2KQYA

Solution structure of avian thymic hormone
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
108
structure length
108
Chain Sequence
AITDILSAKDIESALSSCQAADSFNYKSFFSTVGLSSKTPDQIKKVFGILDQDKSGFIEEEELQLFLKNFSSSARVLTSAETKAFLAAGDTDGDGKIGVEEFQSLVKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Parvalbumin, thymic
publication title Structure of Avian Thymic Hormone, a High-Affinity Avian beta-Parvalbumin, in the Ca(2+)-Free and Ca(2+)-Bound States.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Metal binding protein
total genus 16
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2009-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2kqyA00
1M45A 1G8IA 1Y1AA 2LMVA 5F6TA 1X02A 1G4YR 3GK4X 4I5KA 1RFJA 1CDLA 1QASA 1S1EA 1J7PA 1N2DA 1EG3A 2E30A 3NSOA 1NX3A 1SNLA 3CR5X 3TUYB 5HKWA 1BF5A 1LKJA 1N0YA 3LLEA 3PLFB 2JU0A 2BL0C 2KYFA 5JJGA 1LVCD 2F2OA 1RJVA 1JSAA 1YX8A 1SCMB 3DVEA 5D69A 2HETA 4N5XA 2SCPA 1YRUB 1HQVA 1OQPA 1YR5A 1ZACA 3JTDC 1MXLC 2HPSA 3NSKA 3HCMA 4N1GA 3TS5C 2LP3A 2PVBA 4OCIA 2CXJA 4CFQA 2BCXA 3AAKA 4FTGA 1TOPA 2COLB 1QIVA 1ODBA 1OMRA 1K9PA 1SW8A 1XK4C 2LHIA 3D0YB 4BY4A 3BOWA 2KQYA 5ER4X 4PHKA 2M29A 3TDUA 3PN7B 2L50A 1QV1A 1TNPA 2PRUA 1QIWA 5ER5A 3OP0A 1IQ3A 2QPTA 4XJKA 1A29A 1UUSA 1ALVA 1A03A 1UHIA 2MLFC 1BMOA 1A75A 4Q04A 3IF7A 5AFPA 2KFGA 1K9KA 1SRAA 1TIZA 3M0WA 2KYCA 4PE0A 1J7RA 1B7TZ 3NSIA 1PSRA 4USLA 5D7FA 2F8PA 4GGFA 2LMUA 2CNPA 1SR6B 2LMTA 1SL8A 2AMIA 3ICBA 2JTZA 3FS7A 2BBNA 3EK7A 1WDCB 3EK4A 2LCPA 1QLSA 2K0JA 2R2IA 3QRXA 4DS7A 2SASA 3KHEA 1FI5A 5HKYA 1V1GA 1KK7Z 1NYAA 3FWCA 1F71A 2I2RE 1L2OC 4ICBA 1KK7Y 2KQ6A 2L0PA 5DKRA 5B8IB 1QXPA 3I5HB 1IQ5A 1XK4A 2TN4A 2FCDA 1ALWA 3I5FC 1TNQA 1XYDA 1ZMZA 4HRHA 3O2PA 4WQ2A 1M46A 2CTNA 2G2BA 4PHNA 1JUOA 2L4IA 2MAZA 3TDIA 1K90D 1CTRA 3BXKA 3OX5A 3NXAA 1J55A 4DUQA 1NCZA 4M2OA 1IJ6A 3DVKA 3GOFA 1WLMA 3CS1A 1J1DA 3H4SE 4U8DA 1NPQA 2PASA 1B47A 1PVBA 1BR4B 1JC2A 1JFKA 4PE4A 1E8AA 2MBXA 2WCBA 3KO0A 1B9AA 2JTTA 1UURA 4ORAB 1MF8B 4OVNF 2K8MB 2LV7A 1YTZC 5TNCA 4TNCA 2VRGA 2M8UA 2KFFA 1U5IB 1TN4A 2KI6D 4R1EA 3VGOA 2FOTA 1BJFA 3DVJA 4XJKB 4HREE 1AJ5A 1F8HA 1QTXA 1A75B 1AHRA 2P6BB 1SY9A 3PM8A 3AAJA 1A4PA 3NSLA 2L51A 2ZKMX 3HX4A 1WY9A 2LUXA 4WQ3A 1YURA 3SG2A 1JF2A 2KNEA 5GQQC 1KFXS 4I5JA 2BECA 1G33A 1MQ1A 2JPTA 1NCXA 1SL7A 1J1EA 2B1UA 3RM1A 1BT6A 1TRFA 1M63B 1H8BA 2F33A 1VRKA 5AXIA 3PSRA 5I2OA 1LA3A 4GAOA 3JTDB 2FJUB 1XFYO 2ZN9A 1BU3A 3JVTC 3SG5A 3OB1B 3BUOB 2BE6A 1EL4A 1QVIZ 4MRYA 5HLOA 1TNXA 1QVIY 1DJXA 1CLBA 4YGBB 1QS7A 1M31A 3K21A 4FQOA 2AUCA 1S6IA 2BKIB 1FPWA 1DGVA 1PVAA 2ZNEA 1Y0VH 3D10A 2NLNA 2E6WA 4OR9B 4ETOA 2V53A 1CFCA 3CGAA 1CDNA 5J3XA 2ZNDA 3SJSA 1L7ZA 2BCAA 2KGBC 3IQQA 2KBIA 1J7QA 1KFUS 2F3ZA 3LL8B 2KSPA 3SG6A 5HKZA 4GFTA 2LVVA 2LVJA 4E68A 1KQMC 1BG1A 4C0LA 2WOSA 4QJ3B 4GPLB 4XYNA 2M7LA 1WRKA 4GUKA 4QJ5B 3C1VA 1F4QA 1DJYA 1K8UA 1EJ3A 3EVRA 4P2YB 2M0RA 3DF0A 4I5LB 4UPGA 1SCVA 3KF9A 5AERA 2KAYA 2ZRTA 2L4HA 1B8LA 3I5FB 4YGCB 1WRLA 1MWNA 2JT8A 1OE9B 1PK0D 2LC5A 3SG3A 3AKBA 1M39A 1U5IA 1IRJA 2WC8A 1MXEA 4IL1A 2OS8C 2GGMA 1JBAA 1B1GA 2CCMA 4D1EA 1NCYA 1KQVA 1B8CA 2I7AA 4N1FA 4YGAA 4GBAA 1K95A 1KK8C 1JF0A 4PALA 5CPVA 4JPZB 1OMVA 4HRGA 4YI9A 4GGNA 2I18A 4P5OE 1IJ5A 1NSHA 2JOJA 2KFHA 2PALA 1MUXA 1DJIA 3MSEB 3CTNA 1PULA 4M2QA 1Y1XA 3VRQA 1YUSA 2M1UA 2JWWA 1WRZA 2LVKA 3SG7A 1Q80A 1H4BA 2M97A 3A8RA 1OSAA 1NP8A 4MSPA 1QX7A 1CNPA 2JRFA 1KWOC 2Q4UA 5I2QA 2F3YA 1K96A 2LHLA 4CPVA 5KU1A 2KDHA 1B8RA 2LLTA 2M1KB 4YBHB 4C0JA 5I8NA 1SCMC 1TCOB 3VROA 4YGEB 1F54A 3OB2B 2JZIA 4QJ4B 2MLEC 1KFXL 2MRDA 1QLKA 3DF0B 1FW4A 1MHOA 3BQ3A 4MRXA 2LM5A 3WXAA 2JT0A 4ORCB 3OHMB 2JNXA 3EVVA 2KI6C 4MVFA 2JXLA 2WNDA 2JC2A 1BODA 1NIWA 1RECA 1AUIB 2Y5IA 1RTP1 3SIAA 1FBVA 4OKHA 1KCYA 3SG4A 4NQGA 4A4BA 4JWQA 2M3WA 3FWBA 1CLMA 3CWGA 2M49B 2LAPA 3BUNB 4BY5A 3CLNA 1DF0A 4CLNA 1UHHA 3BYAA 3WHTB 3LK1A 2BL0B 5CSFA 1EXRA 1LA0A 2I94A 1KQMB 2HF5A 1GGZA 2L98A 3TZ1A 1C07A 1TCFA 5JOLA 4DRWA 1SR6C 2LANA 4MEWA 5KTYA 3OX6A 1SKTA 2NZ0A 5CSIA 3TS5B 1CDMA 1KFUL 1OZOA 4AQIA 1XVJA 1SBJA 4I5NB 1S26D 2Q91A 2WCFA 4YI8A 3WNXB 1UWOA 5IBWA 1MR8A 1F55A 1XFVO 2KGRA 1S5GZ 3I5HC 4ZCUA 1SK6D 4PE1A 1S5GY 1NX2A 1S3PA 2K61A 2NCPA 2Y1MA 1IKUA 2JULA 2OS8B 1UHJA 1XO5A 1YVHA 3I5IC 5PALA 2EC6C 3AKAA 1IWQA 1ZUZA 2PSRA 4NDBA 3I5GC 1ZFSA 1XA5A 3GK1A 4M2PA 3BUMB 1QATA 4L9MA 2JQ6A 4WRIA 4DIRA 1CM4A 2LVIA 2JXCA 1W7JB 1K9UA 5CSNA 3O78A 3DD4A 1CMGA 4ORBB 1K94A 3GK2A 1B4CA 4PHJA 1XFWO 2L5XB 1W7IB 1CM1A 2H2KA 3O6BA 2KI4C 1BLQA 1JWDA 1C7WA 1L2OB 2OTGC 4CIDA 2M9GA 5AANA 3VRRA 5HLVA 2O60A 3EK8A 3LK0A 1CLLA 2ZFDA 3E3RA 3ZWHA 1AVSA 1CMFA 1K2HA 1KWOB 3ZNIA 1DF0B 2GGZA 1A2XA 3EVUA 2K2AA 2MJWB 4MBEA 2IS9A 3EKHA 5BPJA 3O4YA 4GGFC 2HQ8A 2O5GA 4A4CA 3CZTX 2JT3A 2H61C 2CBLA 2EGDA 4AOMA 1LXFC 5DKQA 4ZCVA 4PE7A 2RGIA 2Y1NA 3VRPA 2NXQA 4GNKB 1QX5B 2MHHA 3FIAA 2KHNA 5HYDA 1XFUO 2MA2A 1N65A 4PHMA 1AJ4A 5G08A 3TDZA 2KOTA 2OPOA 1S6JA 4MZKA 1CKKA 1KSOA 1V1FA 2ISDA 1YX7A 1UP5A 1FI6A 2BCBA 1C7VA 2JNFA 1BR1B 1AK8A 5CSJA 1K93D 4CFRA 1NUBA 2LE9B 2EHBA 2LLUA 2K7BA 3IQOA 1IGVA 4NDDA 5KSZA 3SIBA 3TUYC 2KAVA 1R6PA 1B7TY 2LLSA 1BOCA 1QJTA 2M7NA 3RLZA 1PRWA 1GJYA 1QV0A 1S6CA 2H61A 3CR2A 2ZN8A 1CB1A 1GGWA 1IH0A 3JVTB 1NX1A 2ZRSA 3BUXB 3VRNA 4MN0A 4MZLA 1DMOA 1FF1A 1GQMA 4F0ZB 3EKJA 2QACA 1YUUA 3BUWB 2WORA 2LNKA 1YVLA 4PDZA 1UHKA 5FYXA 2BBMA 1DGUA 4MZJA 3PN7C 1DJWA 5K89A 1DVIA 1J7OA 1PSBA 1YRTB 4MLWA 5I2LA 3I5IB 1TNWA 2EC6B 1TTXA 1Y1UA 1OOJA 4NDCA 1HT9A 2WCEA 3I5GB 2KAXA 1UHNA 1DJZA 4AQJA 2LP2A 2KBMA 1NX0A 3PALA 2Y4QA 1IG5A 1YUTA 1DJHA 3BOWB 3DVMA 2L2EA 1RROA 2F2PA 1OMDA 1CFPA 1JFJA 1F4OA 4OV2A 1LINA 1WDCC 2KI4B 2PMYA 1SL9A 2OTGB 4PCWA 2BKHB 2A4JA 2NCOA 3KPXA 5DKNA 3PATA 1RK9A 1Y6WA 4YGDB 1PALA 1D1OA 2DOQA 2D8NA 1WLZA 2LUCA 2HQWA 1ZOTB 3D0YA 1RWYA 1DJGA 2K7OA 4C0KA 1DT7B 1KSMA 1SYMA 3CR4X 1R2UA 1CFDA 4HSZA 1OZSA 3F45A 1F70A 2BE4A 2K2FA 1AP4A 1KK8B 1CFFA 1SMGA 1NWDA 2K7CA 1XFZO 3A4UB 1QX2A 3KEVA 1CDPA 1XFXO 1EH2A 2G9BA 4YRUA 4JQ0D 4DCKA 3WHUB 2FCEA 2GV5A 1DTLA 5AEQA 2CT9A 2K7DA 3PFVA 1SPYA 1EG4A 1S36A 2AAOA 3LCPC
chains in the Genus database with same CATH superfamily
1M45A 1G8IA 1Y1AA 2LMVA 5F6TA 1X02A 1G4YR 3GK4X 4I5KA 1RFJA 1CDLA 1QASA 1S1EA 1J7PA 1N2DA 1EG3A 2E30A 3NSOA 1NX3A 1SNLA 3CR5X 3TUYB 3VB1A 5HKWA 1BF5A 1LKJA 1N0YA 3LLEA 3PLFB 2JU0A 2BL0C 2KYFA 5JJGA 1LVCD 2F2OA 1RJVA 1JSAA 2QDIA 1YX8A 1SCMB 1OOHA 3DVEA 5D69A 2HETA 4N5XA 2SCPA 1YRUB 1HQVA 1OQPA 1YR5A 2JPOA 1ZACA 3JTDC 1MXLC 2HPSA 1DQEA 3HCMA 3NSKA 4N1GA 3TS5C 2LP3A 2QEOA 2PVBA 3DZTA 4OCIA 2CXJA 4CFQA 2BCXA 3AAKA 4FTGA 1TOPA 2COLB 1QIVA 1ODBA 1ORGA 1OMRA 1K9PA 1SW8A 1XK4C 2LHIA 3K1EA 3D0YB 4BY4A 3RZSA 3BOWA 2KQYA 5ER4X 4PHKA 2M29A 3TDUA 3PN7B 2L50A 1QV1A 1TNPA 2PRUA 1QIWA 5DKNA 3OP0A 5ER5A 1IQ3A 3S0GA 2QPTA 4XJKA 1A29A 1UUSA 1ALVA 3S0EA 1UHIA 2MLFC 1BMOA 1A75A 4Q04A 1A03A 3IF7A 3L4LA 5AFPA 2KFGA 1K9KA 1SRAA 1TIZA 3B86A 3M0WA 2KYCA 4PE0A 1J7RA 1B7TZ 4KYNA 3NSIA 1PSRA 4USLA 4INXA 5D7FA 2F8PA 4GGFA 5FI2A 2KLDA 2LMUA 2CNPA 1SR6B 2LMTA 1SL8A 2AMIA 3OBVA 3ICBA 2JTZA 3FS7A 1IIOA 2BBNA 3EK7A 1WDCB 3EK4A 2LCPA 1QLSA 2K0JA 2R2IA 3DY9A 3QRXA 2SASA 3KHEA 4DS7A 5HKYA 1V1GA 1KK7Z 1NYAA 3FWCA 1F71A 2I2RE 1L2OC 4ICBA 1KK7Y 2KQ6A 2L0PA 5DKRA 5B8IB 1QXPA 3B87A 1IQ5A 3I5HB 1XK4A 2TN4A 2FCDA 1ALWA 3I5FC 1TNQA 1XYDA 1ZMZA 4HRHA 3O2PA 4WQ2A 1M46A 2CTNA 3S0DA 2G2BA 4PHNA 1JUOA 2L4IA 2MAZA 3TDIA 1K90D 1CTRA 3BXKA 3OX5A 3NXAA 1J55A 4DUQA 1NCZA 4M2OA 2FJYA 1IJ6A 3DVKA 3GOFA 1WLMA 3CS1A 1J1DA 3H4SE 4U8DA 1NPQA 2PASA 1B47A 1PVBA 1BR4B 1JC2A 1JFKA 4PE4A 1E8AA 2MBXA 3SS3A 2WCBA 3KO0A 1B9AA 2JTTA 1UURA 4ORAB 1MF8B 4OVNF 2K8MB 2LV7A 1YTZC 2WC6A 2WCJA 4FQTA 4TNCA 5TNCA 1GM0A 1TWOA 2M8UA 2KFFA 2GTEA 2VRGA 1U5IB 1P28A 2KI6D 4R1EA 3VGOA 2FOTA 1BJFA 3DVJA 4XJKB 4HREE 1AJ5A 1F8HA 1QTXA 1A75B 1AHRA 3DYEA 2P6BB 1SY9A 3PM8A 3AAJA 1A4PA 3NSLA 2L51A 2ZKMX 3HX4A 1WY9A 2LUXA 4WQ3A 1YURA 3SG2A 1JF2A 3UNWA 2KNEA 2WCLA 3R1VA 5GQQC 1KFXS 4I5JA 2BECA 1G33A 1MQ1A 2JPTA 1NCXA 1SL7A 1J1EA 2B1UA 3RM1A 1BT6A 1TRFA 1M63B 1H8BA 3S0FA 2F33A 1VRKA 5AXIA 3PSRA 5I2OA 1LA3A 4GAOA 3JTDB 2FJUB 1XFYO 2L2CA 2ZN9A 1BU3A 3JVTC 3SG5A 3OB1B 3BUOB 2BE6A 1EL4A 1QVIZ 4MRYA 5HLOA 1TNXA 1C3ZA 1QVIY 1DJXA 1CLBA 4YGBB 1QS7A 1M31A 3K21A 4FQOA 4IJ7A 2AUCA 1S6IA 2BKIB 1FPWA 1DGVA 1PVAA 2ZNEA 1Y0VH 3D10A 2NLNA 2E6WA 4OR9B 4ETOA 2V53A 1CFCA 3CGAA 3S0BA 1CDNA 2BNXA 5J3XA 2ZNDA 3SJSA 1L7ZA 2BCAA 2KGBC 3IQQA 2KBIA 1J7QA 1KFUS 2F3ZA 3LL8B 2QEHA 2KSPA 3SG6A 5HKZA 4GFTA 2LVVA 2LVJA 4E68A 1KQMC 1BG1A 4C0LA 2WOSA 4QJ3B 4GPLB 2H8VA 3D74A 4XYNA 1OW4A 2M7LA 1WRKA 4GUKA 4QJ5B 3C1VA 1F4QA 1DJYA 1K8UA 1EJ3A 3EVRA 4P2YB 2M0RA 3DF0A 4I5LB 4UPGA 1SCVA 3KF9A 5AERA 3NGVA 3R1PA 2KAYA 2WCMA 2ZRTA 2L4HA 1B8LA 3I5FB 4YGCB 1WRLA 1MWNA 2JT8A 1OE9B 1PK0D 2LC5A 3SG3A 3CDNA 3AKBA 1M39A 1U5IA 1IRJA 2WC8A 1MXEA 4IL1A 2OS8C 2GGMA 1JBAA 1B1GA 2CCMA 4D1EA 1NCYA 1KQVA 1B8CA 2I7AA 4N1FA 4YGAA 4GBAA 1K95A 1KK8C 1JF0A 4PALA 5CPVA 3S0AA 4JPZB 1OMVA 4HRGA 4YI9A 1XFRA 4GGNA 2I18A 3FE6A 4P5OE 1IJ5A 1NSHA 2JOJA 2KFHA 2PALA 1MUXA 1DJIA 3MSEB 3CTNA 1PULA 3D73A 4M2QA 5DICA 1Y1XA 2WCHA 3VRQA 1YUSA 2M1UA 2JWWA 1WRZA 2LVKA 3SG7A 1Q80A 1H4BA 2M97A 3A8RA 1OSAA 1NP8A 4MSPA 1QX7A 1CNPA 2JRFA 1KWOC 2Q4UA 2WCKA 1TUZA 3QMEA 5I2QA 2F3YA 2P71A 1K96A 2LHLA 4CPVA 3DXLA 5KU1A 2KDHA 1B8RA 2LLTA 2M1KB 4YBHB 4C0JA 5I8NA 1SCMC 1TCOB 3VROA 4YGEB 1F54A 3OB2B 2JZIA 4QJ4B 2MLEC 1KFXL 2MRDA 1QLKA 3DF0B 1FW4A 3FE8A 1MHOA 3BQ3A 4MRXA 2K60A 2LM5A 3WXAA 2JT0A 4ORCB 3OHMB 2JNXA 3EVVA 1SSEB 2KI6C 2KLEA 4MVFA 2JXLA 2WNDA 2JC2A 1BODA 1NIWA 1RECA 3BFAA 3D78A 1AUIB 2Y5IA 1RTP1 3SIAA 1FBVA 4OKHA 1KCYA 3SG4A 4NQGA 3PM2A 4A4BA 4JWQA 2M3WA 3FWBA 1D1OA 1CLMA 3CWGA 3O4XA 2M49B 2LAPA 3BUNB 4BY5A 3CLNA 1DF0A 4CLNA 3IVTA 1UHHA 3BYAA 4JD9A 3WHTB 4CIDA 3LK1A 2BL0B 5CSFA 1EXRA 1LA0A 2I94A 1KQMB 2HF5A 3B88A 1GGZA 2L98A 3TZ1A 4INWA 1TCFA 5JOLA 4DRWA 1SR6C 1C07A 2LANA 4MEWA 5KTYA 3OX6A 1SKTA 2NZ0A 5CSIA 3TS5B 1CDMA 1KFUL 1OZOA 4AQIA 1XVJA 1DC1A 1SBJA 4I5NB 1S26D 2Q91A 2WCFA 4YI8A 3WNXB 1UWOA 5IBWA 1MR8A 1F55A 1XFVO 3PJIA 2KGRA 1S5GZ 3I5HC 4ZCUA 1SK6D 1T14A 4PE1A 1S5GY 5D3OA 1NX2A 3N7HA 1S3PA 2K61A 2NCPA 2Y1MA 1IKUA 2JULA 2OS8B 3B6XA 1UHJA 1XO5A 1FI5A 1OOIX 3SS5A 1YVHA 3I5IC 5PALA 2EC6C 3AKAA 1IWQA 1ZUZA 2PSRA 4NDBA 2ERBA 5HL1A 3I5GC 1ZFSA 1XA5A 3CABA 3GK1A 4M2PA 3BUMB 1QATA 4L9MA 2JQ6A 4WRIA 4DIRA 1CM4A 2LVIA 2JXCA 1W7JB 1K9UA 3SS4A 5CSNA 3O78A 3DD4A 1CMGA 4ORBB 1K94A 3GK2A 1B4CA 4PHJA 1XFWO 2L5XB 1W7IB 1CM1A 2H2KA 3O6BA 2KI4C 1BLQA 1JWDA 1C7WA 1L2OB 2OTGC 4PT1A 2M9GA 5AANA 3VRRA 5HLVA 2O60A 3EK8A 3LK0A 1CLLA 2ZFDA 3E3RA 3ZWHA 1AVSA 1CMFA 2PQLA 1K2HA 1KWOB 3ZNIA 1DF0B 2GGZA 1A2XA 3EVUA 2K2AA 2MJWB 4MBEA 2IS9A 3EKHA 5BPJA 3O4YA 3FE9A 4GGFC 2QEVA 2HQ8A 2O5GA 5I94A 1QWVA 4A4CA 3CZTX 2JT3A 2H61C 2CBLA 2EGDA 4AOMA 1LXFC 5DKQA 4ZCVA 3L4AA 4PE7A 2RGIA 2Y1NA 3VRPA 5EL2A 1W9ZA 2NXQA 4GNKB 1QX5B 2BAPA 2MHHA 2KHNA 3FIAA 5HYDA 1XFUO 2MA2A 1N65A 3CYZA 1AJ4A 4PHMA 3R72A 2KOTA 2OPOA 1S6JA 4MZKA 5G08A 1CKKA 1KSOA 1V1FA 2ISDA 1YX7A 1UP5A 2L5YA 1FI6A 2BCBA 1OOGA 1C7VA 2JNFA 1BR1B 1AK8A 5CSJA 5FI6A 1K93D 3D77A 4CFRA 1NUBA 2LE9B 2EHBA 2LLUA 2K7BA 3IQOA 1IGVA 4NDDA 5KSZA 3SIBA 3TUYC 2KAVA 1DELA 1R6PA 3L47A 1B7TY 2LLSA 1BOCA 1QJTA 3V2LA 2M7NA 3RLZA 1PRWA 1GJYA 2P70A 1QV0A 1S6CA 2H61A 3CR2A 2ZN8A 1CB1A 1GGWA 3UO9A 3CZ1A 1IH0A 3JVTB 1NX1A 2ZRSA 1DEKA 3BUXB 3CZ0A 3VRNA 4MN0A 4MZLA 1DMOA 1FF1A 1GQMA 4F0ZB 3EKJA 2QACA 1YUUA 1Z2CB 3BUWB 2WORA 1C3YA 2LNKA 1YVLA 4PDZA 1UHKA 2QEBA 5FYXA 2BBMA 1DGUA 4MZJA 3PN7C 1DJWA 1Z4HA 5K89A 1DVIA 1J7OA 1PSBA 1YRTB 4MLWA 5I2LA 3I5IB 1TNWA 2EC6B 1TTXA 1TUJA 1Y1UA 1OOJA 3CZ2A 3NHTA 4NDCA 2AAOA 1HT9A 2WCEA 3B7AA 3I5GB 4JKTA 2KAXA 1UHNA 1DJZA 4AQJA 2LP2A 2KBMA 1NX0A 3NHIA 3PALA 2Y4QA 1IG5A 1YUTA 1DJHA 3BOWB 3DVMA 2L2EA 3OGNA 3R1OA 4OZDA 3D76A 1RROA 2F2PA 3TDZA 1OMDA 1CFPA 1JFJA 1F4OA 4OV2A 3BJHA 1LINA 1WDCC 2KI4B 2PMYA 1SL9A 2OTGB 4PCWA 2BKHB 2A4JA 2NCOA 3D75A 3KPXA 3PATA 1RK9A 1Y6WA 4YGDB 1PALA 3BFHA 2DOQA 2D8NA 5FI7A 1WLZA 2LUCA 2HQWA 1ZOTB 3D0YA 1RWYA 1DJGA 2KPHA 2K7OA 4C0KA 1DT7B 1LS8A 1SYMA 1KSMA 3CR4X 1R2UA 1CFDA 2YGUA 1OZSA 3F45A 3Q8IA 4HSZA 1F70A 2BE4A 2K2FA 1AP4A 1KK8B 1CFFA 1SMGA 1NWDA 2K7CA 1XFZO 3A4UB 1QX2A 3KEVA 1CDPA 1XFXO 1OOFA 1EH2A 2G9BA 4YRUA 4JQ0D 3EG5B 4DCKA 2PYQA 3BFBA 3WHUB 2FCEA 2GV5A 1DTLA 5AEQA 2WC5A 2CT9A 2K7DA 4F7FA 3PFVA 1SPYA 1EG4A 1S36A 1TN4A 3LCPC
chains in the Genus database with same CATH topology
1M45A 1G8IA 1Y1AA 2LMVA 5F6TA 1X02A 1G4YR 3GK4X 4I5KA 1RFJA 1CDLA 1QASA 1S1EA 1J7PA 1N2DA 1EG3A 2E30A 3NSOA 1NX3A 1SNLA 3CR5X 3TUYB 5HKWA 1BF5A 1LKJA 1N0YA 3LLEA 3PLFB 2JU0A 2BL0C 2KYFA 5JJGA 1LVCD 2F2OA 1RJVA 1JSAA 1YX8A 1SCMB 3DVEA 5D69A 2HETA 4N5XA 2SCPA 1YRUB 1HQVA 1OQPA 1YR5A 1ZACA 3JTDC 1MXLC 2HPSA 3NSKA 3HCMA 4N1GA 3TS5C 2LP3A 2PVBA 4OCIA 2CXJA 4CFQA 2BCXA 3AAKA 4FTGA 1TOPA 2COLB 1QIVA 1ODBA 1OMRA 1K9PA 1SW8A 1XK4C 2LHIA 3D0YB 4BY4A 3BOWA 2KQYA 5ER4X 4PHKA 2M29A 3TDUA 3PN7B 2L50A 1QV1A 1TNPA 2PRUA 1QIWA 5ER5A 3OP0A 1IQ3A 2QPTA 4XJKA 1A29A 1UUSA 1ALVA 1A03A 1UHIA 2MLFC 1BMOA 1A75A 4Q04A 3IF7A 5AFPA 2KFGA 1K9KA 1SRAA 1TIZA 3M0WA 2KYCA 4PE0A 1J7RA 1B7TZ 3NSIA 1PSRA 4USLA 5D7FA 2F8PA 4GGFA 2LMUA 2CNPA 1SR6B 2LMTA 1SL8A 2AMIA 3ICBA 2JTZA 3FS7A 2BBNA 3EK7A 1WDCB 3EK4A 2LCPA 1QLSA 2K0JA 2R2IA 3QRXA 4DS7A 2SASA 3KHEA 1FI5A 5HKYA 1V1GA 1KK7Z 1NYAA 3FWCA 1F71A 2I2RE 1L2OC 4ICBA 1KK7Y 2KQ6A 2L0PA 5DKRA 5B8IB 1QXPA 3I5HB 1IQ5A 1XK4A 2TN4A 2FCDA 1ALWA 3I5FC 1TNQA 1XYDA 1ZMZA 4HRHA 3O2PA 4WQ2A 1M46A 2CTNA 2G2BA 4PHNA 1JUOA 2L4IA 2MAZA 3TDIA 1K90D 1CTRA 3BXKA 3OX5A 3NXAA 1J55A 4DUQA 1NCZA 4M2OA 1IJ6A 3DVKA 3GOFA 1WLMA 3CS1A 1J1DA 3H4SE 4U8DA 1NPQA 2PASA 1B47A 1PVBA 1BR4B 1JC2A 1JFKA 4PE4A 1E8AA 2MBXA 2WCBA 3KO0A 1B9AA 2JTTA 1UURA 4ORAB 1MF8B 4OVNF 2K8MB 2LV7A 1YTZC 5TNCA 4TNCA 2VRGA 2M8UA 2KFFA 1U5IB 1TN4A 2KI6D 4R1EA 3VGOA 2FOTA 1BJFA 3DVJA 4XJKB 4HREE 1AJ5A 1F8HA 1QTXA 1A75B 1AHRA 2P6BB 1SY9A 3PM8A 3AAJA 1A4PA 3NSLA 2L51A 2ZKMX 3HX4A 1WY9A 2LUXA 4WQ3A 1YURA 3SG2A 1JF2A 2KNEA 5GQQC 1KFXS 4I5JA 2BECA 1G33A 1MQ1A 2JPTA 1NCXA 1SL7A 1J1EA 2B1UA 3RM1A 1BT6A 1TRFA 1M63B 1H8BA 2F33A 1VRKA 5AXIA 3PSRA 5I2OA 1LA3A 4GAOA 3JTDB 2FJUB 1XFYO 2ZN9A 1BU3A 3JVTC 3SG5A 3OB1B 3BUOB 2BE6A 1EL4A 1QVIZ 4MRYA 5HLOA 1TNXA 1QVIY 1DJXA 1CLBA 4YGBB 1QS7A 1M31A 3K21A 4FQOA 2AUCA 1S6IA 2BKIB 1FPWA 1DGVA 1PVAA 2ZNEA 1Y0VH 3D10A 2NLNA 2E6WA 4OR9B 4ETOA 2V53A 1CFCA 3CGAA 1CDNA 5J3XA 2ZNDA 3SJSA 1L7ZA 2BCAA 2KGBC 3IQQA 2KBIA 1J7QA 1KFUS 2F3ZA 3LL8B 2KSPA 3SG6A 5HKZA 4GFTA 2LVVA 2LVJA 4E68A 1KQMC 1BG1A 4C0LA 2WOSA 4QJ3B 4GPLB 4XYNA 2M7LA 1WRKA 4GUKA 4QJ5B 3C1VA 1F4QA 1DJYA 1K8UA 1EJ3A 3EVRA 4P2YB 2M0RA 3DF0A 4I5LB 4UPGA 1SCVA 3KF9A 5AERA 2KAYA 2ZRTA 2L4HA 1B8LA 3I5FB 4YGCB 1WRLA 1MWNA 2JT8A 1OE9B 1PK0D 2LC5A 3SG3A 3AKBA 1M39A 1U5IA 1IRJA 2WC8A 1MXEA 4IL1A 2OS8C 2GGMA 1JBAA 1B1GA 2CCMA 4D1EA 1NCYA 1KQVA 1B8CA 2I7AA 4N1FA 4YGAA 4GBAA 1K95A 1KK8C 1JF0A 4PALA 5CPVA 4JPZB 1OMVA 4HRGA 4YI9A 4GGNA 2I18A 4P5OE 1IJ5A 1NSHA 2JOJA 2KFHA 2PALA 1MUXA 1DJIA 3MSEB 3CTNA 1PULA 4M2QA 1Y1XA 3VRQA 1YUSA 2M1UA 2JWWA 1WRZA 2LVKA 3SG7A 1Q80A 1H4BA 2M97A 3A8RA 1OSAA 1NP8A 4MSPA 1QX7A 1CNPA 2JRFA 1KWOC 2Q4UA 5I2QA 2F3YA 1K96A 2LHLA 4CPVA 5KU1A 2KDHA 1B8RA 2LLTA 2M1KB 4YBHB 4C0JA 5I8NA 1SCMC 1TCOB 3VROA 4YGEB 1F54A 3OB2B 2JZIA 4QJ4B 2MLEC 1KFXL 2MRDA 1QLKA 3DF0B 1FW4A 1MHOA 3BQ3A 4MRXA 2LM5A 3WXAA 2JT0A 4ORCB 3OHMB 2JNXA 3EVVA 2KI6C 4MVFA 2JXLA 2WNDA 2JC2A 1BODA 1NIWA 1RECA 1AUIB 2Y5IA 1RTP1 3SIAA 1FBVA 4OKHA 1KCYA 3SG4A 4NQGA 4A4BA 4JWQA 2M3WA 3FWBA 1CLMA 3CWGA 2M49B 2LAPA 3BUNB 4BY5A 3CLNA 1DF0A 4CLNA 1UHHA 3BYAA 3WHTB 3LK1A 2BL0B 5CSFA 1EXRA 1LA0A 2I94A 1KQMB 2HF5A 1GGZA 2L98A 3TZ1A 1C07A 1TCFA 5JOLA 4DRWA 1SR6C 2LANA 4MEWA 5KTYA 3OX6A 1SKTA 2NZ0A 5CSIA 3TS5B 1CDMA 1KFUL 1OZOA 4AQIA 1XVJA 1SBJA 4I5NB 1S26D 2Q91A 2WCFA 4YI8A 3WNXB 1UWOA 5IBWA 1MR8A 1F55A 1XFVO 2KGRA 1S5GZ 3I5HC 4ZCUA 1SK6D 4PE1A 1S5GY 1NX2A 1S3PA 2K61A 2NCPA 2Y1MA 1IKUA 2JULA 2OS8B 1UHJA 1XO5A 1YVHA 3I5IC 5PALA 2EC6C 3AKAA 1IWQA 1ZUZA 2PSRA 4NDBA 3I5GC 1ZFSA 1XA5A 3GK1A 4M2PA 3BUMB 1QATA 4L9MA 2JQ6A 4WRIA 4DIRA 1CM4A 2LVIA 2JXCA 1W7JB 1K9UA 5CSNA 3O78A 3DD4A 1CMGA 4ORBB 1K94A 3GK2A 1B4CA 4PHJA 1XFWO 2L5XB 1W7IB 1CM1A 2H2KA 3O6BA 2KI4C 1BLQA 1JWDA 1C7WA 1L2OB 2OTGC 4CIDA 2M9GA 5AANA 3VRRA 5HLVA 2O60A 3EK8A 3LK0A 1CLLA 2ZFDA 3E3RA 3ZWHA 1AVSA 1CMFA 1K2HA 1KWOB 3ZNIA 1DF0B 2GGZA 1A2XA 3EVUA 2K2AA 2MJWB 4MBEA 2IS9A 3EKHA 5BPJA 3O4YA 4GGFC 2HQ8A 2O5GA 4A4CA 3CZTX 2JT3A 2H61C 2CBLA 2EGDA 4AOMA 1LXFC 5DKQA 4ZCVA 4PE7A 2RGIA 2Y1NA 3VRPA 2NXQA 4GNKB 1QX5B 2MHHA 3FIAA 2KHNA 5HYDA 1XFUO 2MA2A 1N65A 4PHMA 1AJ4A 5G08A 3TDZA 2KOTA 2OPOA 1S6JA 4MZKA 1CKKA 1KSOA 1V1FA 2ISDA 1YX7A 1UP5A 1FI6A 2BCBA 1C7VA 2JNFA 1BR1B 1AK8A 5CSJA 1K93D 4CFRA 1NUBA 2LE9B 2EHBA 2LLUA 2K7BA 3IQOA 1IGVA 4NDDA 5KSZA 3SIBA 3TUYC 2KAVA 1R6PA 1B7TY 2LLSA 1BOCA 1QJTA 2M7NA 3RLZA 1PRWA 1GJYA 1QV0A 1S6CA 2H61A 3CR2A 2ZN8A 1CB1A 1GGWA 1IH0A 3JVTB 1NX1A 2ZRSA 3BUXB 3VRNA 4MN0A 4MZLA 1DMOA 1FF1A 1GQMA 4F0ZB 3EKJA 2QACA 1YUUA 3BUWB 2WORA 2LNKA 1YVLA 4PDZA 1UHKA 5FYXA 2BBMA 1DGUA 4MZJA 3PN7C 1DJWA 5K89A 1DVIA 1J7OA 1PSBA 1YRTB 4MLWA 5I2LA 3I5IB 1TNWA 2EC6B 1TTXA 1Y1UA 1OOJA 4NDCA 1HT9A 2WCEA 3I5GB 2KAXA 1UHNA 1DJZA 4AQJA 2LP2A 2KBMA 1NX0A 3PALA 2Y4QA 1IG5A 1YUTA 1DJHA 3BOWB 3DVMA 2L2EA 1RROA 2F2PA 1OMDA 1CFPA 1JFJA 1F4OA 4OV2A 1LINA 1WDCC 2KI4B 2PMYA 1SL9A 2OTGB 4PCWA 2BKHB 2A4JA 2NCOA 3KPXA 5DKNA 3PATA 1RK9A 1Y6WA 4YGDB 1PALA 1D1OA 2DOQA 2D8NA 1WLZA 2LUCA 2HQWA 1ZOTB 3D0YA 1RWYA 1DJGA 2K7OA 4C0KA 1DT7B 1KSMA 1SYMA 3CR4X 1R2UA 1CFDA 4HSZA 1OZSA 3F45A 1F70A 2BE4A 2K2FA 1AP4A 1KK8B 1CFFA 1SMGA 1NWDA 2K7CA 1XFZO 3A4UB 1QX2A 3KEVA 1CDPA 1XFXO 1EH2A 2G9BA 4YRUA 4JQ0D 4DCKA 3WHUB 2FCEA 2GV5A 1DTLA 5AEQA 2CT9A 2K7DA 3PFVA 1SPYA 1EG4A 1S36A 2AAOA 3LCPC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M45 A;  1G8I A;  1Y1A A;  2LMV A;  5F6T A;  1X02 A;  1G4Y R;  3GK4 X;  4I5K A;  1RFJ A;  1CDL A;  1QAS A;  1S1E A;  1J7P A;  1N2D A;  1EG3 A;  2E30 A;  3NSO A;  1NX3 A;  1SNL A;  3CR5 X;  3TUY B;  5HKW A;  1BF5 A;  1LKJ A;  1N0Y A;  3LLE A;  3PLF B;  2JU0 A;  2BL0 C;  2KYF A;  5JJG A;  1LVC D;  2F2O A;  1RJV A;  1JSA A;  1YX8 A;  1SCM B;  3DVE A;  5D69 A;  2HET A;  4N5X A;  2SCP A;  1YRU B;  1HQV A;  1OQP A;  1YR5 A;  1ZAC A;  3JTD C;  1MXL C;  2HPS A;  3NSK A;  3HCM A;  4N1G A;  3TS5 C;  2LP3 A;  2PVB A;  4OCI A;  2CXJ A;  4CFQ A;  2BCX A;  3AAK A;  4FTG A;  1TOP A;  2COL B;  1QIV A;  1ODB A;  1OMR A;  1K9P A;  1SW8 A;  1XK4 C;  2LHI A;  3D0Y B;  4BY4 A;  3BOW A;  2KQY A;  5ER4 X;  4PHK A;  2M29 A;  3TDU A;  3PN7 B;  2L50 A;  1QV1 A;  1TNP A;  2PRU A;  1QIW A;  5ER5 A;  3OP0 A;  1IQ3 A;  2QPT A;  4XJK A;  1A29 A;  1UUS A;  1ALV A;  1A03 A;  1UHI A;  2MLF C;  1BMO A;  1A75 A;  4Q04 A;  3IF7 A;  5AFP A;  2KFG A;  1K9K A;  1SRA A;  1TIZ A;  3M0W A;  2KYC A;  4PE0 A;  1J7R A;  1B7T Z;  3NSI A;  1PSR A;  4USL A;  5D7F A;  2F8P A;  4GGF A;  2LMU A;  2CNP A;  1SR6 B;  2LMT A;  1SL8 A;  2AMI A;  3ICB A;  2JTZ A;  3FS7 A;  2BBN A;  3EK7 A;  1WDC B;  3EK4 A;  2LCP A;  1QLS A;  2K0J A;  2R2I A;  3QRX A;  4DS7 A;  2SAS A;  3KHE A;  1FI5 A;  5HKY A;  1V1G A;  1KK7 Z;  1NYA A;  3FWC A;  1F71 A;  2I2R E;  1L2O C;  4ICB A;  1KK7 Y;  2KQ6 A;  2L0P A;  5DKR A;  5B8I B;  1QXP A;  3I5H B;  1IQ5 A;  1XK4 A;  2TN4 A;  2FCD A;  1ALW A;  3I5F C;  1TNQ A;  1XYD A;  1ZMZ A;  4HRH A;  3O2P A;  4WQ2 A;  1M46 A;  2CTN A;  2G2B A;  4PHN A;  1JUO A;  2L4I A;  2MAZ A;  3TDI A;  1K90 D;  1CTR A;  3BXK A;  3OX5 A;  3NXA A;  1J55 A;  4DUQ A;  1NCZ A;  4M2O A;  1IJ6 A;  3DVK A;  3GOF A;  1WLM A;  3CS1 A;  1J1D A;  3H4S E;  4U8D A;  1NPQ A;  2PAS A;  1B47 A;  1PVB A;  1BR4 B;  1JC2 A;  1JFK A;  4PE4 A;  1E8A A;  2MBX A;  2WCB A;  3KO0 A;  1B9A A;  2JTT A;  1UUR A;  4ORA B;  1MF8 B;  4OVN F;  2K8M B;  2LV7 A;  1YTZ C;  5TNC A;  4TNC A;  2VRG A;  2M8U A;  2KFF A;  1U5I B;  1TN4 A;  2KI6 D;  4R1E A;  3VGO A;  2FOT A;  1BJF A;  3DVJ A;  4XJK B;  4HRE E;  1AJ5 A;  1F8H A;  1QTX A;  1A75 B;  1AHR A;  2P6B B;  1SY9 A;  3PM8 A;  3AAJ A;  1A4P A;  3NSL A;  2L51 A;  2ZKM X;  3HX4 A;  1WY9 A;  2LUX A;  4WQ3 A;  1YUR A;  3SG2 A;  1JF2 A;  2KNE A;  5GQQ C;  1KFX S;  4I5J A;  2BEC A;  1G33 A;  1MQ1 A;  2JPT A;  1NCX A;  1SL7 A;  1J1E A;  2B1U A;  3RM1 A;  1BT6 A;  1TRF A;  1M63 B;  1H8B A;  2F33 A;  1VRK A;  5AXI A;  3PSR A;  5I2O A;  1LA3 A;  4GAO A;  3JTD B;  2FJU B;  1XFY O;  2ZN9 A;  1BU3 A;  3JVT C;  3SG5 A;  3OB1 B;  3BUO B;  2BE6 A;  1EL4 A;  1QVI Z;  4MRY A;  5HLO A;  1TNX A;  1QVI Y;  1DJX A;  1CLB A;  4YGB B;  1QS7 A;  1M31 A;  3K21 A;  4FQO A;  2AUC A;  1S6I A;  2BKI B;  1FPW A;  1DGV A;  1PVA A;  2ZNE A;  1Y0V H;  3D10 A;  2NLN A;  2E6W A;  4OR9 B;  4ETO A;  2V53 A;  1CFC A;  3CGA A;  1CDN A;  5J3X A;  2ZND A;  3SJS A;  1L7Z A;  2BCA A;  2KGB C;  3IQQ A;  2KBI A;  1J7Q A;  1KFU S;  2F3Z A;  3LL8 B;  2KSP A;  3SG6 A;  5HKZ A;  4GFT A;  2LVV A;  2LVJ A;  4E68 A;  1KQM C;  1BG1 A;  4C0L A;  2WOS A;  4QJ3 B;  4GPL B;  4XYN A;  2M7L A;  1WRK A;  4GUK A;  4QJ5 B;  3C1V A;  1F4Q A;  1DJY A;  1K8U A;  1EJ3 A;  3EVR A;  4P2Y B;  2M0R A;  3DF0 A;  4I5L B;  4UPG A;  1SCV A;  3KF9 A;  5AER A;  2KAY A;  2ZRT A;  2L4H A;  1B8L A;  3I5F B;  4YGC B;  1WRL A;  1MWN A;  2JT8 A;  1OE9 B;  1PK0 D;  2LC5 A;  3SG3 A;  3AKB A;  1M39 A;  1U5I A;  1IRJ A;  2WC8 A;  1MXE A;  4IL1 A;  2OS8 C;  2GGM A;  1JBA A;  1B1G A;  2CCM A;  4D1E A;  1NCY A;  1KQV A;  1B8C A;  2I7A A;  4N1F A;  4YGA A;  4GBA A;  1K95 A;  1KK8 C;  1JF0 A;  4PAL A;  5CPV A;  4JPZ B;  1OMV A;  4HRG A;  4YI9 A;  4GGN A;  2I18 A;  4P5O E;  1IJ5 A;  1NSH A;  2JOJ A;  2KFH A;  2PAL A;  1MUX A;  1DJI A;  3MSE B;  3CTN A;  1PUL A;  4M2Q A;  1Y1X A;  3VRQ A;  1YUS A;  2M1U A;  2JWW A;  1WRZ A;  2LVK A;  3SG7 A;  1Q80 A;  1H4B A;  2M97 A;  3A8R A;  1OSA A;  1NP8 A;  4MSP A;  1QX7 A;  1CNP A;  2JRF A;  1KWO C;  2Q4U A;  5I2Q A;  2F3Y A;  1K96 A;  2LHL A;  4CPV A;  5KU1 A;  2KDH A;  1B8R A;  2LLT A;  2M1K B;  4YBH B;  4C0J A;  5I8N A;  1SCM C;  1TCO B;  3VRO A;  4YGE B;  1F54 A;  3OB2 B;  2JZI A;  4QJ4 B;  2MLE C;  1KFX L;  2MRD A;  1QLK A;  3DF0 B;  1FW4 A;  1MHO A;  3BQ3 A;  4MRX A;  2LM5 A;  3WXA A;  2JT0 A;  4ORC B;  3OHM B;  2JNX A;  3EVV A;  2KI6 C;  4MVF A;  2JXL A;  2WND A;  2JC2 A;  1BOD A;  1NIW A;  1REC A;  1AUI B;  2Y5I A;  1RTP 1;  3SIA A;  1FBV A;  4OKH A;  1KCY A;  3SG4 A;  4NQG A;  4A4B A;  4JWQ A;  2M3W A;  3FWB A;  1CLM A;  3CWG A;  2M49 B;  2LAP A;  3BUN B;  4BY5 A;  3CLN A;  1DF0 A;  4CLN A;  1UHH A;  3BYA A;  3WHT B;  3LK1 A;  2BL0 B;  5CSF A;  1EXR A;  1LA0 A;  2I94 A;  1KQM B;  2HF5 A;  1GGZ A;  2L98 A;  3TZ1 A;  1C07 A;  1TCF A;  5JOL A;  4DRW A;  1SR6 C;  2LAN A;  4MEW A;  5KTY A;  3OX6 A;  1SKT A;  2NZ0 A;  5CSI A;  3TS5 B;  1CDM A;  1KFU L;  1OZO A;  4AQI A;  1XVJ A;  1SBJ A;  4I5N B;  1S26 D;  2Q91 A;  2WCF A;  4YI8 A;  3WNX B;  1UWO A;  5IBW A;  1MR8 A;  1F55 A;  1XFV O;  2KGR A;  1S5G Z;  3I5H C;  4ZCU A;  1SK6 D;  4PE1 A;  1S5G Y;  1NX2 A;  1S3P A;  2K61 A;  2NCP A;  2Y1M A;  1IKU A;  2JUL A;  2OS8 B;  1UHJ A;  1XO5 A;  1YVH A;  3I5I C;  5PAL A;  2EC6 C;  3AKA A;  1IWQ A;  1ZUZ A;  2PSR A;  4NDB A;  3I5G C;  1ZFS A;  1XA5 A;  3GK1 A;  4M2P A;  3BUM B;  1QAT A;  4L9M A;  2JQ6 A;  4WRI A;  4DIR A;  1CM4 A;  2LVI A;  2JXC A;  1W7J B;  1K9U A;  5CSN A;  3O78 A;  3DD4 A;  1CMG A;  4ORB B;  1K94 A;  3GK2 A;  1B4C A;  4PHJ A;  1XFW O;  2L5X B;  1W7I B;  1CM1 A;  2H2K A;  3O6B A;  2KI4 C;  1BLQ A;  1JWD A;  1C7W A;  1L2O B;  2OTG C;  4CID A;  2M9G A;  5AAN A;  3VRR A;  5HLV A;  2O60 A;  3EK8 A;  3LK0 A;  1CLL A;  2ZFD A;  3E3R A;  3ZWH A;  1AVS A;  1CMF A;  1K2H A;  1KWO B;  3ZNI A;  1DF0 B;  2GGZ A;  1A2X A;  3EVU A;  2K2A A;  2MJW B;  4MBE A;  2IS9 A;  3EKH A;  5BPJ A;  3O4Y A;  4GGF C;  2HQ8 A;  2O5G A;  4A4C A;  3CZT X;  2JT3 A;  2H61 C;  2CBL A;  2EGD A;  4AOM A;  1LXF C;  5DKQ A;  4ZCV A;  4PE7 A;  2RGI A;  2Y1N A;  3VRP A;  2NXQ A;  4GNK B;  1QX5 B;  2MHH A;  3FIA A;  2KHN A;  5HYD A;  1XFU O;  2MA2 A;  1N65 A;  4PHM A;  1AJ4 A;  5G08 A;  3TDZ A;  2KOT A;  2OPO A;  1S6J A;  4MZK A;  1CKK A;  1KSO A;  1V1F A;  2ISD A;  1YX7 A;  1UP5 A;  1FI6 A;  2BCB A;  1C7V A;  2JNF A;  1BR1 B;  1AK8 A;  5CSJ A;  1K93 D;  4CFR A;  1NUB A;  2LE9 B;  2EHB A;  2LLU A;  2K7B A;  3IQO A;  1IGV A;  4NDD A;  5KSZ A;  3SIB A;  3TUY C;  2KAV A;  1R6P A;  1B7T Y;  2LLS A;  1BOC A;  1QJT A;  2M7N A;  3RLZ A;  1PRW A;  1GJY A;  1QV0 A;  1S6C A;  2H61 A;  3CR2 A;  2ZN8 A;  1CB1 A;  1GGW A;  1IH0 A;  3JVT B;  1NX1 A;  2ZRS A;  3BUX B;  3VRN A;  4MN0 A;  4MZL A;  1DMO A;  1FF1 A;  1GQM A;  4F0Z B;  3EKJ A;  2QAC A;  1YUU A;  3BUW B;  2WOR A;  2LNK A;  1YVL A;  4PDZ A;  1UHK A;  5FYX A;  2BBM A;  1DGU A;  4MZJ A;  3PN7 C;  1DJW A;  5K89 A;  1DVI A;  1J7O A;  1PSB A;  1YRT B;  4MLW A;  5I2L A;  3I5I B;  1TNW A;  2EC6 B;  1TTX A;  1Y1U A;  1OOJ A;  4NDC A;  1HT9 A;  2WCE A;  3I5G B;  2KAX A;  1UHN A;  1DJZ A;  4AQJ A;  2LP2 A;  2KBM A;  1NX0 A;  3PAL A;  2Y4Q A;  1IG5 A;  1YUT A;  1DJH A;  3BOW B;  3DVM A;  2L2E A;  1RRO A;  2F2P A;  1OMD A;  1CFP A;  1JFJ A;  1F4O A;  4OV2 A;  1LIN A;  1WDC C;  2KI4 B;  2PMY A;  1SL9 A;  2OTG B;  4PCW A;  2BKH B;  2A4J A;  2NCO A;  3KPX A;  5DKN A;  3PAT A;  1RK9 A;  1Y6W A;  4YGD B;  1PAL A;  1D1O A;  2DOQ A;  2D8N A;  1WLZ A;  2LUC A;  2HQW A;  1ZOT B;  3D0Y A;  1RWY A;  1DJG A;  2K7O A;  4C0K A;  1DT7 B;  1KSM A;  1SYM A;  3CR4 X;  1R2U A;  1CFD A;  4HSZ A;  1OZS A;  3F45 A;  1F70 A;  2BE4 A;  2K2F A;  1AP4 A;  1KK8 B;  1CFF A;  1SMG A;  1NWD A;  2K7C A;  1XFZ O;  3A4U B;  1QX2 A;  3KEV A;  1CDP A;  1XFX O;  1EH2 A;  2G9B A;  4YRU A;  4JQ0 D;  4DCK A;  3WHU B;  2FCE A;  2GV5 A;  1DTL A;  5AEQ A;  2CT9 A;  2K7D A;  3PFV A;  1SPY A;  1EG4 A;  1S36 A;  2AAO A;  3LCP C; 
#chains in the Genus database with same CATH topology
 1M45 A;  1G8I A;  1Y1A A;  2LMV A;  5F6T A;  1X02 A;  1G4Y R;  3GK4 X;  4I5K A;  1RFJ A;  1CDL A;  1QAS A;  1S1E A;  1J7P A;  1N2D A;  1EG3 A;  2E30 A;  3NSO A;  1NX3 A;  1SNL A;  3CR5 X;  3TUY B;  3VB1 A;  5HKW A;  1BF5 A;  1LKJ A;  1N0Y A;  3LLE A;  3PLF B;  2JU0 A;  2BL0 C;  2KYF A;  5JJG A;  1LVC D;  2F2O A;  1RJV A;  1JSA A;  2QDI A;  1YX8 A;  1SCM B;  1OOH A;  3DVE A;  5D69 A;  2HET A;  4N5X A;  2SCP A;  1YRU B;  1HQV A;  1OQP A;  1YR5 A;  2JPO A;  1ZAC A;  3JTD C;  1MXL C;  2HPS A;  1DQE A;  3HCM A;  3NSK A;  4N1G A;  3TS5 C;  2LP3 A;  2QEO A;  2PVB A;  3DZT A;  4OCI A;  2CXJ A;  4CFQ A;  2BCX A;  3AAK A;  4FTG A;  1TOP A;  2COL B;  1QIV A;  1ODB A;  1ORG A;  1OMR A;  1K9P A;  1SW8 A;  1XK4 C;  2LHI A;  3K1E A;  3D0Y B;  4BY4 A;  3RZS A;  3BOW A;  2KQY A;  5ER4 X;  4PHK A;  2M29 A;  3TDU A;  3PN7 B;  2L50 A;  1QV1 A;  1TNP A;  2PRU A;  1QIW A;  5DKN A;  3OP0 A;  5ER5 A;  1IQ3 A;  3S0G A;  2QPT A;  4XJK A;  1A29 A;  1UUS A;  1ALV A;  3S0E A;  1UHI A;  2MLF C;  1BMO A;  1A75 A;  4Q04 A;  1A03 A;  3IF7 A;  3L4L A;  5AFP A;  2KFG A;  1K9K A;  1SRA A;  1TIZ A;  3B86 A;  3M0W A;  2KYC A;  4PE0 A;  1J7R A;  1B7T Z;  4KYN A;  3NSI A;  1PSR A;  4USL A;  4INX A;  5D7F A;  2F8P A;  4GGF A;  5FI2 A;  2KLD A;  2LMU A;  2CNP A;  1SR6 B;  2LMT A;  1SL8 A;  2AMI A;  3OBV A;  3ICB A;  2JTZ A;  3FS7 A;  1IIO A;  2BBN A;  3EK7 A;  1WDC B;  3EK4 A;  2LCP A;  1QLS A;  2K0J A;  2R2I A;  3DY9 A;  3QRX A;  2SAS A;  3KHE A;  4DS7 A;  5HKY A;  1V1G A;  1KK7 Z;  1NYA A;  3FWC A;  1F71 A;  2I2R E;  1L2O C;  4ICB A;  1KK7 Y;  2KQ6 A;  2L0P A;  5DKR A;  5B8I B;  1QXP A;  3B87 A;  1IQ5 A;  3I5H B;  1XK4 A;  2TN4 A;  2FCD A;  1ALW A;  3I5F C;  1TNQ A;  1XYD A;  1ZMZ A;  4HRH A;  3O2P A;  4WQ2 A;  1M46 A;  2CTN A;  3S0D A;  2G2B A;  4PHN A;  1JUO A;  2L4I A;  2MAZ A;  3TDI A;  1K90 D;  1CTR A;  3BXK A;  3OX5 A;  3NXA A;  1J55 A;  4DUQ A;  1NCZ A;  4M2O A;  2FJY A;  1IJ6 A;  3DVK A;  3GOF A;  1WLM A;  3CS1 A;  1J1D A;  3H4S E;  4U8D A;  1NPQ A;  2PAS A;  1B47 A;  1PVB A;  1BR4 B;  1JC2 A;  1JFK A;  4PE4 A;  1E8A A;  2MBX A;  3SS3 A;  2WCB A;  3KO0 A;  1B9A A;  2JTT A;  1UUR A;  4ORA B;  1MF8 B;  4OVN F;  2K8M B;  2LV7 A;  1YTZ C;  2WC6 A;  2WCJ A;  4FQT A;  4TNC A;  5TNC A;  1GM0 A;  1TWO A;  2M8U A;  2KFF A;  2GTE A;  2VRG A;  1U5I B;  1P28 A;  2KI6 D;  4R1E A;  3VGO A;  2FOT A;  1BJF A;  3DVJ A;  4XJK B;  4HRE E;  1AJ5 A;  1F8H A;  1QTX A;  1A75 B;  1AHR A;  3DYE A;  2P6B B;  1SY9 A;  3PM8 A;  3AAJ A;  1A4P A;  3NSL A;  2L51 A;  2ZKM X;  3HX4 A;  1WY9 A;  2LUX A;  4WQ3 A;  1YUR A;  3SG2 A;  1JF2 A;  3UNW A;  2KNE A;  2WCL A;  3R1V A;  5GQQ C;  1KFX S;  4I5J A;  2BEC A;  1G33 A;  1MQ1 A;  2JPT A;  1NCX A;  1SL7 A;  1J1E A;  2B1U A;  3RM1 A;  1BT6 A;  1TRF A;  1M63 B;  1H8B A;  3S0F A;  2F33 A;  1VRK A;  5AXI A;  3PSR A;  5I2O A;  1LA3 A;  4GAO A;  3JTD B;  2FJU B;  1XFY O;  2L2C A;  2ZN9 A;  1BU3 A;  3JVT C;  3SG5 A;  3OB1 B;  3BUO B;  2BE6 A;  1EL4 A;  1QVI Z;  4MRY A;  5HLO A;  1TNX A;  1C3Z A;  1QVI Y;  1DJX A;  1CLB A;  4YGB B;  1QS7 A;  1M31 A;  3K21 A;  4FQO A;  4IJ7 A;  2AUC A;  1S6I A;  2BKI B;  1FPW A;  1DGV A;  1PVA A;  2ZNE A;  1Y0V H;  3D10 A;  2NLN A;  2E6W A;  4OR9 B;  4ETO A;  2V53 A;  1CFC A;  3CGA A;  3S0B A;  1CDN A;  2BNX A;  5J3X A;  2ZND A;  3SJS A;  1L7Z A;  2BCA A;  2KGB C;  3IQQ A;  2KBI A;  1J7Q A;  1KFU S;  2F3Z A;  3LL8 B;  2QEH A;  2KSP A;  3SG6 A;  5HKZ A;  4GFT A;  2LVV A;  2LVJ A;  4E68 A;  1KQM C;  1BG1 A;  4C0L A;  2WOS A;  4QJ3 B;  4GPL B;  2H8V A;  3D74 A;  4XYN A;  1OW4 A;  2M7L A;  1WRK A;  4GUK A;  4QJ5 B;  3C1V A;  1F4Q A;  1DJY A;  1K8U A;  1EJ3 A;  3EVR A;  4P2Y B;  2M0R A;  3DF0 A;  4I5L B;  4UPG A;  1SCV A;  3KF9 A;  5AER A;  3NGV A;  3R1P A;  2KAY A;  2WCM A;  2ZRT A;  2L4H A;  1B8L A;  3I5F B;  4YGC B;  1WRL A;  1MWN A;  2JT8 A;  1OE9 B;  1PK0 D;  2LC5 A;  3SG3 A;  3CDN A;  3AKB A;  1M39 A;  1U5I A;  1IRJ A;  2WC8 A;  1MXE A;  4IL1 A;  2OS8 C;  2GGM A;  1JBA A;  1B1G A;  2CCM A;  4D1E A;  1NCY A;  1KQV A;  1B8C A;  2I7A A;  4N1F A;  4YGA A;  4GBA A;  1K95 A;  1KK8 C;  1JF0 A;  4PAL A;  5CPV A;  3S0A A;  4JPZ B;  1OMV A;  4HRG A;  4YI9 A;  1XFR A;  4GGN A;  2I18 A;  3FE6 A;  4P5O E;  1IJ5 A;  1NSH A;  2JOJ A;  2KFH A;  2PAL A;  1MUX A;  1DJI A;  3MSE B;  3CTN A;  1PUL A;  3D73 A;  4M2Q A;  5DIC A;  1Y1X A;  2WCH A;  3VRQ A;  1YUS A;  2M1U A;  2JWW A;  1WRZ A;  2LVK A;  3SG7 A;  1Q80 A;  1H4B A;  2M97 A;  3A8R A;  1OSA A;  1NP8 A;  4MSP A;  1QX7 A;  1CNP A;  2JRF A;  1KWO C;  2Q4U A;  2WCK A;  1TUZ A;  3QME A;  5I2Q A;  2F3Y A;  2P71 A;  1K96 A;  2LHL A;  4CPV A;  3DXL A;  5KU1 A;  2KDH A;  1B8R A;  2LLT A;  2M1K B;  4YBH B;  4C0J A;  5I8N A;  1SCM C;  1TCO B;  3VRO A;  4YGE B;  1F54 A;  3OB2 B;  2JZI A;  4QJ4 B;  2MLE C;  1KFX L;  2MRD A;  1QLK A;  3DF0 B;  1FW4 A;  3FE8 A;  1MHO A;  3BQ3 A;  4MRX A;  2K60 A;  2LM5 A;  3WXA A;  2JT0 A;  4ORC B;  3OHM B;  2JNX A;  3EVV A;  1SSE B;  2KI6 C;  2KLE A;  4MVF A;  2JXL A;  2WND A;  2JC2 A;  1BOD A;  1NIW A;  1REC A;  3BFA A;  3D78 A;  1AUI B;  2Y5I A;  1RTP 1;  3SIA A;  1FBV A;  4OKH A;  1KCY A;  3SG4 A;  4NQG A;  3PM2 A;  4A4B A;  4JWQ A;  2M3W A;  3FWB A;  1D1O A;  1CLM A;  3CWG A;  3O4X A;  2M49 B;  2LAP A;  3BUN B;  4BY5 A;  3CLN A;  1DF0 A;  4CLN A;  3IVT A;  1UHH A;  3BYA A;  4JD9 A;  3WHT B;  4CID A;  3LK1 A;  2BL0 B;  5CSF A;  1EXR A;  1LA0 A;  2I94 A;  1KQM B;  2HF5 A;  3B88 A;  1GGZ A;  2L98 A;  3TZ1 A;  4INW A;  1TCF A;  5JOL A;  4DRW A;  1SR6 C;  1C07 A;  2LAN A;  4MEW A;  5KTY A;  3OX6 A;  1SKT A;  2NZ0 A;  5CSI A;  3TS5 B;  1CDM A;  1KFU L;  1OZO A;  4AQI A;  1XVJ A;  1DC1 A;  1SBJ A;  4I5N B;  1S26 D;  2Q91 A;  2WCF A;  4YI8 A;  3WNX B;  1UWO A;  5IBW A;  1MR8 A;  1F55 A;  1XFV O;  3PJI A;  2KGR A;  1S5G Z;  3I5H C;  4ZCU A;  1SK6 D;  1T14 A;  4PE1 A;  1S5G Y;  5D3O A;  1NX2 A;  3N7H A;  1S3P A;  2K61 A;  2NCP A;  2Y1M A;  1IKU A;  2JUL A;  2OS8 B;  3B6X A;  1UHJ A;  1XO5 A;  1FI5 A;  1OOI X;  3SS5 A;  1YVH A;  3I5I C;  5PAL A;  2EC6 C;  3AKA A;  1IWQ A;  1ZUZ A;  2PSR A;  4NDB A;  2ERB A;  5HL1 A;  3I5G C;  1ZFS A;  1XA5 A;  3CAB A;  3GK1 A;  4M2P A;  3BUM B;  1QAT A;  4L9M A;  2JQ6 A;  4WRI A;  4DIR A;  1CM4 A;  2LVI A;  2JXC A;  1W7J B;  1K9U A;  3SS4 A;  5CSN A;  3O78 A;  3DD4 A;  1CMG A;  4ORB B;  1K94 A;  3GK2 A;  1B4C A;  4PHJ A;  1XFW O;  2L5X B;  1W7I B;  1CM1 A;  2H2K A;  3O6B A;  2KI4 C;  1BLQ A;  1JWD A;  1C7W A;  1L2O B;  2OTG C;  4PT1 A;  2M9G A;  5AAN A;  3VRR A;  5HLV A;  2O60 A;  3EK8 A;  3LK0 A;  1CLL A;  2ZFD A;  3E3R A;  3ZWH A;  1AVS A;  1CMF A;  2PQL A;  1K2H A;  1KWO B;  3ZNI A;  1DF0 B;  2GGZ A;  1A2X A;  3EVU A;  2K2A A;  2MJW B;  4MBE A;  2IS9 A;  3EKH A;  5BPJ A;  3O4Y A;  3FE9 A;  4GGF C;  2QEV A;  2HQ8 A;  2O5G A;  5I94 A;  1QWV A;  4A4C A;  3CZT X;  2JT3 A;  2H61 C;  2CBL A;  2EGD A;  4AOM A;  1LXF C;  5DKQ A;  4ZCV A;  3L4A A;  4PE7 A;  2RGI A;  2Y1N A;  3VRP A;  5EL2 A;  1W9Z A;  2NXQ A;  4GNK B;  1QX5 B;  2BAP A;  2MHH A;  2KHN A;  3FIA A;  5HYD A;  1XFU O;  2MA2 A;  1N65 A;  3CYZ A;  1AJ4 A;  4PHM A;  3R72 A;  2KOT A;  2OPO A;  1S6J A;  4MZK A;  5G08 A;  1CKK A;  1KSO A;  1V1F A;  2ISD A;  1YX7 A;  1UP5 A;  2L5Y A;  1FI6 A;  2BCB A;  1OOG A;  1C7V A;  2JNF A;  1BR1 B;  1AK8 A;  5CSJ A;  5FI6 A;  1K93 D;  3D77 A;  4CFR A;  1NUB A;  2LE9 B;  2EHB A;  2LLU A;  2K7B A;  3IQO A;  1IGV A;  4NDD A;  5KSZ A;  3SIB A;  3TUY C;  2KAV A;  1DEL A;  1R6P A;  3L47 A;  1B7T Y;  2LLS A;  1BOC A;  1QJT A;  3V2L A;  2M7N A;  3RLZ A;  1PRW A;  1GJY A;  2P70 A;  1QV0 A;  1S6C A;  2H61 A;  3CR2 A;  2ZN8 A;  1CB1 A;  1GGW A;  3UO9 A;  3CZ1 A;  1IH0 A;  3JVT B;  1NX1 A;  2ZRS A;  1DEK A;  3BUX B;  3CZ0 A;  3VRN A;  4MN0 A;  4MZL A;  1DMO A;  1FF1 A;  1GQM A;  4F0Z B;  3EKJ A;  2QAC A;  1YUU A;  1Z2C B;  3BUW B;  2WOR A;  1C3Y A;  2LNK A;  1YVL A;  4PDZ A;  1UHK A;  2QEB A;  5FYX A;  2BBM A;  1DGU A;  4MZJ A;  3PN7 C;  1DJW A;  1Z4H A;  5K89 A;  1DVI A;  1J7O A;  1PSB A;  1YRT B;  4MLW A;  5I2L A;  3I5I B;  1TNW A;  2EC6 B;  1TTX A;  1TUJ A;  1Y1U A;  1OOJ A;  3CZ2 A;  3NHT A;  4NDC A;  2AAO A;  1HT9 A;  2WCE A;  3B7A A;  3I5G B;  4JKT A;  2KAX A;  1UHN A;  1DJZ A;  4AQJ A;  2LP2 A;  2KBM A;  1NX0 A;  3NHI A;  3PAL A;  2Y4Q A;  1IG5 A;  1YUT A;  1DJH A;  3BOW B;  3DVM A;  2L2E A;  3OGN A;  3R1O A;  4OZD A;  3D76 A;  1RRO A;  2F2P A;  3TDZ A;  1OMD A;  1CFP A;  1JFJ A;  1F4O A;  4OV2 A;  3BJH A;  1LIN A;  1WDC C;  2KI4 B;  2PMY A;  1SL9 A;  2OTG B;  4PCW A;  2BKH B;  2A4J A;  2NCO A;  3D75 A;  3KPX A;  3PAT A;  1RK9 A;  1Y6W A;  4YGD B;  1PAL A;  3BFH A;  2DOQ A;  2D8N A;  5FI7 A;  1WLZ A;  2LUC A;  2HQW A;  1ZOT B;  3D0Y A;  1RWY A;  1DJG A;  2KPH A;  2K7O A;  4C0K A;  1DT7 B;  1LS8 A;  1SYM A;  1KSM A;  3CR4 X;  1R2U A;  1CFD A;  2YGU A;  1OZS A;  3F45 A;  3Q8I A;  4HSZ A;  1F70 A;  2BE4 A;  2K2F A;  1AP4 A;  1KK8 B;  1CFF A;  1SMG A;  1NWD A;  2K7C A;  1XFZ O;  3A4U B;  1QX2 A;  3KEV A;  1CDP A;  1XFX O;  1OOF A;  1EH2 A;  2G9B A;  4YRU A;  4JQ0 D;  3EG5 B;  4DCK A;  2PYQ A;  3BFB A;  3WHU B;  2FCE A;  2GV5 A;  1DTL A;  5AEQ A;  2WC5 A;  2CT9 A;  2K7D A;  4F7F A;  3PFV A;  1SPY A;  1EG4 A;  1S36 A;  1TN4 A;  3LCP C; 
#chains in the Genus database with same CATH homology
 1M45 A;  1G8I A;  1Y1A A;  2LMV A;  5F6T A;  1X02 A;  1G4Y R;  3GK4 X;  4I5K A;  1RFJ A;  1CDL A;  1QAS A;  1S1E A;  1J7P A;  1N2D A;  1EG3 A;  2E30 A;  3NSO A;  1NX3 A;  1SNL A;  3CR5 X;  3TUY B;  5HKW A;  1BF5 A;  1LKJ A;  1N0Y A;  3LLE A;  3PLF B;  2JU0 A;  2BL0 C;  2KYF A;  5JJG A;  1LVC D;  2F2O A;  1RJV A;  1JSA A;  1YX8 A;  1SCM B;  3DVE A;  5D69 A;  2HET A;  4N5X A;  2SCP A;  1YRU B;  1HQV A;  1OQP A;  1YR5 A;  1ZAC A;  3JTD C;  1MXL C;  2HPS A;  3NSK A;  3HCM A;  4N1G A;  3TS5 C;  2LP3 A;  2PVB A;  4OCI A;  2CXJ A;  4CFQ A;  2BCX A;  3AAK A;  4FTG A;  1TOP A;  2COL B;  1QIV A;  1ODB A;  1OMR A;  1K9P A;  1SW8 A;  1XK4 C;  2LHI A;  3D0Y B;  4BY4 A;  3BOW A;  2KQY A;  5ER4 X;  4PHK A;  2M29 A;  3TDU A;  3PN7 B;  2L50 A;  1QV1 A;  1TNP A;  2PRU A;  1QIW A;  5ER5 A;  3OP0 A;  1IQ3 A;  2QPT A;  4XJK A;  1A29 A;  1UUS A;  1ALV A;  1A03 A;  1UHI A;  2MLF C;  1BMO A;  1A75 A;  4Q04 A;  3IF7 A;  5AFP A;  2KFG A;  1K9K A;  1SRA A;  1TIZ A;  3M0W A;  2KYC A;  4PE0 A;  1J7R A;  1B7T Z;  3NSI A;  1PSR A;  4USL A;  5D7F A;  2F8P A;  4GGF A;  2LMU A;  2CNP A;  1SR6 B;  2LMT A;  1SL8 A;  2AMI A;  3ICB A;  2JTZ A;  3FS7 A;  2BBN A;  3EK7 A;  1WDC B;  3EK4 A;  2LCP A;  1QLS A;  2K0J A;  2R2I A;  3QRX A;  4DS7 A;  2SAS A;  3KHE A;  1FI5 A;  5HKY A;  1V1G A;  1KK7 Z;  1NYA A;  3FWC A;  1F71 A;  2I2R E;  1L2O C;  4ICB A;  1KK7 Y;  2KQ6 A;  2L0P A;  5DKR A;  5B8I B;  1QXP A;  3I5H B;  1IQ5 A;  1XK4 A;  2TN4 A;  2FCD A;  1ALW A;  3I5F C;  1TNQ A;  1XYD A;  1ZMZ A;  4HRH A;  3O2P A;  4WQ2 A;  1M46 A;  2CTN A;  2G2B A;  4PHN A;  1JUO A;  2L4I A;  2MAZ A;  3TDI A;  1K90 D;  1CTR A;  3BXK A;  3OX5 A;  3NXA A;  1J55 A;  4DUQ A;  1NCZ A;  4M2O A;  1IJ6 A;  3DVK A;  3GOF A;  1WLM A;  3CS1 A;  1J1D A;  3H4S E;  4U8D A;  1NPQ A;  2PAS A;  1B47 A;  1PVB A;  1BR4 B;  1JC2 A;  1JFK A;  4PE4 A;  1E8A A;  2MBX A;  2WCB A;  3KO0 A;  1B9A A;  2JTT A;  1UUR A;  4ORA B;  1MF8 B;  4OVN F;  2K8M B;  2LV7 A;  1YTZ C;  5TNC A;  4TNC A;  2VRG A;  2M8U A;  2KFF A;  1U5I B;  1TN4 A;  2KI6 D;  4R1E A;  3VGO A;  2FOT A;  1BJF A;  3DVJ A;  4XJK B;  4HRE E;  1AJ5 A;  1F8H A;  1QTX A;  1A75 B;  1AHR A;  2P6B B;  1SY9 A;  3PM8 A;  3AAJ A;  1A4P A;  3NSL A;  2L51 A;  2ZKM X;  3HX4 A;  1WY9 A;  2LUX A;  4WQ3 A;  1YUR A;  3SG2 A;  1JF2 A;  2KNE A;  5GQQ C;  1KFX S;  4I5J A;  2BEC A;  1G33 A;  1MQ1 A;  2JPT A;  1NCX A;  1SL7 A;  1J1E A;  2B1U A;  3RM1 A;  1BT6 A;  1TRF A;  1M63 B;  1H8B A;  2F33 A;  1VRK A;  5AXI A;  3PSR A;  5I2O A;  1LA3 A;  4GAO A;  3JTD B;  2FJU B;  1XFY O;  2ZN9 A;  1BU3 A;  3JVT C;  3SG5 A;  3OB1 B;  3BUO B;  2BE6 A;  1EL4 A;  1QVI Z;  4MRY A;  5HLO A;  1TNX A;  1QVI Y;  1DJX A;  1CLB A;  4YGB B;  1QS7 A;  1M31 A;  3K21 A;  4FQO A;  2AUC A;  1S6I A;  2BKI B;  1FPW A;  1DGV A;  1PVA A;  2ZNE A;  1Y0V H;  3D10 A;  2NLN A;  2E6W A;  4OR9 B;  4ETO A;  2V53 A;  1CFC A;  3CGA A;  1CDN A;  5J3X A;  2ZND A;  3SJS A;  1L7Z A;  2BCA A;  2KGB C;  3IQQ A;  2KBI A;  1J7Q A;  1KFU S;  2F3Z A;  3LL8 B;  2KSP A;  3SG6 A;  5HKZ A;  4GFT A;  2LVV A;  2LVJ A;  4E68 A;  1KQM C;  1BG1 A;  4C0L A;  2WOS A;  4QJ3 B;  4GPL B;  4XYN A;  2M7L A;  1WRK A;  4GUK A;  4QJ5 B;  3C1V A;  1F4Q A;  1DJY A;  1K8U A;  1EJ3 A;  3EVR A;  4P2Y B;  2M0R A;  3DF0 A;  4I5L B;  4UPG A;  1SCV A;  3KF9 A;  5AER A;  2KAY A;  2ZRT A;  2L4H A;  1B8L A;  3I5F B;  4YGC B;  1WRL A;  1MWN A;  2JT8 A;  1OE9 B;  1PK0 D;  2LC5 A;  3SG3 A;  3AKB A;  1M39 A;  1U5I A;  1IRJ A;  2WC8 A;  1MXE A;  4IL1 A;  2OS8 C;  2GGM A;  1JBA A;  1B1G A;  2CCM A;  4D1E A;  1NCY A;  1KQV A;  1B8C A;  2I7A A;  4N1F A;  4YGA A;  4GBA A;  1K95 A;  1KK8 C;  1JF0 A;  4PAL A;  5CPV A;  4JPZ B;  1OMV A;  4HRG A;  4YI9 A;  4GGN A;  2I18 A;  4P5O E;  1IJ5 A;  1NSH A;  2JOJ A;  2KFH A;  2PAL A;  1MUX A;  1DJI A;  3MSE B;  3CTN A;  1PUL A;  4M2Q A;  1Y1X A;  3VRQ A;  1YUS A;  2M1U A;  2JWW A;  1WRZ A;  2LVK A;  3SG7 A;  1Q80 A;  1H4B A;  2M97 A;  3A8R A;  1OSA A;  1NP8 A;  4MSP A;  1QX7 A;  1CNP A;  2JRF A;  1KWO C;  2Q4U A;  5I2Q A;  2F3Y A;  1K96 A;  2LHL A;  4CPV A;  5KU1 A;  2KDH A;  1B8R A;  2LLT A;  2M1K B;  4YBH B;  4C0J A;  5I8N A;  1SCM C;  1TCO B;  3VRO A;  4YGE B;  1F54 A;  3OB2 B;  2JZI A;  4QJ4 B;  2MLE C;  1KFX L;  2MRD A;  1QLK A;  3DF0 B;  1FW4 A;  1MHO A;  3BQ3 A;  4MRX A;  2LM5 A;  3WXA A;  2JT0 A;  4ORC B;  3OHM B;  2JNX A;  3EVV A;  2KI6 C;  4MVF A;  2JXL A;  2WND A;  2JC2 A;  1BOD A;  1NIW A;  1REC A;  1AUI B;  2Y5I A;  1RTP 1;  3SIA A;  1FBV A;  4OKH A;  1KCY A;  3SG4 A;  4NQG A;  4A4B A;  4JWQ A;  2M3W A;  3FWB A;  1CLM A;  3CWG A;  2M49 B;  2LAP A;  3BUN B;  4BY5 A;  3CLN A;  1DF0 A;  4CLN A;  1UHH A;  3BYA A;  3WHT B;  3LK1 A;  2BL0 B;  5CSF A;  1EXR A;  1LA0 A;  2I94 A;  1KQM B;  2HF5 A;  1GGZ A;  2L98 A;  3TZ1 A;  1C07 A;  1TCF A;  5JOL A;  4DRW A;  1SR6 C;  2LAN A;  4MEW A;  5KTY A;  3OX6 A;  1SKT A;  2NZ0 A;  5CSI A;  3TS5 B;  1CDM A;  1KFU L;  1OZO A;  4AQI A;  1XVJ A;  1SBJ A;  4I5N B;  1S26 D;  2Q91 A;  2WCF A;  4YI8 A;  3WNX B;  1UWO A;  5IBW A;  1MR8 A;  1F55 A;  1XFV O;  2KGR A;  1S5G Z;  3I5H C;  4ZCU A;  1SK6 D;  4PE1 A;  1S5G Y;  1NX2 A;  1S3P A;  2K61 A;  2NCP A;  2Y1M A;  1IKU A;  2JUL A;  2OS8 B;  1UHJ A;  1XO5 A;  1YVH A;  3I5I C;  5PAL A;  2EC6 C;  3AKA A;  1IWQ A;  1ZUZ A;  2PSR A;  4NDB A;  3I5G C;  1ZFS A;  1XA5 A;  3GK1 A;  4M2P A;  3BUM B;  1QAT A;  4L9M A;  2JQ6 A;  4WRI A;  4DIR A;  1CM4 A;  2LVI A;  2JXC A;  1W7J B;  1K9U A;  5CSN A;  3O78 A;  3DD4 A;  1CMG A;  4ORB B;  1K94 A;  3GK2 A;  1B4C A;  4PHJ A;  1XFW O;  2L5X B;  1W7I B;  1CM1 A;  2H2K A;  3O6B A;  2KI4 C;  1BLQ A;  1JWD A;  1C7W A;  1L2O B;  2OTG C;  4CID A;  2M9G A;  5AAN A;  3VRR A;  5HLV A;  2O60 A;  3EK8 A;  3LK0 A;  1CLL A;  2ZFD A;  3E3R A;  3ZWH A;  1AVS A;  1CMF A;  1K2H A;  1KWO B;  3ZNI A;  1DF0 B;  2GGZ A;  1A2X A;  3EVU A;  2K2A A;  2MJW B;  4MBE A;  2IS9 A;  3EKH A;  5BPJ A;  3O4Y A;  4GGF C;  2HQ8 A;  2O5G A;  4A4C A;  3CZT X;  2JT3 A;  2H61 C;  2CBL A;  2EGD A;  4AOM A;  1LXF C;  5DKQ A;  4ZCV A;  4PE7 A;  2RGI A;  2Y1N A;  3VRP A;  2NXQ A;  4GNK B;  1QX5 B;  2MHH A;  3FIA A;  2KHN A;  5HYD A;  1XFU O;  2MA2 A;  1N65 A;  4PHM A;  1AJ4 A;  5G08 A;  3TDZ A;  2KOT A;  2OPO A;  1S6J A;  4MZK A;  1CKK A;  1KSO A;  1V1F A;  2ISD A;  1YX7 A;  1UP5 A;  1FI6 A;  2BCB A;  1C7V A;  2JNF A;  1BR1 B;  1AK8 A;  5CSJ A;  1K93 D;  4CFR A;  1NUB A;  2LE9 B;  2EHB A;  2LLU A;  2K7B A;  3IQO A;  1IGV A;  4NDD A;  5KSZ A;  3SIB A;  3TUY C;  2KAV A;  1R6P A;  1B7T Y;  2LLS A;  1BOC A;  1QJT A;  2M7N A;  3RLZ A;  1PRW A;  1GJY A;  1QV0 A;  1S6C A;  2H61 A;  3CR2 A;  2ZN8 A;  1CB1 A;  1GGW A;  1IH0 A;  3JVT B;  1NX1 A;  2ZRS A;  3BUX B;  3VRN A;  4MN0 A;  4MZL A;  1DMO A;  1FF1 A;  1GQM A;  4F0Z B;  3EKJ A;  2QAC A;  1YUU A;  3BUW B;  2WOR A;  2LNK A;  1YVL A;  4PDZ A;  1UHK A;  5FYX A;  2BBM A;  1DGU A;  4MZJ A;  3PN7 C;  1DJW A;  5K89 A;  1DVI A;  1J7O A;  1PSB A;  1YRT B;  4MLW A;  5I2L A;  3I5I B;  1TNW A;  2EC6 B;  1TTX A;  1Y1U A;  1OOJ A;  4NDC A;  1HT9 A;  2WCE A;  3I5G B;  2KAX A;  1UHN A;  1DJZ A;  4AQJ A;  2LP2 A;  2KBM A;  1NX0 A;  3PAL A;  2Y4Q A;  1IG5 A;  1YUT A;  1DJH A;  3BOW B;  3DVM A;  2L2E A;  1RRO A;  2F2P A;  1OMD A;  1CFP A;  1JFJ A;  1F4O A;  4OV2 A;  1LIN A;  1WDC C;  2KI4 B;  2PMY A;  1SL9 A;  2OTG B;  4PCW A;  2BKH B;  2A4J A;  2NCO A;  3KPX A;  5DKN A;  3PAT A;  1RK9 A;  1Y6W A;  4YGD B;  1PAL A;  1D1O A;  2DOQ A;  2D8N A;  1WLZ A;  2LUC A;  2HQW A;  1ZOT B;  3D0Y A;  1RWY A;  1DJG A;  2K7O A;  4C0K A;  1DT7 B;  1KSM A;  1SYM A;  3CR4 X;  1R2U A;  1CFD A;  4HSZ A;  1OZS A;  3F45 A;  1F70 A;  2BE4 A;  2K2F A;  1AP4 A;  1KK8 B;  1CFF A;  1SMG A;  1NWD A;  2K7C A;  1XFZ O;  3A4U B;  1QX2 A;  3KEV A;  1CDP A;  1XFX O;  1EH2 A;  2G9B A;  4YRU A;  4JQ0 D;  4DCK A;  3WHU B;  2FCE A;  2GV5 A;  1DTL A;  5AEQ A;  2CT9 A;  2K7D A;  3PFV A;  1SPY A;  1EG4 A;  1S36 A;  2AAO A;  3LCP C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...