1BLQA

Structure and interaction site of the regulatory domain of troponin-c when complexed with the 96-148 region of troponin-i, nmr, 29 structures
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
90
structure length
90
Chain Sequence
ASMTDQQAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-TROPONIN C
publication title Structure and interaction site of the regulatory domain of troponin-C when complexed with the 96-148 region of troponin-I.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Calcium-binding protein
total genus 11
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 1998-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1blqA00
1YUSA 1CM4A 2BKHB 2KYCA 3BUNB 4JWQA 5BPJA 1PK0D 1EH2A 2ZRSA 2WOSA 1NYAA 4USLA 4YBHB 2DOQA 3BQ3A 4YGBB 3DVMA 3EVUA 3VRPA 4WQ3A 3LK1A 2QACA 1SR6C 2KBMA 5AEQA 4I5KA 1TNXA 3A8RA 2MA2A 2NZ0A 4P2YB 4C0JA 1CKKA 1J7OA 2KSPA 1M63B 1UP5A 3CR2A 3GK4X 1ZOTB 1ZMZA 1MF8B 2KI4C 4A4BA 2L51A 3RM1A 1CFPA 1B7TZ 5GQQC 1YVHA 1QTXA 4U8DA 1NUBA 3A4UB 2FCEA 1KSMA 1WDCB 2LMUA 1DF0B 2JT0A 1RROA 2CBLA 1TCOB 2K7CA 2VRGA 3BUMB 3FWCA 1QX2A 2F8PA 3NSKA 1PSBA 1A2XA 1PRWA 5CSNA 2K61A 2KQ6A 1LKJA 1K9PA 3EVVA 2KAYA 2MBXA 2A4JA 2LVKA 1OMRA 1CMFA 2ZN8A 4DS7A 5AFPA 2JTZA 1QXPA 1WY9A 1DJXA 5J3XA 3ICBA 3O78A 2M0RA 1XFWO 4OKHA 1WDCC 1XYDA 3KEVA 4N1GA 5HKWA 1SMGA 2JOJA 2LVIA 2BCAA 4YGEB 1CFCA 1Y1UA 1CLMA 4AQJA 1QJTA 5KSZA 3AKAA 5I2QA 1C07A 1NWDA 1LXFC 1NX1A 4PDZA 4BY4A 1L2OB 1S3PA 2L2EA 2KOTA 1YRUB 4GGFC 2L0PA 3DVKA 3AAJA 1DF0A 1SCMB 3TUYB 1SKTA 2KNEA 4OR9B 1K96A 2PMYA 4GAOA 4GUKA 1CDPA 1EG3A 2JZIA 2JNXA 2V53A 2E30A 1Q80A 4MZJA 1DGVA 1K90D 2HETA 2M49B 2OPOA 1OQPA 1CDMA 1ALWA 3SG2A 1AHRA 1XK4C 1HT9A 2L5XB 2AMIA 3E3RA 4YRUA 4YGCB 3BUXB 1KWOB 3VRRA 1AP4A 3O4YA 3OB2B 1S6CA 1L2OC 4OCIA 2L4HA 2SCPA 2G9BA 3IQOA 2PSRA 1B47A 1B7TY 2ZNDA 4GNKB 3TUYC 2M1UA 1B4CA 1J7RA 1FI6A 4CFQA 1S5GZ 1D1OA 1OSAA 3PALA 2LVJA 1S6IA 4ZCVA 1H4BA 1BT6A 1CLLA 2MAZA 4MLWA 3KPXA 1M46A 3D0YB 5DKQA 1CNPA 3NSLA 3BUWB 1F4OA 5ER5A 1SY9A 1IJ6A 2WCEA 1BU3A 3KF9A 1JWDA 2K7OA 2WCFA 1QV1A 3OX5A 4P5OE 1GGWA 1QV0A 1PULA 3OP0A 2LP2A 2F2PA 3TS5B 3O2PA 3VROA 1DJHA 1NX3A 1KQVA 4NDCA 1N65A 2I7AA 2MJWB 2JC2A 3K21A 3NSOA 2LUCA 1CB1A 1RFJA 4PE1A 5IBWA 2LHIA 1F4QA 2WORA 1IQ3A 2H61A 2JT8A 2K7DA 4NQGA 2FJUB 2KBIA 1AK8A 1EG4A 3OHMB 1ZUZA 2B1UA 3GOFA 3D0YA 3TZ1A 1DJWA 4PHMA 1G33A 3TDZA 3TS5C 1RJVA 1GGZA 3EKHA 1SBJA 3TDUA 1RK9A 1S1EA 4ICBA 5JOLA 1YUUA 1CLBA 1C7WA 1OZSA 1SW8A 3SG7A 2LMVA 4M2OA 2JWWA 1C7VA 1DMOA 1UUSA 4MRXA 4GFTA 5HYDA 1BG1A 1EJ3A 1WRZA 2M97A 4PE4A 2K7BA 1OZOA 3CR4X 2I18A 2K0JA 2GV5A 5K89A 1M39A 2L50A 5HKZA 1S5GY 1W7IB 2Q91A 2ZKMX 3IQQA 1DGUA 2EHBA 2ZNEA 2MLEC 5PALA 3RLZA 3DVJA 4I5LB 3VRNA 4A4CA 1IRJA 1AUIB 5I8NA 3I5FC 1K2HA 2SASA 1XFUO 4R1EA 4ZCUA 3LCPC 3PN7B 1K9KA 1OMDA 1XFVO 1XFYO 1VRKA 4MZKA 1E8AA 1J7PA 4M2PA 2KYFA 3BYAA 3BOWA 4Q04A 1DJGA 5I2LA 1NP8A 4JPZB 2KAXA 2JT3A 4QJ4B 2Y4QA 2LNKA 1KSOA 5CPVA 3HCMA 2KFGA 2O5GA 1SL8A 1NX0A 2WCBA 1BJFA 3KO0A 1U5IA 1NSHA 2PVBA 3DVEA 4FQOA 4CFRA 1G4YR 2KFHA 2M7NA 1YX8A 1Y1XA 4HRGA 3BUOB 3NSIA 1IQ5A 3LK0A 1BR4B 2NCPA 4ORBB 4C0LA 1TTXA 2LV7A 3PN7C 1FBVA 1Y1AA 2WC8A 5FYXA 4WQ2A 5AANA 1UHIA 2F3ZA 3FIAA 1JFKA 1DT7B 1IWQA 5DKRA 5HKYA 3EK4A 2F33A 3GK2A 1WLMA 1XFZO 4PHKA 3CLNA 1JC2A 5G08A 5D7FA 3CZTX 4YI8A 3EK7A 4YGAA 4GGNA 1SYMA 1YTZC 4GBAA 1KK8B 3LL8B 5KTYA 4ETOA 1ALVA 1IKUA 4F0ZB 4QJ3B 4UPGA 1OE9B 2BCXA 2KI6D 4PE7A 1UHJA 1K95A 1A75A 4PE0A 1MXEA 4C0KA 1BODA 3OX6A 1OMVA 1XFXO 2K2FA 2WNDA 4OV2A 3EVRA 3I5HB 3KHEA 3SG6A 1KK7Z 1QS7A 1NX2A 2JRFA 4HRHA 2JNFA 2M7LA 3SIAA 3SG3A 1RECA 2Y1NA 2ZN9A 2LE9B 1TRFA 1KK8C 1F8HA 3M0WA 2I2RE 2K8MB 3PATA 4MN0A 2CCMA 2BCBA 2TN4A 2D8NA 1FW4A 4WRIA 1W7JB 3WNXB 1MWNA 1QATA 1HQVA 1UHKA 4N1FA 2BE4A 3I5HC 1MXLC 1CFDA 3JTDB 4TNCA 4XYNA 1K94A 3AAKA 4L9MA 3IF7A 1IJ5A 2BE6A 2M3WA 1F54A 3O6BA 1TIZA 2H61C 1NCZA 4GPLB 2LMTA 2MLFC 2LANA 4PHNA 2M8UA 4XJKB 1KFUL 1ZFSA 1V1FA 1Y0VH 1MUXA 3SJSA 1UHHA 2RGIA 2P6BB 2FOTA 3WHUB 4JQ0D 1KQMB 2BBMA 2KI6C 1KFUS 4MEWA 2LHLA 1A4PA 1R2UA 1S6JA 3I5GB 2QPTA 3JTDC 1J55A 2LP3A 4ORAB 1B8RA 3BOWB 1JSAA 3H4SE 1DTLA 3I5FB 1Y6WA 1FPWA 3F45A 4E68A 1EL4A 5JJGA 1GJYA 2BKIB 4QJ5B 2NCOA 4MSPA 2COLB 3VRQA 1M45A 1U5IB 1B8LA 1JUOA 2ZRTA 1WLZA 4MVFA 1KK7Y 1KQMC 3PFVA 2ISDA 1QVIZ 2F3YA 4XJKA 1YX7A 2JPTA 3I5GC 2BECA 1RTP1 5KU1A 1LA3A 3DF0A 1SPYA 1GQMA 4CPVA 1WRKA 1TNPA 1CMGA 1QASA 2MRDA 4FTGA 2HPSA 5CSJA 2NXQA 1UWOA 4PALA 1TN4A 2JXCA 1A03A 1B1GA 4IL1A 1IG5A 2IS9A 3EKJA 1F71A 1M31A 1N0YA 2JU0A 1V1GA 3BXKA 1TNQA 1XA5A 1BR1B 2JXLA 1K9UA 2BL0B 3EK8A 1AJ4A 4MBEA 1BLQA 1A75B 1B9AA 3CTNA 1FF1A 1ODBA 2LUXA 3GK1A 1NCYA 1PSRA 1J1EA 1QX5B 2F2OA 3WXAA 1F70A 3HX4A 1PALA 1IH0A 1F55A 4I5JA 5D69A 1UHNA 2L4IA 3CGAA 4DUQA 1DJIA 3CR5X 2HQWA 3SG5A 2LC5A 2OS8B 1QLKA 5HLVA 4PCWA 1SRAA 3PSRA 2KGRA 2PALA 3NXAA 3LLEA 2GGZA 1AVSA 1JF0A 1MR8A 2ZFDA 3DD4A 2BL0C 5AXIA 4NDBA 4PHJA 1SK6D 3I5IB 5B8IB 1K93D 1DJYA 4HSZA 2OTGB 1YUTA 1SNLA 1K8UA 2G2BA 1A29A 1B8CA 1TNWA 1AJ5A 1LINA 1KFXL 4YGDB 1QVIY 4HREE 2H2KA 2OS8C 2BBNA 1NCXA 5TNCA 2FCDA 1XVJA 1R6PA 1SL9A 1JF2A 1CDNA 1KFXS 1CDLA 1IGVA 5CSFA 3SIBA 1NIWA 2KAVA 4DIRA 2KFFA 1BOCA 3ZWHA 1H8BA 2LLSA 1ZACA 1N2DA 3I5IC 4GGFA 1LA0A 1QIVA 2OTGC 3FS7A 1YURA 2I94A 2K2AA 2E6WA 1JBAA 1XO5A 2M9GA 3VGOA 1CM1A 1QLSA 5CSIA 2Q4UA 1PVBA 2AAOA 4ORCB 1EXRA 2KQYA 2LAPA 2CT9A 5ER4X 1CTRA 1TOPA 3OB1B 2CXJA 3SG4A 1PVAA 1SCMC 3WHTB 1YRTB 2Y1MA 1XK4A 1MQ1A 1UURA 2PASA 3C1VA 1BMOA 1DJZA 2L98A 2LVVA 3JVTB 1QIWA 1BF5A 1SL7A 5DKNA 1RWYA 2JTTA 2Y5IA 2KDHA 1KCYA 2HF5A 3AKBA 2LM5A 2HQ8A 3PLFB 4BY5A 4N5XA 4AOMA 2JULA 3DF0B 3PM8A 1CFFA 2LLUA 4MZLA 3CWGA 3FWBA 2AUCA 1KWOC 2NLNA 2EC6B 4M2QA 1LVCD 1J7QA 5HLOA 2LLTA 1S36A 5AERA 2GGMA 1MHOA 1S26D 1J1DA 4YI9A 3ZNIA 1TCFA 2CTNA 1NPQA 2M29A 1OOJA 4AQIA 2O60A 3JVTC 1G8IA 1FI5A 3CS1A 1WRLA 4MRYA 4D1EA 1YR5A 1QX7A 5F6TA 1SR6B 2KGBC 2LCPA 4I5NB 1L7ZA 3TDIA 3MSEB 2M1KB 4DCKA 4NDDA 4CLNA 1JFJA 4OVNF 2MHHA 3QRXA 4DRWA 2EGDA 1DVIA 1SCVA 2CNPA 1YVLA 2PRUA 2EC6C 2KHNA 2JQ6A 5I2OA 2KI4B 3D10A 4CIDA 2R2IA 1X02A
chains in the Genus database with same CATH superfamily
1YUSA 1CM4A 2BKHB 2KYCA 3BUNB 4JWQA 5BPJA 1PK0D 1EH2A 2ZRSA 2WOSA 4KYNA 1NYAA 4USLA 4YBHB 2DOQA 3BQ3A 4YGBB 3DVMA 3EVUA 3VRPA 4WQ3A 3LK1A 2QACA 1SR6C 2KBMA 4F7FA 5AEQA 4I5KA 1TNXA 3A8RA 2MA2A 2NZ0A 3NGVA 4P2YB 3NHIA 4C0JA 1CKKA 1J7OA 2KSPA 1M63B 1UP5A 3CR2A 3GK4X 1ZOTB 1ZMZA 1MF8B 2H8VA 2KI4C 3CDNA 4A4BA 2L51A 3RM1A 1CFPA 1B7TZ 5GQQC 1YVHA 1QTXA 4U8DA 1NUBA 3B88A 3A4UB 2FCEA 1KSMA 1WDCB 2LMUA 1DF0B 2JT0A 3BJHA 1RROA 2CBLA 1TCOB 2K7CA 2VRGA 3BUMB 3FWCA 1QX2A 2F8PA 3NSKA 1PSBA 1A2XA 1PRWA 3R1OA 5CSNA 1TUJA 2K61A 2KQ6A 1LKJA 1Z2CB 4OZDA 1K9PA 3EVVA 2KAYA 2MBXA 2A4JA 2LVKA 1OMRA 1CMFA 2ZN8A 4DS7A 4JD9A 5AFPA 2JTZA 4IJ7A 1QXPA 1WY9A 1DJXA 2L2CA 5J3XA 3ICBA 3O78A 2M0RA 4JKTA 1XFWO 4OKHA 1WDCC 1XYDA 3KEVA 3S0BA 4N1GA 5HKWA 1SMGA 2JOJA 2LVIA 2BCAA 4YGEB 2WCKA 1CFCA 1Y1UA 1CLMA 1OOHA 1QJTA 4AQJA 5KSZA 3AKAA 5I2QA 1C07A 1NWDA 1LXFC 1NX1A 4PDZA 4BY4A 1L2OB 1S3PA 2L2EA 3R1PA 2KOTA 1YRUB 4GGFC 2L0PA 3DVKA 3AAJA 1DF0A 1SCMB 3PJIA 3TUYB 1SKTA 2KNEA 4OR9B 1K96A 2PMYA 4GAOA 4GUKA 1CDPA 1EG3A 2JZIA 2JNXA 2V53A 2E30A 1Q80A 4MZJA 3PM2A 1DGVA 1K90D 2HETA 2M49B 2L5YA 2OPOA 3L4LA 1OQPA 3O4XA 1CDMA 1ALWA 3SG2A 1AHRA 1XK4C 1HT9A 2L5XB 2AMIA 3E3RA 4YRUA 4YGCB 3BUXB 1KWOB 3VRRA 1AP4A 3O4YA 3OB2B 1S6CA 1L2OC 4OCIA 2L4HA 1TWOA 2SCPA 2G9BA 3IQOA 2PSRA 1B47A 1B7TY 2ZNDA 4GNKB 3TUYC 2M1UA 1B4CA 1J7RA 3OGNA 1FI6A 4CFQA 1S5GZ 1D1OA 1OSAA 3PALA 2LVJA 1S6IA 4ZCVA 3BFAA 1H4BA 1BT6A 1CLLA 2MAZA 4MLWA 3KPXA 1M46A 3D0YB 5DKQA 1CNPA 3NSLA 3BUWB 1F4OA 5ER5A 1SY9A 1IJ6A 2WCEA 3OBVA 1BU3A 3KF9A 1JWDA 2JPOA 1ORGA 2K7OA 1IIOA 2ERBA 1QV1A 2WCFA 3L47A 3OX5A 1QV0A 4P5OE 1PULA 3OP0A 3B87A 2LP2A 1GGWA 2F2PA 3TS5B 2WCLA 3O2PA 3VROA 1DJHA 1NX3A 1KQVA 4NDCA 1N65A 2I7AA 5FI6A 2MJWB 2JC2A 3K21A 5D3OA 3NSOA 2LUCA 3UO9A 1CB1A 1RFJA 4PE1A 5IBWA 2LHIA 1F4QA 2WORA 2YGUA 1IQ3A 1SSEB 3D78A 2H61A 2JT8A 2K7DA 2QDIA 4NQGA 2FJUB 2KBIA 1AK8A 2QEVA 1TUZA 1EG4A 3OHMB 1ZUZA 2B1UA 3GOFA 3D0YA 3TZ1A 1DJWA 4PHMA 1G33A 1DEKA 4INXA 3TDZA 3DZTA 3TS5C 3S0AA 1RJVA 1GGZA 3EKHA 1SBJA 3TDUA 1RK9A 1S1EA 4ICBA 1OOIX 3FE6A 5JOLA 1YUUA 1CLBA 1C7WA 1OZSA 1SW8A 2KLEA 3SG7A 2LMVA 4M2OA 2JWWA 1C7VA 1DMOA 1UUSA 4MRXA 4GFTA 5HYDA 1BG1A 1EJ3A 1WRZA 2M97A 4PE4A 2K7BA 1OZOA 3CR4X 3K1EA 2I18A 2K0JA 2GV5A 5K89A 1M39A 2L50A 2WCJA 5HKZA 1S5GY 1W7IB 2Q91A 2ZKMX 3IQQA 2QEBA 1DGUA 2EHBA 2ZNEA 2MLEC 5PALA 3RLZA 3DVJA 4I5LB 3VRNA 4A4CA 1IRJA 1AUIB 5I8NA 3I5FC 1K2HA 2SASA 1XFUO 4R1EA 4ZCUA 3LCPC 2PQLA 3PN7B 1K9KA 1OMDA 1XFVO 1XFYO 1VRKA 4MZKA 1E8AA 1J7PA 4M2PA 2KYFA 3BYAA 3BOWA 4INWA 4Q04A 1DJGA 5DICA 5I2LA 1NP8A 4JPZB 2KAXA 2JT3A 4QJ4B 2Y4QA 2LNKA 1KSOA 5CPVA 3HCMA 2KFGA 1C3YA 2O5GA 1SL8A 1NX0A 2WCBA 1BJFA 3KO0A 1U5IA 1NSHA 2PVBA 2WC5A 3DVEA 4FQOA 4CFRA 1G4YR 2KFHA 3SS3A 2M7NA 1YX8A 1Y1XA 4HRGA 3BUOB 3DY9A 3NSIA 1IQ5A 1P28A 1BR4B 2NCPA 3LK0A 3D77A 1TTXA 2LV7A 4ORBB 5FI2A 4C0LA 3PN7C 1FBVA 1Y1AA 2WC8A 4FQTA 5FYXA 4WQ2A 5AANA 1UHIA 2F3ZA 3FIAA 1JFKA 3D75A 1DT7B 1IWQA 2BNXA 5DKRA 5HKYA 3EK4A 2F33A 3GK2A 1WLMA 1XFZO 4PHKA 3CLNA 3IVTA 3N7HA 4PT1A 1JC2A 5G08A 5D7FA 3CZTX 4YI8A 3EK7A 4YGAA 4GGNA 1SYMA 1YTZC 4GBAA 5HL1A 1KK8B 3DXLA 3LL8B 5KTYA 4ETOA 1ALVA 1IKUA 4F0ZB 4QJ3B 4UPGA 1OE9B 2BCXA 2KI6D 3L4AA 4PE7A 1UHJA 1K95A 1A75A 4PE0A 1MXEA 4C0KA 1BODA 3OX6A 1OMVA 1XFXO 2K2FA 2WNDA 4OV2A 3EVRA 3I5HB 3KHEA 2PYQA 3SG6A 1KK7Z 1QS7A 1NX2A 2JRFA 4HRHA 2JNFA 2M7LA 3CABA 3SIAA 3SG3A 1RECA 2Y1NA 1DC1A 2ZN9A 2LE9B 1TRFA 1KK8C 3R72A 1F8HA 3M0WA 2I2RE 2K8MB 3PATA 4MN0A 2CCMA 2BCBA 2TN4A 2D8NA 1FW4A 5I94A 5EL2A 4WRIA 1W7JB 1C3ZA 3WNXB 1MWNA 1QATA 1HQVA 1UHKA 4N1FA 2BE4A 2P70A 3I5HC 1MXLC 1CFDA 3JTDB 4TNCA 4XYNA 1K94A 3AAKA 4L9MA 3IF7A 1IJ5A 2BE6A 2M3WA 1F54A 3O6BA 1TIZA 2H61C 1NCZA 4GPLB 2LMTA 2MLFC 2LANA 4PHNA 3UNWA 2M8UA 4XJKB 1KFUL 1ZFSA 1V1FA 1Z4HA 1Y0VH 1MUXA 3DYEA 3SJSA 2QEHA 1UHHA 2RGIA 2P6BB 2FOTA 3WHUB 4JQ0D 1KQMB 2BBMA 2KI6C 1KFUS 4MEWA 2WCHA 2LHLA 1A4PA 3V2LA 1R2UA 1S6JA 3I5GB 2QPTA 3JTDC 1J55A 3B7AA 2LP3A 4ORAB 1B8RA 3BOWB 1JSAA 1OOFA 3H4SE 1DTLA 3I5FB 1Y6WA 1FPWA 2P71A 3F45A 4E68A 1EL4A 5JJGA 1GJYA 2BKIB 4QJ5B 3CZ2A 2K60A 2NCOA 4MSPA 2COLB 3VRQA 1M45A 3CZ0A 1U5IB 1B8LA 1JUOA 2ZRTA 1WLZA 4MVFA 1KK7Y 1KQMC 3PFVA 2ISDA 1QVIZ 2F3YA 4XJKA 1YX7A 1W9ZA 3S0EA 2GTEA 2JPTA 3I5GC 2BECA 1RTP1 5KU1A 1LA3A 2FJYA 3DF0A 1SPYA 1GQMA 4CPVA 1WRKA 1TNPA 1CMGA 1LS8A 1QASA 2MRDA 4FTGA 2HPSA 5CSJA 3SS5A 2NXQA 1UWOA 4PALA 1TN4A 2JXCA 1A03A 5FI7A 1B1GA 4IL1A 1IG5A 2IS9A 3EKJA 1F71A 1M31A 1N0YA 2JU0A 1V1GA 3BXKA 1TNQA 1XA5A 1BR1B 2JXLA 1K9UA 2BL0B 3EK8A 1AJ4A 1OW4A 2KPHA 4MBEA 1A75B 1B9AA 1BLQA 3CTNA 1FF1A 1ODBA 2LUXA 3GK1A 3D73A 3SS4A 1NCYA 1PSRA 1J1EA 1QX5B 2F2OA 3WXAA 3S0FA 1F70A 3HX4A 1PALA 1IH0A 1F55A 4I5JA 5D69A 1UHNA 2L4IA 3CGAA 4DUQA 1DJIA 3CR5X 2HQWA 3SG5A 2LC5A 2OS8B 1DELA 1QLKA 5HLVA 4PCWA 1SRAA 3PSRA 2KGRA 2PALA 3NXAA 3LLEA 2GGZA 1AVSA 1JF0A 1MR8A 2ZFDA 3DD4A 2BL0C 5AXIA 4NDBA 4PHJA 1SK6D 3I5IB 5B8IB 1K93D 1DJYA 4HSZA 2OTGB 1YUTA 1SNLA 1K8UA 2G2BA 1A29A 1B8CA 1TNWA 3EG5B 1AJ5A 3BFHA 1LINA 1KFXL 2WC6A 4YGDB 1QVIY 4HREE 2H2KA 2OS8C 2BBNA 1NCXA 3R1VA 2FCDA 5TNCA 1XVJA 1R6PA 1SL9A 1JF2A 1CDNA 3VB1A 1KFXS 1CDLA 1IGVA 5CSFA 3SIBA 1NIWA 2KAVA 4DIRA 2KFFA 1BOCA 3ZWHA 1H8BA 2LLSA 1ZACA 3S0DA 1N2DA 3I5IC 4GGFA 1LA0A 1QIVA 2OTGC 3FS7A 1YURA 2I94A 2K2AA 3FE9A 2E6WA 1JBAA 3S0GA 1XO5A 1OOGA 2M9GA 1XFRA 3VGOA 1CM1A 1QLSA 5CSIA 2Q4UA 3D76A 2KLDA 1PVBA 2AAOA 4ORCB 1EXRA 2KQYA 2LAPA 2WCMA 2CT9A 5ER4X 1CTRA 1TOPA 3OB1B 2CXJA 3SG4A 2QEOA 1PVAA 1SCMC 3Q8IA 3WHTB 1YRTB 2Y1MA 1T14A 1MQ1A 1UURA 1XK4A 2PASA 3C1VA 1BMOA 1DJZA 2L98A 2LVVA 3JVTB 1QIWA 3B86A 1BF5A 1SL7A 5DKNA 1RWYA 2JTTA 2Y5IA 2KDHA 1KCYA 2HF5A 3AKBA 2LM5A 2HQ8A 3PLFB 4BY5A 4N5XA 3CZ1A 2JULA 3DF0B 4AOMA 3PM8A 1CFFA 2LLUA 4MZLA 3BFBA 3CWGA 3QMEA 3FWBA 2AUCA 1KWOC 2NLNA 2EC6B 4M2QA 1LVCD 1J7QA 3NHTA 5HLOA 2LLTA 3D74A 1S36A 5AERA 1DQEA 2GGMA 1MHOA 1S26D 1J1DA 4YI9A 3ZNIA 1TCFA 2CTNA 1NPQA 2M29A 1OOJA 4AQIA 2O60A 2BAPA 3JVTC 3FE8A 1G8IA 1FI5A 3B6XA 1QWVA 3CS1A 3CYZA 1WRLA 4MRYA 4D1EA 1YR5A 1QX7A 5F6TA 1SR6B 2KGBC 2LCPA 4I5NB 1L7ZA 3TDIA 3MSEB 2M1KB 4DCKA 4NDDA 4CLNA 1JFJA 4OVNF 2MHHA 3QRXA 4DRWA 2EGDA 1GM0A 1DVIA 1SCVA 2CNPA 1YVLA 2PRUA 2EC6C 2KHNA 2JQ6A 5I2OA 2KI4B 3D10A 4CIDA 3RZSA 2R2IA 1X02A
chains in the Genus database with same CATH topology
1YUSA 1CM4A 2BKHB 2KYCA 3BUNB 4JWQA 5BPJA 1PK0D 1EH2A 2ZRSA 2WOSA 1NYAA 4USLA 4YBHB 2DOQA 3BQ3A 4YGBB 3DVMA 3EVUA 3VRPA 4WQ3A 3LK1A 2QACA 1SR6C 2KBMA 5AEQA 4I5KA 1TNXA 3A8RA 2MA2A 2NZ0A 4P2YB 4C0JA 1CKKA 1J7OA 2KSPA 1M63B 1UP5A 3CR2A 3GK4X 1ZOTB 1ZMZA 1MF8B 2KI4C 4A4BA 2L51A 3RM1A 1CFPA 1B7TZ 5GQQC 1YVHA 1QTXA 4U8DA 1NUBA 3A4UB 2FCEA 1KSMA 1WDCB 2LMUA 1DF0B 2JT0A 1RROA 2CBLA 1TCOB 2K7CA 2VRGA 3BUMB 3FWCA 1QX2A 2F8PA 3NSKA 1PSBA 1A2XA 1PRWA 5CSNA 2K61A 2KQ6A 1LKJA 1K9PA 3EVVA 2KAYA 2MBXA 2A4JA 2LVKA 1OMRA 1CMFA 2ZN8A 4DS7A 5AFPA 2JTZA 1QXPA 1WY9A 1DJXA 5J3XA 3ICBA 3O78A 2M0RA 1XFWO 4OKHA 1WDCC 1XYDA 3KEVA 4N1GA 5HKWA 1SMGA 2JOJA 2LVIA 2BCAA 4YGEB 1CFCA 1Y1UA 1CLMA 4AQJA 1QJTA 5KSZA 3AKAA 5I2QA 1C07A 1NWDA 1LXFC 1NX1A 4PDZA 4BY4A 1L2OB 1S3PA 2L2EA 2KOTA 1YRUB 4GGFC 2L0PA 3DVKA 3AAJA 1DF0A 1SCMB 3TUYB 1SKTA 2KNEA 4OR9B 1K96A 2PMYA 4GAOA 4GUKA 1CDPA 1EG3A 2JZIA 2JNXA 2V53A 2E30A 1Q80A 4MZJA 1DGVA 1K90D 2HETA 2M49B 2OPOA 1OQPA 1CDMA 1ALWA 3SG2A 1AHRA 1XK4C 1HT9A 2L5XB 2AMIA 3E3RA 4YRUA 4YGCB 3BUXB 1KWOB 3VRRA 1AP4A 3O4YA 3OB2B 1S6CA 1L2OC 4OCIA 2L4HA 2SCPA 2G9BA 3IQOA 2PSRA 1B47A 1B7TY 2ZNDA 4GNKB 3TUYC 2M1UA 1B4CA 1J7RA 1FI6A 4CFQA 1S5GZ 1D1OA 1OSAA 3PALA 2LVJA 1S6IA 4ZCVA 1H4BA 1BT6A 1CLLA 2MAZA 4MLWA 3KPXA 1M46A 3D0YB 5DKQA 1CNPA 3NSLA 3BUWB 1F4OA 5ER5A 1SY9A 1IJ6A 2WCEA 1BU3A 3KF9A 1JWDA 2K7OA 2WCFA 1QV1A 3OX5A 4P5OE 1GGWA 1QV0A 1PULA 3OP0A 2LP2A 2F2PA 3TS5B 3O2PA 3VROA 1DJHA 1NX3A 1KQVA 4NDCA 1N65A 2I7AA 2MJWB 2JC2A 3K21A 3NSOA 2LUCA 1CB1A 1RFJA 4PE1A 5IBWA 2LHIA 1F4QA 2WORA 1IQ3A 2H61A 2JT8A 2K7DA 4NQGA 2FJUB 2KBIA 1AK8A 1EG4A 3OHMB 1ZUZA 2B1UA 3GOFA 3D0YA 3TZ1A 1DJWA 4PHMA 1G33A 3TDZA 3TS5C 1RJVA 1GGZA 3EKHA 1SBJA 3TDUA 1RK9A 1S1EA 4ICBA 5JOLA 1YUUA 1CLBA 1C7WA 1OZSA 1SW8A 3SG7A 2LMVA 4M2OA 2JWWA 1C7VA 1DMOA 1UUSA 4MRXA 4GFTA 5HYDA 1BG1A 1EJ3A 1WRZA 2M97A 4PE4A 2K7BA 1OZOA 3CR4X 2I18A 2K0JA 2GV5A 5K89A 1M39A 2L50A 5HKZA 1S5GY 1W7IB 2Q91A 2ZKMX 3IQQA 1DGUA 2EHBA 2ZNEA 2MLEC 5PALA 3RLZA 3DVJA 4I5LB 3VRNA 4A4CA 1IRJA 1AUIB 5I8NA 3I5FC 1K2HA 2SASA 1XFUO 4R1EA 4ZCUA 3LCPC 3PN7B 1K9KA 1OMDA 1XFVO 1XFYO 1VRKA 4MZKA 1E8AA 1J7PA 4M2PA 2KYFA 3BYAA 3BOWA 4Q04A 1DJGA 5I2LA 1NP8A 4JPZB 2KAXA 2JT3A 4QJ4B 2Y4QA 2LNKA 1KSOA 5CPVA 3HCMA 2KFGA 2O5GA 1SL8A 1NX0A 2WCBA 1BJFA 3KO0A 1U5IA 1NSHA 2PVBA 3DVEA 4FQOA 4CFRA 1G4YR 2KFHA 2M7NA 1YX8A 1Y1XA 4HRGA 3BUOB 3NSIA 1IQ5A 3LK0A 1BR4B 2NCPA 4ORBB 4C0LA 1TTXA 2LV7A 3PN7C 1FBVA 1Y1AA 2WC8A 5FYXA 4WQ2A 5AANA 1UHIA 2F3ZA 3FIAA 1JFKA 1DT7B 1IWQA 5DKRA 5HKYA 3EK4A 2F33A 3GK2A 1WLMA 1XFZO 4PHKA 3CLNA 1JC2A 5G08A 5D7FA 3CZTX 4YI8A 3EK7A 4YGAA 4GGNA 1SYMA 1YTZC 4GBAA 1KK8B 3LL8B 5KTYA 4ETOA 1ALVA 1IKUA 4F0ZB 4QJ3B 4UPGA 1OE9B 2BCXA 2KI6D 4PE7A 1UHJA 1K95A 1A75A 4PE0A 1MXEA 4C0KA 1BODA 3OX6A 1OMVA 1XFXO 2K2FA 2WNDA 4OV2A 3EVRA 3I5HB 3KHEA 3SG6A 1KK7Z 1QS7A 1NX2A 2JRFA 4HRHA 2JNFA 2M7LA 3SIAA 3SG3A 1RECA 2Y1NA 2ZN9A 2LE9B 1TRFA 1KK8C 1F8HA 3M0WA 2I2RE 2K8MB 3PATA 4MN0A 2CCMA 2BCBA 2TN4A 2D8NA 1FW4A 4WRIA 1W7JB 3WNXB 1MWNA 1QATA 1HQVA 1UHKA 4N1FA 2BE4A 3I5HC 1MXLC 1CFDA 3JTDB 4TNCA 4XYNA 1K94A 3AAKA 4L9MA 3IF7A 1IJ5A 2BE6A 2M3WA 1F54A 3O6BA 1TIZA 2H61C 1NCZA 4GPLB 2LMTA 2MLFC 2LANA 4PHNA 2M8UA 4XJKB 1KFUL 1ZFSA 1V1FA 1Y0VH 1MUXA 3SJSA 1UHHA 2RGIA 2P6BB 2FOTA 3WHUB 4JQ0D 1KQMB 2BBMA 2KI6C 1KFUS 4MEWA 2LHLA 1A4PA 1R2UA 1S6JA 3I5GB 2QPTA 3JTDC 1J55A 2LP3A 4ORAB 1B8RA 3BOWB 1JSAA 3H4SE 1DTLA 3I5FB 1Y6WA 1FPWA 3F45A 4E68A 1EL4A 5JJGA 1GJYA 2BKIB 4QJ5B 2NCOA 4MSPA 2COLB 3VRQA 1M45A 1U5IB 1B8LA 1JUOA 2ZRTA 1WLZA 4MVFA 1KK7Y 1KQMC 3PFVA 2ISDA 1QVIZ 2F3YA 4XJKA 1YX7A 2JPTA 3I5GC 2BECA 1RTP1 5KU1A 1LA3A 3DF0A 1SPYA 1GQMA 4CPVA 1WRKA 1TNPA 1CMGA 1QASA 2MRDA 4FTGA 2HPSA 5CSJA 2NXQA 1UWOA 4PALA 1TN4A 2JXCA 1A03A 1B1GA 4IL1A 1IG5A 2IS9A 3EKJA 1F71A 1M31A 1N0YA 2JU0A 1V1GA 3BXKA 1TNQA 1XA5A 1BR1B 2JXLA 1K9UA 2BL0B 3EK8A 1AJ4A 4MBEA 1BLQA 1A75B 1B9AA 3CTNA 1FF1A 1ODBA 2LUXA 3GK1A 1NCYA 1PSRA 1J1EA 1QX5B 2F2OA 3WXAA 1F70A 3HX4A 1PALA 1IH0A 1F55A 4I5JA 5D69A 1UHNA 2L4IA 3CGAA 4DUQA 1DJIA 3CR5X 2HQWA 3SG5A 2LC5A 2OS8B 1QLKA 5HLVA 4PCWA 1SRAA 3PSRA 2KGRA 2PALA 3NXAA 3LLEA 2GGZA 1AVSA 1JF0A 1MR8A 2ZFDA 3DD4A 2BL0C 5AXIA 4NDBA 4PHJA 1SK6D 3I5IB 5B8IB 1K93D 1DJYA 4HSZA 2OTGB 1YUTA 1SNLA 1K8UA 2G2BA 1A29A 1B8CA 1TNWA 1AJ5A 1LINA 1KFXL 4YGDB 1QVIY 4HREE 2H2KA 2OS8C 2BBNA 1NCXA 5TNCA 2FCDA 1XVJA 1R6PA 1SL9A 1JF2A 1CDNA 1KFXS 1CDLA 1IGVA 5CSFA 3SIBA 1NIWA 2KAVA 4DIRA 2KFFA 1BOCA 3ZWHA 1H8BA 2LLSA 1ZACA 1N2DA 3I5IC 4GGFA 1LA0A 1QIVA 2OTGC 3FS7A 1YURA 2I94A 2K2AA 2E6WA 1JBAA 1XO5A 2M9GA 3VGOA 1CM1A 1QLSA 5CSIA 2Q4UA 1PVBA 2AAOA 4ORCB 1EXRA 2KQYA 2LAPA 2CT9A 5ER4X 1CTRA 1TOPA 3OB1B 2CXJA 3SG4A 1PVAA 1SCMC 3WHTB 1YRTB 2Y1MA 1XK4A 1MQ1A 1UURA 2PASA 3C1VA 1BMOA 1DJZA 2L98A 2LVVA 3JVTB 1QIWA 1BF5A 1SL7A 5DKNA 1RWYA 2JTTA 2Y5IA 2KDHA 1KCYA 2HF5A 3AKBA 2LM5A 2HQ8A 3PLFB 4BY5A 4N5XA 4AOMA 2JULA 3DF0B 3PM8A 1CFFA 2LLUA 4MZLA 3CWGA 3FWBA 2AUCA 1KWOC 2NLNA 2EC6B 4M2QA 1LVCD 1J7QA 5HLOA 2LLTA 1S36A 5AERA 2GGMA 1MHOA 1S26D 1J1DA 4YI9A 3ZNIA 1TCFA 2CTNA 1NPQA 2M29A 1OOJA 4AQIA 2O60A 3JVTC 1G8IA 1FI5A 3CS1A 1WRLA 4MRYA 4D1EA 1YR5A 1QX7A 5F6TA 1SR6B 2KGBC 2LCPA 4I5NB 1L7ZA 3TDIA 3MSEB 2M1KB 4DCKA 4NDDA 4CLNA 1JFJA 4OVNF 2MHHA 3QRXA 4DRWA 2EGDA 1DVIA 1SCVA 2CNPA 1YVLA 2PRUA 2EC6C 2KHNA 2JQ6A 5I2OA 2KI4B 3D10A 4CIDA 2R2IA 1X02A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YUS A;  1CM4 A;  2BKH B;  2KYC A;  3BUN B;  4JWQ A;  5BPJ A;  1PK0 D;  1EH2 A;  2ZRS A;  2WOS A;  1NYA A;  4USL A;  4YBH B;  2DOQ A;  3BQ3 A;  4YGB B;  3DVM A;  3EVU A;  3VRP A;  4WQ3 A;  3LK1 A;  2QAC A;  1SR6 C;  2KBM A;  5AEQ A;  4I5K A;  1TNX A;  3A8R A;  2MA2 A;  2NZ0 A;  4P2Y B;  4C0J A;  1CKK A;  1J7O A;  2KSP A;  1M63 B;  1UP5 A;  3CR2 A;  3GK4 X;  1ZOT B;  1ZMZ A;  1MF8 B;  2KI4 C;  4A4B A;  2L51 A;  3RM1 A;  1CFP A;  1B7T Z;  5GQQ C;  1YVH A;  1QTX A;  4U8D A;  1NUB A;  3A4U B;  2FCE A;  1KSM A;  1WDC B;  2LMU A;  1DF0 B;  2JT0 A;  1RRO A;  2CBL A;  1TCO B;  2K7C A;  2VRG A;  3BUM B;  3FWC A;  1QX2 A;  2F8P A;  3NSK A;  1PSB A;  1A2X A;  1PRW A;  5CSN A;  2K61 A;  2KQ6 A;  1LKJ A;  1K9P A;  3EVV A;  2KAY A;  2MBX A;  2A4J A;  2LVK A;  1OMR A;  1CMF A;  2ZN8 A;  4DS7 A;  5AFP A;  2JTZ A;  1QXP A;  1WY9 A;  1DJX A;  5J3X A;  3ICB A;  3O78 A;  2M0R A;  1XFW O;  4OKH A;  1WDC C;  1XYD A;  3KEV A;  4N1G A;  5HKW A;  1SMG A;  2JOJ A;  2LVI A;  2BCA A;  4YGE B;  1CFC A;  1Y1U A;  1CLM A;  4AQJ A;  1QJT A;  5KSZ A;  3AKA A;  5I2Q A;  1C07 A;  1NWD A;  1LXF C;  1NX1 A;  4PDZ A;  4BY4 A;  1L2O B;  1S3P A;  2L2E A;  2KOT A;  1YRU B;  4GGF C;  2L0P A;  3DVK A;  3AAJ A;  1DF0 A;  1SCM B;  3TUY B;  1SKT A;  2KNE A;  4OR9 B;  1K96 A;  2PMY A;  4GAO A;  4GUK A;  1CDP A;  1EG3 A;  2JZI A;  2JNX A;  2V53 A;  2E30 A;  1Q80 A;  4MZJ A;  1DGV A;  1K90 D;  2HET A;  2M49 B;  2OPO A;  1OQP A;  1CDM A;  1ALW A;  3SG2 A;  1AHR A;  1XK4 C;  1HT9 A;  2L5X B;  2AMI A;  3E3R A;  4YRU A;  4YGC B;  3BUX B;  1KWO B;  3VRR A;  1AP4 A;  3O4Y A;  3OB2 B;  1S6C A;  1L2O C;  4OCI A;  2L4H A;  2SCP A;  2G9B A;  3IQO A;  2PSR A;  1B47 A;  1B7T Y;  2ZND A;  4GNK B;  3TUY C;  2M1U A;  1B4C A;  1J7R A;  1FI6 A;  4CFQ A;  1S5G Z;  1D1O A;  1OSA A;  3PAL A;  2LVJ A;  1S6I A;  4ZCV A;  1H4B A;  1BT6 A;  1CLL A;  2MAZ A;  4MLW A;  3KPX A;  1M46 A;  3D0Y B;  5DKQ A;  1CNP A;  3NSL A;  3BUW B;  1F4O A;  5ER5 A;  1SY9 A;  1IJ6 A;  2WCE A;  1BU3 A;  3KF9 A;  1JWD A;  2K7O A;  2WCF A;  1QV1 A;  3OX5 A;  4P5O E;  1GGW A;  1QV0 A;  1PUL A;  3OP0 A;  2LP2 A;  2F2P A;  3TS5 B;  3O2P A;  3VRO A;  1DJH A;  1NX3 A;  1KQV A;  4NDC A;  1N65 A;  2I7A A;  2MJW B;  2JC2 A;  3K21 A;  3NSO A;  2LUC A;  1CB1 A;  1RFJ A;  4PE1 A;  5IBW A;  2LHI A;  1F4Q A;  2WOR A;  1IQ3 A;  2H61 A;  2JT8 A;  2K7D A;  4NQG A;  2FJU B;  2KBI A;  1AK8 A;  1EG4 A;  3OHM B;  1ZUZ A;  2B1U A;  3GOF A;  3D0Y A;  3TZ1 A;  1DJW A;  4PHM A;  1G33 A;  3TDZ A;  3TS5 C;  1RJV A;  1GGZ A;  3EKH A;  1SBJ A;  3TDU A;  1RK9 A;  1S1E A;  4ICB A;  5JOL A;  1YUU A;  1CLB A;  1C7W A;  1OZS A;  1SW8 A;  3SG7 A;  2LMV A;  4M2O A;  2JWW A;  1C7V A;  1DMO A;  1UUS A;  4MRX A;  4GFT A;  5HYD A;  1BG1 A;  1EJ3 A;  1WRZ A;  2M97 A;  4PE4 A;  2K7B A;  1OZO A;  3CR4 X;  2I18 A;  2K0J A;  2GV5 A;  5K89 A;  1M39 A;  2L50 A;  5HKZ A;  1S5G Y;  1W7I B;  2Q91 A;  2ZKM X;  3IQQ A;  1DGU A;  2EHB A;  2ZNE A;  2MLE C;  5PAL A;  3RLZ A;  3DVJ A;  4I5L B;  3VRN A;  4A4C A;  1IRJ A;  1AUI B;  5I8N A;  3I5F C;  1K2H A;  2SAS A;  1XFU O;  4R1E A;  4ZCU A;  3LCP C;  3PN7 B;  1K9K A;  1OMD A;  1XFV O;  1XFY O;  1VRK A;  4MZK A;  1E8A A;  1J7P A;  4M2P A;  2KYF A;  3BYA A;  3BOW A;  4Q04 A;  1DJG A;  5I2L A;  1NP8 A;  4JPZ B;  2KAX A;  2JT3 A;  4QJ4 B;  2Y4Q A;  2LNK A;  1KSO A;  5CPV A;  3HCM A;  2KFG A;  2O5G A;  1SL8 A;  1NX0 A;  2WCB A;  1BJF A;  3KO0 A;  1U5I A;  1NSH A;  2PVB A;  3DVE A;  4FQO A;  4CFR A;  1G4Y R;  2KFH A;  2M7N A;  1YX8 A;  1Y1X A;  4HRG A;  3BUO B;  3NSI A;  1IQ5 A;  3LK0 A;  1BR4 B;  2NCP A;  4ORB B;  4C0L A;  1TTX A;  2LV7 A;  3PN7 C;  1FBV A;  1Y1A A;  2WC8 A;  5FYX A;  4WQ2 A;  5AAN A;  1UHI A;  2F3Z A;  3FIA A;  1JFK A;  1DT7 B;  1IWQ A;  5DKR A;  5HKY A;  3EK4 A;  2F33 A;  3GK2 A;  1WLM A;  1XFZ O;  4PHK A;  3CLN A;  1JC2 A;  5G08 A;  5D7F A;  3CZT X;  4YI8 A;  3EK7 A;  4YGA A;  4GGN A;  1SYM A;  1YTZ C;  4GBA A;  1KK8 B;  3LL8 B;  5KTY A;  4ETO A;  1ALV A;  1IKU A;  4F0Z B;  4QJ3 B;  4UPG A;  1OE9 B;  2BCX A;  2KI6 D;  4PE7 A;  1UHJ A;  1K95 A;  1A75 A;  4PE0 A;  1MXE A;  4C0K A;  1BOD A;  3OX6 A;  1OMV A;  1XFX O;  2K2F A;  2WND A;  4OV2 A;  3EVR A;  3I5H B;  3KHE A;  3SG6 A;  1KK7 Z;  1QS7 A;  1NX2 A;  2JRF A;  4HRH A;  2JNF A;  2M7L A;  3SIA A;  3SG3 A;  1REC A;  2Y1N A;  2ZN9 A;  2LE9 B;  1TRF A;  1KK8 C;  1F8H A;  3M0W A;  2I2R E;  2K8M B;  3PAT A;  4MN0 A;  2CCM A;  2BCB A;  2TN4 A;  2D8N A;  1FW4 A;  4WRI A;  1W7J B;  3WNX B;  1MWN A;  1QAT A;  1HQV A;  1UHK A;  4N1F A;  2BE4 A;  3I5H C;  1MXL C;  1CFD A;  3JTD B;  4TNC A;  4XYN A;  1K94 A;  3AAK A;  4L9M A;  3IF7 A;  1IJ5 A;  2BE6 A;  2M3W A;  1F54 A;  3O6B A;  1TIZ A;  2H61 C;  1NCZ A;  4GPL B;  2LMT A;  2MLF C;  2LAN A;  4PHN A;  2M8U A;  4XJK B;  1KFU L;  1ZFS A;  1V1F A;  1Y0V H;  1MUX A;  3SJS A;  1UHH A;  2RGI A;  2P6B B;  2FOT A;  3WHU B;  4JQ0 D;  1KQM B;  2BBM A;  2KI6 C;  1KFU S;  4MEW A;  2LHL A;  1A4P A;  1R2U A;  1S6J A;  3I5G B;  2QPT A;  3JTD C;  1J55 A;  2LP3 A;  4ORA B;  1B8R A;  3BOW B;  1JSA A;  3H4S E;  1DTL A;  3I5F B;  1Y6W A;  1FPW A;  3F45 A;  4E68 A;  1EL4 A;  5JJG A;  1GJY A;  2BKI B;  4QJ5 B;  2NCO A;  4MSP A;  2COL B;  3VRQ A;  1M45 A;  1U5I B;  1B8L A;  1JUO A;  2ZRT A;  1WLZ A;  4MVF A;  1KK7 Y;  1KQM C;  3PFV A;  2ISD A;  1QVI Z;  2F3Y A;  4XJK A;  1YX7 A;  2JPT A;  3I5G C;  2BEC A;  1RTP 1;  5KU1 A;  1LA3 A;  3DF0 A;  1SPY A;  1GQM A;  4CPV A;  1WRK A;  1TNP A;  1CMG A;  1QAS A;  2MRD A;  4FTG A;  2HPS A;  5CSJ A;  2NXQ A;  1UWO A;  4PAL A;  1TN4 A;  2JXC A;  1A03 A;  1B1G A;  4IL1 A;  1IG5 A;  2IS9 A;  3EKJ A;  1F71 A;  1M31 A;  1N0Y A;  2JU0 A;  1V1G A;  3BXK A;  1TNQ A;  1XA5 A;  1BR1 B;  2JXL A;  1K9U A;  2BL0 B;  3EK8 A;  1AJ4 A;  4MBE A;  1BLQ A;  1A75 B;  1B9A A;  3CTN A;  1FF1 A;  1ODB A;  2LUX A;  3GK1 A;  1NCY A;  1PSR A;  1J1E A;  1QX5 B;  2F2O A;  3WXA A;  1F70 A;  3HX4 A;  1PAL A;  1IH0 A;  1F55 A;  4I5J A;  5D69 A;  1UHN A;  2L4I A;  3CGA A;  4DUQ A;  1DJI A;  3CR5 X;  2HQW A;  3SG5 A;  2LC5 A;  2OS8 B;  1QLK A;  5HLV A;  4PCW A;  1SRA A;  3PSR A;  2KGR A;  2PAL A;  3NXA A;  3LLE A;  2GGZ A;  1AVS A;  1JF0 A;  1MR8 A;  2ZFD A;  3DD4 A;  2BL0 C;  5AXI A;  4NDB A;  4PHJ A;  1SK6 D;  3I5I B;  5B8I B;  1K93 D;  1DJY A;  4HSZ A;  2OTG B;  1YUT A;  1SNL A;  1K8U A;  2G2B A;  1A29 A;  1B8C A;  1TNW A;  1AJ5 A;  1LIN A;  1KFX L;  4YGD B;  1QVI Y;  4HRE E;  2H2K A;  2OS8 C;  2BBN A;  1NCX A;  5TNC A;  2FCD A;  1XVJ A;  1R6P A;  1SL9 A;  1JF2 A;  1CDN A;  1KFX S;  1CDL A;  1IGV A;  5CSF A;  3SIB A;  1NIW A;  2KAV A;  4DIR A;  2KFF A;  1BOC A;  3ZWH A;  1H8B A;  2LLS A;  1ZAC A;  1N2D A;  3I5I C;  4GGF A;  1LA0 A;  1QIV A;  2OTG C;  3FS7 A;  1YUR A;  2I94 A;  2K2A A;  2E6W A;  1JBA A;  1XO5 A;  2M9G A;  3VGO A;  1CM1 A;  1QLS A;  5CSI A;  2Q4U A;  1PVB A;  2AAO A;  4ORC B;  1EXR A;  2KQY A;  2LAP A;  2CT9 A;  5ER4 X;  1CTR A;  1TOP A;  3OB1 B;  2CXJ A;  3SG4 A;  1PVA A;  1SCM C;  3WHT B;  1YRT B;  2Y1M A;  1XK4 A;  1MQ1 A;  1UUR A;  2PAS A;  3C1V A;  1BMO A;  1DJZ A;  2L98 A;  2LVV A;  3JVT B;  1QIW A;  1BF5 A;  1SL7 A;  5DKN A;  1RWY A;  2JTT A;  2Y5I A;  2KDH A;  1KCY A;  2HF5 A;  3AKB A;  2LM5 A;  2HQ8 A;  3PLF B;  4BY5 A;  4N5X A;  4AOM A;  2JUL A;  3DF0 B;  3PM8 A;  1CFF A;  2LLU A;  4MZL A;  3CWG A;  3FWB A;  2AUC A;  1KWO C;  2NLN A;  2EC6 B;  4M2Q A;  1LVC D;  1J7Q A;  5HLO A;  2LLT A;  1S36 A;  5AER A;  2GGM A;  1MHO A;  1S26 D;  1J1D A;  4YI9 A;  3ZNI A;  1TCF A;  2CTN A;  1NPQ A;  2M29 A;  1OOJ A;  4AQI A;  2O60 A;  3JVT C;  1G8I A;  1FI5 A;  3CS1 A;  1WRL A;  4MRY A;  4D1E A;  1YR5 A;  1QX7 A;  5F6T A;  1SR6 B;  2KGB C;  2LCP A;  4I5N B;  1L7Z A;  3TDI A;  3MSE B;  2M1K B;  4DCK A;  4NDD A;  4CLN A;  1JFJ A;  4OVN F;  2MHH A;  3QRX A;  4DRW A;  2EGD A;  1DVI A;  1SCV A;  2CNP A;  1YVL A;  2PRU A;  2EC6 C;  2KHN A;  2JQ6 A;  5I2O A;  2KI4 B;  3D10 A;  4CID A;  2R2I A;  1X02 A; 
#chains in the Genus database with same CATH topology
 1YUS A;  1CM4 A;  2BKH B;  2KYC A;  3BUN B;  4JWQ A;  5BPJ A;  1PK0 D;  1EH2 A;  2ZRS A;  2WOS A;  4KYN A;  1NYA A;  4USL A;  4YBH B;  2DOQ A;  3BQ3 A;  4YGB B;  3DVM A;  3EVU A;  3VRP A;  4WQ3 A;  3LK1 A;  2QAC A;  1SR6 C;  2KBM A;  4F7F A;  5AEQ A;  4I5K A;  1TNX A;  3A8R A;  2MA2 A;  2NZ0 A;  3NGV A;  4P2Y B;  3NHI A;  4C0J A;  1CKK A;  1J7O A;  2KSP A;  1M63 B;  1UP5 A;  3CR2 A;  3GK4 X;  1ZOT B;  1ZMZ A;  1MF8 B;  2H8V A;  2KI4 C;  3CDN A;  4A4B A;  2L51 A;  3RM1 A;  1CFP A;  1B7T Z;  5GQQ C;  1YVH A;  1QTX A;  4U8D A;  1NUB A;  3B88 A;  3A4U B;  2FCE A;  1KSM A;  1WDC B;  2LMU A;  1DF0 B;  2JT0 A;  3BJH A;  1RRO A;  2CBL A;  1TCO B;  2K7C A;  2VRG A;  3BUM B;  3FWC A;  1QX2 A;  2F8P A;  3NSK A;  1PSB A;  1A2X A;  1PRW A;  3R1O A;  5CSN A;  1TUJ A;  2K61 A;  2KQ6 A;  1LKJ A;  1Z2C B;  4OZD A;  1K9P A;  3EVV A;  2KAY A;  2MBX A;  2A4J A;  2LVK A;  1OMR A;  1CMF A;  2ZN8 A;  4DS7 A;  4JD9 A;  5AFP A;  2JTZ A;  4IJ7 A;  1QXP A;  1WY9 A;  1DJX A;  2L2C A;  5J3X A;  3ICB A;  3O78 A;  2M0R A;  4JKT A;  1XFW O;  4OKH A;  1WDC C;  1XYD A;  3KEV A;  3S0B A;  4N1G A;  5HKW A;  1SMG A;  2JOJ A;  2LVI A;  2BCA A;  4YGE B;  2WCK A;  1CFC A;  1Y1U A;  1CLM A;  1OOH A;  1QJT A;  4AQJ A;  5KSZ A;  3AKA A;  5I2Q A;  1C07 A;  1NWD A;  1LXF C;  1NX1 A;  4PDZ A;  4BY4 A;  1L2O B;  1S3P A;  2L2E A;  3R1P A;  2KOT A;  1YRU B;  4GGF C;  2L0P A;  3DVK A;  3AAJ A;  1DF0 A;  1SCM B;  3PJI A;  3TUY B;  1SKT A;  2KNE A;  4OR9 B;  1K96 A;  2PMY A;  4GAO A;  4GUK A;  1CDP A;  1EG3 A;  2JZI A;  2JNX A;  2V53 A;  2E30 A;  1Q80 A;  4MZJ A;  3PM2 A;  1DGV A;  1K90 D;  2HET A;  2M49 B;  2L5Y A;  2OPO A;  3L4L A;  1OQP A;  3O4X A;  1CDM A;  1ALW A;  3SG2 A;  1AHR A;  1XK4 C;  1HT9 A;  2L5X B;  2AMI A;  3E3R A;  4YRU A;  4YGC B;  3BUX B;  1KWO B;  3VRR A;  1AP4 A;  3O4Y A;  3OB2 B;  1S6C A;  1L2O C;  4OCI A;  2L4H A;  1TWO A;  2SCP A;  2G9B A;  3IQO A;  2PSR A;  1B47 A;  1B7T Y;  2ZND A;  4GNK B;  3TUY C;  2M1U A;  1B4C A;  1J7R A;  3OGN A;  1FI6 A;  4CFQ A;  1S5G Z;  1D1O A;  1OSA A;  3PAL A;  2LVJ A;  1S6I A;  4ZCV A;  3BFA A;  1H4B A;  1BT6 A;  1CLL A;  2MAZ A;  4MLW A;  3KPX A;  1M46 A;  3D0Y B;  5DKQ A;  1CNP A;  3NSL A;  3BUW B;  1F4O A;  5ER5 A;  1SY9 A;  1IJ6 A;  2WCE A;  3OBV A;  1BU3 A;  3KF9 A;  1JWD A;  2JPO A;  1ORG A;  2K7O A;  1IIO A;  2ERB A;  1QV1 A;  2WCF A;  3L47 A;  3OX5 A;  1QV0 A;  4P5O E;  1PUL A;  3OP0 A;  3B87 A;  2LP2 A;  1GGW A;  2F2P A;  3TS5 B;  2WCL A;  3O2P A;  3VRO A;  1DJH A;  1NX3 A;  1KQV A;  4NDC A;  1N65 A;  2I7A A;  5FI6 A;  2MJW B;  2JC2 A;  3K21 A;  5D3O A;  3NSO A;  2LUC A;  3UO9 A;  1CB1 A;  1RFJ A;  4PE1 A;  5IBW A;  2LHI A;  1F4Q A;  2WOR A;  2YGU A;  1IQ3 A;  1SSE B;  3D78 A;  2H61 A;  2JT8 A;  2K7D A;  2QDI A;  4NQG A;  2FJU B;  2KBI A;  1AK8 A;  2QEV A;  1TUZ A;  1EG4 A;  3OHM B;  1ZUZ A;  2B1U A;  3GOF A;  3D0Y A;  3TZ1 A;  1DJW A;  4PHM A;  1G33 A;  1DEK A;  4INX A;  3TDZ A;  3DZT A;  3TS5 C;  3S0A A;  1RJV A;  1GGZ A;  3EKH A;  1SBJ A;  3TDU A;  1RK9 A;  1S1E A;  4ICB A;  1OOI X;  3FE6 A;  5JOL A;  1YUU A;  1CLB A;  1C7W A;  1OZS A;  1SW8 A;  2KLE A;  3SG7 A;  2LMV A;  4M2O A;  2JWW A;  1C7V A;  1DMO A;  1UUS A;  4MRX A;  4GFT A;  5HYD A;  1BG1 A;  1EJ3 A;  1WRZ A;  2M97 A;  4PE4 A;  2K7B A;  1OZO A;  3CR4 X;  3K1E A;  2I18 A;  2K0J A;  2GV5 A;  5K89 A;  1M39 A;  2L50 A;  2WCJ A;  5HKZ A;  1S5G Y;  1W7I B;  2Q91 A;  2ZKM X;  3IQQ A;  2QEB A;  1DGU A;  2EHB A;  2ZNE A;  2MLE C;  5PAL A;  3RLZ A;  3DVJ A;  4I5L B;  3VRN A;  4A4C A;  1IRJ A;  1AUI B;  5I8N A;  3I5F C;  1K2H A;  2SAS A;  1XFU O;  4R1E A;  4ZCU A;  3LCP C;  2PQL A;  3PN7 B;  1K9K A;  1OMD A;  1XFV O;  1XFY O;  1VRK A;  4MZK A;  1E8A A;  1J7P A;  4M2P A;  2KYF A;  3BYA A;  3BOW A;  4INW A;  4Q04 A;  1DJG A;  5DIC A;  5I2L A;  1NP8 A;  4JPZ B;  2KAX A;  2JT3 A;  4QJ4 B;  2Y4Q A;  2LNK A;  1KSO A;  5CPV A;  3HCM A;  2KFG A;  1C3Y A;  2O5G A;  1SL8 A;  1NX0 A;  2WCB A;  1BJF A;  3KO0 A;  1U5I A;  1NSH A;  2PVB A;  2WC5 A;  3DVE A;  4FQO A;  4CFR A;  1G4Y R;  2KFH A;  3SS3 A;  2M7N A;  1YX8 A;  1Y1X A;  4HRG A;  3BUO B;  3DY9 A;  3NSI A;  1IQ5 A;  1P28 A;  1BR4 B;  2NCP A;  3LK0 A;  3D77 A;  1TTX A;  2LV7 A;  4ORB B;  5FI2 A;  4C0L A;  3PN7 C;  1FBV A;  1Y1A A;  2WC8 A;  4FQT A;  5FYX A;  4WQ2 A;  5AAN A;  1UHI A;  2F3Z A;  3FIA A;  1JFK A;  3D75 A;  1DT7 B;  1IWQ A;  2BNX A;  5DKR A;  5HKY A;  3EK4 A;  2F33 A;  3GK2 A;  1WLM A;  1XFZ O;  4PHK A;  3CLN A;  3IVT A;  3N7H A;  4PT1 A;  1JC2 A;  5G08 A;  5D7F A;  3CZT X;  4YI8 A;  3EK7 A;  4YGA A;  4GGN A;  1SYM A;  1YTZ C;  4GBA A;  5HL1 A;  1KK8 B;  3DXL A;  3LL8 B;  5KTY A;  4ETO A;  1ALV A;  1IKU A;  4F0Z B;  4QJ3 B;  4UPG A;  1OE9 B;  2BCX A;  2KI6 D;  3L4A A;  4PE7 A;  1UHJ A;  1K95 A;  1A75 A;  4PE0 A;  1MXE A;  4C0K A;  1BOD A;  3OX6 A;  1OMV A;  1XFX O;  2K2F A;  2WND A;  4OV2 A;  3EVR A;  3I5H B;  3KHE A;  2PYQ A;  3SG6 A;  1KK7 Z;  1QS7 A;  1NX2 A;  2JRF A;  4HRH A;  2JNF A;  2M7L A;  3CAB A;  3SIA A;  3SG3 A;  1REC A;  2Y1N A;  1DC1 A;  2ZN9 A;  2LE9 B;  1TRF A;  1KK8 C;  3R72 A;  1F8H A;  3M0W A;  2I2R E;  2K8M B;  3PAT A;  4MN0 A;  2CCM A;  2BCB A;  2TN4 A;  2D8N A;  1FW4 A;  5I94 A;  5EL2 A;  4WRI A;  1W7J B;  1C3Z A;  3WNX B;  1MWN A;  1QAT A;  1HQV A;  1UHK A;  4N1F A;  2BE4 A;  2P70 A;  3I5H C;  1MXL C;  1CFD A;  3JTD B;  4TNC A;  4XYN A;  1K94 A;  3AAK A;  4L9M A;  3IF7 A;  1IJ5 A;  2BE6 A;  2M3W A;  1F54 A;  3O6B A;  1TIZ A;  2H61 C;  1NCZ A;  4GPL B;  2LMT A;  2MLF C;  2LAN A;  4PHN A;  3UNW A;  2M8U A;  4XJK B;  1KFU L;  1ZFS A;  1V1F A;  1Z4H A;  1Y0V H;  1MUX A;  3DYE A;  3SJS A;  2QEH A;  1UHH A;  2RGI A;  2P6B B;  2FOT A;  3WHU B;  4JQ0 D;  1KQM B;  2BBM A;  2KI6 C;  1KFU S;  4MEW A;  2WCH A;  2LHL A;  1A4P A;  3V2L A;  1R2U A;  1S6J A;  3I5G B;  2QPT A;  3JTD C;  1J55 A;  3B7A A;  2LP3 A;  4ORA B;  1B8R A;  3BOW B;  1JSA A;  1OOF A;  3H4S E;  1DTL A;  3I5F B;  1Y6W A;  1FPW A;  2P71 A;  3F45 A;  4E68 A;  1EL4 A;  5JJG A;  1GJY A;  2BKI B;  4QJ5 B;  3CZ2 A;  2K60 A;  2NCO A;  4MSP A;  2COL B;  3VRQ A;  1M45 A;  3CZ0 A;  1U5I B;  1B8L A;  1JUO A;  2ZRT A;  1WLZ A;  4MVF A;  1KK7 Y;  1KQM C;  3PFV A;  2ISD A;  1QVI Z;  2F3Y A;  4XJK A;  1YX7 A;  1W9Z A;  3S0E A;  2GTE A;  2JPT A;  3I5G C;  2BEC A;  1RTP 1;  5KU1 A;  1LA3 A;  2FJY A;  3DF0 A;  1SPY A;  1GQM A;  4CPV A;  1WRK A;  1TNP A;  1CMG A;  1LS8 A;  1QAS A;  2MRD A;  4FTG A;  2HPS A;  5CSJ A;  3SS5 A;  2NXQ A;  1UWO A;  4PAL A;  1TN4 A;  2JXC A;  1A03 A;  5FI7 A;  1B1G A;  4IL1 A;  1IG5 A;  2IS9 A;  3EKJ A;  1F71 A;  1M31 A;  1N0Y A;  2JU0 A;  1V1G A;  3BXK A;  1TNQ A;  1XA5 A;  1BR1 B;  2JXL A;  1K9U A;  2BL0 B;  3EK8 A;  1AJ4 A;  1OW4 A;  2KPH A;  4MBE A;  1A75 B;  1B9A A;  1BLQ A;  3CTN A;  1FF1 A;  1ODB A;  2LUX A;  3GK1 A;  3D73 A;  3SS4 A;  1NCY A;  1PSR A;  1J1E A;  1QX5 B;  2F2O A;  3WXA A;  3S0F A;  1F70 A;  3HX4 A;  1PAL A;  1IH0 A;  1F55 A;  4I5J A;  5D69 A;  1UHN A;  2L4I A;  3CGA A;  4DUQ A;  1DJI A;  3CR5 X;  2HQW A;  3SG5 A;  2LC5 A;  2OS8 B;  1DEL A;  1QLK A;  5HLV A;  4PCW A;  1SRA A;  3PSR A;  2KGR A;  2PAL A;  3NXA A;  3LLE A;  2GGZ A;  1AVS A;  1JF0 A;  1MR8 A;  2ZFD A;  3DD4 A;  2BL0 C;  5AXI A;  4NDB A;  4PHJ A;  1SK6 D;  3I5I B;  5B8I B;  1K93 D;  1DJY A;  4HSZ A;  2OTG B;  1YUT A;  1SNL A;  1K8U A;  2G2B A;  1A29 A;  1B8C A;  1TNW A;  3EG5 B;  1AJ5 A;  3BFH A;  1LIN A;  1KFX L;  2WC6 A;  4YGD B;  1QVI Y;  4HRE E;  2H2K A;  2OS8 C;  2BBN A;  1NCX A;  3R1V A;  2FCD A;  5TNC A;  1XVJ A;  1R6P A;  1SL9 A;  1JF2 A;  1CDN A;  3VB1 A;  1KFX S;  1CDL A;  1IGV A;  5CSF A;  3SIB A;  1NIW A;  2KAV A;  4DIR A;  2KFF A;  1BOC A;  3ZWH A;  1H8B A;  2LLS A;  1ZAC A;  3S0D A;  1N2D A;  3I5I C;  4GGF A;  1LA0 A;  1QIV A;  2OTG C;  3FS7 A;  1YUR A;  2I94 A;  2K2A A;  3FE9 A;  2E6W A;  1JBA A;  3S0G A;  1XO5 A;  1OOG A;  2M9G A;  1XFR A;  3VGO A;  1CM1 A;  1QLS A;  5CSI A;  2Q4U A;  3D76 A;  2KLD A;  1PVB A;  2AAO A;  4ORC B;  1EXR A;  2KQY A;  2LAP A;  2WCM A;  2CT9 A;  5ER4 X;  1CTR A;  1TOP A;  3OB1 B;  2CXJ A;  3SG4 A;  2QEO A;  1PVA A;  1SCM C;  3Q8I A;  3WHT B;  1YRT B;  2Y1M A;  1T14 A;  1MQ1 A;  1UUR A;  1XK4 A;  2PAS A;  3C1V A;  1BMO A;  1DJZ A;  2L98 A;  2LVV A;  3JVT B;  1QIW A;  3B86 A;  1BF5 A;  1SL7 A;  5DKN A;  1RWY A;  2JTT A;  2Y5I A;  2KDH A;  1KCY A;  2HF5 A;  3AKB A;  2LM5 A;  2HQ8 A;  3PLF B;  4BY5 A;  4N5X A;  3CZ1 A;  2JUL A;  3DF0 B;  4AOM A;  3PM8 A;  1CFF A;  2LLU A;  4MZL A;  3BFB A;  3CWG A;  3QME A;  3FWB A;  2AUC A;  1KWO C;  2NLN A;  2EC6 B;  4M2Q A;  1LVC D;  1J7Q A;  3NHT A;  5HLO A;  2LLT A;  3D74 A;  1S36 A;  5AER A;  1DQE A;  2GGM A;  1MHO A;  1S26 D;  1J1D A;  4YI9 A;  3ZNI A;  1TCF A;  2CTN A;  1NPQ A;  2M29 A;  1OOJ A;  4AQI A;  2O60 A;  2BAP A;  3JVT C;  3FE8 A;  1G8I A;  1FI5 A;  3B6X A;  1QWV A;  3CS1 A;  3CYZ A;  1WRL A;  4MRY A;  4D1E A;  1YR5 A;  1QX7 A;  5F6T A;  1SR6 B;  2KGB C;  2LCP A;  4I5N B;  1L7Z A;  3TDI A;  3MSE B;  2M1K B;  4DCK A;  4NDD A;  4CLN A;  1JFJ A;  4OVN F;  2MHH A;  3QRX A;  4DRW A;  2EGD A;  1GM0 A;  1DVI A;  1SCV A;  2CNP A;  1YVL A;  2PRU A;  2EC6 C;  2KHN A;  2JQ6 A;  5I2O A;  2KI4 B;  3D10 A;  4CID A;  3RZS A;  2R2I A;  1X02 A; 
#chains in the Genus database with same CATH homology
 1YUS A;  1CM4 A;  2BKH B;  2KYC A;  3BUN B;  4JWQ A;  5BPJ A;  1PK0 D;  1EH2 A;  2ZRS A;  2WOS A;  1NYA A;  4USL A;  4YBH B;  2DOQ A;  3BQ3 A;  4YGB B;  3DVM A;  3EVU A;  3VRP A;  4WQ3 A;  3LK1 A;  2QAC A;  1SR6 C;  2KBM A;  5AEQ A;  4I5K A;  1TNX A;  3A8R A;  2MA2 A;  2NZ0 A;  4P2Y B;  4C0J A;  1CKK A;  1J7O A;  2KSP A;  1M63 B;  1UP5 A;  3CR2 A;  3GK4 X;  1ZOT B;  1ZMZ A;  1MF8 B;  2KI4 C;  4A4B A;  2L51 A;  3RM1 A;  1CFP A;  1B7T Z;  5GQQ C;  1YVH A;  1QTX A;  4U8D A;  1NUB A;  3A4U B;  2FCE A;  1KSM A;  1WDC B;  2LMU A;  1DF0 B;  2JT0 A;  1RRO A;  2CBL A;  1TCO B;  2K7C A;  2VRG A;  3BUM B;  3FWC A;  1QX2 A;  2F8P A;  3NSK A;  1PSB A;  1A2X A;  1PRW A;  5CSN A;  2K61 A;  2KQ6 A;  1LKJ A;  1K9P A;  3EVV A;  2KAY A;  2MBX A;  2A4J A;  2LVK A;  1OMR A;  1CMF A;  2ZN8 A;  4DS7 A;  5AFP A;  2JTZ A;  1QXP A;  1WY9 A;  1DJX A;  5J3X A;  3ICB A;  3O78 A;  2M0R A;  1XFW O;  4OKH A;  1WDC C;  1XYD A;  3KEV A;  4N1G A;  5HKW A;  1SMG A;  2JOJ A;  2LVI A;  2BCA A;  4YGE B;  1CFC A;  1Y1U A;  1CLM A;  4AQJ A;  1QJT A;  5KSZ A;  3AKA A;  5I2Q A;  1C07 A;  1NWD A;  1LXF C;  1NX1 A;  4PDZ A;  4BY4 A;  1L2O B;  1S3P A;  2L2E A;  2KOT A;  1YRU B;  4GGF C;  2L0P A;  3DVK A;  3AAJ A;  1DF0 A;  1SCM B;  3TUY B;  1SKT A;  2KNE A;  4OR9 B;  1K96 A;  2PMY A;  4GAO A;  4GUK A;  1CDP A;  1EG3 A;  2JZI A;  2JNX A;  2V53 A;  2E30 A;  1Q80 A;  4MZJ A;  1DGV A;  1K90 D;  2HET A;  2M49 B;  2OPO A;  1OQP A;  1CDM A;  1ALW A;  3SG2 A;  1AHR A;  1XK4 C;  1HT9 A;  2L5X B;  2AMI A;  3E3R A;  4YRU A;  4YGC B;  3BUX B;  1KWO B;  3VRR A;  1AP4 A;  3O4Y A;  3OB2 B;  1S6C A;  1L2O C;  4OCI A;  2L4H A;  2SCP A;  2G9B A;  3IQO A;  2PSR A;  1B47 A;  1B7T Y;  2ZND A;  4GNK B;  3TUY C;  2M1U A;  1B4C A;  1J7R A;  1FI6 A;  4CFQ A;  1S5G Z;  1D1O A;  1OSA A;  3PAL A;  2LVJ A;  1S6I A;  4ZCV A;  1H4B A;  1BT6 A;  1CLL A;  2MAZ A;  4MLW A;  3KPX A;  1M46 A;  3D0Y B;  5DKQ A;  1CNP A;  3NSL A;  3BUW B;  1F4O A;  5ER5 A;  1SY9 A;  1IJ6 A;  2WCE A;  1BU3 A;  3KF9 A;  1JWD A;  2K7O A;  2WCF A;  1QV1 A;  3OX5 A;  4P5O E;  1GGW A;  1QV0 A;  1PUL A;  3OP0 A;  2LP2 A;  2F2P A;  3TS5 B;  3O2P A;  3VRO A;  1DJH A;  1NX3 A;  1KQV A;  4NDC A;  1N65 A;  2I7A A;  2MJW B;  2JC2 A;  3K21 A;  3NSO A;  2LUC A;  1CB1 A;  1RFJ A;  4PE1 A;  5IBW A;  2LHI A;  1F4Q A;  2WOR A;  1IQ3 A;  2H61 A;  2JT8 A;  2K7D A;  4NQG A;  2FJU B;  2KBI A;  1AK8 A;  1EG4 A;  3OHM B;  1ZUZ A;  2B1U A;  3GOF A;  3D0Y A;  3TZ1 A;  1DJW A;  4PHM A;  1G33 A;  3TDZ A;  3TS5 C;  1RJV A;  1GGZ A;  3EKH A;  1SBJ A;  3TDU A;  1RK9 A;  1S1E A;  4ICB A;  5JOL A;  1YUU A;  1CLB A;  1C7W A;  1OZS A;  1SW8 A;  3SG7 A;  2LMV A;  4M2O A;  2JWW A;  1C7V A;  1DMO A;  1UUS A;  4MRX A;  4GFT A;  5HYD A;  1BG1 A;  1EJ3 A;  1WRZ A;  2M97 A;  4PE4 A;  2K7B A;  1OZO A;  3CR4 X;  2I18 A;  2K0J A;  2GV5 A;  5K89 A;  1M39 A;  2L50 A;  5HKZ A;  1S5G Y;  1W7I B;  2Q91 A;  2ZKM X;  3IQQ A;  1DGU A;  2EHB A;  2ZNE A;  2MLE C;  5PAL A;  3RLZ A;  3DVJ A;  4I5L B;  3VRN A;  4A4C A;  1IRJ A;  1AUI B;  5I8N A;  3I5F C;  1K2H A;  2SAS A;  1XFU O;  4R1E A;  4ZCU A;  3LCP C;  3PN7 B;  1K9K A;  1OMD A;  1XFV O;  1XFY O;  1VRK A;  4MZK A;  1E8A A;  1J7P A;  4M2P A;  2KYF A;  3BYA A;  3BOW A;  4Q04 A;  1DJG A;  5I2L A;  1NP8 A;  4JPZ B;  2KAX A;  2JT3 A;  4QJ4 B;  2Y4Q A;  2LNK A;  1KSO A;  5CPV A;  3HCM A;  2KFG A;  2O5G A;  1SL8 A;  1NX0 A;  2WCB A;  1BJF A;  3KO0 A;  1U5I A;  1NSH A;  2PVB A;  3DVE A;  4FQO A;  4CFR A;  1G4Y R;  2KFH A;  2M7N A;  1YX8 A;  1Y1X A;  4HRG A;  3BUO B;  3NSI A;  1IQ5 A;  3LK0 A;  1BR4 B;  2NCP A;  4ORB B;  4C0L A;  1TTX A;  2LV7 A;  3PN7 C;  1FBV A;  1Y1A A;  2WC8 A;  5FYX A;  4WQ2 A;  5AAN A;  1UHI A;  2F3Z A;  3FIA A;  1JFK A;  1DT7 B;  1IWQ A;  5DKR A;  5HKY A;  3EK4 A;  2F33 A;  3GK2 A;  1WLM A;  1XFZ O;  4PHK A;  3CLN A;  1JC2 A;  5G08 A;  5D7F A;  3CZT X;  4YI8 A;  3EK7 A;  4YGA A;  4GGN A;  1SYM A;  1YTZ C;  4GBA A;  1KK8 B;  3LL8 B;  5KTY A;  4ETO A;  1ALV A;  1IKU A;  4F0Z B;  4QJ3 B;  4UPG A;  1OE9 B;  2BCX A;  2KI6 D;  4PE7 A;  1UHJ A;  1K95 A;  1A75 A;  4PE0 A;  1MXE A;  4C0K A;  1BOD A;  3OX6 A;  1OMV A;  1XFX O;  2K2F A;  2WND A;  4OV2 A;  3EVR A;  3I5H B;  3KHE A;  3SG6 A;  1KK7 Z;  1QS7 A;  1NX2 A;  2JRF A;  4HRH A;  2JNF A;  2M7L A;  3SIA A;  3SG3 A;  1REC A;  2Y1N A;  2ZN9 A;  2LE9 B;  1TRF A;  1KK8 C;  1F8H A;  3M0W A;  2I2R E;  2K8M B;  3PAT A;  4MN0 A;  2CCM A;  2BCB A;  2TN4 A;  2D8N A;  1FW4 A;  4WRI A;  1W7J B;  3WNX B;  1MWN A;  1QAT A;  1HQV A;  1UHK A;  4N1F A;  2BE4 A;  3I5H C;  1MXL C;  1CFD A;  3JTD B;  4TNC A;  4XYN A;  1K94 A;  3AAK A;  4L9M A;  3IF7 A;  1IJ5 A;  2BE6 A;  2M3W A;  1F54 A;  3O6B A;  1TIZ A;  2H61 C;  1NCZ A;  4GPL B;  2LMT A;  2MLF C;  2LAN A;  4PHN A;  2M8U A;  4XJK B;  1KFU L;  1ZFS A;  1V1F A;  1Y0V H;  1MUX A;  3SJS A;  1UHH A;  2RGI A;  2P6B B;  2FOT A;  3WHU B;  4JQ0 D;  1KQM B;  2BBM A;  2KI6 C;  1KFU S;  4MEW A;  2LHL A;  1A4P A;  1R2U A;  1S6J A;  3I5G B;  2QPT A;  3JTD C;  1J55 A;  2LP3 A;  4ORA B;  1B8R A;  3BOW B;  1JSA A;  3H4S E;  1DTL A;  3I5F B;  1Y6W A;  1FPW A;  3F45 A;  4E68 A;  1EL4 A;  5JJG A;  1GJY A;  2BKI B;  4QJ5 B;  2NCO A;  4MSP A;  2COL B;  3VRQ A;  1M45 A;  1U5I B;  1B8L A;  1JUO A;  2ZRT A;  1WLZ A;  4MVF A;  1KK7 Y;  1KQM C;  3PFV A;  2ISD A;  1QVI Z;  2F3Y A;  4XJK A;  1YX7 A;  2JPT A;  3I5G C;  2BEC A;  1RTP 1;  5KU1 A;  1LA3 A;  3DF0 A;  1SPY A;  1GQM A;  4CPV A;  1WRK A;  1TNP A;  1CMG A;  1QAS A;  2MRD A;  4FTG A;  2HPS A;  5CSJ A;  2NXQ A;  1UWO A;  4PAL A;  1TN4 A;  2JXC A;  1A03 A;  1B1G A;  4IL1 A;  1IG5 A;  2IS9 A;  3EKJ A;  1F71 A;  1M31 A;  1N0Y A;  2JU0 A;  1V1G A;  3BXK A;  1TNQ A;  1XA5 A;  1BR1 B;  2JXL A;  1K9U A;  2BL0 B;  3EK8 A;  1AJ4 A;  4MBE A;  1BLQ A;  1A75 B;  1B9A A;  3CTN A;  1FF1 A;  1ODB A;  2LUX A;  3GK1 A;  1NCY A;  1PSR A;  1J1E A;  1QX5 B;  2F2O A;  3WXA A;  1F70 A;  3HX4 A;  1PAL A;  1IH0 A;  1F55 A;  4I5J A;  5D69 A;  1UHN A;  2L4I A;  3CGA A;  4DUQ A;  1DJI A;  3CR5 X;  2HQW A;  3SG5 A;  2LC5 A;  2OS8 B;  1QLK A;  5HLV A;  4PCW A;  1SRA A;  3PSR A;  2KGR A;  2PAL A;  3NXA A;  3LLE A;  2GGZ A;  1AVS A;  1JF0 A;  1MR8 A;  2ZFD A;  3DD4 A;  2BL0 C;  5AXI A;  4NDB A;  4PHJ A;  1SK6 D;  3I5I B;  5B8I B;  1K93 D;  1DJY A;  4HSZ A;  2OTG B;  1YUT A;  1SNL A;  1K8U A;  2G2B A;  1A29 A;  1B8C A;  1TNW A;  1AJ5 A;  1LIN A;  1KFX L;  4YGD B;  1QVI Y;  4HRE E;  2H2K A;  2OS8 C;  2BBN A;  1NCX A;  5TNC A;  2FCD A;  1XVJ A;  1R6P A;  1SL9 A;  1JF2 A;  1CDN A;  1KFX S;  1CDL A;  1IGV A;  5CSF A;  3SIB A;  1NIW A;  2KAV A;  4DIR A;  2KFF A;  1BOC A;  3ZWH A;  1H8B A;  2LLS A;  1ZAC A;  1N2D A;  3I5I C;  4GGF A;  1LA0 A;  1QIV A;  2OTG C;  3FS7 A;  1YUR A;  2I94 A;  2K2A A;  2E6W A;  1JBA A;  1XO5 A;  2M9G A;  3VGO A;  1CM1 A;  1QLS A;  5CSI A;  2Q4U A;  1PVB A;  2AAO A;  4ORC B;  1EXR A;  2KQY A;  2LAP A;  2CT9 A;  5ER4 X;  1CTR A;  1TOP A;  3OB1 B;  2CXJ A;  3SG4 A;  1PVA A;  1SCM C;  3WHT B;  1YRT B;  2Y1M A;  1XK4 A;  1MQ1 A;  1UUR A;  2PAS A;  3C1V A;  1BMO A;  1DJZ A;  2L98 A;  2LVV A;  3JVT B;  1QIW A;  1BF5 A;  1SL7 A;  5DKN A;  1RWY A;  2JTT A;  2Y5I A;  2KDH A;  1KCY A;  2HF5 A;  3AKB A;  2LM5 A;  2HQ8 A;  3PLF B;  4BY5 A;  4N5X A;  4AOM A;  2JUL A;  3DF0 B;  3PM8 A;  1CFF A;  2LLU A;  4MZL A;  3CWG A;  3FWB A;  2AUC A;  1KWO C;  2NLN A;  2EC6 B;  4M2Q A;  1LVC D;  1J7Q A;  5HLO A;  2LLT A;  1S36 A;  5AER A;  2GGM A;  1MHO A;  1S26 D;  1J1D A;  4YI9 A;  3ZNI A;  1TCF A;  2CTN A;  1NPQ A;  2M29 A;  1OOJ A;  4AQI A;  2O60 A;  3JVT C;  1G8I A;  1FI5 A;  3CS1 A;  1WRL A;  4MRY A;  4D1E A;  1YR5 A;  1QX7 A;  5F6T A;  1SR6 B;  2KGB C;  2LCP A;  4I5N B;  1L7Z A;  3TDI A;  3MSE B;  2M1K B;  4DCK A;  4NDD A;  4CLN A;  1JFJ A;  4OVN F;  2MHH A;  3QRX A;  4DRW A;  2EGD A;  1DVI A;  1SCV A;  2CNP A;  1YVL A;  2PRU A;  2EC6 C;  2KHN A;  2JQ6 A;  5I2O A;  2KI4 B;  3D10 A;  4CID A;  2R2I A;  1X02 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...