3NHTA

Crystal structure of the anst-d7l1-u46619 complex
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
296
structure length
295
Chain Sequence
QPWKALDAEQALYVYKRCYEDHLPSGSDRKTYMTLWNAWRLEPNDAITHCYAKCVLTGLQIYDPQENAFKSDRIPVQYQAYKTITQSKQKEVTEYQKALAAANAKSGSCVDLYNAYLPVHNRFVNLSRQLYHGTVEGAAKIYAAMPEIKQKGESFHAYCEKRAWKGNKQSEWKNGRRYKLTGSPELKDAIDCIFRGLRYMDDTGLKVDEIVRDFNLINKSELEPEVRSVLASCKGSEAYDYYVCLVNSRLKQHFKNAFDFHELRSADYAYLLRKVYENPEKVKEEMKKLNTTVHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D7 protein
publication title The function and three-dimensional structure of a thromboxane a(2)/cysteinyl leukotriene-binding protein from the saliva of a mosquito vector of the malaria parasite.
pubmed doi rcsb
source organism Anopheles stephensi
molecule tags Transport protein
total genus 112
structure length 295
sequence length 296
ec nomenclature
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3nhtA02
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3nhtA01
1C3YA 3CZ0A 2FJYA 3L4LA 2P71A 3N7HA 3FE6A 2H8VA 3DXLA 4INWA 1OOFA 1OOIX 2WCLA 2QEHA 2QEBA 2JPOA 3D77A 4OZDA 3S0FA 2L2CA 3S0EA 3QMEA 3B86A 2QDIA 3D73A 3DY9A 3B6XA 3BFBA 2P70A 3D78A 1OOHA 3BJHA 4F7FA 3FE9A 1TWOA 1XFRA 4FQTA 3S0DA 2WCMA 4JD9A 1DQEA 3R1OA 2WCHA 4PT1A 1LS8A 3CDNA 3DZTA 2WCJA 3CZ1A 1OW4A 3OGNA 3R72A 3VB1A 2QEOA 5EL2A 2PQLA 5DICA 3R1VA 2WC5A 3CABA 3DYEA 1OOGA 1QWVA 2QEVA 2KPHA 3D75A 1T14A 3PJIA 3S0GA 3FE8A 2WC6A 3D74A 3R1PA 3S0AA 3D76A 2ERBA 2GTEA 1C3ZA 3L4AA 3NHTA 3BFAA 3BFHA 3V2LA 3RZSA 1ORGA 3L47A 3NHIA 3B87A 3B7AA 3K1EA 3CYZA 3CZ2A 1GM0A 1P28A 3NGVA 3Q8IA 2WCKA 3S0BA 1TUJA 3B88A 4INXA
chains in the Genus database with same CATH superfamily
3FIAA 2E6WA 3CZTX 1MXEA 2I2RE 2FJYA 4N5XA 1SL9A 4GGFC 1FPWA 1UHNA 1OOJA 2L2EA 3I5IB 1XVJA 1S5GZ 2Y1NA 3TZ1A 1SW8A 2KAVA 3N7HA 3DXLA 2JXLA 1OOIX 3DVEA 1H4BA 1NSHA 2K61A 5D3OA 2FOTA 3HCMA 2WCLA 2MBXA 1Y6WA 1YVHA 2JPTA 1NX2A 3D0YB 3BUNB 3TDIA 2PSRA 4XJKA 2WOSA 5J3XA 3ZWHA 4DIRA 3PN7C 2PVBA 1L2OC 1EG4A 3O78A 3CR5X 2KYFA 3RLZA 1C07A 3PALA 1W9ZA 1J55A 1UHKA 3O2PA 3O6BA 5JOLA 4FQOA 2I94A 4MSPA 1F71A 3B6XA 1CM1A 3PATA 2P70A 2LUCA 2H61C 5KTYA 1SNLA 1M63B 1ZOTB 3BJHA 4YGCB 4F7FA 4UPGA 1FI6A 1IRJA 2JOJA 1JBAA 4NDBA 1TOPA 5CPVA 1S6JA 2LP2A 3BOWA 3OX6A 1C7VA 1MUXA 1DGUA 1DTLA 4C0KA 2KOTA 1W7JB 1M31A 3EVUA 2LLUA 3I5HB 1S3PA 1J1DA 1ALVA 2Y4QA 3DVJA 5IBWA 3DF0B 1F70A 1BT6A 1X02A 2BL0B 4CFQA 1SYMA 2KQYA 1TTXA 4L9MA 4XYNA 1KWOC 3VGOA 3TDUA 2WNDA 4BY5A 1J7OA 2NXQA 4DCKA 1UURA 2GV5A 5JJGA 3TUYC 1BOCA 1ZACA 1K9UA 4YGDB 2LVVA 1B4CA 3DYEA 1OOGA 1YRTB 1JF0A 1QWVA 3VRRA 1KK7Z 1ODBA 3JTDC 3UNWA 1B9AA 5CSNA 1XA5A 2K7BA 3NSIA 1OSAA 1KQVA 3R1PA 3VRPA 2COLB 3SS4A 3D76A 1AP4A 1DJWA 2AUCA 3L4AA 3OB2B 2PMYA 1AJ4A 1FW4A 1D1OA 1G4YR 2MJWB 4D1EA 4FTGA 2D8NA 3NHTA 4M2PA 2KBMA 2JNFA 3BFAA 3TS5B 1KFUS 4N1FA 3RZSA 3BUXB 3DVKA 4ORBB 2BKIB 2LC5A 1SSEB 4AQIA 2LE9B 2NCPA 1NIWA 3BUMB 4YI8A 1KFXS 1V1GA 3JVTB 1DJIA 2ZRTA 4PHKA 3CZ2A 1P28A 3GK4X 2JU0A 4AOMA 1S36A 4PE0A 1BR4B 1EJ3A 2M3WA 1B47A 2ZNDA 1OZSA 3EK7A 1UP5A 1QLKA 1FI5A 2ZN9A 4DS7A 2LHIA 2KFFA 5D69A 1SY9A 1RTP1 1TUJA 4QJ4B 2NZ0A 2WCEA 4PDZA 1RK9A 1A03A 3I5FB 1PK0D 3GK1A 2L4IA 2PYQA 5FI2A 3A8RA 3CZ0A 3CWGA 3SG4A 1CNPA 1CB1A 2M29A 1G33A 2K2AA 2Q4UA 1CDMA 1BMOA 5D7FA 1IQ3A 1KQMC 2BBNA 4INWA 4GBAA 3KO0A 2JC2A 1PSRA 1EL4A 5DKQA 4NDCA 4MZKA 4GGFA 1F55A 4IL1A 1OZOA 2JPOA 2KFHA 2KFGA 1CFPA 3D77A 4OZDA 3VRQA 3S0FA 1KCYA 3HX4A 3BXKA 3VROA 2LP3A 2BCBA 1EXRA 1QS7A 4TNCA 1K94A 1QV0A 2FJUB 2QDIA 2K7CA 4MZLA 1QLSA 1WDCC 3DY9A 5AEQA 2K8MB 1XO5A 1CDPA 1XFWO 2K7OA 2OS8B 1DJGA 2LMVA 2LM5A 4KYNA 3K21A 1BG1A 1MF8B 1Y1XA 3LLEA 3O4XA 1OOHA 3FE9A 1TNQA 1QX7A 1Y1UA 1JC2A 1IG5A 2CBLA 3VRNA 1K93D 1LKJA 3PM2A 1ZFSA 1UHHA 1WRZA 2I7AA 2JT3A 2OTGB 4OV2A 4YGEB 5FI7A 1SK6D 2H61A 4FQTA 5HLVA 2ISDA 1B1GA 4JD9A 3ICBA 4MZJA 4DRWA 4XJKB 1QTXA 4M2OA 1Z4HA 3KF9A 4MRXA 1TNXA 1K9PA 3KEVA 4PT1A 1LS8A 3CDNA 1XFXO 1QX5B 2WC8A 3F45A 1LA3A 2JT8A 3PFVA 3CZ1A 2EGDA 3KHEA 2LMTA 4I5NB 4YGAA 3FS7A 4CLNA 3H4SE 3R72A 3VB1A 1S26D 1IQ5A 2O60A 5ER5A 2F2PA 2WCFA 4PE1A 3AAKA 3EG5B 4GGNA 3TDZA 5CSFA 1YURA 2K7DA 3BOWB 1SCMC 1SL7A 4P2YB 3TUYB 1MWNA 2MLEC 4GUKA 1EH2A 4E68A 2JQ6A 1T14A 4GAOA 3S0GA 1IWQA 4PE4A 2WC6A 2MHHA 1J7PA 1ZUZA 3D74A 3SG3A 3JTDB 3E3RA 3S0AA 1ALWA 2FCDA 3WNXB 1DMOA 3LL8B 4ZCVA 3SG5A 3O4YA 2AMIA 2JNXA 1B7TY 3IQOA 4WQ3A 1M45A 1R6PA 1KK8C 3AKAA 4DUQA 2LAPA 3PLFB 1PULA 2KI4B 5AANA 5HYDA 3D10A 1K9KA 2MRDA 2KGRA 4MBEA 1BJFA 2F33A 5DKRA 5FYXA 1HT9A 1QIWA 4YBHB 5CSJA 3IQQA 1XFZO 2NLNA 4OCIA 2M1KB 1R2UA 2KI6D 3CYZA 3AAJA 1OMDA 1G8IA 2H2KA 3NGVA 1F4OA 2M7NA 1J7RA 4OR9B 2YGUA 2WCKA 1CLLA 1DVIA 4R1EA 4IJ7A 1AHRA 3CGAA 3NSLA 4CPVA 1YTZC 4HREE 2EC6C 1UHJA 2TN4A 1IJ6A 3B88A 1NWDA 1N2DA 1AVSA 4INXA 1JFJA 1NX3A 1WY9A 1A75A 1C3YA 1XFVO 2BCAA 2BNXA 2KI6C 2VRGA 2MAZA 3L4LA 1PRWA 1SKTA 2LVIA 5TNCA 2KYCA 1OMVA 1CFDA 3FE6A 1Z2CB 1B8LA 1M39A 4U8DA 1DJZA 1KQMB 2KAYA 1UUSA 2QEBA 1XK4C 3DD4A 5G08A 5F6TA 3EK8A 3EVVA 3BYAA 3BQ3A 1UWOA 1GJYA 2QACA 2LV7A 2L2CA 2JT0A 3OP0A 3S0EA 1A29A 1Y0VH 2KHNA 1K8UA 4JWQA 5HKYA 1JFKA 3QMEA 3CR2A 3D73A 4CFRA 1QIVA 1EG3A 1S6IA 2HQWA 1IKUA 1A4PA 2NCOA 4PE7A 4NQGA 2KNEA 2E30A 2K60A 1YUTA 1TIZA 2PRUA 1SR6C 1WDCB 3D78A 2L5YA 1KSOA 4YGBB 1DELA 1BR1B 1B7TZ 1TN4A 4YRUA 1KFUL 1JWDA 3GK2A 1U5IA 3FWCA 2LHLA 2M1UA 3DVMA 1QATA 1CM4A 1XFRA 1MQ1A 2RGIA 1M46A 1RECA 3OB1B 4I5KA 4ORCB 3S0DA 1LINA 1A2XA 1GQMA 1KFXL 1PVAA 3CS1A 1DT7B 1CDNA 3R1OA 2V53A 1CLBA 2WCHA 3I5GC 1E8AA 2LLSA 4OKHA 5HKZA 1CFFA 2ZFDA 1JF2A 2MA2A 2F8PA 1W7IB 2WCJA 4PALA 2ZRSA 1OW4A 3OGNA 2KLDA 2L51A 2KDHA 1CDLA 4ZCUA 2P6BB 4Q04A 3PN7B 1SCVA 1L2OB 1Y1AA 4I5JA 1SL8A 2JULA 2QEOA 1H8BA 2BBMA 5EL2A 4CIDA 2IS9A 1B8RA 5DICA 4GNKB 3JVTC 1LA0A 2WC5A 3CABA 1YR5A 1CMGA 1MR8A 2JWWA 4ETOA 2QEVA 2L0PA 3PJIA 4MN0A 2A4JA 2SCPA 5HKWA 2BKHB 1NCZA 2KGBC 4JPZB 4HRHA 5HL1A 1F8HA 3WHUB 2K0JA 2CXJA 1SMGA 2L50A 1SPYA 4C0LA 1V1FA 2WCBA 5K89A 4NDDA 1S6CA 1N0YA 2LNKA 1MHOA 1YUSA 3EKJA 3IVTA 1HQVA 4JKTA 4N1GA 4A4BA 4ICBA 3NSKA 1DEKA 3BFHA 2HETA 3SS5A 5GQQC 4ORAB 5I2OA 1B8CA 1ORGA 1RROA 2MLFC 1BODA 1AJ5A 3L47A 1KWOB 1KK8B 4F0ZB 4BY4A 3PM8A 3B87A 2O5GA 3LK1A 5I8NA 1KSMA 2M0RA 1LXFC 3MSEB 4P5OE 5HLOA 4PCWA 1IGVA 1C7WA 2Y5IA 1BF5A 1QV1A 2F3YA 1GM0A 1NCXA 1TUZA 1TNWA 2ZN8A 1FF1A 4WQ2A 3Q8IA 1PALA 1RFJA 1JUOA 1FBVA 5DKNA 3SJSA 3WXAA 5BPJA 3D0YA 1XFYO 2WORA 2BCXA 2OS8C 2LUXA 3CTNA 2QPTA 1QXPA 5FI6A 1Q80A 4GPLB 2HQ8A 1VRKA 1DJHA 1BU3A 2OPOA 2AAOA 1AUIB 3I5IC 1QX2A 1WRLA 2EC6B 4QJ5B 1WRKA 3SG7A 2G9BA 2OTGC 3QRXA 1J1EA 1F4QA 2P71A 2R2IA 1UHIA 2H8VA 1QASA 3GOFA 4HSZA 1OOFA 1RWYA 2ZNEA 2LANA 4QJ3B 1WLZA 4HRGA 2EHBA 2QEHA 1CFCA 1XYDA 2M97A 3EK4A 4USLA 2K2FA 1CLMA 4YI9A 2F2OA 4AQJA 2LMUA 1LVCD 2LLTA 3B86A 2LCPA 1GGWA 2HF5A 3DF0A 1CMFA 1XK4A 1A75B 1K95A 5I2QA 4C0JA 5PALA 2KQ6A 3PSRA 4PHNA 3BFBA 1K96A 2Q91A 3SIAA 2M49B 2BAPA 2KBIA 2JTZA 2JTTA 1WLMA 1TWOA 1SR6B 3A4UB 5AFPA 1BLQA 1OE9B 1OQPA 2KSPA 3OHMB 1OMRA 2JZIA 2L98A 3I5HC 2KAXA 1K2HA 2M7LA 2DOQA 2WCMA 1QVIY 4M2QA 4WRIA 1NUBA 1DQEA 3LCPC 1N65A 1YX7A 2Y1MA 2BL0C 1CTRA 3AKBA 2CNPA 3CLNA 1L7ZA 3DZTA 1JSAA 2KI4C 3I5GB 1RJVA 2BE6A 1S5GY 1TCFA 1J7QA 3EVRA 2BE4A 1IJ5A 5AXIA 2PQLA 1U5IB 3R1VA 2I18A 1F54A 3NXAA 2JRFA 2M8UA 3M0WA 1NX1A 4GFTA 2KPHA 2PASA 1S1EA 3D75A 3FWBA 3OBVA 4JQ0D 4MRYA 3SIBA 1NPQA 5AERA 2LVKA 3FE8A 2L4HA 2SASA 1TCOB 4PHJA 1SBJA 1NX0A 1NP8A 3NSOA 2ERBA 2B1UA 5KSZA 2M9GA 1IIOA 5KU1A 2GTEA 1C3ZA 2BECA 5CSIA 1CKKA 1DGVA 4OVNF 2CTNA 3TS5C 5I94A 3CR4X 4A4CA 3RM1A 5B8IB 3KPXA 1YVLA 2G2BA 1QJTA 1TRFA 3SG6A 1DC1A 3EKHA 3V2LA 1PSBA 3OX5A 3UO9A 3LK0A 2FCEA 5ER4X 2HPSA 3WHTB 1DF0B 3NHIA 1XFUO 2GGMA 2LVJA 1ZMZA 3BUOB 3SG2A 3B7AA 1YRUB 1DF0A 1IH0A 2GGZA 3BUWB 2F3ZA 3K1EA 1PVBA 4PHMA 1NCYA 1K90D 1SCMB 2JXCA 4MLWA 2PALA 4MVFA 1DJXA 5I2LA 1YX8A 2CT9A 1NYAA 3ZNIA 1GGZA 3C1VA 4MEWA 1MXLC 3S0BA 3SS3A 1AK8A 1QVIZ 3I5FC 1SRAA 3IF7A 2L5XB 1DJYA 2KLEA 4I5LB 2CCMA 1TNPA 1YUUA 1KK7Y 2ZKMX
chains in the Genus database with same CATH topology
1C3YA 3CZ0A 2FJYA 3L4LA 2P71A 3N7HA 3FE6A 2H8VA 3DXLA 4INWA 1OOFA 1OOIX 2WCLA 2QEHA 2QEBA 2JPOA 3D77A 4OZDA 3S0FA 2L2CA 3S0EA 3QMEA 3B86A 2QDIA 3D73A 3DY9A 3B6XA 3BFBA 2P70A 3D78A 1OOHA 3BJHA 4F7FA 3FE9A 1TWOA 1XFRA 4FQTA 3S0DA 2WCMA 4JD9A 1DQEA 3R1OA 2WCHA 4PT1A 1LS8A 3CDNA 3DZTA 2WCJA 3CZ1A 1OW4A 3OGNA 3R72A 3VB1A 2QEOA 5EL2A 2PQLA 5DICA 3R1VA 2WC5A 3CABA 3DYEA 1OOGA 1QWVA 2QEVA 2KPHA 3D75A 1T14A 3PJIA 3S0GA 3FE8A 2WC6A 3D74A 3R1PA 3S0AA 3D76A 2ERBA 2GTEA 1C3ZA 3L4AA 3NHTA 3BFAA 3BFHA 3V2LA 3RZSA 1ORGA 3L47A 3NHIA 3B87A 3B7AA 3K1EA 3CYZA 3CZ2A 1GM0A 1P28A 3NGVA 3Q8IA 2WCKA 3S0BA 1TUJA 3B88A 4INXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C3Y A;  3CZ0 A;  2FJY A;  3L4L A;  2P71 A;  3N7H A;  3FE6 A;  2H8V A;  3DXL A;  4INW A;  1OOF A;  1OOI X;  2WCL A;  2QEH A;  2QEB A;  2JPO A;  3D77 A;  4OZD A;  3S0F A;  2L2C A;  3S0E A;  3QME A;  3B86 A;  2QDI A;  3D73 A;  3DY9 A;  3B6X A;  3BFB A;  2P70 A;  3D78 A;  1OOH A;  3BJH A;  4F7F A;  3FE9 A;  1TWO A;  1XFR A;  4FQT A;  3S0D A;  2WCM A;  4JD9 A;  1DQE A;  3R1O A;  2WCH A;  4PT1 A;  1LS8 A;  3CDN A;  3DZT A;  2WCJ A;  3CZ1 A;  1OW4 A;  3OGN A;  3R72 A;  3VB1 A;  2QEO A;  5EL2 A;  2PQL A;  5DIC A;  3R1V A;  2WC5 A;  3CAB A;  3DYE A;  1OOG A;  1QWV A;  2QEV A;  2KPH A;  3D75 A;  1T14 A;  3PJI A;  3S0G A;  3FE8 A;  2WC6 A;  3D74 A;  3R1P A;  3S0A A;  3D76 A;  2ERB A;  2GTE A;  1C3Z A;  3L4A A;  3NHT A;  3BFA A;  3BFH A;  3V2L A;  3RZS A;  1ORG A;  3L47 A;  3NHI A;  3B87 A;  3B7A A;  3K1E A;  3CYZ A;  3CZ2 A;  1GM0 A;  1P28 A;  3NGV A;  3Q8I A;  2WCK A;  3S0B A;  1TUJ A;  3B88 A;  4INX A; 
#chains in the Genus database with same CATH topology
 3FIA A;  2E6W A;  3CZT X;  1MXE A;  2I2R E;  2FJY A;  4N5X A;  1SL9 A;  4GGF C;  1FPW A;  1UHN A;  1OOJ A;  2L2E A;  3I5I B;  1XVJ A;  1S5G Z;  2Y1N A;  3TZ1 A;  1SW8 A;  2KAV A;  3N7H A;  3DXL A;  2JXL A;  1OOI X;  3DVE A;  1H4B A;  1NSH A;  2K61 A;  5D3O A;  2FOT A;  3HCM A;  2WCL A;  2MBX A;  1Y6W A;  1YVH A;  2JPT A;  1NX2 A;  3D0Y B;  3BUN B;  3TDI A;  2PSR A;  4XJK A;  2WOS A;  5J3X A;  3ZWH A;  4DIR A;  3PN7 C;  2PVB A;  1L2O C;  1EG4 A;  3O78 A;  3CR5 X;  2KYF A;  3RLZ A;  1C07 A;  3PAL A;  1W9Z A;  1J55 A;  1UHK A;  3O2P A;  3O6B A;  5JOL A;  4FQO A;  2I94 A;  4MSP A;  1F71 A;  3B6X A;  1CM1 A;  3PAT A;  2P70 A;  2LUC A;  2H61 C;  5KTY A;  1SNL A;  1M63 B;  1ZOT B;  3BJH A;  4YGC B;  4F7F A;  4UPG A;  1FI6 A;  1IRJ A;  2JOJ A;  1JBA A;  4NDB A;  1TOP A;  5CPV A;  1S6J A;  2LP2 A;  3BOW A;  3OX6 A;  1C7V A;  1MUX A;  1DGU A;  1DTL A;  4C0K A;  2KOT A;  1W7J B;  1M31 A;  3EVU A;  2LLU A;  3I5H B;  1S3P A;  1J1D A;  1ALV A;  2Y4Q A;  3DVJ A;  5IBW A;  3DF0 B;  1F70 A;  1BT6 A;  1X02 A;  2BL0 B;  4CFQ A;  1SYM A;  2KQY A;  1TTX A;  4L9M A;  4XYN A;  1KWO C;  3VGO A;  3TDU A;  2WND A;  4BY5 A;  1J7O A;  2NXQ A;  4DCK A;  1UUR A;  2GV5 A;  5JJG A;  3TUY C;  1BOC A;  1ZAC A;  1K9U A;  4YGD B;  2LVV A;  1B4C A;  3DYE A;  1OOG A;  1YRT B;  1JF0 A;  1QWV A;  3VRR A;  1KK7 Z;  1ODB A;  3JTD C;  3UNW A;  1B9A A;  5CSN A;  1XA5 A;  2K7B A;  3NSI A;  1OSA A;  1KQV A;  3R1P A;  3VRP A;  2COL B;  3SS4 A;  3D76 A;  1AP4 A;  1DJW A;  2AUC A;  3L4A A;  3OB2 B;  2PMY A;  1AJ4 A;  1FW4 A;  1D1O A;  1G4Y R;  2MJW B;  4D1E A;  4FTG A;  2D8N A;  3NHT A;  4M2P A;  2KBM A;  2JNF A;  3BFA A;  3TS5 B;  1KFU S;  4N1F A;  3RZS A;  3BUX B;  3DVK A;  4ORB B;  2BKI B;  2LC5 A;  1SSE B;  4AQI A;  2LE9 B;  2NCP A;  1NIW A;  3BUM B;  4YI8 A;  1KFX S;  1V1G A;  3JVT B;  1DJI A;  2ZRT A;  4PHK A;  3CZ2 A;  1P28 A;  3GK4 X;  2JU0 A;  4AOM A;  1S36 A;  4PE0 A;  1BR4 B;  1EJ3 A;  2M3W A;  1B47 A;  2ZND A;  1OZS A;  3EK7 A;  1UP5 A;  1QLK A;  1FI5 A;  2ZN9 A;  4DS7 A;  2LHI A;  2KFF A;  5D69 A;  1SY9 A;  1RTP 1;  1TUJ A;  4QJ4 B;  2NZ0 A;  2WCE A;  4PDZ A;  1RK9 A;  1A03 A;  3I5F B;  1PK0 D;  3GK1 A;  2L4I A;  2PYQ A;  5FI2 A;  3A8R A;  3CZ0 A;  3CWG A;  3SG4 A;  1CNP A;  1CB1 A;  2M29 A;  1G33 A;  2K2A A;  2Q4U A;  1CDM A;  1BMO A;  5D7F A;  1IQ3 A;  1KQM C;  2BBN A;  4INW A;  4GBA A;  3KO0 A;  2JC2 A;  1PSR A;  1EL4 A;  5DKQ A;  4NDC A;  4MZK A;  4GGF A;  1F55 A;  4IL1 A;  1OZO A;  2JPO A;  2KFH A;  2KFG A;  1CFP A;  3D77 A;  4OZD A;  3VRQ A;  3S0F A;  1KCY A;  3HX4 A;  3BXK A;  3VRO A;  2LP3 A;  2BCB A;  1EXR A;  1QS7 A;  4TNC A;  1K94 A;  1QV0 A;  2FJU B;  2QDI A;  2K7C A;  4MZL A;  1QLS A;  1WDC C;  3DY9 A;  5AEQ A;  2K8M B;  1XO5 A;  1CDP A;  1XFW O;  2K7O A;  2OS8 B;  1DJG A;  2LMV A;  2LM5 A;  4KYN A;  3K21 A;  1BG1 A;  1MF8 B;  1Y1X A;  3LLE A;  3O4X A;  1OOH A;  3FE9 A;  1TNQ A;  1QX7 A;  1Y1U A;  1JC2 A;  1IG5 A;  2CBL A;  3VRN A;  1K93 D;  1LKJ A;  3PM2 A;  1ZFS A;  1UHH A;  1WRZ A;  2I7A A;  2JT3 A;  2OTG B;  4OV2 A;  4YGE B;  5FI7 A;  1SK6 D;  2H61 A;  4FQT A;  5HLV A;  2ISD A;  1B1G A;  4JD9 A;  3ICB A;  4MZJ A;  4DRW A;  4XJK B;  1QTX A;  4M2O A;  1Z4H A;  3KF9 A;  4MRX A;  1TNX A;  1K9P A;  3KEV A;  4PT1 A;  1LS8 A;  3CDN A;  1XFX O;  1QX5 B;  2WC8 A;  3F45 A;  1LA3 A;  2JT8 A;  3PFV A;  3CZ1 A;  2EGD A;  3KHE A;  2LMT A;  4I5N B;  4YGA A;  3FS7 A;  4CLN A;  3H4S E;  3R72 A;  3VB1 A;  1S26 D;  1IQ5 A;  2O60 A;  5ER5 A;  2F2P A;  2WCF A;  4PE1 A;  3AAK A;  3EG5 B;  4GGN A;  3TDZ A;  5CSF A;  1YUR A;  2K7D A;  3BOW B;  1SCM C;  1SL7 A;  4P2Y B;  3TUY B;  1MWN A;  2MLE C;  4GUK A;  1EH2 A;  4E68 A;  2JQ6 A;  1T14 A;  4GAO A;  3S0G A;  1IWQ A;  4PE4 A;  2WC6 A;  2MHH A;  1J7P A;  1ZUZ A;  3D74 A;  3SG3 A;  3JTD B;  3E3R A;  3S0A A;  1ALW A;  2FCD A;  3WNX B;  1DMO A;  3LL8 B;  4ZCV A;  3SG5 A;  3O4Y A;  2AMI A;  2JNX A;  1B7T Y;  3IQO A;  4WQ3 A;  1M45 A;  1R6P A;  1KK8 C;  3AKA A;  4DUQ A;  2LAP A;  3PLF B;  1PUL A;  2KI4 B;  5AAN A;  5HYD A;  3D10 A;  1K9K A;  2MRD A;  2KGR A;  4MBE A;  1BJF A;  2F33 A;  5DKR A;  5FYX A;  1HT9 A;  1QIW A;  4YBH B;  5CSJ A;  3IQQ A;  1XFZ O;  2NLN A;  4OCI A;  2M1K B;  1R2U A;  2KI6 D;  3CYZ A;  3AAJ A;  1OMD A;  1G8I A;  2H2K A;  3NGV A;  1F4O A;  2M7N A;  1J7R A;  4OR9 B;  2YGU A;  2WCK A;  1CLL A;  1DVI A;  4R1E A;  4IJ7 A;  1AHR A;  3CGA A;  3NSL A;  4CPV A;  1YTZ C;  4HRE E;  2EC6 C;  1UHJ A;  2TN4 A;  1IJ6 A;  3B88 A;  1NWD A;  1N2D A;  1AVS A;  4INX A;  1JFJ A;  1NX3 A;  1WY9 A;  1A75 A;  1C3Y A;  1XFV O;  2BCA A;  2BNX A;  2KI6 C;  2VRG A;  2MAZ A;  3L4L A;  1PRW A;  1SKT A;  2LVI A;  5TNC A;  2KYC A;  1OMV A;  1CFD A;  3FE6 A;  1Z2C B;  1B8L A;  1M39 A;  4U8D A;  1DJZ A;  1KQM B;  2KAY A;  1UUS A;  2QEB A;  1XK4 C;  3DD4 A;  5G08 A;  5F6T A;  3EK8 A;  3EVV A;  3BYA A;  3BQ3 A;  1UWO A;  1GJY A;  2QAC A;  2LV7 A;  2L2C A;  2JT0 A;  3OP0 A;  3S0E A;  1A29 A;  1Y0V H;  2KHN A;  1K8U A;  4JWQ A;  5HKY A;  1JFK A;  3QME A;  3CR2 A;  3D73 A;  4CFR A;  1QIV A;  1EG3 A;  1S6I A;  2HQW A;  1IKU A;  1A4P A;  2NCO A;  4PE7 A;  4NQG A;  2KNE A;  2E30 A;  2K60 A;  1YUT A;  1TIZ A;  2PRU A;  1SR6 C;  1WDC B;  3D78 A;  2L5Y A;  1KSO A;  4YGB B;  1DEL A;  1BR1 B;  1B7T Z;  1TN4 A;  4YRU A;  1KFU L;  1JWD A;  3GK2 A;  1U5I A;  3FWC A;  2LHL A;  2M1U A;  3DVM A;  1QAT A;  1CM4 A;  1XFR A;  1MQ1 A;  2RGI A;  1M46 A;  1REC A;  3OB1 B;  4I5K A;  4ORC B;  3S0D A;  1LIN A;  1A2X A;  1GQM A;  1KFX L;  1PVA A;  3CS1 A;  1DT7 B;  1CDN A;  3R1O A;  2V53 A;  1CLB A;  2WCH A;  3I5G C;  1E8A A;  2LLS A;  4OKH A;  5HKZ A;  1CFF A;  2ZFD A;  1JF2 A;  2MA2 A;  2F8P A;  1W7I B;  2WCJ A;  4PAL A;  2ZRS A;  1OW4 A;  3OGN A;  2KLD A;  2L51 A;  2KDH A;  1CDL A;  4ZCU A;  2P6B B;  4Q04 A;  3PN7 B;  1SCV A;  1L2O B;  1Y1A A;  4I5J A;  1SL8 A;  2JUL A;  2QEO A;  1H8B A;  2BBM A;  5EL2 A;  4CID A;  2IS9 A;  1B8R A;  5DIC A;  4GNK B;  3JVT C;  1LA0 A;  2WC5 A;  3CAB A;  1YR5 A;  1CMG A;  1MR8 A;  2JWW A;  4ETO A;  2QEV A;  2L0P A;  3PJI A;  4MN0 A;  2A4J A;  2SCP A;  5HKW A;  2BKH B;  1NCZ A;  2KGB C;  4JPZ B;  4HRH A;  5HL1 A;  1F8H A;  3WHU B;  2K0J A;  2CXJ A;  1SMG A;  2L50 A;  1SPY A;  4C0L A;  1V1F A;  2WCB A;  5K89 A;  4NDD A;  1S6C A;  1N0Y A;  2LNK A;  1MHO A;  1YUS A;  3EKJ A;  3IVT A;  1HQV A;  4JKT A;  4N1G A;  4A4B A;  4ICB A;  3NSK A;  1DEK A;  3BFH A;  2HET A;  3SS5 A;  5GQQ C;  4ORA B;  5I2O A;  1B8C A;  1ORG A;  1RRO A;  2MLF C;  1BOD A;  1AJ5 A;  3L47 A;  1KWO B;  1KK8 B;  4F0Z B;  4BY4 A;  3PM8 A;  3B87 A;  2O5G A;  3LK1 A;  5I8N A;  1KSM A;  2M0R A;  1LXF C;  3MSE B;  4P5O E;  5HLO A;  4PCW A;  1IGV A;  1C7W A;  2Y5I A;  1BF5 A;  1QV1 A;  2F3Y A;  1GM0 A;  1NCX A;  1TUZ A;  1TNW A;  2ZN8 A;  1FF1 A;  4WQ2 A;  3Q8I A;  1PAL A;  1RFJ A;  1JUO A;  1FBV A;  5DKN A;  3SJS A;  3WXA A;  5BPJ A;  3D0Y A;  1XFY O;  2WOR A;  2BCX A;  2OS8 C;  2LUX A;  3CTN A;  2QPT A;  1QXP A;  5FI6 A;  1Q80 A;  4GPL B;  2HQ8 A;  1VRK A;  1DJH A;  1BU3 A;  2OPO A;  2AAO A;  1AUI B;  3I5I C;  1QX2 A;  1WRL A;  2EC6 B;  4QJ5 B;  1WRK A;  3SG7 A;  2G9B A;  2OTG C;  3QRX A;  1J1E A;  1F4Q A;  2P71 A;  2R2I A;  1UHI A;  2H8V A;  1QAS A;  3GOF A;  4HSZ A;  1OOF A;  1RWY A;  2ZNE A;  2LAN A;  4QJ3 B;  1WLZ A;  4HRG A;  2EHB A;  2QEH A;  1CFC A;  1XYD A;  2M97 A;  3EK4 A;  4USL A;  2K2F A;  1CLM A;  4YI9 A;  2F2O A;  4AQJ A;  2LMU A;  1LVC D;  2LLT A;  3B86 A;  2LCP A;  1GGW A;  2HF5 A;  3DF0 A;  1CMF A;  1XK4 A;  1A75 B;  1K95 A;  5I2Q A;  4C0J A;  5PAL A;  2KQ6 A;  3PSR A;  4PHN A;  3BFB A;  1K96 A;  2Q91 A;  3SIA A;  2M49 B;  2BAP A;  2KBI A;  2JTZ A;  2JTT A;  1WLM A;  1TWO A;  1SR6 B;  3A4U B;  5AFP A;  1BLQ A;  1OE9 B;  1OQP A;  2KSP A;  3OHM B;  1OMR A;  2JZI A;  2L98 A;  3I5H C;  2KAX A;  1K2H A;  2M7L A;  2DOQ A;  2WCM A;  1QVI Y;  4M2Q A;  4WRI A;  1NUB A;  1DQE A;  3LCP C;  1N65 A;  1YX7 A;  2Y1M A;  2BL0 C;  1CTR A;  3AKB A;  2CNP A;  3CLN A;  1L7Z A;  3DZT A;  1JSA A;  2KI4 C;  3I5G B;  1RJV A;  2BE6 A;  1S5G Y;  1TCF A;  1J7Q A;  3EVR A;  2BE4 A;  1IJ5 A;  5AXI A;  2PQL A;  1U5I B;  3R1V A;  2I18 A;  1F54 A;  3NXA A;  2JRF A;  2M8U A;  3M0W A;  1NX1 A;  4GFT A;  2KPH A;  2PAS A;  1S1E A;  3D75 A;  3FWB A;  3OBV A;  4JQ0 D;  4MRY A;  3SIB A;  1NPQ A;  5AER A;  2LVK A;  3FE8 A;  2L4H A;  2SAS A;  1TCO B;  4PHJ A;  1SBJ A;  1NX0 A;  1NP8 A;  3NSO A;  2ERB A;  2B1U A;  5KSZ A;  2M9G A;  1IIO A;  5KU1 A;  2GTE A;  1C3Z A;  2BEC A;  5CSI A;  1CKK A;  1DGV A;  4OVN F;  2CTN A;  3TS5 C;  5I94 A;  3CR4 X;  4A4C A;  3RM1 A;  5B8I B;  3KPX A;  1YVL A;  2G2B A;  1QJT A;  1TRF A;  3SG6 A;  1DC1 A;  3EKH A;  3V2L A;  1PSB A;  3OX5 A;  3UO9 A;  3LK0 A;  2FCE A;  5ER4 X;  2HPS A;  3WHT B;  1DF0 B;  3NHI A;  1XFU O;  2GGM A;  2LVJ A;  1ZMZ A;  3BUO B;  3SG2 A;  3B7A A;  1YRU B;  1DF0 A;  1IH0 A;  2GGZ A;  3BUW B;  2F3Z A;  3K1E A;  1PVB A;  4PHM A;  1NCY A;  1K90 D;  1SCM B;  2JXC A;  4MLW A;  2PAL A;  4MVF A;  1DJX A;  5I2L A;  1YX8 A;  2CT9 A;  1NYA A;  3ZNI A;  1GGZ A;  3C1V A;  4MEW A;  1MXL C;  3S0B A;  3SS3 A;  1AK8 A;  1QVI Z;  3I5F C;  1SRA A;  3IF7 A;  2L5X B;  1DJY A;  2KLE A;  4I5L B;  2CCM A;  1TNP A;  1YUU A;  1KK7 Y;  2ZKM X; 
#chains in the Genus database with same CATH homology
 1C3Y A;  3CZ0 A;  2FJY A;  3L4L A;  2P71 A;  3N7H A;  3FE6 A;  2H8V A;  3DXL A;  4INW A;  1OOF A;  1OOI X;  2WCL A;  2QEH A;  2QEB A;  2JPO A;  3D77 A;  4OZD A;  3S0F A;  2L2C A;  3S0E A;  3QME A;  3B86 A;  2QDI A;  3D73 A;  3DY9 A;  3B6X A;  3BFB A;  2P70 A;  3D78 A;  1OOH A;  3BJH A;  4F7F A;  3FE9 A;  1TWO A;  1XFR A;  4FQT A;  3S0D A;  2WCM A;  4JD9 A;  1DQE A;  3R1O A;  2WCH A;  4PT1 A;  1LS8 A;  3CDN A;  3DZT A;  2WCJ A;  3CZ1 A;  1OW4 A;  3OGN A;  3R72 A;  3VB1 A;  2QEO A;  5EL2 A;  2PQL A;  5DIC A;  3R1V A;  2WC5 A;  3CAB A;  3DYE A;  1OOG A;  1QWV A;  2QEV A;  2KPH A;  3D75 A;  1T14 A;  3PJI A;  3S0G A;  3FE8 A;  2WC6 A;  3D74 A;  3R1P A;  3S0A A;  3D76 A;  2ERB A;  2GTE A;  1C3Z A;  3L4A A;  3NHT A;  3BFA A;  3BFH A;  3V2L A;  3RZS A;  1ORG A;  3L47 A;  3NHI A;  3B87 A;  3B7A A;  3K1E A;  3CYZ A;  3CZ2 A;  1GM0 A;  1P28 A;  3NGV A;  3Q8I A;  2WCK A;  3S0B A;  1TUJ A;  3B88 A;  4INX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...