1BLQA

Structure and interaction site of the regulatory domain of troponin-c when complexed with the 96-148 region of troponin-i, nmr, 29 structures
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
90
structure length
90
Chain Sequence
ASMTDQQAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium-binding protein
molecule keywords N-TROPONIN C
publication title Structure and interaction site of the regulatory domain of troponin-C when complexed with the 96-148 region of troponin-I.
pubmed doi rcsb
source organism Gallus gallus
total genus 11
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 1998-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1blqA00
1Y0VH 4M2PA 5J3XA 1C7WA 1YTZC 2COLB 3NSLA 3BUNB 1ODBA 4JQ0D 1HQVA 3ZWHA 3AAJA 3EK7A 1CDNA 2BBNA 1WDCC 2LUCA 1IH0A 1NUBA 4PE4A 3K21A 1LA3A 4CLNA 3BUMB 1BODA 3RLZA 1YVLA 4HREE 4WRIA 5D69A 2TN4A 1XFUO 3MSEB 4NDBA 2DOQA 4PE7A 1YR5A 2AAOA 4DIRA 2KBIA 2I7AA 2BCXA 3KPXA 1DTLA 4QJ4B 2HQWA 1MXEA 4F0ZB 3I5IC 3CR2A 1QS7A 4ORAB 1A29A 4Q04A 1BT6A 2KYCA 1NX3A 2LVIA 2M9GA 1L2OC 2R2IA 2KI4C 1BG1A 2CTNA 5B8IB 5AXIA 3KO0A 2CBLA 2PSRA 4ZCUA 1XK4C 1SW8A 1AJ4A 1JUOA 1PVAA 3SG6A 1BJFA 1CM4A 4MLWA 1NP8A 2LMTA 1DJYA 1CTRA 4YGDB 2CCMA 4YGCB 1DJHA 1B7TZ 1M46A 1SKTA 1IQ3A 3BQ3A 1RWYA 2OTGC 3O6BA 1CDPA 1F4QA 3I5GB 1FW4A 2F8PA 2SASA 1ALWA 1IG5A 1XYDA 2JTTA 2L0PA 4PE1A 3JTDC 3SG3A 1A2XA 3H4SE 4OKHA 3LCPC 1K96A 1KQVA 2L5XB 4QJ3B 2ZN8A 4QJ5B 1CLBA 1J7QA 3AKAA 2Y5IA 4N1GA 1QIWA 4TNCA 1MHOA 3CR5X 1EL4A 3VRPA 1Y1AA 4M2OA 2F3ZA 3TUYB 2K61A 2MHHA 1IKUA 3PN7B 1NCZA 5HLOA 5D7FA 3GK2A 3SG5A 1IJ6A 1DF0A 1SR6C 2CNPA 4E68A 1RTP1 2K7OA 4C0LA 1G33A 1M63B 1QV1A 1XFVO 4R1EA 1IRJA 1A03A 4ZCVA 2BBMA 2L4HA 2Y1NA 2BL0C 3TS5C 3OB1B 1S5GY 4NDCA 2K8MB 2OPOA 3KHEA 3OP0A 2EC6B 3HX4A 1B9AA 1TRFA 4OR9B 1M45A 2H61A 2V53A 5DKRA 2MA2A 3SG2A 1TOPA 3JTDB 2JT8A 1DF0B 2L2EA 4MZLA 5F6TA 3OX5A 2ZFDA 1AK8A 1YURA 1X02A 4AQJA 1E8AA 2ZRTA 3A4UB 4NQGA 3KEVA 1DT7B 1NYAA 2Q91A 2G9BA 1QVIY 4WQ2A 3PSRA 4C0KA 3QRXA 1RJVA 3PFVA 3JVTB 2E30A 3OB2B 4XJKA 1EJ3A 1KK8C 2JQ6A 2KI6C 2AMIA 2L98A 3PALA 2BE6A 1BMOA 1S3PA 2KFHA 1LXFC 1QX7A 2JU0A 3DVMA 1CFCA 1CFDA 4WQ3A 1QJTA 5KTYA 2M1UA 1CM1A 1F71A 2LANA 3DD4A 1MUXA 2GV5A 2KSPA 2O5GA 5I2QA 5AANA 2D8NA 4JPZB 1B1GA 4ICBA 1KSMA 2LUXA 3BUOB 1XFYO 4MN0A 2F33A 1EG4A 1DJXA 2F2OA 3CZTX 2EHBA 3VRNA 4XJKB 3BOWB 1K9PA 2Q4UA 1M31A 2HETA 1G8IA 1RK9A 1XFWO 4HRGA 2PRUA 2LAPA 1DMOA 2LLSA 1SCMC 1KSOA 4GAOA 2QPTA 1NX0A 1PULA 1UHNA 3AAKA 1MF8B 4MBEA 5ER4X 1QTXA 2PVBA 2NCPA 2ZNDA 3RM1A 1OQPA 1OZSA 4C0JA 2NXQA 4HSZA 2K0JA 1SRAA 1QX2A 1ZOTB 4USLA 1M39A 1AHRA 2BECA 2IS9A 2LP2A 1IJ5A 2LHIA 1KQMC 5HLVA 2KFGA 5FYXA 3TZ1A 2F2PA 4YGBB 1QV0A 1NWDA 4GPLB 1UWOA 3IQQA 1UUSA 3TDUA 1CMGA 1SL9A 1B4CA 5AERA 2BCBA 1SNLA 3IQOA 1QXPA 1OMDA 1SCMB 3CGAA 4N1FA 1A75B 1S6JA 1F8HA 1WDCB 5HYDA 1W7IB 1KK7Z 3EVUA 4FTGA 3EKJA 2CT9A 2JT0A 3BUXB 4ORCB 4DS7A 1W7JB 2BKIB 1XK4A 2NZ0A 1JFKA 1B8RA 1RECA 1Y1UA 2FOTA 3ICBA 1CMFA 1ZFSA 1K94A 1J7RA 3PLFB 2MAZA 1SCVA 1WLMA 2I18A 3DVJA 5CSFA 2K2AA 2M8UA 3WHUB 1GJYA 4MZJA 2BE4A 3I5IB 3BUWB 1NX2A 1AUIB 1A4PA 3DF0B 2HPSA 2JULA 3KF9A 2B1UA 5JJGA 3CLNA 1TNXA 4PHNA 1BU3A 1KWOC 1L2OB 2KGBC 3SJSA 2KI4B 4U8DA 1AP4A 1K8UA 1PSBA 1OSAA 1QASA 2JNXA 2KOTA 4MZKA 4PCWA 1PALA 4GGFA 1PSRA 1K90D 2JNFA 1QVIZ 2M49B 3LK1A 1SL7A 4CPVA 3LLEA 1LVCD 5DKNA 4MEWA 3NSKA 1FI5A 1D1OA 1YUSA 2MLEC 4DCKA 1Y6WA 5KSZA 1FPWA 2OTGB 1H8BA 1KFUL 3WXAA 1CB1A 2LP3A 1JF2A 2I2RE 3E3RA 1K9KA 1CDLA 1K93D 2MRDA 4MVFA 3PATA 4BY4A 3VRRA 1UURA 2KNEA 2LMUA 1CLMA 1BR1B 1FI6A 1JSAA 2MBXA 2SCPA 2LV7A 2L50A 2JWWA 1BR4B 3NXAA 1S6IA 2JPTA 1EG3A 3D0YB 1KFXL 1OE9B 3I5FC 3EK8A 3EVVA 2PALA 2HQ8A 4BY5A 1SR6B 1TN4A 1XA5A 3O78A 4CFQA 1JC2A 3BOWA 2CXJA 3I5HC 2L4IA 1UHIA 1TCOB 2GGZA 4PE0A 2OS8C 3TS5B 2BL0B 4A4CA 2NLNA 1DGUA 2JOJA 3IF7A 4UPGA 2G2BA 1UHKA 1F70A 4AOMA 1ZMZA 1SL8A 4I5NB 1HT9A 3WNXB 1U5IB 2FCDA 1PK0D 2KQ6A 2WNDA 3M0WA 4L9MA 1DJGA 1JF0A 2JZIA 2WCEA 2WOSA 4ORBB 1PVBA 1WRKA 4N5XA 5I2LA 1CDMA 3HCMA 1XFXO 1R6PA 2KBMA 3AKBA 1S1EA 1EXRA 2LLUA 2LVJA 1K2HA 1DJWA 1QX5B 2KDHA 1F4OA 3EVRA 3VROA 1F54A 2LCPA 2E6WA 2LC5A 3EKHA 1S36A 2M7LA 5DKQA 5PALA 1ZUZA 2M7NA 1JFJA 4MRYA 1RROA 1QLSA 2VRGA 1KK8B 2KYFA 1FF1A 1DGVA 1DJIA 5K89A 1JBAA 2F3YA 1EH2A 1KFUS 1YX7A 2KGRA 1A75A 1MR8A 3A8RA 1OMVA 2WORA 1NIWA 4YGAA 2FCEA 1S6CA 1MWNA 5HKYA 2AUCA 1FBVA 1YUUA 2KI6D 4XYNA 1B8CA 2WCBA 2M0RA 5I2OA 3FWBA 2M29A 3LL8B 1BLQA 1WY9A 3BYAA 4MRXA 4GGNA 4YRUA 1YRUB 1KFXS 2HF5A 2KQYA 1NCXA 3CR4X 1IQ5A 3PM8A 1QATA 3I5GC 1B47A 1YVHA 1ALVA 1MXLC 2K2FA 2LLTA 3DF0A 3GK1A 2Y1MA 3LK0A 2MLFC 5HKWA 5CSNA 2FJUB 1J1DA 1XO5A 4OV2A 5TNCA 3GK4X 1RFJA 1YUTA 2A4JA 1J7PA 4YI8A 1TNQA 2KAYA 1DJZA 2Y4QA 2ZRSA 5BPJA 4DUQA 1LA0A 1QLKA 1UP5A 3SG7A 1AVSA 4I5LB 3VGOA 1XFZO 2JRFA 1YRTB 3NSIA 1S5GZ 4CIDA 3TUYC 2H2KA 3PN7C 1L7ZA 1XVJA 3C1VA 1CFPA 1OMRA 1K95A 4OVNF 1NX1A 5IBWA 2KHNA 3CTNA 1Q80A 2LMVA 1OZOA 1C07A 5AEQA 1IGVA 1NCYA 1TNPA 1KQMB 4FQOA 4IL1A 1SPYA 4PDZA 2ZNEA 2JC2A 2EC6C 4GFTA 2JTZA 5I8NA 1NPQA 2LE9B 3OHMB 2GGMA 3FS7A 2ZN9A 4PALA 1H4BA 2KAVA 2L51A 1UHJA 2KFFA 4MSPA 1NSHA 1TCFA 4I5JA 1GGZA 1KCYA 1QIVA 1SBJA 1UHHA 3D0YA 1V1FA 3TDZA 5JOLA 3TDIA 1J1EA 5KU1A 4GGFC 4GBAA 2BKHB 3WHTB 3O4YA 3NSOA 3DVEA 3BXKA 4D1EA 1JWDA 2LHLA 3SIAA 1OOJA 5ER5A 1N2DA 2K7BA 1KK7Y 3CWGA 1K9UA 5HKZA 3JVTC 2MJWB 3EK4A 5G08A 3F45A 2ISDA 1WLZA 1B7TY 1TTXA 4JWQA 1GQMA 2H61C 1TNWA 1IWQA 3FWCA 2LVKA 2RGIA 1CNPA 1PRWA 1AJ5A 1J55A 1U5IA 4P5OE 1DVIA 1ZACA 1WRZA 3VRQA 1KWOB 4P2YB 1YX8A 2WCFA 4HRHA 2WC8A 1LINA 3D10A 2K7CA 1B8LA 1CKKA 2I94A 4CFRA 1C7VA 4PHMA 4PHJA 1Y1XA 4YGEB 2KAXA 4DRWA 1BF5A 2P6BB 3FIAA 2EGDA 1MQ1A 1SK6D 4AQIA 2LNKA 4PHKA 2LVVA 4YBHB 5GQQC 2LM5A 1G4YR 1R2UA 3ZNIA 4I5KA 4GUKA 4A4BA 4NDDA 4GNKB 1F55A 1LKJA 2PASA 5CPVA 2JT3A 2ZKMX 1CFFA 2PMYA 4M2QA 4YI9A 2QACA 3CS1A 3SG4A 2M3WA 1GGWA 1VRKA 1J7OA 2BCAA 3SIBA 2O60A 2M1KB 3DVKA 3O2PA 1V1GA 1SY9A 1WRLA 1CLLA 5CSJA 1N0YA 2JXLA 3I5FB 4OCIA 2NCOA 1SYMA 1SMGA 2M97A 4ETOA 1TIZA 1N65A 1S26D 2JXCA 1BOCA 3I5HB 3OX6A 3GOFA 2OS8B 5AFPA 5CSIA 2K7DA
chains in the Genus database with same CATH superfamily
1Y0VH 4M2PA 5J3XA 1C7WA 3SS5A 1YTZC 2COLB 3IVTA 3NSLA 3BUNB 1ODBA 4JQ0D 1HQVA 3ZWHA 3AAJA 3EK7A 1CDNA 2BBNA 1WDCC 2LUCA 2BNXA 1IH0A 3B88A 1NUBA 4PE4A 3K21A 5FI2A 1LA3A 4CLNA 3BUMB 5HL1A 1BODA 3RLZA 2YGUA 1YVLA 4HREE 4WRIA 5D69A 2TN4A 1XFUO 3MSEB 4NDBA 2DOQA 4PE7A 1YR5A 2AAOA 4DIRA 2KBIA 2I7AA 2BCXA 3KPXA 1DTLA 4QJ4B 2HQWA 1MXEA 4F0ZB 3I5IC 2PYQA 3CR2A 1QS7A 4ORAB 3B6XA 1A29A 4Q04A 1BT6A 3BFAA 2KYCA 1NX3A 2LVIA 5FI7A 2M9GA 1L2OC 2R2IA 2KI4C 1BG1A 2CTNA 5B8IB 5AXIA 3KO0A 2CBLA 3Q8IA 2PSRA 4ZCUA 1XK4C 3VB1A 1SW8A 1AJ4A 1JUOA 1PVAA 3SG6A 1BJFA 1CM4A 4MLWA 1NP8A 2LMTA 4JD9A 1DJYA 1CTRA 3CABA 4YGDB 2CCMA 4YGCB 1DJHA 1B7TZ 1M46A 4PT1A 1SKTA 1IQ3A 3BQ3A 1RWYA 2OTGC 3O6BA 1CDPA 1F4QA 3I5GB 1FW4A 2F8PA 2SASA 1ALWA 1IG5A 1XYDA 2JTTA 2L0PA 4PE1A 3JTDC 3SG3A 1A2XA 3H4SE 4OKHA 3LCPC 1K96A 2QDIA 1KQVA 2L5XB 5D3OA 4QJ3B 3S0EA 2ZN8A 4QJ5B 1CLBA 1J7QA 3AKAA 2Y5IA 4N1GA 1QIWA 4TNCA 1MHOA 3CR5X 1EL4A 3VRPA 1Y1AA 4M2OA 2F3ZA 3TUYB 2K61A 2MHHA 1IKUA 3PN7B 1NCZA 5HLOA 5D7FA 3GK2A 3SG5A 1IJ6A 1DF0A 1SR6C 2CNPA 2FJYA 4E68A 1RTP1 2K7OA 4C0LA 1G33A 3B87A 1M63B 1QV1A 1XFVO 3L4LA 1IRJA 1Z4HA 4R1EA 1A03A 4ZCVA 2BBMA 2L4HA 2Y1NA 2BL0C 3D73A 3OB1B 1S5GY 4NDCA 2K8MB 2OPOA 3KHEA 3OP0A 3TS5C 2EC6B 3S0FA 3HX4A 3DY9A 1B9AA 1TRFA 4OR9B 1M45A 2H61A 2V53A 5DKRA 2MA2A 3SG2A 1TOPA 3JTDB 2JT8A 1OW4A 3V2LA 1DF0B 2L2EA 2KPHA 1SSEB 4MZLA 5F6TA 3OX5A 4IJ7A 2ZFDA 1AK8A 1YURA 1X02A 4AQJA 1QWVA 1E8AA 2ZRTA 3A4UB 4NQGA 3KEVA 1DT7B 1NYAA 2Q91A 2G9BA 1QVIY 4WQ2A 3PSRA 1DQEA 4C0KA 3QRXA 1RJVA 3PFVA 3JVTB 2E30A 3OB2B 4XJKA 1EJ3A 1KK8C 1OOGA 2JQ6A 2KI6C 2AMIA 1OOFA 2L98A 2WCHA 3K1EA 2BE6A 3PALA 1BMOA 1S3PA 2KFHA 1LXFC 1QX7A 2JU0A 3BJHA 3DVMA 1CFCA 1CFDA 4WQ3A 1QJTA 2QEVA 5KTYA 2M1UA 1CM1A 1F71A 2LANA 3DD4A 1MUXA 2GV5A 2KSPA 2O5GA 5I2QA 5AANA 3BFBA 2D8NA 4JPZB 1B1GA 3NHTA 4ICBA 1KSMA 2LUXA 3BUOB 3SS4A 1XFYO 4MN0A 2F33A 2BAPA 1EG4A 1DJXA 2F2OA 3CZTX 3PJIA 2EHBA 3VRNA 1DC1A 4XJKB 3BOWB 1K9PA 2Q4UA 1M31A 2HETA 1G8IA 1RK9A 1XFWO 4HRGA 2PRUA 2LAPA 1DMOA 2LLSA 1SCMC 1KSOA 4GAOA 1TUJA 2QPTA 3CYZA 1NX0A 1PULA 3CZ2A 1UHNA 3AAKA 1MF8B 4MBEA 5ER4X 1QTXA 2PVBA 3DYEA 1DEKA 2NCPA 2ZNDA 3RM1A 2KLDA 1OQPA 1OZSA 4C0JA 2NXQA 4HSZA 2K0JA 1SRAA 1QX2A 1ZOTB 4USLA 1M39A 1AHRA 2BECA 2IS9A 2LP2A 1IJ5A 2WCJA 1OOHA 2LHIA 3S0BA 1KQMC 5HLVA 2KFGA 5FYXA 3TZ1A 2F2PA 4YGBB 3UNWA 1QV0A 1NWDA 4GPLB 1UWOA 3IQQA 1UUSA 1W9ZA 3TDUA 4F7FA 1CMGA 1SL9A 1B4CA 5AERA 2BCBA 1SNLA 3IQOA 1QXPA 1OMDA 1SCMB 3CGAA 3CDNA 1A75B 1S6JA 4N1FA 3SS3A 1F8HA 1WDCB 5HYDA 1W7IB 3OBVA 1KK7Z 3EVUA 4FTGA 3EKJA 2CT9A 3S0AA 2JT0A 3BUXB 4ORCB 4DS7A 1W7JB 2BKIB 1XK4A 2NZ0A 1JFKA 1B8RA 1RECA 1Y1UA 2FOTA 3ICBA 1CMFA 1GM0A 1ZFSA 1K94A 1J7RA 3PLFB 2MAZA 1SCVA 1WLMA 2I18A 3DVJA 5CSFA 2K2AA 2M8UA 3WHUB 1GJYA 4MZJA 2BE4A 3I5IB 3BUWB 1NX2A 1AUIB 1A4PA 3DF0B 2HPSA 2JULA 3KF9A 2B1UA 5JJGA 3CLNA 1TNXA 4PHNA 1BU3A 1KWOC 2L5YA 1L2OB 2KGBC 5FI6A 3SJSA 2KI4B 4U8DA 1AP4A 1K8UA 1PSBA 1OSAA 1QASA 2JNXA 2KOTA 4MZKA 4PCWA 1PALA 4GGFA 1PSRA 1K90D 2JNFA 1QVIZ 2M49B 3N7HA 3LK1A 1SL7A 2GTEA 3PM2A 4CPVA 3LLEA 1LVCD 3R1OA 4MEWA 5DKNA 3NSKA 1FI5A 1D1OA 1YUSA 2MLEC 3D74A 4DCKA 1Y6WA 2QEHA 5KSZA 1FPWA 2OTGB 1H8BA 1KFUL 3WXAA 1CB1A 2LP3A 1JF2A 2I2RE 3E3RA 1K9KA 1CDLA 1K93D 2MRDA 1LS8A 3L47A 3PATA 4MVFA 4BY4A 2QEOA 3VRRA 1UURA 2KNEA 2LMUA 1CLMA 1BR1B 1FI6A 1JSAA 2MBXA 3O4XA 2SCPA 2LV7A 2L50A 2JWWA 1BR4B 3NXAA 1S6IA 2JPTA 1EG3A 3D0YB 3RZSA 1KFXL 1OE9B 3I5FC 3EK8A 3EVVA 1IIOA 2PALA 2HQ8A 4BY5A 1SR6B 1TN4A 1XA5A 3O78A 4CFQA 1JC2A 3BOWA 2CXJA 3I5HC 2L4IA 3CZ1A 1UHIA 1TCOB 2GGZA 4PE0A 2OS8C 3TS5B 2BL0B 4A4CA 2NLNA 3D77A 1DGUA 2JOJA 3IF7A 4JKTA 4UPGA 1XFRA 2G2BA 1UHKA 1TUZA 1F70A 4AOMA 1ZMZA 1SL8A 4I5NB 1HT9A 3FE9A 3WNXB 1U5IB 2FCDA 1PK0D 2ERBA 2KQ6A 2WNDA 3M0WA 4L9MA 1DJGA 1JF0A 2JZIA 2WCEA 2WOSA 4ORBB 1PVBA 3FE6A 1WRKA 4N5XA 5I2LA 1CDMA 3HCMA 1XFXO 3R72A 1R6PA 2KBMA 3AKBA 3NGVA 3CZ0A 1S1EA 1EXRA 2LLUA 2LVJA 1K2HA 1DJWA 1QX5B 2KDHA 1F4OA 3EVRA 3VROA 1F54A 2LCPA 2E6WA 2LC5A 3EKHA 1S36A 2M7LA 5DKQA 5PALA 1ZUZA 2M7NA 1JFJA 4MRYA 1RROA 1QLSA 2VRGA 1KK8B 2KYFA 1FF1A 1C3YA 1DGVA 1DJIA 5K89A 1JBAA 2F3YA 1EH2A 3NHIA 1KFUS 1YX7A 2KGRA 1A75A 1MR8A 3A8RA 1OMVA 2WCKA 2WORA 1NIWA 4YGAA 2FCEA 1S6CA 1MWNA 5HKYA 2AUCA 1FBVA 2QEBA 1YUUA 3EG5B 2KI6D 4XYNA 1B8CA 2WCBA 2M0RA 5I2OA 3FWBA 2M29A 3LL8B 1BLQA 1WY9A 3BYAA 4MRXA 3DXLA 4GGNA 4YRUA 1YRUB 1KFXS 2HF5A 2KQYA 1NCXA 3CR4X 1IQ5A 3PM8A 1P28A 1QATA 1TWOA 3I5GC 1B47A 1YVHA 1ALVA 1MXLC 2K2FA 2LLTA 3DF0A 3GK1A 2Y1MA 4INWA 3LK0A 2MLFC 5HKWA 5CSNA 2FJUB 1J1DA 1XO5A 3DZTA 4OV2A 3GK4X 5TNCA 1RFJA 1T14A 2JPOA 1YUTA 2A4JA 1J7PA 4YI8A 1TNQA 2KAYA 1DJZA 2Y4QA 2ZRSA 5BPJA 4DUQA 1LA0A 1QLKA 1UP5A 3SG7A 1AVSA 4I5LB 3VGOA 1XFZO 2JRFA 1YRTB 3NSIA 1S5GZ 4CIDA 3TUYC 3B86A 2H2KA 3PN7C 1L7ZA 1XVJA 3C1VA 1CFPA 1OMRA 1K95A 4OVNF 1NX1A 3BFHA 2P71A 2KHNA 5IBWA 3B7AA 3CTNA 1Q80A 2LMVA 1OZOA 1C07A 5AEQA 1IGVA 1NCYA 1TNPA 1KQMB 4FQOA 4IL1A 1SPYA 4PDZA 2P70A 2ZNEA 2JC2A 2EC6C 1Z2CB 4GFTA 2JTZA 5I8NA 1NPQA 2LE9B 3OHMB 2GGMA 3FS7A 2ZN9A 4FQTA 4PALA 1H4BA 2KAVA 2L51A 1UHJA 2KFFA 4MSPA 1NSHA 1TCFA 4I5JA 3D76A 1GGZA 1KCYA 1QIVA 1SBJA 4OZDA 1UHHA 3D0YA 1V1FA 3TDZA 5JOLA 3TDIA 1C3ZA 1J1EA 5KU1A 1DELA 4GGFC 4GBAA 2BKHB 3WHTB 3D78A 3O4YA 3NSOA 3R1VA 3DVEA 3BXKA 4D1EA 1JWDA 2LHLA 3SIAA 1OOJA 5ER5A 2WC5A 1N2DA 2K7BA 1KK7Y 3CWGA 1K9UA 5HKZA 3JVTC 2MJWB 3EK4A 5G08A 3F45A 2ISDA 1WLZA 1B7TY 1TTXA 4JWQA 1GQMA 2H61C 2WC6A 1TNWA 1IWQA 3FWCA 2LVKA 2RGIA 1ORGA 1PRWA 1AJ5A 1J55A 1U5IA 3OGNA 1CNPA 4P5OE 1DVIA 1ZACA 1WRZA 3VRQA 1KWOB 4P2YB 1YX8A 2WCFA 4HRHA 2WC8A 1LINA 3D10A 2K7CA 1B8LA 1CKKA 3UO9A 2I94A 4CFRA 1C7VA 4PHMA 4PHJA 1Y1XA 4YGEB 2KAXA 4DRWA 1BF5A 2P6BB 3FIAA 3R1PA 2EGDA 1MQ1A 1SK6D 4AQIA 2LNKA 4PHKA 2LVVA 2K60A 4YBHB 2LM5A 5GQQC 2WCMA 1G4YR 1R2UA 4KYNA 3ZNIA 4I5KA 4GUKA 4A4BA 4NDDA 4GNKB 1F55A 3D75A 3S0GA 2L2CA 1LKJA 2PASA 5CPVA 2JT3A 3L4AA 2ZKMX 1CFFA 2WCLA 2PMYA 4M2QA 5I94A 4YI9A 2QACA 3CS1A 3SG4A 2M3WA 3QMEA 5EL2A 1GGWA 2H8VA 1VRKA 1J7OA 2BCAA 3SIBA 2O60A 2M1KB 3DVKA 3O2PA 1V1GA 1SY9A 1WRLA 3S0DA 1CLLA 5CSJA 1N0YA 2JXLA 3I5FB 4OCIA 2NCOA 1SYMA 1SMGA 2M97A 3FE8A 2PQLA 4ETOA 1TIZA 1OOIX 1N65A 1S26D 2JXCA 2KLEA 1BOCA 3I5HB 3OX6A 3GOFA 2OS8B 5DICA 5AFPA 5CSIA 4INXA 2K7DA
chains in the Genus database with same CATH topology
1Y0VH 4M2PA 5J3XA 1C7WA 1YTZC 2COLB 3NSLA 3BUNB 1ODBA 4JQ0D 1HQVA 3ZWHA 3AAJA 3EK7A 1CDNA 2BBNA 1WDCC 2LUCA 1IH0A 1NUBA 4PE4A 3K21A 1LA3A 4CLNA 3BUMB 1BODA 3RLZA 1YVLA 4HREE 4WRIA 5D69A 2TN4A 1XFUO 3MSEB 4NDBA 2DOQA 4PE7A 1YR5A 2AAOA 4DIRA 2KBIA 2I7AA 2BCXA 3KPXA 1DTLA 4QJ4B 2HQWA 1MXEA 4F0ZB 3I5IC 3CR2A 1QS7A 4ORAB 1A29A 4Q04A 1BT6A 2KYCA 1NX3A 2LVIA 2M9GA 1L2OC 2R2IA 2KI4C 1BG1A 2CTNA 5B8IB 5AXIA 3KO0A 2CBLA 2PSRA 4ZCUA 1XK4C 1SW8A 1AJ4A 1JUOA 1PVAA 3SG6A 1BJFA 1CM4A 4MLWA 1NP8A 2LMTA 1DJYA 1CTRA 4YGDB 2CCMA 4YGCB 1DJHA 1B7TZ 1M46A 1SKTA 1IQ3A 3BQ3A 1RWYA 2OTGC 3O6BA 1CDPA 1F4QA 3I5GB 1FW4A 2F8PA 2SASA 1ALWA 1IG5A 1XYDA 2JTTA 2L0PA 4PE1A 3JTDC 3SG3A 1A2XA 3H4SE 4OKHA 3LCPC 1K96A 1KQVA 2L5XB 4QJ3B 2ZN8A 4QJ5B 1CLBA 1J7QA 3AKAA 2Y5IA 4N1GA 1QIWA 4TNCA 1MHOA 3CR5X 1EL4A 3VRPA 1Y1AA 4M2OA 2F3ZA 3TUYB 2K61A 2MHHA 1IKUA 3PN7B 1NCZA 5HLOA 5D7FA 3GK2A 3SG5A 1IJ6A 1DF0A 1SR6C 2CNPA 4E68A 1RTP1 2K7OA 4C0LA 1G33A 1M63B 1QV1A 1XFVO 4R1EA 1IRJA 1A03A 4ZCVA 2BBMA 2L4HA 2Y1NA 2BL0C 3TS5C 3OB1B 1S5GY 4NDCA 2K8MB 2OPOA 3KHEA 3OP0A 2EC6B 3HX4A 1B9AA 1TRFA 4OR9B 1M45A 2H61A 2V53A 5DKRA 2MA2A 3SG2A 1TOPA 3JTDB 2JT8A 1DF0B 2L2EA 4MZLA 5F6TA 3OX5A 2ZFDA 1AK8A 1YURA 1X02A 4AQJA 1E8AA 2ZRTA 3A4UB 4NQGA 3KEVA 1DT7B 1NYAA 2Q91A 2G9BA 1QVIY 4WQ2A 3PSRA 4C0KA 3QRXA 1RJVA 3PFVA 3JVTB 2E30A 3OB2B 4XJKA 1EJ3A 1KK8C 2JQ6A 2KI6C 2AMIA 2L98A 3PALA 2BE6A 1BMOA 1S3PA 2KFHA 1LXFC 1QX7A 2JU0A 3DVMA 1CFCA 1CFDA 4WQ3A 1QJTA 5KTYA 2M1UA 1CM1A 1F71A 2LANA 3DD4A 1MUXA 2GV5A 2KSPA 2O5GA 5I2QA 5AANA 2D8NA 4JPZB 1B1GA 4ICBA 1KSMA 2LUXA 3BUOB 1XFYO 4MN0A 2F33A 1EG4A 1DJXA 2F2OA 3CZTX 2EHBA 3VRNA 4XJKB 3BOWB 1K9PA 2Q4UA 1M31A 2HETA 1G8IA 1RK9A 1XFWO 4HRGA 2PRUA 2LAPA 1DMOA 2LLSA 1SCMC 1KSOA 4GAOA 2QPTA 1NX0A 1PULA 1UHNA 3AAKA 1MF8B 4MBEA 5ER4X 1QTXA 2PVBA 2NCPA 2ZNDA 3RM1A 1OQPA 1OZSA 4C0JA 2NXQA 4HSZA 2K0JA 1SRAA 1QX2A 1ZOTB 4USLA 1M39A 1AHRA 2BECA 2IS9A 2LP2A 1IJ5A 2LHIA 1KQMC 5HLVA 2KFGA 5FYXA 3TZ1A 2F2PA 4YGBB 1QV0A 1NWDA 4GPLB 1UWOA 3IQQA 1UUSA 3TDUA 1CMGA 1SL9A 1B4CA 5AERA 2BCBA 1SNLA 3IQOA 1QXPA 1OMDA 1SCMB 3CGAA 4N1FA 1A75B 1S6JA 1F8HA 1WDCB 5HYDA 1W7IB 1KK7Z 3EVUA 4FTGA 3EKJA 2CT9A 2JT0A 3BUXB 4ORCB 4DS7A 1W7JB 2BKIB 1XK4A 2NZ0A 1JFKA 1B8RA 1RECA 1Y1UA 2FOTA 3ICBA 1CMFA 1ZFSA 1K94A 1J7RA 3PLFB 2MAZA 1SCVA 1WLMA 2I18A 3DVJA 5CSFA 2K2AA 2M8UA 3WHUB 1GJYA 4MZJA 2BE4A 3I5IB 3BUWB 1NX2A 1AUIB 1A4PA 3DF0B 2HPSA 2JULA 3KF9A 2B1UA 5JJGA 3CLNA 1TNXA 4PHNA 1BU3A 1KWOC 1L2OB 2KGBC 3SJSA 2KI4B 4U8DA 1AP4A 1K8UA 1PSBA 1OSAA 1QASA 2JNXA 2KOTA 4MZKA 4PCWA 1PALA 4GGFA 1PSRA 1K90D 2JNFA 1QVIZ 2M49B 3LK1A 1SL7A 4CPVA 3LLEA 1LVCD 5DKNA 4MEWA 3NSKA 1FI5A 1D1OA 1YUSA 2MLEC 4DCKA 1Y6WA 5KSZA 1FPWA 2OTGB 1H8BA 1KFUL 3WXAA 1CB1A 2LP3A 1JF2A 2I2RE 3E3RA 1K9KA 1CDLA 1K93D 2MRDA 4MVFA 3PATA 4BY4A 3VRRA 1UURA 2KNEA 2LMUA 1CLMA 1BR1B 1FI6A 1JSAA 2MBXA 2SCPA 2LV7A 2L50A 2JWWA 1BR4B 3NXAA 1S6IA 2JPTA 1EG3A 3D0YB 1KFXL 1OE9B 3I5FC 3EK8A 3EVVA 2PALA 2HQ8A 4BY5A 1SR6B 1TN4A 1XA5A 3O78A 4CFQA 1JC2A 3BOWA 2CXJA 3I5HC 2L4IA 1UHIA 1TCOB 2GGZA 4PE0A 2OS8C 3TS5B 2BL0B 4A4CA 2NLNA 1DGUA 2JOJA 3IF7A 4UPGA 2G2BA 1UHKA 1F70A 4AOMA 1ZMZA 1SL8A 4I5NB 1HT9A 3WNXB 1U5IB 2FCDA 1PK0D 2KQ6A 2WNDA 3M0WA 4L9MA 1DJGA 1JF0A 2JZIA 2WCEA 2WOSA 4ORBB 1PVBA 1WRKA 4N5XA 5I2LA 1CDMA 3HCMA 1XFXO 1R6PA 2KBMA 3AKBA 1S1EA 1EXRA 2LLUA 2LVJA 1K2HA 1DJWA 1QX5B 2KDHA 1F4OA 3EVRA 3VROA 1F54A 2LCPA 2E6WA 2LC5A 3EKHA 1S36A 2M7LA 5DKQA 5PALA 1ZUZA 2M7NA 1JFJA 4MRYA 1RROA 1QLSA 2VRGA 1KK8B 2KYFA 1FF1A 1DGVA 1DJIA 5K89A 1JBAA 2F3YA 1EH2A 1KFUS 1YX7A 2KGRA 1A75A 1MR8A 3A8RA 1OMVA 2WORA 1NIWA 4YGAA 2FCEA 1S6CA 1MWNA 5HKYA 2AUCA 1FBVA 1YUUA 2KI6D 4XYNA 1B8CA 2WCBA 2M0RA 5I2OA 3FWBA 2M29A 3LL8B 1BLQA 1WY9A 3BYAA 4MRXA 4GGNA 4YRUA 1YRUB 1KFXS 2HF5A 2KQYA 1NCXA 3CR4X 1IQ5A 3PM8A 1QATA 3I5GC 1B47A 1YVHA 1ALVA 1MXLC 2K2FA 2LLTA 3DF0A 3GK1A 2Y1MA 3LK0A 2MLFC 5HKWA 5CSNA 2FJUB 1J1DA 1XO5A 4OV2A 5TNCA 3GK4X 1RFJA 1YUTA 2A4JA 1J7PA 4YI8A 1TNQA 2KAYA 1DJZA 2Y4QA 2ZRSA 5BPJA 4DUQA 1LA0A 1QLKA 1UP5A 3SG7A 1AVSA 4I5LB 3VGOA 1XFZO 2JRFA 1YRTB 3NSIA 1S5GZ 4CIDA 3TUYC 2H2KA 3PN7C 1L7ZA 1XVJA 3C1VA 1CFPA 1OMRA 1K95A 4OVNF 1NX1A 5IBWA 2KHNA 3CTNA 1Q80A 2LMVA 1OZOA 1C07A 5AEQA 1IGVA 1NCYA 1TNPA 1KQMB 4FQOA 4IL1A 1SPYA 4PDZA 2ZNEA 2JC2A 2EC6C 4GFTA 2JTZA 5I8NA 1NPQA 2LE9B 3OHMB 2GGMA 3FS7A 2ZN9A 4PALA 1H4BA 2KAVA 2L51A 1UHJA 2KFFA 4MSPA 1NSHA 1TCFA 4I5JA 1GGZA 1KCYA 1QIVA 1SBJA 1UHHA 3D0YA 1V1FA 3TDZA 5JOLA 3TDIA 1J1EA 5KU1A 4GGFC 4GBAA 2BKHB 3WHTB 3O4YA 3NSOA 3DVEA 3BXKA 4D1EA 1JWDA 2LHLA 3SIAA 1OOJA 5ER5A 1N2DA 2K7BA 1KK7Y 3CWGA 1K9UA 5HKZA 3JVTC 2MJWB 3EK4A 5G08A 3F45A 2ISDA 1WLZA 1B7TY 1TTXA 4JWQA 1GQMA 2H61C 1TNWA 1IWQA 3FWCA 2LVKA 2RGIA 1CNPA 1PRWA 1AJ5A 1J55A 1U5IA 4P5OE 1DVIA 1ZACA 1WRZA 3VRQA 1KWOB 4P2YB 1YX8A 2WCFA 4HRHA 2WC8A 1LINA 3D10A 2K7CA 1B8LA 1CKKA 2I94A 4CFRA 1C7VA 4PHMA 4PHJA 1Y1XA 4YGEB 2KAXA 4DRWA 1BF5A 2P6BB 3FIAA 2EGDA 1MQ1A 1SK6D 4AQIA 2LNKA 4PHKA 2LVVA 4YBHB 5GQQC 2LM5A 1G4YR 1R2UA 3ZNIA 4I5KA 4GUKA 4A4BA 4NDDA 4GNKB 1F55A 1LKJA 2PASA 5CPVA 2JT3A 2ZKMX 1CFFA 2PMYA 4M2QA 4YI9A 2QACA 3CS1A 3SG4A 2M3WA 1GGWA 1VRKA 1J7OA 2BCAA 3SIBA 2O60A 2M1KB 3DVKA 3O2PA 1V1GA 1SY9A 1WRLA 1CLLA 5CSJA 1N0YA 2JXLA 3I5FB 4OCIA 2NCOA 1SYMA 1SMGA 2M97A 4ETOA 1TIZA 1N65A 1S26D 2JXCA 1BOCA 3I5HB 3OX6A 3GOFA 2OS8B 5AFPA 5CSIA 2K7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y0V H;  4M2P A;  5J3X A;  1C7W A;  1YTZ C;  2COL B;  3NSL A;  3BUN B;  1ODB A;  4JQ0 D;  1HQV A;  3ZWH A;  3AAJ A;  3EK7 A;  1CDN A;  2BBN A;  1WDC C;  2LUC A;  1IH0 A;  1NUB A;  4PE4 A;  3K21 A;  1LA3 A;  4CLN A;  3BUM B;  1BOD A;  3RLZ A;  1YVL A;  4HRE E;  4WRI A;  5D69 A;  2TN4 A;  1XFU O;  3MSE B;  4NDB A;  2DOQ A;  4PE7 A;  1YR5 A;  2AAO A;  4DIR A;  2KBI A;  2I7A A;  2BCX A;  3KPX A;  1DTL A;  4QJ4 B;  2HQW A;  1MXE A;  4F0Z B;  3I5I C;  3CR2 A;  1QS7 A;  4ORA B;  1A29 A;  4Q04 A;  1BT6 A;  2KYC A;  1NX3 A;  2LVI A;  2M9G A;  1L2O C;  2R2I A;  2KI4 C;  1BG1 A;  2CTN A;  5B8I B;  5AXI A;  3KO0 A;  2CBL A;  2PSR A;  4ZCU A;  1XK4 C;  1SW8 A;  1AJ4 A;  1JUO A;  1PVA A;  3SG6 A;  1BJF A;  1CM4 A;  4MLW A;  1NP8 A;  2LMT A;  1DJY A;  1CTR A;  4YGD B;  2CCM A;  4YGC B;  1DJH A;  1B7T Z;  1M46 A;  1SKT A;  1IQ3 A;  3BQ3 A;  1RWY A;  2OTG C;  3O6B A;  1CDP A;  1F4Q A;  3I5G B;  1FW4 A;  2F8P A;  2SAS A;  1ALW A;  1IG5 A;  1XYD A;  2JTT A;  2L0P A;  4PE1 A;  3JTD C;  3SG3 A;  1A2X A;  3H4S E;  4OKH A;  3LCP C;  1K96 A;  1KQV A;  2L5X B;  4QJ3 B;  2ZN8 A;  4QJ5 B;  1CLB A;  1J7Q A;  3AKA A;  2Y5I A;  4N1G A;  1QIW A;  4TNC A;  1MHO A;  3CR5 X;  1EL4 A;  3VRP A;  1Y1A A;  4M2O A;  2F3Z A;  3TUY B;  2K61 A;  2MHH A;  1IKU A;  3PN7 B;  1NCZ A;  5HLO A;  5D7F A;  3GK2 A;  3SG5 A;  1IJ6 A;  1DF0 A;  1SR6 C;  2CNP A;  4E68 A;  1RTP 1;  2K7O A;  4C0L A;  1G33 A;  1M63 B;  1QV1 A;  1XFV O;  4R1E A;  1IRJ A;  1A03 A;  4ZCV A;  2BBM A;  2L4H A;  2Y1N A;  2BL0 C;  3TS5 C;  3OB1 B;  1S5G Y;  4NDC A;  2K8M B;  2OPO A;  3KHE A;  3OP0 A;  2EC6 B;  3HX4 A;  1B9A A;  1TRF A;  4OR9 B;  1M45 A;  2H61 A;  2V53 A;  5DKR A;  2MA2 A;  3SG2 A;  1TOP A;  3JTD B;  2JT8 A;  1DF0 B;  2L2E A;  4MZL A;  5F6T A;  3OX5 A;  2ZFD A;  1AK8 A;  1YUR A;  1X02 A;  4AQJ A;  1E8A A;  2ZRT A;  3A4U B;  4NQG A;  3KEV A;  1DT7 B;  1NYA A;  2Q91 A;  2G9B A;  1QVI Y;  4WQ2 A;  3PSR A;  4C0K A;  3QRX A;  1RJV A;  3PFV A;  3JVT B;  2E30 A;  3OB2 B;  4XJK A;  1EJ3 A;  1KK8 C;  2JQ6 A;  2KI6 C;  2AMI A;  2L98 A;  3PAL A;  2BE6 A;  1BMO A;  1S3P A;  2KFH A;  1LXF C;  1QX7 A;  2JU0 A;  3DVM A;  1CFC A;  1CFD A;  4WQ3 A;  1QJT A;  5KTY A;  2M1U A;  1CM1 A;  1F71 A;  2LAN A;  3DD4 A;  1MUX A;  2GV5 A;  2KSP A;  2O5G A;  5I2Q A;  5AAN A;  2D8N A;  4JPZ B;  1B1G A;  4ICB A;  1KSM A;  2LUX A;  3BUO B;  1XFY O;  4MN0 A;  2F33 A;  1EG4 A;  1DJX A;  2F2O A;  3CZT X;  2EHB A;  3VRN A;  4XJK B;  3BOW B;  1K9P A;  2Q4U A;  1M31 A;  2HET A;  1G8I A;  1RK9 A;  1XFW O;  4HRG A;  2PRU A;  2LAP A;  1DMO A;  2LLS A;  1SCM C;  1KSO A;  4GAO A;  2QPT A;  1NX0 A;  1PUL A;  1UHN A;  3AAK A;  1MF8 B;  4MBE A;  5ER4 X;  1QTX A;  2PVB A;  2NCP A;  2ZND A;  3RM1 A;  1OQP A;  1OZS A;  4C0J A;  2NXQ A;  4HSZ A;  2K0J A;  1SRA A;  1QX2 A;  1ZOT B;  4USL A;  1M39 A;  1AHR A;  2BEC A;  2IS9 A;  2LP2 A;  1IJ5 A;  2LHI A;  1KQM C;  5HLV A;  2KFG A;  5FYX A;  3TZ1 A;  2F2P A;  4YGB B;  1QV0 A;  1NWD A;  4GPL B;  1UWO A;  3IQQ A;  1UUS A;  3TDU A;  1CMG A;  1SL9 A;  1B4C A;  5AER A;  2BCB A;  1SNL A;  3IQO A;  1QXP A;  1OMD A;  1SCM B;  3CGA A;  4N1F A;  1A75 B;  1S6J A;  1F8H A;  1WDC B;  5HYD A;  1W7I B;  1KK7 Z;  3EVU A;  4FTG A;  3EKJ A;  2CT9 A;  2JT0 A;  3BUX B;  4ORC B;  4DS7 A;  1W7J B;  2BKI B;  1XK4 A;  2NZ0 A;  1JFK A;  1B8R A;  1REC A;  1Y1U A;  2FOT A;  3ICB A;  1CMF A;  1ZFS A;  1K94 A;  1J7R A;  3PLF B;  2MAZ A;  1SCV A;  1WLM A;  2I18 A;  3DVJ A;  5CSF A;  2K2A A;  2M8U A;  3WHU B;  1GJY A;  4MZJ A;  2BE4 A;  3I5I B;  3BUW B;  1NX2 A;  1AUI B;  1A4P A;  3DF0 B;  2HPS A;  2JUL A;  3KF9 A;  2B1U A;  5JJG A;  3CLN A;  1TNX A;  4PHN A;  1BU3 A;  1KWO C;  1L2O B;  2KGB C;  3SJS A;  2KI4 B;  4U8D A;  1AP4 A;  1K8U A;  1PSB A;  1OSA A;  1QAS A;  2JNX A;  2KOT A;  4MZK A;  4PCW A;  1PAL A;  4GGF A;  1PSR A;  1K90 D;  2JNF A;  1QVI Z;  2M49 B;  3LK1 A;  1SL7 A;  4CPV A;  3LLE A;  1LVC D;  5DKN A;  4MEW A;  3NSK A;  1FI5 A;  1D1O A;  1YUS A;  2MLE C;  4DCK A;  1Y6W A;  5KSZ A;  1FPW A;  2OTG B;  1H8B A;  1KFU L;  3WXA A;  1CB1 A;  2LP3 A;  1JF2 A;  2I2R E;  3E3R A;  1K9K A;  1CDL A;  1K93 D;  2MRD A;  4MVF A;  3PAT A;  4BY4 A;  3VRR A;  1UUR A;  2KNE A;  2LMU A;  1CLM A;  1BR1 B;  1FI6 A;  1JSA A;  2MBX A;  2SCP A;  2LV7 A;  2L50 A;  2JWW A;  1BR4 B;  3NXA A;  1S6I A;  2JPT A;  1EG3 A;  3D0Y B;  1KFX L;  1OE9 B;  3I5F C;  3EK8 A;  3EVV A;  2PAL A;  2HQ8 A;  4BY5 A;  1SR6 B;  1TN4 A;  1XA5 A;  3O78 A;  4CFQ A;  1JC2 A;  3BOW A;  2CXJ A;  3I5H C;  2L4I A;  1UHI A;  1TCO B;  2GGZ A;  4PE0 A;  2OS8 C;  3TS5 B;  2BL0 B;  4A4C A;  2NLN A;  1DGU A;  2JOJ A;  3IF7 A;  4UPG A;  2G2B A;  1UHK A;  1F70 A;  4AOM A;  1ZMZ A;  1SL8 A;  4I5N B;  1HT9 A;  3WNX B;  1U5I B;  2FCD A;  1PK0 D;  2KQ6 A;  2WND A;  3M0W A;  4L9M A;  1DJG A;  1JF0 A;  2JZI A;  2WCE A;  2WOS A;  4ORB B;  1PVB A;  1WRK A;  4N5X A;  5I2L A;  1CDM A;  3HCM A;  1XFX O;  1R6P A;  2KBM A;  3AKB A;  1S1E A;  1EXR A;  2LLU A;  2LVJ A;  1K2H A;  1DJW A;  1QX5 B;  2KDH A;  1F4O A;  3EVR A;  3VRO A;  1F54 A;  2LCP A;  2E6W A;  2LC5 A;  3EKH A;  1S36 A;  2M7L A;  5DKQ A;  5PAL A;  1ZUZ A;  2M7N A;  1JFJ A;  4MRY A;  1RRO A;  1QLS A;  2VRG A;  1KK8 B;  2KYF A;  1FF1 A;  1DGV A;  1DJI A;  5K89 A;  1JBA A;  2F3Y A;  1EH2 A;  1KFU S;  1YX7 A;  2KGR A;  1A75 A;  1MR8 A;  3A8R A;  1OMV A;  2WOR A;  1NIW A;  4YGA A;  2FCE A;  1S6C A;  1MWN A;  5HKY A;  2AUC A;  1FBV A;  1YUU A;  2KI6 D;  4XYN A;  1B8C A;  2WCB A;  2M0R A;  5I2O A;  3FWB A;  2M29 A;  3LL8 B;  1BLQ A;  1WY9 A;  3BYA A;  4MRX A;  4GGN A;  4YRU A;  1YRU B;  1KFX S;  2HF5 A;  2KQY A;  1NCX A;  3CR4 X;  1IQ5 A;  3PM8 A;  1QAT A;  3I5G C;  1B47 A;  1YVH A;  1ALV A;  1MXL C;  2K2F A;  2LLT A;  3DF0 A;  3GK1 A;  2Y1M A;  3LK0 A;  2MLF C;  5HKW A;  5CSN A;  2FJU B;  1J1D A;  1XO5 A;  4OV2 A;  5TNC A;  3GK4 X;  1RFJ A;  1YUT A;  2A4J A;  1J7P A;  4YI8 A;  1TNQ A;  2KAY A;  1DJZ A;  2Y4Q A;  2ZRS A;  5BPJ A;  4DUQ A;  1LA0 A;  1QLK A;  1UP5 A;  3SG7 A;  1AVS A;  4I5L B;  3VGO A;  1XFZ O;  2JRF A;  1YRT B;  3NSI A;  1S5G Z;  4CID A;  3TUY C;  2H2K A;  3PN7 C;  1L7Z A;  1XVJ A;  3C1V A;  1CFP A;  1OMR A;  1K95 A;  4OVN F;  1NX1 A;  5IBW A;  2KHN A;  3CTN A;  1Q80 A;  2LMV A;  1OZO A;  1C07 A;  5AEQ A;  1IGV A;  1NCY A;  1TNP A;  1KQM B;  4FQO A;  4IL1 A;  1SPY A;  4PDZ A;  2ZNE A;  2JC2 A;  2EC6 C;  4GFT A;  2JTZ A;  5I8N A;  1NPQ A;  2LE9 B;  3OHM B;  2GGM A;  3FS7 A;  2ZN9 A;  4PAL A;  1H4B A;  2KAV A;  2L51 A;  1UHJ A;  2KFF A;  4MSP A;  1NSH A;  1TCF A;  4I5J A;  1GGZ A;  1KCY A;  1QIV A;  1SBJ A;  1UHH A;  3D0Y A;  1V1F A;  3TDZ A;  5JOL A;  3TDI A;  1J1E A;  5KU1 A;  4GGF C;  4GBA A;  2BKH B;  3WHT B;  3O4Y A;  3NSO A;  3DVE A;  3BXK A;  4D1E A;  1JWD A;  2LHL A;  3SIA A;  1OOJ A;  5ER5 A;  1N2D A;  2K7B A;  1KK7 Y;  3CWG A;  1K9U A;  5HKZ A;  3JVT C;  2MJW B;  3EK4 A;  5G08 A;  3F45 A;  2ISD A;  1WLZ A;  1B7T Y;  1TTX A;  4JWQ A;  1GQM A;  2H61 C;  1TNW A;  1IWQ A;  3FWC A;  2LVK A;  2RGI A;  1CNP A;  1PRW A;  1AJ5 A;  1J55 A;  1U5I A;  4P5O E;  1DVI A;  1ZAC A;  1WRZ A;  3VRQ A;  1KWO B;  4P2Y B;  1YX8 A;  2WCF A;  4HRH A;  2WC8 A;  1LIN A;  3D10 A;  2K7C A;  1B8L A;  1CKK A;  2I94 A;  4CFR A;  1C7V A;  4PHM A;  4PHJ A;  1Y1X A;  4YGE B;  2KAX A;  4DRW A;  1BF5 A;  2P6B B;  3FIA A;  2EGD A;  1MQ1 A;  1SK6 D;  4AQI A;  2LNK A;  4PHK A;  2LVV A;  4YBH B;  5GQQ C;  2LM5 A;  1G4Y R;  1R2U A;  3ZNI A;  4I5K A;  4GUK A;  4A4B A;  4NDD A;  4GNK B;  1F55 A;  1LKJ A;  2PAS A;  5CPV A;  2JT3 A;  2ZKM X;  1CFF A;  2PMY A;  4M2Q A;  4YI9 A;  2QAC A;  3CS1 A;  3SG4 A;  2M3W A;  1GGW A;  1VRK A;  1J7O A;  2BCA A;  3SIB A;  2O60 A;  2M1K B;  3DVK A;  3O2P A;  1V1G A;  1SY9 A;  1WRL A;  1CLL A;  5CSJ A;  1N0Y A;  2JXL A;  3I5F B;  4OCI A;  2NCO A;  1SYM A;  1SMG A;  2M97 A;  4ETO A;  1TIZ A;  1N65 A;  1S26 D;  2JXC A;  1BOC A;  3I5H B;  3OX6 A;  3GOF A;  2OS8 B;  5AFP A;  5CSI A;  2K7D A; 
#chains in the Genus database with same CATH topology
 1Y0V H;  4M2P A;  5J3X A;  1C7W A;  3SS5 A;  1YTZ C;  2COL B;  3IVT A;  3NSL A;  3BUN B;  1ODB A;  4JQ0 D;  1HQV A;  3ZWH A;  3AAJ A;  3EK7 A;  1CDN A;  2BBN A;  1WDC C;  2LUC A;  2BNX A;  1IH0 A;  3B88 A;  1NUB A;  4PE4 A;  3K21 A;  5FI2 A;  1LA3 A;  4CLN A;  3BUM B;  5HL1 A;  1BOD A;  3RLZ A;  2YGU A;  1YVL A;  4HRE E;  4WRI A;  5D69 A;  2TN4 A;  1XFU O;  3MSE B;  4NDB A;  2DOQ A;  4PE7 A;  1YR5 A;  2AAO A;  4DIR A;  2KBI A;  2I7A A;  2BCX A;  3KPX A;  1DTL A;  4QJ4 B;  2HQW A;  1MXE A;  4F0Z B;  3I5I C;  2PYQ A;  3CR2 A;  1QS7 A;  4ORA B;  3B6X A;  1A29 A;  4Q04 A;  1BT6 A;  3BFA A;  2KYC A;  1NX3 A;  2LVI A;  5FI7 A;  2M9G A;  1L2O C;  2R2I A;  2KI4 C;  1BG1 A;  2CTN A;  5B8I B;  5AXI A;  3KO0 A;  2CBL A;  3Q8I A;  2PSR A;  4ZCU A;  1XK4 C;  3VB1 A;  1SW8 A;  1AJ4 A;  1JUO A;  1PVA A;  3SG6 A;  1BJF A;  1CM4 A;  4MLW A;  1NP8 A;  2LMT A;  4JD9 A;  1DJY A;  1CTR A;  3CAB A;  4YGD B;  2CCM A;  4YGC B;  1DJH A;  1B7T Z;  1M46 A;  4PT1 A;  1SKT A;  1IQ3 A;  3BQ3 A;  1RWY A;  2OTG C;  3O6B A;  1CDP A;  1F4Q A;  3I5G B;  1FW4 A;  2F8P A;  2SAS A;  1ALW A;  1IG5 A;  1XYD A;  2JTT A;  2L0P A;  4PE1 A;  3JTD C;  3SG3 A;  1A2X A;  3H4S E;  4OKH A;  3LCP C;  1K96 A;  2QDI A;  1KQV A;  2L5X B;  5D3O A;  4QJ3 B;  3S0E A;  2ZN8 A;  4QJ5 B;  1CLB A;  1J7Q A;  3AKA A;  2Y5I A;  4N1G A;  1QIW A;  4TNC A;  1MHO A;  3CR5 X;  1EL4 A;  3VRP A;  1Y1A A;  4M2O A;  2F3Z A;  3TUY B;  2K61 A;  2MHH A;  1IKU A;  3PN7 B;  1NCZ A;  5HLO A;  5D7F A;  3GK2 A;  3SG5 A;  1IJ6 A;  1DF0 A;  1SR6 C;  2CNP A;  2FJY A;  4E68 A;  1RTP 1;  2K7O A;  4C0L A;  1G33 A;  3B87 A;  1M63 B;  1QV1 A;  1XFV O;  3L4L A;  1IRJ A;  1Z4H A;  4R1E A;  1A03 A;  4ZCV A;  2BBM A;  2L4H A;  2Y1N A;  2BL0 C;  3D73 A;  3OB1 B;  1S5G Y;  4NDC A;  2K8M B;  2OPO A;  3KHE A;  3OP0 A;  3TS5 C;  2EC6 B;  3S0F A;  3HX4 A;  3DY9 A;  1B9A A;  1TRF A;  4OR9 B;  1M45 A;  2H61 A;  2V53 A;  5DKR A;  2MA2 A;  3SG2 A;  1TOP A;  3JTD B;  2JT8 A;  1OW4 A;  3V2L A;  1DF0 B;  2L2E A;  2KPH A;  1SSE B;  4MZL A;  5F6T A;  3OX5 A;  4IJ7 A;  2ZFD A;  1AK8 A;  1YUR A;  1X02 A;  4AQJ A;  1QWV A;  1E8A A;  2ZRT A;  3A4U B;  4NQG A;  3KEV A;  1DT7 B;  1NYA A;  2Q91 A;  2G9B A;  1QVI Y;  4WQ2 A;  3PSR A;  1DQE A;  4C0K A;  3QRX A;  1RJV A;  3PFV A;  3JVT B;  2E30 A;  3OB2 B;  4XJK A;  1EJ3 A;  1KK8 C;  1OOG A;  2JQ6 A;  2KI6 C;  2AMI A;  1OOF A;  2L98 A;  2WCH A;  3K1E A;  2BE6 A;  3PAL A;  1BMO A;  1S3P A;  2KFH A;  1LXF C;  1QX7 A;  2JU0 A;  3BJH A;  3DVM A;  1CFC A;  1CFD A;  4WQ3 A;  1QJT A;  2QEV A;  5KTY A;  2M1U A;  1CM1 A;  1F71 A;  2LAN A;  3DD4 A;  1MUX A;  2GV5 A;  2KSP A;  2O5G A;  5I2Q A;  5AAN A;  3BFB A;  2D8N A;  4JPZ B;  1B1G A;  3NHT A;  4ICB A;  1KSM A;  2LUX A;  3BUO B;  3SS4 A;  1XFY O;  4MN0 A;  2F33 A;  2BAP A;  1EG4 A;  1DJX A;  2F2O A;  3CZT X;  3PJI A;  2EHB A;  3VRN A;  1DC1 A;  4XJK B;  3BOW B;  1K9P A;  2Q4U A;  1M31 A;  2HET A;  1G8I A;  1RK9 A;  1XFW O;  4HRG A;  2PRU A;  2LAP A;  1DMO A;  2LLS A;  1SCM C;  1KSO A;  4GAO A;  1TUJ A;  2QPT A;  3CYZ A;  1NX0 A;  1PUL A;  3CZ2 A;  1UHN A;  3AAK A;  1MF8 B;  4MBE A;  5ER4 X;  1QTX A;  2PVB A;  3DYE A;  1DEK A;  2NCP A;  2ZND A;  3RM1 A;  2KLD A;  1OQP A;  1OZS A;  4C0J A;  2NXQ A;  4HSZ A;  2K0J A;  1SRA A;  1QX2 A;  1ZOT B;  4USL A;  1M39 A;  1AHR A;  2BEC A;  2IS9 A;  2LP2 A;  1IJ5 A;  2WCJ A;  1OOH A;  2LHI A;  3S0B A;  1KQM C;  5HLV A;  2KFG A;  5FYX A;  3TZ1 A;  2F2P A;  4YGB B;  3UNW A;  1QV0 A;  1NWD A;  4GPL B;  1UWO A;  3IQQ A;  1UUS A;  1W9Z A;  3TDU A;  4F7F A;  1CMG A;  1SL9 A;  1B4C A;  5AER A;  2BCB A;  1SNL A;  3IQO A;  1QXP A;  1OMD A;  1SCM B;  3CGA A;  3CDN A;  1A75 B;  1S6J A;  4N1F A;  3SS3 A;  1F8H A;  1WDC B;  5HYD A;  1W7I B;  3OBV A;  1KK7 Z;  3EVU A;  4FTG A;  3EKJ A;  2CT9 A;  3S0A A;  2JT0 A;  3BUX B;  4ORC B;  4DS7 A;  1W7J B;  2BKI B;  1XK4 A;  2NZ0 A;  1JFK A;  1B8R A;  1REC A;  1Y1U A;  2FOT A;  3ICB A;  1CMF A;  1GM0 A;  1ZFS A;  1K94 A;  1J7R A;  3PLF B;  2MAZ A;  1SCV A;  1WLM A;  2I18 A;  3DVJ A;  5CSF A;  2K2A A;  2M8U A;  3WHU B;  1GJY A;  4MZJ A;  2BE4 A;  3I5I B;  3BUW B;  1NX2 A;  1AUI B;  1A4P A;  3DF0 B;  2HPS A;  2JUL A;  3KF9 A;  2B1U A;  5JJG A;  3CLN A;  1TNX A;  4PHN A;  1BU3 A;  1KWO C;  2L5Y A;  1L2O B;  2KGB C;  5FI6 A;  3SJS A;  2KI4 B;  4U8D A;  1AP4 A;  1K8U A;  1PSB A;  1OSA A;  1QAS A;  2JNX A;  2KOT A;  4MZK A;  4PCW A;  1PAL A;  4GGF A;  1PSR A;  1K90 D;  2JNF A;  1QVI Z;  2M49 B;  3N7H A;  3LK1 A;  1SL7 A;  2GTE A;  3PM2 A;  4CPV A;  3LLE A;  1LVC D;  3R1O A;  4MEW A;  5DKN A;  3NSK A;  1FI5 A;  1D1O A;  1YUS A;  2MLE C;  3D74 A;  4DCK A;  1Y6W A;  2QEH A;  5KSZ A;  1FPW A;  2OTG B;  1H8B A;  1KFU L;  3WXA A;  1CB1 A;  2LP3 A;  1JF2 A;  2I2R E;  3E3R A;  1K9K A;  1CDL A;  1K93 D;  2MRD A;  1LS8 A;  3L47 A;  3PAT A;  4MVF A;  4BY4 A;  2QEO A;  3VRR A;  1UUR A;  2KNE A;  2LMU A;  1CLM A;  1BR1 B;  1FI6 A;  1JSA A;  2MBX A;  3O4X A;  2SCP A;  2LV7 A;  2L50 A;  2JWW A;  1BR4 B;  3NXA A;  1S6I A;  2JPT A;  1EG3 A;  3D0Y B;  3RZS A;  1KFX L;  1OE9 B;  3I5F C;  3EK8 A;  3EVV A;  1IIO A;  2PAL A;  2HQ8 A;  4BY5 A;  1SR6 B;  1TN4 A;  1XA5 A;  3O78 A;  4CFQ A;  1JC2 A;  3BOW A;  2CXJ A;  3I5H C;  2L4I A;  3CZ1 A;  1UHI A;  1TCO B;  2GGZ A;  4PE0 A;  2OS8 C;  3TS5 B;  2BL0 B;  4A4C A;  2NLN A;  3D77 A;  1DGU A;  2JOJ A;  3IF7 A;  4JKT A;  4UPG A;  1XFR A;  2G2B A;  1UHK A;  1TUZ A;  1F70 A;  4AOM A;  1ZMZ A;  1SL8 A;  4I5N B;  1HT9 A;  3FE9 A;  3WNX B;  1U5I B;  2FCD A;  1PK0 D;  2ERB A;  2KQ6 A;  2WND A;  3M0W A;  4L9M A;  1DJG A;  1JF0 A;  2JZI A;  2WCE A;  2WOS A;  4ORB B;  1PVB A;  3FE6 A;  1WRK A;  4N5X A;  5I2L A;  1CDM A;  3HCM A;  1XFX O;  3R72 A;  1R6P A;  2KBM A;  3AKB A;  3NGV A;  3CZ0 A;  1S1E A;  1EXR A;  2LLU A;  2LVJ A;  1K2H A;  1DJW A;  1QX5 B;  2KDH A;  1F4O A;  3EVR A;  3VRO A;  1F54 A;  2LCP A;  2E6W A;  2LC5 A;  3EKH A;  1S36 A;  2M7L A;  5DKQ A;  5PAL A;  1ZUZ A;  2M7N A;  1JFJ A;  4MRY A;  1RRO A;  1QLS A;  2VRG A;  1KK8 B;  2KYF A;  1FF1 A;  1C3Y A;  1DGV A;  1DJI A;  5K89 A;  1JBA A;  2F3Y A;  1EH2 A;  3NHI A;  1KFU S;  1YX7 A;  2KGR A;  1A75 A;  1MR8 A;  3A8R A;  1OMV A;  2WCK A;  2WOR A;  1NIW A;  4YGA A;  2FCE A;  1S6C A;  1MWN A;  5HKY A;  2AUC A;  1FBV A;  2QEB A;  1YUU A;  3EG5 B;  2KI6 D;  4XYN A;  1B8C A;  2WCB A;  2M0R A;  5I2O A;  3FWB A;  2M29 A;  3LL8 B;  1BLQ A;  1WY9 A;  3BYA A;  4MRX A;  3DXL A;  4GGN A;  4YRU A;  1YRU B;  1KFX S;  2HF5 A;  2KQY A;  1NCX A;  3CR4 X;  1IQ5 A;  3PM8 A;  1P28 A;  1QAT A;  1TWO A;  3I5G C;  1B47 A;  1YVH A;  1ALV A;  1MXL C;  2K2F A;  2LLT A;  3DF0 A;  3GK1 A;  2Y1M A;  4INW A;  3LK0 A;  2MLF C;  5HKW A;  5CSN A;  2FJU B;  1J1D A;  1XO5 A;  3DZT A;  4OV2 A;  3GK4 X;  5TNC A;  1RFJ A;  1T14 A;  2JPO A;  1YUT A;  2A4J A;  1J7P A;  4YI8 A;  1TNQ A;  2KAY A;  1DJZ A;  2Y4Q A;  2ZRS A;  5BPJ A;  4DUQ A;  1LA0 A;  1QLK A;  1UP5 A;  3SG7 A;  1AVS A;  4I5L B;  3VGO A;  1XFZ O;  2JRF A;  1YRT B;  3NSI A;  1S5G Z;  4CID A;  3TUY C;  3B86 A;  2H2K A;  3PN7 C;  1L7Z A;  1XVJ A;  3C1V A;  1CFP A;  1OMR A;  1K95 A;  4OVN F;  1NX1 A;  3BFH A;  2P71 A;  2KHN A;  5IBW A;  3B7A A;  3CTN A;  1Q80 A;  2LMV A;  1OZO A;  1C07 A;  5AEQ A;  1IGV A;  1NCY A;  1TNP A;  1KQM B;  4FQO A;  4IL1 A;  1SPY A;  4PDZ A;  2P70 A;  2ZNE A;  2JC2 A;  2EC6 C;  1Z2C B;  4GFT A;  2JTZ A;  5I8N A;  1NPQ A;  2LE9 B;  3OHM B;  2GGM A;  3FS7 A;  2ZN9 A;  4FQT A;  4PAL A;  1H4B A;  2KAV A;  2L51 A;  1UHJ A;  2KFF A;  4MSP A;  1NSH A;  1TCF A;  4I5J A;  3D76 A;  1GGZ A;  1KCY A;  1QIV A;  1SBJ A;  4OZD A;  1UHH A;  3D0Y A;  1V1F A;  3TDZ A;  5JOL A;  3TDI A;  1C3Z A;  1J1E A;  5KU1 A;  1DEL A;  4GGF C;  4GBA A;  2BKH B;  3WHT B;  3D78 A;  3O4Y A;  3NSO A;  3R1V A;  3DVE A;  3BXK A;  4D1E A;  1JWD A;  2LHL A;  3SIA A;  1OOJ A;  5ER5 A;  2WC5 A;  1N2D A;  2K7B A;  1KK7 Y;  3CWG A;  1K9U A;  5HKZ A;  3JVT C;  2MJW B;  3EK4 A;  5G08 A;  3F45 A;  2ISD A;  1WLZ A;  1B7T Y;  1TTX A;  4JWQ A;  1GQM A;  2H61 C;  2WC6 A;  1TNW A;  1IWQ A;  3FWC A;  2LVK A;  2RGI A;  1ORG A;  1PRW A;  1AJ5 A;  1J55 A;  1U5I A;  3OGN A;  1CNP A;  4P5O E;  1DVI A;  1ZAC A;  1WRZ A;  3VRQ A;  1KWO B;  4P2Y B;  1YX8 A;  2WCF A;  4HRH A;  2WC8 A;  1LIN A;  3D10 A;  2K7C A;  1B8L A;  1CKK A;  3UO9 A;  2I94 A;  4CFR A;  1C7V A;  4PHM A;  4PHJ A;  1Y1X A;  4YGE B;  2KAX A;  4DRW A;  1BF5 A;  2P6B B;  3FIA A;  3R1P A;  2EGD A;  1MQ1 A;  1SK6 D;  4AQI A;  2LNK A;  4PHK A;  2LVV A;  2K60 A;  4YBH B;  2LM5 A;  5GQQ C;  2WCM A;  1G4Y R;  1R2U A;  4KYN A;  3ZNI A;  4I5K A;  4GUK A;  4A4B A;  4NDD A;  4GNK B;  1F55 A;  3D75 A;  3S0G A;  2L2C A;  1LKJ A;  2PAS A;  5CPV A;  2JT3 A;  3L4A A;  2ZKM X;  1CFF A;  2WCL A;  2PMY A;  4M2Q A;  5I94 A;  4YI9 A;  2QAC A;  3CS1 A;  3SG4 A;  2M3W A;  3QME A;  5EL2 A;  1GGW A;  2H8V A;  1VRK A;  1J7O A;  2BCA A;  3SIB A;  2O60 A;  2M1K B;  3DVK A;  3O2P A;  1V1G A;  1SY9 A;  1WRL A;  3S0D A;  1CLL A;  5CSJ A;  1N0Y A;  2JXL A;  3I5F B;  4OCI A;  2NCO A;  1SYM A;  1SMG A;  2M97 A;  3FE8 A;  2PQL A;  4ETO A;  1TIZ A;  1OOI X;  1N65 A;  1S26 D;  2JXC A;  2KLE A;  1BOC A;  3I5H B;  3OX6 A;  3GOF A;  2OS8 B;  5DIC A;  5AFP A;  5CSI A;  4INX A;  2K7D A; 
#chains in the Genus database with same CATH homology
 1Y0V H;  4M2P A;  5J3X A;  1C7W A;  1YTZ C;  2COL B;  3NSL A;  3BUN B;  1ODB A;  4JQ0 D;  1HQV A;  3ZWH A;  3AAJ A;  3EK7 A;  1CDN A;  2BBN A;  1WDC C;  2LUC A;  1IH0 A;  1NUB A;  4PE4 A;  3K21 A;  1LA3 A;  4CLN A;  3BUM B;  1BOD A;  3RLZ A;  1YVL A;  4HRE E;  4WRI A;  5D69 A;  2TN4 A;  1XFU O;  3MSE B;  4NDB A;  2DOQ A;  4PE7 A;  1YR5 A;  2AAO A;  4DIR A;  2KBI A;  2I7A A;  2BCX A;  3KPX A;  1DTL A;  4QJ4 B;  2HQW A;  1MXE A;  4F0Z B;  3I5I C;  3CR2 A;  1QS7 A;  4ORA B;  1A29 A;  4Q04 A;  1BT6 A;  2KYC A;  1NX3 A;  2LVI A;  2M9G A;  1L2O C;  2R2I A;  2KI4 C;  1BG1 A;  2CTN A;  5B8I B;  5AXI A;  3KO0 A;  2CBL A;  2PSR A;  4ZCU A;  1XK4 C;  1SW8 A;  1AJ4 A;  1JUO A;  1PVA A;  3SG6 A;  1BJF A;  1CM4 A;  4MLW A;  1NP8 A;  2LMT A;  1DJY A;  1CTR A;  4YGD B;  2CCM A;  4YGC B;  1DJH A;  1B7T Z;  1M46 A;  1SKT A;  1IQ3 A;  3BQ3 A;  1RWY A;  2OTG C;  3O6B A;  1CDP A;  1F4Q A;  3I5G B;  1FW4 A;  2F8P A;  2SAS A;  1ALW A;  1IG5 A;  1XYD A;  2JTT A;  2L0P A;  4PE1 A;  3JTD C;  3SG3 A;  1A2X A;  3H4S E;  4OKH A;  3LCP C;  1K96 A;  1KQV A;  2L5X B;  4QJ3 B;  2ZN8 A;  4QJ5 B;  1CLB A;  1J7Q A;  3AKA A;  2Y5I A;  4N1G A;  1QIW A;  4TNC A;  1MHO A;  3CR5 X;  1EL4 A;  3VRP A;  1Y1A A;  4M2O A;  2F3Z A;  3TUY B;  2K61 A;  2MHH A;  1IKU A;  3PN7 B;  1NCZ A;  5HLO A;  5D7F A;  3GK2 A;  3SG5 A;  1IJ6 A;  1DF0 A;  1SR6 C;  2CNP A;  4E68 A;  1RTP 1;  2K7O A;  4C0L A;  1G33 A;  1M63 B;  1QV1 A;  1XFV O;  4R1E A;  1IRJ A;  1A03 A;  4ZCV A;  2BBM A;  2L4H A;  2Y1N A;  2BL0 C;  3TS5 C;  3OB1 B;  1S5G Y;  4NDC A;  2K8M B;  2OPO A;  3KHE A;  3OP0 A;  2EC6 B;  3HX4 A;  1B9A A;  1TRF A;  4OR9 B;  1M45 A;  2H61 A;  2V53 A;  5DKR A;  2MA2 A;  3SG2 A;  1TOP A;  3JTD B;  2JT8 A;  1DF0 B;  2L2E A;  4MZL A;  5F6T A;  3OX5 A;  2ZFD A;  1AK8 A;  1YUR A;  1X02 A;  4AQJ A;  1E8A A;  2ZRT A;  3A4U B;  4NQG A;  3KEV A;  1DT7 B;  1NYA A;  2Q91 A;  2G9B A;  1QVI Y;  4WQ2 A;  3PSR A;  4C0K A;  3QRX A;  1RJV A;  3PFV A;  3JVT B;  2E30 A;  3OB2 B;  4XJK A;  1EJ3 A;  1KK8 C;  2JQ6 A;  2KI6 C;  2AMI A;  2L98 A;  3PAL A;  2BE6 A;  1BMO A;  1S3P A;  2KFH A;  1LXF C;  1QX7 A;  2JU0 A;  3DVM A;  1CFC A;  1CFD A;  4WQ3 A;  1QJT A;  5KTY A;  2M1U A;  1CM1 A;  1F71 A;  2LAN A;  3DD4 A;  1MUX A;  2GV5 A;  2KSP A;  2O5G A;  5I2Q A;  5AAN A;  2D8N A;  4JPZ B;  1B1G A;  4ICB A;  1KSM A;  2LUX A;  3BUO B;  1XFY O;  4MN0 A;  2F33 A;  1EG4 A;  1DJX A;  2F2O A;  3CZT X;  2EHB A;  3VRN A;  4XJK B;  3BOW B;  1K9P A;  2Q4U A;  1M31 A;  2HET A;  1G8I A;  1RK9 A;  1XFW O;  4HRG A;  2PRU A;  2LAP A;  1DMO A;  2LLS A;  1SCM C;  1KSO A;  4GAO A;  2QPT A;  1NX0 A;  1PUL A;  1UHN A;  3AAK A;  1MF8 B;  4MBE A;  5ER4 X;  1QTX A;  2PVB A;  2NCP A;  2ZND A;  3RM1 A;  1OQP A;  1OZS A;  4C0J A;  2NXQ A;  4HSZ A;  2K0J A;  1SRA A;  1QX2 A;  1ZOT B;  4USL A;  1M39 A;  1AHR A;  2BEC A;  2IS9 A;  2LP2 A;  1IJ5 A;  2LHI A;  1KQM C;  5HLV A;  2KFG A;  5FYX A;  3TZ1 A;  2F2P A;  4YGB B;  1QV0 A;  1NWD A;  4GPL B;  1UWO A;  3IQQ A;  1UUS A;  3TDU A;  1CMG A;  1SL9 A;  1B4C A;  5AER A;  2BCB A;  1SNL A;  3IQO A;  1QXP A;  1OMD A;  1SCM B;  3CGA A;  4N1F A;  1A75 B;  1S6J A;  1F8H A;  1WDC B;  5HYD A;  1W7I B;  1KK7 Z;  3EVU A;  4FTG A;  3EKJ A;  2CT9 A;  2JT0 A;  3BUX B;  4ORC B;  4DS7 A;  1W7J B;  2BKI B;  1XK4 A;  2NZ0 A;  1JFK A;  1B8R A;  1REC A;  1Y1U A;  2FOT A;  3ICB A;  1CMF A;  1ZFS A;  1K94 A;  1J7R A;  3PLF B;  2MAZ A;  1SCV A;  1WLM A;  2I18 A;  3DVJ A;  5CSF A;  2K2A A;  2M8U A;  3WHU B;  1GJY A;  4MZJ A;  2BE4 A;  3I5I B;  3BUW B;  1NX2 A;  1AUI B;  1A4P A;  3DF0 B;  2HPS A;  2JUL A;  3KF9 A;  2B1U A;  5JJG A;  3CLN A;  1TNX A;  4PHN A;  1BU3 A;  1KWO C;  1L2O B;  2KGB C;  3SJS A;  2KI4 B;  4U8D A;  1AP4 A;  1K8U A;  1PSB A;  1OSA A;  1QAS A;  2JNX A;  2KOT A;  4MZK A;  4PCW A;  1PAL A;  4GGF A;  1PSR A;  1K90 D;  2JNF A;  1QVI Z;  2M49 B;  3LK1 A;  1SL7 A;  4CPV A;  3LLE A;  1LVC D;  5DKN A;  4MEW A;  3NSK A;  1FI5 A;  1D1O A;  1YUS A;  2MLE C;  4DCK A;  1Y6W A;  5KSZ A;  1FPW A;  2OTG B;  1H8B A;  1KFU L;  3WXA A;  1CB1 A;  2LP3 A;  1JF2 A;  2I2R E;  3E3R A;  1K9K A;  1CDL A;  1K93 D;  2MRD A;  4MVF A;  3PAT A;  4BY4 A;  3VRR A;  1UUR A;  2KNE A;  2LMU A;  1CLM A;  1BR1 B;  1FI6 A;  1JSA A;  2MBX A;  2SCP A;  2LV7 A;  2L50 A;  2JWW A;  1BR4 B;  3NXA A;  1S6I A;  2JPT A;  1EG3 A;  3D0Y B;  1KFX L;  1OE9 B;  3I5F C;  3EK8 A;  3EVV A;  2PAL A;  2HQ8 A;  4BY5 A;  1SR6 B;  1TN4 A;  1XA5 A;  3O78 A;  4CFQ A;  1JC2 A;  3BOW A;  2CXJ A;  3I5H C;  2L4I A;  1UHI A;  1TCO B;  2GGZ A;  4PE0 A;  2OS8 C;  3TS5 B;  2BL0 B;  4A4C A;  2NLN A;  1DGU A;  2JOJ A;  3IF7 A;  4UPG A;  2G2B A;  1UHK A;  1F70 A;  4AOM A;  1ZMZ A;  1SL8 A;  4I5N B;  1HT9 A;  3WNX B;  1U5I B;  2FCD A;  1PK0 D;  2KQ6 A;  2WND A;  3M0W A;  4L9M A;  1DJG A;  1JF0 A;  2JZI A;  2WCE A;  2WOS A;  4ORB B;  1PVB A;  1WRK A;  4N5X A;  5I2L A;  1CDM A;  3HCM A;  1XFX O;  1R6P A;  2KBM A;  3AKB A;  1S1E A;  1EXR A;  2LLU A;  2LVJ A;  1K2H A;  1DJW A;  1QX5 B;  2KDH A;  1F4O A;  3EVR A;  3VRO A;  1F54 A;  2LCP A;  2E6W A;  2LC5 A;  3EKH A;  1S36 A;  2M7L A;  5DKQ A;  5PAL A;  1ZUZ A;  2M7N A;  1JFJ A;  4MRY A;  1RRO A;  1QLS A;  2VRG A;  1KK8 B;  2KYF A;  1FF1 A;  1DGV A;  1DJI A;  5K89 A;  1JBA A;  2F3Y A;  1EH2 A;  1KFU S;  1YX7 A;  2KGR A;  1A75 A;  1MR8 A;  3A8R A;  1OMV A;  2WOR A;  1NIW A;  4YGA A;  2FCE A;  1S6C A;  1MWN A;  5HKY A;  2AUC A;  1FBV A;  1YUU A;  2KI6 D;  4XYN A;  1B8C A;  2WCB A;  2M0R A;  5I2O A;  3FWB A;  2M29 A;  3LL8 B;  1BLQ A;  1WY9 A;  3BYA A;  4MRX A;  4GGN A;  4YRU A;  1YRU B;  1KFX S;  2HF5 A;  2KQY A;  1NCX A;  3CR4 X;  1IQ5 A;  3PM8 A;  1QAT A;  3I5G C;  1B47 A;  1YVH A;  1ALV A;  1MXL C;  2K2F A;  2LLT A;  3DF0 A;  3GK1 A;  2Y1M A;  3LK0 A;  2MLF C;  5HKW A;  5CSN A;  2FJU B;  1J1D A;  1XO5 A;  4OV2 A;  5TNC A;  3GK4 X;  1RFJ A;  1YUT A;  2A4J A;  1J7P A;  4YI8 A;  1TNQ A;  2KAY A;  1DJZ A;  2Y4Q A;  2ZRS A;  5BPJ A;  4DUQ A;  1LA0 A;  1QLK A;  1UP5 A;  3SG7 A;  1AVS A;  4I5L B;  3VGO A;  1XFZ O;  2JRF A;  1YRT B;  3NSI A;  1S5G Z;  4CID A;  3TUY C;  2H2K A;  3PN7 C;  1L7Z A;  1XVJ A;  3C1V A;  1CFP A;  1OMR A;  1K95 A;  4OVN F;  1NX1 A;  5IBW A;  2KHN A;  3CTN A;  1Q80 A;  2LMV A;  1OZO A;  1C07 A;  5AEQ A;  1IGV A;  1NCY A;  1TNP A;  1KQM B;  4FQO A;  4IL1 A;  1SPY A;  4PDZ A;  2ZNE A;  2JC2 A;  2EC6 C;  4GFT A;  2JTZ A;  5I8N A;  1NPQ A;  2LE9 B;  3OHM B;  2GGM A;  3FS7 A;  2ZN9 A;  4PAL A;  1H4B A;  2KAV A;  2L51 A;  1UHJ A;  2KFF A;  4MSP A;  1NSH A;  1TCF A;  4I5J A;  1GGZ A;  1KCY A;  1QIV A;  1SBJ A;  1UHH A;  3D0Y A;  1V1F A;  3TDZ A;  5JOL A;  3TDI A;  1J1E A;  5KU1 A;  4GGF C;  4GBA A;  2BKH B;  3WHT B;  3O4Y A;  3NSO A;  3DVE A;  3BXK A;  4D1E A;  1JWD A;  2LHL A;  3SIA A;  1OOJ A;  5ER5 A;  1N2D A;  2K7B A;  1KK7 Y;  3CWG A;  1K9U A;  5HKZ A;  3JVT C;  2MJW B;  3EK4 A;  5G08 A;  3F45 A;  2ISD A;  1WLZ A;  1B7T Y;  1TTX A;  4JWQ A;  1GQM A;  2H61 C;  1TNW A;  1IWQ A;  3FWC A;  2LVK A;  2RGI A;  1CNP A;  1PRW A;  1AJ5 A;  1J55 A;  1U5I A;  4P5O E;  1DVI A;  1ZAC A;  1WRZ A;  3VRQ A;  1KWO B;  4P2Y B;  1YX8 A;  2WCF A;  4HRH A;  2WC8 A;  1LIN A;  3D10 A;  2K7C A;  1B8L A;  1CKK A;  2I94 A;  4CFR A;  1C7V A;  4PHM A;  4PHJ A;  1Y1X A;  4YGE B;  2KAX A;  4DRW A;  1BF5 A;  2P6B B;  3FIA A;  2EGD A;  1MQ1 A;  1SK6 D;  4AQI A;  2LNK A;  4PHK A;  2LVV A;  4YBH B;  5GQQ C;  2LM5 A;  1G4Y R;  1R2U A;  3ZNI A;  4I5K A;  4GUK A;  4A4B A;  4NDD A;  4GNK B;  1F55 A;  1LKJ A;  2PAS A;  5CPV A;  2JT3 A;  2ZKM X;  1CFF A;  2PMY A;  4M2Q A;  4YI9 A;  2QAC A;  3CS1 A;  3SG4 A;  2M3W A;  1GGW A;  1VRK A;  1J7O A;  2BCA A;  3SIB A;  2O60 A;  2M1K B;  3DVK A;  3O2P A;  1V1G A;  1SY9 A;  1WRL A;  1CLL A;  5CSJ A;  1N0Y A;  2JXL A;  3I5F B;  4OCI A;  2NCO A;  1SYM A;  1SMG A;  2M97 A;  4ETO A;  1TIZ A;  1N65 A;  1S26 D;  2JXC A;  1BOC A;  3I5H B;  3OX6 A;  3GOF A;  2OS8 B;  5AFP A;  5CSI A;  2K7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...