1BLQA

Structure and interaction site of the regulatory domain of troponin-c when complexed with the 96-148 region of troponin-i, nmr, 29 structures
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
90
structure length
90
Chain Sequence
ASMTDQQAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-TROPONIN C
publication title Structure and interaction site of the regulatory domain of troponin-C when complexed with the 96-148 region of troponin-I.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Calcium-binding protein
total genus 11
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 1998-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1blqA00
2BKIB 4AQIA 3PFVA 1XA5A 1JFKA 1U5IB 1M31A 1S5GZ 1YUUA 2L4IA 4BY4A 4L9MA 3GOFA 2ZNEA 2KNEA 3BXKA 2NXQA 4TNCA 2CTNA 1RWYA 1QS7A 1TRFA 4D1EA 3I5FC 1PSBA 3SG2A 2VRGA 1CDNA 1FI5A 2JC2A 2K7DA 2K0JA 3AKAA 3NSOA 4AOMA 2QACA 1A2XA 3OX5A 1SNLA 5I2OA 5KU1A 1EJ3A 2K2AA 2LVKA 3EK7A 1J7OA 2KI4C 1BU3A 2LUXA 1SCVA 2LC5A 2CCMA 1KK7Z 1BJFA 1JUOA 1LINA 2MA2A 1YVHA 1NIWA 2ZFDA 4CIDA 4GGFC 1PVBA 2TN4A 2MAZA 3IQOA 4ZCVA 1YUTA 4C0LA 1LVCD 4FTGA 1A75B 4PE0A 5I2LA 4MSPA 1J7PA 4GFTA 4HSZA 4ORAB 2OS8C 1EXRA 3PALA 1CLLA 1M45A 4FQOA 2JNXA 1F54A 1S26D 5D69A 3SG7A 3TUYB 1K93D 2BBNA 1S6JA 2NLNA 1VRKA 1UHJA 4GAOA 4CPVA 2LMTA 3D0YA 1IQ3A 1AUIB 3O6BA 3OB1B 4R1EA 1JC2A 1RK9A 1IGVA 3IF7A 2JULA 2M9GA 1Y1XA 2JTZA 1DT7B 2JT0A 1SCMC 3DF0B 5DKNA 5D7FA 1IH0A 1DGUA 1NYAA 2E30A 2F2PA 4PDZA 2LMVA 1WRZA 1XK4A 1DJIA 1SPYA 3CLNA 3GK1A 1CDMA 1AVSA 4JQ0D 4MRYA 4N1GA 5HKYA 4WQ3A 4MZKA 1AJ5A 3BOWB 1JWDA 1S3PA 2NZ0A 3O78A 1WRKA 1LA3A 2ZKMX 3LK1A 2ZRTA 1B47A 3BUMB 4NDCA 4DRWA 3I5GB 1Y6WA 2O60A 1NX0A 2JWWA 4CFQA 1RECA 2G9BA 1CFCA 2KBIA 1WLZA 1F8HA 1TCFA 3JTDC 3VRNA 1PSRA 2HETA 1QV1A 3SIAA 5IBWA 1B8RA 4GNKB 3DVEA 1NX1A 2FCDA 3EK4A 1PULA 5KTYA 5AFPA 2NCPA 1XVJA 3GK2A 5FYXA 1NCXA 2COLB 1DTLA 2CBLA 1SBJA 2L5XB 4YGAA 4MLWA 2I94A 5G08A 1KQMC 2A4JA 4YGEB 4XJKA 2LLSA 1HQVA 5DKQA 2LHLA 3BUWB 1TIZA 2M49B 4N5XA 4PHNA 2LNKA 2NCOA 3D10A 3CR2A 1UWOA 1TNWA 2KYFA 2JXLA 1QVIZ 3I5HB 1KSMA 3PM8A 1QIVA 2LVJA 1DJYA 2LM5A 1KQVA 1ALWA 2JRFA 1LXFC 1F55A 3RLZA 5HYDA 1WY9A 2ZN8A 5BPJA 5AERA 2PMYA 4CFRA 3WNXB 2MRDA 1NCZA 1RJVA 1A29A 3PLFB 4U8DA 1ZUZA 1G8IA 4GUKA 2H61A 2GGMA 1F4QA 1IQ5A 3KEVA 1OE9B 3O2PA 4E68A 1SKTA 3CGAA 2ZRSA 1QATA 3SG3A 1JF0A 1N0YA 3BUOB 3LCPC 2HPSA 2KBMA 5GQQC 2BCBA 2LMUA 1DJZA 1IG5A 1GGWA 2KHNA 1DF0A 5I8NA 3BUXB 1TNQA 2M7NA 4YI9A 1BG1A 1KWOC 4YRUA 2F33A 2KSPA 1CMGA 1BF5A 1JSAA 1UURA 2HQWA 5DKRA 1F70A 1Y0VH 3FS7A 3OX6A 2AUCA 4YI8A 1BR4B 4P2YB 2F2OA 4Q04A 2BECA 2LAPA 4N1FA 1M63B 3TUYC 1D1OA 2F8PA 2M29A 1GJYA 3DVKA 1V1GA 4IL1A 4P5OE 1ZACA 2MLFC 1ZOTB 3PN7B 2BCAA 2EC6C 2KYCA 2MLEC 2WCEA 1NWDA 1XYDA 3H4SE 4YGDB 4I5NB 4DUQA 1DMOA 2I2RE 1MXEA 3VRQA 1J7QA 1K94A 1SRAA 1KK8B 1ODBA 1EL4A 1KWOB 1WDCC 1JBAA 1KCYA 1CKKA 2IS9A 1IRJA 3AKBA 2KI6D 4WQ2A 4OCIA 4OKHA 1H4BA 1OZOA 3ZWHA 1NPQA 2KI6C 1J7RA 1DJGA 2QPTA 1QX2A 1AJ4A 2Q4UA 3KF9A 2MHHA 4PE4A 1UHNA 2WNDA 4PE7A 1XFXO 4GPLB 4YBHB 2HQ8A 4NDDA 3WHTB 2EC6B 5AXIA 1W7JB 3I5GC 2M3WA 1BT6A 3D0YB 1DJXA 1WDCB 1J1DA 4PALA 1CFFA 2EHBA 5F6TA 1OSAA 2JXCA 1YR5A 1B7TZ 1S6IA 2WC8A 1RTP1 1N65A 1QV0A 1S36A 1YVLA 2M97A 1N2DA 1B4CA 1YX8A 3VRRA 4GGFA 4DS7A 2ZN9A 1K90D 1SL8A 3KPXA 3I5IB 3TS5B 1Y1AA 4PHJA 2Y1NA 1J1EA 5AANA 1KSOA 3LK0A 5CSNA 4OR9B 1KFXS 3EVRA 4ORBB 2KQYA 4PCWA 2KOTA 5ER4X 3DVJA 2CT9A 1OMVA 2KGBC 2Y1MA 3I5HC 1CMFA 1OOJA 3SG5A 1XFZO 1NSHA 1QLKA 3CS1A 5HLOA 3DD4A 1NX3A 2M0RA 1EH2A 1XO5A 2JOJA 2BL0B 3JVTB 4HRGA 1TCOB 2OTGC 3WXAA 4I5LB 1F4OA 2BCXA 1TNXA 3DVMA 1MQ1A 4ORCB 2K8MB 2P6BB 1R6PA 1K95A 2PSRA 2KDHA 1RFJA 4MVFA 5ER5A 5HKWA 1BMOA 1K96A 2E6WA 3CZTX 3PATA 3TDUA 2PALA 1CTRA 1M46A 1SR6C 3TDZA 3CTNA 3VGOA 3F45A 1CDLA 1MXLC 3VROA 4ETOA 1CLBA 2JT3A 3VRPA 4XJKB 1AK8A 3BUNB 3AAKA 1TN4A 2K61A 3OB2B 5HKZA 2M1KB 4A4CA 1B1GA 1C7VA 2OTGB 4OV2A 4AQJA 2LLUA 1IKUA 4USLA 2LLTA 5J3XA 3CWGA 2ZNDA 1CB1A 2O5GA 1L2OB 3OHMB 1ALVA 1L7ZA 2FCEA 1Q80A 4I5JA 4M2OA 3SG4A 1BOCA 1MR8A 2LV7A 1SR6B 1CFDA 3PN7C 1FBVA 4I5KA 2LUCA 1OMDA 3FWCA 1FI6A 1MHOA 1B9AA 4F0ZB 1MUXA 5PALA 4HRHA 1KK8C 2OPOA 2FOTA 2BE6A 1NX2A 2L2EA 2M8UA 3SIBA 2BE4A 1JFJA 2V53A 1DF0B 1ZMZA 3RM1A 2B1UA 3K21A 1U5IA 2FJUB 4DCKA 1YUSA 2PASA 5I2QA 2Y4QA 2KAVA 1DVIA 3M0WA 4MRXA 5TNCA 1BODA 1TTXA 1IJ6A 4UPGA 1Y1UA 1DJHA 2G2BA 3FWBA 1JF2A 4NDBA 1PVAA 2K7CA 1NUBA 1V1FA 1YRTB 1OMRA 1S5GY 1B8CA 1SK6D 2M7LA 4C0JA 4MZLA 3CR4X 1AP4A 3NXAA 5CSJA 2CNPA 2LVVA 4MBEA 1XFUO 1XFVO 2LCPA 1IJ5A 1UUSA 1K9UA 1CDPA 1WLMA 4BY5A 1XFYO 3QRXA 3KHEA 4MN0A 3EKHA 1J55A 4OVNF 4A4BA 2WCBA 3SJSA 4WRIA 2SASA 1FF1A 1XK4C 1X02A 2WCFA 3I5IC 3OP0A 3TS5C 1HT9A 1A75A 4PHMA 1YURA 1CLMA 2LP2A 3HCMA 4QJ4B 1CFPA 3CR5X 2JZIA 3I5FB 1MF8B 1C7WA 1KK7Y 2DOQA 1H8BA 1LKJA 2WORA 2AMIA 2L4HA 1FW4A 1TOPA 2H2KA 3ICBA 4ICBA 5JJGA 1CM4A 3LL8B 3TZ1A 2JNFA 2MBXA 3JVTC 2BL0C 2RGIA 2KFHA 2KGRA 3FIAA 5B8IB 3SG6A 2F3YA 2KI4B 2KAXA 1GQMA 2LP3A 1CM1A 1NP8A 2PVBA 5CSIA 3A4UB 1QX7A 5KSZA 1MWNA 2SCPA 1KFXL 5K89A 2F3ZA 5JOLA 2L50A 1UP5A 3DF0A 1QX5B 1CNPA 2KFGA 2EGDA 1YX7A 1QJTA 4PHKA 5CSFA 2AAOA 1YRUB 2LE9B 2LHIA 4C0KA 2KQ6A 1R2UA 2I18A 1S6CA 1SY9A 2GV5A 2K7BA 2LANA 3C1VA 1M39A 3BOWA 4GBAA 3GK4X 3MSEB 1EG4A 4NQGA 1QLSA 1ZFSA 2OS8B 1BR1B 1GGZA 1QTXA 3EVVA 3LLEA 4M2QA 1IWQA 2D8NA 1LA0A 4XYNA 5AEQA 1PRWA 1B7TY 1WRLA 4MEWA 3BQ3A 1UHKA 2LVIA 4JPZB 2WOSA 1YTZC 1G33A 1SL9A 2BBMA 1PK0D 2KAYA 1L2OC 1SL7A 1OZSA 1RROA 2Q91A 4YGBB 4QJ3B 3E3RA 2HF5A 3BYAA 1B8LA 3EVUA 3NSIA 1FPWA 2H61C 1SCMB 1QXPA 1PALA 1E8AA 2JTTA 2L51A 2PRUA 3IQQA 1SW8A 5CPVA 3TDIA 2JT8A 1DJWA 1TNPA 1A03A 2Y5IA 4ZCUA 2I7AA 4M2PA 1SMGA 2L0PA 3ZNIA 1K2HA 1C07A 3KO0A 3NSKA 2MJWB 2JQ6A 1UHIA 3O4YA 1NCYA 5HLVA 1K8UA 4YGCB 1W7IB 1K9KA 2K7OA 1A4PA 3AAJA 1BLQA 3EK8A 1SYMA 2K2FA 2KFFA 3NSLA 3WHUB 1F71A 1S1EA 2JPTA 3A8RA 3JTDB 4PE1A 1KFUL 1QASA 2ISDA 1QVIY 4QJ5B 4GGNA 4HREE 2R2IA 1UHHA 4DIRA 1QIWA 2M1UA 4CLNA 1AHRA 4JWQA 1KFUS 4MZJA 2JU0A 1K9PA 2BKHB 2CXJA 3EKJA 1EG3A 3PSRA 1G4YR 2GGZA 3HX4A 1XFWO 1OQPA 1KQMB 2L98A 1DGVA
chains in the Genus database with same CATH superfamily
2BKIB 4AQIA 4FQTA 3PFVA 1XA5A 1JFKA 1U5IB 1M31A 1S5GZ 1YUUA 2L4IA 4BY4A 4L9MA 3GOFA 2ZNEA 2KNEA 2QEHA 3L47A 3BXKA 2NXQA 4TNCA 2CTNA 1RWYA 1QS7A 1TRFA 4D1EA 3I5FC 1PSBA 3SG2A 2VRGA 3B87A 1CDNA 3BFHA 1FI5A 2JC2A 1DC1A 1IIOA 2K7DA 2K0JA 3AKAA 3FE6A 3NSOA 4AOMA 2QACA 1A2XA 3OX5A 4PT1A 1SNLA 5I2OA 5KU1A 1EJ3A 3D73A 2K2AA 2LVKA 3EK7A 1J7OA 2KI4C 2L5YA 5FI2A 1BU3A 2LUXA 1SCVA 3SS4A 2LC5A 2CCMA 1KK7Z 1BJFA 1JUOA 1LINA 2MA2A 1YVHA 1NIWA 2ZFDA 4CIDA 4GGFC 1PVBA 2TN4A 2MAZA 3IQOA 4ZCVA 1YUTA 4C0LA 1LVCD 4FTGA 1A75B 4PE0A 5I2LA 4MSPA 1J7PA 4GFTA 4HSZA 2KLDA 4ORAB 2OS8C 1EXRA 3PALA 1CLLA 1M45A 4FQOA 2JNXA 3S0AA 1F54A 1S26D 5D69A 3SG7A 3TUYB 1K93D 2BBNA 1S6JA 2NLNA 1VRKA 1UHJA 4GAOA 4CPVA 2LMTA 3L4LA 3D0YA 1IQ3A 1AUIB 3O6BA 3OB1B 4R1EA 1JC2A 1RK9A 1IGVA 3IF7A 2JULA 2M9GA 1Y1XA 1Z2CB 2JTZA 1DT7B 2JT0A 1SCMC 3DF0B 5DKNA 5D7FA 1IH0A 1DGUA 2K60A 2FJYA 1NYAA 2E30A 2F2PA 4PDZA 2ERBA 2LMVA 1WRZA 1XK4A 3DXLA 1DJIA 1SPYA 3CLNA 3GK1A 1CDMA 1AVSA 2WC6A 4JQ0D 4MRYA 4N1GA 5HKYA 4WQ3A 4MZKA 1AJ5A 3BOWB 1JWDA 1OOGA 1S3PA 2NZ0A 3O78A 1WRKA 1LA3A 2ZKMX 3LK1A 2ZRTA 1B47A 3BUMB 4NDCA 4DRWA 3I5GB 1Y6WA 2O60A 1NX0A 5HL1A 2JWWA 4CFQA 3V2LA 1RECA 2G9BA 2P71A 1CFCA 2KBIA 1P28A 1WLZA 1F8HA 1TCFA 3JTDC 3VRNA 1PSRA 5D3OA 2HETA 1ORGA 1QV1A 3SIAA 1OOIX 5IBWA 1B8RA 4GNKB 3BJHA 1NX1A 3DVEA 2FCDA 3EK4A 1PULA 5KTYA 5AFPA 2NCPA 1XVJA 3GK2A 5FYXA 1NCXA 1QWVA 2COLB 1DTLA 3SS3A 2CBLA 1SBJA 2L5XB 4YGAA 4MLWA 2I94A 5G08A 1KQMC 2A4JA 2GTEA 4YGEB 5DICA 4XJKA 2LLSA 1HQVA 5DKQA 2LHLA 3BUWB 1TIZA 2M49B 4N5XA 4PHNA 2LNKA 2NCOA 3D10A 3CR2A 1UWOA 1TNWA 2KYFA 2JXLA 1QVIZ 3I5HB 1KSMA 3PM8A 1QIVA 2LVJA 1DJYA 2LM5A 1KQVA 1ALWA 2JRFA 1LXFC 1F55A 3RLZA 5HYDA 1WY9A 2ZN8A 5BPJA 5AERA 2PMYA 4CFRA 3WNXB 2MRDA 1NCZA 1RJVA 1A29A 3PLFB 4U8DA 1ZUZA 1G8IA 2QDIA 4GUKA 2H61A 2GGMA 1F4QA 1IQ5A 3KEVA 1OE9B 3O2PA 4E68A 1SKTA 3CGAA 2ZRSA 1QATA 3SG3A 1JF0A 1N0YA 3BUOB 3LCPC 2QEVA 2HPSA 2KBMA 5GQQC 2BCBA 2LMUA 1DJZA 1IG5A 1GGWA 2KHNA 1DF0A 5I8NA 3BUXB 1TNQA 2M7NA 2PQLA 3OBVA 4YI9A 1BG1A 1KWOC 3DY9A 4YRUA 2F33A 2KSPA 3B6XA 1BF5A 1CMGA 1UURA 2HQWA 5DKRA 1F70A 1JSAA 1Y0VH 3FS7A 3OGNA 3OX6A 2AUCA 4YI8A 1BR4B 4P2YB 2F2OA 3R1OA 4OZDA 2BECA 4Q04A 3B88A 2LAPA 4N1FA 1M63B 3TUYC 3N7HA 2F8PA 1D1OA 2M29A 1GJYA 3DVKA 1V1GA 4IL1A 4P5OE 1ZACA 2MLFC 1ZOTB 3PN7B 2H8VA 2BCAA 2EC6C 2KYCA 2MLEC 2WCEA 1T14A 1NWDA 1XYDA 3H4SE 4YGDB 4I5NB 4DUQA 1DMOA 2I2RE 1MXEA 3VRQA 1J7QA 1K94A 3BFAA 1SRAA 1KK8B 1ODBA 1EL4A 1KWOB 1WDCC 1JBAA 1KCYA 1CKKA 2IS9A 1IRJA 3AKBA 2KI6D 1XFRA 3D74A 3PM2A 3CYZA 4OCIA 4WQ2A 4OKHA 1H4BA 1OZOA 3ZWHA 1NPQA 1TUZA 2KI6C 1J7RA 1DJGA 2QPTA 1QX2A 3BFBA 1AJ4A 2Q4UA 4KYNA 3KF9A 2MHHA 4PE4A 1UHNA 2WNDA 4PE7A 5I94A 1XFXO 2KLEA 3FE8A 4GPLB 4YBHB 2HQ8A 4NDDA 3WHTB 2EC6B 5AXIA 1W7JB 3I5GC 3B86A 3CZ1A 2M3WA 3IVTA 1BT6A 3CDNA 3D0YB 1DJXA 3S0DA 1WDCB 1J1DA 4PALA 1CFFA 2EHBA 5F6TA 1OSAA 2JXCA 1YR5A 1B7TZ 1S6IA 2WC8A 1RTP1 1N65A 1QV0A 1S36A 1YVLA 2M97A 2WCKA 1N2DA 1B4CA 1YX8A 3VRRA 4GGFA 4DS7A 2ZN9A 1K90D 1SL8A 3KPXA 2QEBA 3I5IB 2PYQA 1Y1AA 4PHJA 3TS5B 2Y1NA 1J1EA 5AANA 2P70A 1KSOA 3LK0A 5CSNA 2WC5A 4OR9B 3DZTA 1KFXS 3EVRA 4ORBB 2KQYA 4PCWA 1GM0A 2KOTA 5ER4X 3DVJA 2CT9A 1OMVA 2KGBC 2Y1MA 3I5HC 1CMFA 1OOJA 3SG5A 1XFZO 1NSHA 1QLKA 3CS1A 5HLOA 3DD4A 1NX3A 2M0RA 3S0BA 1EH2A 1XO5A 2JOJA 2BL0B 3JVTB 4HRGA 3FE9A 1TCOB 2OTGC 3WXAA 4I5LB 1F4OA 2BCXA 1TNXA 3DVMA 1MQ1A 2BNXA 4ORCB 2K8MB 2P6BB 2KPHA 1R6PA 1K95A 2PSRA 2KDHA 1RFJA 4MVFA 5ER5A 5HKWA 1BMOA 1K96A 2E6WA 3CZTX 3O4XA 3PATA 3TDUA 2PALA 1CTRA 1M46A 2QEOA 1DQEA 1SR6C 3TDZA 3CTNA 1OW4A 3QMEA 3VGOA 3F45A 1CDLA 1MXLC 3VROA 4ETOA 1CLBA 2JT3A 3VRPA 4XJKB 1AK8A 3BUNB 3AAKA 1TN4A 3L4AA 2K61A 3OB2B 5HKZA 2M1KB 4A4CA 1B1GA 1C7VA 2OTGB 5EL2A 4OV2A 4AQJA 3CABA 2LLUA 1IKUA 1W9ZA 4USLA 2LLTA 3UNWA 5J3XA 3CWGA 3NHIA 2ZNDA 3D77A 2O5GA 1CB1A 1TUJA 1L2OB 3OHMB 1ALVA 1L7ZA 2FCEA 3Q8IA 1Q80A 4I5JA 4M2OA 3SG4A 1BOCA 1MR8A 2LV7A 1SR6B 1CFDA 3PN7C 1FBVA 4I5KA 2LUCA 1OMDA 3FWCA 3CZ2A 1MHOA 1FI6A 1DELA 1B9AA 4F0ZB 1MUXA 5PALA 4HRHA 1KK8C 2OPOA 2FOTA 2BE6A 1NX2A 2L2EA 2M8UA 3SIBA 2BE4A 1JFJA 2V53A 1DF0B 1ZMZA 3RM1A 2B1UA 4F7FA 3K21A 1U5IA 2FJUB 4DCKA 1YUSA 2PASA 5I2QA 4INWA 2Y4QA 2KAVA 1DVIA 3M0WA 4MRXA 5TNCA 1BODA 5FI7A 1TTXA 3D75A 1IJ6A 4UPGA 1Y1UA 1DJHA 2G2BA 3FWBA 1JF2A 3CZ0A 4NDBA 1PVAA 1Z4HA 1NUBA 2K7CA 1V1FA 1YRTB 1OMRA 1S5GY 1B8CA 1SK6D 2M7LA 4C0JA 4MZLA 3CR4X 1AP4A 3NXAA 5CSJA 2CNPA 2LVVA 4MBEA 1XFUO 1XFVO 2LCPA 3R1VA 1IJ5A 1UUSA 1K9UA 1CDPA 1WLMA 3D78A 4BY5A 1XFYO 3QRXA 3KHEA 4MN0A 4INXA 2JPOA 3EKHA 1J55A 4OVNF 4A4BA 2WCBA 3SJSA 4WRIA 2SASA 1FF1A 1XK4C 1X02A 2WCFA 3I5IC 3OP0A 3TS5C 1HT9A 1A75A 4PHMA 1YURA 1CLMA 2LP2A 3HCMA 3S0GA 4QJ4B 1CFPA 3CR5X 2JZIA 3S0FA 3I5FB 1MF8B 1C7WA 1KK7Y 2DOQA 1H8BA 1LKJA 2WORA 2AMIA 2L4HA 1FW4A 1TOPA 2H2KA 3ICBA 2L2CA 4ICBA 5JJGA 1CM4A 3LL8B 3B7AA 2JNFA 2MBXA 1C3ZA 3TZ1A 3JVTC 2BL0C 2RGIA 2KFHA 2KGRA 3EG5B 3FIAA 3R1PA 3SG6A 1SSEB 5B8IB 2F3YA 2KI4B 2KAXA 1GQMA 2LP3A 1CM1A 1NP8A 2PVBA 5CSIA 3A4UB 1QX7A 5KSZA 1MWNA 2SCPA 1KFXL 5K89A 2BAPA 2F3ZA 5JOLA 2L50A 1UP5A 3DF0A 1QX5B 1CNPA 2KFGA 2EGDA 1TWOA 1YX7A 1QJTA 4PHKA 5CSFA 2AAOA 1YRUB 2LE9B 2LHIA 3NHTA 4C0KA 2KQ6A 1R2UA 2I18A 3NGVA 1S6CA 1SY9A 2GV5A 2K7BA 2LANA 3C1VA 1M39A 3SS5A 3BOWA 4GBAA 3GK4X 3MSEB 1EG4A 4NQGA 1QLSA 1ZFSA 2OS8B 1BR1B 1GGZA 1QTXA 3EVVA 3LLEA 2YGUA 1IWQA 4M2QA 4JD9A 2D8NA 1LA0A 4XYNA 5AEQA 1PRWA 1B7TY 1WRLA 4MEWA 3BQ3A 1UHKA 2LVIA 4JPZB 2WOSA 1YTZC 1G33A 1SL9A 1PK0D 2BBMA 2KAYA 3DYEA 3D76A 1L2OC 1SL7A 1OZSA 1RROA 3S0EA 2Q91A 4YGBB 4QJ3B 3E3RA 2HF5A 3K1EA 3BYAA 1B8LA 3EVUA 3NSIA 1FPWA 2H61C 1SCMB 1QXPA 1PALA 2WCMA 4IJ7A 1C3YA 1E8AA 2JTTA 2L51A 2PRUA 3IQQA 1SW8A 5CPVA 3TDIA 2WCLA 2JT8A 1DJWA 1TNPA 1A03A 2Y5IA 4ZCUA 2I7AA 4M2PA 1SMGA 2L0PA 3ZNIA 4JKTA 1K2HA 1C07A 3KO0A 1LS8A 3NSKA 3RZSA 2MJWB 2JQ6A 1UHIA 3O4YA 3R72A 1NCYA 5HLVA 1K8UA 4YGCB 1W7IB 1K9KA 2K7OA 3VB1A 3PJIA 1A4PA 3AAJA 1BLQA 3EK8A 1SYMA 2K2FA 2KFFA 3NSLA 2WCHA 3WHUB 1F71A 1S1EA 1OOFA 2JPTA 3A8RA 3JTDB 4PE1A 1KFUL 1QASA 5FI6A 3UO9A 2ISDA 1QVIY 4QJ5B 4GGNA 4HREE 2R2IA 1UHHA 4DIRA 1QIWA 2M1UA 4CLNA 1AHRA 4JWQA 1KFUS 4MZJA 2JU0A 1K9PA 2BKHB 2CXJA 3EKJA 1EG3A 3PSRA 2WCJA 1G4YR 2GGZA 1OOHA 3HX4A 1XFWO 1OQPA 1KQMB 2L98A 1DGVA 1DEKA
chains in the Genus database with same CATH topology
2BKIB 4AQIA 3PFVA 1XA5A 1JFKA 1U5IB 1M31A 1S5GZ 1YUUA 2L4IA 4BY4A 4L9MA 3GOFA 2ZNEA 2KNEA 3BXKA 2NXQA 4TNCA 2CTNA 1RWYA 1QS7A 1TRFA 4D1EA 3I5FC 1PSBA 3SG2A 2VRGA 1CDNA 1FI5A 2JC2A 2K7DA 2K0JA 3AKAA 3NSOA 4AOMA 2QACA 1A2XA 3OX5A 1SNLA 5I2OA 5KU1A 1EJ3A 2K2AA 2LVKA 3EK7A 1J7OA 2KI4C 1BU3A 2LUXA 1SCVA 2LC5A 2CCMA 1KK7Z 1BJFA 1JUOA 1LINA 2MA2A 1YVHA 1NIWA 2ZFDA 4CIDA 4GGFC 1PVBA 2TN4A 2MAZA 3IQOA 4ZCVA 1YUTA 4C0LA 1LVCD 4FTGA 1A75B 4PE0A 5I2LA 4MSPA 1J7PA 4GFTA 4HSZA 4ORAB 2OS8C 1EXRA 3PALA 1CLLA 1M45A 4FQOA 2JNXA 1F54A 1S26D 5D69A 3SG7A 3TUYB 1K93D 2BBNA 1S6JA 2NLNA 1VRKA 1UHJA 4GAOA 4CPVA 2LMTA 3D0YA 1IQ3A 1AUIB 3O6BA 3OB1B 4R1EA 1JC2A 1RK9A 1IGVA 3IF7A 2JULA 2M9GA 1Y1XA 2JTZA 1DT7B 2JT0A 1SCMC 3DF0B 5DKNA 5D7FA 1IH0A 1DGUA 1NYAA 2E30A 2F2PA 4PDZA 2LMVA 1WRZA 1XK4A 1DJIA 1SPYA 3CLNA 3GK1A 1CDMA 1AVSA 4JQ0D 4MRYA 4N1GA 5HKYA 4WQ3A 4MZKA 1AJ5A 3BOWB 1JWDA 1S3PA 2NZ0A 3O78A 1WRKA 1LA3A 2ZKMX 3LK1A 2ZRTA 1B47A 3BUMB 4NDCA 4DRWA 3I5GB 1Y6WA 2O60A 1NX0A 2JWWA 4CFQA 1RECA 2G9BA 1CFCA 2KBIA 1WLZA 1F8HA 1TCFA 3JTDC 3VRNA 1PSRA 2HETA 1QV1A 3SIAA 5IBWA 1B8RA 4GNKB 3DVEA 1NX1A 2FCDA 3EK4A 1PULA 5KTYA 5AFPA 2NCPA 1XVJA 3GK2A 5FYXA 1NCXA 2COLB 1DTLA 2CBLA 1SBJA 2L5XB 4YGAA 4MLWA 2I94A 5G08A 1KQMC 2A4JA 4YGEB 4XJKA 2LLSA 1HQVA 5DKQA 2LHLA 3BUWB 1TIZA 2M49B 4N5XA 4PHNA 2LNKA 2NCOA 3D10A 3CR2A 1UWOA 1TNWA 2KYFA 2JXLA 1QVIZ 3I5HB 1KSMA 3PM8A 1QIVA 2LVJA 1DJYA 2LM5A 1KQVA 1ALWA 2JRFA 1LXFC 1F55A 3RLZA 5HYDA 1WY9A 2ZN8A 5BPJA 5AERA 2PMYA 4CFRA 3WNXB 2MRDA 1NCZA 1RJVA 1A29A 3PLFB 4U8DA 1ZUZA 1G8IA 4GUKA 2H61A 2GGMA 1F4QA 1IQ5A 3KEVA 1OE9B 3O2PA 4E68A 1SKTA 3CGAA 2ZRSA 1QATA 3SG3A 1JF0A 1N0YA 3BUOB 3LCPC 2HPSA 2KBMA 5GQQC 2BCBA 2LMUA 1DJZA 1IG5A 1GGWA 2KHNA 1DF0A 5I8NA 3BUXB 1TNQA 2M7NA 4YI9A 1BG1A 1KWOC 4YRUA 2F33A 2KSPA 1CMGA 1BF5A 1JSAA 1UURA 2HQWA 5DKRA 1F70A 1Y0VH 3FS7A 3OX6A 2AUCA 4YI8A 1BR4B 4P2YB 2F2OA 4Q04A 2BECA 2LAPA 4N1FA 1M63B 3TUYC 1D1OA 2F8PA 2M29A 1GJYA 3DVKA 1V1GA 4IL1A 4P5OE 1ZACA 2MLFC 1ZOTB 3PN7B 2BCAA 2EC6C 2KYCA 2MLEC 2WCEA 1NWDA 1XYDA 3H4SE 4YGDB 4I5NB 4DUQA 1DMOA 2I2RE 1MXEA 3VRQA 1J7QA 1K94A 1SRAA 1KK8B 1ODBA 1EL4A 1KWOB 1WDCC 1JBAA 1KCYA 1CKKA 2IS9A 1IRJA 3AKBA 2KI6D 4WQ2A 4OCIA 4OKHA 1H4BA 1OZOA 3ZWHA 1NPQA 2KI6C 1J7RA 1DJGA 2QPTA 1QX2A 1AJ4A 2Q4UA 3KF9A 2MHHA 4PE4A 1UHNA 2WNDA 4PE7A 1XFXO 4GPLB 4YBHB 2HQ8A 4NDDA 3WHTB 2EC6B 5AXIA 1W7JB 3I5GC 2M3WA 1BT6A 3D0YB 1DJXA 1WDCB 1J1DA 4PALA 1CFFA 2EHBA 5F6TA 1OSAA 2JXCA 1YR5A 1B7TZ 1S6IA 2WC8A 1RTP1 1N65A 1QV0A 1S36A 1YVLA 2M97A 1N2DA 1B4CA 1YX8A 3VRRA 4GGFA 4DS7A 2ZN9A 1K90D 1SL8A 3KPXA 3I5IB 3TS5B 1Y1AA 4PHJA 2Y1NA 1J1EA 5AANA 1KSOA 3LK0A 5CSNA 4OR9B 1KFXS 3EVRA 4ORBB 2KQYA 4PCWA 2KOTA 5ER4X 3DVJA 2CT9A 1OMVA 2KGBC 2Y1MA 3I5HC 1CMFA 1OOJA 3SG5A 1XFZO 1NSHA 1QLKA 3CS1A 5HLOA 3DD4A 1NX3A 2M0RA 1EH2A 1XO5A 2JOJA 2BL0B 3JVTB 4HRGA 1TCOB 2OTGC 3WXAA 4I5LB 1F4OA 2BCXA 1TNXA 3DVMA 1MQ1A 4ORCB 2K8MB 2P6BB 1R6PA 1K95A 2PSRA 2KDHA 1RFJA 4MVFA 5ER5A 5HKWA 1BMOA 1K96A 2E6WA 3CZTX 3PATA 3TDUA 2PALA 1CTRA 1M46A 1SR6C 3TDZA 3CTNA 3VGOA 3F45A 1CDLA 1MXLC 3VROA 4ETOA 1CLBA 2JT3A 3VRPA 4XJKB 1AK8A 3BUNB 3AAKA 1TN4A 2K61A 3OB2B 5HKZA 2M1KB 4A4CA 1B1GA 1C7VA 2OTGB 4OV2A 4AQJA 2LLUA 1IKUA 4USLA 2LLTA 5J3XA 3CWGA 2ZNDA 1CB1A 2O5GA 1L2OB 3OHMB 1ALVA 1L7ZA 2FCEA 1Q80A 4I5JA 4M2OA 3SG4A 1BOCA 1MR8A 2LV7A 1SR6B 1CFDA 3PN7C 1FBVA 4I5KA 2LUCA 1OMDA 3FWCA 1FI6A 1MHOA 1B9AA 4F0ZB 1MUXA 5PALA 4HRHA 1KK8C 2OPOA 2FOTA 2BE6A 1NX2A 2L2EA 2M8UA 3SIBA 2BE4A 1JFJA 2V53A 1DF0B 1ZMZA 3RM1A 2B1UA 3K21A 1U5IA 2FJUB 4DCKA 1YUSA 2PASA 5I2QA 2Y4QA 2KAVA 1DVIA 3M0WA 4MRXA 5TNCA 1BODA 1TTXA 1IJ6A 4UPGA 1Y1UA 1DJHA 2G2BA 3FWBA 1JF2A 4NDBA 1PVAA 2K7CA 1NUBA 1V1FA 1YRTB 1OMRA 1S5GY 1B8CA 1SK6D 2M7LA 4C0JA 4MZLA 3CR4X 1AP4A 3NXAA 5CSJA 2CNPA 2LVVA 4MBEA 1XFUO 1XFVO 2LCPA 1IJ5A 1UUSA 1K9UA 1CDPA 1WLMA 4BY5A 1XFYO 3QRXA 3KHEA 4MN0A 3EKHA 1J55A 4OVNF 4A4BA 2WCBA 3SJSA 4WRIA 2SASA 1FF1A 1XK4C 1X02A 2WCFA 3I5IC 3OP0A 3TS5C 1HT9A 1A75A 4PHMA 1YURA 1CLMA 2LP2A 3HCMA 4QJ4B 1CFPA 3CR5X 2JZIA 3I5FB 1MF8B 1C7WA 1KK7Y 2DOQA 1H8BA 1LKJA 2WORA 2AMIA 2L4HA 1FW4A 1TOPA 2H2KA 3ICBA 4ICBA 5JJGA 1CM4A 3LL8B 3TZ1A 2JNFA 2MBXA 3JVTC 2BL0C 2RGIA 2KFHA 2KGRA 3FIAA 5B8IB 3SG6A 2F3YA 2KI4B 2KAXA 1GQMA 2LP3A 1CM1A 1NP8A 2PVBA 5CSIA 3A4UB 1QX7A 5KSZA 1MWNA 2SCPA 1KFXL 5K89A 2F3ZA 5JOLA 2L50A 1UP5A 3DF0A 1QX5B 1CNPA 2KFGA 2EGDA 1YX7A 1QJTA 4PHKA 5CSFA 2AAOA 1YRUB 2LE9B 2LHIA 4C0KA 2KQ6A 1R2UA 2I18A 1S6CA 1SY9A 2GV5A 2K7BA 2LANA 3C1VA 1M39A 3BOWA 4GBAA 3GK4X 3MSEB 1EG4A 4NQGA 1QLSA 1ZFSA 2OS8B 1BR1B 1GGZA 1QTXA 3EVVA 3LLEA 4M2QA 1IWQA 2D8NA 1LA0A 4XYNA 5AEQA 1PRWA 1B7TY 1WRLA 4MEWA 3BQ3A 1UHKA 2LVIA 4JPZB 2WOSA 1YTZC 1G33A 1SL9A 2BBMA 1PK0D 2KAYA 1L2OC 1SL7A 1OZSA 1RROA 2Q91A 4YGBB 4QJ3B 3E3RA 2HF5A 3BYAA 1B8LA 3EVUA 3NSIA 1FPWA 2H61C 1SCMB 1QXPA 1PALA 1E8AA 2JTTA 2L51A 2PRUA 3IQQA 1SW8A 5CPVA 3TDIA 2JT8A 1DJWA 1TNPA 1A03A 2Y5IA 4ZCUA 2I7AA 4M2PA 1SMGA 2L0PA 3ZNIA 1K2HA 1C07A 3KO0A 3NSKA 2MJWB 2JQ6A 1UHIA 3O4YA 1NCYA 5HLVA 1K8UA 4YGCB 1W7IB 1K9KA 2K7OA 1A4PA 3AAJA 1BLQA 3EK8A 1SYMA 2K2FA 2KFFA 3NSLA 3WHUB 1F71A 1S1EA 2JPTA 3A8RA 3JTDB 4PE1A 1KFUL 1QASA 2ISDA 1QVIY 4QJ5B 4GGNA 4HREE 2R2IA 1UHHA 4DIRA 1QIWA 2M1UA 4CLNA 1AHRA 4JWQA 1KFUS 4MZJA 2JU0A 1K9PA 2BKHB 2CXJA 3EKJA 1EG3A 3PSRA 1G4YR 2GGZA 3HX4A 1XFWO 1OQPA 1KQMB 2L98A 1DGVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BKI B;  4AQI A;  3PFV A;  1XA5 A;  1JFK A;  1U5I B;  1M31 A;  1S5G Z;  1YUU A;  2L4I A;  4BY4 A;  4L9M A;  3GOF A;  2ZNE A;  2KNE A;  3BXK A;  2NXQ A;  4TNC A;  2CTN A;  1RWY A;  1QS7 A;  1TRF A;  4D1E A;  3I5F C;  1PSB A;  3SG2 A;  2VRG A;  1CDN A;  1FI5 A;  2JC2 A;  2K7D A;  2K0J A;  3AKA A;  3NSO A;  4AOM A;  2QAC A;  1A2X A;  3OX5 A;  1SNL A;  5I2O A;  5KU1 A;  1EJ3 A;  2K2A A;  2LVK A;  3EK7 A;  1J7O A;  2KI4 C;  1BU3 A;  2LUX A;  1SCV A;  2LC5 A;  2CCM A;  1KK7 Z;  1BJF A;  1JUO A;  1LIN A;  2MA2 A;  1YVH A;  1NIW A;  2ZFD A;  4CID A;  4GGF C;  1PVB A;  2TN4 A;  2MAZ A;  3IQO A;  4ZCV A;  1YUT A;  4C0L A;  1LVC D;  4FTG A;  1A75 B;  4PE0 A;  5I2L A;  4MSP A;  1J7P A;  4GFT A;  4HSZ A;  4ORA B;  2OS8 C;  1EXR A;  3PAL A;  1CLL A;  1M45 A;  4FQO A;  2JNX A;  1F54 A;  1S26 D;  5D69 A;  3SG7 A;  3TUY B;  1K93 D;  2BBN A;  1S6J A;  2NLN A;  1VRK A;  1UHJ A;  4GAO A;  4CPV A;  2LMT A;  3D0Y A;  1IQ3 A;  1AUI B;  3O6B A;  3OB1 B;  4R1E A;  1JC2 A;  1RK9 A;  1IGV A;  3IF7 A;  2JUL A;  2M9G A;  1Y1X A;  2JTZ A;  1DT7 B;  2JT0 A;  1SCM C;  3DF0 B;  5DKN A;  5D7F A;  1IH0 A;  1DGU A;  1NYA A;  2E30 A;  2F2P A;  4PDZ A;  2LMV A;  1WRZ A;  1XK4 A;  1DJI A;  1SPY A;  3CLN A;  3GK1 A;  1CDM A;  1AVS A;  4JQ0 D;  4MRY A;  4N1G A;  5HKY A;  4WQ3 A;  4MZK A;  1AJ5 A;  3BOW B;  1JWD A;  1S3P A;  2NZ0 A;  3O78 A;  1WRK A;  1LA3 A;  2ZKM X;  3LK1 A;  2ZRT A;  1B47 A;  3BUM B;  4NDC A;  4DRW A;  3I5G B;  1Y6W A;  2O60 A;  1NX0 A;  2JWW A;  4CFQ A;  1REC A;  2G9B A;  1CFC A;  2KBI A;  1WLZ A;  1F8H A;  1TCF A;  3JTD C;  3VRN A;  1PSR A;  2HET A;  1QV1 A;  3SIA A;  5IBW A;  1B8R A;  4GNK B;  3DVE A;  1NX1 A;  2FCD A;  3EK4 A;  1PUL A;  5KTY A;  5AFP A;  2NCP A;  1XVJ A;  3GK2 A;  5FYX A;  1NCX A;  2COL B;  1DTL A;  2CBL A;  1SBJ A;  2L5X B;  4YGA A;  4MLW A;  2I94 A;  5G08 A;  1KQM C;  2A4J A;  4YGE B;  4XJK A;  2LLS A;  1HQV A;  5DKQ A;  2LHL A;  3BUW B;  1TIZ A;  2M49 B;  4N5X A;  4PHN A;  2LNK A;  2NCO A;  3D10 A;  3CR2 A;  1UWO A;  1TNW A;  2KYF A;  2JXL A;  1QVI Z;  3I5H B;  1KSM A;  3PM8 A;  1QIV A;  2LVJ A;  1DJY A;  2LM5 A;  1KQV A;  1ALW A;  2JRF A;  1LXF C;  1F55 A;  3RLZ A;  5HYD A;  1WY9 A;  2ZN8 A;  5BPJ A;  5AER A;  2PMY A;  4CFR A;  3WNX B;  2MRD A;  1NCZ A;  1RJV A;  1A29 A;  3PLF B;  4U8D A;  1ZUZ A;  1G8I A;  4GUK A;  2H61 A;  2GGM A;  1F4Q A;  1IQ5 A;  3KEV A;  1OE9 B;  3O2P A;  4E68 A;  1SKT A;  3CGA A;  2ZRS A;  1QAT A;  3SG3 A;  1JF0 A;  1N0Y A;  3BUO B;  3LCP C;  2HPS A;  2KBM A;  5GQQ C;  2BCB A;  2LMU A;  1DJZ A;  1IG5 A;  1GGW A;  2KHN A;  1DF0 A;  5I8N A;  3BUX B;  1TNQ A;  2M7N A;  4YI9 A;  1BG1 A;  1KWO C;  4YRU A;  2F33 A;  2KSP A;  1CMG A;  1BF5 A;  1JSA A;  1UUR A;  2HQW A;  5DKR A;  1F70 A;  1Y0V H;  3FS7 A;  3OX6 A;  2AUC A;  4YI8 A;  1BR4 B;  4P2Y B;  2F2O A;  4Q04 A;  2BEC A;  2LAP A;  4N1F A;  1M63 B;  3TUY C;  1D1O A;  2F8P A;  2M29 A;  1GJY A;  3DVK A;  1V1G A;  4IL1 A;  4P5O E;  1ZAC A;  2MLF C;  1ZOT B;  3PN7 B;  2BCA A;  2EC6 C;  2KYC A;  2MLE C;  2WCE A;  1NWD A;  1XYD A;  3H4S E;  4YGD B;  4I5N B;  4DUQ A;  1DMO A;  2I2R E;  1MXE A;  3VRQ A;  1J7Q A;  1K94 A;  1SRA A;  1KK8 B;  1ODB A;  1EL4 A;  1KWO B;  1WDC C;  1JBA A;  1KCY A;  1CKK A;  2IS9 A;  1IRJ A;  3AKB A;  2KI6 D;  4WQ2 A;  4OCI A;  4OKH A;  1H4B A;  1OZO A;  3ZWH A;  1NPQ A;  2KI6 C;  1J7R A;  1DJG A;  2QPT A;  1QX2 A;  1AJ4 A;  2Q4U A;  3KF9 A;  2MHH A;  4PE4 A;  1UHN A;  2WND A;  4PE7 A;  1XFX O;  4GPL B;  4YBH B;  2HQ8 A;  4NDD A;  3WHT B;  2EC6 B;  5AXI A;  1W7J B;  3I5G C;  2M3W A;  1BT6 A;  3D0Y B;  1DJX A;  1WDC B;  1J1D A;  4PAL A;  1CFF A;  2EHB A;  5F6T A;  1OSA A;  2JXC A;  1YR5 A;  1B7T Z;  1S6I A;  2WC8 A;  1RTP 1;  1N65 A;  1QV0 A;  1S36 A;  1YVL A;  2M97 A;  1N2D A;  1B4C A;  1YX8 A;  3VRR A;  4GGF A;  4DS7 A;  2ZN9 A;  1K90 D;  1SL8 A;  3KPX A;  3I5I B;  3TS5 B;  1Y1A A;  4PHJ A;  2Y1N A;  1J1E A;  5AAN A;  1KSO A;  3LK0 A;  5CSN A;  4OR9 B;  1KFX S;  3EVR A;  4ORB B;  2KQY A;  4PCW A;  2KOT A;  5ER4 X;  3DVJ A;  2CT9 A;  1OMV A;  2KGB C;  2Y1M A;  3I5H C;  1CMF A;  1OOJ A;  3SG5 A;  1XFZ O;  1NSH A;  1QLK A;  3CS1 A;  5HLO A;  3DD4 A;  1NX3 A;  2M0R A;  1EH2 A;  1XO5 A;  2JOJ A;  2BL0 B;  3JVT B;  4HRG A;  1TCO B;  2OTG C;  3WXA A;  4I5L B;  1F4O A;  2BCX A;  1TNX A;  3DVM A;  1MQ1 A;  4ORC B;  2K8M B;  2P6B B;  1R6P A;  1K95 A;  2PSR A;  2KDH A;  1RFJ A;  4MVF A;  5ER5 A;  5HKW A;  1BMO A;  1K96 A;  2E6W A;  3CZT X;  3PAT A;  3TDU A;  2PAL A;  1CTR A;  1M46 A;  1SR6 C;  3TDZ A;  3CTN A;  3VGO A;  3F45 A;  1CDL A;  1MXL C;  3VRO A;  4ETO A;  1CLB A;  2JT3 A;  3VRP A;  4XJK B;  1AK8 A;  3BUN B;  3AAK A;  1TN4 A;  2K61 A;  3OB2 B;  5HKZ A;  2M1K B;  4A4C A;  1B1G A;  1C7V A;  2OTG B;  4OV2 A;  4AQJ A;  2LLU A;  1IKU A;  4USL A;  2LLT A;  5J3X A;  3CWG A;  2ZND A;  1CB1 A;  2O5G A;  1L2O B;  3OHM B;  1ALV A;  1L7Z A;  2FCE A;  1Q80 A;  4I5J A;  4M2O A;  3SG4 A;  1BOC A;  1MR8 A;  2LV7 A;  1SR6 B;  1CFD A;  3PN7 C;  1FBV A;  4I5K A;  2LUC A;  1OMD A;  3FWC A;  1FI6 A;  1MHO A;  1B9A A;  4F0Z B;  1MUX A;  5PAL A;  4HRH A;  1KK8 C;  2OPO A;  2FOT A;  2BE6 A;  1NX2 A;  2L2E A;  2M8U A;  3SIB A;  2BE4 A;  1JFJ A;  2V53 A;  1DF0 B;  1ZMZ A;  3RM1 A;  2B1U A;  3K21 A;  1U5I A;  2FJU B;  4DCK A;  1YUS A;  2PAS A;  5I2Q A;  2Y4Q A;  2KAV A;  1DVI A;  3M0W A;  4MRX A;  5TNC A;  1BOD A;  1TTX A;  1IJ6 A;  4UPG A;  1Y1U A;  1DJH A;  2G2B A;  3FWB A;  1JF2 A;  4NDB A;  1PVA A;  2K7C A;  1NUB A;  1V1F A;  1YRT B;  1OMR A;  1S5G Y;  1B8C A;  1SK6 D;  2M7L A;  4C0J A;  4MZL A;  3CR4 X;  1AP4 A;  3NXA A;  5CSJ A;  2CNP A;  2LVV A;  4MBE A;  1XFU O;  1XFV O;  2LCP A;  1IJ5 A;  1UUS A;  1K9U A;  1CDP A;  1WLM A;  4BY5 A;  1XFY O;  3QRX A;  3KHE A;  4MN0 A;  3EKH A;  1J55 A;  4OVN F;  4A4B A;  2WCB A;  3SJS A;  4WRI A;  2SAS A;  1FF1 A;  1XK4 C;  1X02 A;  2WCF A;  3I5I C;  3OP0 A;  3TS5 C;  1HT9 A;  1A75 A;  4PHM A;  1YUR A;  1CLM A;  2LP2 A;  3HCM A;  4QJ4 B;  1CFP A;  3CR5 X;  2JZI A;  3I5F B;  1MF8 B;  1C7W A;  1KK7 Y;  2DOQ A;  1H8B A;  1LKJ A;  2WOR A;  2AMI A;  2L4H A;  1FW4 A;  1TOP A;  2H2K A;  3ICB A;  4ICB A;  5JJG A;  1CM4 A;  3LL8 B;  3TZ1 A;  2JNF A;  2MBX A;  3JVT C;  2BL0 C;  2RGI A;  2KFH A;  2KGR A;  3FIA A;  5B8I B;  3SG6 A;  2F3Y A;  2KI4 B;  2KAX A;  1GQM A;  2LP3 A;  1CM1 A;  1NP8 A;  2PVB A;  5CSI A;  3A4U B;  1QX7 A;  5KSZ A;  1MWN A;  2SCP A;  1KFX L;  5K89 A;  2F3Z A;  5JOL A;  2L50 A;  1UP5 A;  3DF0 A;  1QX5 B;  1CNP A;  2KFG A;  2EGD A;  1YX7 A;  1QJT A;  4PHK A;  5CSF A;  2AAO A;  1YRU B;  2LE9 B;  2LHI A;  4C0K A;  2KQ6 A;  1R2U A;  2I18 A;  1S6C A;  1SY9 A;  2GV5 A;  2K7B A;  2LAN A;  3C1V A;  1M39 A;  3BOW A;  4GBA A;  3GK4 X;  3MSE B;  1EG4 A;  4NQG A;  1QLS A;  1ZFS A;  2OS8 B;  1BR1 B;  1GGZ A;  1QTX A;  3EVV A;  3LLE A;  4M2Q A;  1IWQ A;  2D8N A;  1LA0 A;  4XYN A;  5AEQ A;  1PRW A;  1B7T Y;  1WRL A;  4MEW A;  3BQ3 A;  1UHK A;  2LVI A;  4JPZ B;  2WOS A;  1YTZ C;  1G33 A;  1SL9 A;  2BBM A;  1PK0 D;  2KAY A;  1L2O C;  1SL7 A;  1OZS A;  1RRO A;  2Q91 A;  4YGB B;  4QJ3 B;  3E3R A;  2HF5 A;  3BYA A;  1B8L A;  3EVU A;  3NSI A;  1FPW A;  2H61 C;  1SCM B;  1QXP A;  1PAL A;  1E8A A;  2JTT A;  2L51 A;  2PRU A;  3IQQ A;  1SW8 A;  5CPV A;  3TDI A;  2JT8 A;  1DJW A;  1TNP A;  1A03 A;  2Y5I A;  4ZCU A;  2I7A A;  4M2P A;  1SMG A;  2L0P A;  3ZNI A;  1K2H A;  1C07 A;  3KO0 A;  3NSK A;  2MJW B;  2JQ6 A;  1UHI A;  3O4Y A;  1NCY A;  5HLV A;  1K8U A;  4YGC B;  1W7I B;  1K9K A;  2K7O A;  1A4P A;  3AAJ A;  1BLQ A;  3EK8 A;  1SYM A;  2K2F A;  2KFF A;  3NSL A;  3WHU B;  1F71 A;  1S1E A;  2JPT A;  3A8R A;  3JTD B;  4PE1 A;  1KFU L;  1QAS A;  2ISD A;  1QVI Y;  4QJ5 B;  4GGN A;  4HRE E;  2R2I A;  1UHH A;  4DIR A;  1QIW A;  2M1U A;  4CLN A;  1AHR A;  4JWQ A;  1KFU S;  4MZJ A;  2JU0 A;  1K9P A;  2BKH B;  2CXJ A;  3EKJ A;  1EG3 A;  3PSR A;  1G4Y R;  2GGZ A;  3HX4 A;  1XFW O;  1OQP A;  1KQM B;  2L98 A;  1DGV A; 
#chains in the Genus database with same CATH topology
 2BKI B;  4AQI A;  4FQT A;  3PFV A;  1XA5 A;  1JFK A;  1U5I B;  1M31 A;  1S5G Z;  1YUU A;  2L4I A;  4BY4 A;  4L9M A;  3GOF A;  2ZNE A;  2KNE A;  2QEH A;  3L47 A;  3BXK A;  2NXQ A;  4TNC A;  2CTN A;  1RWY A;  1QS7 A;  1TRF A;  4D1E A;  3I5F C;  1PSB A;  3SG2 A;  2VRG A;  3B87 A;  1CDN A;  3BFH A;  1FI5 A;  2JC2 A;  1DC1 A;  1IIO A;  2K7D A;  2K0J A;  3AKA A;  3FE6 A;  3NSO A;  4AOM A;  2QAC A;  1A2X A;  3OX5 A;  4PT1 A;  1SNL A;  5I2O A;  5KU1 A;  1EJ3 A;  3D73 A;  2K2A A;  2LVK A;  3EK7 A;  1J7O A;  2KI4 C;  2L5Y A;  5FI2 A;  1BU3 A;  2LUX A;  1SCV A;  3SS4 A;  2LC5 A;  2CCM A;  1KK7 Z;  1BJF A;  1JUO A;  1LIN A;  2MA2 A;  1YVH A;  1NIW A;  2ZFD A;  4CID A;  4GGF C;  1PVB A;  2TN4 A;  2MAZ A;  3IQO A;  4ZCV A;  1YUT A;  4C0L A;  1LVC D;  4FTG A;  1A75 B;  4PE0 A;  5I2L A;  4MSP A;  1J7P A;  4GFT A;  4HSZ A;  2KLD A;  4ORA B;  2OS8 C;  1EXR A;  3PAL A;  1CLL A;  1M45 A;  4FQO A;  2JNX A;  3S0A A;  1F54 A;  1S26 D;  5D69 A;  3SG7 A;  3TUY B;  1K93 D;  2BBN A;  1S6J A;  2NLN A;  1VRK A;  1UHJ A;  4GAO A;  4CPV A;  2LMT A;  3L4L A;  3D0Y A;  1IQ3 A;  1AUI B;  3O6B A;  3OB1 B;  4R1E A;  1JC2 A;  1RK9 A;  1IGV A;  3IF7 A;  2JUL A;  2M9G A;  1Y1X A;  1Z2C B;  2JTZ A;  1DT7 B;  2JT0 A;  1SCM C;  3DF0 B;  5DKN A;  5D7F A;  1IH0 A;  1DGU A;  2K60 A;  2FJY A;  1NYA A;  2E30 A;  2F2P A;  4PDZ A;  2ERB A;  2LMV A;  1WRZ A;  1XK4 A;  3DXL A;  1DJI A;  1SPY A;  3CLN A;  3GK1 A;  1CDM A;  1AVS A;  2WC6 A;  4JQ0 D;  4MRY A;  4N1G A;  5HKY A;  4WQ3 A;  4MZK A;  1AJ5 A;  3BOW B;  1JWD A;  1OOG A;  1S3P A;  2NZ0 A;  3O78 A;  1WRK A;  1LA3 A;  2ZKM X;  3LK1 A;  2ZRT A;  1B47 A;  3BUM B;  4NDC A;  4DRW A;  3I5G B;  1Y6W A;  2O60 A;  1NX0 A;  5HL1 A;  2JWW A;  4CFQ A;  3V2L A;  1REC A;  2G9B A;  2P71 A;  1CFC A;  2KBI A;  1P28 A;  1WLZ A;  1F8H A;  1TCF A;  3JTD C;  3VRN A;  1PSR A;  5D3O A;  2HET A;  1ORG A;  1QV1 A;  3SIA A;  1OOI X;  5IBW A;  1B8R A;  4GNK B;  3BJH A;  1NX1 A;  3DVE A;  2FCD A;  3EK4 A;  1PUL A;  5KTY A;  5AFP A;  2NCP A;  1XVJ A;  3GK2 A;  5FYX A;  1NCX A;  1QWV A;  2COL B;  1DTL A;  3SS3 A;  2CBL A;  1SBJ A;  2L5X B;  4YGA A;  4MLW A;  2I94 A;  5G08 A;  1KQM C;  2A4J A;  2GTE A;  4YGE B;  5DIC A;  4XJK A;  2LLS A;  1HQV A;  5DKQ A;  2LHL A;  3BUW B;  1TIZ A;  2M49 B;  4N5X A;  4PHN A;  2LNK A;  2NCO A;  3D10 A;  3CR2 A;  1UWO A;  1TNW A;  2KYF A;  2JXL A;  1QVI Z;  3I5H B;  1KSM A;  3PM8 A;  1QIV A;  2LVJ A;  1DJY A;  2LM5 A;  1KQV A;  1ALW A;  2JRF A;  1LXF C;  1F55 A;  3RLZ A;  5HYD A;  1WY9 A;  2ZN8 A;  5BPJ A;  5AER A;  2PMY A;  4CFR A;  3WNX B;  2MRD A;  1NCZ A;  1RJV A;  1A29 A;  3PLF B;  4U8D A;  1ZUZ A;  1G8I A;  2QDI A;  4GUK A;  2H61 A;  2GGM A;  1F4Q A;  1IQ5 A;  3KEV A;  1OE9 B;  3O2P A;  4E68 A;  1SKT A;  3CGA A;  2ZRS A;  1QAT A;  3SG3 A;  1JF0 A;  1N0Y A;  3BUO B;  3LCP C;  2QEV A;  2HPS A;  2KBM A;  5GQQ C;  2BCB A;  2LMU A;  1DJZ A;  1IG5 A;  1GGW A;  2KHN A;  1DF0 A;  5I8N A;  3BUX B;  1TNQ A;  2M7N A;  2PQL A;  3OBV A;  4YI9 A;  1BG1 A;  1KWO C;  3DY9 A;  4YRU A;  2F33 A;  2KSP A;  3B6X A;  1BF5 A;  1CMG A;  1UUR A;  2HQW A;  5DKR A;  1F70 A;  1JSA A;  1Y0V H;  3FS7 A;  3OGN A;  3OX6 A;  2AUC A;  4YI8 A;  1BR4 B;  4P2Y B;  2F2O A;  3R1O A;  4OZD A;  2BEC A;  4Q04 A;  3B88 A;  2LAP A;  4N1F A;  1M63 B;  3TUY C;  3N7H A;  2F8P A;  1D1O A;  2M29 A;  1GJY A;  3DVK A;  1V1G A;  4IL1 A;  4P5O E;  1ZAC A;  2MLF C;  1ZOT B;  3PN7 B;  2H8V A;  2BCA A;  2EC6 C;  2KYC A;  2MLE C;  2WCE A;  1T14 A;  1NWD A;  1XYD A;  3H4S E;  4YGD B;  4I5N B;  4DUQ A;  1DMO A;  2I2R E;  1MXE A;  3VRQ A;  1J7Q A;  1K94 A;  3BFA A;  1SRA A;  1KK8 B;  1ODB A;  1EL4 A;  1KWO B;  1WDC C;  1JBA A;  1KCY A;  1CKK A;  2IS9 A;  1IRJ A;  3AKB A;  2KI6 D;  1XFR A;  3D74 A;  3PM2 A;  3CYZ A;  4OCI A;  4WQ2 A;  4OKH A;  1H4B A;  1OZO A;  3ZWH A;  1NPQ A;  1TUZ A;  2KI6 C;  1J7R A;  1DJG A;  2QPT A;  1QX2 A;  3BFB A;  1AJ4 A;  2Q4U A;  4KYN A;  3KF9 A;  2MHH A;  4PE4 A;  1UHN A;  2WND A;  4PE7 A;  5I94 A;  1XFX O;  2KLE A;  3FE8 A;  4GPL B;  4YBH B;  2HQ8 A;  4NDD A;  3WHT B;  2EC6 B;  5AXI A;  1W7J B;  3I5G C;  3B86 A;  3CZ1 A;  2M3W A;  3IVT A;  1BT6 A;  3CDN A;  3D0Y B;  1DJX A;  3S0D A;  1WDC B;  1J1D A;  4PAL A;  1CFF A;  2EHB A;  5F6T A;  1OSA A;  2JXC A;  1YR5 A;  1B7T Z;  1S6I A;  2WC8 A;  1RTP 1;  1N65 A;  1QV0 A;  1S36 A;  1YVL A;  2M97 A;  2WCK A;  1N2D A;  1B4C A;  1YX8 A;  3VRR A;  4GGF A;  4DS7 A;  2ZN9 A;  1K90 D;  1SL8 A;  3KPX A;  2QEB A;  3I5I B;  2PYQ A;  1Y1A A;  4PHJ A;  3TS5 B;  2Y1N A;  1J1E A;  5AAN A;  2P70 A;  1KSO A;  3LK0 A;  5CSN A;  2WC5 A;  4OR9 B;  3DZT A;  1KFX S;  3EVR A;  4ORB B;  2KQY A;  4PCW A;  1GM0 A;  2KOT A;  5ER4 X;  3DVJ A;  2CT9 A;  1OMV A;  2KGB C;  2Y1M A;  3I5H C;  1CMF A;  1OOJ A;  3SG5 A;  1XFZ O;  1NSH A;  1QLK A;  3CS1 A;  5HLO A;  3DD4 A;  1NX3 A;  2M0R A;  3S0B A;  1EH2 A;  1XO5 A;  2JOJ A;  2BL0 B;  3JVT B;  4HRG A;  3FE9 A;  1TCO B;  2OTG C;  3WXA A;  4I5L B;  1F4O A;  2BCX A;  1TNX A;  3DVM A;  1MQ1 A;  2BNX A;  4ORC B;  2K8M B;  2P6B B;  2KPH A;  1R6P A;  1K95 A;  2PSR A;  2KDH A;  1RFJ A;  4MVF A;  5ER5 A;  5HKW A;  1BMO A;  1K96 A;  2E6W A;  3CZT X;  3O4X A;  3PAT A;  3TDU A;  2PAL A;  1CTR A;  1M46 A;  2QEO A;  1DQE A;  1SR6 C;  3TDZ A;  3CTN A;  1OW4 A;  3QME A;  3VGO A;  3F45 A;  1CDL A;  1MXL C;  3VRO A;  4ETO A;  1CLB A;  2JT3 A;  3VRP A;  4XJK B;  1AK8 A;  3BUN B;  3AAK A;  1TN4 A;  3L4A A;  2K61 A;  3OB2 B;  5HKZ A;  2M1K B;  4A4C A;  1B1G A;  1C7V A;  2OTG B;  5EL2 A;  4OV2 A;  4AQJ A;  3CAB A;  2LLU A;  1IKU A;  1W9Z A;  4USL A;  2LLT A;  3UNW A;  5J3X A;  3CWG A;  3NHI A;  2ZND A;  3D77 A;  2O5G A;  1CB1 A;  1TUJ A;  1L2O B;  3OHM B;  1ALV A;  1L7Z A;  2FCE A;  3Q8I A;  1Q80 A;  4I5J A;  4M2O A;  3SG4 A;  1BOC A;  1MR8 A;  2LV7 A;  1SR6 B;  1CFD A;  3PN7 C;  1FBV A;  4I5K A;  2LUC A;  1OMD A;  3FWC A;  3CZ2 A;  1MHO A;  1FI6 A;  1DEL A;  1B9A A;  4F0Z B;  1MUX A;  5PAL A;  4HRH A;  1KK8 C;  2OPO A;  2FOT A;  2BE6 A;  1NX2 A;  2L2E A;  2M8U A;  3SIB A;  2BE4 A;  1JFJ A;  2V53 A;  1DF0 B;  1ZMZ A;  3RM1 A;  2B1U A;  4F7F A;  3K21 A;  1U5I A;  2FJU B;  4DCK A;  1YUS A;  2PAS A;  5I2Q A;  4INW A;  2Y4Q A;  2KAV A;  1DVI A;  3M0W A;  4MRX A;  5TNC A;  1BOD A;  5FI7 A;  1TTX A;  3D75 A;  1IJ6 A;  4UPG A;  1Y1U A;  1DJH A;  2G2B A;  3FWB A;  1JF2 A;  3CZ0 A;  4NDB A;  1PVA A;  1Z4H A;  1NUB A;  2K7C A;  1V1F A;  1YRT B;  1OMR A;  1S5G Y;  1B8C A;  1SK6 D;  2M7L A;  4C0J A;  4MZL A;  3CR4 X;  1AP4 A;  3NXA A;  5CSJ A;  2CNP A;  2LVV A;  4MBE A;  1XFU O;  1XFV O;  2LCP A;  3R1V A;  1IJ5 A;  1UUS A;  1K9U A;  1CDP A;  1WLM A;  3D78 A;  4BY5 A;  1XFY O;  3QRX A;  3KHE A;  4MN0 A;  4INX A;  2JPO A;  3EKH A;  1J55 A;  4OVN F;  4A4B A;  2WCB A;  3SJS A;  4WRI A;  2SAS A;  1FF1 A;  1XK4 C;  1X02 A;  2WCF A;  3I5I C;  3OP0 A;  3TS5 C;  1HT9 A;  1A75 A;  4PHM A;  1YUR A;  1CLM A;  2LP2 A;  3HCM A;  3S0G A;  4QJ4 B;  1CFP A;  3CR5 X;  2JZI A;  3S0F A;  3I5F B;  1MF8 B;  1C7W A;  1KK7 Y;  2DOQ A;  1H8B A;  1LKJ A;  2WOR A;  2AMI A;  2L4H A;  1FW4 A;  1TOP A;  2H2K A;  3ICB A;  2L2C A;  4ICB A;  5JJG A;  1CM4 A;  3LL8 B;  3B7A A;  2JNF A;  2MBX A;  1C3Z A;  3TZ1 A;  3JVT C;  2BL0 C;  2RGI A;  2KFH A;  2KGR A;  3EG5 B;  3FIA A;  3R1P A;  3SG6 A;  1SSE B;  5B8I B;  2F3Y A;  2KI4 B;  2KAX A;  1GQM A;  2LP3 A;  1CM1 A;  1NP8 A;  2PVB A;  5CSI A;  3A4U B;  1QX7 A;  5KSZ A;  1MWN A;  2SCP A;  1KFX L;  5K89 A;  2BAP A;  2F3Z A;  5JOL A;  2L50 A;  1UP5 A;  3DF0 A;  1QX5 B;  1CNP A;  2KFG A;  2EGD A;  1TWO A;  1YX7 A;  1QJT A;  4PHK A;  5CSF A;  2AAO A;  1YRU B;  2LE9 B;  2LHI A;  3NHT A;  4C0K A;  2KQ6 A;  1R2U A;  2I18 A;  3NGV A;  1S6C A;  1SY9 A;  2GV5 A;  2K7B A;  2LAN A;  3C1V A;  1M39 A;  3SS5 A;  3BOW A;  4GBA A;  3GK4 X;  3MSE B;  1EG4 A;  4NQG A;  1QLS A;  1ZFS A;  2OS8 B;  1BR1 B;  1GGZ A;  1QTX A;  3EVV A;  3LLE A;  2YGU A;  1IWQ A;  4M2Q A;  4JD9 A;  2D8N A;  1LA0 A;  4XYN A;  5AEQ A;  1PRW A;  1B7T Y;  1WRL A;  4MEW A;  3BQ3 A;  1UHK A;  2LVI A;  4JPZ B;  2WOS A;  1YTZ C;  1G33 A;  1SL9 A;  1PK0 D;  2BBM A;  2KAY A;  3DYE A;  3D76 A;  1L2O C;  1SL7 A;  1OZS A;  1RRO A;  3S0E A;  2Q91 A;  4YGB B;  4QJ3 B;  3E3R A;  2HF5 A;  3K1E A;  3BYA A;  1B8L A;  3EVU A;  3NSI A;  1FPW A;  2H61 C;  1SCM B;  1QXP A;  1PAL A;  2WCM A;  4IJ7 A;  1C3Y A;  1E8A A;  2JTT A;  2L51 A;  2PRU A;  3IQQ A;  1SW8 A;  5CPV A;  3TDI A;  2WCL A;  2JT8 A;  1DJW A;  1TNP A;  1A03 A;  2Y5I A;  4ZCU A;  2I7A A;  4M2P A;  1SMG A;  2L0P A;  3ZNI A;  4JKT A;  1K2H A;  1C07 A;  3KO0 A;  1LS8 A;  3NSK A;  3RZS A;  2MJW B;  2JQ6 A;  1UHI A;  3O4Y A;  3R72 A;  1NCY A;  5HLV A;  1K8U A;  4YGC B;  1W7I B;  1K9K A;  2K7O A;  3VB1 A;  3PJI A;  1A4P A;  3AAJ A;  1BLQ A;  3EK8 A;  1SYM A;  2K2F A;  2KFF A;  3NSL A;  2WCH A;  3WHU B;  1F71 A;  1S1E A;  1OOF A;  2JPT A;  3A8R A;  3JTD B;  4PE1 A;  1KFU L;  1QAS A;  5FI6 A;  3UO9 A;  2ISD A;  1QVI Y;  4QJ5 B;  4GGN A;  4HRE E;  2R2I A;  1UHH A;  4DIR A;  1QIW A;  2M1U A;  4CLN A;  1AHR A;  4JWQ A;  1KFU S;  4MZJ A;  2JU0 A;  1K9P A;  2BKH B;  2CXJ A;  3EKJ A;  1EG3 A;  3PSR A;  2WCJ A;  1G4Y R;  2GGZ A;  1OOH A;  3HX4 A;  1XFW O;  1OQP A;  1KQM B;  2L98 A;  1DGV A;  1DEK A; 
#chains in the Genus database with same CATH homology
 2BKI B;  4AQI A;  3PFV A;  1XA5 A;  1JFK A;  1U5I B;  1M31 A;  1S5G Z;  1YUU A;  2L4I A;  4BY4 A;  4L9M A;  3GOF A;  2ZNE A;  2KNE A;  3BXK A;  2NXQ A;  4TNC A;  2CTN A;  1RWY A;  1QS7 A;  1TRF A;  4D1E A;  3I5F C;  1PSB A;  3SG2 A;  2VRG A;  1CDN A;  1FI5 A;  2JC2 A;  2K7D A;  2K0J A;  3AKA A;  3NSO A;  4AOM A;  2QAC A;  1A2X A;  3OX5 A;  1SNL A;  5I2O A;  5KU1 A;  1EJ3 A;  2K2A A;  2LVK A;  3EK7 A;  1J7O A;  2KI4 C;  1BU3 A;  2LUX A;  1SCV A;  2LC5 A;  2CCM A;  1KK7 Z;  1BJF A;  1JUO A;  1LIN A;  2MA2 A;  1YVH A;  1NIW A;  2ZFD A;  4CID A;  4GGF C;  1PVB A;  2TN4 A;  2MAZ A;  3IQO A;  4ZCV A;  1YUT A;  4C0L A;  1LVC D;  4FTG A;  1A75 B;  4PE0 A;  5I2L A;  4MSP A;  1J7P A;  4GFT A;  4HSZ A;  4ORA B;  2OS8 C;  1EXR A;  3PAL A;  1CLL A;  1M45 A;  4FQO A;  2JNX A;  1F54 A;  1S26 D;  5D69 A;  3SG7 A;  3TUY B;  1K93 D;  2BBN A;  1S6J A;  2NLN A;  1VRK A;  1UHJ A;  4GAO A;  4CPV A;  2LMT A;  3D0Y A;  1IQ3 A;  1AUI B;  3O6B A;  3OB1 B;  4R1E A;  1JC2 A;  1RK9 A;  1IGV A;  3IF7 A;  2JUL A;  2M9G A;  1Y1X A;  2JTZ A;  1DT7 B;  2JT0 A;  1SCM C;  3DF0 B;  5DKN A;  5D7F A;  1IH0 A;  1DGU A;  1NYA A;  2E30 A;  2F2P A;  4PDZ A;  2LMV A;  1WRZ A;  1XK4 A;  1DJI A;  1SPY A;  3CLN A;  3GK1 A;  1CDM A;  1AVS A;  4JQ0 D;  4MRY A;  4N1G A;  5HKY A;  4WQ3 A;  4MZK A;  1AJ5 A;  3BOW B;  1JWD A;  1S3P A;  2NZ0 A;  3O78 A;  1WRK A;  1LA3 A;  2ZKM X;  3LK1 A;  2ZRT A;  1B47 A;  3BUM B;  4NDC A;  4DRW A;  3I5G B;  1Y6W A;  2O60 A;  1NX0 A;  2JWW A;  4CFQ A;  1REC A;  2G9B A;  1CFC A;  2KBI A;  1WLZ A;  1F8H A;  1TCF A;  3JTD C;  3VRN A;  1PSR A;  2HET A;  1QV1 A;  3SIA A;  5IBW A;  1B8R A;  4GNK B;  3DVE A;  1NX1 A;  2FCD A;  3EK4 A;  1PUL A;  5KTY A;  5AFP A;  2NCP A;  1XVJ A;  3GK2 A;  5FYX A;  1NCX A;  2COL B;  1DTL A;  2CBL A;  1SBJ A;  2L5X B;  4YGA A;  4MLW A;  2I94 A;  5G08 A;  1KQM C;  2A4J A;  4YGE B;  4XJK A;  2LLS A;  1HQV A;  5DKQ A;  2LHL A;  3BUW B;  1TIZ A;  2M49 B;  4N5X A;  4PHN A;  2LNK A;  2NCO A;  3D10 A;  3CR2 A;  1UWO A;  1TNW A;  2KYF A;  2JXL A;  1QVI Z;  3I5H B;  1KSM A;  3PM8 A;  1QIV A;  2LVJ A;  1DJY A;  2LM5 A;  1KQV A;  1ALW A;  2JRF A;  1LXF C;  1F55 A;  3RLZ A;  5HYD A;  1WY9 A;  2ZN8 A;  5BPJ A;  5AER A;  2PMY A;  4CFR A;  3WNX B;  2MRD A;  1NCZ A;  1RJV A;  1A29 A;  3PLF B;  4U8D A;  1ZUZ A;  1G8I A;  4GUK A;  2H61 A;  2GGM A;  1F4Q A;  1IQ5 A;  3KEV A;  1OE9 B;  3O2P A;  4E68 A;  1SKT A;  3CGA A;  2ZRS A;  1QAT A;  3SG3 A;  1JF0 A;  1N0Y A;  3BUO B;  3LCP C;  2HPS A;  2KBM A;  5GQQ C;  2BCB A;  2LMU A;  1DJZ A;  1IG5 A;  1GGW A;  2KHN A;  1DF0 A;  5I8N A;  3BUX B;  1TNQ A;  2M7N A;  4YI9 A;  1BG1 A;  1KWO C;  4YRU A;  2F33 A;  2KSP A;  1CMG A;  1BF5 A;  1JSA A;  1UUR A;  2HQW A;  5DKR A;  1F70 A;  1Y0V H;  3FS7 A;  3OX6 A;  2AUC A;  4YI8 A;  1BR4 B;  4P2Y B;  2F2O A;  4Q04 A;  2BEC A;  2LAP A;  4N1F A;  1M63 B;  3TUY C;  1D1O A;  2F8P A;  2M29 A;  1GJY A;  3DVK A;  1V1G A;  4IL1 A;  4P5O E;  1ZAC A;  2MLF C;  1ZOT B;  3PN7 B;  2BCA A;  2EC6 C;  2KYC A;  2MLE C;  2WCE A;  1NWD A;  1XYD A;  3H4S E;  4YGD B;  4I5N B;  4DUQ A;  1DMO A;  2I2R E;  1MXE A;  3VRQ A;  1J7Q A;  1K94 A;  1SRA A;  1KK8 B;  1ODB A;  1EL4 A;  1KWO B;  1WDC C;  1JBA A;  1KCY A;  1CKK A;  2IS9 A;  1IRJ A;  3AKB A;  2KI6 D;  4WQ2 A;  4OCI A;  4OKH A;  1H4B A;  1OZO A;  3ZWH A;  1NPQ A;  2KI6 C;  1J7R A;  1DJG A;  2QPT A;  1QX2 A;  1AJ4 A;  2Q4U A;  3KF9 A;  2MHH A;  4PE4 A;  1UHN A;  2WND A;  4PE7 A;  1XFX O;  4GPL B;  4YBH B;  2HQ8 A;  4NDD A;  3WHT B;  2EC6 B;  5AXI A;  1W7J B;  3I5G C;  2M3W A;  1BT6 A;  3D0Y B;  1DJX A;  1WDC B;  1J1D A;  4PAL A;  1CFF A;  2EHB A;  5F6T A;  1OSA A;  2JXC A;  1YR5 A;  1B7T Z;  1S6I A;  2WC8 A;  1RTP 1;  1N65 A;  1QV0 A;  1S36 A;  1YVL A;  2M97 A;  1N2D A;  1B4C A;  1YX8 A;  3VRR A;  4GGF A;  4DS7 A;  2ZN9 A;  1K90 D;  1SL8 A;  3KPX A;  3I5I B;  3TS5 B;  1Y1A A;  4PHJ A;  2Y1N A;  1J1E A;  5AAN A;  1KSO A;  3LK0 A;  5CSN A;  4OR9 B;  1KFX S;  3EVR A;  4ORB B;  2KQY A;  4PCW A;  2KOT A;  5ER4 X;  3DVJ A;  2CT9 A;  1OMV A;  2KGB C;  2Y1M A;  3I5H C;  1CMF A;  1OOJ A;  3SG5 A;  1XFZ O;  1NSH A;  1QLK A;  3CS1 A;  5HLO A;  3DD4 A;  1NX3 A;  2M0R A;  1EH2 A;  1XO5 A;  2JOJ A;  2BL0 B;  3JVT B;  4HRG A;  1TCO B;  2OTG C;  3WXA A;  4I5L B;  1F4O A;  2BCX A;  1TNX A;  3DVM A;  1MQ1 A;  4ORC B;  2K8M B;  2P6B B;  1R6P A;  1K95 A;  2PSR A;  2KDH A;  1RFJ A;  4MVF A;  5ER5 A;  5HKW A;  1BMO A;  1K96 A;  2E6W A;  3CZT X;  3PAT A;  3TDU A;  2PAL A;  1CTR A;  1M46 A;  1SR6 C;  3TDZ A;  3CTN A;  3VGO A;  3F45 A;  1CDL A;  1MXL C;  3VRO A;  4ETO A;  1CLB A;  2JT3 A;  3VRP A;  4XJK B;  1AK8 A;  3BUN B;  3AAK A;  1TN4 A;  2K61 A;  3OB2 B;  5HKZ A;  2M1K B;  4A4C A;  1B1G A;  1C7V A;  2OTG B;  4OV2 A;  4AQJ A;  2LLU A;  1IKU A;  4USL A;  2LLT A;  5J3X A;  3CWG A;  2ZND A;  1CB1 A;  2O5G A;  1L2O B;  3OHM B;  1ALV A;  1L7Z A;  2FCE A;  1Q80 A;  4I5J A;  4M2O A;  3SG4 A;  1BOC A;  1MR8 A;  2LV7 A;  1SR6 B;  1CFD A;  3PN7 C;  1FBV A;  4I5K A;  2LUC A;  1OMD A;  3FWC A;  1FI6 A;  1MHO A;  1B9A A;  4F0Z B;  1MUX A;  5PAL A;  4HRH A;  1KK8 C;  2OPO A;  2FOT A;  2BE6 A;  1NX2 A;  2L2E A;  2M8U A;  3SIB A;  2BE4 A;  1JFJ A;  2V53 A;  1DF0 B;  1ZMZ A;  3RM1 A;  2B1U A;  3K21 A;  1U5I A;  2FJU B;  4DCK A;  1YUS A;  2PAS A;  5I2Q A;  2Y4Q A;  2KAV A;  1DVI A;  3M0W A;  4MRX A;  5TNC A;  1BOD A;  1TTX A;  1IJ6 A;  4UPG A;  1Y1U A;  1DJH A;  2G2B A;  3FWB A;  1JF2 A;  4NDB A;  1PVA A;  2K7C A;  1NUB A;  1V1F A;  1YRT B;  1OMR A;  1S5G Y;  1B8C A;  1SK6 D;  2M7L A;  4C0J A;  4MZL A;  3CR4 X;  1AP4 A;  3NXA A;  5CSJ A;  2CNP A;  2LVV A;  4MBE A;  1XFU O;  1XFV O;  2LCP A;  1IJ5 A;  1UUS A;  1K9U A;  1CDP A;  1WLM A;  4BY5 A;  1XFY O;  3QRX A;  3KHE A;  4MN0 A;  3EKH A;  1J55 A;  4OVN F;  4A4B A;  2WCB A;  3SJS A;  4WRI A;  2SAS A;  1FF1 A;  1XK4 C;  1X02 A;  2WCF A;  3I5I C;  3OP0 A;  3TS5 C;  1HT9 A;  1A75 A;  4PHM A;  1YUR A;  1CLM A;  2LP2 A;  3HCM A;  4QJ4 B;  1CFP A;  3CR5 X;  2JZI A;  3I5F B;  1MF8 B;  1C7W A;  1KK7 Y;  2DOQ A;  1H8B A;  1LKJ A;  2WOR A;  2AMI A;  2L4H A;  1FW4 A;  1TOP A;  2H2K A;  3ICB A;  4ICB A;  5JJG A;  1CM4 A;  3LL8 B;  3TZ1 A;  2JNF A;  2MBX A;  3JVT C;  2BL0 C;  2RGI A;  2KFH A;  2KGR A;  3FIA A;  5B8I B;  3SG6 A;  2F3Y A;  2KI4 B;  2KAX A;  1GQM A;  2LP3 A;  1CM1 A;  1NP8 A;  2PVB A;  5CSI A;  3A4U B;  1QX7 A;  5KSZ A;  1MWN A;  2SCP A;  1KFX L;  5K89 A;  2F3Z A;  5JOL A;  2L50 A;  1UP5 A;  3DF0 A;  1QX5 B;  1CNP A;  2KFG A;  2EGD A;  1YX7 A;  1QJT A;  4PHK A;  5CSF A;  2AAO A;  1YRU B;  2LE9 B;  2LHI A;  4C0K A;  2KQ6 A;  1R2U A;  2I18 A;  1S6C A;  1SY9 A;  2GV5 A;  2K7B A;  2LAN A;  3C1V A;  1M39 A;  3BOW A;  4GBA A;  3GK4 X;  3MSE B;  1EG4 A;  4NQG A;  1QLS A;  1ZFS A;  2OS8 B;  1BR1 B;  1GGZ A;  1QTX A;  3EVV A;  3LLE A;  4M2Q A;  1IWQ A;  2D8N A;  1LA0 A;  4XYN A;  5AEQ A;  1PRW A;  1B7T Y;  1WRL A;  4MEW A;  3BQ3 A;  1UHK A;  2LVI A;  4JPZ B;  2WOS A;  1YTZ C;  1G33 A;  1SL9 A;  2BBM A;  1PK0 D;  2KAY A;  1L2O C;  1SL7 A;  1OZS A;  1RRO A;  2Q91 A;  4YGB B;  4QJ3 B;  3E3R A;  2HF5 A;  3BYA A;  1B8L A;  3EVU A;  3NSI A;  1FPW A;  2H61 C;  1SCM B;  1QXP A;  1PAL A;  1E8A A;  2JTT A;  2L51 A;  2PRU A;  3IQQ A;  1SW8 A;  5CPV A;  3TDI A;  2JT8 A;  1DJW A;  1TNP A;  1A03 A;  2Y5I A;  4ZCU A;  2I7A A;  4M2P A;  1SMG A;  2L0P A;  3ZNI A;  1K2H A;  1C07 A;  3KO0 A;  3NSK A;  2MJW B;  2JQ6 A;  1UHI A;  3O4Y A;  1NCY A;  5HLV A;  1K8U A;  4YGC B;  1W7I B;  1K9K A;  2K7O A;  1A4P A;  3AAJ A;  1BLQ A;  3EK8 A;  1SYM A;  2K2F A;  2KFF A;  3NSL A;  3WHU B;  1F71 A;  1S1E A;  2JPT A;  3A8R A;  3JTD B;  4PE1 A;  1KFU L;  1QAS A;  2ISD A;  1QVI Y;  4QJ5 B;  4GGN A;  4HRE E;  2R2I A;  1UHH A;  4DIR A;  1QIW A;  2M1U A;  4CLN A;  1AHR A;  4JWQ A;  1KFU S;  4MZJ A;  2JU0 A;  1K9P A;  2BKH B;  2CXJ A;  3EKJ A;  1EG3 A;  3PSR A;  1G4Y R;  2GGZ A;  3HX4 A;  1XFW O;  1OQP A;  1KQM B;  2L98 A;  1DGV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...