2KQYA

Solution structure of avian thymic hormone
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
108
structure length
108
Chain Sequence
b'AITDILSAKDIESALSSCQAADSFNYKSFFSTVGLSSKTPDQIKKVFGILDQDKSGFIEEEELQLFLKNFSSSARVLTSAETKAFLAAGDTDGDGKIGVEEFQSLVKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Parvalbumin, thymic
publication title Structure of Avian Thymic Hormone, a High-Affinity Avian beta-Parvalbumin, in the Ca(2+)-Free and Ca(2+)-Bound States.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Metal binding protein
total genus 16
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2009-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2kqyA00
1CLBA 2BCAA 2EHBA 1IGVA 5HLOA 3NSLA 1SR6B 1F8HA 5CSFA 4DRWA 1H8BA 3CS1A 4I5LB 1OQPA 1S5GY 1TTXA 1OSAA 2LV7A 2KI6C 3JTDB 3AKAA 2E30A 1TRFA 3PLFB 1LXFC 1BR1B 2KGBC 1XK4A 3I5GC 3JVTC 3AAKA 1WDCB 2KGRA 1KCYA 5KTYA 2PVBA 4ZCVA 4N5XA 1RFJA 2O5GA 1CB1A 2JZIA 2CCMA 1CNPA 4NDCA 1TCFA 1OZSA 3OB2B 1NSHA 2E6WA 2OTGC 2RGIA 2TN4A 4HSZA 1B4CA 3NSKA 1NCXA 4YGAA 2MAZA 1SYMA 2I7AA 4ETOA 1JFKA 3CR4X 3SG6A 4DIRA 1DJHA 1GQMA 5KSZA 2JNFA 1BU3A 1WY9A 3RM1A 2NCPA 1SL7A 2BECA 1QIWA 1QASA 2GV5A 1BF5A 1J7OA 3EVVA 1CM1A 1SCVA 2LMUA 4MSPA 2HQ8A 3I5IB 5I2QA 1FBVA 4PCWA 1CTRA 1YR5A 4R1EA 5HLVA 1BMOA 2KI4C 2Q91A 2ZKMX 3K21A 1QATA 2COLB 2KFFA 1ZOTB 4OKHA 2ISDA 5AEQA 4L9MA 4MEWA 5JJGA 1WLZA 2L50A 2P6BB 2ZN8A 1D1OA 3BUXB 1AVSA 2LLTA 2OPOA 2K2FA 2JTTA 3JVTB 1PVAA 3TDUA 2QACA 1B7TZ 1KWOB 3DVJA 4JQ0D 3D10A 1EH2A 1A2XA 1WRKA 4PHNA 2LUCA 3GK4X 1CMGA 1B8CA 1QLSA 2BKIB 1DJIA 5CSIA 3O78A 4PHJA 1PSRA 1YUSA 5DKRA 3TUYB 2WCEA 1M39A 1YUTA 2OS8C 1TNQA 3CR2A 1YRTB 4M2QA 4BY4A 1YTZC 1JBAA 4ICBA 2G2BA 1YVLA 1A29A 2WORA 2KYFA 2M0RA 3HX4A 3NSIA 3OHMB 1IJ5A 2HPSA 1NPQA 3EK4A 2SCPA 3BQ3A 3ZNIA 2KI4B 1TNPA 1EL4A 1K93D 4PHMA 1F54A 1YURA 4YRUA 2L4IA 3EKJA 2BBMA 4WQ2A 2JT8A 1XK4C 4PDZA 1Y6WA 4NDDA 1OE9B 2LHIA 2KOTA 3AAJA 1NWDA 1XFZO 2MLFC 4MZKA 1FF1A 3DD4A 3IQOA 1MXLC 2K7BA 1BT6A 1CKKA 1K8UA 1J7QA 3M0WA 4PHKA 1MR8A 4MBEA 2LANA 3VRNA 2NCOA 2M7LA 1BLQA 1NYAA 1E8AA 1KSMA 1M31A 1UHNA 1A75B 2B1UA 3BYAA 1DJYA 2OS8B 1RROA 2Q4UA 3LK1A 1QVIZ 1RJVA 3VGOA 3ICBA 2SASA 4P5OE 1N2DA 4A4CA 3F45A 4TNCA 1QJTA 2M3WA 5DKNA 5AERA 1DT7B 1ODBA 4HRGA 4MZJA 1V1GA 5TNCA 4NQGA 4PE0A 1S6CA 1YX8A 2KFGA 3WHUB 3RLZA 1UHHA 2WCFA 1NUBA 2JWWA 3SIBA 3BOWA 2I2RE 1FI5A 3I5HC 4GFTA 1IG5A 1QTXA 2M29A 3I5FC 3WXAA 1JFJA 2PSRA 1F70A 1TCOB 3DVMA 1SMGA 1JC2A 1WLMA 3PM8A 4CFRA 2LM5A 1SCMC 2M1KB 1J1DA 2PASA 1J1EA 2BE6A 2FCDA 2JT0A 3KEVA 2EC6C 1NX3A 4I5JA 3A8RA 1EG3A 1AHRA 1K9KA 4C0JA 3BUWB 2LHLA 1M63B 3EVRA 1ZACA 4CLNA 2LVVA 1ZUZA 1Q80A 1OMDA 2LP3A 5CPVA 4CPVA 1R2UA 2KAVA 1FW4A 2CXJA 2CNPA 2JRFA 2WCBA 4MLWA 1G4YR 2H61C 1JF0A 1CLLA 1SL9A 3NXAA 4QJ4B 1SKTA 2FCEA 2M7NA 2Y4QA 4XJKB 2CTNA 1S36A 2BBNA 3O2PA 2M97A 5HKZA 4CFQA 1DF0B 1ALWA 1KK7Y 1KK8B 2JNXA 2MBXA 1S3PA 2KAYA 4DUQA 1A03A 4MRYA 2WOSA 2JOJA 1FI6A 5AXIA 4I5KA 5J3XA 3HCMA 1BOCA 4GUKA 2EGDA 5K89A 1PRWA 2F2OA 3DVEA 2LNKA 3KO0A 2M49B 2BE4A 2V53A 1KQMC 3I5FB 3O4YA 3SJSA 1S5GZ 4M2OA 4UPGA 1Y0VH 4GGFA 1TIZA 1UUSA 2EC6B 1DJGA 2L5XB 3D0YA 3OX6A 4M2PA 4WQ3A 5DKQA 1B9AA 4YGEB 3EKHA 1IKUA 2QPTA 3OX5A 3I5GB 1J7RA 3FIAA 3H4SE 4DS7A 1DJZA 1PK0D 1RK9A 2KQ6A 3EK7A 1OOJA 1QLKA 3VRRA 4ORAB 4PE7A 2R2IA 3C1VA 4MZLA 4QJ3B 3GK2A 1KFXL 2OTGB 5D7FA 5AANA 1QX2A 5CSNA 2L4HA 1SRAA 1IH0A 1XFYO 1JUOA 3SG2A 1IJ6A 2M9GA 5I2OA 5KU1A 4AOMA 1FPWA 2LVKA 4MN0A 4AQIA 2DOQA 2KQYA 2H61A 1B8LA 1UHJA 3CLNA 4PE1A 2LLSA 4OR9B 3FWBA 1YUUA 1OZOA 2WNDA 2PRUA 2JULA 1U5IB 2NXQA 5D69A 2K0JA 1QS7A 1IQ3A 4P2YB 2BL0C 1MF8B 2BKHB 3QRXA 1C07A 1JSAA 1CDLA 3SG3A 3ZWHA 1BJFA 3GK1A 2LMTA 2Y1NA 2MRDA 1W7IB 1LKJA 2MLEC 1XVJA 1UURA 1QVIY 4IL1A 4QJ5B 2MHHA 1L7ZA 1V1FA 2G9BA 4U8DA 1ZMZA 4CIDA 3CZTX 3LL8B 4N1FA 4AQJA 3TS5C 1AP4A 1AJ4A 1EXRA 1CFFA 1TNWA 5HYDA 3BUNB 1BG1A 4DCKA 3SG7A 5ER4X 2KHNA 4E68A 2NLNA 1SNLA 1QX7A 2K61A 1K95A 2KDHA 4USLA 4YI8A 1R6PA 3BUOB 2IS9A 1VRKA 2K7CA 2F2PA 4GBAA 5FYXA 4JPZB 5BPJA 1KFUL 1K94A 1QV0A 2JC2A 2A4JA 1LA0A 4YGBB 2JPTA 3LLEA 3FS7A 2CBLA 3PALA 1XFXO 2K7DA 4ZCUA 3BOWB 2BL0B 2LCPA 1WDCC 1DJWA 2I18A 3EVUA 3DF0A 4Q04A 4GGFC 1OMVA 1BODA 4YGDB 1GJYA 2ZRSA 1L2OC 3E3RA 2M8UA 3IF7A 1LINA 1ALVA 2MA2A 1CLMA 1PALA 1XYDA 1K9PA 5I2LA 5G08A 3TS5B 4OCIA 3O6BA 2F3YA 1QXPA 4JWQA 1SW8A 2GGZA 4XYNA 1NIWA 3BUMB 5HKWA 1YRUB 1PVBA 3I5IC 3SG5A 4I5NB 4C0KA 1RECA 2KBMA 1NX0A 1YVHA 1F4QA 1SK6D 2AAOA 3VROA 1CDMA 1DGVA 1M45A 4FQOA 1QV1A 1TOPA 1BR4B 1JF2A 1UWOA 4N1GA 3VRQA 3LK0A 1GGZA 1K9UA 3PATA 3KHEA 1KWOC 1AUIB 1B7TY 2LMVA 4BY5A 1SPYA 2HETA 1YX7A 3SIAA 3TDIA 3KF9A 5CSJA 2BCBA 2VRGA 1XA5A 4F0ZB 2M1UA 1G8IA 3D0YB 4MVFA 2ZRTA 2FOTA 3MSEB 3OP0A 4YBHB 1B47A 3I5HB 4GNKB 1XFUO 1S6IA 2LAPA 2K8MB 2D8NA 3A4UB 1L2OB 3TUYC 1QX5B 1UP5A 1DVIA 1S6JA 1SCMB 1F4OA 1CFCA 1GGWA 3KPXA 3SG4A 2K2AA 5HKYA 2LC5A 1LA3A 4XJKA 1C7WA 1KSOA 3PN7C 4C0LA 1K2HA 1KFXS 1DF0A 3NSOA 4OV2A 5ER5A 2KI6D 1CFPA 1XFVO 1G33A 2KYCA 2ZNEA 4A4BA 3AKBA 1NX2A 2KNEA 2KBIA 1EJ3A 3VRPA 1F71A 4D1EA 1AK8A 1B8RA 4WRIA 1KK7Z 2LE9B 2HF5A 2L2EA 4HREE 1A4PA 3LCPC 1XO5A 1HQVA 3CR5X 1IRJA 1CFDA 1MUXA 5IBWA 2O60A 1J55A 1RTP1 1EG4A 1IWQA 2L98A 1DMOA 2CT9A 3CTNA 5PALA 1ZFSA 1SBJA 1SL8A 1XFWO 1MXEA 3BXKA 4OVNF 4NDBA 4ORCB 5I8NA 1TN4A 1CMFA 1KQMB 1KQVA 1HT9A 2LUXA 2KSPA 1MHOA 2JTZA 4MRXA 1W7JB 1M46A 1PSBA 2GGMA 2KAXA 1F55A 2FJUB 2L0PA 1N65A 2LVJA 5JOLA 3PN7B 2PMYA 2PALA 2ZN9A 3WNXB 1K96A 3TDZA 3OB1B 3GOFA 1WRZA 2KFHA 1JWDA 4GAOA 4GPLB 1IQ5A 1MWNA 2JXCA 1KFUS 1S1EA 2WC8A 3PSRA 4FTGA 2AMIA 1U5IA 1RWYA 1SR6C 1K90D 1UHKA 2K7OA 3CWGA 1Y1AA 3DVKA 1DTLA 1QIVA 2Y1MA 4HRHA 1Y1XA 1UHIA 2LVIA 2JT3A 1OMRA 2ZNDA 2H2KA 4GGNA 1NCZA 3JTDC 2ZFDA 2F3ZA 2AUCA 3EK8A 3DF0B 2HQWA 5B8IB 1N0YA 4YI9A 2L51A 1NX1A 2JQ6A 3CGAA 2MJWB 1WRLA 1C7VA 1TNXA 5AFPA 2LP2A 3WHTB 4PALA 2I94A 1NP8A 4YGCB 2BCXA 5GQQC 1DJXA 2Y5IA 5F6TA 1SY9A 2F8PA 4ORBB 1B1GA 1CDNA 1S26D 1PULA 4PE4A 1LVCD 1NCYA 1KK8C 1CM4A 1A75A 1H4BA 1Y1UA 3FWCA 2JU0A 2F33A 1AJ5A 3PFVA 1X02A 1MQ1A 2LLUA 3TZ1A 1J7PA 1CDPA 1DGUA 2NZ0A 2JXLA 3IQQA
chains in the Genus database with same CATH superfamily
1CLBA 3NGVA 2BCAA 2EHBA 1IGVA 5HLOA 3NSLA 1SR6B 1F8HA 5CSFA 4DRWA 1H8BA 3CS1A 4I5LB 2WC6A 1OQPA 1S5GY 3BFHA 4HSZA 1TTXA 1OSAA 1OOGA 2KI6C 2LV7A 2QEVA 2E30A 3AKAA 1TRFA 3JTDB 3PLFB 3S0EA 1IIOA 1LXFC 1BR1B 2KGBC 3L4AA 1XK4A 3I5GC 3JVTC 3AAKA 1WDCB 2KGRA 1KCYA 3RZSA 5KTYA 2PVBA 2QDIA 4ZCVA 4N5XA 1RFJA 2O5GA 1CB1A 1F70A 2JZIA 1DQEA 2CCMA 3D76A 1CNPA 4NDCA 1TCFA 1OZSA 1SSEB 1NSHA 2E6WA 2OTGC 2P71A 2PQLA 2RGIA 2TN4A 3OB2B 3OBVA 4FQTA 3NSKA 1NCXA 4YGAA 2MAZA 1SYMA 2I7AA 4ETOA 1JFKA 3CR4X 3L4LA 3SG6A 4DIRA 1DJHA 1GQMA 5KSZA 2JNFA 1BU3A 1WY9A 3RM1A 2NCPA 1SL7A 2BECA 3CABA 1QIWA 1QASA 2GV5A 1BF5A 1J7OA 3EVVA 1CM1A 1SCVA 2LMUA 1C3ZA 4MSPA 2HQ8A 3I5IB 5I2QA 1FBVA 4PCWA 1CTRA 1YR5A 4R1EA 5HLVA 1BMOA 2KI4C 2Q91A 2ZKMX 3SS3A 3K21A 1QATA 2COLB 2KFFA 1ZOTB 4OKHA 2ISDA 5AEQA 4L9MA 4MEWA 5JJGA 1WLZA 2L50A 2P6BB 2ZN8A 1D1OA 3BUXB 1AVSA 2LLTA 2OPOA 2K2FA 2JTTA 3JVTB 1PVAA 3TDUA 2QACA 1B7TZ 1KWOB 3DVJA 4JQ0D 1LS8A 3D10A 1EH2A 1A2XA 1WRKA 4PHNA 2LUCA 3GK4X 1CMGA 1B8CA 1QLSA 2BKIB 2WCLA 1DJIA 5CSIA 3O78A 4PHJA 1PSRA 1YUSA 5DKRA 3TUYB 2WCEA 1M39A 1YUTA 2OS8C 1TNQA 2GTEA 3CR2A 1YRTB 4M2QA 4BY4A 1YTZC 1JBAA 4ICBA 2G2BA 1YVLA 1A29A 2WORA 2KYFA 2M0RA 3HX4A 3NSIA 3OHMB 3B6XA 1IJ5A 2HPSA 2KPHA 3PJIA 1NPQA 3R72A 3EK4A 2SCPA 3BQ3A 3ZNIA 2KI4B 1TNPA 3FE6A 1EL4A 1K93D 4PHMA 1F54A 1YURA 3B88A 4YRUA 2L4IA 3EKJA 2BBMA 4WQ2A 2JT8A 1XK4C 4PDZA 1Y6WA 4NDDA 1OE9B 2LHIA 2KOTA 3AAJA 1NWDA 1DC1A 2WCKA 1XFZO 2MLFC 4MZKA 1FF1A 3DD4A 3IQOA 1MXLC 2K7BA 1BT6A 1CKKA 1K8UA 1J7QA 3M0WA 3FE9A 4PHKA 1MR8A 4MBEA 2LANA 3VRNA 2NCOA 2M7LA 1BLQA 1NYAA 1E8AA 1KSMA 1M31A 1UHNA 1A75B 2B1UA 3CYZA 3V2LA 5DICA 3BYAA 1DJYA 2OS8B 1RROA 2Q4UA 3CZ0A 3LK1A 1QVIZ 1RJVA 3VGOA 3ICBA 2SASA 4P5OE 1N2DA 4A4CA 1GM0A 3F45A 4TNCA 1QJTA 2M3WA 5DKNA 2ERBA 5AERA 1DT7B 1ODBA 4HRGA 4MZJA 1V1GA 5TNCA 3BFBA 3QMEA 1OOIX 4NQGA 4PE0A 1S6CA 1YX8A 2KFGA 3WHUB 3RLZA 1UHHA 3IVTA 2WCFA 1NUBA 2JWWA 3DXLA 3SIBA 3BOWA 2I2RE 1FI5A 1T14A 3I5HC 4GFTA 1IG5A 1QTXA 2M29A 3I5FC 3WXAA 1JFJA 2PSRA 3Q8IA 1TCOB 3DVMA 1SMGA 1JC2A 1WLMA 3PM8A 4CFRA 2LM5A 1SCMC 2M1KB 1J1DA 2PASA 1J1EA 2WCMA 2BE6A 2FCDA 2JT0A 3KEVA 2EC6C 1NX3A 3NHTA 4I5JA 3A8RA 1EG3A 3B7AA 1AHRA 1K9KA 2WCJA 3BUWB 4C0JA 2LHLA 1M63B 3EVRA 1ZACA 4CLNA 2LVVA 1ZUZA 1Q80A 1OMDA 2LP3A 5CPVA 4CPVA 1R2UA 5I94A 2KAVA 1FW4A 2CXJA 2CNPA 2JRFA 2WCBA 4MLWA 1G4YR 2H61C 1JF0A 1CLLA 1SL9A 3NXAA 4QJ4B 1SKTA 2FCEA 2M7NA 2Y4QA 4XJKB 2CTNA 1S36A 2BBNA 3O2PA 2M97A 5HKZA 4CFQA 1DF0B 1ALWA 1KK7Y 1KK8B 2JNXA 2MBXA 1S3PA 1XFRA 2KAYA 4DUQA 1A03A 3SS5A 4MRYA 2WOSA 2JOJA 1FI6A 5AXIA 4I5KA 5J3XA 3HCMA 1BOCA 4GUKA 2EGDA 5K89A 1OOHA 3CZ1A 1PRWA 2F2OA 2L2CA 2LNKA 3DVEA 2M49B 3KO0A 2BE4A 2V53A 1KQMC 1DELA 3I5FB 3O4YA 3SJSA 1S5GZ 4M2OA 4UPGA 1Y0VH 4GGFA 1TIZA 1UUSA 2EC6B 1DJGA 2L5XB 3D0YA 3OX6A 4M2PA 4WQ3A 5DKQA 1B9AA 4YGEB 2WC5A 2FJYA 2QPTA 3EKHA 1IKUA 5FI2A 3OX5A 3I5GB 1J7RA 3FIAA 3H4SE 4DS7A 1DJZA 1PK0D 1RK9A 2KQ6A 3EK7A 1OOJA 1QLKA 3NHIA 3VRRA 4ORAB 4PE7A 2R2IA 3C1VA 4MZLA 4QJ3B 3GK2A 1KFXL 2OTGB 5D7FA 5AANA 1QX2A 5CSNA 2L4HA 1SRAA 1IH0A 1XFYO 1JUOA 3SG2A 1IJ6A 2M9GA 5I2OA 5KU1A 4AOMA 1FPWA 2LVKA 4MN0A 4AQIA 4IJ7A 5FI6A 5FI7A 2DOQA 2KQYA 2H61A 1B8LA 1UHJA 3CLNA 4PE1A 2LLSA 4OR9B 3FWBA 1YUUA 1OZOA 2WNDA 3D75A 2PRUA 3S0FA 1OOFA 2JULA 1U5IB 2NXQA 5D69A 2K0JA 1QS7A 1IQ3A 4P2YB 2BL0C 1MF8B 2BKHB 3QRXA 1C07A 1JSAA 1CDLA 3SG3A 3ZWHA 1BJFA 2PYQA 2QEHA 3GK1A 2LMTA 2Y1NA 2MRDA 1W7IB 1LKJA 2MLEC 3D73A 1XVJA 1UURA 1QVIY 4IL1A 4QJ5B 2MHHA 1L7ZA 1V1FA 2G9BA 4U8DA 1ZMZA 4CIDA 3CZTX 3LL8B 4N1FA 2QEBA 3TS5C 4AQJA 1AP4A 1AJ4A 1EXRA 1CFFA 1TNWA 5HYDA 3BUNB 1BG1A 4DCKA 3SG7A 5ER4X 2KHNA 4F7FA 4E68A 2NLNA 1SNLA 1QX7A 2K61A 1K95A 2KDHA 4USLA 4YI8A 1R6PA 3BUOB 2IS9A 1VRKA 2K7CA 2F2PA 4GBAA 5FYXA 4JPZB 5BPJA 1KFUL 1K94A 1QV0A 2JC2A 2A4JA 1LA0A 4JKTA 4YGBB 3DYEA 2JPTA 3LLEA 3FS7A 4JD9A 2CBLA 1DEKA 2P70A 3PALA 1XFXO 2K60A 2K7DA 4ZCUA 3BOWB 1Z2CB 3R1PA 2BL0B 4INWA 1Z4HA 2LCPA 1WDCC 3DZTA 1DJWA 2BNXA 2I18A 3EVUA 3DF0A 4Q04A 4GGFC 1OMVA 1BODA 1TWOA 4YGDB 1GJYA 2ZRSA 1L2OC 3E3RA 2M8UA 2KLDA 3IF7A 1LINA 1ALVA 2MA2A 1CLMA 1PALA 1XYDA 3FE8A 1K9PA 5I2LA 1TUZA 5G08A 3TS5B 4OCIA 3O6BA 2F3YA 1QXPA 4JWQA 3BFAA 1SW8A 1P28A 2GGZA 4XYNA 1NIWA 3BUMB 5HKWA 1YRUB 1PVBA 3I5IC 3SG5A 4I5NB 2KLEA 4C0KA 1RECA 2KBMA 1NX0A 3UO9A 1YVHA 1F4QA 1SK6D 2AAOA 3VROA 1CDMA 1DGVA 1M45A 4FQOA 2BAPA 1B4CA 1QV1A 1TOPA 1BR4B 1JF2A 1UWOA 4N1GA 3VRQA 3LK0A 1GGZA 1K9UA 4OZDA 3PATA 3KHEA 3DY9A 1KWOC 1AUIB 1B7TY 2LMVA 3K1EA 3UNWA 4BY5A 1SPYA 2HETA 1YX7A 3OGNA 3SIAA 3TDIA 3KF9A 5CSJA 2BCBA 2VRGA 1XA5A 4F0ZB 2M1UA 1G8IA 3D78A 3D0YB 4MVFA 2ZRTA 2FOTA 3MSEB 3OP0A 4YBHB 1B47A 3I5HB 4GNKB 1XFUO 1S6IA 1OW4A 2K8MB 2D8NA 2LAPA 1L2OB 1W9ZA 3A4UB 3O4XA 1QX5B 1UP5A 3VB1A 3TUYC 1DVIA 1S6JA 1SCMB 1F4OA 3L47A 1CFCA 1GGWA 3KPXA 3SG4A 2K2AA 5HKYA 2LC5A 1LA3A 3BJHA 1C7WA 1KSOA 3PN7C 4XJKA 4C0LA 1K2HA 1KFXS 1DF0A 3NSOA 4OV2A 5ER5A 2KI6D 3S0DA 1CFPA 1XFVO 1G33A 2KYCA 2ZNEA 4A4BA 3AKBA 1NX2A 2KNEA 3D77A 2KBIA 1EJ3A 3VRPA 1F71A 3R1OA 4D1EA 1AK8A 1B8RA 4WRIA 1KK7Z 2WCHA 3B87A 2LE9B 3N7HA 2HF5A 2L2EA 4HREE 1A4PA 3LCPC 1XO5A 1HQVA 3CR5X 1IRJA 1CFDA 1MUXA 5IBWA 3R1VA 2O60A 1J55A 1RTP1 1EG4A 1IWQA 2L98A 1DMOA 2CT9A 3CTNA 5PALA 1ZFSA 1SBJA 1SL8A 1XFWO 1MXEA 3BXKA 3S0AA 4OVNF 2L5YA 4NDBA 3PM2A 4ORCB 5I8NA 1TN4A 1CMFA 1KQMB 1KQVA 1HT9A 2LUXA 2KSPA 1MHOA 2JTZA 3B86A 4MRXA 1TUJA 1W7JB 1M46A 1PSBA 2H8VA 2GGMA 2KAXA 3S0GA 2YGUA 1F55A 2FJUB 2L0PA 1N65A 3D74A 5D3OA 2LVJA 5JOLA 3PN7B 2PMYA 2PALA 2ZN9A 3WNXB 1K96A 3TDZA 3OB1B 3GOFA 1WRZA 2KFHA 4KYNA 1JWDA 3S0BA 4GAOA 4GPLB 1IQ5A 1MWNA 1QWVA 2JXCA 1KFUS 1S1EA 2WC8A 3PSRA 4FTGA 2AMIA 4INXA 1U5IA 4PT1A 1RWYA 1SR6C 1K90D 1UHKA 2K7OA 3CWGA 1Y1AA 3DVKA 1DTLA 1QIVA 2Y1MA 4HRHA 1Y1XA 1UHIA 2LVIA 2JT3A 1OMRA 2ZNDA 2H2KA 3EG5B 1NCZA 4GGNA 3JTDC 2ZFDA 2F3ZA 2AUCA 3CDNA 3EK8A 5HL1A 3DF0B 2HQWA 5B8IB 1N0YA 4YI9A 2L51A 1NX1A 2JQ6A 3CGAA 2MJWB 1WRLA 1C7VA 1TNXA 5AFPA 1C3YA 2LP2A 3WHTB 4PALA 2I94A 1NP8A 4YGCB 5EL2A 2BCXA 5GQQC 1DJXA 2Y5IA 5F6TA 1SY9A 2F8PA 4ORBB 1B1GA 1CDNA 1S26D 1PULA 4PE4A 1LVCD 1NCYA 1KK8C 1CM4A 1A75A 1H4BA 1Y1UA 3FWCA 2JU0A 2F33A 1ORGA 1AJ5A 3SS4A 3PFVA 1X02A 1MQ1A 2LLUA 3CZ2A 3TZ1A 1CDPA 2JPOA 2QEOA 1J7PA 1DGUA 2NZ0A 2JXLA 3IQQA
chains in the Genus database with same CATH topology
1CLBA 2BCAA 2EHBA 1IGVA 5HLOA 3NSLA 1SR6B 1F8HA 5CSFA 4DRWA 1H8BA 3CS1A 4I5LB 1OQPA 1S5GY 1TTXA 1OSAA 2LV7A 2KI6C 3JTDB 3AKAA 2E30A 1TRFA 3PLFB 1LXFC 1BR1B 2KGBC 1XK4A 3I5GC 3JVTC 3AAKA 1WDCB 2KGRA 1KCYA 5KTYA 2PVBA 4ZCVA 4N5XA 1RFJA 2O5GA 1CB1A 2JZIA 2CCMA 1CNPA 4NDCA 1TCFA 1OZSA 3OB2B 1NSHA 2E6WA 2OTGC 2RGIA 2TN4A 4HSZA 1B4CA 3NSKA 1NCXA 4YGAA 2MAZA 1SYMA 2I7AA 4ETOA 1JFKA 3CR4X 3SG6A 4DIRA 1DJHA 1GQMA 5KSZA 2JNFA 1BU3A 1WY9A 3RM1A 2NCPA 1SL7A 2BECA 1QIWA 1QASA 2GV5A 1BF5A 1J7OA 3EVVA 1CM1A 1SCVA 2LMUA 4MSPA 2HQ8A 3I5IB 5I2QA 1FBVA 4PCWA 1CTRA 1YR5A 4R1EA 5HLVA 1BMOA 2KI4C 2Q91A 2ZKMX 3K21A 1QATA 2COLB 2KFFA 1ZOTB 4OKHA 2ISDA 5AEQA 4L9MA 4MEWA 5JJGA 1WLZA 2L50A 2P6BB 2ZN8A 1D1OA 3BUXB 1AVSA 2LLTA 2OPOA 2K2FA 2JTTA 3JVTB 1PVAA 3TDUA 2QACA 1B7TZ 1KWOB 3DVJA 4JQ0D 3D10A 1EH2A 1A2XA 1WRKA 4PHNA 2LUCA 3GK4X 1CMGA 1B8CA 1QLSA 2BKIB 1DJIA 5CSIA 3O78A 4PHJA 1PSRA 1YUSA 5DKRA 3TUYB 2WCEA 1M39A 1YUTA 2OS8C 1TNQA 3CR2A 1YRTB 4M2QA 4BY4A 1YTZC 1JBAA 4ICBA 2G2BA 1YVLA 1A29A 2WORA 2KYFA 2M0RA 3HX4A 3NSIA 3OHMB 1IJ5A 2HPSA 1NPQA 3EK4A 2SCPA 3BQ3A 3ZNIA 2KI4B 1TNPA 1EL4A 1K93D 4PHMA 1F54A 1YURA 4YRUA 2L4IA 3EKJA 2BBMA 4WQ2A 2JT8A 1XK4C 4PDZA 1Y6WA 4NDDA 1OE9B 2LHIA 2KOTA 3AAJA 1NWDA 1XFZO 2MLFC 4MZKA 1FF1A 3DD4A 3IQOA 1MXLC 2K7BA 1BT6A 1CKKA 1K8UA 1J7QA 3M0WA 4PHKA 1MR8A 4MBEA 2LANA 3VRNA 2NCOA 2M7LA 1BLQA 1NYAA 1E8AA 1KSMA 1M31A 1UHNA 1A75B 2B1UA 3BYAA 1DJYA 2OS8B 1RROA 2Q4UA 3LK1A 1QVIZ 1RJVA 3VGOA 3ICBA 2SASA 4P5OE 1N2DA 4A4CA 3F45A 4TNCA 1QJTA 2M3WA 5DKNA 5AERA 1DT7B 1ODBA 4HRGA 4MZJA 1V1GA 5TNCA 4NQGA 4PE0A 1S6CA 1YX8A 2KFGA 3WHUB 3RLZA 1UHHA 2WCFA 1NUBA 2JWWA 3SIBA 3BOWA 2I2RE 1FI5A 3I5HC 4GFTA 1IG5A 1QTXA 2M29A 3I5FC 3WXAA 1JFJA 2PSRA 1F70A 1TCOB 3DVMA 1SMGA 1JC2A 1WLMA 3PM8A 4CFRA 2LM5A 1SCMC 2M1KB 1J1DA 2PASA 1J1EA 2BE6A 2FCDA 2JT0A 3KEVA 2EC6C 1NX3A 4I5JA 3A8RA 1EG3A 1AHRA 1K9KA 4C0JA 3BUWB 2LHLA 1M63B 3EVRA 1ZACA 4CLNA 2LVVA 1ZUZA 1Q80A 1OMDA 2LP3A 5CPVA 4CPVA 1R2UA 2KAVA 1FW4A 2CXJA 2CNPA 2JRFA 2WCBA 4MLWA 1G4YR 2H61C 1JF0A 1CLLA 1SL9A 3NXAA 4QJ4B 1SKTA 2FCEA 2M7NA 2Y4QA 4XJKB 2CTNA 1S36A 2BBNA 3O2PA 2M97A 5HKZA 4CFQA 1DF0B 1ALWA 1KK7Y 1KK8B 2JNXA 2MBXA 1S3PA 2KAYA 4DUQA 1A03A 4MRYA 2WOSA 2JOJA 1FI6A 5AXIA 4I5KA 5J3XA 3HCMA 1BOCA 4GUKA 2EGDA 5K89A 1PRWA 2F2OA 3DVEA 2LNKA 3KO0A 2M49B 2BE4A 2V53A 1KQMC 3I5FB 3O4YA 3SJSA 1S5GZ 4M2OA 4UPGA 1Y0VH 4GGFA 1TIZA 1UUSA 2EC6B 1DJGA 2L5XB 3D0YA 3OX6A 4M2PA 4WQ3A 5DKQA 1B9AA 4YGEB 3EKHA 1IKUA 2QPTA 3OX5A 3I5GB 1J7RA 3FIAA 3H4SE 4DS7A 1DJZA 1PK0D 1RK9A 2KQ6A 3EK7A 1OOJA 1QLKA 3VRRA 4ORAB 4PE7A 2R2IA 3C1VA 4MZLA 4QJ3B 3GK2A 1KFXL 2OTGB 5D7FA 5AANA 1QX2A 5CSNA 2L4HA 1SRAA 1IH0A 1XFYO 1JUOA 3SG2A 1IJ6A 2M9GA 5I2OA 5KU1A 4AOMA 1FPWA 2LVKA 4MN0A 4AQIA 2DOQA 2KQYA 2H61A 1B8LA 1UHJA 3CLNA 4PE1A 2LLSA 4OR9B 3FWBA 1YUUA 1OZOA 2WNDA 2PRUA 2JULA 1U5IB 2NXQA 5D69A 2K0JA 1QS7A 1IQ3A 4P2YB 2BL0C 1MF8B 2BKHB 3QRXA 1C07A 1JSAA 1CDLA 3SG3A 3ZWHA 1BJFA 3GK1A 2LMTA 2Y1NA 2MRDA 1W7IB 1LKJA 2MLEC 1XVJA 1UURA 1QVIY 4IL1A 4QJ5B 2MHHA 1L7ZA 1V1FA 2G9BA 4U8DA 1ZMZA 4CIDA 3CZTX 3LL8B 4N1FA 4AQJA 3TS5C 1AP4A 1AJ4A 1EXRA 1CFFA 1TNWA 5HYDA 3BUNB 1BG1A 4DCKA 3SG7A 5ER4X 2KHNA 4E68A 2NLNA 1SNLA 1QX7A 2K61A 1K95A 2KDHA 4USLA 4YI8A 1R6PA 3BUOB 2IS9A 1VRKA 2K7CA 2F2PA 4GBAA 5FYXA 4JPZB 5BPJA 1KFUL 1K94A 1QV0A 2JC2A 2A4JA 1LA0A 4YGBB 2JPTA 3LLEA 3FS7A 2CBLA 3PALA 1XFXO 2K7DA 4ZCUA 3BOWB 2BL0B 2LCPA 1WDCC 1DJWA 2I18A 3EVUA 3DF0A 4Q04A 4GGFC 1OMVA 1BODA 4YGDB 1GJYA 2ZRSA 1L2OC 3E3RA 2M8UA 3IF7A 1LINA 1ALVA 2MA2A 1CLMA 1PALA 1XYDA 1K9PA 5I2LA 5G08A 3TS5B 4OCIA 3O6BA 2F3YA 1QXPA 4JWQA 1SW8A 2GGZA 4XYNA 1NIWA 3BUMB 5HKWA 1YRUB 1PVBA 3I5IC 3SG5A 4I5NB 4C0KA 1RECA 2KBMA 1NX0A 1YVHA 1F4QA 1SK6D 2AAOA 3VROA 1CDMA 1DGVA 1M45A 4FQOA 1QV1A 1TOPA 1BR4B 1JF2A 1UWOA 4N1GA 3VRQA 3LK0A 1GGZA 1K9UA 3PATA 3KHEA 1KWOC 1AUIB 1B7TY 2LMVA 4BY5A 1SPYA 2HETA 1YX7A 3SIAA 3TDIA 3KF9A 5CSJA 2BCBA 2VRGA 1XA5A 4F0ZB 2M1UA 1G8IA 3D0YB 4MVFA 2ZRTA 2FOTA 3MSEB 3OP0A 4YBHB 1B47A 3I5HB 4GNKB 1XFUO 1S6IA 2LAPA 2K8MB 2D8NA 3A4UB 1L2OB 3TUYC 1QX5B 1UP5A 1DVIA 1S6JA 1SCMB 1F4OA 1CFCA 1GGWA 3KPXA 3SG4A 2K2AA 5HKYA 2LC5A 1LA3A 4XJKA 1C7WA 1KSOA 3PN7C 4C0LA 1K2HA 1KFXS 1DF0A 3NSOA 4OV2A 5ER5A 2KI6D 1CFPA 1XFVO 1G33A 2KYCA 2ZNEA 4A4BA 3AKBA 1NX2A 2KNEA 2KBIA 1EJ3A 3VRPA 1F71A 4D1EA 1AK8A 1B8RA 4WRIA 1KK7Z 2LE9B 2HF5A 2L2EA 4HREE 1A4PA 3LCPC 1XO5A 1HQVA 3CR5X 1IRJA 1CFDA 1MUXA 5IBWA 2O60A 1J55A 1RTP1 1EG4A 1IWQA 2L98A 1DMOA 2CT9A 3CTNA 5PALA 1ZFSA 1SBJA 1SL8A 1XFWO 1MXEA 3BXKA 4OVNF 4NDBA 4ORCB 5I8NA 1TN4A 1CMFA 1KQMB 1KQVA 1HT9A 2LUXA 2KSPA 1MHOA 2JTZA 4MRXA 1W7JB 1M46A 1PSBA 2GGMA 2KAXA 1F55A 2FJUB 2L0PA 1N65A 2LVJA 5JOLA 3PN7B 2PMYA 2PALA 2ZN9A 3WNXB 1K96A 3TDZA 3OB1B 3GOFA 1WRZA 2KFHA 1JWDA 4GAOA 4GPLB 1IQ5A 1MWNA 2JXCA 1KFUS 1S1EA 2WC8A 3PSRA 4FTGA 2AMIA 1U5IA 1RWYA 1SR6C 1K90D 1UHKA 2K7OA 3CWGA 1Y1AA 3DVKA 1DTLA 1QIVA 2Y1MA 4HRHA 1Y1XA 1UHIA 2LVIA 2JT3A 1OMRA 2ZNDA 2H2KA 4GGNA 1NCZA 3JTDC 2ZFDA 2F3ZA 2AUCA 3EK8A 3DF0B 2HQWA 5B8IB 1N0YA 4YI9A 2L51A 1NX1A 2JQ6A 3CGAA 2MJWB 1WRLA 1C7VA 1TNXA 5AFPA 2LP2A 3WHTB 4PALA 2I94A 1NP8A 4YGCB 2BCXA 5GQQC 1DJXA 2Y5IA 5F6TA 1SY9A 2F8PA 4ORBB 1B1GA 1CDNA 1S26D 1PULA 4PE4A 1LVCD 1NCYA 1KK8C 1CM4A 1A75A 1H4BA 1Y1UA 3FWCA 2JU0A 2F33A 1AJ5A 3PFVA 1X02A 1MQ1A 2LLUA 3TZ1A 1J7PA 1CDPA 1DGUA 2NZ0A 2JXLA 3IQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CLB A;  2BCA A;  2EHB A;  1IGV A;  5HLO A;  3NSL A;  1SR6 B;  1F8H A;  5CSF A;  4DRW A;  1H8B A;  3CS1 A;  4I5L B;  1OQP A;  1S5G Y;  1TTX A;  1OSA A;  2LV7 A;  2KI6 C;  3JTD B;  3AKA A;  2E30 A;  1TRF A;  3PLF B;  1LXF C;  1BR1 B;  2KGB C;  1XK4 A;  3I5G C;  3JVT C;  3AAK A;  1WDC B;  2KGR A;  1KCY A;  5KTY A;  2PVB A;  4ZCV A;  4N5X A;  1RFJ A;  2O5G A;  1CB1 A;  2JZI A;  2CCM A;  1CNP A;  4NDC A;  1TCF A;  1OZS A;  3OB2 B;  1NSH A;  2E6W A;  2OTG C;  2RGI A;  2TN4 A;  4HSZ A;  1B4C A;  3NSK A;  1NCX A;  4YGA A;  2MAZ A;  1SYM A;  2I7A A;  4ETO A;  1JFK A;  3CR4 X;  3SG6 A;  4DIR A;  1DJH A;  1GQM A;  5KSZ A;  2JNF A;  1BU3 A;  1WY9 A;  3RM1 A;  2NCP A;  1SL7 A;  2BEC A;  1QIW A;  1QAS A;  2GV5 A;  1BF5 A;  1J7O A;  3EVV A;  1CM1 A;  1SCV A;  2LMU A;  4MSP A;  2HQ8 A;  3I5I B;  5I2Q A;  1FBV A;  4PCW A;  1CTR A;  1YR5 A;  4R1E A;  5HLV A;  1BMO A;  2KI4 C;  2Q91 A;  2ZKM X;  3K21 A;  1QAT A;  2COL B;  2KFF A;  1ZOT B;  4OKH A;  2ISD A;  5AEQ A;  4L9M A;  4MEW A;  5JJG A;  1WLZ A;  2L50 A;  2P6B B;  2ZN8 A;  1D1O A;  3BUX B;  1AVS A;  2LLT A;  2OPO A;  2K2F A;  2JTT A;  3JVT B;  1PVA A;  3TDU A;  2QAC A;  1B7T Z;  1KWO B;  3DVJ A;  4JQ0 D;  3D10 A;  1EH2 A;  1A2X A;  1WRK A;  4PHN A;  2LUC A;  3GK4 X;  1CMG A;  1B8C A;  1QLS A;  2BKI B;  1DJI A;  5CSI A;  3O78 A;  4PHJ A;  1PSR A;  1YUS A;  5DKR A;  3TUY B;  2WCE A;  1M39 A;  1YUT A;  2OS8 C;  1TNQ A;  3CR2 A;  1YRT B;  4M2Q A;  4BY4 A;  1YTZ C;  1JBA A;  4ICB A;  2G2B A;  1YVL A;  1A29 A;  2WOR A;  2KYF A;  2M0R A;  3HX4 A;  3NSI A;  3OHM B;  1IJ5 A;  2HPS A;  1NPQ A;  3EK4 A;  2SCP A;  3BQ3 A;  3ZNI A;  2KI4 B;  1TNP A;  1EL4 A;  1K93 D;  4PHM A;  1F54 A;  1YUR A;  4YRU A;  2L4I A;  3EKJ A;  2BBM A;  4WQ2 A;  2JT8 A;  1XK4 C;  4PDZ A;  1Y6W A;  4NDD A;  1OE9 B;  2LHI A;  2KOT A;  3AAJ A;  1NWD A;  1XFZ O;  2MLF C;  4MZK A;  1FF1 A;  3DD4 A;  3IQO A;  1MXL C;  2K7B A;  1BT6 A;  1CKK A;  1K8U A;  1J7Q A;  3M0W A;  4PHK A;  1MR8 A;  4MBE A;  2LAN A;  3VRN A;  2NCO A;  2M7L A;  1BLQ A;  1NYA A;  1E8A A;  1KSM A;  1M31 A;  1UHN A;  1A75 B;  2B1U A;  3BYA A;  1DJY A;  2OS8 B;  1RRO A;  2Q4U A;  3LK1 A;  1QVI Z;  1RJV A;  3VGO A;  3ICB A;  2SAS A;  4P5O E;  1N2D A;  4A4C A;  3F45 A;  4TNC A;  1QJT A;  2M3W A;  5DKN A;  5AER A;  1DT7 B;  1ODB A;  4HRG A;  4MZJ A;  1V1G A;  5TNC A;  4NQG A;  4PE0 A;  1S6C A;  1YX8 A;  2KFG A;  3WHU B;  3RLZ A;  1UHH A;  2WCF A;  1NUB A;  2JWW A;  3SIB A;  3BOW A;  2I2R E;  1FI5 A;  3I5H C;  4GFT A;  1IG5 A;  1QTX A;  2M29 A;  3I5F C;  3WXA A;  1JFJ A;  2PSR A;  1F70 A;  1TCO B;  3DVM A;  1SMG A;  1JC2 A;  1WLM A;  3PM8 A;  4CFR A;  2LM5 A;  1SCM C;  2M1K B;  1J1D A;  2PAS A;  1J1E A;  2BE6 A;  2FCD A;  2JT0 A;  3KEV A;  2EC6 C;  1NX3 A;  4I5J A;  3A8R A;  1EG3 A;  1AHR A;  1K9K A;  4C0J A;  3BUW B;  2LHL A;  1M63 B;  3EVR A;  1ZAC A;  4CLN A;  2LVV A;  1ZUZ A;  1Q80 A;  1OMD A;  2LP3 A;  5CPV A;  4CPV A;  1R2U A;  2KAV A;  1FW4 A;  2CXJ A;  2CNP A;  2JRF A;  2WCB A;  4MLW A;  1G4Y R;  2H61 C;  1JF0 A;  1CLL A;  1SL9 A;  3NXA A;  4QJ4 B;  1SKT A;  2FCE A;  2M7N A;  2Y4Q A;  4XJK B;  2CTN A;  1S36 A;  2BBN A;  3O2P A;  2M97 A;  5HKZ A;  4CFQ A;  1DF0 B;  1ALW A;  1KK7 Y;  1KK8 B;  2JNX A;  2MBX A;  1S3P A;  2KAY A;  4DUQ A;  1A03 A;  4MRY A;  2WOS A;  2JOJ A;  1FI6 A;  5AXI A;  4I5K A;  5J3X A;  3HCM A;  1BOC A;  4GUK A;  2EGD A;  5K89 A;  1PRW A;  2F2O A;  3DVE A;  2LNK A;  3KO0 A;  2M49 B;  2BE4 A;  2V53 A;  1KQM C;  3I5F B;  3O4Y A;  3SJS A;  1S5G Z;  4M2O A;  4UPG A;  1Y0V H;  4GGF A;  1TIZ A;  1UUS A;  2EC6 B;  1DJG A;  2L5X B;  3D0Y A;  3OX6 A;  4M2P A;  4WQ3 A;  5DKQ A;  1B9A A;  4YGE B;  3EKH A;  1IKU A;  2QPT A;  3OX5 A;  3I5G B;  1J7R A;  3FIA A;  3H4S E;  4DS7 A;  1DJZ A;  1PK0 D;  1RK9 A;  2KQ6 A;  3EK7 A;  1OOJ A;  1QLK A;  3VRR A;  4ORA B;  4PE7 A;  2R2I A;  3C1V A;  4MZL A;  4QJ3 B;  3GK2 A;  1KFX L;  2OTG B;  5D7F A;  5AAN A;  1QX2 A;  5CSN A;  2L4H A;  1SRA A;  1IH0 A;  1XFY O;  1JUO A;  3SG2 A;  1IJ6 A;  2M9G A;  5I2O A;  5KU1 A;  4AOM A;  1FPW A;  2LVK A;  4MN0 A;  4AQI A;  2DOQ A;  2KQY A;  2H61 A;  1B8L A;  1UHJ A;  3CLN A;  4PE1 A;  2LLS A;  4OR9 B;  3FWB A;  1YUU A;  1OZO A;  2WND A;  2PRU A;  2JUL A;  1U5I B;  2NXQ A;  5D69 A;  2K0J A;  1QS7 A;  1IQ3 A;  4P2Y B;  2BL0 C;  1MF8 B;  2BKH B;  3QRX A;  1C07 A;  1JSA A;  1CDL A;  3SG3 A;  3ZWH A;  1BJF A;  3GK1 A;  2LMT A;  2Y1N A;  2MRD A;  1W7I B;  1LKJ A;  2MLE C;  1XVJ A;  1UUR A;  1QVI Y;  4IL1 A;  4QJ5 B;  2MHH A;  1L7Z A;  1V1F A;  2G9B A;  4U8D A;  1ZMZ A;  4CID A;  3CZT X;  3LL8 B;  4N1F A;  4AQJ A;  3TS5 C;  1AP4 A;  1AJ4 A;  1EXR A;  1CFF A;  1TNW A;  5HYD A;  3BUN B;  1BG1 A;  4DCK A;  3SG7 A;  5ER4 X;  2KHN A;  4E68 A;  2NLN A;  1SNL A;  1QX7 A;  2K61 A;  1K95 A;  2KDH A;  4USL A;  4YI8 A;  1R6P A;  3BUO B;  2IS9 A;  1VRK A;  2K7C A;  2F2P A;  4GBA A;  5FYX A;  4JPZ B;  5BPJ A;  1KFU L;  1K94 A;  1QV0 A;  2JC2 A;  2A4J A;  1LA0 A;  4YGB B;  2JPT A;  3LLE A;  3FS7 A;  2CBL A;  3PAL A;  1XFX O;  2K7D A;  4ZCU A;  3BOW B;  2BL0 B;  2LCP A;  1WDC C;  1DJW A;  2I18 A;  3EVU A;  3DF0 A;  4Q04 A;  4GGF C;  1OMV A;  1BOD A;  4YGD B;  1GJY A;  2ZRS A;  1L2O C;  3E3R A;  2M8U A;  3IF7 A;  1LIN A;  1ALV A;  2MA2 A;  1CLM A;  1PAL A;  1XYD A;  1K9P A;  5I2L A;  5G08 A;  3TS5 B;  4OCI A;  3O6B A;  2F3Y A;  1QXP A;  4JWQ A;  1SW8 A;  2GGZ A;  4XYN A;  1NIW A;  3BUM B;  5HKW A;  1YRU B;  1PVB A;  3I5I C;  3SG5 A;  4I5N B;  4C0K A;  1REC A;  2KBM A;  1NX0 A;  1YVH A;  1F4Q A;  1SK6 D;  2AAO A;  3VRO A;  1CDM A;  1DGV A;  1M45 A;  4FQO A;  1QV1 A;  1TOP A;  1BR4 B;  1JF2 A;  1UWO A;  4N1G A;  3VRQ A;  3LK0 A;  1GGZ A;  1K9U A;  3PAT A;  3KHE A;  1KWO C;  1AUI B;  1B7T Y;  2LMV A;  4BY5 A;  1SPY A;  2HET A;  1YX7 A;  3SIA A;  3TDI A;  3KF9 A;  5CSJ A;  2BCB A;  2VRG A;  1XA5 A;  4F0Z B;  2M1U A;  1G8I A;  3D0Y B;  4MVF A;  2ZRT A;  2FOT A;  3MSE B;  3OP0 A;  4YBH B;  1B47 A;  3I5H B;  4GNK B;  1XFU O;  1S6I A;  2LAP A;  2K8M B;  2D8N A;  3A4U B;  1L2O B;  3TUY C;  1QX5 B;  1UP5 A;  1DVI A;  1S6J A;  1SCM B;  1F4O A;  1CFC A;  1GGW A;  3KPX A;  3SG4 A;  2K2A A;  5HKY A;  2LC5 A;  1LA3 A;  4XJK A;  1C7W A;  1KSO A;  3PN7 C;  4C0L A;  1K2H A;  1KFX S;  1DF0 A;  3NSO A;  4OV2 A;  5ER5 A;  2KI6 D;  1CFP A;  1XFV O;  1G33 A;  2KYC A;  2ZNE A;  4A4B A;  3AKB A;  1NX2 A;  2KNE A;  2KBI A;  1EJ3 A;  3VRP A;  1F71 A;  4D1E A;  1AK8 A;  1B8R A;  4WRI A;  1KK7 Z;  2LE9 B;  2HF5 A;  2L2E A;  4HRE E;  1A4P A;  3LCP C;  1XO5 A;  1HQV A;  3CR5 X;  1IRJ A;  1CFD A;  1MUX A;  5IBW A;  2O60 A;  1J55 A;  1RTP 1;  1EG4 A;  1IWQ A;  2L98 A;  1DMO A;  2CT9 A;  3CTN A;  5PAL A;  1ZFS A;  1SBJ A;  1SL8 A;  1XFW O;  1MXE A;  3BXK A;  4OVN F;  4NDB A;  4ORC B;  5I8N A;  1TN4 A;  1CMF A;  1KQM B;  1KQV A;  1HT9 A;  2LUX A;  2KSP A;  1MHO A;  2JTZ A;  4MRX A;  1W7J B;  1M46 A;  1PSB A;  2GGM A;  2KAX A;  1F55 A;  2FJU B;  2L0P A;  1N65 A;  2LVJ A;  5JOL A;  3PN7 B;  2PMY A;  2PAL A;  2ZN9 A;  3WNX B;  1K96 A;  3TDZ A;  3OB1 B;  3GOF A;  1WRZ A;  2KFH A;  1JWD A;  4GAO A;  4GPL B;  1IQ5 A;  1MWN A;  2JXC A;  1KFU S;  1S1E A;  2WC8 A;  3PSR A;  4FTG A;  2AMI A;  1U5I A;  1RWY A;  1SR6 C;  1K90 D;  1UHK A;  2K7O A;  3CWG A;  1Y1A A;  3DVK A;  1DTL A;  1QIV A;  2Y1M A;  4HRH A;  1Y1X A;  1UHI A;  2LVI A;  2JT3 A;  1OMR A;  2ZND A;  2H2K A;  4GGN A;  1NCZ A;  3JTD C;  2ZFD A;  2F3Z A;  2AUC A;  3EK8 A;  3DF0 B;  2HQW A;  5B8I B;  1N0Y A;  4YI9 A;  2L51 A;  1NX1 A;  2JQ6 A;  3CGA A;  2MJW B;  1WRL A;  1C7V A;  1TNX A;  5AFP A;  2LP2 A;  3WHT B;  4PAL A;  2I94 A;  1NP8 A;  4YGC B;  2BCX A;  5GQQ C;  1DJX A;  2Y5I A;  5F6T A;  1SY9 A;  2F8P A;  4ORB B;  1B1G A;  1CDN A;  1S26 D;  1PUL A;  4PE4 A;  1LVC D;  1NCY A;  1KK8 C;  1CM4 A;  1A75 A;  1H4B A;  1Y1U A;  3FWC A;  2JU0 A;  2F33 A;  1AJ5 A;  3PFV A;  1X02 A;  1MQ1 A;  2LLU A;  3TZ1 A;  1J7P A;  1CDP A;  1DGU A;  2NZ0 A;  2JXL A;  3IQQ A; 
#chains in the Genus database with same CATH topology
 1CLB A;  3NGV A;  2BCA A;  2EHB A;  1IGV A;  5HLO A;  3NSL A;  1SR6 B;  1F8H A;  5CSF A;  4DRW A;  1H8B A;  3CS1 A;  4I5L B;  2WC6 A;  1OQP A;  1S5G Y;  3BFH A;  4HSZ A;  1TTX A;  1OSA A;  1OOG A;  2KI6 C;  2LV7 A;  2QEV A;  2E30 A;  3AKA A;  1TRF A;  3JTD B;  3PLF B;  3S0E A;  1IIO A;  1LXF C;  1BR1 B;  2KGB C;  3L4A A;  1XK4 A;  3I5G C;  3JVT C;  3AAK A;  1WDC B;  2KGR A;  1KCY A;  3RZS A;  5KTY A;  2PVB A;  2QDI A;  4ZCV A;  4N5X A;  1RFJ A;  2O5G A;  1CB1 A;  1F70 A;  2JZI A;  1DQE A;  2CCM A;  3D76 A;  1CNP A;  4NDC A;  1TCF A;  1OZS A;  1SSE B;  1NSH A;  2E6W A;  2OTG C;  2P71 A;  2PQL A;  2RGI A;  2TN4 A;  3OB2 B;  3OBV A;  4FQT A;  3NSK A;  1NCX A;  4YGA A;  2MAZ A;  1SYM A;  2I7A A;  4ETO A;  1JFK A;  3CR4 X;  3L4L A;  3SG6 A;  4DIR A;  1DJH A;  1GQM A;  5KSZ A;  2JNF A;  1BU3 A;  1WY9 A;  3RM1 A;  2NCP A;  1SL7 A;  2BEC A;  3CAB A;  1QIW A;  1QAS A;  2GV5 A;  1BF5 A;  1J7O A;  3EVV A;  1CM1 A;  1SCV A;  2LMU A;  1C3Z A;  4MSP A;  2HQ8 A;  3I5I B;  5I2Q A;  1FBV A;  4PCW A;  1CTR A;  1YR5 A;  4R1E A;  5HLV A;  1BMO A;  2KI4 C;  2Q91 A;  2ZKM X;  3SS3 A;  3K21 A;  1QAT A;  2COL B;  2KFF A;  1ZOT B;  4OKH A;  2ISD A;  5AEQ A;  4L9M A;  4MEW A;  5JJG A;  1WLZ A;  2L50 A;  2P6B B;  2ZN8 A;  1D1O A;  3BUX B;  1AVS A;  2LLT A;  2OPO A;  2K2F A;  2JTT A;  3JVT B;  1PVA A;  3TDU A;  2QAC A;  1B7T Z;  1KWO B;  3DVJ A;  4JQ0 D;  1LS8 A;  3D10 A;  1EH2 A;  1A2X A;  1WRK A;  4PHN A;  2LUC A;  3GK4 X;  1CMG A;  1B8C A;  1QLS A;  2BKI B;  2WCL A;  1DJI A;  5CSI A;  3O78 A;  4PHJ A;  1PSR A;  1YUS A;  5DKR A;  3TUY B;  2WCE A;  1M39 A;  1YUT A;  2OS8 C;  1TNQ A;  2GTE A;  3CR2 A;  1YRT B;  4M2Q A;  4BY4 A;  1YTZ C;  1JBA A;  4ICB A;  2G2B A;  1YVL A;  1A29 A;  2WOR A;  2KYF A;  2M0R A;  3HX4 A;  3NSI A;  3OHM B;  3B6X A;  1IJ5 A;  2HPS A;  2KPH A;  3PJI A;  1NPQ A;  3R72 A;  3EK4 A;  2SCP A;  3BQ3 A;  3ZNI A;  2KI4 B;  1TNP A;  3FE6 A;  1EL4 A;  1K93 D;  4PHM A;  1F54 A;  1YUR A;  3B88 A;  4YRU A;  2L4I A;  3EKJ A;  2BBM A;  4WQ2 A;  2JT8 A;  1XK4 C;  4PDZ A;  1Y6W A;  4NDD A;  1OE9 B;  2LHI A;  2KOT A;  3AAJ A;  1NWD A;  1DC1 A;  2WCK A;  1XFZ O;  2MLF C;  4MZK A;  1FF1 A;  3DD4 A;  3IQO A;  1MXL C;  2K7B A;  1BT6 A;  1CKK A;  1K8U A;  1J7Q A;  3M0W A;  3FE9 A;  4PHK A;  1MR8 A;  4MBE A;  2LAN A;  3VRN A;  2NCO A;  2M7L A;  1BLQ A;  1NYA A;  1E8A A;  1KSM A;  1M31 A;  1UHN A;  1A75 B;  2B1U A;  3CYZ A;  3V2L A;  5DIC A;  3BYA A;  1DJY A;  2OS8 B;  1RRO A;  2Q4U A;  3CZ0 A;  3LK1 A;  1QVI Z;  1RJV A;  3VGO A;  3ICB A;  2SAS A;  4P5O E;  1N2D A;  4A4C A;  1GM0 A;  3F45 A;  4TNC A;  1QJT A;  2M3W A;  5DKN A;  2ERB A;  5AER A;  1DT7 B;  1ODB A;  4HRG A;  4MZJ A;  1V1G A;  5TNC A;  3BFB A;  3QME A;  1OOI X;  4NQG A;  4PE0 A;  1S6C A;  1YX8 A;  2KFG A;  3WHU B;  3RLZ A;  1UHH A;  3IVT A;  2WCF A;  1NUB A;  2JWW A;  3DXL A;  3SIB A;  3BOW A;  2I2R E;  1FI5 A;  1T14 A;  3I5H C;  4GFT A;  1IG5 A;  1QTX A;  2M29 A;  3I5F C;  3WXA A;  1JFJ A;  2PSR A;  3Q8I A;  1TCO B;  3DVM A;  1SMG A;  1JC2 A;  1WLM A;  3PM8 A;  4CFR A;  2LM5 A;  1SCM C;  2M1K B;  1J1D A;  2PAS A;  1J1E A;  2WCM A;  2BE6 A;  2FCD A;  2JT0 A;  3KEV A;  2EC6 C;  1NX3 A;  3NHT A;  4I5J A;  3A8R A;  1EG3 A;  3B7A A;  1AHR A;  1K9K A;  2WCJ A;  3BUW B;  4C0J A;  2LHL A;  1M63 B;  3EVR A;  1ZAC A;  4CLN A;  2LVV A;  1ZUZ A;  1Q80 A;  1OMD A;  2LP3 A;  5CPV A;  4CPV A;  1R2U A;  5I94 A;  2KAV A;  1FW4 A;  2CXJ A;  2CNP A;  2JRF A;  2WCB A;  4MLW A;  1G4Y R;  2H61 C;  1JF0 A;  1CLL A;  1SL9 A;  3NXA A;  4QJ4 B;  1SKT A;  2FCE A;  2M7N A;  2Y4Q A;  4XJK B;  2CTN A;  1S36 A;  2BBN A;  3O2P A;  2M97 A;  5HKZ A;  4CFQ A;  1DF0 B;  1ALW A;  1KK7 Y;  1KK8 B;  2JNX A;  2MBX A;  1S3P A;  1XFR A;  2KAY A;  4DUQ A;  1A03 A;  3SS5 A;  4MRY A;  2WOS A;  2JOJ A;  1FI6 A;  5AXI A;  4I5K A;  5J3X A;  3HCM A;  1BOC A;  4GUK A;  2EGD A;  5K89 A;  1OOH A;  3CZ1 A;  1PRW A;  2F2O A;  2L2C A;  2LNK A;  3DVE A;  2M49 B;  3KO0 A;  2BE4 A;  2V53 A;  1KQM C;  1DEL A;  3I5F B;  3O4Y A;  3SJS A;  1S5G Z;  4M2O A;  4UPG A;  1Y0V H;  4GGF A;  1TIZ A;  1UUS A;  2EC6 B;  1DJG A;  2L5X B;  3D0Y A;  3OX6 A;  4M2P A;  4WQ3 A;  5DKQ A;  1B9A A;  4YGE B;  2WC5 A;  2FJY A;  2QPT A;  3EKH A;  1IKU A;  5FI2 A;  3OX5 A;  3I5G B;  1J7R A;  3FIA A;  3H4S E;  4DS7 A;  1DJZ A;  1PK0 D;  1RK9 A;  2KQ6 A;  3EK7 A;  1OOJ A;  1QLK A;  3NHI A;  3VRR A;  4ORA B;  4PE7 A;  2R2I A;  3C1V A;  4MZL A;  4QJ3 B;  3GK2 A;  1KFX L;  2OTG B;  5D7F A;  5AAN A;  1QX2 A;  5CSN A;  2L4H A;  1SRA A;  1IH0 A;  1XFY O;  1JUO A;  3SG2 A;  1IJ6 A;  2M9G A;  5I2O A;  5KU1 A;  4AOM A;  1FPW A;  2LVK A;  4MN0 A;  4AQI A;  4IJ7 A;  5FI6 A;  5FI7 A;  2DOQ A;  2KQY A;  2H61 A;  1B8L A;  1UHJ A;  3CLN A;  4PE1 A;  2LLS A;  4OR9 B;  3FWB A;  1YUU A;  1OZO A;  2WND A;  3D75 A;  2PRU A;  3S0F A;  1OOF A;  2JUL A;  1U5I B;  2NXQ A;  5D69 A;  2K0J A;  1QS7 A;  1IQ3 A;  4P2Y B;  2BL0 C;  1MF8 B;  2BKH B;  3QRX A;  1C07 A;  1JSA A;  1CDL A;  3SG3 A;  3ZWH A;  1BJF A;  2PYQ A;  2QEH A;  3GK1 A;  2LMT A;  2Y1N A;  2MRD A;  1W7I B;  1LKJ A;  2MLE C;  3D73 A;  1XVJ A;  1UUR A;  1QVI Y;  4IL1 A;  4QJ5 B;  2MHH A;  1L7Z A;  1V1F A;  2G9B A;  4U8D A;  1ZMZ A;  4CID A;  3CZT X;  3LL8 B;  4N1F A;  2QEB A;  3TS5 C;  4AQJ A;  1AP4 A;  1AJ4 A;  1EXR A;  1CFF A;  1TNW A;  5HYD A;  3BUN B;  1BG1 A;  4DCK A;  3SG7 A;  5ER4 X;  2KHN A;  4F7F A;  4E68 A;  2NLN A;  1SNL A;  1QX7 A;  2K61 A;  1K95 A;  2KDH A;  4USL A;  4YI8 A;  1R6P A;  3BUO B;  2IS9 A;  1VRK A;  2K7C A;  2F2P A;  4GBA A;  5FYX A;  4JPZ B;  5BPJ A;  1KFU L;  1K94 A;  1QV0 A;  2JC2 A;  2A4J A;  1LA0 A;  4JKT A;  4YGB B;  3DYE A;  2JPT A;  3LLE A;  3FS7 A;  4JD9 A;  2CBL A;  1DEK A;  2P70 A;  3PAL A;  1XFX O;  2K60 A;  2K7D A;  4ZCU A;  3BOW B;  1Z2C B;  3R1P A;  2BL0 B;  4INW A;  1Z4H A;  2LCP A;  1WDC C;  3DZT A;  1DJW A;  2BNX A;  2I18 A;  3EVU A;  3DF0 A;  4Q04 A;  4GGF C;  1OMV A;  1BOD A;  1TWO A;  4YGD B;  1GJY A;  2ZRS A;  1L2O C;  3E3R A;  2M8U A;  2KLD A;  3IF7 A;  1LIN A;  1ALV A;  2MA2 A;  1CLM A;  1PAL A;  1XYD A;  3FE8 A;  1K9P A;  5I2L A;  1TUZ A;  5G08 A;  3TS5 B;  4OCI A;  3O6B A;  2F3Y A;  1QXP A;  4JWQ A;  3BFA A;  1SW8 A;  1P28 A;  2GGZ A;  4XYN A;  1NIW A;  3BUM B;  5HKW A;  1YRU B;  1PVB A;  3I5I C;  3SG5 A;  4I5N B;  2KLE A;  4C0K A;  1REC A;  2KBM A;  1NX0 A;  3UO9 A;  1YVH A;  1F4Q A;  1SK6 D;  2AAO A;  3VRO A;  1CDM A;  1DGV A;  1M45 A;  4FQO A;  2BAP A;  1B4C A;  1QV1 A;  1TOP A;  1BR4 B;  1JF2 A;  1UWO A;  4N1G A;  3VRQ A;  3LK0 A;  1GGZ A;  1K9U A;  4OZD A;  3PAT A;  3KHE A;  3DY9 A;  1KWO C;  1AUI B;  1B7T Y;  2LMV A;  3K1E A;  3UNW A;  4BY5 A;  1SPY A;  2HET A;  1YX7 A;  3OGN A;  3SIA A;  3TDI A;  3KF9 A;  5CSJ A;  2BCB A;  2VRG A;  1XA5 A;  4F0Z B;  2M1U A;  1G8I A;  3D78 A;  3D0Y B;  4MVF A;  2ZRT A;  2FOT A;  3MSE B;  3OP0 A;  4YBH B;  1B47 A;  3I5H B;  4GNK B;  1XFU O;  1S6I A;  1OW4 A;  2K8M B;  2D8N A;  2LAP A;  1L2O B;  1W9Z A;  3A4U B;  3O4X A;  1QX5 B;  1UP5 A;  3VB1 A;  3TUY C;  1DVI A;  1S6J A;  1SCM B;  1F4O A;  3L47 A;  1CFC A;  1GGW A;  3KPX A;  3SG4 A;  2K2A A;  5HKY A;  2LC5 A;  1LA3 A;  3BJH A;  1C7W A;  1KSO A;  3PN7 C;  4XJK A;  4C0L A;  1K2H A;  1KFX S;  1DF0 A;  3NSO A;  4OV2 A;  5ER5 A;  2KI6 D;  3S0D A;  1CFP A;  1XFV O;  1G33 A;  2KYC A;  2ZNE A;  4A4B A;  3AKB A;  1NX2 A;  2KNE A;  3D77 A;  2KBI A;  1EJ3 A;  3VRP A;  1F71 A;  3R1O A;  4D1E A;  1AK8 A;  1B8R A;  4WRI A;  1KK7 Z;  2WCH A;  3B87 A;  2LE9 B;  3N7H A;  2HF5 A;  2L2E A;  4HRE E;  1A4P A;  3LCP C;  1XO5 A;  1HQV A;  3CR5 X;  1IRJ A;  1CFD A;  1MUX A;  5IBW A;  3R1V A;  2O60 A;  1J55 A;  1RTP 1;  1EG4 A;  1IWQ A;  2L98 A;  1DMO A;  2CT9 A;  3CTN A;  5PAL A;  1ZFS A;  1SBJ A;  1SL8 A;  1XFW O;  1MXE A;  3BXK A;  3S0A A;  4OVN F;  2L5Y A;  4NDB A;  3PM2 A;  4ORC B;  5I8N A;  1TN4 A;  1CMF A;  1KQM B;  1KQV A;  1HT9 A;  2LUX A;  2KSP A;  1MHO A;  2JTZ A;  3B86 A;  4MRX A;  1TUJ A;  1W7J B;  1M46 A;  1PSB A;  2H8V A;  2GGM A;  2KAX A;  3S0G A;  2YGU A;  1F55 A;  2FJU B;  2L0P A;  1N65 A;  3D74 A;  5D3O A;  2LVJ A;  5JOL A;  3PN7 B;  2PMY A;  2PAL A;  2ZN9 A;  3WNX B;  1K96 A;  3TDZ A;  3OB1 B;  3GOF A;  1WRZ A;  2KFH A;  4KYN A;  1JWD A;  3S0B A;  4GAO A;  4GPL B;  1IQ5 A;  1MWN A;  1QWV A;  2JXC A;  1KFU S;  1S1E A;  2WC8 A;  3PSR A;  4FTG A;  2AMI A;  4INX A;  1U5I A;  4PT1 A;  1RWY A;  1SR6 C;  1K90 D;  1UHK A;  2K7O A;  3CWG A;  1Y1A A;  3DVK A;  1DTL A;  1QIV A;  2Y1M A;  4HRH A;  1Y1X A;  1UHI A;  2LVI A;  2JT3 A;  1OMR A;  2ZND A;  2H2K A;  3EG5 B;  1NCZ A;  4GGN A;  3JTD C;  2ZFD A;  2F3Z A;  2AUC A;  3CDN A;  3EK8 A;  5HL1 A;  3DF0 B;  2HQW A;  5B8I B;  1N0Y A;  4YI9 A;  2L51 A;  1NX1 A;  2JQ6 A;  3CGA A;  2MJW B;  1WRL A;  1C7V A;  1TNX A;  5AFP A;  1C3Y A;  2LP2 A;  3WHT B;  4PAL A;  2I94 A;  1NP8 A;  4YGC B;  5EL2 A;  2BCX A;  5GQQ C;  1DJX A;  2Y5I A;  5F6T A;  1SY9 A;  2F8P A;  4ORB B;  1B1G A;  1CDN A;  1S26 D;  1PUL A;  4PE4 A;  1LVC D;  1NCY A;  1KK8 C;  1CM4 A;  1A75 A;  1H4B A;  1Y1U A;  3FWC A;  2JU0 A;  2F33 A;  1ORG A;  1AJ5 A;  3SS4 A;  3PFV A;  1X02 A;  1MQ1 A;  2LLU A;  3CZ2 A;  3TZ1 A;  1CDP A;  2JPO A;  2QEO A;  1J7P A;  1DGU A;  2NZ0 A;  2JXL A;  3IQQ A; 
#chains in the Genus database with same CATH homology
 1CLB A;  2BCA A;  2EHB A;  1IGV A;  5HLO A;  3NSL A;  1SR6 B;  1F8H A;  5CSF A;  4DRW A;  1H8B A;  3CS1 A;  4I5L B;  1OQP A;  1S5G Y;  1TTX A;  1OSA A;  2LV7 A;  2KI6 C;  3JTD B;  3AKA A;  2E30 A;  1TRF A;  3PLF B;  1LXF C;  1BR1 B;  2KGB C;  1XK4 A;  3I5G C;  3JVT C;  3AAK A;  1WDC B;  2KGR A;  1KCY A;  5KTY A;  2PVB A;  4ZCV A;  4N5X A;  1RFJ A;  2O5G A;  1CB1 A;  2JZI A;  2CCM A;  1CNP A;  4NDC A;  1TCF A;  1OZS A;  3OB2 B;  1NSH A;  2E6W A;  2OTG C;  2RGI A;  2TN4 A;  4HSZ A;  1B4C A;  3NSK A;  1NCX A;  4YGA A;  2MAZ A;  1SYM A;  2I7A A;  4ETO A;  1JFK A;  3CR4 X;  3SG6 A;  4DIR A;  1DJH A;  1GQM A;  5KSZ A;  2JNF A;  1BU3 A;  1WY9 A;  3RM1 A;  2NCP A;  1SL7 A;  2BEC A;  1QIW A;  1QAS A;  2GV5 A;  1BF5 A;  1J7O A;  3EVV A;  1CM1 A;  1SCV A;  2LMU A;  4MSP A;  2HQ8 A;  3I5I B;  5I2Q A;  1FBV A;  4PCW A;  1CTR A;  1YR5 A;  4R1E A;  5HLV A;  1BMO A;  2KI4 C;  2Q91 A;  2ZKM X;  3K21 A;  1QAT A;  2COL B;  2KFF A;  1ZOT B;  4OKH A;  2ISD A;  5AEQ A;  4L9M A;  4MEW A;  5JJG A;  1WLZ A;  2L50 A;  2P6B B;  2ZN8 A;  1D1O A;  3BUX B;  1AVS A;  2LLT A;  2OPO A;  2K2F A;  2JTT A;  3JVT B;  1PVA A;  3TDU A;  2QAC A;  1B7T Z;  1KWO B;  3DVJ A;  4JQ0 D;  3D10 A;  1EH2 A;  1A2X A;  1WRK A;  4PHN A;  2LUC A;  3GK4 X;  1CMG A;  1B8C A;  1QLS A;  2BKI B;  1DJI A;  5CSI A;  3O78 A;  4PHJ A;  1PSR A;  1YUS A;  5DKR A;  3TUY B;  2WCE A;  1M39 A;  1YUT A;  2OS8 C;  1TNQ A;  3CR2 A;  1YRT B;  4M2Q A;  4BY4 A;  1YTZ C;  1JBA A;  4ICB A;  2G2B A;  1YVL A;  1A29 A;  2WOR A;  2KYF A;  2M0R A;  3HX4 A;  3NSI A;  3OHM B;  1IJ5 A;  2HPS A;  1NPQ A;  3EK4 A;  2SCP A;  3BQ3 A;  3ZNI A;  2KI4 B;  1TNP A;  1EL4 A;  1K93 D;  4PHM A;  1F54 A;  1YUR A;  4YRU A;  2L4I A;  3EKJ A;  2BBM A;  4WQ2 A;  2JT8 A;  1XK4 C;  4PDZ A;  1Y6W A;  4NDD A;  1OE9 B;  2LHI A;  2KOT A;  3AAJ A;  1NWD A;  1XFZ O;  2MLF C;  4MZK A;  1FF1 A;  3DD4 A;  3IQO A;  1MXL C;  2K7B A;  1BT6 A;  1CKK A;  1K8U A;  1J7Q A;  3M0W A;  4PHK A;  1MR8 A;  4MBE A;  2LAN A;  3VRN A;  2NCO A;  2M7L A;  1BLQ A;  1NYA A;  1E8A A;  1KSM A;  1M31 A;  1UHN A;  1A75 B;  2B1U A;  3BYA A;  1DJY A;  2OS8 B;  1RRO A;  2Q4U A;  3LK1 A;  1QVI Z;  1RJV A;  3VGO A;  3ICB A;  2SAS A;  4P5O E;  1N2D A;  4A4C A;  3F45 A;  4TNC A;  1QJT A;  2M3W A;  5DKN A;  5AER A;  1DT7 B;  1ODB A;  4HRG A;  4MZJ A;  1V1G A;  5TNC A;  4NQG A;  4PE0 A;  1S6C A;  1YX8 A;  2KFG A;  3WHU B;  3RLZ A;  1UHH A;  2WCF A;  1NUB A;  2JWW A;  3SIB A;  3BOW A;  2I2R E;  1FI5 A;  3I5H C;  4GFT A;  1IG5 A;  1QTX A;  2M29 A;  3I5F C;  3WXA A;  1JFJ A;  2PSR A;  1F70 A;  1TCO B;  3DVM A;  1SMG A;  1JC2 A;  1WLM A;  3PM8 A;  4CFR A;  2LM5 A;  1SCM C;  2M1K B;  1J1D A;  2PAS A;  1J1E A;  2BE6 A;  2FCD A;  2JT0 A;  3KEV A;  2EC6 C;  1NX3 A;  4I5J A;  3A8R A;  1EG3 A;  1AHR A;  1K9K A;  4C0J A;  3BUW B;  2LHL A;  1M63 B;  3EVR A;  1ZAC A;  4CLN A;  2LVV A;  1ZUZ A;  1Q80 A;  1OMD A;  2LP3 A;  5CPV A;  4CPV A;  1R2U A;  2KAV A;  1FW4 A;  2CXJ A;  2CNP A;  2JRF A;  2WCB A;  4MLW A;  1G4Y R;  2H61 C;  1JF0 A;  1CLL A;  1SL9 A;  3NXA A;  4QJ4 B;  1SKT A;  2FCE A;  2M7N A;  2Y4Q A;  4XJK B;  2CTN A;  1S36 A;  2BBN A;  3O2P A;  2M97 A;  5HKZ A;  4CFQ A;  1DF0 B;  1ALW A;  1KK7 Y;  1KK8 B;  2JNX A;  2MBX A;  1S3P A;  2KAY A;  4DUQ A;  1A03 A;  4MRY A;  2WOS A;  2JOJ A;  1FI6 A;  5AXI A;  4I5K A;  5J3X A;  3HCM A;  1BOC A;  4GUK A;  2EGD A;  5K89 A;  1PRW A;  2F2O A;  3DVE A;  2LNK A;  3KO0 A;  2M49 B;  2BE4 A;  2V53 A;  1KQM C;  3I5F B;  3O4Y A;  3SJS A;  1S5G Z;  4M2O A;  4UPG A;  1Y0V H;  4GGF A;  1TIZ A;  1UUS A;  2EC6 B;  1DJG A;  2L5X B;  3D0Y A;  3OX6 A;  4M2P A;  4WQ3 A;  5DKQ A;  1B9A A;  4YGE B;  3EKH A;  1IKU A;  2QPT A;  3OX5 A;  3I5G B;  1J7R A;  3FIA A;  3H4S E;  4DS7 A;  1DJZ A;  1PK0 D;  1RK9 A;  2KQ6 A;  3EK7 A;  1OOJ A;  1QLK A;  3VRR A;  4ORA B;  4PE7 A;  2R2I A;  3C1V A;  4MZL A;  4QJ3 B;  3GK2 A;  1KFX L;  2OTG B;  5D7F A;  5AAN A;  1QX2 A;  5CSN A;  2L4H A;  1SRA A;  1IH0 A;  1XFY O;  1JUO A;  3SG2 A;  1IJ6 A;  2M9G A;  5I2O A;  5KU1 A;  4AOM A;  1FPW A;  2LVK A;  4MN0 A;  4AQI A;  2DOQ A;  2KQY A;  2H61 A;  1B8L A;  1UHJ A;  3CLN A;  4PE1 A;  2LLS A;  4OR9 B;  3FWB A;  1YUU A;  1OZO A;  2WND A;  2PRU A;  2JUL A;  1U5I B;  2NXQ A;  5D69 A;  2K0J A;  1QS7 A;  1IQ3 A;  4P2Y B;  2BL0 C;  1MF8 B;  2BKH B;  3QRX A;  1C07 A;  1JSA A;  1CDL A;  3SG3 A;  3ZWH A;  1BJF A;  3GK1 A;  2LMT A;  2Y1N A;  2MRD A;  1W7I B;  1LKJ A;  2MLE C;  1XVJ A;  1UUR A;  1QVI Y;  4IL1 A;  4QJ5 B;  2MHH A;  1L7Z A;  1V1F A;  2G9B A;  4U8D A;  1ZMZ A;  4CID A;  3CZT X;  3LL8 B;  4N1F A;  4AQJ A;  3TS5 C;  1AP4 A;  1AJ4 A;  1EXR A;  1CFF A;  1TNW A;  5HYD A;  3BUN B;  1BG1 A;  4DCK A;  3SG7 A;  5ER4 X;  2KHN A;  4E68 A;  2NLN A;  1SNL A;  1QX7 A;  2K61 A;  1K95 A;  2KDH A;  4USL A;  4YI8 A;  1R6P A;  3BUO B;  2IS9 A;  1VRK A;  2K7C A;  2F2P A;  4GBA A;  5FYX A;  4JPZ B;  5BPJ A;  1KFU L;  1K94 A;  1QV0 A;  2JC2 A;  2A4J A;  1LA0 A;  4YGB B;  2JPT A;  3LLE A;  3FS7 A;  2CBL A;  3PAL A;  1XFX O;  2K7D A;  4ZCU A;  3BOW B;  2BL0 B;  2LCP A;  1WDC C;  1DJW A;  2I18 A;  3EVU A;  3DF0 A;  4Q04 A;  4GGF C;  1OMV A;  1BOD A;  4YGD B;  1GJY A;  2ZRS A;  1L2O C;  3E3R A;  2M8U A;  3IF7 A;  1LIN A;  1ALV A;  2MA2 A;  1CLM A;  1PAL A;  1XYD A;  1K9P A;  5I2L A;  5G08 A;  3TS5 B;  4OCI A;  3O6B A;  2F3Y A;  1QXP A;  4JWQ A;  1SW8 A;  2GGZ A;  4XYN A;  1NIW A;  3BUM B;  5HKW A;  1YRU B;  1PVB A;  3I5I C;  3SG5 A;  4I5N B;  4C0K A;  1REC A;  2KBM A;  1NX0 A;  1YVH A;  1F4Q A;  1SK6 D;  2AAO A;  3VRO A;  1CDM A;  1DGV A;  1M45 A;  4FQO A;  1QV1 A;  1TOP A;  1BR4 B;  1JF2 A;  1UWO A;  4N1G A;  3VRQ A;  3LK0 A;  1GGZ A;  1K9U A;  3PAT A;  3KHE A;  1KWO C;  1AUI B;  1B7T Y;  2LMV A;  4BY5 A;  1SPY A;  2HET A;  1YX7 A;  3SIA A;  3TDI A;  3KF9 A;  5CSJ A;  2BCB A;  2VRG A;  1XA5 A;  4F0Z B;  2M1U A;  1G8I A;  3D0Y B;  4MVF A;  2ZRT A;  2FOT A;  3MSE B;  3OP0 A;  4YBH B;  1B47 A;  3I5H B;  4GNK B;  1XFU O;  1S6I A;  2LAP A;  2K8M B;  2D8N A;  3A4U B;  1L2O B;  3TUY C;  1QX5 B;  1UP5 A;  1DVI A;  1S6J A;  1SCM B;  1F4O A;  1CFC A;  1GGW A;  3KPX A;  3SG4 A;  2K2A A;  5HKY A;  2LC5 A;  1LA3 A;  4XJK A;  1C7W A;  1KSO A;  3PN7 C;  4C0L A;  1K2H A;  1KFX S;  1DF0 A;  3NSO A;  4OV2 A;  5ER5 A;  2KI6 D;  1CFP A;  1XFV O;  1G33 A;  2KYC A;  2ZNE A;  4A4B A;  3AKB A;  1NX2 A;  2KNE A;  2KBI A;  1EJ3 A;  3VRP A;  1F71 A;  4D1E A;  1AK8 A;  1B8R A;  4WRI A;  1KK7 Z;  2LE9 B;  2HF5 A;  2L2E A;  4HRE E;  1A4P A;  3LCP C;  1XO5 A;  1HQV A;  3CR5 X;  1IRJ A;  1CFD A;  1MUX A;  5IBW A;  2O60 A;  1J55 A;  1RTP 1;  1EG4 A;  1IWQ A;  2L98 A;  1DMO A;  2CT9 A;  3CTN A;  5PAL A;  1ZFS A;  1SBJ A;  1SL8 A;  1XFW O;  1MXE A;  3BXK A;  4OVN F;  4NDB A;  4ORC B;  5I8N A;  1TN4 A;  1CMF A;  1KQM B;  1KQV A;  1HT9 A;  2LUX A;  2KSP A;  1MHO A;  2JTZ A;  4MRX A;  1W7J B;  1M46 A;  1PSB A;  2GGM A;  2KAX A;  1F55 A;  2FJU B;  2L0P A;  1N65 A;  2LVJ A;  5JOL A;  3PN7 B;  2PMY A;  2PAL A;  2ZN9 A;  3WNX B;  1K96 A;  3TDZ A;  3OB1 B;  3GOF A;  1WRZ A;  2KFH A;  1JWD A;  4GAO A;  4GPL B;  1IQ5 A;  1MWN A;  2JXC A;  1KFU S;  1S1E A;  2WC8 A;  3PSR A;  4FTG A;  2AMI A;  1U5I A;  1RWY A;  1SR6 C;  1K90 D;  1UHK A;  2K7O A;  3CWG A;  1Y1A A;  3DVK A;  1DTL A;  1QIV A;  2Y1M A;  4HRH A;  1Y1X A;  1UHI A;  2LVI A;  2JT3 A;  1OMR A;  2ZND A;  2H2K A;  4GGN A;  1NCZ A;  3JTD C;  2ZFD A;  2F3Z A;  2AUC A;  3EK8 A;  3DF0 B;  2HQW A;  5B8I B;  1N0Y A;  4YI9 A;  2L51 A;  1NX1 A;  2JQ6 A;  3CGA A;  2MJW B;  1WRL A;  1C7V A;  1TNX A;  5AFP A;  2LP2 A;  3WHT B;  4PAL A;  2I94 A;  1NP8 A;  4YGC B;  2BCX A;  5GQQ C;  1DJX A;  2Y5I A;  5F6T A;  1SY9 A;  2F8P A;  4ORB B;  1B1G A;  1CDN A;  1S26 D;  1PUL A;  4PE4 A;  1LVC D;  1NCY A;  1KK8 C;  1CM4 A;  1A75 A;  1H4B A;  1Y1U A;  3FWC A;  2JU0 A;  2F33 A;  1AJ5 A;  3PFV A;  1X02 A;  1MQ1 A;  2LLU A;  3TZ1 A;  1J7P A;  1CDP A;  1DGU A;  2NZ0 A;  2JXL A;  3IQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...