1YR5A 1GJYA 3NSIA 2CT9A 2HQWA 1G8IA 1RJVA 2HPSA 4HRGA 2LVJA 5ER4X 4FQOA 2BE6A 2AUCA 4BY4A 3TDZA 1CNPA 4UPGA 1HQVA 4OR9B 1E8AA 2F33A 1Y1UA 5AANA 1S26D 1A75B 2OTGC 1B1GA 2M3WA 2RGIA 3EK8A 1UHJA 4WQ2A 4WRIA 2NXQA 1LVCD 1F8HA 1S36A 1ALWA 1QS7A 1B47A 1H4BA 4DRWA 1IWQA 2L98A 1CFCA 1W7JB 2V53A 2M29A 1DT7B 1Y6WA 1AK8A 3D0YA 1WLZA 1XA5A 5CSFA 2LP2A 2JTTA 1LA3A 1KSOA 1SNLA 4P2YB 1FBVA 2K2AA 1KCYA 1ZFSA 3SJSA 2LV7A 2O60A 1AP4A 2JU0A 1LKJA 1S6IA 3PSRA 5CSIA 1OMRA 4MLWA 1TIZA 4A4CA 4PCWA 1KQMB 3GK1A 4D1EA 4NQGA 2MLEC 1NP8A 3RM1A 3VRPA 1EH2A 2OS8C 1SW8A 1IQ3A 2L2EA 2BKIB 1OMDA 1Y1AA 4DS7A 5I2QA 2H61A 4MEWA 4U8DA 3KPXA 3BQ3A 1IKUA 4JPZB 3RLZA 4AOMA 2ZRSA 1IJ5A 2K0JA 1KK8C 3O78A 4F0ZB 1SCVA 2IS9A 4PHKA 2K2FA 1KFUS 2MRDA 4CFQA 3LK1A 2LNKA 2LVVA 1NX3A 2DOQA 2CCMA 3TZ1A 1UP5A 1UUSA 3BUWB 2JZIA 2OPOA 2EC6B 2HQ8A 5CSJA 2M0RA 1M46A 5FYXA 4E68A 3SG7A 1B4CA 4ICBA 2B1UA 2KBIA 3TS5C 1TTXA 4YI8A 2BCXA 2COLB 5DKRA 1SMGA 1EG4A 1U5IB 5HKYA 1TNXA 1RFJA 2JPTA 1DMOA 3OX5A 5JJGA 2PVBA 3DF0B 3DVEA 4C0JA 2KI6C 2LHIA 1PRWA 2G9BA 2HETA 4M2OA 1AHRA 2ZN9A 4TNCA 1JC2A 3I5HB 1EG3A 3CR5X 4FTGA 1SRAA 1A75A 2I94A 2M1KB 1KQVA 1ZOTB 1M45A 4AQIA 1YURA 1YTZC 2WNDA 1WLMA 4ORBB 2JULA 1DJXA 1LA0A 3ZWHA 1CMGA 4PALA 1QX5B 1KWOB 2FCEA 4NDBA 1FF1A 1K90D 3DD4A 1K2HA 2M7LA 2CBLA 1J1EA 2KBMA 2KGBC 5I2LA 3CTNA 1KFUL 2Y5IA 3PN7C 2Y4QA 3KF9A 3CGAA 5DKQA 3KEVA 1UURA 4MSPA 3KO0A 3JTDC 4NDDA 2GGMA 1Y0VH 2M8UA 2H61C 1NX1A 3AKBA 3CR4X 1CKKA 3I5GB 4HSZA 1D1OA 2FOTA 4I5NB 3JVTB 3PFVA 3WHTB 1WDCC 1B8LA 2KOTA 2CXJA 4OV2A 1WY9A 3O6BA 3VROA 2K7DA 1WRLA 1K96A 1RWYA 1DJWA 1SL7A 4ORAB 1S6CA 2F8PA 4QJ3B 4BY5A 2D8NA 1SR6C 1XFZO 1LXFC 4MZJA 5AERA 1C7WA 2P6BB 3SG6A 3DVJA 4ORCB 2AMIA 1XFWO 3I5FB 2JNFA 3M0WA 1EXRA 2KFHA 1BOCA 2KAVA 3BUMB 4MVFA 1DF0B 1TRFA 2JQ6A 1HT9A 2KI4C 4JWQA 4YGCB 1C07A 1IH0A 2MJWB 2ISDA 1AJ4A 1TCOB 4A4BA 1QV0A 3GK2A 1IQ5A 1TNPA 2Y1NA 5DKNA 3SG5A 1C7VA 4XYNA 1NPQA 4OKHA 1BR1B 2ZNDA 3NSOA 4MZLA 4GGFC 3PALA 1A03A 1U5IA 3I5IB 1EJ3A 1J1DA 2I18A 2KFFA 1DGVA 1ODBA 4MZKA 2GV5A 3DF0A 1XFXO 1DJZA 1SCMC 1XVJA 1QJTA 1ZUZA 1DGUA 2LUXA 1CMFA 1QX2A 3EKJA 2KNEA 4PHJA 1SL8A 1UWOA 1CFDA 4GPLB 1G33A 2ZNEA 4QJ4B 2ZRTA 2LANA 1NCYA 1CDNA 4GBAA 4CIDA 1CFPA 4M2PA 2JRFA 2PMYA 3O2PA 1BF5A 1TNWA 2BE4A 3ICBA 3OHMB 1QIWA 2I2RE 1NYAA 1MXEA 3SG2A 4PE7A 4JQ0D 3OB2B 2JTZA 2QPTA 4CFRA 1YUSA 3H4SE 3WHUB 4ZCVA 2GGZA 3LK0A 5CSNA 1JF0A 1TOPA 2F2OA 2LLSA 1K93D 2BKHB 1K94A 2PRUA 3K21A 3SIAA 1IGVA 5B8IB 2CTNA 2G2BA 3AKAA 2KDHA 1A4PA 2BBMA 3IQOA 1X02A 1B8RA 1TNQA 2MA2A 1MQ1A 3A8RA 4WQ3A 4QJ5B 1F55A 4R1EA 1CB1A 5TNCA 1LINA 2ZN8A 3SG4A 2LVIA 1XK4A 1FI6A 2KAXA 1NIWA 3AAKA 3CZTX 3C1VA 2E30A 4C0LA 1XO5A 1MWNA 1OSAA 1J7RA 1V1GA 2SCPA 3EKHA 2EC6C 5HKZA 1CLMA 3VRRA 3LL8B 4N1GA 1BMOA 4PE4A 1M39A 1BR4B 4HREE 5D69A 2EHBA 2M1UA 1SBJA 1QV1A 1CM1A 1FI5A 2FJUB 2KGRA 4N5XA 1BODA 4ZCUA 1QX7A 3AAJA 3LLEA 5BPJA 2KYCA 3TUYB 3VRQA 2WCFA 5AXIA 4CPVA 4DCKA 1WRKA 1Y1XA 2Y1MA 3OP0A 1DF0A 1CFFA 3IF7A 1W7IB 1R2UA 1MHOA 2BL0B 3BUXB 1DJIA 1N2DA 2I7AA 2LHLA 2R2IA 4GAOA 1IRJA 4MRXA 1IG5A 1MF8B 1KK7Z 1QASA 5HKWA 3QRXA 1A29A 1B7TZ 2JC2A 1NCXA 2LMUA 3I5HC 1R6PA 1GGZA 1KK7Y 1N0YA 1B7TY 2Q4UA 2WCBA 1K9PA 3NSKA 1SK6D 5KTYA 2MBXA 2BCAA 4PDZA 1TCFA 4XJKB 2EGDA 5HLVA 1BU3A 1K9KA 3NXAA 1AVSA 1XFVO 2L4HA 3CR2A 4Q04A 2K7CA 1KWOC 4L9MA 4MN0A 2F2PA 1FW4A 2WC8A 2K7BA 1RK9A 2F3ZA 1PULA 5HYDA 2L51A 1JFJA 1NX2A 1F4OA 3A4UB 1F70A 3E3RA 2H2KA 4DUQA 1KSMA 1N65A 1PSBA 1L2OB 5KSZA 1K9UA 1UHNA 3O4YA 3BUNB 3I5GC 3CS1A 3OB1B 3JVTC 3WNXB 1G4YR 2LC5A 2NCOA 3HX4A 3NSLA 4YBHB 1JWDA 1QTXA 1PK0D 3KHEA 1QLKA 1NCZA 5HLOA 2KAYA 4PHMA 2KHNA 2LM5A 2OTGB 1CLLA 1OMVA 5AEQA 1F54A 1BG1A 4YGBB 2JXLA 2KI4B 4YGDB 1NX0A 2WCEA 3LCPC 4HRHA 4OCIA 2NCPA 3I5FC 3CWGA 4GNKB 4NDCA 5ER5A 5JOLA 3ZNIA 4ETOA 2MLFC 3GOFA 1ALVA 3EK4A 2LP3A 1SPYA 3F45A 2FCDA 1GQMA 3BUOB 1K8UA 1M31A 2BBNA 2L4IA 4GFTA 4USLA 1CDLA 1UHIA 5J3XA 1YRTB 1OOJA 3FWBA 4OVNF 2L0PA 1SCMB 3DVMA 5PALA 2LLTA 2F3YA 3PLFB 3I5IC 1MR8A 3HCMA 1QVIZ 2LAPA 1RECA 1DJGA 1JF2A 1TN4A 1F71A 1QVIY 1UHHA 2KI6D 2M7NA 2CNPA 5G08A 2M97A 1PALA 5K89A 1ZMZA 2LMVA 2OS8B 2JT0A 1Q80A 1YUTA 3BOWB 1S6JA 1YRUB 1KQMC 1PSRA 1WRZA 3BXKA 3EK7A 3MSEB 4N1FA 1KFXL 2LCPA 1H8BA 4XJKA 2BECA 3EVRA 1KK8B 2KFGA 2JT3A 2PSRA 5F6TA 1B9AA
chains in the Genus database with same CATH superfamily
2LMTA 1K95A 3PM8A 1Z2CB 2LE9B 5GQQC 4C0KA 3VRNA 1OQPA 4I5LB 1YVHA 4I5KA 1CLBA 4IL1A 4M2QA 2L5XB 1DTLA 3GK4X 1L7ZA 1NUBA 2MAZA 4PE1A 3D78A 1EL4A 2QACA 5I8NA 3QMEA 1JUOA 3D10A 3TS5B 3D74A 2NZ0A 2WOSA 1CDMA 1JFKA 2AAOA 1PVBA 1YX7A 2K8MB 1W9ZA 2ZKMX 2SASA 3RZSA 1SYMA 1IJ6A 1XFUO 2WCLA 4IJ7A 1XFYO 3VGOA 1DJHA 1SKTA 1J55A 3CYZA 2KSPA 3B88A 1SY9A 1JSAA 4YRUA 3TDIA 2JOJA 3DXLA 4YI9A 2JT8A 3SG3A 1QATA 1QXPA 1AUIB 3PATA 3TDUA 2KQ6A 1S5GZ 2QEVA 1BT6A 2O5GA 3S0BA 3WXAA 1GM0A 3D0YB 5I2OA 2A4JA 1FPWA 1S5GY 2JNXA 1CDPA 2E6WA 1SL9A 1MUXA 2PALA 4INWA 5KU1A 2TN4A 1XYDA 2NLNA 3TUYC 1M63B 1S3PA 2BL0C 5CPVA 1J7QA 2L50A 4CLNA 3FIAA 3PN7B 3Q8IA 1AJ5A 1CTRA 2ZFDA 4GGNA 4PHNA 4I5JA 2K61A 1TUJA 1NWDA 4MBEA 1UHKA 1YUUA 3JTDB 4GGFA 4YGEB 5AFPA 4P5OE 1A2XA 1ZACA 2JWWA 2VRGA 2FJYA 2M49B 3S0DA 2M9GA 1J7OA 1S1EA 3FS7A 3FWCA 5D3OA 4DIRA 1BLQA 4YGAA 3NGVA 1V1FA 1GGWA 2PASA 1CM4A 3R1PA 3IQQA 2BCBA 2K60A 1BJFA 1RTP1 2WORA 5FI7A 1WDCB 4PE0A 3OX6A 1JBAA 2Q91A 3DVKA 2K7OA 1YVLA 3CLNA 4GUKA 1VRKA 1J7PA 4MRYA 2LLUA 1OE9B 2WCKA 2KQYA 3BYAA 2LVKA 5D7FA 1YX8A 3BOWA 1NSHA 1RROA 1PVAA 1XK4C 3EVVA 1OZOA 5IBWA 1SR6B 2HF5A 1L2OC 1DJYA 2LUCA 2JXCA 2WCJA 1MXLC 1DVIA 1QLSA 1F4QA 1KFXS 1B8CA 1OZSA 2MHHA 3EVUA 3SIBA 1QIVA 2KPHA 2KYFA 1YR5A 1GJYA 3NSIA 4AQJA 2CT9A 2HQWA 1G8IA 1RJVA 2HPSA 2WCHA 4HRGA 3S0FA 1OOGA 2LVJA 5ER4X 4FQOA 1LS8A 2BE6A 2AUCA 4BY4A 3TDZA 1CNPA 2QEOA 4UPGA 1HQVA 4OR9B 1E8AA 2F33A 1Y1UA 5AANA 1S26D 3S0EA 3DY9A 1A75B 1DEKA 2OTGC 3S0GA 1B1GA 2M3WA 2RGIA 4OZDA 2QEHA 3EK8A 1UHJA 2KLDA 4WQ2A 3UO9A 4WRIA 2NXQA 1DQEA 1LVCD 3PJIA 1F8HA 1S36A 3SS5A 1ALWA 1QS7A 1B47A 1H4BA 4DRWA 1IWQA 2L98A 1CFCA 1W7JB 2V53A 2M29A 3B86A 1DT7B 1Y6WA 1AK8A 3D0YA 1WLZA 1XA5A 5CSFA 2LP2A 2JTTA 1LA3A 1KSOA 1SNLA 4P2YB 5FI6A 1FBVA 2K2AA 1KCYA 1ZFSA 3SJSA 2L2CA 2WC6A 2LV7A 2O60A 1AP4A 2JU0A 1LKJA 1S6IA 3PSRA 5CSIA 1OMRA 4MLWA 1TIZA 4A4CA 4PCWA 1KQMB 3GK1A 4D1EA 4NQGA 2MLEC 1NP8A 3RM1A 3VRPA 1EH2A 2OS8C 1SW8A 1IQ3A 2L2EA 2BKIB 1OMDA 1Y1AA 4DS7A 5I2QA 1DC1A 2H61A 4MEWA 4U8DA 3KPXA 1ORGA 3BQ3A 1IKUA 4JPZB 3RLZA 5EL2A 4AOMA 2ZRSA 3CZ0A 1IJ5A 2K0JA 1KK8C 3O78A 3EG5B 4F0ZB 1SCVA 2IS9A 4PHKA 2K2FA 1KFUS 2MRDA 4CFQA 3LK1A 2LNKA 2LVVA 1NX3A 2DOQA 2CCMA 3TZ1A 1UP5A 1UUSA 3BUWB 2JZIA 2OPOA 2EC6B 2HQ8A 3DZTA 5CSJA 2M0RA 1M46A 3R1OA 5FYXA 4E68A 2PYQA 4FQTA 3SG7A 1B4CA 4ICBA 2B1UA 2KBIA 3TS5C 1TTXA 4YI8A 1P28A 2BCXA 2COLB 5DKRA 1SMGA 1EG4A 1U5IB 5HKYA 1TNXA 1RFJA 2JPTA 3BFAA 1DMOA 3OX5A 5JJGA 2PVBA 3DF0B 3DVEA 4C0JA 2KI6C 2LHIA 1PRWA 2G9BA 1C3ZA 2HETA 3K1EA 2WCMA 4M2OA 1AHRA 2ZN9A 3FE8A 4TNCA 1JC2A 3I5HB 1EG3A 3CR5X 4FTGA 1SRAA 1A75A 2I94A 2M1KB 1KQVA 1ZOTB 1M45A 4AQIA 1YURA 1YTZC 2WNDA 1TUZA 1WLMA 4ORBB 2JULA 1DJXA 1LA0A 5DICA 3ZWHA 1CMGA 4PALA 2QEBA 1QX5B 1KWOB 2FCEA 4NDBA 1FF1A 1K90D 3DD4A 1K2HA 3OGNA 2M7LA 2CBLA 1J1EA 2KBMA 1XFRA 2KGBC 5I2LA 3CTNA 1KFUL 2Y5IA 3O4XA 3FE6A 3PN7C 2Y4QA 3KF9A 3CGAA 5DKQA 2P71A 3KEVA 1UURA 4MSPA 3KO0A 3JTDC 4NDDA 2GGMA 3L4AA 1Y0VH 2M8UA 2H61C 2PQLA 1NX1A 3AKBA 3CR4X 1IIOA 3S0AA 1CKKA 3I5GB 3PM2A 3B87A 2FOTA 4HSZA 4PT1A 1D1OA 3BJHA 4I5NB 3JVTB 3PFVA 3WHTB 1WDCC 1B8LA 2KOTA 2CXJA 4OV2A 1WY9A 3O6BA 3VROA 3OBVA 2K7DA 1WRLA 1K96A 1RWYA 1DJWA 3L47A 1SL7A 4ORAB 1S6CA 2F8PA 4QJ3B 4BY5A 2D8NA 1SR6C 5FI2A 1XFZO 1LXFC 4MZJA 5AERA 1C7WA 2P6BB 3SG6A 3DVJA 4ORCB 2AMIA 1XFWO 3I5FB 2JNFA 3M0WA 1EXRA 2KFHA 1BOCA 2KAVA 3BUMB 1DELA 1DF0B 3IVTA 1TRFA 4MVFA 2JQ6A 1HT9A 2KI4C 4JWQA 4YGCB 1C07A 3UNWA 1IH0A 2MJWB 2ISDA 1AJ4A 1TCOB 3CZ2A 4A4BA 1QV0A 3GK2A 1IQ5A 1TNPA 2Y1NA 2L5YA 5DKNA 3SG5A 1C7VA 1OW4A 1NPQA 4OKHA 4XYNA 1BR1B 2ZNDA 3NSOA 4MZLA 4GGFC 2QDIA 3PALA 3NHTA 1A03A 1U5IA 3I5IB 1EJ3A 1J1DA 2I18A 2KFFA 1DGVA 1ODBA 4MZKA 2GV5A 3DF0A 1XFXO 1DJZA 1SCMC 1XVJA 1QJTA 1ZUZA 1DGUA 2LUXA 1CMFA 1QX2A 3EKJA 2KNEA 4PHJA 3V2LA 1SL8A 1UWOA 2BNXA 1CFDA 4GPLB 1OOIX 1G33A 2ZNEA 4QJ4B 2ZRTA 1TWOA 2LANA 1NCYA 1CDNA 4GBAA 4CIDA 1CFPA 4M2PA 2JRFA 2PMYA 3O2PA 4F7FA 1BF5A 1TNWA 2BE4A 3BFBA 3ICBA 3OHMB 1QIWA 2I2RE 1NYAA 1MXEA 3SG2A 4PE7A 3FE9A 4JQ0D 3D76A 2JTZA 2QPTA 3OB2B 4CFRA 1YUSA 3H4SE 3WHUB 4ZCVA 2GGZA 3LK0A 5CSNA 1JF0A 1TOPA 2F2OA 1C3YA 2LLSA 1K93D 1K94A 2BKHB 2PRUA 3K21A 3SIAA 1IGVA 5B8IB 2CTNA 2G2BA 3AKAA 2KDHA 1A4PA 2GTEA 2BBMA 3D75A 3IQOA 1X02A 1B8RA 1TNQA 2MA2A 1MQ1A 3A8RA 4INXA 4WQ3A 4QJ5B 4R1EA 1OOFA 1F55A 1CB1A 5TNCA 1LINA 2YGUA 2ZN8A 3SG4A 2LVIA 1XK4A 1FI6A 2KAXA 1NIWA 3AAKA 3CZTX 3C1VA 2E30A 4C0LA 1XO5A 1MWNA 1OSAA 1J7RA 1V1GA 2SCPA 3EKHA 2EC6C 5HKZA 1CLMA 3VRRA 3LL8B 3CZ1A 1BMOA 4N1GA 1M39A 1BR4B 4HREE 4PE4A 2EHBA 2M1UA 1SBJA 1QV1A 1CM1A 3SS3A 1FI5A 3D77A 2FJUB 2KGRA 4N5XA 1BODA 4ZCUA 1QX7A 3AAJA 3LLEA 5BPJA 2KYCA 2JPOA 3TUYB 2WCFA 5AXIA 3VRQA 4CPVA 2BAPA 1WRKA 1Y1XA 2Y1MA 3OP0A 1DF0A 1CFFA 3IF7A 1W7IB 1R2UA 1MHOA 2BL0B 3BUXB 2WC5A 1DJIA 1N2DA 2I7AA 2LHLA 2R2IA 4GAOA 1IRJA 2H8VA 4MRXA 1IG5A 1MF8B 1KK7Z 1QASA 5HKWA 3QRXA 1A29A 1B7TZ 2JC2A 1NCXA 1Z4HA 2LMUA 3I5HC 1T14A 1R6PA 1GGZA 1KK7Y 1N0YA 1B7TY 2Q4UA 3D73A 1OOHA 2WCBA 1K9PA 3NSKA 1SK6D 5KTYA 2MBXA 2BCAA 4PDZA 1TCFA 4XJKB 2EGDA 5HLVA 1BU3A 1K9KA 3NXAA 1AVSA 1XFVO 2L4HA 3CR2A 4Q04A 2K7CA 1KWOC 4L9MA 4MN0A 2F2PA 1FW4A 2WC8A 2K7BA 1RK9A 2F3ZA 1PULA 5HYDA 2L51A 1JFJA 1NX2A 1F4OA 3A4UB 1F70A 3E3RA 2H2KA 4DUQA 1KSMA 1N65A 1PSBA 1L2OB 5KSZA 4DCKA 1K9UA 1UHNA 3O4YA 3BUNB 1QWVA 3I5GC 4JD9A 3CS1A 3OB1B 3JVTC 3WNXB 1G4YR 2LC5A 2NCOA 3HX4A 3NSLA 4YBHB 1JWDA 1QTXA 1PK0D 3KHEA 3R1VA 1QLKA 1NCZA 5HLOA 2KAYA 3CABA 4PHMA 2KHNA 2LM5A 2OTGB 5I94A 1CLLA 1OMVA 5AEQA 1F54A 1BG1A 4YGBB 2JXLA 2KI4B 4YGDB 1NX0A 2WCEA 3LCPC 4HRHA 4OCIA 2NCPA 3I5FC 3CWGA 4GNKB 3CDNA 4NDCA 5ER5A 5JOLA 3ZNIA 4ETOA 2MLFC 3GOFA 1ALVA 3EK4A 2LP3A 1SPYA 5HL1A 5D69A 3F45A 2FCDA 1GQMA 3L4LA 3BUOB 1K8UA 1M31A 2BBNA 2L4IA 4GFTA 4USLA 1CDLA 1UHIA 5J3XA 1YRTB 1OOJA 3FWBA 4OVNF 3VB1A 2L0PA 1SCMB 3DVMA 5PALA 2LLTA 2F3YA 3B6XA 3PLFB 3I5IC 1MR8A 2P70A 3HCMA 1QVIZ 3B7AA 2LAPA 2KLEA 1RECA 1SSEB 1DJGA 3BFHA 1JF2A 1TN4A 3SS4A 1QVIY 1UHHA 2KI6D 1F71A 3DYEA 2M7NA 2CNPA 5G08A 2M97A 1PALA 5K89A 1ZMZA 2LMVA 2OS8B 3N7HA 2JT0A 1Q80A 1YUTA 3BOWB 1S6JA 1YRUB 4JKTA 1KQMC 3NHIA 1PSRA 1WRZA 3BXKA 3EK7A 3MSEB 4N1FA 1KFXL 2LCPA 1H8BA 4XJKA 2ERBA 2BECA 3EVRA 4KYNA 1KK8B 2KFGA 2JT3A 3R72A 2PSRA 5F6TA 1B9AA
chains in the Genus database with same CATH topology
2LMTA 1K95A 3PM8A 5GQQC 2LE9B 4C0KA 3VRNA 1OQPA 4I5LB 1YVHA 4I5KA 1CLBA 4IL1A 4M2QA 2L5XB 1DTLA 3GK4X 1L7ZA 1NUBA 2MAZA 4PE1A 1EL4A 2QACA 5I8NA 1JUOA 3D10A 3TS5B 2NZ0A 2WOSA 1CDMA 1JFKA 2AAOA 1PVBA 1YX7A 2K8MB 2ZKMX 2SASA 1SYMA 1IJ6A 1XFUO 1XFYO 3VGOA 1DJHA 1SKTA 1J55A 2KSPA 1SY9A 1JSAA 4YRUA 3TDIA 2JOJA 4YI9A 2JT8A 3SG3A 1QATA 1QXPA 1AUIB 3PATA 3TDUA 2KQ6A 1S5GZ 1BT6A 2O5GA 3WXAA 3D0YB 5I2OA 2A4JA 1FPWA 1S5GY 2JNXA 1CDPA 2E6WA 1SL9A 1MUXA 2PALA 5KU1A 2TN4A 1XYDA 2NLNA 3TUYC 1M63B 1S3PA 2BL0C 5CPVA 1J7QA 2L50A 4CLNA 3FIAA 3PN7B 1AJ5A 1CTRA 2ZFDA 4GGNA 4PHNA 4I5JA 2K61A 4YGEB 1NWDA 4MBEA 1UHKA 1YUUA 3JTDB 4GGFA 5AFPA 4P5OE 1A2XA 1ZACA 2JWWA 2VRGA 2M49B 1J7OA 2M9GA 1S1EA 3FS7A 3FWCA 4DIRA 1BLQA 4YGAA 1V1FA 1GGWA 2PASA 1CM4A 3IQQA 2BCBA 1BJFA 1RTP1 2WORA 1WDCB 4PE0A 3OX6A 1JBAA 2Q91A 3DVKA 2K7OA 1YVLA 3CLNA 4GUKA 1VRKA 1J7PA 4MRYA 2LLUA 1OE9B 2KQYA 3BYAA 2LVKA 5D7FA 1YX8A 3BOWA 1NSHA 1RROA 1PVAA 1XK4C 3EVVA 1OZOA 5IBWA 1SR6B 2HF5A 1L2OC 1DJYA 2LUCA 2JXCA 1MXLC 1DVIA 1QLSA 1F4QA 1KFXS 1B8CA 1OZSA 2MHHA 3EVUA 3SIBA 1QIVA 4AQJA 2KYFA 1YR5A 1GJYA 3NSIA 2CT9A 2HQWA 1G8IA 1RJVA 2HPSA 4HRGA 2LVJA 5ER4X 4FQOA 2BE6A 2AUCA 4BY4A 3TDZA 1CNPA 4UPGA 1HQVA 4OR9B 1E8AA 2F33A 1Y1UA 5AANA 1S26D 1A75B 2OTGC 1B1GA 2M3WA 2RGIA 3EK8A 1UHJA 4WQ2A 4WRIA 2NXQA 1LVCD 1F8HA 1S36A 1ALWA 1QS7A 1B47A 1H4BA 4DRWA 1IWQA 2L98A 1CFCA 1W7JB 2V53A 2M29A 1DT7B 1Y6WA 1AK8A 3D0YA 1WLZA 1XA5A 5CSFA 2LP2A 2JTTA 1LA3A 1KSOA 1SNLA 4P2YB 1FBVA 2K2AA 1KCYA 1ZFSA 3SJSA 2LV7A 2O60A 1AP4A 2JU0A 1LKJA 1S6IA 3PSRA 5CSIA 1OMRA 4MLWA 1TIZA 4A4CA 4PCWA 1KQMB 3GK1A 4D1EA 4NQGA 2MLEC 1NP8A 3RM1A 3VRPA 1EH2A 2OS8C 1SW8A 1IQ3A 2L2EA 2BKIB 1OMDA 1Y1AA 4DS7A 5I2QA 2H61A 4MEWA 4U8DA 3KPXA 3BQ3A 1IKUA 4JPZB 3RLZA 4AOMA 2ZRSA 1IJ5A 2K0JA 1KK8C 3O78A 4F0ZB 1SCVA 2IS9A 4PHKA 2K2FA 1KFUS 2MRDA 4CFQA 3LK1A 2LNKA 2LVVA 1NX3A 2DOQA 2CCMA 3TZ1A 1UP5A 1UUSA 3BUWB 2JZIA 2OPOA 2EC6B 2HQ8A 5CSJA 2M0RA 1M46A 5FYXA 4E68A 3SG7A 1B4CA 4ICBA 2B1UA 2KBIA 3TS5C 1TTXA 4YI8A 2BCXA 2COLB 5DKRA 1SMGA 1EG4A 1U5IB 5HKYA 1TNXA 1RFJA 2JPTA 1DMOA 3OX5A 5JJGA 2PVBA 3DF0B 3DVEA 4C0JA 2KI6C 2LHIA 1PRWA 2G9BA 2HETA 4M2OA 1AHRA 2ZN9A 4TNCA 1JC2A 3I5HB 1EG3A 3CR5X 4FTGA 1SRAA 1A75A 2I94A 2M1KB 1KQVA 1ZOTB 1M45A 4AQIA 1YURA 1YTZC 2WNDA 1WLMA 4ORBB 2JULA 1DJXA 1LA0A 3ZWHA 1CMGA 4PALA 1QX5B 1KWOB 2FCEA 4NDBA 1FF1A 1K90D 3DD4A 1K2HA 2M7LA 2CBLA 1J1EA 2KBMA 2KGBC 5I2LA 3CTNA 1KFUL 2Y5IA 3PN7C 2Y4QA 3KF9A 3CGAA 5DKQA 3KEVA 1UURA 4MSPA 3KO0A 3JTDC 4NDDA 2GGMA 1Y0VH 2M8UA 2H61C 1NX1A 3AKBA 3CR4X 1CKKA 3I5GB 4HSZA 1D1OA 2FOTA 4I5NB 3JVTB 3PFVA 3WHTB 1WDCC 1B8LA 2KOTA 2CXJA 4OV2A 1WY9A 3O6BA 3VROA 2K7DA 1WRLA 1K96A 1RWYA 1DJWA 1SL7A 4ORAB 1S6CA 2F8PA 4QJ3B 4BY5A 2D8NA 1SR6C 1XFZO 1LXFC 4MZJA 5AERA 1C7WA 2P6BB 3SG6A 3DVJA 4ORCB 2AMIA 1XFWO 3I5FB 2JNFA 3M0WA 1EXRA 2KFHA 1BOCA 2KAVA 3BUMB 4MVFA 1DF0B 1TRFA 2JQ6A 1HT9A 2KI4C 4JWQA 4YGCB 1C07A 1IH0A 2MJWB 2ISDA 1AJ4A 1TCOB 4A4BA 1QV0A 3GK2A 1IQ5A 1TNPA 2Y1NA 5DKNA 3SG5A 1C7VA 4XYNA 1NPQA 4OKHA 1BR1B 2ZNDA 3NSOA 4MZLA 4GGFC 3PALA 1A03A 1U5IA 3I5IB 1EJ3A 1J1DA 2I18A 2KFFA 1DGVA 1ODBA 4MZKA 2GV5A 3DF0A 1XFXO 1DJZA 1SCMC 1XVJA 1QJTA 1ZUZA 1DGUA 2LUXA 1CMFA 1QX2A 3EKJA 2KNEA 4PHJA 1SL8A 1UWOA 1CFDA 4GPLB 1G33A 2ZNEA 4QJ4B 2ZRTA 2LANA 1NCYA 1CDNA 4GBAA 4CIDA 1CFPA 4M2PA 2JRFA 2PMYA 3O2PA 1BF5A 1TNWA 2BE4A 3ICBA 3OHMB 1QIWA 2I2RE 1NYAA 1MXEA 3SG2A 4PE7A 4JQ0D 3OB2B 2JTZA 2QPTA 4CFRA 1YUSA 3H4SE 3WHUB 4ZCVA 2GGZA 3LK0A 5CSNA 1JF0A 1TOPA 2F2OA 2LLSA 1K93D 2BKHB 1K94A 2PRUA 3K21A 3SIAA 1IGVA 5B8IB 2CTNA 2G2BA 3AKAA 2KDHA 1A4PA 2BBMA 3IQOA 1X02A 1B8RA 1TNQA 2MA2A 1MQ1A 3A8RA 4WQ3A 4QJ5B 1F55A 4R1EA 1CB1A 5TNCA 1LINA 2ZN8A 3SG4A 2LVIA 1XK4A 1FI6A 2KAXA 1NIWA 3AAKA 3CZTX 3C1VA 2E30A 4C0LA 1XO5A 1MWNA 1OSAA 1J7RA 1V1GA 2SCPA 3EKHA 2EC6C 5HKZA 1CLMA 3VRRA 3LL8B 4N1GA 1BMOA 4PE4A 1M39A 1BR4B 4HREE 5D69A 2EHBA 2M1UA 1SBJA 1QV1A 1CM1A 1FI5A 2FJUB 2KGRA 4N5XA 1BODA 4ZCUA 1QX7A 3AAJA 3LLEA 5BPJA 2KYCA 3TUYB 3VRQA 2WCFA 5AXIA 4CPVA 4DCKA 1WRKA 1Y1XA 2Y1MA 3OP0A 1DF0A 1CFFA 3IF7A 1W7IB 1R2UA 1MHOA 2BL0B 3BUXB 1DJIA 1N2DA 2I7AA 2LHLA 2R2IA 4GAOA 1IRJA 4MRXA 1IG5A 1MF8B 1KK7Z 1QASA 5HKWA 3QRXA 1A29A 1B7TZ 2JC2A 1NCXA 2LMUA 3I5HC 1R6PA 1GGZA 1KK7Y 1N0YA 1B7TY 2Q4UA 2WCBA 1K9PA 3NSKA 1SK6D 5KTYA 2MBXA 2BCAA 4PDZA 1TCFA 4XJKB 2EGDA 5HLVA 1BU3A 1K9KA 3NXAA 1AVSA 1XFVO 2L4HA 3CR2A 4Q04A 2K7CA 1KWOC 4L9MA 4MN0A 2F2PA 1FW4A 2WC8A 2K7BA 1RK9A 2F3ZA 1PULA 5HYDA 2L51A 1JFJA 1NX2A 1F4OA 3A4UB 1F70A 3E3RA 2H2KA 4DUQA 1KSMA 1N65A 1PSBA 1L2OB 5KSZA 1K9UA 1UHNA 3O4YA 3BUNB 3I5GC 3CS1A 3OB1B 3JVTC 3WNXB 1G4YR 2LC5A 2NCOA 3HX4A 3NSLA 4YBHB 1JWDA 1QTXA 1PK0D 3KHEA 1QLKA 1NCZA 5HLOA 2KAYA 4PHMA 2KHNA 2LM5A 2OTGB 1CLLA 1OMVA 5AEQA 1F54A 1BG1A 4YGBB 2JXLA 2KI4B 4YGDB 1NX0A 2WCEA 3LCPC 4HRHA 4OCIA 2NCPA 3I5FC 3CWGA 4GNKB 4NDCA 5ER5A 5JOLA 3ZNIA 4ETOA 2MLFC 3GOFA 1ALVA 3EK4A 2LP3A 1SPYA 3F45A 2FCDA 1GQMA 3BUOB 1K8UA 1M31A 2BBNA 2L4IA 4GFTA 4USLA 1CDLA 1UHIA 5J3XA 1YRTB 1OOJA 3FWBA 4OVNF 2L0PA 1SCMB 3DVMA 5PALA 2LLTA 2F3YA 3PLFB 3I5IC 1MR8A 3HCMA 1QVIZ 2LAPA 1RECA 1DJGA 1JF2A 1TN4A 1F71A 1QVIY 1UHHA 2KI6D 2M7NA 2CNPA 5G08A 2M97A 1PALA 5K89A 1ZMZA 2LMVA 2OS8B 2JT0A 1Q80A 1YUTA 3BOWB 1S6JA 1YRUB 1KQMC 1PSRA 1WRZA 3BXKA 3EK7A 3MSEB 4N1FA 1KFXL 2LCPA 1H8BA 4XJKA 2BECA 3EVRA 1KK8B 2KFGA 2JT3A 2PSRA 5F6TA 1B9AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LMT A;  1K95 A;  3PM8 A;  5GQQ C;  2LE9 B;  4C0K A;  3VRN A;  1OQP A;  4I5L B;  1YVH A;  4I5K A;  1CLB A;  4IL1 A;  4M2Q A;  2L5X B;  1DTL A;  3GK4 X;  1L7Z A;  1NUB A;  2MAZ A;  4PE1 A;  1EL4 A;  2QAC A;  5I8N A;  1JUO A;  3D10 A;  3TS5 B;  2NZ0 A;  2WOS A;  1CDM A;  1JFK A;  2AAO A;  1PVB A;  1YX7 A;  2K8M B;  2ZKM X;  2SAS A;  1SYM A;  1IJ6 A;  1XFU O;  1XFY O;  3VGO A;  1DJH A;  1SKT A;  1J55 A;  2KSP A;  1SY9 A;  1JSA A;  4YRU A;  3TDI A;  2JOJ A;  4YI9 A;  2JT8 A;  3SG3 A;  1QAT A;  1QXP A;  1AUI B;  3PAT A;  3TDU A;  2KQ6 A;  1S5G Z;  1BT6 A;  2O5G A;  3WXA A;  3D0Y B;  5I2O A;  2A4J A;  1FPW A;  1S5G Y;  2JNX A;  1CDP A;  2E6W A;  1SL9 A;  1MUX A;  2PAL A;  5KU1 A;  2TN4 A;  1XYD A;  2NLN A;  3TUY C;  1M63 B;  1S3P A;  2BL0 C;  5CPV A;  1J7Q A;  2L50 A;  4CLN A;  3FIA A;  3PN7 B;  1AJ5 A;  1CTR A;  2ZFD A;  4GGN A;  4PHN A;  4I5J A;  2K61 A;  4YGE B;  1NWD A;  4MBE A;  1UHK A;  1YUU A;  3JTD B;  4GGF A;  5AFP A;  4P5O E;  1A2X A;  1ZAC A;  2JWW A;  2VRG A;  2M49 B;  1J7O A;  2M9G A;  1S1E A;  3FS7 A;  3FWC A;  4DIR A;  1BLQ A;  4YGA A;  1V1F A;  1GGW A;  2PAS A;  1CM4 A;  3IQQ A;  2BCB A;  1BJF A;  1RTP 1;  2WOR A;  1WDC B;  4PE0 A;  3OX6 A;  1JBA A;  2Q91 A;  3DVK A;  2K7O A;  1YVL A;  3CLN A;  4GUK A;  1VRK A;  1J7P A;  4MRY A;  2LLU A;  1OE9 B;  2KQY A;  3BYA A;  2LVK A;  5D7F A;  1YX8 A;  3BOW A;  1NSH A;  1RRO A;  1PVA A;  1XK4 C;  3EVV A;  1OZO A;  5IBW A;  1SR6 B;  2HF5 A;  1L2O C;  1DJY A;  2LUC A;  2JXC A;  1MXL C;  1DVI A;  1QLS A;  1F4Q A;  1KFX S;  1B8C A;  1OZS A;  2MHH A;  3EVU A;  3SIB A;  1QIV A;  4AQJ A;  2KYF A;  1YR5 A;  1GJY A;  3NSI A;  2CT9 A;  2HQW A;  1G8I A;  1RJV A;  2HPS A;  4HRG A;  2LVJ A;  5ER4 X;  4FQO A;  2BE6 A;  2AUC A;  4BY4 A;  3TDZ A;  1CNP A;  4UPG A;  1HQV A;  4OR9 B;  1E8A A;  2F33 A;  1Y1U A;  5AAN A;  1S26 D;  1A75 B;  2OTG C;  1B1G A;  2M3W A;  2RGI A;  3EK8 A;  1UHJ A;  4WQ2 A;  4WRI A;  2NXQ A;  1LVC D;  1F8H A;  1S36 A;  1ALW A;  1QS7 A;  1B47 A;  1H4B A;  4DRW A;  1IWQ A;  2L98 A;  1CFC A;  1W7J B;  2V53 A;  2M29 A;  1DT7 B;  1Y6W A;  1AK8 A;  3D0Y A;  1WLZ A;  1XA5 A;  5CSF A;  2LP2 A;  2JTT A;  1LA3 A;  1KSO A;  1SNL A;  4P2Y B;  1FBV A;  2K2A A;  1KCY A;  1ZFS A;  3SJS A;  2LV7 A;  2O60 A;  1AP4 A;  2JU0 A;  1LKJ A;  1S6I A;  3PSR A;  5CSI A;  1OMR A;  4MLW A;  1TIZ A;  4A4C A;  4PCW A;  1KQM B;  3GK1 A;  4D1E A;  4NQG A;  2MLE C;  1NP8 A;  3RM1 A;  3VRP A;  1EH2 A;  2OS8 C;  1SW8 A;  1IQ3 A;  2L2E A;  2BKI B;  1OMD A;  1Y1A A;  4DS7 A;  5I2Q A;  2H61 A;  4MEW A;  4U8D A;  3KPX A;  3BQ3 A;  1IKU A;  4JPZ B;  3RLZ A;  4AOM A;  2ZRS A;  1IJ5 A;  2K0J A;  1KK8 C;  3O78 A;  4F0Z B;  1SCV A;  2IS9 A;  4PHK A;  2K2F A;  1KFU S;  2MRD A;  4CFQ A;  3LK1 A;  2LNK A;  2LVV A;  1NX3 A;  2DOQ A;  2CCM A;  3TZ1 A;  1UP5 A;  1UUS A;  3BUW B;  2JZI A;  2OPO A;  2EC6 B;  2HQ8 A;  5CSJ A;  2M0R A;  1M46 A;  5FYX A;  4E68 A;  3SG7 A;  1B4C A;  4ICB A;  2B1U A;  2KBI A;  3TS5 C;  1TTX A;  4YI8 A;  2BCX A;  2COL B;  5DKR A;  1SMG A;  1EG4 A;  1U5I B;  5HKY A;  1TNX A;  1RFJ A;  2JPT A;  1DMO A;  3OX5 A;  5JJG A;  2PVB A;  3DF0 B;  3DVE A;  4C0J A;  2KI6 C;  2LHI A;  1PRW A;  2G9B A;  2HET A;  4M2O A;  1AHR A;  2ZN9 A;  4TNC A;  1JC2 A;  3I5H B;  1EG3 A;  3CR5 X;  4FTG A;  1SRA A;  1A75 A;  2I94 A;  2M1K B;  1KQV A;  1ZOT B;  1M45 A;  4AQI A;  1YUR A;  1YTZ C;  2WND A;  1WLM A;  4ORB B;  2JUL A;  1DJX A;  1LA0 A;  3ZWH A;  1CMG A;  4PAL A;  1QX5 B;  1KWO B;  2FCE A;  4NDB A;  1FF1 A;  1K90 D;  3DD4 A;  1K2H A;  2M7L A;  2CBL A;  1J1E A;  2KBM A;  2KGB C;  5I2L A;  3CTN A;  1KFU L;  2Y5I A;  3PN7 C;  2Y4Q A;  3KF9 A;  3CGA A;  5DKQ A;  3KEV A;  1UUR A;  4MSP A;  3KO0 A;  3JTD C;  4NDD A;  2GGM A;  1Y0V H;  2M8U A;  2H61 C;  1NX1 A;  3AKB A;  3CR4 X;  1CKK A;  3I5G B;  4HSZ A;  1D1O A;  2FOT A;  4I5N B;  3JVT B;  3PFV A;  3WHT B;  1WDC C;  1B8L A;  2KOT A;  2CXJ A;  4OV2 A;  1WY9 A;  3O6B A;  3VRO A;  2K7D A;  1WRL A;  1K96 A;  1RWY A;  1DJW A;  1SL7 A;  4ORA B;  1S6C A;  2F8P A;  4QJ3 B;  4BY5 A;  2D8N A;  1SR6 C;  1XFZ O;  1LXF C;  4MZJ A;  5AER A;  1C7W A;  2P6B B;  3SG6 A;  3DVJ A;  4ORC B;  2AMI A;  1XFW O;  3I5F B;  2JNF A;  3M0W A;  1EXR A;  2KFH A;  1BOC A;  2KAV A;  3BUM B;  4MVF A;  1DF0 B;  1TRF A;  2JQ6 A;  1HT9 A;  2KI4 C;  4JWQ A;  4YGC B;  1C07 A;  1IH0 A;  2MJW B;  2ISD A;  1AJ4 A;  1TCO B;  4A4B A;  1QV0 A;  3GK2 A;  1IQ5 A;  1TNP A;  2Y1N A;  5DKN A;  3SG5 A;  1C7V A;  4XYN A;  1NPQ A;  4OKH A;  1BR1 B;  2ZND A;  3NSO A;  4MZL A;  4GGF C;  3PAL A;  1A03 A;  1U5I A;  3I5I B;  1EJ3 A;  1J1D A;  2I18 A;  2KFF A;  1DGV A;  1ODB A;  4MZK A;  2GV5 A;  3DF0 A;  1XFX O;  1DJZ A;  1SCM C;  1XVJ A;  1QJT A;  1ZUZ A;  1DGU A;  2LUX A;  1CMF A;  1QX2 A;  3EKJ A;  2KNE A;  4PHJ A;  1SL8 A;  1UWO A;  1CFD A;  4GPL B;  1G33 A;  2ZNE A;  4QJ4 B;  2ZRT A;  2LAN A;  1NCY A;  1CDN A;  4GBA A;  4CID A;  1CFP A;  4M2P A;  2JRF A;  2PMY A;  3O2P A;  1BF5 A;  1TNW A;  2BE4 A;  3ICB A;  3OHM B;  1QIW A;  2I2R E;  1NYA A;  1MXE A;  3SG2 A;  4PE7 A;  4JQ0 D;  3OB2 B;  2JTZ A;  2QPT A;  4CFR A;  1YUS A;  3H4S E;  3WHU B;  4ZCV A;  2GGZ A;  3LK0 A;  5CSN A;  1JF0 A;  1TOP A;  2F2O A;  2LLS A;  1K93 D;  2BKH B;  1K94 A;  2PRU A;  3K21 A;  3SIA A;  1IGV A;  5B8I B;  2CTN A;  2G2B A;  3AKA A;  2KDH A;  1A4P A;  2BBM A;  3IQO A;  1X02 A;  1B8R A;  1TNQ A;  2MA2 A;  1MQ1 A;  3A8R A;  4WQ3 A;  4QJ5 B;  1F55 A;  4R1E A;  1CB1 A;  5TNC A;  1LIN A;  2ZN8 A;  3SG4 A;  2LVI A;  1XK4 A;  1FI6 A;  2KAX A;  1NIW A;  3AAK A;  3CZT X;  3C1V A;  2E30 A;  4C0L A;  1XO5 A;  1MWN A;  1OSA A;  1J7R A;  1V1G A;  2SCP A;  3EKH A;  2EC6 C;  5HKZ A;  1CLM A;  3VRR A;  3LL8 B;  4N1G A;  1BMO A;  4PE4 A;  1M39 A;  1BR4 B;  4HRE E;  5D69 A;  2EHB A;  2M1U A;  1SBJ A;  1QV1 A;  1CM1 A;  1FI5 A;  2FJU B;  2KGR A;  4N5X A;  1BOD A;  4ZCU A;  1QX7 A;  3AAJ A;  3LLE A;  5BPJ A;  2KYC A;  3TUY B;  3VRQ A;  2WCF A;  5AXI A;  4CPV A;  4DCK A;  1WRK A;  1Y1X A;  2Y1M A;  3OP0 A;  1DF0 A;  1CFF A;  3IF7 A;  1W7I B;  1R2U A;  1MHO A;  2BL0 B;  3BUX B;  1DJI A;  1N2D A;  2I7A A;  2LHL A;  2R2I A;  4GAO A;  1IRJ A;  4MRX A;  1IG5 A;  1MF8 B;  1KK7 Z;  1QAS A;  5HKW A;  3QRX A;  1A29 A;  1B7T Z;  2JC2 A;  1NCX A;  2LMU A;  3I5H C;  1R6P A;  1GGZ A;  1KK7 Y;  1N0Y A;  1B7T Y;  2Q4U A;  2WCB A;  1K9P A;  3NSK A;  1SK6 D;  5KTY A;  2MBX A;  2BCA A;  4PDZ A;  1TCF A;  4XJK B;  2EGD A;  5HLV A;  1BU3 A;  1K9K A;  3NXA A;  1AVS A;  1XFV O;  2L4H A;  3CR2 A;  4Q04 A;  2K7C A;  1KWO C;  4L9M A;  4MN0 A;  2F2P A;  1FW4 A;  2WC8 A;  2K7B A;  1RK9 A;  2F3Z A;  1PUL A;  5HYD A;  2L51 A;  1JFJ A;  1NX2 A;  1F4O A;  3A4U B;  1F70 A;  3E3R A;  2H2K A;  4DUQ A;  1KSM A;  1N65 A;  1PSB A;  1L2O B;  5KSZ A;  1K9U A;  1UHN A;  3O4Y A;  3BUN B;  3I5G C;  3CS1 A;  3OB1 B;  3JVT C;  3WNX B;  1G4Y R;  2LC5 A;  2NCO A;  3HX4 A;  3NSL A;  4YBH B;  1JWD A;  1QTX A;  1PK0 D;  3KHE A;  1QLK A;  1NCZ A;  5HLO A;  2KAY A;  4PHM A;  2KHN A;  2LM5 A;  2OTG B;  1CLL A;  1OMV A;  5AEQ A;  1F54 A;  1BG1 A;  4YGB B;  2JXL A;  2KI4 B;  4YGD B;  1NX0 A;  2WCE A;  3LCP C;  4HRH A;  4OCI A;  2NCP A;  3I5F C;  3CWG A;  4GNK B;  4NDC A;  5ER5 A;  5JOL A;  3ZNI A;  4ETO A;  2MLF C;  3GOF A;  1ALV A;  3EK4 A;  2LP3 A;  1SPY A;  3F45 A;  2FCD A;  1GQM A;  3BUO B;  1K8U A;  1M31 A;  2BBN A;  2L4I A;  4GFT A;  4USL A;  1CDL A;  1UHI A;  5J3X A;  1YRT B;  1OOJ A;  3FWB A;  4OVN F;  2L0P A;  1SCM B;  3DVM A;  5PAL A;  2LLT A;  2F3Y A;  3PLF B;  3I5I C;  1MR8 A;  3HCM A;  1QVI Z;  2LAP A;  1REC A;  1DJG A;  1JF2 A;  1TN4 A;  1F71 A;  1QVI Y;  1UHH A;  2KI6 D;  2M7N A;  2CNP A;  5G08 A;  2M97 A;  1PAL A;  5K89 A;  1ZMZ A;  2LMV A;  2OS8 B;  2JT0 A;  1Q80 A;  1YUT A;  3BOW B;  1S6J A;  1YRU B;  1KQM C;  1PSR A;  1WRZ A;  3BXK A;  3EK7 A;  3MSE B;  4N1F A;  1KFX L;  2LCP A;  1H8B A;  4XJK A;  2BEC A;  3EVR A;  1KK8 B;  2KFG A;  2JT3 A;  2PSR A;  5F6T A;  1B9A A; 
#chains in the Genus database with same CATH topology
 2LMT A;  1K95 A;  3PM8 A;  1Z2C B;  2LE9 B;  5GQQ C;  4C0K A;  3VRN A;  1OQP A;  4I5L B;  1YVH A;  4I5K A;  1CLB A;  4IL1 A;  4M2Q A;  2L5X B;  1DTL A;  3GK4 X;  1L7Z A;  1NUB A;  2MAZ A;  4PE1 A;  3D78 A;  1EL4 A;  2QAC A;  5I8N A;  3QME A;  1JUO A;  3D10 A;  3TS5 B;  3D74 A;  2NZ0 A;  2WOS A;  1CDM A;  1JFK A;  2AAO A;  1PVB A;  1YX7 A;  2K8M B;  1W9Z A;  2ZKM X;  2SAS A;  3RZS A;  1SYM A;  1IJ6 A;  1XFU O;  2WCL A;  4IJ7 A;  1XFY O;  3VGO A;  1DJH A;  1SKT A;  1J55 A;  3CYZ A;  2KSP A;  3B88 A;  1SY9 A;  1JSA A;  4YRU A;  3TDI A;  2JOJ A;  3DXL A;  4YI9 A;  2JT8 A;  3SG3 A;  1QAT A;  1QXP A;  1AUI B;  3PAT A;  3TDU A;  2KQ6 A;  1S5G Z;  2QEV A;  1BT6 A;  2O5G A;  3S0B A;  3WXA A;  1GM0 A;  3D0Y B;  5I2O A;  2A4J A;  1FPW A;  1S5G Y;  2JNX A;  1CDP A;  2E6W A;  1SL9 A;  1MUX A;  2PAL A;  4INW A;  5KU1 A;  2TN4 A;  1XYD A;  2NLN A;  3TUY C;  1M63 B;  1S3P A;  2BL0 C;  5CPV A;  1J7Q A;  2L50 A;  4CLN A;  3FIA A;  3PN7 B;  3Q8I A;  1AJ5 A;  1CTR A;  2ZFD A;  4GGN A;  4PHN A;  4I5J A;  2K61 A;  1TUJ A;  1NWD A;  4MBE A;  1UHK A;  1YUU A;  3JTD B;  4GGF A;  4YGE B;  5AFP A;  4P5O E;  1A2X A;  1ZAC A;  2JWW A;  2VRG A;  2FJY A;  2M49 B;  3S0D A;  2M9G A;  1J7O A;  1S1E A;  3FS7 A;  3FWC A;  5D3O A;  4DIR A;  1BLQ A;  4YGA A;  3NGV A;  1V1F A;  1GGW A;  2PAS A;  1CM4 A;  3R1P A;  3IQQ A;  2BCB A;  2K60 A;  1BJF A;  1RTP 1;  2WOR A;  5FI7 A;  1WDC B;  4PE0 A;  3OX6 A;  1JBA A;  2Q91 A;  3DVK A;  2K7O A;  1YVL A;  3CLN A;  4GUK A;  1VRK A;  1J7P A;  4MRY A;  2LLU A;  1OE9 B;  2WCK A;  2KQY A;  3BYA A;  2LVK A;  5D7F A;  1YX8 A;  3BOW A;  1NSH A;  1RRO A;  1PVA A;  1XK4 C;  3EVV A;  1OZO A;  5IBW A;  1SR6 B;  2HF5 A;  1L2O C;  1DJY A;  2LUC A;  2JXC A;  2WCJ A;  1MXL C;  1DVI A;  1QLS A;  1F4Q A;  1KFX S;  1B8C A;  1OZS A;  2MHH A;  3EVU A;  3SIB A;  1QIV A;  2KPH A;  2KYF A;  1YR5 A;  1GJY A;  3NSI A;  4AQJ A;  2CT9 A;  2HQW A;  1G8I A;  1RJV A;  2HPS A;  2WCH A;  4HRG A;  3S0F A;  1OOG A;  2LVJ A;  5ER4 X;  4FQO A;  1LS8 A;  2BE6 A;  2AUC A;  4BY4 A;  3TDZ A;  1CNP A;  2QEO A;  4UPG A;  1HQV A;  4OR9 B;  1E8A A;  2F33 A;  1Y1U A;  5AAN A;  1S26 D;  3S0E A;  3DY9 A;  1A75 B;  1DEK A;  2OTG C;  3S0G A;  1B1G A;  2M3W A;  2RGI A;  4OZD A;  2QEH A;  3EK8 A;  1UHJ A;  2KLD A;  4WQ2 A;  3UO9 A;  4WRI A;  2NXQ A;  1DQE A;  1LVC D;  3PJI A;  1F8H A;  1S36 A;  3SS5 A;  1ALW A;  1QS7 A;  1B47 A;  1H4B A;  4DRW A;  1IWQ A;  2L98 A;  1CFC A;  1W7J B;  2V53 A;  2M29 A;  3B86 A;  1DT7 B;  1Y6W A;  1AK8 A;  3D0Y A;  1WLZ A;  1XA5 A;  5CSF A;  2LP2 A;  2JTT A;  1LA3 A;  1KSO A;  1SNL A;  4P2Y B;  5FI6 A;  1FBV A;  2K2A A;  1KCY A;  1ZFS A;  3SJS A;  2L2C A;  2WC6 A;  2LV7 A;  2O60 A;  1AP4 A;  2JU0 A;  1LKJ A;  1S6I A;  3PSR A;  5CSI A;  1OMR A;  4MLW A;  1TIZ A;  4A4C A;  4PCW A;  1KQM B;  3GK1 A;  4D1E A;  4NQG A;  2MLE C;  1NP8 A;  3RM1 A;  3VRP A;  1EH2 A;  2OS8 C;  1SW8 A;  1IQ3 A;  2L2E A;  2BKI B;  1OMD A;  1Y1A A;  4DS7 A;  5I2Q A;  1DC1 A;  2H61 A;  4MEW A;  4U8D A;  3KPX A;  1ORG A;  3BQ3 A;  1IKU A;  4JPZ B;  3RLZ A;  5EL2 A;  4AOM A;  2ZRS A;  3CZ0 A;  1IJ5 A;  2K0J A;  1KK8 C;  3O78 A;  3EG5 B;  4F0Z B;  1SCV A;  2IS9 A;  4PHK A;  2K2F A;  1KFU S;  2MRD A;  4CFQ A;  3LK1 A;  2LNK A;  2LVV A;  1NX3 A;  2DOQ A;  2CCM A;  3TZ1 A;  1UP5 A;  1UUS A;  3BUW B;  2JZI A;  2OPO A;  2EC6 B;  2HQ8 A;  3DZT A;  5CSJ A;  2M0R A;  1M46 A;  3R1O A;  5FYX A;  4E68 A;  2PYQ A;  4FQT A;  3SG7 A;  1B4C A;  4ICB A;  2B1U A;  2KBI A;  3TS5 C;  1TTX A;  4YI8 A;  1P28 A;  2BCX A;  2COL B;  5DKR A;  1SMG A;  1EG4 A;  1U5I B;  5HKY A;  1TNX A;  1RFJ A;  2JPT A;  3BFA A;  1DMO A;  3OX5 A;  5JJG A;  2PVB A;  3DF0 B;  3DVE A;  4C0J A;  2KI6 C;  2LHI A;  1PRW A;  2G9B A;  1C3Z A;  2HET A;  3K1E A;  2WCM A;  4M2O A;  1AHR A;  2ZN9 A;  3FE8 A;  4TNC A;  1JC2 A;  3I5H B;  1EG3 A;  3CR5 X;  4FTG A;  1SRA A;  1A75 A;  2I94 A;  2M1K B;  1KQV A;  1ZOT B;  1M45 A;  4AQI A;  1YUR A;  1YTZ C;  2WND A;  1TUZ A;  1WLM A;  4ORB B;  2JUL A;  1DJX A;  1LA0 A;  5DIC A;  3ZWH A;  1CMG A;  4PAL A;  2QEB A;  1QX5 B;  1KWO B;  2FCE A;  4NDB A;  1FF1 A;  1K90 D;  3DD4 A;  1K2H A;  3OGN A;  2M7L A;  2CBL A;  1J1E A;  2KBM A;  1XFR A;  2KGB C;  5I2L A;  3CTN A;  1KFU L;  2Y5I A;  3O4X A;  3FE6 A;  3PN7 C;  2Y4Q A;  3KF9 A;  3CGA A;  5DKQ A;  2P71 A;  3KEV A;  1UUR A;  4MSP A;  3KO0 A;  3JTD C;  4NDD A;  2GGM A;  3L4A A;  1Y0V H;  2M8U A;  2H61 C;  2PQL A;  1NX1 A;  3AKB A;  3CR4 X;  1IIO A;  3S0A A;  1CKK A;  3I5G B;  3PM2 A;  3B87 A;  2FOT A;  4HSZ A;  4PT1 A;  1D1O A;  3BJH A;  4I5N B;  3JVT B;  3PFV A;  3WHT B;  1WDC C;  1B8L A;  2KOT A;  2CXJ A;  4OV2 A;  1WY9 A;  3O6B A;  3VRO A;  3OBV A;  2K7D A;  1WRL A;  1K96 A;  1RWY A;  1DJW A;  3L47 A;  1SL7 A;  4ORA B;  1S6C A;  2F8P A;  4QJ3 B;  4BY5 A;  2D8N A;  1SR6 C;  5FI2 A;  1XFZ O;  1LXF C;  4MZJ A;  5AER A;  1C7W A;  2P6B B;  3SG6 A;  3DVJ A;  4ORC B;  2AMI A;  1XFW O;  3I5F B;  2JNF A;  3M0W A;  1EXR A;  2KFH A;  1BOC A;  2KAV A;  3BUM B;  1DEL A;  1DF0 B;  3IVT A;  1TRF A;  4MVF A;  2JQ6 A;  1HT9 A;  2KI4 C;  4JWQ A;  4YGC B;  1C07 A;  3UNW A;  1IH0 A;  2MJW B;  2ISD A;  1AJ4 A;  1TCO B;  3CZ2 A;  4A4B A;  1QV0 A;  3GK2 A;  1IQ5 A;  1TNP A;  2Y1N A;  2L5Y A;  5DKN A;  3SG5 A;  1C7V A;  1OW4 A;  1NPQ A;  4OKH A;  4XYN A;  1BR1 B;  2ZND A;  3NSO A;  4MZL A;  4GGF C;  2QDI A;  3PAL A;  3NHT A;  1A03 A;  1U5I A;  3I5I B;  1EJ3 A;  1J1D A;  2I18 A;  2KFF A;  1DGV A;  1ODB A;  4MZK A;  2GV5 A;  3DF0 A;  1XFX O;  1DJZ A;  1SCM C;  1XVJ A;  1QJT A;  1ZUZ A;  1DGU A;  2LUX A;  1CMF A;  1QX2 A;  3EKJ A;  2KNE A;  4PHJ A;  3V2L A;  1SL8 A;  1UWO A;  2BNX A;  1CFD A;  4GPL B;  1OOI X;  1G33 A;  2ZNE A;  4QJ4 B;  2ZRT A;  1TWO A;  2LAN A;  1NCY A;  1CDN A;  4GBA A;  4CID A;  1CFP A;  4M2P A;  2JRF A;  2PMY A;  3O2P A;  4F7F A;  1BF5 A;  1TNW A;  2BE4 A;  3BFB A;  3ICB A;  3OHM B;  1QIW A;  2I2R E;  1NYA A;  1MXE A;  3SG2 A;  4PE7 A;  3FE9 A;  4JQ0 D;  3D76 A;  2JTZ A;  2QPT A;  3OB2 B;  4CFR A;  1YUS A;  3H4S E;  3WHU B;  4ZCV A;  2GGZ A;  3LK0 A;  5CSN A;  1JF0 A;  1TOP A;  2F2O A;  1C3Y A;  2LLS A;  1K93 D;  1K94 A;  2BKH B;  2PRU A;  3K21 A;  3SIA A;  1IGV A;  5B8I B;  2CTN A;  2G2B A;  3AKA A;  2KDH A;  1A4P A;  2GTE A;  2BBM A;  3D75 A;  3IQO A;  1X02 A;  1B8R A;  1TNQ A;  2MA2 A;  1MQ1 A;  3A8R A;  4INX A;  4WQ3 A;  4QJ5 B;  4R1E A;  1OOF A;  1F55 A;  1CB1 A;  5TNC A;  1LIN A;  2YGU A;  2ZN8 A;  3SG4 A;  2LVI A;  1XK4 A;  1FI6 A;  2KAX A;  1NIW A;  3AAK A;  3CZT X;  3C1V A;  2E30 A;  4C0L A;  1XO5 A;  1MWN A;  1OSA A;  1J7R A;  1V1G A;  2SCP A;  3EKH A;  2EC6 C;  5HKZ A;  1CLM A;  3VRR A;  3LL8 B;  3CZ1 A;  1BMO A;  4N1G A;  1M39 A;  1BR4 B;  4HRE E;  4PE4 A;  2EHB A;  2M1U A;  1SBJ A;  1QV1 A;  1CM1 A;  3SS3 A;  1FI5 A;  3D77 A;  2FJU B;  2KGR A;  4N5X A;  1BOD A;  4ZCU A;  1QX7 A;  3AAJ A;  3LLE A;  5BPJ A;  2KYC A;  2JPO A;  3TUY B;  2WCF A;  5AXI A;  3VRQ A;  4CPV A;  2BAP A;  1WRK A;  1Y1X A;  2Y1M A;  3OP0 A;  1DF0 A;  1CFF A;  3IF7 A;  1W7I B;  1R2U A;  1MHO A;  2BL0 B;  3BUX B;  2WC5 A;  1DJI A;  1N2D A;  2I7A A;  2LHL A;  2R2I A;  4GAO A;  1IRJ A;  2H8V A;  4MRX A;  1IG5 A;  1MF8 B;  1KK7 Z;  1QAS A;  5HKW A;  3QRX A;  1A29 A;  1B7T Z;  2JC2 A;  1NCX A;  1Z4H A;  2LMU A;  3I5H C;  1T14 A;  1R6P A;  1GGZ A;  1KK7 Y;  1N0Y A;  1B7T Y;  2Q4U A;  3D73 A;  1OOH A;  2WCB A;  1K9P A;  3NSK A;  1SK6 D;  5KTY A;  2MBX A;  2BCA A;  4PDZ A;  1TCF A;  4XJK B;  2EGD A;  5HLV A;  1BU3 A;  1K9K A;  3NXA A;  1AVS A;  1XFV O;  2L4H A;  3CR2 A;  4Q04 A;  2K7C A;  1KWO C;  4L9M A;  4MN0 A;  2F2P A;  1FW4 A;  2WC8 A;  2K7B A;  1RK9 A;  2F3Z A;  1PUL A;  5HYD A;  2L51 A;  1JFJ A;  1NX2 A;  1F4O A;  3A4U B;  1F70 A;  3E3R A;  2H2K A;  4DUQ A;  1KSM A;  1N65 A;  1PSB A;  1L2O B;  5KSZ A;  4DCK A;  1K9U A;  1UHN A;  3O4Y A;  3BUN B;  1QWV A;  3I5G C;  4JD9 A;  3CS1 A;  3OB1 B;  3JVT C;  3WNX B;  1G4Y R;  2LC5 A;  2NCO A;  3HX4 A;  3NSL A;  4YBH B;  1JWD A;  1QTX A;  1PK0 D;  3KHE A;  3R1V A;  1QLK A;  1NCZ A;  5HLO A;  2KAY A;  3CAB A;  4PHM A;  2KHN A;  2LM5 A;  2OTG B;  5I94 A;  1CLL A;  1OMV A;  5AEQ A;  1F54 A;  1BG1 A;  4YGB B;  2JXL A;  2KI4 B;  4YGD B;  1NX0 A;  2WCE A;  3LCP C;  4HRH A;  4OCI A;  2NCP A;  3I5F C;  3CWG A;  4GNK B;  3CDN A;  4NDC A;  5ER5 A;  5JOL A;  3ZNI A;  4ETO A;  2MLF C;  3GOF A;  1ALV A;  3EK4 A;  2LP3 A;  1SPY A;  5HL1 A;  5D69 A;  3F45 A;  2FCD A;  1GQM A;  3L4L A;  3BUO B;  1K8U A;  1M31 A;  2BBN A;  2L4I A;  4GFT A;  4USL A;  1CDL A;  1UHI A;  5J3X A;  1YRT B;  1OOJ A;  3FWB A;  4OVN F;  3VB1 A;  2L0P A;  1SCM B;  3DVM A;  5PAL A;  2LLT A;  2F3Y A;  3B6X A;  3PLF B;  3I5I C;  1MR8 A;  2P70 A;  3HCM A;  1QVI Z;  3B7A A;  2LAP A;  2KLE A;  1REC A;  1SSE B;  1DJG A;  3BFH A;  1JF2 A;  1TN4 A;  3SS4 A;  1QVI Y;  1UHH A;  2KI6 D;  1F71 A;  3DYE A;  2M7N A;  2CNP A;  5G08 A;  2M97 A;  1PAL A;  5K89 A;  1ZMZ A;  2LMV A;  2OS8 B;  3N7H A;  2JT0 A;  1Q80 A;  1YUT A;  3BOW B;  1S6J A;  1YRU B;  4JKT A;  1KQM C;  3NHI A;  1PSR A;  1WRZ A;  3BXK A;  3EK7 A;  3MSE B;  4N1F A;  1KFX L;  2LCP A;  1H8B A;  4XJK A;  2ERB A;  2BEC A;  3EVR A;  4KYN A;  1KK8 B;  2KFG A;  2JT3 A;  3R72 A;  2PSR A;  5F6T A;  1B9A A; 
#chains in the Genus database with same CATH homology
 2LMT A;  1K95 A;  3PM8 A;  5GQQ C;  2LE9 B;  4C0K A;  3VRN A;  1OQP A;  4I5L B;  1YVH A;  4I5K A;  1CLB A;  4IL1 A;  4M2Q A;  2L5X B;  1DTL A;  3GK4 X;  1L7Z A;  1NUB A;  2MAZ A;  4PE1 A;  1EL4 A;  2QAC A;  5I8N A;  1JUO A;  3D10 A;  3TS5 B;  2NZ0 A;  2WOS A;  1CDM A;  1JFK A;  2AAO A;  1PVB A;  1YX7 A;  2K8M B;  2ZKM X;  2SAS A;  1SYM A;  1IJ6 A;  1XFU O;  1XFY O;  3VGO A;  1DJH A;  1SKT A;  1J55 A;  2KSP A;  1SY9 A;  1JSA A;  4YRU A;  3TDI A;  2JOJ A;  4YI9 A;  2JT8 A;  3SG3 A;  1QAT A;  1QXP A;  1AUI B;  3PAT A;  3TDU A;  2KQ6 A;  1S5G Z;  1BT6 A;  2O5G A;  3WXA A;  3D0Y B;  5I2O A;  2A4J A;  1FPW A;  1S5G Y;  2JNX A;  1CDP A;  2E6W A;  1SL9 A;  1MUX A;  2PAL A;  5KU1 A;  2TN4 A;  1XYD A;  2NLN A;  3TUY C;  1M63 B;  1S3P A;  2BL0 C;  5CPV A;  1J7Q A;  2L50 A;  4CLN A;  3FIA A;  3PN7 B;  1AJ5 A;  1CTR A;  2ZFD A;  4GGN A;  4PHN A;  4I5J A;  2K61 A;  4YGE B;  1NWD A;  4MBE A;  1UHK A;  1YUU A;  3JTD B;  4GGF A;  5AFP A;  4P5O E;  1A2X A;  1ZAC A;  2JWW A;  2VRG A;  2M49 B;  1J7O A;  2M9G A;  1S1E A;  3FS7 A;  3FWC A;  4DIR A;  1BLQ A;  4YGA A;  1V1F A;  1GGW A;  2PAS A;  1CM4 A;  3IQQ A;  2BCB A;  1BJF A;  1RTP 1;  2WOR A;  1WDC B;  4PE0 A;  3OX6 A;  1JBA A;  2Q91 A;  3DVK A;  2K7O A;  1YVL A;  3CLN A;  4GUK A;  1VRK A;  1J7P A;  4MRY A;  2LLU A;  1OE9 B;  2KQY A;  3BYA A;  2LVK A;  5D7F A;  1YX8 A;  3BOW A;  1NSH A;  1RRO A;  1PVA A;  1XK4 C;  3EVV A;  1OZO A;  5IBW A;  1SR6 B;  2HF5 A;  1L2O C;  1DJY A;  2LUC A;  2JXC A;  1MXL C;  1DVI A;  1QLS A;  1F4Q A;  1KFX S;  1B8C A;  1OZS A;  2MHH A;  3EVU A;  3SIB A;  1QIV A;  4AQJ A;  2KYF A;  1YR5 A;  1GJY A;  3NSI A;  2CT9 A;  2HQW A;  1G8I A;  1RJV A;  2HPS A;  4HRG A;  2LVJ A;  5ER4 X;  4FQO A;  2BE6 A;  2AUC A;  4BY4 A;  3TDZ A;  1CNP A;  4UPG A;  1HQV A;  4OR9 B;  1E8A A;  2F33 A;  1Y1U A;  5AAN A;  1S26 D;  1A75 B;  2OTG C;  1B1G A;  2M3W A;  2RGI A;  3EK8 A;  1UHJ A;  4WQ2 A;  4WRI A;  2NXQ A;  1LVC D;  1F8H A;  1S36 A;  1ALW A;  1QS7 A;  1B47 A;  1H4B A;  4DRW A;  1IWQ A;  2L98 A;  1CFC A;  1W7J B;  2V53 A;  2M29 A;  1DT7 B;  1Y6W A;  1AK8 A;  3D0Y A;  1WLZ A;  1XA5 A;  5CSF A;  2LP2 A;  2JTT A;  1LA3 A;  1KSO A;  1SNL A;  4P2Y B;  1FBV A;  2K2A A;  1KCY A;  1ZFS A;  3SJS A;  2LV7 A;  2O60 A;  1AP4 A;  2JU0 A;  1LKJ A;  1S6I A;  3PSR A;  5CSI A;  1OMR A;  4MLW A;  1TIZ A;  4A4C A;  4PCW A;  1KQM B;  3GK1 A;  4D1E A;  4NQG A;  2MLE C;  1NP8 A;  3RM1 A;  3VRP A;  1EH2 A;  2OS8 C;  1SW8 A;  1IQ3 A;  2L2E A;  2BKI B;  1OMD A;  1Y1A A;  4DS7 A;  5I2Q A;  2H61 A;  4MEW A;  4U8D A;  3KPX A;  3BQ3 A;  1IKU A;  4JPZ B;  3RLZ A;  4AOM A;  2ZRS A;  1IJ5 A;  2K0J A;  1KK8 C;  3O78 A;  4F0Z B;  1SCV A;  2IS9 A;  4PHK A;  2K2F A;  1KFU S;  2MRD A;  4CFQ A;  3LK1 A;  2LNK A;  2LVV A;  1NX3 A;  2DOQ A;  2CCM A;  3TZ1 A;  1UP5 A;  1UUS A;  3BUW B;  2JZI A;  2OPO A;  2EC6 B;  2HQ8 A;  5CSJ A;  2M0R A;  1M46 A;  5FYX A;  4E68 A;  3SG7 A;  1B4C A;  4ICB A;  2B1U A;  2KBI A;  3TS5 C;  1TTX A;  4YI8 A;  2BCX A;  2COL B;  5DKR A;  1SMG A;  1EG4 A;  1U5I B;  5HKY A;  1TNX A;  1RFJ A;  2JPT A;  1DMO A;  3OX5 A;  5JJG A;  2PVB A;  3DF0 B;  3DVE A;  4C0J A;  2KI6 C;  2LHI A;  1PRW A;  2G9B A;  2HET A;  4M2O A;  1AHR A;  2ZN9 A;  4TNC A;  1JC2 A;  3I5H B;  1EG3 A;  3CR5 X;  4FTG A;  1SRA A;  1A75 A;  2I94 A;  2M1K B;  1KQV A;  1ZOT B;  1M45 A;  4AQI A;  1YUR A;  1YTZ C;  2WND A;  1WLM A;  4ORB B;  2JUL A;  1DJX A;  1LA0 A;  3ZWH A;  1CMG A;  4PAL A;  1QX5 B;  1KWO B;  2FCE A;  4NDB A;  1FF1 A;  1K90 D;  3DD4 A;  1K2H A;  2M7L A;  2CBL A;  1J1E A;  2KBM A;  2KGB C;  5I2L A;  3CTN A;  1KFU L;  2Y5I A;  3PN7 C;  2Y4Q A;  3KF9 A;  3CGA A;  5DKQ A;  3KEV A;  1UUR A;  4MSP A;  3KO0 A;  3JTD C;  4NDD A;  2GGM A;  1Y0V H;  2M8U A;  2H61 C;  1NX1 A;  3AKB A;  3CR4 X;  1CKK A;  3I5G B;  4HSZ A;  1D1O A;  2FOT A;  4I5N B;  3JVT B;  3PFV A;  3WHT B;  1WDC C;  1B8L A;  2KOT A;  2CXJ A;  4OV2 A;  1WY9 A;  3O6B A;  3VRO A;  2K7D A;  1WRL A;  1K96 A;  1RWY A;  1DJW A;  1SL7 A;  4ORA B;  1S6C A;  2F8P A;  4QJ3 B;  4BY5 A;  2D8N A;  1SR6 C;  1XFZ O;  1LXF C;  4MZJ A;  5AER A;  1C7W A;  2P6B B;  3SG6 A;  3DVJ A;  4ORC B;  2AMI A;  1XFW O;  3I5F B;  2JNF A;  3M0W A;  1EXR A;  2KFH A;  1BOC A;  2KAV A;  3BUM B;  4MVF A;  1DF0 B;  1TRF A;  2JQ6 A;  1HT9 A;  2KI4 C;  4JWQ A;  4YGC B;  1C07 A;  1IH0 A;  2MJW B;  2ISD A;  1AJ4 A;  1TCO B;  4A4B A;  1QV0 A;  3GK2 A;  1IQ5 A;  1TNP A;  2Y1N A;  5DKN A;  3SG5 A;  1C7V A;  4XYN A;  1NPQ A;  4OKH A;  1BR1 B;  2ZND A;  3NSO A;  4MZL A;  4GGF C;  3PAL A;  1A03 A;  1U5I A;  3I5I B;  1EJ3 A;  1J1D A;  2I18 A;  2KFF A;  1DGV A;  1ODB A;  4MZK A;  2GV5 A;  3DF0 A;  1XFX O;  1DJZ A;  1SCM C;  1XVJ A;  1QJT A;  1ZUZ A;  1DGU A;  2LUX A;  1CMF A;  1QX2 A;  3EKJ A;  2KNE A;  4PHJ A;  1SL8 A;  1UWO A;  1CFD A;  4GPL B;  1G33 A;  2ZNE A;  4QJ4 B;  2ZRT A;  2LAN A;  1NCY A;  1CDN A;  4GBA A;  4CID A;  1CFP A;  4M2P A;  2JRF A;  2PMY A;  3O2P A;  1BF5 A;  1TNW A;  2BE4 A;  3ICB A;  3OHM B;  1QIW A;  2I2R E;  1NYA A;  1MXE A;  3SG2 A;  4PE7 A;  4JQ0 D;  3OB2 B;  2JTZ A;  2QPT A;  4CFR A;  1YUS A;  3H4S E;  3WHU B;  4ZCV A;  2GGZ A;  3LK0 A;  5CSN A;  1JF0 A;  1TOP A;  2F2O A;  2LLS A;  1K93 D;  2BKH B;  1K94 A;  2PRU A;  3K21 A;  3SIA A;  1IGV A;  5B8I B;  2CTN A;  2G2B A;  3AKA A;  2KDH A;  1A4P A;  2BBM A;  3IQO A;  1X02 A;  1B8R A;  1TNQ A;  2MA2 A;  1MQ1 A;  3A8R A;  4WQ3 A;  4QJ5 B;  1F55 A;  4R1E A;  1CB1 A;  5TNC A;  1LIN A;  2ZN8 A;  3SG4 A;  2LVI A;  1XK4 A;  1FI6 A;  2KAX A;  1NIW A;  3AAK A;  3CZT X;  3C1V A;  2E30 A;  4C0L A;  1XO5 A;  1MWN A;  1OSA A;  1J7R A;  1V1G A;  2SCP A;  3EKH A;  2EC6 C;  5HKZ A;  1CLM A;  3VRR A;  3LL8 B;  4N1G A;  1BMO A;  4PE4 A;  1M39 A;  1BR4 B;  4HRE E;  5D69 A;  2EHB A;  2M1U A;  1SBJ A;  1QV1 A;  1CM1 A;  1FI5 A;  2FJU B;  2KGR A;  4N5X A;  1BOD A;  4ZCU A;  1QX7 A;  3AAJ A;  3LLE A;  5BPJ A;  2KYC A;  3TUY B;  3VRQ A;  2WCF A;  5AXI A;  4CPV A;  4DCK A;  1WRK A;  1Y1X A;  2Y1M A;  3OP0 A;  1DF0 A;  1CFF A;  3IF7 A;  1W7I B;  1R2U A;  1MHO A;  2BL0 B;  3BUX B;  1DJI A;  1N2D A;  2I7A A;  2LHL A;  2R2I A;  4GAO A;  1IRJ A;  4MRX A;  1IG5 A;  1MF8 B;  1KK7 Z;  1QAS A;  5HKW A;  3QRX A;  1A29 A;  1B7T Z;  2JC2 A;  1NCX A;  2LMU A;  3I5H C;  1R6P A;  1GGZ A;  1KK7 Y;  1N0Y A;  1B7T Y;  2Q4U A;  2WCB A;  1K9P A;  3NSK A;  1SK6 D;  5KTY A;  2MBX A;  2BCA A;  4PDZ A;  1TCF A;  4XJK B;  2EGD A;  5HLV A;  1BU3 A;  1K9K A;  3NXA A;  1AVS A;  1XFV O;  2L4H A;  3CR2 A;  4Q04 A;  2K7C A;  1KWO C;  4L9M A;  4MN0 A;  2F2P A;  1FW4 A;  2WC8 A;  2K7B A;  1RK9 A;  2F3Z A;  1PUL A;  5HYD A;  2L51 A;  1JFJ A;  1NX2 A;  1F4O A;  3A4U B;  1F70 A;  3E3R A;  2H2K A;  4DUQ A;  1KSM A;  1N65 A;  1PSB A;  1L2O B;  5KSZ A;  1K9U A;  1UHN A;  3O4Y A;  3BUN B;  3I5G C;  3CS1 A;  3OB1 B;  3JVT C;  3WNX B;  1G4Y R;  2LC5 A;  2NCO A;  3HX4 A;  3NSL A;  4YBH B;  1JWD A;  1QTX A;  1PK0 D;  3KHE A;  1QLK A;  1NCZ A;  5HLO A;  2KAY A;  4PHM A;  2KHN A;  2LM5 A;  2OTG B;  1CLL A;  1OMV A;  5AEQ A;  1F54 A;  1BG1 A;  4YGB B;  2JXL A;  2KI4 B;  4YGD B;  1NX0 A;  2WCE A;  3LCP C;  4HRH A;  4OCI A;  2NCP A;  3I5F C;  3CWG A;  4GNK B;  4NDC A;  5ER5 A;  5JOL A;  3ZNI A;  4ETO A;  2MLF C;  3GOF A;  1ALV A;  3EK4 A;  2LP3 A;  1SPY A;  3F45 A;  2FCD A;  1GQM A;  3BUO B;  1K8U A;  1M31 A;  2BBN A;  2L4I A;  4GFT A;  4USL A;  1CDL A;  1UHI A;  5J3X A;  1YRT B;  1OOJ A;  3FWB A;  4OVN F;  2L0P A;  1SCM B;  3DVM A;  5PAL A;  2LLT A;  2F3Y A;  3PLF B;  3I5I C;  1MR8 A;  3HCM A;  1QVI Z;  2LAP A;  1REC A;  1DJG A;  1JF2 A;  1TN4 A;  1F71 A;  1QVI Y;  1UHH A;  2KI6 D;  2M7N A;  2CNP A;  5G08 A;  2M97 A;  1PAL A;  5K89 A;  1ZMZ A;  2LMV A;  2OS8 B;  2JT0 A;  1Q80 A;  1YUT A;  3BOW B;  1S6J A;  1YRU B;  1KQM C;  1PSR A;  1WRZ A;  3BXK A;  3EK7 A;  3MSE B;  4N1F A;  1KFX L;  2LCP A;  1H8B A;  4XJK A;  2BEC A;  3EVR A;  1KK8 B;  2KFG A;  2JT3 A;  2PSR A;  5F6T A;  1B9A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...