3NHTA

Crystal structure of the anst-d7l1-u46619 complex
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
296
structure length
295
Chain Sequence
QPWKALDAEQALYVYKRCYEDHLPSGSDRKTYMTLWNAWRLEPNDAITHCYAKCVLTGLQIYDPQENAFKSDRIPVQYQAYKTITQSKQKEVTEYQKALAAANAKSGSCVDLYNAYLPVHNRFVNLSRQLYHGTVEGAAKIYAAMPEIKQKGESFHAYCEKRAWKGNKQSEWKNGRRYKLTGSPELKDAIDCIFRGLRYMDDTGLKVDEIVRDFNLINKSELEPEVRSVLASCKGSEAYDYYVCLVNSRLKQHFKNAFDFHELRSADYAYLLRKVYENPEKVKEEMKKLNTTVHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords D7 protein
publication title The function and three-dimensional structure of a thromboxane a(2)/cysteinyl leukotriene-binding protein from the saliva of a mosquito vector of the malaria parasite.
pubmed doi rcsb
source organism Anopheles stephensi
total genus 112
structure length 295
sequence length 296
ec nomenclature
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3nhtA02
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3nhtA01
3B86A 3NHIA 3NHTA 2ERBA 3N7HA 3NGVA 1QWVA 3Q8IA 4FQTA 3CABA 3RZSA 1P28A 3R1VA 3BFHA 2WCJA 3L47A 3R1OA 3S0AA 4OZDA 3B6XA 3BFBA 3OGNA 3CZ1A 3QMEA 3FE8A 2WCKA 2P70A 3S0EA 3B87A 2GTEA 1TUJA 3D75A 1C3YA 1TWOA 2P71A 1OOIX 3S0DA 3B7AA 2QEBA 3VB1A 1OOHA 3BFAA 3S0BA 2WC5A 3S0GA 3FE9A 3D77A 1T14A 1OW4A 2PQLA 3CYZA 2WC6A 1ORGA 5DICA 1XFRA 2L2CA 1OOFA 3BJHA 4INWA 2QEHA 3V2LA 2WCMA 3DY9A 3FE6A 1LS8A 3D78A 1DQEA 3CZ0A 3CZ2A 4PT1A 3DXLA 1GM0A 3CDNA 2QDIA 3K1EA 3L4AA 3D73A 3D76A 3R72A 3L4LA 4INXA 2FJYA 2QEVA 3DYEA 3PJIA 2WCHA 2KPHA 5EL2A 3S0FA 3B88A 2H8VA 3DZTA 4F7FA 4JD9A 1OOGA 3D74A 2JPOA 2WCLA 3R1PA 2QEOA 1C3ZA
chains in the Genus database with same CATH superfamily
1YX8A 1SW8A 3OBVA 4WQ2A 2AMIA 2LMVA 3SG6A 3CWGA 4NDDA 3N7HA 3NGVA 1QWVA 4M2QA 1A75B 1J1DA 3EKHA 3JVTB 4PHMA 3PN7C 1NPQA 1IIOA 5I2OA 4XJKB 3NSOA 1P28A 2M3WA 1TNQA 2I2RE 2MA2A 3DF0A 3R1VA 4MRYA 4PE1A 5DKRA 2KYFA 1B4CA 2KYCA 4MEWA 1BODA 1QLKA 3PLFB 3R1OA 3EVUA 1YR5A 1BLQA 4KYNA 1WRLA 4PE0A 3UO9A 1DELA 5K89A 1NWDA 2K0JA 1AVSA 1ODBA 3ZNIA 1KQVA 3BFBA 5CSIA 1U5IB 5TNCA 3OX5A 1UHHA 2GGZA 3FE8A 5I94A 1DT7B 2WCKA 1XK4A 3D0YA 4PHNA 2KNEA 2LLTA 2P70A 1DTLA 3S0EA 3KF9A 1L2OC 1SKTA 2G9BA 1J7RA 1YTZC 3GK2A 1QJTA 2K60A 1AP4A 1NSHA 4GUKA 1WRZA 3D75A 1GGZA 1SCMB 3EG5B 1FW4A 1SL9A 2PVBA 4MLWA 3CR4X 1OOIX 3QRXA 1EH2A 4WQ3A 1TCFA 3LK0A 1BU3A 1AK8A 2ZFDA 1IRJA 2BCBA 2YGUA 4YGCB 1SYMA 1DF0A 1XA5A 2KBIA 5KSZA 4GAOA 2H61C 1QVIY 1ZMZA 1G8IA 2WC5A 1XVJA 3LK1A 1M31A 1K8UA 1MWNA 2LVIA 2K7BA 2HF5A 5D3OA 5DKQA 1JUOA 2JXCA 5KU1A 2KGBC 4YI8A 2LLSA 1S1EA 2JTZA 3BOWA 3SIAA 3TDIA 1K96A 1RJVA 4DCKA 3K21A 4ICBA 3BJHA 4N1GA 3HX4A 3TDZA 1CMGA 2K7CA 4PE4A 1DJGA 1LA3A 2JULA 2L4HA 1J1EA 2MJWB 2LCPA 1AJ5A 3I5FC 3KPXA 2CXJA 1KK8C 1LS8A 3I5GC 2KAYA 3TUYC 3A4UB 1AHRA 4PT1A 1GQMA 1B7TZ 1SNLA 3CDNA 1TN4A 1A4PA 2QDIA 1B7TY 3O6BA 4PCWA 4QJ3B 1QV0A 2AUCA 4QJ5B 1M45A 2BKHB 5AXIA 1JFJA 3NXAA 1RROA 2EC6C 1FI6A 1BOCA 2L50A 4N1FA 2KLDA 2LVVA 2WOSA 4GGNA 1BF5A 1A29A 1EJ3A 1CFFA 2LHIA 2M1UA 1MQ1A 3IF7A 2K8MB 5CSFA 3H4SE 2KI6D 3SG2A 1KSMA 5BPJA 1F54A 1ALVA 1WDCC 1DJXA 1MXLC 1Q80A 2Q91A 2TN4A 5F6TA 1PULA 1KFXS 1QIVA 3OX6A 1B8CA 1K90D 3S0FA 2E30A 3B88A 1ZFSA 4F7FA 3CLNA 4JD9A 3NSIA 3CZTX 2GGMA 1S3PA 1SR6B 2M49B 5FI6A 2MLFC 3EK8A 3R1PA 1C3ZA 1MUXA 3LLEA 1QX2A 3B86A 4IL1A 2L5XB 3NHIA 1K9KA 1JF0A 2CCMA 4FQTA 1TNPA 3PM2A 4P2YB 2PMYA 4PDZA 1CMFA 2QPTA 1Z4HA 1DGVA 5JJGA 3RZSA 4CFQA 1FPWA 1W9ZA 3PM8A 3BFHA 1QIWA 4AOMA 1V1GA 2NXQA 3I5HB 4HRHA 4CIDA 2FCEA 2LVJA 2SCPA 4L9MA 5IBWA 3S0AA 3JVTC 1SK6D 3OGNA 4DRWA 4C0KA 3QMEA 3PFVA 1K94A 1QASA 5AFPA 3BUXB 1Y1XA 1DJIA 1IWQA 1OZSA 1DMOA 1KWOB 1WLZA 4E68A 3BQ3A 1TIZA 3SS4A 1OMVA 3O4XA 5CPVA 1CLBA 2F2OA 2LLUA 1TUJA 3D10A 3SS3A 5HKYA 2EGDA 1QX5B 2JRFA 3VGOA 1H4BA 4DUQA 3OHMB 4GBAA 1TWOA 1RTP1 4ORAB 1NYAA 1W7JB 2LHLA 3VRQA 4AQJA 1KFUL 1JFKA 1BMOA 3PSRA 2AAOA 1G4YR 1N2DA 1NCYA 1CLMA 2QEBA 5CSJA 1H8BA 3BYAA 1J7PA 2LMTA 3BUNB 3O78A 1SCVA 3ZWHA 1RFJA 1RK9A 1C7WA 3OP0A 1SCMC 1NX0A 3S0GA 3FE9A 1CTRA 1EG4A 1A2XA 1NX2A 1OQPA 3D77A 1X02A 2MHHA 3SG3A 4MBEA 2HQ8A 4ETOA 1A75A 4BY5A 1SMGA 1LVCD 1KSOA 1SBJA 1YVHA 2PQLA 3CYZA 4XJKA 5D69A 2WC6A 2KLEA 2K2AA 5J3XA 1CDPA 1LA0A 1S6CA 4YRUA 1OMRA 2K7DA 4DIRA 2KFHA 4I5NB 2QACA 2LC5A 1UURA 2QEHA 1AUIB 3DY9A 1Z2CB 3FE6A 1D1OA 1KQMB 1TNXA 2K7OA 1U5IA 3CZ0A 2Q4UA 3TDUA 2FOTA 4JKTA 4AQIA 1YURA 1OSAA 2LUCA 2M8UA 1DEKA 2NCPA 4XYNA 1QATA 3K1EA 2ISDA 3GK1A 2ZRTA 2L98A 3D73A 2F8PA 5HLVA 1XFYO 2PYQA 3VRNA 3D76A 1KK7Z 4N5XA 3DVEA 1KK7Y 2JPTA 2JOJA 2KDHA 1XFUO 1YX7A 1CB1A 1LKJA 2MRDA 1JC2A 1MHOA 2BL0B 1F4QA 3A8RA 2K2FA 4UPGA 1Y1UA 4MZLA 2KAXA 1JBAA 1IJ6A 4YI9A 1IJ5A 1XFZO 1G33A 1LINA 1PVBA 1SPYA 1ALWA 4PE7A 1WLMA 4ZCUA 2WCHA 2M7LA 4CLNA 1NCZA 5EL2A 2WCBA 1IGVA 2H8VA 1YVLA 2LM5A 3DZTA 4M2OA 3SG4A 1C7VA 1RWYA 3D74A 1YUTA 2F3ZA 2JPOA 1BJFA 1EL4A 2WCLA 3KO0A 2L51A 2QEOA 1B9AA 3AAKA 1S6IA 2BE6A 3CS1A 1XFXO 4FTGA 1OZOA 1WRKA 1Y6WA 2ERBA 2JT0A 3NHTA 4JWQA 1XFVO 1A03A 3CABA 3AKAA 2OTGB 3EKJA 1N0YA 4QJ4B 2L4IA 2R2IA 4Q04A 1SR6C 4R1EA 3L47A 2LANA 5PALA 2KHNA 1DJWA 4M2PA 1ZACA 4CFRA 4MSPA 3ICBA 5D7FA 4ORBB 3B6XA 4I5KA 2ZNDA 1HT9A 2F33A 3OB2B 2P6BB 2H2KA 2KI4B 1V1FA 3FWBA 5AANA 4C0LA 3I5IC 2D8NA 2B1UA 3BXKA 1B8LA 3I5HC 2COLB 2JT8A 5HL1A 1K9PA 2FJUB 1SL8A 2ZKMX 4PHKA 4D1EA 3B87A 1CM1A 1TOPA 3PALA 2GTEA 4YGBB 4DS7A 2KQ6A 3IQOA 1CFCA 4I5JA 1B8RA 1DJHA 1Y1AA 4MZJA 3DVMA 2P71A 1S5GZ 3FS7A 5B8IB 2LV7A 3TS5B 1NX3A 2BBMA 1BR4B 1KWOC 2OS8B 2M1KB 3CR5X 1WY9A 1J55A 3VB1A 4YGEB 3VRRA 1SSEB 1DC1A 5HYDA 1OOHA 4NDCA 1XO5A 3NSLA 1W7IB 4HRGA 3DVJA 4NQGA 3S0BA 1TUZA 3EVRA 1QS7A 2V53A 1E8AA 1JSAA 1TTXA 1TCOB 1DGUA 5HKWA 1HQVA 1SRAA 1PK0D 4NDBA 4F0ZB 4HSZA 4JPZB 3KHEA 5I2LA 1ORGA 2HETA 1XFRA 1SY9A 1OOFA 1R2UA 2CNPA 4JQ0D 5ER5A 3WHUB 4A4BA 5KTYA 4C0JA 2I7AA 3WXAA 3DF0B 3JTDB 2L5YA 3CR2A 3O4YA 1F70A 1UHNA 1KCYA 2I94A 1R6PA 2LVKA 3D78A 1FI5A 1YUSA 2M97A 1SL7A 4IJ7A 1LXFC 2E6WA 3DXLA 1GM0A 2EHBA 4MRXA 3IVTA 2LE9B 1IH0A 3M0WA 2JNFA 2PRUA 3L4AA 5ER4X 5HLOA 2CTNA 4YGDB 3D0YB 5GQQC 1K2HA 1OMDA 2VRGA 3CTNA 3GOFA 1KQMC 2M0RA 1CLLA 3C1VA 1NCXA 1OE9B 1F71A 1CKKA 2RGIA 2G2BA 4PALA 4FQOA 2BCXA 3R72A 1F55A 3VRPA 3NSKA 5FI2A 2BBNA 1ZOTB 5HKZA 4GPLB 3SG7A 3RLZA 1PVAA 3GK4X 2FJYA 1UP5A 1UWOA 2QEVA 1BT6A 1C07A 2CT9A 3PN7B 2KAVA 1DF0B 4MN0A 4OV2A 2JU0A 1AJ4A 5I8NA 1UHKA 1GGWA 4U8DA 2PASA 2BE4A 1OOGA 4OVNF 2NLNA 3O2PA 1S26D 2BL0C 3AAJA 2JXLA 1NX1A 2BECA 1N65A 1J7OA 1CFDA 4GGFC 1XYDA 2JWWA 3Q8IA 1CDLA 3UNWA 4GFTA 1KFXL 5FI7A 2F2PA 4OCIA 4GNKB 2A4JA 3BOWB 2KBMA 4PHJA 4USLA 1F4OA 2K61A 1CNPA 1YRUB 1CM4A 2WCJA 1MF8B 1NUBA 2IS9A 1GJYA 1YRTB 1L2OB 2LP3A 1EG3A 1QVIZ 1DVIA 1IQ5A 1K93D 2OPOA 2ZN9A 4BY4A 1M39A 1RECA 2WNDA 2Y4QA 4OZDA 2MBXA 3HCMA 3BUWB 3CZ1A 3AKBA 2OTGC 3TZ1A 3MSEB 1NP8A 2MLEC 1KFUS 5G08A 2JTTA 1IKUA 1JWDA 1DJYA 4A4CA 5AERA 1S6JA 1MR8A 1TNWA 2M7NA 2PSRA 2MAZA 2KOTA 3CGAA 2LAPA 4MZKA 3EK4A 1PSRA 1QV1A 3WNXB 3FIAA 2L2EA 1XFWO 1C3YA 2KI4C 4OKHA 3S0DA 1CDMA 3LCPC 1M46A 4GGFA 3FWCA 4ORCB 3B7AA 2JC2A 3RM1A 2CBLA 2KSPA 2O5GA 1FF1A 3WHTB 2M29A 3BFAA 1OOJA 1BR1B 2BNXA 2Y1NA 2JNXA 1QTXA 2KFFA 1T14A 3TS5C 5AEQA 2H61A 2KGRA 2LP2A 2OS8C 3EVVA 1OW4A 1DJZA 2PALA 3I5FB 2KI6C 1KK8B 1CDNA 4HREE 1QLSA 2WC8A 3I5GB 3TUYB 4TNCA 3PATA 1B1GA 3F45A 5DICA 2L2CA 5FYXA 1FBVA 2Y5IA 2HQWA 1Y0VH 1CFPA 3SJSA 2NZ0A 4INWA 3V2LA 2EC6B 3DVKA 1QXPA 1S5GY 2WCMA 3SIBA 1S36A 1IQ3A 2O60A 2LUXA 1TRFA 2JT3A 2LMUA 2ZN8A 1DQEA 4WRIA 1K9UA 2KQYA 3CZ2A 2DOQA 1UHJA 3LL8B 2LNKA 1PRWA 5DKNA 1BG1A 2L0PA 3DD4A 1UHIA 1UUSA 3VROA 3JTDC 1F8HA 1PALA 1WDCB 1MXEA 1M63B 4P5OE 4CPVA 1NIWA 3KEVA 3OB1B 4I5LB 5I2QA 1K95A 2JZIA 3IQQA 2BAPA 1L7ZA 1VRKA 2WCFA 4YBHB 1EXRA 2JQ6A 4MVFA 5JOLA 2M9GA 4ZCVA 3I5IB 3L4LA 2NCOA 1B47A 4INXA 1IG5A 2GV5A 5CSNA 1JF2A 1XK4C 2BCAA 2SASA 2F3YA 1ZUZA 2KFGA 2WORA 3DYEA 3PJIA 1QX7A 3BUOB 2KPHA 3E3RA 4YGAA 2ZRSA 3SS5A 3SG5A 3EK7A 2WCEA 2HPSA 1YUUA 2I18A 2Y1MA 1J7QA 2FCDA 3BUMB 4OR9B 1PSBA 2BKIB 2ZNEA
chains in the Genus database with same CATH topology
3B86A 3NHIA 3NHTA 2ERBA 3N7HA 3NGVA 1QWVA 3Q8IA 4FQTA 3CABA 3RZSA 1P28A 3R1VA 3BFHA 2WCJA 3L47A 3R1OA 3S0AA 4OZDA 3B6XA 3BFBA 3OGNA 3CZ1A 3QMEA 3FE8A 2WCKA 2P70A 3S0EA 3B87A 2GTEA 1TUJA 3D75A 1C3YA 1TWOA 2P71A 1OOIX 3S0DA 3B7AA 2QEBA 3VB1A 1OOHA 3BFAA 3S0BA 2WC5A 3S0GA 3FE9A 3D77A 1T14A 1OW4A 2PQLA 3CYZA 2WC6A 1ORGA 5DICA 1XFRA 2L2CA 1OOFA 3BJHA 4INWA 2QEHA 3V2LA 2WCMA 3DY9A 3FE6A 1LS8A 3D78A 1DQEA 3CZ0A 3CZ2A 4PT1A 3DXLA 1GM0A 3CDNA 2QDIA 3K1EA 3L4AA 3D73A 3D76A 3R72A 3L4LA 4INXA 2FJYA 2QEVA 3DYEA 3PJIA 2WCHA 2KPHA 5EL2A 3S0FA 3B88A 2H8VA 3DZTA 4F7FA 4JD9A 1OOGA 3D74A 2JPOA 2WCLA 3R1PA 2QEOA 1C3ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B86 A;  3NHI A;  3NHT A;  2ERB A;  3N7H A;  3NGV A;  1QWV A;  3Q8I A;  4FQT A;  3CAB A;  3RZS A;  1P28 A;  3R1V A;  3BFH A;  2WCJ A;  3L47 A;  3R1O A;  3S0A A;  4OZD A;  3B6X A;  3BFB A;  3OGN A;  3CZ1 A;  3QME A;  3FE8 A;  2WCK A;  2P70 A;  3S0E A;  3B87 A;  2GTE A;  1TUJ A;  3D75 A;  1C3Y A;  1TWO A;  2P71 A;  1OOI X;  3S0D A;  3B7A A;  2QEB A;  3VB1 A;  1OOH A;  3BFA A;  3S0B A;  2WC5 A;  3S0G A;  3FE9 A;  3D77 A;  1T14 A;  1OW4 A;  2PQL A;  3CYZ A;  2WC6 A;  1ORG A;  5DIC A;  1XFR A;  2L2C A;  1OOF A;  3BJH A;  4INW A;  2QEH A;  3V2L A;  2WCM A;  3DY9 A;  3FE6 A;  1LS8 A;  3D78 A;  1DQE A;  3CZ0 A;  3CZ2 A;  4PT1 A;  3DXL A;  1GM0 A;  3CDN A;  2QDI A;  3K1E A;  3L4A A;  3D73 A;  3D76 A;  3R72 A;  3L4L A;  4INX A;  2FJY A;  2QEV A;  3DYE A;  3PJI A;  2WCH A;  2KPH A;  5EL2 A;  3S0F A;  3B88 A;  2H8V A;  3DZT A;  4F7F A;  4JD9 A;  1OOG A;  3D74 A;  2JPO A;  2WCL A;  3R1P A;  2QEO A;  1C3Z A; 
#chains in the Genus database with same CATH topology
 1YX8 A;  1SW8 A;  3OBV A;  4WQ2 A;  2AMI A;  2LMV A;  3SG6 A;  3CWG A;  4NDD A;  3N7H A;  3NGV A;  1QWV A;  4M2Q A;  1A75 B;  1J1D A;  3EKH A;  3JVT B;  4PHM A;  3PN7 C;  1NPQ A;  1IIO A;  5I2O A;  4XJK B;  3NSO A;  1P28 A;  2M3W A;  1TNQ A;  2I2R E;  2MA2 A;  3DF0 A;  3R1V A;  4MRY A;  4PE1 A;  5DKR A;  2KYF A;  1B4C A;  2KYC A;  4MEW A;  1BOD A;  1QLK A;  3PLF B;  3R1O A;  3EVU A;  1YR5 A;  1BLQ A;  4KYN A;  1WRL A;  4PE0 A;  3UO9 A;  1DEL A;  5K89 A;  1NWD A;  2K0J A;  1AVS A;  1ODB A;  3ZNI A;  1KQV A;  3BFB A;  5CSI A;  1U5I B;  5TNC A;  3OX5 A;  1UHH A;  2GGZ A;  3FE8 A;  5I94 A;  1DT7 B;  2WCK A;  1XK4 A;  3D0Y A;  4PHN A;  2KNE A;  2LLT A;  2P70 A;  1DTL A;  3S0E A;  3KF9 A;  1L2O C;  1SKT A;  2G9B A;  1J7R A;  1YTZ C;  3GK2 A;  1QJT A;  2K60 A;  1AP4 A;  1NSH A;  4GUK A;  1WRZ A;  3D75 A;  1GGZ A;  1SCM B;  3EG5 B;  1FW4 A;  1SL9 A;  2PVB A;  4MLW A;  3CR4 X;  1OOI X;  3QRX A;  1EH2 A;  4WQ3 A;  1TCF A;  3LK0 A;  1BU3 A;  1AK8 A;  2ZFD A;  1IRJ A;  2BCB A;  2YGU A;  4YGC B;  1SYM A;  1DF0 A;  1XA5 A;  2KBI A;  5KSZ A;  4GAO A;  2H61 C;  1QVI Y;  1ZMZ A;  1G8I A;  2WC5 A;  1XVJ A;  3LK1 A;  1M31 A;  1K8U A;  1MWN A;  2LVI A;  2K7B A;  2HF5 A;  5D3O A;  5DKQ A;  1JUO A;  2JXC A;  5KU1 A;  2KGB C;  4YI8 A;  2LLS A;  1S1E A;  2JTZ A;  3BOW A;  3SIA A;  3TDI A;  1K96 A;  1RJV A;  4DCK A;  3K21 A;  4ICB A;  3BJH A;  4N1G A;  3HX4 A;  3TDZ A;  1CMG A;  2K7C A;  4PE4 A;  1DJG A;  1LA3 A;  2JUL A;  2L4H A;  1J1E A;  2MJW B;  2LCP A;  1AJ5 A;  3I5F C;  3KPX A;  2CXJ A;  1KK8 C;  1LS8 A;  3I5G C;  2KAY A;  3TUY C;  3A4U B;  1AHR A;  4PT1 A;  1GQM A;  1B7T Z;  1SNL A;  3CDN A;  1TN4 A;  1A4P A;  2QDI A;  1B7T Y;  3O6B A;  4PCW A;  4QJ3 B;  1QV0 A;  2AUC A;  4QJ5 B;  1M45 A;  2BKH B;  5AXI A;  1JFJ A;  3NXA A;  1RRO A;  2EC6 C;  1FI6 A;  1BOC A;  2L50 A;  4N1F A;  2KLD A;  2LVV A;  2WOS A;  4GGN A;  1BF5 A;  1A29 A;  1EJ3 A;  1CFF A;  2LHI A;  2M1U A;  1MQ1 A;  3IF7 A;  2K8M B;  5CSF A;  3H4S E;  2KI6 D;  3SG2 A;  1KSM A;  5BPJ A;  1F54 A;  1ALV A;  1WDC C;  1DJX A;  1MXL C;  1Q80 A;  2Q91 A;  2TN4 A;  5F6T A;  1PUL A;  1KFX S;  1QIV A;  3OX6 A;  1B8C A;  1K90 D;  3S0F A;  2E30 A;  3B88 A;  1ZFS A;  4F7F A;  3CLN A;  4JD9 A;  3NSI A;  3CZT X;  2GGM A;  1S3P A;  1SR6 B;  2M49 B;  5FI6 A;  2MLF C;  3EK8 A;  3R1P A;  1C3Z A;  1MUX A;  3LLE A;  1QX2 A;  3B86 A;  4IL1 A;  2L5X B;  3NHI A;  1K9K A;  1JF0 A;  2CCM A;  4FQT A;  1TNP A;  3PM2 A;  4P2Y B;  2PMY A;  4PDZ A;  1CMF A;  2QPT A;  1Z4H A;  1DGV A;  5JJG A;  3RZS A;  4CFQ A;  1FPW A;  1W9Z A;  3PM8 A;  3BFH A;  1QIW A;  4AOM A;  1V1G A;  2NXQ A;  3I5H B;  4HRH A;  4CID A;  2FCE A;  2LVJ A;  2SCP A;  4L9M A;  5IBW A;  3S0A A;  3JVT C;  1SK6 D;  3OGN A;  4DRW A;  4C0K A;  3QME A;  3PFV A;  1K94 A;  1QAS A;  5AFP A;  3BUX B;  1Y1X A;  1DJI A;  1IWQ A;  1OZS A;  1DMO A;  1KWO B;  1WLZ A;  4E68 A;  3BQ3 A;  1TIZ A;  3SS4 A;  1OMV A;  3O4X A;  5CPV A;  1CLB A;  2F2O A;  2LLU A;  1TUJ A;  3D10 A;  3SS3 A;  5HKY A;  2EGD A;  1QX5 B;  2JRF A;  3VGO A;  1H4B A;  4DUQ A;  3OHM B;  4GBA A;  1TWO A;  1RTP 1;  4ORA B;  1NYA A;  1W7J B;  2LHL A;  3VRQ A;  4AQJ A;  1KFU L;  1JFK A;  1BMO A;  3PSR A;  2AAO A;  1G4Y R;  1N2D A;  1NCY A;  1CLM A;  2QEB A;  5CSJ A;  1H8B A;  3BYA A;  1J7P A;  2LMT A;  3BUN B;  3O78 A;  1SCV A;  3ZWH A;  1RFJ A;  1RK9 A;  1C7W A;  3OP0 A;  1SCM C;  1NX0 A;  3S0G A;  3FE9 A;  1CTR A;  1EG4 A;  1A2X A;  1NX2 A;  1OQP A;  3D77 A;  1X02 A;  2MHH A;  3SG3 A;  4MBE A;  2HQ8 A;  4ETO A;  1A75 A;  4BY5 A;  1SMG A;  1LVC D;  1KSO A;  1SBJ A;  1YVH A;  2PQL A;  3CYZ A;  4XJK A;  5D69 A;  2WC6 A;  2KLE A;  2K2A A;  5J3X A;  1CDP A;  1LA0 A;  1S6C A;  4YRU A;  1OMR A;  2K7D A;  4DIR A;  2KFH A;  4I5N B;  2QAC A;  2LC5 A;  1UUR A;  2QEH A;  1AUI B;  3DY9 A;  1Z2C B;  3FE6 A;  1D1O A;  1KQM B;  1TNX A;  2K7O A;  1U5I A;  3CZ0 A;  2Q4U A;  3TDU A;  2FOT A;  4JKT A;  4AQI A;  1YUR A;  1OSA A;  2LUC A;  2M8U A;  1DEK A;  2NCP A;  4XYN A;  1QAT A;  3K1E A;  2ISD A;  3GK1 A;  2ZRT A;  2L98 A;  3D73 A;  2F8P A;  5HLV A;  1XFY O;  2PYQ A;  3VRN A;  3D76 A;  1KK7 Z;  4N5X A;  3DVE A;  1KK7 Y;  2JPT A;  2JOJ A;  2KDH A;  1XFU O;  1YX7 A;  1CB1 A;  1LKJ A;  2MRD A;  1JC2 A;  1MHO A;  2BL0 B;  1F4Q A;  3A8R A;  2K2F A;  4UPG A;  1Y1U A;  4MZL A;  2KAX A;  1JBA A;  1IJ6 A;  4YI9 A;  1IJ5 A;  1XFZ O;  1G33 A;  1LIN A;  1PVB A;  1SPY A;  1ALW A;  4PE7 A;  1WLM A;  4ZCU A;  2WCH A;  2M7L A;  4CLN A;  1NCZ A;  5EL2 A;  2WCB A;  1IGV A;  2H8V A;  1YVL A;  2LM5 A;  3DZT A;  4M2O A;  3SG4 A;  1C7V A;  1RWY A;  3D74 A;  1YUT A;  2F3Z A;  2JPO A;  1BJF A;  1EL4 A;  2WCL A;  3KO0 A;  2L51 A;  2QEO A;  1B9A A;  3AAK A;  1S6I A;  2BE6 A;  3CS1 A;  1XFX O;  4FTG A;  1OZO A;  1WRK A;  1Y6W A;  2ERB A;  2JT0 A;  3NHT A;  4JWQ A;  1XFV O;  1A03 A;  3CAB A;  3AKA A;  2OTG B;  3EKJ A;  1N0Y A;  4QJ4 B;  2L4I A;  2R2I A;  4Q04 A;  1SR6 C;  4R1E A;  3L47 A;  2LAN A;  5PAL A;  2KHN A;  1DJW A;  4M2P A;  1ZAC A;  4CFR A;  4MSP A;  3ICB A;  5D7F A;  4ORB B;  3B6X A;  4I5K A;  2ZND A;  1HT9 A;  2F33 A;  3OB2 B;  2P6B B;  2H2K A;  2KI4 B;  1V1F A;  3FWB A;  5AAN A;  4C0L A;  3I5I C;  2D8N A;  2B1U A;  3BXK A;  1B8L A;  3I5H C;  2COL B;  2JT8 A;  5HL1 A;  1K9P A;  2FJU B;  1SL8 A;  2ZKM X;  4PHK A;  4D1E A;  3B87 A;  1CM1 A;  1TOP A;  3PAL A;  2GTE A;  4YGB B;  4DS7 A;  2KQ6 A;  3IQO A;  1CFC A;  4I5J A;  1B8R A;  1DJH A;  1Y1A A;  4MZJ A;  3DVM A;  2P71 A;  1S5G Z;  3FS7 A;  5B8I B;  2LV7 A;  3TS5 B;  1NX3 A;  2BBM A;  1BR4 B;  1KWO C;  2OS8 B;  2M1K B;  3CR5 X;  1WY9 A;  1J55 A;  3VB1 A;  4YGE B;  3VRR A;  1SSE B;  1DC1 A;  5HYD A;  1OOH A;  4NDC A;  1XO5 A;  3NSL A;  1W7I B;  4HRG A;  3DVJ A;  4NQG A;  3S0B A;  1TUZ A;  3EVR A;  1QS7 A;  2V53 A;  1E8A A;  1JSA A;  1TTX A;  1TCO B;  1DGU A;  5HKW A;  1HQV A;  1SRA A;  1PK0 D;  4NDB A;  4F0Z B;  4HSZ A;  4JPZ B;  3KHE A;  5I2L A;  1ORG A;  2HET A;  1XFR A;  1SY9 A;  1OOF A;  1R2U A;  2CNP A;  4JQ0 D;  5ER5 A;  3WHU B;  4A4B A;  5KTY A;  4C0J A;  2I7A A;  3WXA A;  3DF0 B;  3JTD B;  2L5Y A;  3CR2 A;  3O4Y A;  1F70 A;  1UHN A;  1KCY A;  2I94 A;  1R6P A;  2LVK A;  3D78 A;  1FI5 A;  1YUS A;  2M97 A;  1SL7 A;  4IJ7 A;  1LXF C;  2E6W A;  3DXL A;  1GM0 A;  2EHB A;  4MRX A;  3IVT A;  2LE9 B;  1IH0 A;  3M0W A;  2JNF A;  2PRU A;  3L4A A;  5ER4 X;  5HLO A;  2CTN A;  4YGD B;  3D0Y B;  5GQQ C;  1K2H A;  1OMD A;  2VRG A;  3CTN A;  3GOF A;  1KQM C;  2M0R A;  1CLL A;  3C1V A;  1NCX A;  1OE9 B;  1F71 A;  1CKK A;  2RGI A;  2G2B A;  4PAL A;  4FQO A;  2BCX A;  3R72 A;  1F55 A;  3VRP A;  3NSK A;  5FI2 A;  2BBN A;  1ZOT B;  5HKZ A;  4GPL B;  3SG7 A;  3RLZ A;  1PVA A;  3GK4 X;  2FJY A;  1UP5 A;  1UWO A;  2QEV A;  1BT6 A;  1C07 A;  2CT9 A;  3PN7 B;  2KAV A;  1DF0 B;  4MN0 A;  4OV2 A;  2JU0 A;  1AJ4 A;  5I8N A;  1UHK A;  1GGW A;  4U8D A;  2PAS A;  2BE4 A;  1OOG A;  4OVN F;  2NLN A;  3O2P A;  1S26 D;  2BL0 C;  3AAJ A;  2JXL A;  1NX1 A;  2BEC A;  1N65 A;  1J7O A;  1CFD A;  4GGF C;  1XYD A;  2JWW A;  3Q8I A;  1CDL A;  3UNW A;  4GFT A;  1KFX L;  5FI7 A;  2F2P A;  4OCI A;  4GNK B;  2A4J A;  3BOW B;  2KBM A;  4PHJ A;  4USL A;  1F4O A;  2K61 A;  1CNP A;  1YRU B;  1CM4 A;  2WCJ A;  1MF8 B;  1NUB A;  2IS9 A;  1GJY A;  1YRT B;  1L2O B;  2LP3 A;  1EG3 A;  1QVI Z;  1DVI A;  1IQ5 A;  1K93 D;  2OPO A;  2ZN9 A;  4BY4 A;  1M39 A;  1REC A;  2WND A;  2Y4Q A;  4OZD A;  2MBX A;  3HCM A;  3BUW B;  3CZ1 A;  3AKB A;  2OTG C;  3TZ1 A;  3MSE B;  1NP8 A;  2MLE C;  1KFU S;  5G08 A;  2JTT A;  1IKU A;  1JWD A;  1DJY A;  4A4C A;  5AER A;  1S6J A;  1MR8 A;  1TNW A;  2M7N A;  2PSR A;  2MAZ A;  2KOT A;  3CGA A;  2LAP A;  4MZK A;  3EK4 A;  1PSR A;  1QV1 A;  3WNX B;  3FIA A;  2L2E A;  1XFW O;  1C3Y A;  2KI4 C;  4OKH A;  3S0D A;  1CDM A;  3LCP C;  1M46 A;  4GGF A;  3FWC A;  4ORC B;  3B7A A;  2JC2 A;  3RM1 A;  2CBL A;  2KSP A;  2O5G A;  1FF1 A;  3WHT B;  2M29 A;  3BFA A;  1OOJ A;  1BR1 B;  2BNX A;  2Y1N A;  2JNX A;  1QTX A;  2KFF A;  1T14 A;  3TS5 C;  5AEQ A;  2H61 A;  2KGR A;  2LP2 A;  2OS8 C;  3EVV A;  1OW4 A;  1DJZ A;  2PAL A;  3I5F B;  2KI6 C;  1KK8 B;  1CDN A;  4HRE E;  1QLS A;  2WC8 A;  3I5G B;  3TUY B;  4TNC A;  3PAT A;  1B1G A;  3F45 A;  5DIC A;  2L2C A;  5FYX A;  1FBV A;  2Y5I A;  2HQW A;  1Y0V H;  1CFP A;  3SJS A;  2NZ0 A;  4INW A;  3V2L A;  2EC6 B;  3DVK A;  1QXP A;  1S5G Y;  2WCM A;  3SIB A;  1S36 A;  1IQ3 A;  2O60 A;  2LUX A;  1TRF A;  2JT3 A;  2LMU A;  2ZN8 A;  1DQE A;  4WRI A;  1K9U A;  2KQY A;  3CZ2 A;  2DOQ A;  1UHJ A;  3LL8 B;  2LNK A;  1PRW A;  5DKN A;  1BG1 A;  2L0P A;  3DD4 A;  1UHI A;  1UUS A;  3VRO A;  3JTD C;  1F8H A;  1PAL A;  1WDC B;  1MXE A;  1M63 B;  4P5O E;  4CPV A;  1NIW A;  3KEV A;  3OB1 B;  4I5L B;  5I2Q A;  1K95 A;  2JZI A;  3IQQ A;  2BAP A;  1L7Z A;  1VRK A;  2WCF A;  4YBH B;  1EXR A;  2JQ6 A;  4MVF A;  5JOL A;  2M9G A;  4ZCV A;  3I5I B;  3L4L A;  2NCO A;  1B47 A;  4INX A;  1IG5 A;  2GV5 A;  5CSN A;  1JF2 A;  1XK4 C;  2BCA A;  2SAS A;  2F3Y A;  1ZUZ A;  2KFG A;  2WOR A;  3DYE A;  3PJI A;  1QX7 A;  3BUO B;  2KPH A;  3E3R A;  4YGA A;  2ZRS A;  3SS5 A;  3SG5 A;  3EK7 A;  2WCE A;  2HPS A;  1YUU A;  2I18 A;  2Y1M A;  1J7Q A;  2FCD A;  3BUM B;  4OR9 B;  1PSB A;  2BKI B;  2ZNE A; 
#chains in the Genus database with same CATH homology
 3B86 A;  3NHI A;  3NHT A;  2ERB A;  3N7H A;  3NGV A;  1QWV A;  3Q8I A;  4FQT A;  3CAB A;  3RZS A;  1P28 A;  3R1V A;  3BFH A;  2WCJ A;  3L47 A;  3R1O A;  3S0A A;  4OZD A;  3B6X A;  3BFB A;  3OGN A;  3CZ1 A;  3QME A;  3FE8 A;  2WCK A;  2P70 A;  3S0E A;  3B87 A;  2GTE A;  1TUJ A;  3D75 A;  1C3Y A;  1TWO A;  2P71 A;  1OOI X;  3S0D A;  3B7A A;  2QEB A;  3VB1 A;  1OOH A;  3BFA A;  3S0B A;  2WC5 A;  3S0G A;  3FE9 A;  3D77 A;  1T14 A;  1OW4 A;  2PQL A;  3CYZ A;  2WC6 A;  1ORG A;  5DIC A;  1XFR A;  2L2C A;  1OOF A;  3BJH A;  4INW A;  2QEH A;  3V2L A;  2WCM A;  3DY9 A;  3FE6 A;  1LS8 A;  3D78 A;  1DQE A;  3CZ0 A;  3CZ2 A;  4PT1 A;  3DXL A;  1GM0 A;  3CDN A;  2QDI A;  3K1E A;  3L4A A;  3D73 A;  3D76 A;  3R72 A;  3L4L A;  4INX A;  2FJY A;  2QEV A;  3DYE A;  3PJI A;  2WCH A;  2KPH A;  5EL2 A;  3S0F A;  3B88 A;  2H8V A;  3DZT A;  4F7F A;  4JD9 A;  1OOG A;  3D74 A;  2JPO A;  2WCL A;  3R1P A;  2QEO A;  1C3Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...