2KQYA

Solution structure of avian thymic hormone
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
108
structure length
108
Chain Sequence
AITDILSAKDIESALSSCQAADSFNYKSFFSTVGLSSKTPDQIKKVFGILDQDKSGFIEEEELQLFLKNFSSSARVLTSAETKAFLAAGDTDGDGKIGVEEFQSLVKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Avian Thymic Hormone, a High-Affinity Avian beta-Parvalbumin, in the Ca(2+)-Free and Ca(2+)-Bound States.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Metal binding protein
molecule keywords Parvalbumin, thymic
total genus 16
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2009-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2kqyA00
1H8BA 3DF0B 1IQ5A 3PALA 2L98A 5ER5A 1YX8A 4NQGA 1SL7A 4ORBB 2BCAA 1L2OB 2JXCA 1J7PA 3JVTC 2OPOA 1NX3A 2NCOA 1CNPA 3PLFB 4PCWA 2NCPA 5AEQA 4DRWA 1ZMZA 4C0LA 1KFUS 3TDIA 4N5XA 1AJ5A 1S3PA 4YGEB 1DGVA 1X02A 1NCYA 4PHNA 1XVJA 1EG3A 1N0YA 5D69A 2LMUA 3O4YA 1NYAA 4MSPA 4MZLA 2LUXA 2M29A 2QACA 2RGIA 2KNEA 1AK8A 1QX5B 2SCPA 4P2YB 2LM5A 2BCBA 2Q4UA 2L2EA 2ZFDA 2KQYA 1TNPA 2VRGA 3BUMB 1SRAA 2HQ8A 1QX2A 1K96A 3BOWA 3EK4A 3BUWB 1PVBA 1ODBA 5PALA 1XK4C 1B9AA 2NLNA 2PVBA 2JTTA 3SIBA 3CGAA 3SG7A 5D7FA 2HETA 3D0YB 4FTGA 2H2KA 2Q91A 5TNCA 3ICBA 1TRFA 2FOTA 3WHUB 1RECA 1KK7Z 5AFPA 3IQOA 4WQ2A 5CSJA 5KSZA 1BU3A 2G2BA 4OVNF 2JWWA 1BLQA 1IG5A 1SBJA 3LK1A 1J7QA 2JNFA 1CFCA 1OMDA 1BT6A 1LKJA 5G08A 1ALVA 1XYDA 1B47A 1UHIA 5DKNA 1EJ3A 2CXJA 3F45A 2LHIA 1NX1A 1ALWA 1QV0A 1CM1A 1JUOA 3VRPA 1OMRA 5CSNA 3DVJA 3I5IC 3NSLA 1Y0VH 2KGBC 1S36A 3CR4X 2TN4A 2A4JA 2LE9B 1QIWA 2WCFA 4GAOA 4NDBA 5HKWA 2LMVA 1RTP1 3GK1A 2NZ0A 1UHJA 2K7DA 3PATA 2MHHA 1KWOB 3TUYC 3GK2A 1WRZA 1GGZA 1MR8A 2CBLA 3NSOA 1BOCA 3CTNA 1DJHA 4I5NB 4I5KA 4QJ5B 1KFXL 2WC8A 2I2RE 1CMFA 2LLTA 3CR5X 1OSAA 1N2DA 1EXRA 2LNKA 2WCBA 2LLUA 3EKJA 1MHOA 1TCFA 1K8UA 1U5IB 3TS5C 1KFUL 1KK8C 1W7JB 2M97A 1XFUO 4CFQA 3KO0A 4HRGA 4MZKA 4ETOA 2ZRTA 4QJ4B 2JXLA 2HQWA 1JFJA 2BKHB 4CFRA 2PSRA 3BYAA 2EC6C 2WOSA 1CFFA 1WRKA 2KOTA 4NDCA 1SCMB 1M39A 1QLSA 1M31A 3DD4A 1EG4A 2F3ZA 1PVAA 4M2PA 1TCOB 1ZUZA 1SK6D 2GV5A 3I5HB 2KHNA 1MQ1A 3SIAA 3ZWHA 2LVIA 1UP5A 1CLMA 3OX6A 1CDMA 2M9GA 2V53A 1F70A 4MRXA 1UHNA 2L5XB 1SPYA 2BECA 1OQPA 4GBAA 2IS9A 1E8AA 2FCEA 5FYXA 1Y1UA 2Y1NA 2KAYA 3PN7B 1QVIZ 1G8IA 2BBNA 5KTYA 1BODA 1CDPA 4XJKA 1IJ6A 2KBMA 1WLZA 4DS7A 1K94A 1QS7A 3DF0A 2KGRA 3VRNA 1JWDA 4WRIA 2K7CA 2K2FA 1SR6C 1XFWO 2LC5A 3QRXA 1B4CA 4P5OE 4DUQA 1RFJA 1NX0A 1QXPA 1DF0B 3MSEB 3BUXB 3JTDB 2EGDA 1CB1A 1C07A 4CLNA 1SL8A 4M2QA 1A75B 2KI6D 2EHBA 4PHJA 3SG5A 2H61C 3D10A 2KSPA 1UHKA 5JJGA 1SCMC 3C1VA 4HRHA 1LXFC 1KFXS 4MVFA 3OX5A 3BUNB 3NXAA 1KQVA 2ZN8A 2D8NA 1BF5A 1YRTB 3EVUA 1EL4A 2JNXA 2ZNDA 3BXKA 1JF2A 1SW8A 1YTZC 3CWGA 3TS5B 2L50A 1M45A 1KSMA 4YRUA 4MN0A 1WDCB 2Y1MA 3I5FB 3LCPC 1A4PA 2LP3A 5HLOA 1TIZA 1LA0A 1DJYA 1DJGA 1RWYA 4PE4A 1KK8B 2L51A 3CR2A 5I2OA 1K9UA 1F8HA 1KWOC 1B8LA 2MA2A 4ZCVA 3O2PA 3EKHA 5F6TA 4YGBB 1QV1A 1MXLC 3WHTB 2K0JA 1DVIA 1WRLA 1N65A 1RROA 1AHRA 2AMIA 3FS7A 1KCYA 1S26D 1F71A 4DCKA 1JBAA 2HPSA 1R2UA 1OZSA 3O78A 4IL1A 3KPXA 1DGUA 3BOWB 1A29A 4GPLB 4MRYA 2OS8B 1L7ZA 3LK0A 3TDZA 1NPQA 3AKAA 2LHLA 5CPVA 2BE4A 2JTZA 4N1GA 1A75A 2KQ6A 1JC2A 4OR9B 1S6CA 1UURA 4FQOA 3OB1B 1QLKA 1UWOA 1F55A 3CS1A 4M2OA 1YVHA 2MLFC 1CFPA 2PRUA 5GQQC 1IRJA 3EVRA 1CLBA 4MEWA 4Q04A 1A2XA 1Y1XA 2MAZA 4F0ZB 5JOLA 1TN4A 3A8RA 3OHMB 1RK9A 3TUYB 2I7AA 1YUTA 1V1FA 1QJTA 1FI6A 3SJSA 2M7LA 1KQMB 2MBXA 2LLSA 1S6JA 2DOQA 1QASA 3IQQA 1MUXA 5HLVA 2KFFA 2KI4B 1C7VA 5HKZA 4JWQA 1OZOA 1SL9A 2L0PA 1OOJA 4TNCA 4CIDA 1XFYO 3NSKA 2O5GA 1XFZO 1NWDA 1F4QA 4YGCB 1YVLA 2LV7A 1B8RA 2HF5A 3M0WA 1YURA 1K93D 1B8CA 2M1UA 3PN7C 1LINA 4YI9A 4MLWA 2PALA 2CNPA 4D1EA 2CT9A 3A4UB 2ISDA 1CDNA 1TNQA 2NXQA 1FPWA 4A4BA 1L2OC 2JQ6A 3IF7A 5I8NA 4JPZB 1F54A 2ZN9A 1DJWA 1DJZA 1HQVA 2JT8A 1SKTA 3I5HC 5DKQA 1XO5A 1BR1B 4AQJA 2KAVA 2JOJA 3E3RA 1CDLA 3FWBA 3SG4A 2JT0A 1NP8A 3O6BA 1QVIY 2LAPA 2I94A 1DMOA 2M1KB 3TZ1A 1WY9A 1YUSA 1FI5A 2I18A 2F2OA 3PSRA 1JSAA 4ZCUA 2O60A 4C0KA 4L9MA 1R6PA 2KYFA 1F4OA 5HKYA 4XYNA 2WORA 3WNXB 1QIVA 2M0RA 1NCXA 4PHKA 3SG3A 1JFKA 3VGOA 4BY5A 3PFVA 2BKIB 2E30A 2QPTA 2LCPA 1GQMA 1ZACA 1WLMA 3VRQA 1IGVA 5DKRA 1S1EA 1G4YR 1OMVA 1MXEA 1ZFSA 4YGDB 2LP2A 1H4BA 2Y4QA 1CKKA 1QTXA 1FBVA 1UUSA 1M46A 3LLEA 1SR6B 1V1GA 2E6WA 2Y5IA 4I5LB 1EH2A 1DTLA 1DF0A 1QATA 3CZTX 3NSIA 4PHMA 2MLEC 2KDHA 1AP4A 5AXIA 1J55A 2OTGC 1S5GZ 1PULA 5BPJA 1K9KA 1W7IB 3D0YA 2L4HA 1TNXA 4OCIA 1J7RA 1MWNA 1YRUB 2G9BA 5CSFA 1B1GA 3ZNIA 3AAJA 1NUBA 3FIAA 1KQMC 1IQ3A 2KFHA 4PE1A 2ZNEA 3K21A 1Q80A 3DVEA 1PRWA 1YUUA 2WNDA 1K2HA 1IH0A 3JVTB 2BL0B 1CMGA 3KF9A 4GUKA 4ORAB 1JF0A 1G33A 4MBEA 4U8DA 3FWCA 3AAKA 1BR4B 1KSOA 1XFVO 1PK0D 2KYCA 2M7NA 1PSRA 1DT7B 2M8UA 1CLLA 3PM8A 2JRFA 4AQIA 4BY4A 3BUOB 5J3XA 3SG2A 2LUCA 2PASA 1PALA 2K7OA 5HYDA 1S6IA 2MJWB 5I2QA 3EK7A 4YI8A 2OS8C 3GK4X 1YR5A 4GFTA 4DIRA 2F2PA 1Y1AA 2H61A 1D1OA 2KI6C 2LMTA 1B7TZ 2COLB 2K8MB 3VROA 1UHHA 1XK4A 2F3YA 4CPVA 5IBWA 1K9PA 2JU0A 1BJFA 4R1EA 1U5IA 1AVSA 1NX2A 4UPGA 2LVKA 5ER4X 2AAOA 3TDUA 2KBIA 3I5GC 5B8IB 1TTXA 5KU1A 2SASA 2K61A 2JULA 4JQ0D 2LVJA 2K7BA 3GOFA 1IWQA 1GJYA 2BCXA 2B1UA 3HCMA 2JZIA 1CM4A 4OKHA 1Y6WA 1K90D 2MRDA 1NCZA 1DJIA 3KHEA 1IJ5A 1YX7A 5AANA 1AJ4A 2KAXA 3I5FC 2WCEA 2LVVA 1CTRA 1XA5A 2BE6A 2ZKMX 4WQ3A 2KFGA 2KI4C 1J1DA 4QJ3B 1CFDA 1BG1A 2CCMA 2BBMA 1C7WA 4YBHB 1K95A 4GNKB 2F8PA 5CSIA 4HSZA 1J7OA 2M3WA 2ZRSA 4USLA 1A03A 1B7TY 3I5GB 2R2IA 3BQ3A 4A4CA 2JT3A 3AKBA 3VRRA 1TNWA 1OE9B 1SNLA 3SG6A 1AUIB 1SCVA 4HREE 4ICBA 2GGMA 3WXAA 3LL8B 3RLZA 5K89A 4OV2A 3H4SE 1WDCC 3JTDC 2LANA 4N1FA 1FF1A 4GGNA 1DJXA 4NDDA 3DVMA 1MF8B 3I5IB 1LVCD 5AERA 4PALA 1LA3A 4GGFA 1NSHA 1HT9A 4PDZA 1TOPA 2OTGB 2GGZA 1GGWA 1PSBA 1XFXO 1J1EA 1IKUA 4E68A 2M49B 1VRKA 2JPTA 3EK8A 3HX4A 1BMOA 1NIWA 1ZOTB 1QX7A 4YGAA 1SMGA 1S5GY 1SYMA 4GGFC 4XJKB 1SY9A 1M63B 4MZJA 4PE7A 2BL0C 4PE0A 3OB2B 4AOMA 3RM1A 2PMYA 2L4IA 2AUCA 3DVKA 3KEVA 1KK7Y 1RJVA 1FW4A 3OP0A 4C0JA 2JC2A 4ORCB 2CTNA 5I2LA 3EVVA 2EC6B 2F33A 2K2AA 3CLNA 4I5JA 2FCDA 2P6BB 2FJUB
chains in the Genus database with same CATH superfamily
1H8BA 3DF0B 1IQ5A 5DICA 3PALA 2L98A 5ER5A 1YX8A 4NQGA 1SL7A 4ORBB 2BCAA 1L2OB 2JXCA 1J7PA 3JVTC 2OPOA 1NX3A 2NCOA 2WCLA 1CNPA 3PLFB 4PCWA 2QDIA 2NCPA 3NHIA 5AEQA 4DRWA 1ZMZA 4C0LA 3D73A 3OBVA 1KFUS 3TDIA 4N5XA 1ORGA 1AJ5A 1S3PA 4YGEB 1DGVA 1X02A 1NCYA 4PHNA 1XVJA 1EG3A 1N0YA 3PJIA 5D69A 2LMUA 3O4YA 1NYAA 4MSPA 4MZLA 3R72A 2LUXA 2M29A 2QACA 2RGIA 2KNEA 1AK8A 1QX5B 2P71A 2SCPA 4P2YB 2LM5A 2BCBA 2Q4UA 2L2EA 1C3ZA 2KQYA 1TNPA 2ZFDA 2VRGA 3BUMB 1SRAA 2HQ8A 1QX2A 1K96A 1LS8A 3BOWA 3BUWB 1PVBA 1ODBA 3EK4A 1XK4C 1B9AA 2NLNA 2PVBA 2JTTA 3CZ2A 2QEBA 3CGAA 3SIBA 3SG7A 5D7FA 2HETA 3D0YB 2QEHA 2H2KA 2Q91A 4FTGA 3ICBA 1TRFA 2FOTA 1TUJA 1RECA 1KK7Z 5TNCA 3WHUB 3IQOA 4WQ2A 5CSJA 5KSZA 1BU3A 2G2BA 4OVNF 2JWWA 1BLQA 1IG5A 1SBJA 3LK1A 1J7QA 2JNFA 1CFCA 1OMDA 1BT6A 1LKJA 5G08A 1ALVA 1XYDA 1B47A 1UHIA 5DKNA 1EJ3A 2CXJA 3F45A 2LHIA 1NX1A 1ALWA 1QV0A 1CM1A 1JUOA 5EL2A 3VRPA 5I94A 1OMRA 5CSNA 3DVJA 3I5IC 3D76A 3NSLA 1Y0VH 2KGBC 1S36A 3CR4X 2TN4A 1IIOA 1OOIX 2A4JA 2K60A 2LE9B 1QIWA 2WCFA 4GAOA 4NDBA 1TWOA 2LMVA 1RTP1 5HKWA 3GK1A 2NZ0A 1UHJA 2K7DA 3PATA 2MHHA 1KWOB 3TUYC 3GK2A 1WRZA 1GGZA 1MR8A 3D75A 2CBLA 3NGVA 3NSOA 1BOCA 3CTNA 1DJHA 4I5NB 1P28A 4I5KA 4QJ5B 1KFXL 2WC8A 1W9ZA 2I2RE 2LLTA 1CMFA 3CR5X 1OSAA 1N2DA 3R1PA 1EXRA 3DZTA 2LNKA 2WCBA 1OOFA 2LLUA 1MHOA 1TCFA 3EKJA 1U5IB 1K8UA 3TS5C 5AFPA 1KFUL 1KK8C 1W7JB 2M97A 1XFUO 4CFQA 3KO0A 4HRGA 4MZKA 4ETOA 2ZRTA 2H8VA 2JXLA 2HQWA 4QJ4B 1JFJA 2BKHB 4CFRA 2PSRA 3BYAA 2EC6C 2WOSA 1CFFA 1WRKA 3S0GA 2KOTA 4NDCA 1SCMB 1M39A 3S0FA 1QLSA 1M31A 3DD4A 1EG4A 2F3ZA 1PVAA 4M2PA 1TCOB 1ZUZA 1SK6D 2GV5A 3I5HB 2KHNA 1MQ1A 3SIAA 3ZWHA 2LVIA 1TUZA 1UP5A 1CLMA 3OX6A 1CDMA 2M9GA 3L4AA 2V53A 3B7AA 1F70A 4MRXA 1UHNA 2L5XB 1SPYA 2BECA 1OQPA 4GBAA 2IS9A 3D77A 3UNWA 1E8AA 2FCEA 5FYXA 1Y1UA 2Y1NA 2KAYA 3PN7B 1QVIZ 1G8IA 2BBNA 5KTYA 1BODA 1CDPA 4XJKA 1IJ6A 2KBMA 1WLZA 2PYQA 4DS7A 1K94A 1QS7A 3DF0A 2KGRA 3VRNA 1JWDA 4WRIA 2K7CA 2K2FA 1SR6C 1XFWO 2LC5A 3QRXA 1B4CA 1DELA 3IVTA 4P5OE 4DUQA 1RFJA 1NX0A 1QXPA 1DF0B 3MSEB 3BUXB 3JTDB 2EGDA 1CB1A 1C07A 4CLNA 1SL8A 4M2QA 1A75B 2KI6D 2EHBA 4PHJA 3SG5A 2H61C 3D10A 2KSPA 1UHKA 5JJGA 1SCMC 3C1VA 4OZDA 4HRHA 1LXFC 1KFXS 4MVFA 3OX5A 3BUNB 3NXAA 1KQVA 2ZN8A 2D8NA 3D74A 1BF5A 3R1OA 3O4XA 1YRTB 3EVUA 1EL4A 1Z4HA 2JNXA 3S0EA 2ZNDA 3BXKA 1JF2A 1SW8A 1YTZC 3CWGA 3TS5B 2L50A 1M45A 1KSMA 4JD9A 4YRUA 4MN0A 1WDCB 2Y1MA 3I5FB 3LCPC 1A4PA 2LP3A 5HLOA 1TIZA 1LA0A 1DJYA 1DJGA 3S0DA 1RWYA 4PE4A 5PALA 3DY9A 1KK8B 2L51A 3CR2A 5I2OA 1K9UA 1F8HA 1KWOC 1B8LA 2MA2A 4ZCVA 3O2PA 1QWVA 3EKHA 5F6TA 4YGBB 1C3YA 1QV1A 1MXLC 3BFBA 3WHTB 2K0JA 1DVIA 1WRLA 1N65A 1RROA 1AHRA 3SS3A 2AMIA 3FS7A 1KCYA 1S26D 2PQLA 4DCKA 1F71A 1Z2CB 2HPSA 1JBAA 3CYZA 1R2UA 1OZSA 3O78A 4IL1A 3KPXA 1DGUA 3BOWB 1A29A 4GPLB 4MRYA 3RZSA 2OS8B 1L7ZA 3LK0A 3TDZA 1NPQA 3AKAA 2LHLA 5CPVA 2BE4A 2JTZA 4N1GA 1A75A 2KQ6A 1JC2A 4OR9B 1S6CA 1UURA 4FQOA 3OB1B 1QLKA 1UWOA 1F55A 4INXA 3CS1A 3L47A 1YVHA 2MLFC 4M2OA 1CFPA 2PRUA 5GQQC 1IRJA 2WCJA 3EVRA 1CLBA 4MEWA 4Q04A 1A2XA 1Y1XA 2MAZA 4F0ZB 5JOLA 1TN4A 3A8RA 3OHMB 1RK9A 3TUYB 2I7AA 1YUTA 1V1FA 1QJTA 1FI6A 3SJSA 2WCKA 2GTEA 1KQMB 3OGNA 2LLSA 2M7LA 1S6JA 2DOQA 2MBXA 1QASA 3IQQA 1MUXA 4FQTA 5HLVA 2KFFA 2KI4B 1C7VA 5HKZA 4JWQA 1OZOA 1SL9A 2L0PA 1OOJA 4TNCA 4CIDA 1XFYO 3N7HA 3NSKA 2O5GA 1XFZO 2BAPA 1NWDA 1F4QA 4YGCB 1YVLA 2LV7A 1B8RA 2HF5A 3M0WA 1YURA 1K93D 1B8CA 2M1UA 3PN7C 1LINA 4IJ7A 4YI9A 4MLWA 3VB1A 2PALA 2CNPA 4D1EA 2CT9A 3A4UB 3L4LA 3FE6A 2ISDA 1CDNA 1TNQA 2NXQA 3B6XA 4F7FA 3B88A 1FPWA 4A4BA 1L2OC 2JQ6A 3IF7A 5I8NA 4JPZB 3QMEA 1F54A 2ZN9A 3BFHA 1DJWA 1DJZA 1HQVA 2JT8A 2YGUA 3BJHA 1SKTA 3I5HC 5DKQA 1XO5A 1DQEA 1BR1B 4AQJA 2KAVA 2JOJA 3E3RA 1CDLA 3FWBA 3SG4A 4INWA 2JT0A 1NP8A 3Q8IA 3O6BA 1QVIY 2LAPA 2I94A 1DMOA 2M1KB 3TZ1A 1WY9A 1YUSA 2WCHA 1FI5A 2I18A 2F2OA 3FE9A 3PSRA 3R1VA 1JSAA 4ZCUA 2O60A 3PM2A 4C0KA 4L9MA 1R6PA 2KYFA 1F4OA 5HKYA 4XYNA 2WORA 3WNXB 1QIVA 2M0RA 1NCXA 2WCMA 4PHKA 3SG3A 1JFKA 3VGOA 4BY5A 3PFVA 2BKIB 2E30A 2L2CA 2QPTA 3BFAA 2LCPA 1GQMA 1ZACA 1WLMA 3VRQA 1IGVA 5DKRA 1S1EA 1G4YR 1OMVA 1MXEA 1ZFSA 2P70A 2LP2A 4YGDB 2Y4QA 1CKKA 1QTXA 1H4BA 1FBVA 1UUSA 1T14A 1M46A 3LLEA 1SR6B 1V1GA 2E6WA 2Y5IA 4I5LB 1EH2A 1GM0A 3CDNA 1DTLA 1DF0A 1QATA 3CZTX 3NSIA 4PHMA 2MLEC 2KDHA 1AP4A 3D78A 5AXIA 1J55A 2OTGC 1S5GZ 1PULA 5BPJA 1K9KA 1W7IB 2ERBA 3D0YA 2L4HA 1TNXA 4OCIA 5FI6A 1J7RA 1MWNA 1YRUB 2G9BA 5CSFA 1B1GA 3ZNIA 3AAJA 1NUBA 3FIAA 1KQMC 1IQ3A 2KFHA 4PE1A 2ZNEA 3K21A 1Q80A 2QEOA 3DVEA 3B86A 1PRWA 1YUUA 2WNDA 1K2HA 1IH0A 3JVTB 2BL0B 1CMGA 3KF9A 3SS5A 4GUKA 4ORAB 1OW4A 1JF0A 1G33A 4MBEA 4U8DA 3FWCA 3AAKA 1BR4B 1KSOA 5HL1A 1XFVO 1PK0D 2KYCA 2M7NA 3B87A 5FI7A 1PSRA 1DT7B 2M8UA 1CLLA 3PM8A 3CABA 2JRFA 4AQIA 4BY4A 3BUOB 5J3XA 3SG2A 2LUCA 2PASA 1PALA 2K7OA 5HYDA 1S6IA 2MJWB 5I2QA 3EK7A 4YI8A 2OS8C 3GK4X 1YR5A 4GFTA 4DIRA 5FI2A 2F2PA 1Y1AA 2H61A 1D1OA 2KI6C 2LMTA 1B7TZ 2COLB 2K8MB 3VROA 1UHHA 4JKTA 1XK4A 2F3YA 4CPVA 5IBWA 1K9PA 2JU0A 2KPHA 1BJFA 4R1EA 1U5IA 1AVSA 1NX2A 4PT1A 4UPGA 2LVKA 5ER4X 2AAOA 3TDUA 2KBIA 3I5GC 5B8IB 1TTXA 5KU1A 2SASA 2K61A 2JULA 3S0AA 4JQ0D 2LVJA 2K7BA 3CZ1A 3GOFA 1IWQA 1GJYA 2BCXA 2B1UA 3HCMA 2JZIA 1CM4A 4OKHA 1Y6WA 1K90D 2MRDA 2WC6A 1NCZA 1DJIA 3KHEA 1IJ5A 1YX7A 5AANA 1AJ4A 2KAXA 3I5FC 2WCEA 3K1EA 2LVVA 1CTRA 1XA5A 2BE6A 2ZKMX 4WQ3A 2KFGA 2L5YA 1DEKA 2KI4C 1J1DA 4QJ3B 1CFDA 1BG1A 2CCMA 2BBMA 1C7WA 4YBHB 1K95A 4GNKB 2F8PA 5CSIA 4HSZA 1J7OA 2M3WA 2ZRSA 4USLA 1A03A 2KLEA 1B7TY 3I5GB 2FJYA 2R2IA 3BQ3A 4A4CA 2JT3A 3AKBA 3VRRA 1TNWA 1OE9B 1SNLA 2KLDA 3CZ0A 3SG6A 1AUIB 1SCVA 4HREE 4ICBA 2GGMA 3WXAA 3LL8B 3RLZA 5K89A 4OV2A 3H4SE 1WDCC 3JTDC 2LANA 4N1FA 1FF1A 4GGNA 1DJXA 4NDDA 3DVMA 1MF8B 3I5IB 1LVCD 5AERA 4PALA 1LA3A 3DXLA 4GGFA 1NSHA 1HT9A 4PDZA 3UO9A 1TOPA 2OTGB 1OOGA 2GGZA 1GGWA 2QEVA 1PSBA 1XFXO 1J1EA 1IKUA 4E68A 3NHTA 2M49B 3S0BA 1VRKA 2JPTA 2WC5A 3EK8A 1BMOA 3HX4A 1NIWA 3V2LA 1ZOTB 2BNXA 1QX7A 3DYEA 4YGAA 1SMGA 1S5GY 1SYMA 4GGFC 4XJKB 1SY9A 1M63B 1OOHA 1XFRA 4MZJA 4PE7A 2BL0C 3EG5B 3FE8A 4PE0A 3OB2B 4AOMA 3RM1A 2PMYA 1DC1A 2L4IA 2AUCA 3DVKA 3KEVA 1KK7Y 1RJVA 2JPOA 4KYNA 1FW4A 3OP0A 4C0JA 2JC2A 4ORCB 1SSEB 2CTNA 5D3OA 5I2LA 3EVVA 2EC6B 3SS4A 2F33A 2K2AA 3CLNA 4I5JA 2FCDA 2P6BB 2FJUB
chains in the Genus database with same CATH topology
1H8BA 3DF0B 1IQ5A 3PALA 2L98A 5ER5A 1YX8A 4NQGA 1SL7A 4ORBB 2BCAA 1L2OB 2JXCA 1J7PA 3JVTC 2OPOA 1NX3A 2NCOA 1CNPA 3PLFB 4PCWA 2NCPA 5AEQA 4DRWA 1ZMZA 4C0LA 1KFUS 3TDIA 4N5XA 1AJ5A 1S3PA 4YGEB 1DGVA 1X02A 1NCYA 4PHNA 1XVJA 1EG3A 1N0YA 5D69A 2LMUA 3O4YA 1NYAA 4MSPA 4MZLA 2LUXA 2M29A 2QACA 2RGIA 2KNEA 1AK8A 1QX5B 2SCPA 4P2YB 2LM5A 2BCBA 2Q4UA 2L2EA 2ZFDA 2KQYA 1TNPA 2VRGA 3BUMB 1SRAA 2HQ8A 1QX2A 1K96A 3BOWA 3EK4A 3BUWB 1PVBA 1ODBA 5PALA 1XK4C 1B9AA 2NLNA 2PVBA 2JTTA 3SIBA 3CGAA 3SG7A 5D7FA 2HETA 3D0YB 4FTGA 2H2KA 2Q91A 5TNCA 3ICBA 1TRFA 2FOTA 3WHUB 1RECA 1KK7Z 5AFPA 3IQOA 4WQ2A 5CSJA 5KSZA 1BU3A 2G2BA 4OVNF 2JWWA 1BLQA 1IG5A 1SBJA 3LK1A 1J7QA 2JNFA 1CFCA 1OMDA 1BT6A 1LKJA 5G08A 1ALVA 1XYDA 1B47A 1UHIA 5DKNA 1EJ3A 2CXJA 3F45A 2LHIA 1NX1A 1ALWA 1QV0A 1CM1A 1JUOA 3VRPA 1OMRA 5CSNA 3DVJA 3I5IC 3NSLA 1Y0VH 2KGBC 1S36A 3CR4X 2TN4A 2A4JA 2LE9B 1QIWA 2WCFA 4GAOA 4NDBA 5HKWA 2LMVA 1RTP1 3GK1A 2NZ0A 1UHJA 2K7DA 3PATA 2MHHA 1KWOB 3TUYC 3GK2A 1WRZA 1GGZA 1MR8A 2CBLA 3NSOA 1BOCA 3CTNA 1DJHA 4I5NB 4I5KA 4QJ5B 1KFXL 2WC8A 2I2RE 1CMFA 2LLTA 3CR5X 1OSAA 1N2DA 1EXRA 2LNKA 2WCBA 2LLUA 3EKJA 1MHOA 1TCFA 1K8UA 1U5IB 3TS5C 1KFUL 1KK8C 1W7JB 2M97A 1XFUO 4CFQA 3KO0A 4HRGA 4MZKA 4ETOA 2ZRTA 4QJ4B 2JXLA 2HQWA 1JFJA 2BKHB 4CFRA 2PSRA 3BYAA 2EC6C 2WOSA 1CFFA 1WRKA 2KOTA 4NDCA 1SCMB 1M39A 1QLSA 1M31A 3DD4A 1EG4A 2F3ZA 1PVAA 4M2PA 1TCOB 1ZUZA 1SK6D 2GV5A 3I5HB 2KHNA 1MQ1A 3SIAA 3ZWHA 2LVIA 1UP5A 1CLMA 3OX6A 1CDMA 2M9GA 2V53A 1F70A 4MRXA 1UHNA 2L5XB 1SPYA 2BECA 1OQPA 4GBAA 2IS9A 1E8AA 2FCEA 5FYXA 1Y1UA 2Y1NA 2KAYA 3PN7B 1QVIZ 1G8IA 2BBNA 5KTYA 1BODA 1CDPA 4XJKA 1IJ6A 2KBMA 1WLZA 4DS7A 1K94A 1QS7A 3DF0A 2KGRA 3VRNA 1JWDA 4WRIA 2K7CA 2K2FA 1SR6C 1XFWO 2LC5A 3QRXA 1B4CA 4P5OE 4DUQA 1RFJA 1NX0A 1QXPA 1DF0B 3MSEB 3BUXB 3JTDB 2EGDA 1CB1A 1C07A 4CLNA 1SL8A 4M2QA 1A75B 2KI6D 2EHBA 4PHJA 3SG5A 2H61C 3D10A 2KSPA 1UHKA 5JJGA 1SCMC 3C1VA 4HRHA 1LXFC 1KFXS 4MVFA 3OX5A 3BUNB 3NXAA 1KQVA 2ZN8A 2D8NA 1BF5A 1YRTB 3EVUA 1EL4A 2JNXA 2ZNDA 3BXKA 1JF2A 1SW8A 1YTZC 3CWGA 3TS5B 2L50A 1M45A 1KSMA 4YRUA 4MN0A 1WDCB 2Y1MA 3I5FB 3LCPC 1A4PA 2LP3A 5HLOA 1TIZA 1LA0A 1DJYA 1DJGA 1RWYA 4PE4A 1KK8B 2L51A 3CR2A 5I2OA 1K9UA 1F8HA 1KWOC 1B8LA 2MA2A 4ZCVA 3O2PA 3EKHA 5F6TA 4YGBB 1QV1A 1MXLC 3WHTB 2K0JA 1DVIA 1WRLA 1N65A 1RROA 1AHRA 2AMIA 3FS7A 1KCYA 1S26D 1F71A 4DCKA 1JBAA 2HPSA 1R2UA 1OZSA 3O78A 4IL1A 3KPXA 1DGUA 3BOWB 1A29A 4GPLB 4MRYA 2OS8B 1L7ZA 3LK0A 3TDZA 1NPQA 3AKAA 2LHLA 5CPVA 2BE4A 2JTZA 4N1GA 1A75A 2KQ6A 1JC2A 4OR9B 1S6CA 1UURA 4FQOA 3OB1B 1QLKA 1UWOA 1F55A 3CS1A 4M2OA 1YVHA 2MLFC 1CFPA 2PRUA 5GQQC 1IRJA 3EVRA 1CLBA 4MEWA 4Q04A 1A2XA 1Y1XA 2MAZA 4F0ZB 5JOLA 1TN4A 3A8RA 3OHMB 1RK9A 3TUYB 2I7AA 1YUTA 1V1FA 1QJTA 1FI6A 3SJSA 2M7LA 1KQMB 2MBXA 2LLSA 1S6JA 2DOQA 1QASA 3IQQA 1MUXA 5HLVA 2KFFA 2KI4B 1C7VA 5HKZA 4JWQA 1OZOA 1SL9A 2L0PA 1OOJA 4TNCA 4CIDA 1XFYO 3NSKA 2O5GA 1XFZO 1NWDA 1F4QA 4YGCB 1YVLA 2LV7A 1B8RA 2HF5A 3M0WA 1YURA 1K93D 1B8CA 2M1UA 3PN7C 1LINA 4YI9A 4MLWA 2PALA 2CNPA 4D1EA 2CT9A 3A4UB 2ISDA 1CDNA 1TNQA 2NXQA 1FPWA 4A4BA 1L2OC 2JQ6A 3IF7A 5I8NA 4JPZB 1F54A 2ZN9A 1DJWA 1DJZA 1HQVA 2JT8A 1SKTA 3I5HC 5DKQA 1XO5A 1BR1B 4AQJA 2KAVA 2JOJA 3E3RA 1CDLA 3FWBA 3SG4A 2JT0A 1NP8A 3O6BA 1QVIY 2LAPA 2I94A 1DMOA 2M1KB 3TZ1A 1WY9A 1YUSA 1FI5A 2I18A 2F2OA 3PSRA 1JSAA 4ZCUA 2O60A 4C0KA 4L9MA 1R6PA 2KYFA 1F4OA 5HKYA 4XYNA 2WORA 3WNXB 1QIVA 2M0RA 1NCXA 4PHKA 3SG3A 1JFKA 3VGOA 4BY5A 3PFVA 2BKIB 2E30A 2QPTA 2LCPA 1GQMA 1ZACA 1WLMA 3VRQA 1IGVA 5DKRA 1S1EA 1G4YR 1OMVA 1MXEA 1ZFSA 4YGDB 2LP2A 1H4BA 2Y4QA 1CKKA 1QTXA 1FBVA 1UUSA 1M46A 3LLEA 1SR6B 1V1GA 2E6WA 2Y5IA 4I5LB 1EH2A 1DTLA 1DF0A 1QATA 3CZTX 3NSIA 4PHMA 2MLEC 2KDHA 1AP4A 5AXIA 1J55A 2OTGC 1S5GZ 1PULA 5BPJA 1K9KA 1W7IB 3D0YA 2L4HA 1TNXA 4OCIA 1J7RA 1MWNA 1YRUB 2G9BA 5CSFA 1B1GA 3ZNIA 3AAJA 1NUBA 3FIAA 1KQMC 1IQ3A 2KFHA 4PE1A 2ZNEA 3K21A 1Q80A 3DVEA 1PRWA 1YUUA 2WNDA 1K2HA 1IH0A 3JVTB 2BL0B 1CMGA 3KF9A 4GUKA 4ORAB 1JF0A 1G33A 4MBEA 4U8DA 3FWCA 3AAKA 1BR4B 1KSOA 1XFVO 1PK0D 2KYCA 2M7NA 1PSRA 1DT7B 2M8UA 1CLLA 3PM8A 2JRFA 4AQIA 4BY4A 3BUOB 5J3XA 3SG2A 2LUCA 2PASA 1PALA 2K7OA 5HYDA 1S6IA 2MJWB 5I2QA 3EK7A 4YI8A 2OS8C 3GK4X 1YR5A 4GFTA 4DIRA 2F2PA 1Y1AA 2H61A 1D1OA 2KI6C 2LMTA 1B7TZ 2COLB 2K8MB 3VROA 1UHHA 1XK4A 2F3YA 4CPVA 5IBWA 1K9PA 2JU0A 1BJFA 4R1EA 1U5IA 1AVSA 1NX2A 4UPGA 2LVKA 5ER4X 2AAOA 3TDUA 2KBIA 3I5GC 5B8IB 1TTXA 5KU1A 2SASA 2K61A 2JULA 4JQ0D 2LVJA 2K7BA 3GOFA 1IWQA 1GJYA 2BCXA 2B1UA 3HCMA 2JZIA 1CM4A 4OKHA 1Y6WA 1K90D 2MRDA 1NCZA 1DJIA 3KHEA 1IJ5A 1YX7A 5AANA 1AJ4A 2KAXA 3I5FC 2WCEA 2LVVA 1CTRA 1XA5A 2BE6A 2ZKMX 4WQ3A 2KFGA 2KI4C 1J1DA 4QJ3B 1CFDA 1BG1A 2CCMA 2BBMA 1C7WA 4YBHB 1K95A 4GNKB 2F8PA 5CSIA 4HSZA 1J7OA 2M3WA 2ZRSA 4USLA 1A03A 1B7TY 3I5GB 2R2IA 3BQ3A 4A4CA 2JT3A 3AKBA 3VRRA 1TNWA 1OE9B 1SNLA 3SG6A 1AUIB 1SCVA 4HREE 4ICBA 2GGMA 3WXAA 3LL8B 3RLZA 5K89A 4OV2A 3H4SE 1WDCC 3JTDC 2LANA 4N1FA 1FF1A 4GGNA 1DJXA 4NDDA 3DVMA 1MF8B 3I5IB 1LVCD 5AERA 4PALA 1LA3A 4GGFA 1NSHA 1HT9A 4PDZA 1TOPA 2OTGB 2GGZA 1GGWA 1PSBA 1XFXO 1J1EA 1IKUA 4E68A 2M49B 1VRKA 2JPTA 3EK8A 3HX4A 1BMOA 1NIWA 1ZOTB 1QX7A 4YGAA 1SMGA 1S5GY 1SYMA 4GGFC 4XJKB 1SY9A 1M63B 4MZJA 4PE7A 2BL0C 4PE0A 3OB2B 4AOMA 3RM1A 2PMYA 2L4IA 2AUCA 3DVKA 3KEVA 1KK7Y 1RJVA 1FW4A 3OP0A 4C0JA 2JC2A 4ORCB 2CTNA 5I2LA 3EVVA 2EC6B 2F33A 2K2AA 3CLNA 4I5JA 2FCDA 2P6BB 2FJUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H8B A;  3DF0 B;  1IQ5 A;  3PAL A;  2L98 A;  5ER5 A;  1YX8 A;  4NQG A;  1SL7 A;  4ORB B;  2BCA A;  1L2O B;  2JXC A;  1J7P A;  3JVT C;  2OPO A;  1NX3 A;  2NCO A;  1CNP A;  3PLF B;  4PCW A;  2NCP A;  5AEQ A;  4DRW A;  1ZMZ A;  4C0L A;  1KFU S;  3TDI A;  4N5X A;  1AJ5 A;  1S3P A;  4YGE B;  1DGV A;  1X02 A;  1NCY A;  4PHN A;  1XVJ A;  1EG3 A;  1N0Y A;  5D69 A;  2LMU A;  3O4Y A;  1NYA A;  4MSP A;  4MZL A;  2LUX A;  2M29 A;  2QAC A;  2RGI A;  2KNE A;  1AK8 A;  1QX5 B;  2SCP A;  4P2Y B;  2LM5 A;  2BCB A;  2Q4U A;  2L2E A;  2ZFD A;  2KQY A;  1TNP A;  2VRG A;  3BUM B;  1SRA A;  2HQ8 A;  1QX2 A;  1K96 A;  3BOW A;  3EK4 A;  3BUW B;  1PVB A;  1ODB A;  5PAL A;  1XK4 C;  1B9A A;  2NLN A;  2PVB A;  2JTT A;  3SIB A;  3CGA A;  3SG7 A;  5D7F A;  2HET A;  3D0Y B;  4FTG A;  2H2K A;  2Q91 A;  5TNC A;  3ICB A;  1TRF A;  2FOT A;  3WHU B;  1REC A;  1KK7 Z;  5AFP A;  3IQO A;  4WQ2 A;  5CSJ A;  5KSZ A;  1BU3 A;  2G2B A;  4OVN F;  2JWW A;  1BLQ A;  1IG5 A;  1SBJ A;  3LK1 A;  1J7Q A;  2JNF A;  1CFC A;  1OMD A;  1BT6 A;  1LKJ A;  5G08 A;  1ALV A;  1XYD A;  1B47 A;  1UHI A;  5DKN A;  1EJ3 A;  2CXJ A;  3F45 A;  2LHI A;  1NX1 A;  1ALW A;  1QV0 A;  1CM1 A;  1JUO A;  3VRP A;  1OMR A;  5CSN A;  3DVJ A;  3I5I C;  3NSL A;  1Y0V H;  2KGB C;  1S36 A;  3CR4 X;  2TN4 A;  2A4J A;  2LE9 B;  1QIW A;  2WCF A;  4GAO A;  4NDB A;  5HKW A;  2LMV A;  1RTP 1;  3GK1 A;  2NZ0 A;  1UHJ A;  2K7D A;  3PAT A;  2MHH A;  1KWO B;  3TUY C;  3GK2 A;  1WRZ A;  1GGZ A;  1MR8 A;  2CBL A;  3NSO A;  1BOC A;  3CTN A;  1DJH A;  4I5N B;  4I5K A;  4QJ5 B;  1KFX L;  2WC8 A;  2I2R E;  1CMF A;  2LLT A;  3CR5 X;  1OSA A;  1N2D A;  1EXR A;  2LNK A;  2WCB A;  2LLU A;  3EKJ A;  1MHO A;  1TCF A;  1K8U A;  1U5I B;  3TS5 C;  1KFU L;  1KK8 C;  1W7J B;  2M97 A;  1XFU O;  4CFQ A;  3KO0 A;  4HRG A;  4MZK A;  4ETO A;  2ZRT A;  4QJ4 B;  2JXL A;  2HQW A;  1JFJ A;  2BKH B;  4CFR A;  2PSR A;  3BYA A;  2EC6 C;  2WOS A;  1CFF A;  1WRK A;  2KOT A;  4NDC A;  1SCM B;  1M39 A;  1QLS A;  1M31 A;  3DD4 A;  1EG4 A;  2F3Z A;  1PVA A;  4M2P A;  1TCO B;  1ZUZ A;  1SK6 D;  2GV5 A;  3I5H B;  2KHN A;  1MQ1 A;  3SIA A;  3ZWH A;  2LVI A;  1UP5 A;  1CLM A;  3OX6 A;  1CDM A;  2M9G A;  2V53 A;  1F70 A;  4MRX A;  1UHN A;  2L5X B;  1SPY A;  2BEC A;  1OQP A;  4GBA A;  2IS9 A;  1E8A A;  2FCE A;  5FYX A;  1Y1U A;  2Y1N A;  2KAY A;  3PN7 B;  1QVI Z;  1G8I A;  2BBN A;  5KTY A;  1BOD A;  1CDP A;  4XJK A;  1IJ6 A;  2KBM A;  1WLZ A;  4DS7 A;  1K94 A;  1QS7 A;  3DF0 A;  2KGR A;  3VRN A;  1JWD A;  4WRI A;  2K7C A;  2K2F A;  1SR6 C;  1XFW O;  2LC5 A;  3QRX A;  1B4C A;  4P5O E;  4DUQ A;  1RFJ A;  1NX0 A;  1QXP A;  1DF0 B;  3MSE B;  3BUX B;  3JTD B;  2EGD A;  1CB1 A;  1C07 A;  4CLN A;  1SL8 A;  4M2Q A;  1A75 B;  2KI6 D;  2EHB A;  4PHJ A;  3SG5 A;  2H61 C;  3D10 A;  2KSP A;  1UHK A;  5JJG A;  1SCM C;  3C1V A;  4HRH A;  1LXF C;  1KFX S;  4MVF A;  3OX5 A;  3BUN B;  3NXA A;  1KQV A;  2ZN8 A;  2D8N A;  1BF5 A;  1YRT B;  3EVU A;  1EL4 A;  2JNX A;  2ZND A;  3BXK A;  1JF2 A;  1SW8 A;  1YTZ C;  3CWG A;  3TS5 B;  2L50 A;  1M45 A;  1KSM A;  4YRU A;  4MN0 A;  1WDC B;  2Y1M A;  3I5F B;  3LCP C;  1A4P A;  2LP3 A;  5HLO A;  1TIZ A;  1LA0 A;  1DJY A;  1DJG A;  1RWY A;  4PE4 A;  1KK8 B;  2L51 A;  3CR2 A;  5I2O A;  1K9U A;  1F8H A;  1KWO C;  1B8L A;  2MA2 A;  4ZCV A;  3O2P A;  3EKH A;  5F6T A;  4YGB B;  1QV1 A;  1MXL C;  3WHT B;  2K0J A;  1DVI A;  1WRL A;  1N65 A;  1RRO A;  1AHR A;  2AMI A;  3FS7 A;  1KCY A;  1S26 D;  1F71 A;  4DCK A;  1JBA A;  2HPS A;  1R2U A;  1OZS A;  3O78 A;  4IL1 A;  3KPX A;  1DGU A;  3BOW B;  1A29 A;  4GPL B;  4MRY A;  2OS8 B;  1L7Z A;  3LK0 A;  3TDZ A;  1NPQ A;  3AKA A;  2LHL A;  5CPV A;  2BE4 A;  2JTZ A;  4N1G A;  1A75 A;  2KQ6 A;  1JC2 A;  4OR9 B;  1S6C A;  1UUR A;  4FQO A;  3OB1 B;  1QLK A;  1UWO A;  1F55 A;  3CS1 A;  4M2O A;  1YVH A;  2MLF C;  1CFP A;  2PRU A;  5GQQ C;  1IRJ A;  3EVR A;  1CLB A;  4MEW A;  4Q04 A;  1A2X A;  1Y1X A;  2MAZ A;  4F0Z B;  5JOL A;  1TN4 A;  3A8R A;  3OHM B;  1RK9 A;  3TUY B;  2I7A A;  1YUT A;  1V1F A;  1QJT A;  1FI6 A;  3SJS A;  2M7L A;  1KQM B;  2MBX A;  2LLS A;  1S6J A;  2DOQ A;  1QAS A;  3IQQ A;  1MUX A;  5HLV A;  2KFF A;  2KI4 B;  1C7V A;  5HKZ A;  4JWQ A;  1OZO A;  1SL9 A;  2L0P A;  1OOJ A;  4TNC A;  4CID A;  1XFY O;  3NSK A;  2O5G A;  1XFZ O;  1NWD A;  1F4Q A;  4YGC B;  1YVL A;  2LV7 A;  1B8R A;  2HF5 A;  3M0W A;  1YUR A;  1K93 D;  1B8C A;  2M1U A;  3PN7 C;  1LIN A;  4YI9 A;  4MLW A;  2PAL A;  2CNP A;  4D1E A;  2CT9 A;  3A4U B;  2ISD A;  1CDN A;  1TNQ A;  2NXQ A;  1FPW A;  4A4B A;  1L2O C;  2JQ6 A;  3IF7 A;  5I8N A;  4JPZ B;  1F54 A;  2ZN9 A;  1DJW A;  1DJZ A;  1HQV A;  2JT8 A;  1SKT A;  3I5H C;  5DKQ A;  1XO5 A;  1BR1 B;  4AQJ A;  2KAV A;  2JOJ A;  3E3R A;  1CDL A;  3FWB A;  3SG4 A;  2JT0 A;  1NP8 A;  3O6B A;  1QVI Y;  2LAP A;  2I94 A;  1DMO A;  2M1K B;  3TZ1 A;  1WY9 A;  1YUS A;  1FI5 A;  2I18 A;  2F2O A;  3PSR A;  1JSA A;  4ZCU A;  2O60 A;  4C0K A;  4L9M A;  1R6P A;  2KYF A;  1F4O A;  5HKY A;  4XYN A;  2WOR A;  3WNX B;  1QIV A;  2M0R A;  1NCX A;  4PHK A;  3SG3 A;  1JFK A;  3VGO A;  4BY5 A;  3PFV A;  2BKI B;  2E30 A;  2QPT A;  2LCP A;  1GQM A;  1ZAC A;  1WLM A;  3VRQ A;  1IGV A;  5DKR A;  1S1E A;  1G4Y R;  1OMV A;  1MXE A;  1ZFS A;  4YGD B;  2LP2 A;  1H4B A;  2Y4Q A;  1CKK A;  1QTX A;  1FBV A;  1UUS A;  1M46 A;  3LLE A;  1SR6 B;  1V1G A;  2E6W A;  2Y5I A;  4I5L B;  1EH2 A;  1DTL A;  1DF0 A;  1QAT A;  3CZT X;  3NSI A;  4PHM A;  2MLE C;  2KDH A;  1AP4 A;  5AXI A;  1J55 A;  2OTG C;  1S5G Z;  1PUL A;  5BPJ A;  1K9K A;  1W7I B;  3D0Y A;  2L4H A;  1TNX A;  4OCI A;  1J7R A;  1MWN A;  1YRU B;  2G9B A;  5CSF A;  1B1G A;  3ZNI A;  3AAJ A;  1NUB A;  3FIA A;  1KQM C;  1IQ3 A;  2KFH A;  4PE1 A;  2ZNE A;  3K21 A;  1Q80 A;  3DVE A;  1PRW A;  1YUU A;  2WND A;  1K2H A;  1IH0 A;  3JVT B;  2BL0 B;  1CMG A;  3KF9 A;  4GUK A;  4ORA B;  1JF0 A;  1G33 A;  4MBE A;  4U8D A;  3FWC A;  3AAK A;  1BR4 B;  1KSO A;  1XFV O;  1PK0 D;  2KYC A;  2M7N A;  1PSR A;  1DT7 B;  2M8U A;  1CLL A;  3PM8 A;  2JRF A;  4AQI A;  4BY4 A;  3BUO B;  5J3X A;  3SG2 A;  2LUC A;  2PAS A;  1PAL A;  2K7O A;  5HYD A;  1S6I A;  2MJW B;  5I2Q A;  3EK7 A;  4YI8 A;  2OS8 C;  3GK4 X;  1YR5 A;  4GFT A;  4DIR A;  2F2P A;  1Y1A A;  2H61 A;  1D1O A;  2KI6 C;  2LMT A;  1B7T Z;  2COL B;  2K8M B;  3VRO A;  1UHH A;  1XK4 A;  2F3Y A;  4CPV A;  5IBW A;  1K9P A;  2JU0 A;  1BJF A;  4R1E A;  1U5I A;  1AVS A;  1NX2 A;  4UPG A;  2LVK A;  5ER4 X;  2AAO A;  3TDU A;  2KBI A;  3I5G C;  5B8I B;  1TTX A;  5KU1 A;  2SAS A;  2K61 A;  2JUL A;  4JQ0 D;  2LVJ A;  2K7B A;  3GOF A;  1IWQ A;  1GJY A;  2BCX A;  2B1U A;  3HCM A;  2JZI A;  1CM4 A;  4OKH A;  1Y6W A;  1K90 D;  2MRD A;  1NCZ A;  1DJI A;  3KHE A;  1IJ5 A;  1YX7 A;  5AAN A;  1AJ4 A;  2KAX A;  3I5F C;  2WCE A;  2LVV A;  1CTR A;  1XA5 A;  2BE6 A;  2ZKM X;  4WQ3 A;  2KFG A;  2KI4 C;  1J1D A;  4QJ3 B;  1CFD A;  1BG1 A;  2CCM A;  2BBM A;  1C7W A;  4YBH B;  1K95 A;  4GNK B;  2F8P A;  5CSI A;  4HSZ A;  1J7O A;  2M3W A;  2ZRS A;  4USL A;  1A03 A;  1B7T Y;  3I5G B;  2R2I A;  3BQ3 A;  4A4C A;  2JT3 A;  3AKB A;  3VRR A;  1TNW A;  1OE9 B;  1SNL A;  3SG6 A;  1AUI B;  1SCV A;  4HRE E;  4ICB A;  2GGM A;  3WXA A;  3LL8 B;  3RLZ A;  5K89 A;  4OV2 A;  3H4S E;  1WDC C;  3JTD C;  2LAN A;  4N1F A;  1FF1 A;  4GGN A;  1DJX A;  4NDD A;  3DVM A;  1MF8 B;  3I5I B;  1LVC D;  5AER A;  4PAL A;  1LA3 A;  4GGF A;  1NSH A;  1HT9 A;  4PDZ A;  1TOP A;  2OTG B;  2GGZ A;  1GGW A;  1PSB A;  1XFX O;  1J1E A;  1IKU A;  4E68 A;  2M49 B;  1VRK A;  2JPT A;  3EK8 A;  3HX4 A;  1BMO A;  1NIW A;  1ZOT B;  1QX7 A;  4YGA A;  1SMG A;  1S5G Y;  1SYM A;  4GGF C;  4XJK B;  1SY9 A;  1M63 B;  4MZJ A;  4PE7 A;  2BL0 C;  4PE0 A;  3OB2 B;  4AOM A;  3RM1 A;  2PMY A;  2L4I A;  2AUC A;  3DVK A;  3KEV A;  1KK7 Y;  1RJV A;  1FW4 A;  3OP0 A;  4C0J A;  2JC2 A;  4ORC B;  2CTN A;  5I2L A;  3EVV A;  2EC6 B;  2F33 A;  2K2A A;  3CLN A;  4I5J A;  2FCD A;  2P6B B;  2FJU B; 
#chains in the Genus database with same CATH topology
 1H8B A;  3DF0 B;  1IQ5 A;  5DIC A;  3PAL A;  2L98 A;  5ER5 A;  1YX8 A;  4NQG A;  1SL7 A;  4ORB B;  2BCA A;  1L2O B;  2JXC A;  1J7P A;  3JVT C;  2OPO A;  1NX3 A;  2NCO A;  2WCL A;  1CNP A;  3PLF B;  4PCW A;  2QDI A;  2NCP A;  3NHI A;  5AEQ A;  4DRW A;  1ZMZ A;  4C0L A;  3D73 A;  3OBV A;  1KFU S;  3TDI A;  4N5X A;  1ORG A;  1AJ5 A;  1S3P A;  4YGE B;  1DGV A;  1X02 A;  1NCY A;  4PHN A;  1XVJ A;  1EG3 A;  1N0Y A;  3PJI A;  5D69 A;  2LMU A;  3O4Y A;  1NYA A;  4MSP A;  4MZL A;  3R72 A;  2LUX A;  2M29 A;  2QAC A;  2RGI A;  2KNE A;  1AK8 A;  1QX5 B;  2P71 A;  2SCP A;  4P2Y B;  2LM5 A;  2BCB A;  2Q4U A;  2L2E A;  1C3Z A;  2KQY A;  1TNP A;  2ZFD A;  2VRG A;  3BUM B;  1SRA A;  2HQ8 A;  1QX2 A;  1K96 A;  1LS8 A;  3BOW A;  3BUW B;  1PVB A;  1ODB A;  3EK4 A;  1XK4 C;  1B9A A;  2NLN A;  2PVB A;  2JTT A;  3CZ2 A;  2QEB A;  3CGA A;  3SIB A;  3SG7 A;  5D7F A;  2HET A;  3D0Y B;  2QEH A;  2H2K A;  2Q91 A;  4FTG A;  3ICB A;  1TRF A;  2FOT A;  1TUJ A;  1REC A;  1KK7 Z;  5TNC A;  3WHU B;  3IQO A;  4WQ2 A;  5CSJ A;  5KSZ A;  1BU3 A;  2G2B A;  4OVN F;  2JWW A;  1BLQ A;  1IG5 A;  1SBJ A;  3LK1 A;  1J7Q A;  2JNF A;  1CFC A;  1OMD A;  1BT6 A;  1LKJ A;  5G08 A;  1ALV A;  1XYD A;  1B47 A;  1UHI A;  5DKN A;  1EJ3 A;  2CXJ A;  3F45 A;  2LHI A;  1NX1 A;  1ALW A;  1QV0 A;  1CM1 A;  1JUO A;  5EL2 A;  3VRP A;  5I94 A;  1OMR A;  5CSN A;  3DVJ A;  3I5I C;  3D76 A;  3NSL A;  1Y0V H;  2KGB C;  1S36 A;  3CR4 X;  2TN4 A;  1IIO A;  1OOI X;  2A4J A;  2K60 A;  2LE9 B;  1QIW A;  2WCF A;  4GAO A;  4NDB A;  1TWO A;  2LMV A;  1RTP 1;  5HKW A;  3GK1 A;  2NZ0 A;  1UHJ A;  2K7D A;  3PAT A;  2MHH A;  1KWO B;  3TUY C;  3GK2 A;  1WRZ A;  1GGZ A;  1MR8 A;  3D75 A;  2CBL A;  3NGV A;  3NSO A;  1BOC A;  3CTN A;  1DJH A;  4I5N B;  1P28 A;  4I5K A;  4QJ5 B;  1KFX L;  2WC8 A;  1W9Z A;  2I2R E;  2LLT A;  1CMF A;  3CR5 X;  1OSA A;  1N2D A;  3R1P A;  1EXR A;  3DZT A;  2LNK A;  2WCB A;  1OOF A;  2LLU A;  1MHO A;  1TCF A;  3EKJ A;  1U5I B;  1K8U A;  3TS5 C;  5AFP A;  1KFU L;  1KK8 C;  1W7J B;  2M97 A;  1XFU O;  4CFQ A;  3KO0 A;  4HRG A;  4MZK A;  4ETO A;  2ZRT A;  2H8V A;  2JXL A;  2HQW A;  4QJ4 B;  1JFJ A;  2BKH B;  4CFR A;  2PSR A;  3BYA A;  2EC6 C;  2WOS A;  1CFF A;  1WRK A;  3S0G A;  2KOT A;  4NDC A;  1SCM B;  1M39 A;  3S0F A;  1QLS A;  1M31 A;  3DD4 A;  1EG4 A;  2F3Z A;  1PVA A;  4M2P A;  1TCO B;  1ZUZ A;  1SK6 D;  2GV5 A;  3I5H B;  2KHN A;  1MQ1 A;  3SIA A;  3ZWH A;  2LVI A;  1TUZ A;  1UP5 A;  1CLM A;  3OX6 A;  1CDM A;  2M9G A;  3L4A A;  2V53 A;  3B7A A;  1F70 A;  4MRX A;  1UHN A;  2L5X B;  1SPY A;  2BEC A;  1OQP A;  4GBA A;  2IS9 A;  3D77 A;  3UNW A;  1E8A A;  2FCE A;  5FYX A;  1Y1U A;  2Y1N A;  2KAY A;  3PN7 B;  1QVI Z;  1G8I A;  2BBN A;  5KTY A;  1BOD A;  1CDP A;  4XJK A;  1IJ6 A;  2KBM A;  1WLZ A;  2PYQ A;  4DS7 A;  1K94 A;  1QS7 A;  3DF0 A;  2KGR A;  3VRN A;  1JWD A;  4WRI A;  2K7C A;  2K2F A;  1SR6 C;  1XFW O;  2LC5 A;  3QRX A;  1B4C A;  1DEL A;  3IVT A;  4P5O E;  4DUQ A;  1RFJ A;  1NX0 A;  1QXP A;  1DF0 B;  3MSE B;  3BUX B;  3JTD B;  2EGD A;  1CB1 A;  1C07 A;  4CLN A;  1SL8 A;  4M2Q A;  1A75 B;  2KI6 D;  2EHB A;  4PHJ A;  3SG5 A;  2H61 C;  3D10 A;  2KSP A;  1UHK A;  5JJG A;  1SCM C;  3C1V A;  4OZD A;  4HRH A;  1LXF C;  1KFX S;  4MVF A;  3OX5 A;  3BUN B;  3NXA A;  1KQV A;  2ZN8 A;  2D8N A;  3D74 A;  1BF5 A;  3R1O A;  3O4X A;  1YRT B;  3EVU A;  1EL4 A;  1Z4H A;  2JNX A;  3S0E A;  2ZND A;  3BXK A;  1JF2 A;  1SW8 A;  1YTZ C;  3CWG A;  3TS5 B;  2L50 A;  1M45 A;  1KSM A;  4JD9 A;  4YRU A;  4MN0 A;  1WDC B;  2Y1M A;  3I5F B;  3LCP C;  1A4P A;  2LP3 A;  5HLO A;  1TIZ A;  1LA0 A;  1DJY A;  1DJG A;  3S0D A;  1RWY A;  4PE4 A;  5PAL A;  3DY9 A;  1KK8 B;  2L51 A;  3CR2 A;  5I2O A;  1K9U A;  1F8H A;  1KWO C;  1B8L A;  2MA2 A;  4ZCV A;  3O2P A;  1QWV A;  3EKH A;  5F6T A;  4YGB B;  1C3Y A;  1QV1 A;  1MXL C;  3BFB A;  3WHT B;  2K0J A;  1DVI A;  1WRL A;  1N65 A;  1RRO A;  1AHR A;  3SS3 A;  2AMI A;  3FS7 A;  1KCY A;  1S26 D;  2PQL A;  4DCK A;  1F71 A;  1Z2C B;  2HPS A;  1JBA A;  3CYZ A;  1R2U A;  1OZS A;  3O78 A;  4IL1 A;  3KPX A;  1DGU A;  3BOW B;  1A29 A;  4GPL B;  4MRY A;  3RZS A;  2OS8 B;  1L7Z A;  3LK0 A;  3TDZ A;  1NPQ A;  3AKA A;  2LHL A;  5CPV A;  2BE4 A;  2JTZ A;  4N1G A;  1A75 A;  2KQ6 A;  1JC2 A;  4OR9 B;  1S6C A;  1UUR A;  4FQO A;  3OB1 B;  1QLK A;  1UWO A;  1F55 A;  4INX A;  3CS1 A;  3L47 A;  1YVH A;  2MLF C;  4M2O A;  1CFP A;  2PRU A;  5GQQ C;  1IRJ A;  2WCJ A;  3EVR A;  1CLB A;  4MEW A;  4Q04 A;  1A2X A;  1Y1X A;  2MAZ A;  4F0Z B;  5JOL A;  1TN4 A;  3A8R A;  3OHM B;  1RK9 A;  3TUY B;  2I7A A;  1YUT A;  1V1F A;  1QJT A;  1FI6 A;  3SJS A;  2WCK A;  2GTE A;  1KQM B;  3OGN A;  2LLS A;  2M7L A;  1S6J A;  2DOQ A;  2MBX A;  1QAS A;  3IQQ A;  1MUX A;  4FQT A;  5HLV A;  2KFF A;  2KI4 B;  1C7V A;  5HKZ A;  4JWQ A;  1OZO A;  1SL9 A;  2L0P A;  1OOJ A;  4TNC A;  4CID A;  1XFY O;  3N7H A;  3NSK A;  2O5G A;  1XFZ O;  2BAP A;  1NWD A;  1F4Q A;  4YGC B;  1YVL A;  2LV7 A;  1B8R A;  2HF5 A;  3M0W A;  1YUR A;  1K93 D;  1B8C A;  2M1U A;  3PN7 C;  1LIN A;  4IJ7 A;  4YI9 A;  4MLW A;  3VB1 A;  2PAL A;  2CNP A;  4D1E A;  2CT9 A;  3A4U B;  3L4L A;  3FE6 A;  2ISD A;  1CDN A;  1TNQ A;  2NXQ A;  3B6X A;  4F7F A;  3B88 A;  1FPW A;  4A4B A;  1L2O C;  2JQ6 A;  3IF7 A;  5I8N A;  4JPZ B;  3QME A;  1F54 A;  2ZN9 A;  3BFH A;  1DJW A;  1DJZ A;  1HQV A;  2JT8 A;  2YGU A;  3BJH A;  1SKT A;  3I5H C;  5DKQ A;  1XO5 A;  1DQE A;  1BR1 B;  4AQJ A;  2KAV A;  2JOJ A;  3E3R A;  1CDL A;  3FWB A;  3SG4 A;  4INW A;  2JT0 A;  1NP8 A;  3Q8I A;  3O6B A;  1QVI Y;  2LAP A;  2I94 A;  1DMO A;  2M1K B;  3TZ1 A;  1WY9 A;  1YUS A;  2WCH A;  1FI5 A;  2I18 A;  2F2O A;  3FE9 A;  3PSR A;  3R1V A;  1JSA A;  4ZCU A;  2O60 A;  3PM2 A;  4C0K A;  4L9M A;  1R6P A;  2KYF A;  1F4O A;  5HKY A;  4XYN A;  2WOR A;  3WNX B;  1QIV A;  2M0R A;  1NCX A;  2WCM A;  4PHK A;  3SG3 A;  1JFK A;  3VGO A;  4BY5 A;  3PFV A;  2BKI B;  2E30 A;  2L2C A;  2QPT A;  3BFA A;  2LCP A;  1GQM A;  1ZAC A;  1WLM A;  3VRQ A;  1IGV A;  5DKR A;  1S1E A;  1G4Y R;  1OMV A;  1MXE A;  1ZFS A;  2P70 A;  2LP2 A;  4YGD B;  2Y4Q A;  1CKK A;  1QTX A;  1H4B A;  1FBV A;  1UUS A;  1T14 A;  1M46 A;  3LLE A;  1SR6 B;  1V1G A;  2E6W A;  2Y5I A;  4I5L B;  1EH2 A;  1GM0 A;  3CDN A;  1DTL A;  1DF0 A;  1QAT A;  3CZT X;  3NSI A;  4PHM A;  2MLE C;  2KDH A;  1AP4 A;  3D78 A;  5AXI A;  1J55 A;  2OTG C;  1S5G Z;  1PUL A;  5BPJ A;  1K9K A;  1W7I B;  2ERB A;  3D0Y A;  2L4H A;  1TNX A;  4OCI A;  5FI6 A;  1J7R A;  1MWN A;  1YRU B;  2G9B A;  5CSF A;  1B1G A;  3ZNI A;  3AAJ A;  1NUB A;  3FIA A;  1KQM C;  1IQ3 A;  2KFH A;  4PE1 A;  2ZNE A;  3K21 A;  1Q80 A;  2QEO A;  3DVE A;  3B86 A;  1PRW A;  1YUU A;  2WND A;  1K2H A;  1IH0 A;  3JVT B;  2BL0 B;  1CMG A;  3KF9 A;  3SS5 A;  4GUK A;  4ORA B;  1OW4 A;  1JF0 A;  1G33 A;  4MBE A;  4U8D A;  3FWC A;  3AAK A;  1BR4 B;  1KSO A;  5HL1 A;  1XFV O;  1PK0 D;  2KYC A;  2M7N A;  3B87 A;  5FI7 A;  1PSR A;  1DT7 B;  2M8U A;  1CLL A;  3PM8 A;  3CAB A;  2JRF A;  4AQI A;  4BY4 A;  3BUO B;  5J3X A;  3SG2 A;  2LUC A;  2PAS A;  1PAL A;  2K7O A;  5HYD A;  1S6I A;  2MJW B;  5I2Q A;  3EK7 A;  4YI8 A;  2OS8 C;  3GK4 X;  1YR5 A;  4GFT A;  4DIR A;  5FI2 A;  2F2P A;  1Y1A A;  2H61 A;  1D1O A;  2KI6 C;  2LMT A;  1B7T Z;  2COL B;  2K8M B;  3VRO A;  1UHH A;  4JKT A;  1XK4 A;  2F3Y A;  4CPV A;  5IBW A;  1K9P A;  2JU0 A;  2KPH A;  1BJF A;  4R1E A;  1U5I A;  1AVS A;  1NX2 A;  4PT1 A;  4UPG A;  2LVK A;  5ER4 X;  2AAO A;  3TDU A;  2KBI A;  3I5G C;  5B8I B;  1TTX A;  5KU1 A;  2SAS A;  2K61 A;  2JUL A;  3S0A A;  4JQ0 D;  2LVJ A;  2K7B A;  3CZ1 A;  3GOF A;  1IWQ A;  1GJY A;  2BCX A;  2B1U A;  3HCM A;  2JZI A;  1CM4 A;  4OKH A;  1Y6W A;  1K90 D;  2MRD A;  2WC6 A;  1NCZ A;  1DJI A;  3KHE A;  1IJ5 A;  1YX7 A;  5AAN A;  1AJ4 A;  2KAX A;  3I5F C;  2WCE A;  3K1E A;  2LVV A;  1CTR A;  1XA5 A;  2BE6 A;  2ZKM X;  4WQ3 A;  2KFG A;  2L5Y A;  1DEK A;  2KI4 C;  1J1D A;  4QJ3 B;  1CFD A;  1BG1 A;  2CCM A;  2BBM A;  1C7W A;  4YBH B;  1K95 A;  4GNK B;  2F8P A;  5CSI A;  4HSZ A;  1J7O A;  2M3W A;  2ZRS A;  4USL A;  1A03 A;  2KLE A;  1B7T Y;  3I5G B;  2FJY A;  2R2I A;  3BQ3 A;  4A4C A;  2JT3 A;  3AKB A;  3VRR A;  1TNW A;  1OE9 B;  1SNL A;  2KLD A;  3CZ0 A;  3SG6 A;  1AUI B;  1SCV A;  4HRE E;  4ICB A;  2GGM A;  3WXA A;  3LL8 B;  3RLZ A;  5K89 A;  4OV2 A;  3H4S E;  1WDC C;  3JTD C;  2LAN A;  4N1F A;  1FF1 A;  4GGN A;  1DJX A;  4NDD A;  3DVM A;  1MF8 B;  3I5I B;  1LVC D;  5AER A;  4PAL A;  1LA3 A;  3DXL A;  4GGF A;  1NSH A;  1HT9 A;  4PDZ A;  3UO9 A;  1TOP A;  2OTG B;  1OOG A;  2GGZ A;  1GGW A;  2QEV A;  1PSB A;  1XFX O;  1J1E A;  1IKU A;  4E68 A;  3NHT A;  2M49 B;  3S0B A;  1VRK A;  2JPT A;  2WC5 A;  3EK8 A;  1BMO A;  3HX4 A;  1NIW A;  3V2L A;  1ZOT B;  2BNX A;  1QX7 A;  3DYE A;  4YGA A;  1SMG A;  1S5G Y;  1SYM A;  4GGF C;  4XJK B;  1SY9 A;  1M63 B;  1OOH A;  1XFR A;  4MZJ A;  4PE7 A;  2BL0 C;  3EG5 B;  3FE8 A;  4PE0 A;  3OB2 B;  4AOM A;  3RM1 A;  2PMY A;  1DC1 A;  2L4I A;  2AUC A;  3DVK A;  3KEV A;  1KK7 Y;  1RJV A;  2JPO A;  4KYN A;  1FW4 A;  3OP0 A;  4C0J A;  2JC2 A;  4ORC B;  1SSE B;  2CTN A;  5D3O A;  5I2L A;  3EVV A;  2EC6 B;  3SS4 A;  2F33 A;  2K2A A;  3CLN A;  4I5J A;  2FCD A;  2P6B B;  2FJU B; 
#chains in the Genus database with same CATH homology
 1H8B A;  3DF0 B;  1IQ5 A;  3PAL A;  2L98 A;  5ER5 A;  1YX8 A;  4NQG A;  1SL7 A;  4ORB B;  2BCA A;  1L2O B;  2JXC A;  1J7P A;  3JVT C;  2OPO A;  1NX3 A;  2NCO A;  1CNP A;  3PLF B;  4PCW A;  2NCP A;  5AEQ A;  4DRW A;  1ZMZ A;  4C0L A;  1KFU S;  3TDI A;  4N5X A;  1AJ5 A;  1S3P A;  4YGE B;  1DGV A;  1X02 A;  1NCY A;  4PHN A;  1XVJ A;  1EG3 A;  1N0Y A;  5D69 A;  2LMU A;  3O4Y A;  1NYA A;  4MSP A;  4MZL A;  2LUX A;  2M29 A;  2QAC A;  2RGI A;  2KNE A;  1AK8 A;  1QX5 B;  2SCP A;  4P2Y B;  2LM5 A;  2BCB A;  2Q4U A;  2L2E A;  2ZFD A;  2KQY A;  1TNP A;  2VRG A;  3BUM B;  1SRA A;  2HQ8 A;  1QX2 A;  1K96 A;  3BOW A;  3EK4 A;  3BUW B;  1PVB A;  1ODB A;  5PAL A;  1XK4 C;  1B9A A;  2NLN A;  2PVB A;  2JTT A;  3SIB A;  3CGA A;  3SG7 A;  5D7F A;  2HET A;  3D0Y B;  4FTG A;  2H2K A;  2Q91 A;  5TNC A;  3ICB A;  1TRF A;  2FOT A;  3WHU B;  1REC A;  1KK7 Z;  5AFP A;  3IQO A;  4WQ2 A;  5CSJ A;  5KSZ A;  1BU3 A;  2G2B A;  4OVN F;  2JWW A;  1BLQ A;  1IG5 A;  1SBJ A;  3LK1 A;  1J7Q A;  2JNF A;  1CFC A;  1OMD A;  1BT6 A;  1LKJ A;  5G08 A;  1ALV A;  1XYD A;  1B47 A;  1UHI A;  5DKN A;  1EJ3 A;  2CXJ A;  3F45 A;  2LHI A;  1NX1 A;  1ALW A;  1QV0 A;  1CM1 A;  1JUO A;  3VRP A;  1OMR A;  5CSN A;  3DVJ A;  3I5I C;  3NSL A;  1Y0V H;  2KGB C;  1S36 A;  3CR4 X;  2TN4 A;  2A4J A;  2LE9 B;  1QIW A;  2WCF A;  4GAO A;  4NDB A;  5HKW A;  2LMV A;  1RTP 1;  3GK1 A;  2NZ0 A;  1UHJ A;  2K7D A;  3PAT A;  2MHH A;  1KWO B;  3TUY C;  3GK2 A;  1WRZ A;  1GGZ A;  1MR8 A;  2CBL A;  3NSO A;  1BOC A;  3CTN A;  1DJH A;  4I5N B;  4I5K A;  4QJ5 B;  1KFX L;  2WC8 A;  2I2R E;  1CMF A;  2LLT A;  3CR5 X;  1OSA A;  1N2D A;  1EXR A;  2LNK A;  2WCB A;  2LLU A;  3EKJ A;  1MHO A;  1TCF A;  1K8U A;  1U5I B;  3TS5 C;  1KFU L;  1KK8 C;  1W7J B;  2M97 A;  1XFU O;  4CFQ A;  3KO0 A;  4HRG A;  4MZK A;  4ETO A;  2ZRT A;  4QJ4 B;  2JXL A;  2HQW A;  1JFJ A;  2BKH B;  4CFR A;  2PSR A;  3BYA A;  2EC6 C;  2WOS A;  1CFF A;  1WRK A;  2KOT A;  4NDC A;  1SCM B;  1M39 A;  1QLS A;  1M31 A;  3DD4 A;  1EG4 A;  2F3Z A;  1PVA A;  4M2P A;  1TCO B;  1ZUZ A;  1SK6 D;  2GV5 A;  3I5H B;  2KHN A;  1MQ1 A;  3SIA A;  3ZWH A;  2LVI A;  1UP5 A;  1CLM A;  3OX6 A;  1CDM A;  2M9G A;  2V53 A;  1F70 A;  4MRX A;  1UHN A;  2L5X B;  1SPY A;  2BEC A;  1OQP A;  4GBA A;  2IS9 A;  1E8A A;  2FCE A;  5FYX A;  1Y1U A;  2Y1N A;  2KAY A;  3PN7 B;  1QVI Z;  1G8I A;  2BBN A;  5KTY A;  1BOD A;  1CDP A;  4XJK A;  1IJ6 A;  2KBM A;  1WLZ A;  4DS7 A;  1K94 A;  1QS7 A;  3DF0 A;  2KGR A;  3VRN A;  1JWD A;  4WRI A;  2K7C A;  2K2F A;  1SR6 C;  1XFW O;  2LC5 A;  3QRX A;  1B4C A;  4P5O E;  4DUQ A;  1RFJ A;  1NX0 A;  1QXP A;  1DF0 B;  3MSE B;  3BUX B;  3JTD B;  2EGD A;  1CB1 A;  1C07 A;  4CLN A;  1SL8 A;  4M2Q A;  1A75 B;  2KI6 D;  2EHB A;  4PHJ A;  3SG5 A;  2H61 C;  3D10 A;  2KSP A;  1UHK A;  5JJG A;  1SCM C;  3C1V A;  4HRH A;  1LXF C;  1KFX S;  4MVF A;  3OX5 A;  3BUN B;  3NXA A;  1KQV A;  2ZN8 A;  2D8N A;  1BF5 A;  1YRT B;  3EVU A;  1EL4 A;  2JNX A;  2ZND A;  3BXK A;  1JF2 A;  1SW8 A;  1YTZ C;  3CWG A;  3TS5 B;  2L50 A;  1M45 A;  1KSM A;  4YRU A;  4MN0 A;  1WDC B;  2Y1M A;  3I5F B;  3LCP C;  1A4P A;  2LP3 A;  5HLO A;  1TIZ A;  1LA0 A;  1DJY A;  1DJG A;  1RWY A;  4PE4 A;  1KK8 B;  2L51 A;  3CR2 A;  5I2O A;  1K9U A;  1F8H A;  1KWO C;  1B8L A;  2MA2 A;  4ZCV A;  3O2P A;  3EKH A;  5F6T A;  4YGB B;  1QV1 A;  1MXL C;  3WHT B;  2K0J A;  1DVI A;  1WRL A;  1N65 A;  1RRO A;  1AHR A;  2AMI A;  3FS7 A;  1KCY A;  1S26 D;  1F71 A;  4DCK A;  1JBA A;  2HPS A;  1R2U A;  1OZS A;  3O78 A;  4IL1 A;  3KPX A;  1DGU A;  3BOW B;  1A29 A;  4GPL B;  4MRY A;  2OS8 B;  1L7Z A;  3LK0 A;  3TDZ A;  1NPQ A;  3AKA A;  2LHL A;  5CPV A;  2BE4 A;  2JTZ A;  4N1G A;  1A75 A;  2KQ6 A;  1JC2 A;  4OR9 B;  1S6C A;  1UUR A;  4FQO A;  3OB1 B;  1QLK A;  1UWO A;  1F55 A;  3CS1 A;  4M2O A;  1YVH A;  2MLF C;  1CFP A;  2PRU A;  5GQQ C;  1IRJ A;  3EVR A;  1CLB A;  4MEW A;  4Q04 A;  1A2X A;  1Y1X A;  2MAZ A;  4F0Z B;  5JOL A;  1TN4 A;  3A8R A;  3OHM B;  1RK9 A;  3TUY B;  2I7A A;  1YUT A;  1V1F A;  1QJT A;  1FI6 A;  3SJS A;  2M7L A;  1KQM B;  2MBX A;  2LLS A;  1S6J A;  2DOQ A;  1QAS A;  3IQQ A;  1MUX A;  5HLV A;  2KFF A;  2KI4 B;  1C7V A;  5HKZ A;  4JWQ A;  1OZO A;  1SL9 A;  2L0P A;  1OOJ A;  4TNC A;  4CID A;  1XFY O;  3NSK A;  2O5G A;  1XFZ O;  1NWD A;  1F4Q A;  4YGC B;  1YVL A;  2LV7 A;  1B8R A;  2HF5 A;  3M0W A;  1YUR A;  1K93 D;  1B8C A;  2M1U A;  3PN7 C;  1LIN A;  4YI9 A;  4MLW A;  2PAL A;  2CNP A;  4D1E A;  2CT9 A;  3A4U B;  2ISD A;  1CDN A;  1TNQ A;  2NXQ A;  1FPW A;  4A4B A;  1L2O C;  2JQ6 A;  3IF7 A;  5I8N A;  4JPZ B;  1F54 A;  2ZN9 A;  1DJW A;  1DJZ A;  1HQV A;  2JT8 A;  1SKT A;  3I5H C;  5DKQ A;  1XO5 A;  1BR1 B;  4AQJ A;  2KAV A;  2JOJ A;  3E3R A;  1CDL A;  3FWB A;  3SG4 A;  2JT0 A;  1NP8 A;  3O6B A;  1QVI Y;  2LAP A;  2I94 A;  1DMO A;  2M1K B;  3TZ1 A;  1WY9 A;  1YUS A;  1FI5 A;  2I18 A;  2F2O A;  3PSR A;  1JSA A;  4ZCU A;  2O60 A;  4C0K A;  4L9M A;  1R6P A;  2KYF A;  1F4O A;  5HKY A;  4XYN A;  2WOR A;  3WNX B;  1QIV A;  2M0R A;  1NCX A;  4PHK A;  3SG3 A;  1JFK A;  3VGO A;  4BY5 A;  3PFV A;  2BKI B;  2E30 A;  2QPT A;  2LCP A;  1GQM A;  1ZAC A;  1WLM A;  3VRQ A;  1IGV A;  5DKR A;  1S1E A;  1G4Y R;  1OMV A;  1MXE A;  1ZFS A;  4YGD B;  2LP2 A;  1H4B A;  2Y4Q A;  1CKK A;  1QTX A;  1FBV A;  1UUS A;  1M46 A;  3LLE A;  1SR6 B;  1V1G A;  2E6W A;  2Y5I A;  4I5L B;  1EH2 A;  1DTL A;  1DF0 A;  1QAT A;  3CZT X;  3NSI A;  4PHM A;  2MLE C;  2KDH A;  1AP4 A;  5AXI A;  1J55 A;  2OTG C;  1S5G Z;  1PUL A;  5BPJ A;  1K9K A;  1W7I B;  3D0Y A;  2L4H A;  1TNX A;  4OCI A;  1J7R A;  1MWN A;  1YRU B;  2G9B A;  5CSF A;  1B1G A;  3ZNI A;  3AAJ A;  1NUB A;  3FIA A;  1KQM C;  1IQ3 A;  2KFH A;  4PE1 A;  2ZNE A;  3K21 A;  1Q80 A;  3DVE A;  1PRW A;  1YUU A;  2WND A;  1K2H A;  1IH0 A;  3JVT B;  2BL0 B;  1CMG A;  3KF9 A;  4GUK A;  4ORA B;  1JF0 A;  1G33 A;  4MBE A;  4U8D A;  3FWC A;  3AAK A;  1BR4 B;  1KSO A;  1XFV O;  1PK0 D;  2KYC A;  2M7N A;  1PSR A;  1DT7 B;  2M8U A;  1CLL A;  3PM8 A;  2JRF A;  4AQI A;  4BY4 A;  3BUO B;  5J3X A;  3SG2 A;  2LUC A;  2PAS A;  1PAL A;  2K7O A;  5HYD A;  1S6I A;  2MJW B;  5I2Q A;  3EK7 A;  4YI8 A;  2OS8 C;  3GK4 X;  1YR5 A;  4GFT A;  4DIR A;  2F2P A;  1Y1A A;  2H61 A;  1D1O A;  2KI6 C;  2LMT A;  1B7T Z;  2COL B;  2K8M B;  3VRO A;  1UHH A;  1XK4 A;  2F3Y A;  4CPV A;  5IBW A;  1K9P A;  2JU0 A;  1BJF A;  4R1E A;  1U5I A;  1AVS A;  1NX2 A;  4UPG A;  2LVK A;  5ER4 X;  2AAO A;  3TDU A;  2KBI A;  3I5G C;  5B8I B;  1TTX A;  5KU1 A;  2SAS A;  2K61 A;  2JUL A;  4JQ0 D;  2LVJ A;  2K7B A;  3GOF A;  1IWQ A;  1GJY A;  2BCX A;  2B1U A;  3HCM A;  2JZI A;  1CM4 A;  4OKH A;  1Y6W A;  1K90 D;  2MRD A;  1NCZ A;  1DJI A;  3KHE A;  1IJ5 A;  1YX7 A;  5AAN A;  1AJ4 A;  2KAX A;  3I5F C;  2WCE A;  2LVV A;  1CTR A;  1XA5 A;  2BE6 A;  2ZKM X;  4WQ3 A;  2KFG A;  2KI4 C;  1J1D A;  4QJ3 B;  1CFD A;  1BG1 A;  2CCM A;  2BBM A;  1C7W A;  4YBH B;  1K95 A;  4GNK B;  2F8P A;  5CSI A;  4HSZ A;  1J7O A;  2M3W A;  2ZRS A;  4USL A;  1A03 A;  1B7T Y;  3I5G B;  2R2I A;  3BQ3 A;  4A4C A;  2JT3 A;  3AKB A;  3VRR A;  1TNW A;  1OE9 B;  1SNL A;  3SG6 A;  1AUI B;  1SCV A;  4HRE E;  4ICB A;  2GGM A;  3WXA A;  3LL8 B;  3RLZ A;  5K89 A;  4OV2 A;  3H4S E;  1WDC C;  3JTD C;  2LAN A;  4N1F A;  1FF1 A;  4GGN A;  1DJX A;  4NDD A;  3DVM A;  1MF8 B;  3I5I B;  1LVC D;  5AER A;  4PAL A;  1LA3 A;  4GGF A;  1NSH A;  1HT9 A;  4PDZ A;  1TOP A;  2OTG B;  2GGZ A;  1GGW A;  1PSB A;  1XFX O;  1J1E A;  1IKU A;  4E68 A;  2M49 B;  1VRK A;  2JPT A;  3EK8 A;  3HX4 A;  1BMO A;  1NIW A;  1ZOT B;  1QX7 A;  4YGA A;  1SMG A;  1S5G Y;  1SYM A;  4GGF C;  4XJK B;  1SY9 A;  1M63 B;  4MZJ A;  4PE7 A;  2BL0 C;  4PE0 A;  3OB2 B;  4AOM A;  3RM1 A;  2PMY A;  2L4I A;  2AUC A;  3DVK A;  3KEV A;  1KK7 Y;  1RJV A;  1FW4 A;  3OP0 A;  4C0J A;  2JC2 A;  4ORC B;  2CTN A;  5I2L A;  3EVV A;  2EC6 B;  2F33 A;  2K2A A;  3CLN A;  4I5J A;  2FCD A;  2P6B B;  2FJU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...