2KQYA

Solution structure of avian thymic hormone
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
108
structure length
108
Chain Sequence
AITDILSAKDIESALSSCQAADSFNYKSFFSTVGLSSKTPDQIKKVFGILDQDKSGFIEEEELQLFLKNFSSSARVLTSAETKAFLAAGDTDGDGKIGVEEFQSLVKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Parvalbumin, thymic
publication title Structure of Avian Thymic Hormone, a High-Affinity Avian beta-Parvalbumin, in the Ca(2+)-Free and Ca(2+)-Bound States.
pubmed doi rcsb
source organism Gallus gallus
total genus 16
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2009-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2kqyA00
5CSJA 1F4OA 2BBMA 1BODA 4YRUA 1KK7Z 1OE9B 2K8MB 2DOQA 4R1EA 2R2IA 3DD4A 1EG3A 3OX5A 1A03A 1BR1B 2WORA 1IQ5A 1DGVA 2GGZA 3HX4A 4PE4A 1U5IB 3WNXB 1YUUA 1F4QA 1QXPA 4AQJA 3LLEA 1BU3A 1YURA 2HQWA 3KPXA 1BLQA 3KF9A 2OPOA 4MVFA 2FCDA 1FPWA 1CMFA 1Y1XA 4I5NB 2LUCA 3I5HB 5D7FA 2M8UA 2GGMA 4YGEB 3TDIA 2PVBA 1HT9A 1DJXA 1J7RA 2KDHA 1KWOB 1PRWA 3PN7B 3O2PA 2PALA 1PULA 5BPJA 3JVTB 2L0PA 4ORCB 3LL8B 4ZCVA 1B8CA 5I8NA 1JFJA 5IBWA 1QASA 1SL7A 1EH2A 5AXIA 5CSFA 3SJSA 1QATA 5JJGA 1KFXS 2JQ6A 2LMTA 1AK8A 2K0JA 2MLFC 3LK1A 1CLBA 2KI6C 3WHUB 3CS1A 3VROA 4QJ3B 1M39A 1KFXL 5I2OA 1NWDA 3TDZA 4GAOA 3NXAA 2O60A 1S6CA 3D0YB 1MF8B 2KQ6A 3SG2A 3TS5B 1K8UA 1AUIB 1J7QA 2LLSA 1SK6D 1TNXA 2LVKA 2EHBA 3QRXA 2LP3A 1IG5A 2Y1MA 2I2RE 1IWQA 1NX1A 1CDLA 4PE7A 2M7LA 1XFVO 3BYAA 5AFPA 1WRKA 4I5LB 3M0WA 2LC5A 4WRIA 1KCYA 3DVJA 4GBAA 2BL0B 5AANA 2KOTA 1XVJA 1BT6A 3A4UB 1J7OA 4DCKA 1IJ5A 2KAXA 1YUSA 2L50A 5JOLA 1JWDA 4CFQA 3BUMB 2JTZA 1JF0A 2G2BA 1S5GZ 2OTGB 3GOFA 1Y1AA 2E30A 4OR9B 2SASA 2K2AA 1QIVA 1H8BA 1WLZA 1J7PA 5HKWA 1KSMA 1A75B 2H61A 2VRGA 4PALA 4OKHA 3EK4A 4PE1A 1L7ZA 3OB1B 1CFFA 3I5GC 2M49B 3I5FB 1YRTB 4U8DA 3I5HC 4BY5A 1LA3A 3DVMA 3BOWB 1AP4A 3K21A 1Q80A 3JVTC 1E8AA 2IS9A 1H4BA 1IGVA 1XFYO 2B1UA 4ETOA 4A4CA 4FTGA 1AVSA 2GV5A 5KTYA 1LVCD 2AAOA 1XK4C 1SNLA 2F3ZA 2Y5IA 1EJ3A 1CMGA 1ZMZA 2Q91A 1DJHA 1YR5A 4YGAA 4HREE 5CPVA 1J1EA 1WLMA 2KAVA 1F8HA 1CFCA 2HPSA 1ALVA 1XA5A 2KYFA 1PSBA 2KGRA 2PSRA 3BUNB 1PK0D 1KQMB 1L2OB 1ZACA 2JNXA 3TS5C 1FI6A 1NPQA 2MRDA 2MBXA 3VRNA 1TNQA 3NSKA 2M9GA 1TN4A 1SR6B 4AQIA 1MXEA 4GGFC 4PHMA 2BCAA 1V1GA 4OV2A 3OX6A 2LUXA 3SG6A 2OS8B 4GFTA 1KFUS 2O5GA 5G08A 2LANA 1BG1A 1F55A 1S3PA 3DVEA 2QPTA 2EGDA 1RROA 4M2PA 4YGCB 2WCFA 5DKNA 1DTLA 1KFUL 1CFDA 3DVKA 2L4IA 2L51A 2V53A 3GK1A 4GUKA 5ER5A 3O78A 1RTP1 4M2QA 1PVBA 1X02A 2BCXA 2Y4QA 2EC6B 4MEWA 3DF0A 1RJVA 2K61A 4I5KA 1FW4A 1NCXA 1YVLA 3A8RA 4MZKA 4PHNA 1SBJA 1NSHA 2FCEA 1DF0A 3EVUA 2ZRTA 4YI8A 5DKRA 1FF1A 2ZN8A 1MUXA 1KK7Y 3ICBA 5HLVA 1RFJA 4C0KA 4QJ4B 4C0JA 2HQ8A 1B7TZ 2CNPA 3TUYC 1K2HA 1EXRA 1B47A 1FBVA 4JWQA 3I5IB 2BKHB 1XFWO 3CGAA 1XFZO 1CFPA 2BECA 1SL9A 3O6BA 4P2YB 2WC8A 1JUOA 2M0RA 1XFUO 1QX7A 5CSIA 3JTDC 1SW8A 2KGBC 2NCOA 5ER4X 1UURA 2L4HA 1BMOA 1N2DA 3SIBA 1QVIZ 1R2UA 1OOJA 5FYXA 2LHLA 1VRKA 2JRFA 1CLLA 3MSEB 3E3RA 1TRFA 4ICBA 1NP8A 1TOPA 3WHTB 2K7OA 1SCMC 4CIDA 4GPLB 4PCWA 2JPTA 2JULA 1D1OA 2E6WA 1DJWA 3PFVA 1DVIA 2KSPA 1RWYA 3TDUA 2LV7A 4XJKB 3SG7A 2JXCA 1UHNA 2A4JA 2LNKA 1KSOA 1SR6C 1B4CA 1U5IA 1XO5A 2BBNA 2F2PA 2K2FA 2F2OA 2JT3A 1QLSA 2Y1NA 4WQ3A 2RGIA 4C0LA 1UP5A 1QX5B 1LXFC 1JFKA 3OB2B 3EKHA 5PALA 2AMIA 1SMGA 1JF2A 2KNEA 1YUTA 1TCOB 3KEVA 3WXAA 4QJ5B 5GQQC 1R6PA 1B9AA 4N1GA 4CLNA 2LMUA 1XFXO 1XK4A 1BR4B 5CSNA 1BOCA 1WDCB 3EVRA 3KHEA 2LVJA 4PHKA 1OZOA 1KQVA 4DRWA 4YGDB 3PATA 4ZCUA 1IQ3A 1OSAA 1S5GY 5B8IB 2MJWB 3BQ3A 2F8PA 4NDBA 2KHNA 1DJZA 3NSOA 4GGNA 3D0YA 3F45A 1KWOC 3PN7C 1LA0A 5TNCA 4CFRA 1F70A 2ISDA 4HSZA 4AOMA 2JXLA 2L98A 1JSAA 1OQPA 1YVHA 2M1KB 5J3XA 1ZFSA 5HKZA 3GK4X 3SG3A 4ORBB 1M31A 4HRHA 1WRLA 3BUOB 1CDMA 4P5OE 1W7IB 1A2XA 1YRUB 5AEQA 1TNWA 1QX2A 1SY9A 3D10A 4M2OA 2KBMA 4OCIA 1LINA 2F33A 1K90D 2NZ0A 1OMRA 1MWNA 1LKJA 1YTZC 3CR2A 1QTXA 1MHOA 1DGUA 2ZN9A 3FS7A 3EKJA 3LK0A 3DF0B 1UHKA 1AJ4A 4NDCA 3SG4A 1V1FA 2QACA 4N1FA 5HKYA 4L9MA 1Y0VH 2BL0C 1DF0B 1K94A 3HCMA 1ALWA 1M63B 1QV0A 4D1EA 4JQ0D 2LLTA 1RECA 4NQGA 1EG4A 1DJIA 2JWWA 4TNCA 2BKIB 1BJFA 1J1DA 2OTGC 5DKQA 3RM1A 1TNPA 3KO0A 1JBAA 3NSLA 1TIZA 2JT8A 4ORAB 2K7DA 1CTRA 1CB1A 1K9PA 2H2KA 2LE9B 1M46A 4IL1A 1SKTA 3I5FC 3NSIA 3OHMB 2ZNDA 2BE4A 3AAKA 4PHJA 2KQYA 1C07A 3VGOA 2JZIA 4MSPA 3EVVA 1MQ1A 3ZNIA 2CCMA 3ZWHA 1F71A 2BCBA 1ZUZA 3H4SE 2LHIA 4XYNA 4BY4A 1A4PA 1B7TY 2K7CA 3IQOA 2CTNA 4MZLA 1PALA 1QLKA 2I18A 2MHHA 2ZKMX 3PLFB 1QV1A 2LAPA 2MLEC 2NLNA 3C1VA 2LP2A 1YX8A 2AUCA 1CNPA 2LCPA 1XYDA 1KK8B 5D69A 2FOTA 1CDPA 1UHHA 3VRRA 3I5GB 1K95A 1N65A 1UWOA 2KFFA 3CLNA 1QVIY 2JU0A 3FIAA 4E68A 1A29A 3BUWB 2ZNEA 1W7JB 4NDDA 1KQMC 1L2OC 1K93D 2P6BB 1S1EA 2M29A 4CPVA 1NX0A 1ODBA 2KI4B 2HETA 1G33A 1M45A 1CLMA 4DUQA 2G9BA 2CXJA 2OS8C 1CDNA 2LMVA 3CR5X 1GGZA 4DS7A 5KU1A 1NX2A 3FWBA 4MRXA 1GQMA 1N0YA 1K9UA 3BXKA 1K9KA 2WOSA 3SIAA 3OP0A 1GGWA 2WCBA 4Q04A 2WNDA 3IQQA 1CM4A 2NXQA 1K96A 1S26D 2EC6C 1WRZA 1MR8A 2NCPA 2ZRSA 5HYDA 4FQOA 3RLZA 1QJTA 1QS7A 4MN0A 4MZJA 3CWGA 5KSZA 5I2QA 2KFHA 3O4YA 4YGBB 3PSRA 1NX3A 3TZ1A 2L2EA 1B8LA 3CZTX 1NYAA 3BUXB 4YBHB 1NIWA 2ZFDA 5F6TA 2F3YA 3I5IC 1UHJA 1NUBA 2KBIA 4XJKA 3SG5A 3AKAA 4MBEA 4DIRA 1DJGA 2JOJA 3CR4X 1C7WA 1SYMA 1SRAA 2KYCA 3CTNA 4N5XA 2L5XB 4HRGA 1S6IA 4JPZB 1TCFA 2MAZA 4F0ZB 4WQ2A 2LM5A 2FJUB 4GGFA 1OMDA 1EL4A 2MA2A 4USLA 2JNFA 1SL8A 1KK8C 1J55A 3VRQA 1IJ6A 2KFGA 3EK8A 1S6JA 2JT0A 1IKUA 4MRYA 1WY9A 2K7BA 2BE6A 2M3WA 2COLB 3TUYB 1F54A 4OVNF 2I94A 2PMYA 1G4YR 1AJ5A 1B8RA 3LCPC 2KI4C 4YI9A 2KI6D 1A75A 1GJYA 1Y1UA 3JTDB 2KAYA 4PE0A 1AHRA 3AAJA 2TN4A 5HLOA 1ZOTB 1DJYA 3PALA 2JC2A 3IF7A 2H61C 4PDZA 2LVIA 1NCZA 4UPGA 2M97A 3BOWA 1SCMB 4A4BA 1FI5A 5K89A 1PSRA 1TTXA 2I7AA 2M7NA 1S36A 1OMVA 1RK9A 1UUSA 3VRPA 4I5JA 1BF5A 2M1UA 2PASA 2PRUA 1G8IA 1CM1A 1MXLC 1Y6WA 2CT9A 2JTTA 1OZSA 1WDCC 3PM8A 1DMOA 3EK7A 5I2LA 1HQVA 1PVAA 2D8NA 1IRJA 1SPYA 1UHIA 4MLWA 2WCEA 3FWCA 2SCPA 2HF5A 1C7VA 1JC2A 1QIWA 2LVVA 1B1GA 5AERA 3GK2A 1SCVA 3AKBA 1DT7B 1NCYA 1YX7A 2CBLA 2Q4UA 2LLUA 1CKKA 1IH0A 4GNKB
chains in the Genus database with same CATH superfamily
5CSJA 1F4OA 2BBMA 1BODA 3QMEA 4YRUA 1KK7Z 1OE9B 2K8MB 2DOQA 4R1EA 2R2IA 3DD4A 3CZ1A 1EG3A 3OX5A 1A03A 1BR1B 2WORA 1IQ5A 2K60A 1DGVA 2GGZA 3HX4A 4PE4A 3IVTA 1U5IB 3WNXB 1YUUA 2WCKA 1F4QA 1QXPA 4AQJA 3LLEA 1BU3A 1YURA 3FE8A 2HQWA 3KPXA 1BLQA 3KF9A 2OPOA 4MVFA 2FCDA 1FPWA 3D75A 1CMFA 1Y1XA 5I94A 4I5NB 2LUCA 3I5HB 5D7FA 2M8UA 2GGMA 4YGEB 3TDIA 2PVBA 1HT9A 1DJXA 1J7RA 2KDHA 2YGUA 1KWOB 1PRWA 3PN7B 3O2PA 1XFRA 2PALA 1PULA 5BPJA 3JVTB 2QEVA 2L0PA 4ORCB 3LL8B 4ZCVA 1B8CA 3Q8IA 5I8NA 3D74A 1JFJA 5IBWA 1QASA 1SL7A 1EH2A 5AXIA 5CSFA 3SJSA 1QATA 5JJGA 1KFXS 2JQ6A 2LMTA 1AK8A 3B87A 2K0JA 3S0DA 2MLFC 3LK1A 1CLBA 2KI6C 3WHUB 3CS1A 3VROA 4QJ3B 1M39A 1KFXL 5I2OA 1NWDA 3TDZA 4GAOA 3NXAA 2O60A 1S6CA 2KLEA 3D0YB 4F7FA 1MF8B 2KQ6A 3SG2A 3TS5B 1K8UA 1AUIB 1J7QA 2LLSA 1SK6D 1TNXA 2LVKA 2EHBA 3QRXA 2LP3A 3BFAA 1IG5A 2Y1MA 2I2RE 1IWQA 1NX1A 1CDLA 4PE7A 2M7LA 3V2LA 1XFVO 5FI6A 3BYAA 5AFPA 1WRKA 4I5LB 3M0WA 2LC5A 2L5YA 4WRIA 1KCYA 3DVJA 4GBAA 2BL0B 5AANA 2KOTA 1XVJA 3EG5B 5FI7A 1BT6A 3A4UB 1J7OA 4DCKA 1IJ5A 2KAXA 1YUSA 2L50A 5JOLA 1JWDA 4CFQA 3BUMB 2JTZA 1JF0A 2G2BA 1S5GZ 2OTGB 3GOFA 1Y1AA 1TUZA 2E30A 4OR9B 2SASA 2K2AA 1QIVA 1H8BA 1WLZA 1J7PA 5HKWA 1KSMA 1A75B 3N7HA 2H61A 2VRGA 4PALA 4OKHA 3EK4A 3D78A 1L7ZA 4PE1A 3OB1B 1CFFA 3I5GC 2M49B 3B86A 1YRTB 2WCHA 3I5FB 4U8DA 3I5HC 4BY5A 1LA3A 3DVMA 3O4XA 3BOWB 1OOIX 3NGVA 3UNWA 3K21A 1AP4A 2P71A 1Q80A 3JVTC 2JPOA 1E8AA 1OOHA 2IS9A 1H4BA 1IGVA 1XFYO 2B1UA 4ETOA 4A4CA 2GTEA 1AVSA 2GV5A 2PQLA 4FTGA 5KTYA 1LVCD 2AAOA 1XK4C 1SNLA 2F3ZA 2H8VA 1EJ3A 2QEBA 1ZMZA 2Y5IA 1CMGA 2Q91A 1DJHA 1YR5A 4YGAA 4HREE 5CPVA 1J1EA 1WLMA 2KAVA 1F8HA 1CFCA 2HPSA 1ALVA 1XA5A 3BFHA 2KYFA 1PSBA 2KGRA 2PSRA 3BUNB 1PK0D 1KQMB 1L2OB 1ZACA 2JNXA 3TS5C 1FI6A 1NPQA 2MRDA 3CABA 2MBXA 3VRNA 1TNQA 3NSKA 2M9GA 1TN4A 1SR6B 3SS4A 1MXEA 4GGFC 4PHMA 4AQIA 2BCAA 1V1GA 4OV2A 3OX6A 2LUXA 3SG6A 2OS8B 4GFTA 1KFUS 2O5GA 5G08A 2LANA 1BG1A 1F55A 3S0EA 1S3PA 3DVEA 2QPTA 2EGDA 1RROA 4M2PA 4YGCB 3PJIA 2WCFA 5DKNA 1DTLA 1KFUL 1CFDA 3DVKA 2L4IA 2L51A 2V53A 2WCLA 3GK1A 4GUKA 3DZTA 5ER5A 3O78A 1RTP1 4M2QA 1PVBA 1X02A 2BCXA 2Y4QA 2EC6B 4MEWA 3DF0A 1RJVA 2K61A 4I5KA 1FW4A 1NCXA 1YVLA 3A8RA 1SSEB 1W9ZA 4MZKA 1SBJA 1NSHA 4PHNA 2FCEA 1DF0A 3EVUA 2ZRTA 4YI8A 5DKRA 1FF1A 2ZN8A 1MUXA 1KK7Y 3ICBA 5HLVA 1RFJA 4C0KA 4QJ4B 4C0JA 2HQ8A 1B7TZ 2CNPA 3TUYC 1K2HA 1EXRA 1B47A 1FBVA 4JWQA 3I5IB 2BKHB 1XFWO 3CGAA 1XFZO 1CFPA 2BECA 1SL9A 3O6BA 4P2YB 2WC8A 1JUOA 2M0RA 1XFUO 1QX7A 5CSIA 3D77A 3JTDC 1SW8A 2BAPA 2KGBC 2NCOA 5ER4X 3RZSA 4INWA 1UURA 2L4HA 1BMOA 1N2DA 3SIBA 1QVIZ 1R2UA 1OOJA 5FYXA 2LHLA 1VRKA 2JRFA 1CLLA 3MSEB 3E3RA 1TRFA 4ICBA 1NP8A 1TOPA 3WHTB 3OGNA 2K7OA 1SCMC 4CIDA 4GPLB 3S0FA 4PCWA 1TUJA 2JPTA 2JULA 1D1OA 2Q4UA 2E6WA 1DJWA 3PFVA 1DVIA 3S0AA 2KSPA 1RWYA 3TDUA 2LV7A 4XJKB 3SG7A 2JXCA 1UHNA 2A4JA 2LNKA 1KSOA 1SR6C 1B4CA 1U5IA 1XO5A 2BBNA 2F2PA 2K2FA 2F2OA 4JKTA 3R1OA 2JT3A 3L4AA 3D76A 1QLSA 2Y1NA 3S0GA 4WQ3A 2RGIA 3FE9A 4C0LA 1UP5A 1QX5B 1LXFC 1JFKA 1OW4A 3OB2B 3EKHA 1DQEA 2AMIA 5PALA 1SMGA 5D3OA 1JF2A 2KNEA 1YUTA 1TCOB 2KPHA 3KEVA 3WXAA 4QJ5B 3BJHA 5GQQC 1R6PA 1B9AA 3OBVA 4N1GA 4CLNA 2LMUA 1XFXO 1XK4A 1BR4B 3BFBA 5CSNA 1BOCA 1WDCB 3EVRA 3KHEA 2LVJA 4PHKA 1OZOA 1KQVA 1OOFA 4DRWA 4YGDB 4OZDA 3PATA 4ZCUA 3CYZA 1IQ3A 1OSAA 1S5GY 5B8IB 2MJWB 3BQ3A 2F8PA 4NDBA 2KHNA 1DJZA 3NSOA 4GGNA 3CZ2A 3D0YA 2QEOA 1KWOC 3F45A 3PN7C 1LA0A 5TNCA 4CFRA 1F70A 2ISDA 4HSZA 4AOMA 2JXLA 2L98A 1JSAA 1OQPA 1YVHA 2M1KB 5J3XA 2QEHA 1ZFSA 5HKZA 3GK4X 3SG3A 4ORBB 1M31A 4HRHA 1WRLA 3BUOB 1CDMA 4IJ7A 4P5OE 1W7IB 1A2XA 1YRUB 3K1EA 5AEQA 1TNWA 1QX2A 1SY9A 3D10A 4M2OA 2KBMA 4OCIA 1LINA 2F33A 1K90D 2NZ0A 1OMRA 1MWNA 1LKJA 1YTZC 3CR2A 1QTXA 1MHOA 1DGUA 2ZN9A 2QDIA 3EKJA 3FS7A 3S0BA 3SS5A 3LK0A 3DF0B 1UHKA 1AJ4A 4NDCA 3SG4A 1V1FA 2QACA 4N1FA 5HKYA 4L9MA 1Y0VH 2BL0C 1DF0B 3SS3A 1K94A 3HCMA 1ALWA 1M63B 1QV0A 4D1EA 4JQ0D 2LLTA 1RECA 4NQGA 1EG4A 1DJIA 2BNXA 2JWWA 4TNCA 2BKIB 1BJFA 1J1DA 2OTGC 5DKQA 3RM1A 3DYEA 3B88A 1TNPA 3KO0A 5DICA 1JBAA 3NSLA 1TIZA 2JT8A 2KLDA 4ORAB 2K7DA 1Z4HA 1CTRA 1CB1A 1K9PA 2H2KA 2LE9B 1M46A 4IL1A 1SKTA 3I5FC 3NSIA 3OHMB 2ZNDA 2BE4A 3AAKA 3DXLA 2KQYA 4PHJA 1ORGA 2WCJA 2PYQA 3UO9A 1C07A 3VGOA 2JZIA 3CDNA 4MSPA 3EVVA 1MQ1A 3ZNIA 1OOGA 2CCMA 4JD9A 3ZWHA 1F71A 2BCBA 1ZUZA 3H4SE 2LHIA 4INXA 4XYNA 4BY4A 1A4PA 1B7TY 2K7CA 3IQOA 2CTNA 1DEKA 1PALA 4MZLA 1QLKA 2I18A 2MHHA 2ZKMX 3FE6A 3PLFB 1QV1A 2LAPA 2MLEC 2NLNA 3C1VA 2LP2A 1YX8A 2AUCA 1CNPA 4FQTA 2LCPA 1XYDA 1KK8B 5D69A 2FOTA 1CDPA 1UHHA 3VRRA 1LS8A 3I5GB 1K95A 1N65A 1UWOA 2KFFA 3CLNA 1QVIY 2JU0A 3FIAA 4E68A 1A29A 2L2CA 3BUWB 2ZNEA 1W7JB 4NDDA 1KQMC 1L2OC 1K93D 3B7AA 2P6BB 1S1EA 3VB1A 2M29A 4CPVA 1NX0A 1ODBA 2KI4B 2HETA 1G33A 1M45A 1CLMA 4DUQA 2G9BA 2CXJA 2OS8C 3NHTA 3NHIA 1CDNA 2LMVA 3CR5X 1GGZA 4DS7A 5KU1A 1NX2A 2WC6A 3FWBA 4MRXA 1GQMA 1N0YA 2P70A 3PM2A 1K9UA 3BXKA 1K9KA 2WOSA 4KYNA 3OP0A 3SIAA 1GGWA 2WCBA 4Q04A 2WNDA 3IQQA 3L47A 1CM4A 2NXQA 1K96A 1S26D 2EC6C 1P28A 1WRZA 1MR8A 2NCPA 2ZRSA 5HYDA 1DC1A 4FQOA 3RLZA 1QJTA 1QS7A 4MN0A 4MZJA 3CWGA 5KSZA 5I2QA 2KFHA 3O4YA 4YGBB 3PSRA 1NX3A 3TZ1A 2L2EA 1B8LA 3CZTX 1NYAA 3BUXB 4YBHB 1NIWA 2ZFDA 5F6TA 2F3YA 3I5IC 1UHJA 1NUBA 2KBIA 4XJKA 3SG5A 1IIOA 5FI2A 3AKAA 4MBEA 4DIRA 2WC5A 3D73A 1DJGA 2JOJA 3CR4X 2WCMA 1C7WA 1SYMA 1SRAA 2KYCA 3B6XA 3CTNA 2L5XB 4N5XA 4HRGA 1S6IA 4JPZB 1TCFA 2MAZA 4F0ZB 2ERBA 4WQ2A 2LM5A 2FJUB 4GGFA 1OMDA 1EL4A 2MA2A 4USLA 2JNFA 1SL8A 1KK8C 1J55A 3VRQA 1IJ6A 2KFGA 3EK8A 1Z2CB 1S6JA 2JT0A 3R1PA 1GM0A 1IKUA 4MRYA 1C3ZA 1WY9A 2K7BA 2BE6A 2M3WA 3R72A 2COLB 3TUYB 1F54A 4OVNF 2I94A 2PMYA 1G4YR 1AJ5A 1B8RA 1QWVA 3LCPC 2KI4C 4YI9A 2KI6D 4PT1A 1A75A 1GJYA 1Y1UA 3JTDB 2KAYA 1TWOA 4PE0A 5EL2A 1AHRA 3AAJA 2TN4A 5HLOA 5HL1A 1ZOTB 1DJYA 3PALA 2FJYA 2JC2A 3IF7A 2H61C 4PDZA 2LVIA 1NCZA 4UPGA 1C3YA 2M97A 3BOWA 1SCMB 4A4BA 1FI5A 5K89A 1PSRA 1TTXA 2I7AA 2M7NA 1S36A 1OMVA 1RK9A 1UUSA 3VRPA 4I5JA 3R1VA 1BF5A 3CZ0A 2M1UA 2PASA 2PRUA 1G8IA 1CM1A 1MXLC 1Y6WA 2CT9A 2JTTA 1OZSA 1WDCC 3PM8A 1DMOA 3EK7A 5I2LA 1HQVA 1PVAA 2D8NA 1IRJA 1SPYA 1UHIA 4MLWA 2WCEA 3FWCA 2SCPA 2HF5A 1C7VA 1JC2A 1QIWA 2LVVA 1B1GA 5AERA 3GK2A 1SCVA 3AKBA 3DY9A 1NCYA 1T14A 1DT7B 1YX7A 2CBLA 3L4LA 1DELA 2LLUA 1CKKA 1IH0A 4GNKB
chains in the Genus database with same CATH topology
5CSJA 1F4OA 2BBMA 1BODA 4YRUA 1KK7Z 1OE9B 2K8MB 2DOQA 4R1EA 2R2IA 3DD4A 1EG3A 3OX5A 1A03A 1BR1B 2WORA 1IQ5A 1DGVA 2GGZA 3HX4A 4PE4A 1U5IB 3WNXB 1YUUA 1F4QA 1QXPA 4AQJA 3LLEA 1BU3A 1YURA 2HQWA 3KPXA 1BLQA 3KF9A 2OPOA 4MVFA 2FCDA 1FPWA 1CMFA 1Y1XA 4I5NB 2LUCA 3I5HB 5D7FA 2M8UA 2GGMA 4YGEB 3TDIA 2PVBA 1HT9A 1DJXA 1J7RA 2KDHA 1KWOB 1PRWA 3PN7B 3O2PA 2PALA 1PULA 5BPJA 3JVTB 2L0PA 4ORCB 3LL8B 4ZCVA 1B8CA 5I8NA 1JFJA 5IBWA 1QASA 1SL7A 1EH2A 5AXIA 5CSFA 3SJSA 1QATA 5JJGA 1KFXS 2JQ6A 2LMTA 1AK8A 2K0JA 2MLFC 3LK1A 1CLBA 2KI6C 3WHUB 3CS1A 3VROA 4QJ3B 1M39A 1KFXL 5I2OA 1NWDA 3TDZA 4GAOA 3NXAA 2O60A 1S6CA 3D0YB 1MF8B 2KQ6A 3SG2A 3TS5B 1K8UA 1AUIB 1J7QA 2LLSA 1SK6D 1TNXA 2LVKA 2EHBA 3QRXA 2LP3A 1IG5A 2Y1MA 2I2RE 1IWQA 1NX1A 1CDLA 4PE7A 2M7LA 1XFVO 3BYAA 5AFPA 1WRKA 4I5LB 3M0WA 2LC5A 4WRIA 1KCYA 3DVJA 4GBAA 2BL0B 5AANA 2KOTA 1XVJA 1BT6A 3A4UB 1J7OA 4DCKA 1IJ5A 2KAXA 1YUSA 2L50A 5JOLA 1JWDA 4CFQA 3BUMB 2JTZA 1JF0A 2G2BA 1S5GZ 2OTGB 3GOFA 1Y1AA 2E30A 4OR9B 2SASA 2K2AA 1QIVA 1H8BA 1WLZA 1J7PA 5HKWA 1KSMA 1A75B 2H61A 2VRGA 4PALA 4OKHA 3EK4A 4PE1A 1L7ZA 3OB1B 1CFFA 3I5GC 2M49B 3I5FB 1YRTB 4U8DA 3I5HC 4BY5A 1LA3A 3DVMA 3BOWB 1AP4A 3K21A 1Q80A 3JVTC 1E8AA 2IS9A 1H4BA 1IGVA 1XFYO 2B1UA 4ETOA 4A4CA 4FTGA 1AVSA 2GV5A 5KTYA 1LVCD 2AAOA 1XK4C 1SNLA 2F3ZA 2Y5IA 1EJ3A 1CMGA 1ZMZA 2Q91A 1DJHA 1YR5A 4YGAA 4HREE 5CPVA 1J1EA 1WLMA 2KAVA 1F8HA 1CFCA 2HPSA 1ALVA 1XA5A 2KYFA 1PSBA 2KGRA 2PSRA 3BUNB 1PK0D 1KQMB 1L2OB 1ZACA 2JNXA 3TS5C 1FI6A 1NPQA 2MRDA 2MBXA 3VRNA 1TNQA 3NSKA 2M9GA 1TN4A 1SR6B 4AQIA 1MXEA 4GGFC 4PHMA 2BCAA 1V1GA 4OV2A 3OX6A 2LUXA 3SG6A 2OS8B 4GFTA 1KFUS 2O5GA 5G08A 2LANA 1BG1A 1F55A 1S3PA 3DVEA 2QPTA 2EGDA 1RROA 4M2PA 4YGCB 2WCFA 5DKNA 1DTLA 1KFUL 1CFDA 3DVKA 2L4IA 2L51A 2V53A 3GK1A 4GUKA 5ER5A 3O78A 1RTP1 4M2QA 1PVBA 1X02A 2BCXA 2Y4QA 2EC6B 4MEWA 3DF0A 1RJVA 2K61A 4I5KA 1FW4A 1NCXA 1YVLA 3A8RA 4MZKA 4PHNA 1SBJA 1NSHA 2FCEA 1DF0A 3EVUA 2ZRTA 4YI8A 5DKRA 1FF1A 2ZN8A 1MUXA 1KK7Y 3ICBA 5HLVA 1RFJA 4C0KA 4QJ4B 4C0JA 2HQ8A 1B7TZ 2CNPA 3TUYC 1K2HA 1EXRA 1B47A 1FBVA 4JWQA 3I5IB 2BKHB 1XFWO 3CGAA 1XFZO 1CFPA 2BECA 1SL9A 3O6BA 4P2YB 2WC8A 1JUOA 2M0RA 1XFUO 1QX7A 5CSIA 3JTDC 1SW8A 2KGBC 2NCOA 5ER4X 1UURA 2L4HA 1BMOA 1N2DA 3SIBA 1QVIZ 1R2UA 1OOJA 5FYXA 2LHLA 1VRKA 2JRFA 1CLLA 3MSEB 3E3RA 1TRFA 4ICBA 1NP8A 1TOPA 3WHTB 2K7OA 1SCMC 4CIDA 4GPLB 4PCWA 2JPTA 2JULA 1D1OA 2E6WA 1DJWA 3PFVA 1DVIA 2KSPA 1RWYA 3TDUA 2LV7A 4XJKB 3SG7A 2JXCA 1UHNA 2A4JA 2LNKA 1KSOA 1SR6C 1B4CA 1U5IA 1XO5A 2BBNA 2F2PA 2K2FA 2F2OA 2JT3A 1QLSA 2Y1NA 4WQ3A 2RGIA 4C0LA 1UP5A 1QX5B 1LXFC 1JFKA 3OB2B 3EKHA 5PALA 2AMIA 1SMGA 1JF2A 2KNEA 1YUTA 1TCOB 3KEVA 3WXAA 4QJ5B 5GQQC 1R6PA 1B9AA 4N1GA 4CLNA 2LMUA 1XFXO 1XK4A 1BR4B 5CSNA 1BOCA 1WDCB 3EVRA 3KHEA 2LVJA 4PHKA 1OZOA 1KQVA 4DRWA 4YGDB 3PATA 4ZCUA 1IQ3A 1OSAA 1S5GY 5B8IB 2MJWB 3BQ3A 2F8PA 4NDBA 2KHNA 1DJZA 3NSOA 4GGNA 3D0YA 3F45A 1KWOC 3PN7C 1LA0A 5TNCA 4CFRA 1F70A 2ISDA 4HSZA 4AOMA 2JXLA 2L98A 1JSAA 1OQPA 1YVHA 2M1KB 5J3XA 1ZFSA 5HKZA 3GK4X 3SG3A 4ORBB 1M31A 4HRHA 1WRLA 3BUOB 1CDMA 4P5OE 1W7IB 1A2XA 1YRUB 5AEQA 1TNWA 1QX2A 1SY9A 3D10A 4M2OA 2KBMA 4OCIA 1LINA 2F33A 1K90D 2NZ0A 1OMRA 1MWNA 1LKJA 1YTZC 3CR2A 1QTXA 1MHOA 1DGUA 2ZN9A 3FS7A 3EKJA 3LK0A 3DF0B 1UHKA 1AJ4A 4NDCA 3SG4A 1V1FA 2QACA 4N1FA 5HKYA 4L9MA 1Y0VH 2BL0C 1DF0B 1K94A 3HCMA 1ALWA 1M63B 1QV0A 4D1EA 4JQ0D 2LLTA 1RECA 4NQGA 1EG4A 1DJIA 2JWWA 4TNCA 2BKIB 1BJFA 1J1DA 2OTGC 5DKQA 3RM1A 1TNPA 3KO0A 1JBAA 3NSLA 1TIZA 2JT8A 4ORAB 2K7DA 1CTRA 1CB1A 1K9PA 2H2KA 2LE9B 1M46A 4IL1A 1SKTA 3I5FC 3NSIA 3OHMB 2ZNDA 2BE4A 3AAKA 4PHJA 2KQYA 1C07A 3VGOA 2JZIA 4MSPA 3EVVA 1MQ1A 3ZNIA 2CCMA 3ZWHA 1F71A 2BCBA 1ZUZA 3H4SE 2LHIA 4XYNA 4BY4A 1A4PA 1B7TY 2K7CA 3IQOA 2CTNA 4MZLA 1PALA 1QLKA 2I18A 2MHHA 2ZKMX 3PLFB 1QV1A 2LAPA 2MLEC 2NLNA 3C1VA 2LP2A 1YX8A 2AUCA 1CNPA 2LCPA 1XYDA 1KK8B 5D69A 2FOTA 1CDPA 1UHHA 3VRRA 3I5GB 1K95A 1N65A 1UWOA 2KFFA 3CLNA 1QVIY 2JU0A 3FIAA 4E68A 1A29A 3BUWB 2ZNEA 1W7JB 4NDDA 1KQMC 1L2OC 1K93D 2P6BB 1S1EA 2M29A 4CPVA 1NX0A 1ODBA 2KI4B 2HETA 1G33A 1M45A 1CLMA 4DUQA 2G9BA 2CXJA 2OS8C 1CDNA 2LMVA 3CR5X 1GGZA 4DS7A 5KU1A 1NX2A 3FWBA 4MRXA 1GQMA 1N0YA 1K9UA 3BXKA 1K9KA 2WOSA 3SIAA 3OP0A 1GGWA 2WCBA 4Q04A 2WNDA 3IQQA 1CM4A 2NXQA 1K96A 1S26D 2EC6C 1WRZA 1MR8A 2NCPA 2ZRSA 5HYDA 4FQOA 3RLZA 1QJTA 1QS7A 4MN0A 4MZJA 3CWGA 5KSZA 5I2QA 2KFHA 3O4YA 4YGBB 3PSRA 1NX3A 3TZ1A 2L2EA 1B8LA 3CZTX 1NYAA 3BUXB 4YBHB 1NIWA 2ZFDA 5F6TA 2F3YA 3I5IC 1UHJA 1NUBA 2KBIA 4XJKA 3SG5A 3AKAA 4MBEA 4DIRA 1DJGA 2JOJA 3CR4X 1C7WA 1SYMA 1SRAA 2KYCA 3CTNA 4N5XA 2L5XB 4HRGA 1S6IA 4JPZB 1TCFA 2MAZA 4F0ZB 4WQ2A 2LM5A 2FJUB 4GGFA 1OMDA 1EL4A 2MA2A 4USLA 2JNFA 1SL8A 1KK8C 1J55A 3VRQA 1IJ6A 2KFGA 3EK8A 1S6JA 2JT0A 1IKUA 4MRYA 1WY9A 2K7BA 2BE6A 2M3WA 2COLB 3TUYB 1F54A 4OVNF 2I94A 2PMYA 1G4YR 1AJ5A 1B8RA 3LCPC 2KI4C 4YI9A 2KI6D 1A75A 1GJYA 1Y1UA 3JTDB 2KAYA 4PE0A 1AHRA 3AAJA 2TN4A 5HLOA 1ZOTB 1DJYA 3PALA 2JC2A 3IF7A 2H61C 4PDZA 2LVIA 1NCZA 4UPGA 2M97A 3BOWA 1SCMB 4A4BA 1FI5A 5K89A 1PSRA 1TTXA 2I7AA 2M7NA 1S36A 1OMVA 1RK9A 1UUSA 3VRPA 4I5JA 1BF5A 2M1UA 2PASA 2PRUA 1G8IA 1CM1A 1MXLC 1Y6WA 2CT9A 2JTTA 1OZSA 1WDCC 3PM8A 1DMOA 3EK7A 5I2LA 1HQVA 1PVAA 2D8NA 1IRJA 1SPYA 1UHIA 4MLWA 2WCEA 3FWCA 2SCPA 2HF5A 1C7VA 1JC2A 1QIWA 2LVVA 1B1GA 5AERA 3GK2A 1SCVA 3AKBA 1DT7B 1NCYA 1YX7A 2CBLA 2Q4UA 2LLUA 1CKKA 1IH0A 4GNKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CSJ A;  1F4O A;  2BBM A;  1BOD A;  4YRU A;  1KK7 Z;  1OE9 B;  2K8M B;  2DOQ A;  4R1E A;  2R2I A;  3DD4 A;  1EG3 A;  3OX5 A;  1A03 A;  1BR1 B;  2WOR A;  1IQ5 A;  1DGV A;  2GGZ A;  3HX4 A;  4PE4 A;  1U5I B;  3WNX B;  1YUU A;  1F4Q A;  1QXP A;  4AQJ A;  3LLE A;  1BU3 A;  1YUR A;  2HQW A;  3KPX A;  1BLQ A;  3KF9 A;  2OPO A;  4MVF A;  2FCD A;  1FPW A;  1CMF A;  1Y1X A;  4I5N B;  2LUC A;  3I5H B;  5D7F A;  2M8U A;  2GGM A;  4YGE B;  3TDI A;  2PVB A;  1HT9 A;  1DJX A;  1J7R A;  2KDH A;  1KWO B;  1PRW A;  3PN7 B;  3O2P A;  2PAL A;  1PUL A;  5BPJ A;  3JVT B;  2L0P A;  4ORC B;  3LL8 B;  4ZCV A;  1B8C A;  5I8N A;  1JFJ A;  5IBW A;  1QAS A;  1SL7 A;  1EH2 A;  5AXI A;  5CSF A;  3SJS A;  1QAT A;  5JJG A;  1KFX S;  2JQ6 A;  2LMT A;  1AK8 A;  2K0J A;  2MLF C;  3LK1 A;  1CLB A;  2KI6 C;  3WHU B;  3CS1 A;  3VRO A;  4QJ3 B;  1M39 A;  1KFX L;  5I2O A;  1NWD A;  3TDZ A;  4GAO A;  3NXA A;  2O60 A;  1S6C A;  3D0Y B;  1MF8 B;  2KQ6 A;  3SG2 A;  3TS5 B;  1K8U A;  1AUI B;  1J7Q A;  2LLS A;  1SK6 D;  1TNX A;  2LVK A;  2EHB A;  3QRX A;  2LP3 A;  1IG5 A;  2Y1M A;  2I2R E;  1IWQ A;  1NX1 A;  1CDL A;  4PE7 A;  2M7L A;  1XFV O;  3BYA A;  5AFP A;  1WRK A;  4I5L B;  3M0W A;  2LC5 A;  4WRI A;  1KCY A;  3DVJ A;  4GBA A;  2BL0 B;  5AAN A;  2KOT A;  1XVJ A;  1BT6 A;  3A4U B;  1J7O A;  4DCK A;  1IJ5 A;  2KAX A;  1YUS A;  2L50 A;  5JOL A;  1JWD A;  4CFQ A;  3BUM B;  2JTZ A;  1JF0 A;  2G2B A;  1S5G Z;  2OTG B;  3GOF A;  1Y1A A;  2E30 A;  4OR9 B;  2SAS A;  2K2A A;  1QIV A;  1H8B A;  1WLZ A;  1J7P A;  5HKW A;  1KSM A;  1A75 B;  2H61 A;  2VRG A;  4PAL A;  4OKH A;  3EK4 A;  4PE1 A;  1L7Z A;  3OB1 B;  1CFF A;  3I5G C;  2M49 B;  3I5F B;  1YRT B;  4U8D A;  3I5H C;  4BY5 A;  1LA3 A;  3DVM A;  3BOW B;  1AP4 A;  3K21 A;  1Q80 A;  3JVT C;  1E8A A;  2IS9 A;  1H4B A;  1IGV A;  1XFY O;  2B1U A;  4ETO A;  4A4C A;  4FTG A;  1AVS A;  2GV5 A;  5KTY A;  1LVC D;  2AAO A;  1XK4 C;  1SNL A;  2F3Z A;  2Y5I A;  1EJ3 A;  1CMG A;  1ZMZ A;  2Q91 A;  1DJH A;  1YR5 A;  4YGA A;  4HRE E;  5CPV A;  1J1E A;  1WLM A;  2KAV A;  1F8H A;  1CFC A;  2HPS A;  1ALV A;  1XA5 A;  2KYF A;  1PSB A;  2KGR A;  2PSR A;  3BUN B;  1PK0 D;  1KQM B;  1L2O B;  1ZAC A;  2JNX A;  3TS5 C;  1FI6 A;  1NPQ A;  2MRD A;  2MBX A;  3VRN A;  1TNQ A;  3NSK A;  2M9G A;  1TN4 A;  1SR6 B;  4AQI A;  1MXE A;  4GGF C;  4PHM A;  2BCA A;  1V1G A;  4OV2 A;  3OX6 A;  2LUX A;  3SG6 A;  2OS8 B;  4GFT A;  1KFU S;  2O5G A;  5G08 A;  2LAN A;  1BG1 A;  1F55 A;  1S3P A;  3DVE A;  2QPT A;  2EGD A;  1RRO A;  4M2P A;  4YGC B;  2WCF A;  5DKN A;  1DTL A;  1KFU L;  1CFD A;  3DVK A;  2L4I A;  2L51 A;  2V53 A;  3GK1 A;  4GUK A;  5ER5 A;  3O78 A;  1RTP 1;  4M2Q A;  1PVB A;  1X02 A;  2BCX A;  2Y4Q A;  2EC6 B;  4MEW A;  3DF0 A;  1RJV A;  2K61 A;  4I5K A;  1FW4 A;  1NCX A;  1YVL A;  3A8R A;  4MZK A;  4PHN A;  1SBJ A;  1NSH A;  2FCE A;  1DF0 A;  3EVU A;  2ZRT A;  4YI8 A;  5DKR A;  1FF1 A;  2ZN8 A;  1MUX A;  1KK7 Y;  3ICB A;  5HLV A;  1RFJ A;  4C0K A;  4QJ4 B;  4C0J A;  2HQ8 A;  1B7T Z;  2CNP A;  3TUY C;  1K2H A;  1EXR A;  1B47 A;  1FBV A;  4JWQ A;  3I5I B;  2BKH B;  1XFW O;  3CGA A;  1XFZ O;  1CFP A;  2BEC A;  1SL9 A;  3O6B A;  4P2Y B;  2WC8 A;  1JUO A;  2M0R A;  1XFU O;  1QX7 A;  5CSI A;  3JTD C;  1SW8 A;  2KGB C;  2NCO A;  5ER4 X;  1UUR A;  2L4H A;  1BMO A;  1N2D A;  3SIB A;  1QVI Z;  1R2U A;  1OOJ A;  5FYX A;  2LHL A;  1VRK A;  2JRF A;  1CLL A;  3MSE B;  3E3R A;  1TRF A;  4ICB A;  1NP8 A;  1TOP A;  3WHT B;  2K7O A;  1SCM C;  4CID A;  4GPL B;  4PCW A;  2JPT A;  2JUL A;  1D1O A;  2E6W A;  1DJW A;  3PFV A;  1DVI A;  2KSP A;  1RWY A;  3TDU A;  2LV7 A;  4XJK B;  3SG7 A;  2JXC A;  1UHN A;  2A4J A;  2LNK A;  1KSO A;  1SR6 C;  1B4C A;  1U5I A;  1XO5 A;  2BBN A;  2F2P A;  2K2F A;  2F2O A;  2JT3 A;  1QLS A;  2Y1N A;  4WQ3 A;  2RGI A;  4C0L A;  1UP5 A;  1QX5 B;  1LXF C;  1JFK A;  3OB2 B;  3EKH A;  5PAL A;  2AMI A;  1SMG A;  1JF2 A;  2KNE A;  1YUT A;  1TCO B;  3KEV A;  3WXA A;  4QJ5 B;  5GQQ C;  1R6P A;  1B9A A;  4N1G A;  4CLN A;  2LMU A;  1XFX O;  1XK4 A;  1BR4 B;  5CSN A;  1BOC A;  1WDC B;  3EVR A;  3KHE A;  2LVJ A;  4PHK A;  1OZO A;  1KQV A;  4DRW A;  4YGD B;  3PAT A;  4ZCU A;  1IQ3 A;  1OSA A;  1S5G Y;  5B8I B;  2MJW B;  3BQ3 A;  2F8P A;  4NDB A;  2KHN A;  1DJZ A;  3NSO A;  4GGN A;  3D0Y A;  3F45 A;  1KWO C;  3PN7 C;  1LA0 A;  5TNC A;  4CFR A;  1F70 A;  2ISD A;  4HSZ A;  4AOM A;  2JXL A;  2L98 A;  1JSA A;  1OQP A;  1YVH A;  2M1K B;  5J3X A;  1ZFS A;  5HKZ A;  3GK4 X;  3SG3 A;  4ORB B;  1M31 A;  4HRH A;  1WRL A;  3BUO B;  1CDM A;  4P5O E;  1W7I B;  1A2X A;  1YRU B;  5AEQ A;  1TNW A;  1QX2 A;  1SY9 A;  3D10 A;  4M2O A;  2KBM A;  4OCI A;  1LIN A;  2F33 A;  1K90 D;  2NZ0 A;  1OMR A;  1MWN A;  1LKJ A;  1YTZ C;  3CR2 A;  1QTX A;  1MHO A;  1DGU A;  2ZN9 A;  3FS7 A;  3EKJ A;  3LK0 A;  3DF0 B;  1UHK A;  1AJ4 A;  4NDC A;  3SG4 A;  1V1F A;  2QAC A;  4N1F A;  5HKY A;  4L9M A;  1Y0V H;  2BL0 C;  1DF0 B;  1K94 A;  3HCM A;  1ALW A;  1M63 B;  1QV0 A;  4D1E A;  4JQ0 D;  2LLT A;  1REC A;  4NQG A;  1EG4 A;  1DJI A;  2JWW A;  4TNC A;  2BKI B;  1BJF A;  1J1D A;  2OTG C;  5DKQ A;  3RM1 A;  1TNP A;  3KO0 A;  1JBA A;  3NSL A;  1TIZ A;  2JT8 A;  4ORA B;  2K7D A;  1CTR A;  1CB1 A;  1K9P A;  2H2K A;  2LE9 B;  1M46 A;  4IL1 A;  1SKT A;  3I5F C;  3NSI A;  3OHM B;  2ZND A;  2BE4 A;  3AAK A;  4PHJ A;  2KQY A;  1C07 A;  3VGO A;  2JZI A;  4MSP A;  3EVV A;  1MQ1 A;  3ZNI A;  2CCM A;  3ZWH A;  1F71 A;  2BCB A;  1ZUZ A;  3H4S E;  2LHI A;  4XYN A;  4BY4 A;  1A4P A;  1B7T Y;  2K7C A;  3IQO A;  2CTN A;  4MZL A;  1PAL A;  1QLK A;  2I18 A;  2MHH A;  2ZKM X;  3PLF B;  1QV1 A;  2LAP A;  2MLE C;  2NLN A;  3C1V A;  2LP2 A;  1YX8 A;  2AUC A;  1CNP A;  2LCP A;  1XYD A;  1KK8 B;  5D69 A;  2FOT A;  1CDP A;  1UHH A;  3VRR A;  3I5G B;  1K95 A;  1N65 A;  1UWO A;  2KFF A;  3CLN A;  1QVI Y;  2JU0 A;  3FIA A;  4E68 A;  1A29 A;  3BUW B;  2ZNE A;  1W7J B;  4NDD A;  1KQM C;  1L2O C;  1K93 D;  2P6B B;  1S1E A;  2M29 A;  4CPV A;  1NX0 A;  1ODB A;  2KI4 B;  2HET A;  1G33 A;  1M45 A;  1CLM A;  4DUQ A;  2G9B A;  2CXJ A;  2OS8 C;  1CDN A;  2LMV A;  3CR5 X;  1GGZ A;  4DS7 A;  5KU1 A;  1NX2 A;  3FWB A;  4MRX A;  1GQM A;  1N0Y A;  1K9U A;  3BXK A;  1K9K A;  2WOS A;  3SIA A;  3OP0 A;  1GGW A;  2WCB A;  4Q04 A;  2WND A;  3IQQ A;  1CM4 A;  2NXQ A;  1K96 A;  1S26 D;  2EC6 C;  1WRZ A;  1MR8 A;  2NCP A;  2ZRS A;  5HYD A;  4FQO A;  3RLZ A;  1QJT A;  1QS7 A;  4MN0 A;  4MZJ A;  3CWG A;  5KSZ A;  5I2Q A;  2KFH A;  3O4Y A;  4YGB B;  3PSR A;  1NX3 A;  3TZ1 A;  2L2E A;  1B8L A;  3CZT X;  1NYA A;  3BUX B;  4YBH B;  1NIW A;  2ZFD A;  5F6T A;  2F3Y A;  3I5I C;  1UHJ A;  1NUB A;  2KBI A;  4XJK A;  3SG5 A;  3AKA A;  4MBE A;  4DIR A;  1DJG A;  2JOJ A;  3CR4 X;  1C7W A;  1SYM A;  1SRA A;  2KYC A;  3CTN A;  4N5X A;  2L5X B;  4HRG A;  1S6I A;  4JPZ B;  1TCF A;  2MAZ A;  4F0Z B;  4WQ2 A;  2LM5 A;  2FJU B;  4GGF A;  1OMD A;  1EL4 A;  2MA2 A;  4USL A;  2JNF A;  1SL8 A;  1KK8 C;  1J55 A;  3VRQ A;  1IJ6 A;  2KFG A;  3EK8 A;  1S6J A;  2JT0 A;  1IKU A;  4MRY A;  1WY9 A;  2K7B A;  2BE6 A;  2M3W A;  2COL B;  3TUY B;  1F54 A;  4OVN F;  2I94 A;  2PMY A;  1G4Y R;  1AJ5 A;  1B8R A;  3LCP C;  2KI4 C;  4YI9 A;  2KI6 D;  1A75 A;  1GJY A;  1Y1U A;  3JTD B;  2KAY A;  4PE0 A;  1AHR A;  3AAJ A;  2TN4 A;  5HLO A;  1ZOT B;  1DJY A;  3PAL A;  2JC2 A;  3IF7 A;  2H61 C;  4PDZ A;  2LVI A;  1NCZ A;  4UPG A;  2M97 A;  3BOW A;  1SCM B;  4A4B A;  1FI5 A;  5K89 A;  1PSR A;  1TTX A;  2I7A A;  2M7N A;  1S36 A;  1OMV A;  1RK9 A;  1UUS A;  3VRP A;  4I5J A;  1BF5 A;  2M1U A;  2PAS A;  2PRU A;  1G8I A;  1CM1 A;  1MXL C;  1Y6W A;  2CT9 A;  2JTT A;  1OZS A;  1WDC C;  3PM8 A;  1DMO A;  3EK7 A;  5I2L A;  1HQV A;  1PVA A;  2D8N A;  1IRJ A;  1SPY A;  1UHI A;  4MLW A;  2WCE A;  3FWC A;  2SCP A;  2HF5 A;  1C7V A;  1JC2 A;  1QIW A;  2LVV A;  1B1G A;  5AER A;  3GK2 A;  1SCV A;  3AKB A;  1DT7 B;  1NCY A;  1YX7 A;  2CBL A;  2Q4U A;  2LLU A;  1CKK A;  1IH0 A;  4GNK B; 
#chains in the Genus database with same CATH topology
 5CSJ A;  1F4O A;  2BBM A;  1BOD A;  3QME A;  4YRU A;  1KK7 Z;  1OE9 B;  2K8M B;  2DOQ A;  4R1E A;  2R2I A;  3DD4 A;  3CZ1 A;  1EG3 A;  3OX5 A;  1A03 A;  1BR1 B;  2WOR A;  1IQ5 A;  2K60 A;  1DGV A;  2GGZ A;  3HX4 A;  4PE4 A;  3IVT A;  1U5I B;  3WNX B;  1YUU A;  2WCK A;  1F4Q A;  1QXP A;  4AQJ A;  3LLE A;  1BU3 A;  1YUR A;  3FE8 A;  2HQW A;  3KPX A;  1BLQ A;  3KF9 A;  2OPO A;  4MVF A;  2FCD A;  1FPW A;  3D75 A;  1CMF A;  1Y1X A;  5I94 A;  4I5N B;  2LUC A;  3I5H B;  5D7F A;  2M8U A;  2GGM A;  4YGE B;  3TDI A;  2PVB A;  1HT9 A;  1DJX A;  1J7R A;  2KDH A;  2YGU A;  1KWO B;  1PRW A;  3PN7 B;  3O2P A;  1XFR A;  2PAL A;  1PUL A;  5BPJ A;  3JVT B;  2QEV A;  2L0P A;  4ORC B;  3LL8 B;  4ZCV A;  1B8C A;  3Q8I A;  5I8N A;  3D74 A;  1JFJ A;  5IBW A;  1QAS A;  1SL7 A;  1EH2 A;  5AXI A;  5CSF A;  3SJS A;  1QAT A;  5JJG A;  1KFX S;  2JQ6 A;  2LMT A;  1AK8 A;  3B87 A;  2K0J A;  3S0D A;  2MLF C;  3LK1 A;  1CLB A;  2KI6 C;  3WHU B;  3CS1 A;  3VRO A;  4QJ3 B;  1M39 A;  1KFX L;  5I2O A;  1NWD A;  3TDZ A;  4GAO A;  3NXA A;  2O60 A;  1S6C A;  2KLE A;  3D0Y B;  4F7F A;  1MF8 B;  2KQ6 A;  3SG2 A;  3TS5 B;  1K8U A;  1AUI B;  1J7Q A;  2LLS A;  1SK6 D;  1TNX A;  2LVK A;  2EHB A;  3QRX A;  2LP3 A;  3BFA A;  1IG5 A;  2Y1M A;  2I2R E;  1IWQ A;  1NX1 A;  1CDL A;  4PE7 A;  2M7L A;  3V2L A;  1XFV O;  5FI6 A;  3BYA A;  5AFP A;  1WRK A;  4I5L B;  3M0W A;  2LC5 A;  2L5Y A;  4WRI A;  1KCY A;  3DVJ A;  4GBA A;  2BL0 B;  5AAN A;  2KOT A;  1XVJ A;  3EG5 B;  5FI7 A;  1BT6 A;  3A4U B;  1J7O A;  4DCK A;  1IJ5 A;  2KAX A;  1YUS A;  2L50 A;  5JOL A;  1JWD A;  4CFQ A;  3BUM B;  2JTZ A;  1JF0 A;  2G2B A;  1S5G Z;  2OTG B;  3GOF A;  1Y1A A;  1TUZ A;  2E30 A;  4OR9 B;  2SAS A;  2K2A A;  1QIV A;  1H8B A;  1WLZ A;  1J7P A;  5HKW A;  1KSM A;  1A75 B;  3N7H A;  2H61 A;  2VRG A;  4PAL A;  4OKH A;  3EK4 A;  3D78 A;  1L7Z A;  4PE1 A;  3OB1 B;  1CFF A;  3I5G C;  2M49 B;  3B86 A;  1YRT B;  2WCH A;  3I5F B;  4U8D A;  3I5H C;  4BY5 A;  1LA3 A;  3DVM A;  3O4X A;  3BOW B;  1OOI X;  3NGV A;  3UNW A;  3K21 A;  1AP4 A;  2P71 A;  1Q80 A;  3JVT C;  2JPO A;  1E8A A;  1OOH A;  2IS9 A;  1H4B A;  1IGV A;  1XFY O;  2B1U A;  4ETO A;  4A4C A;  2GTE A;  1AVS A;  2GV5 A;  2PQL A;  4FTG A;  5KTY A;  1LVC D;  2AAO A;  1XK4 C;  1SNL A;  2F3Z A;  2H8V A;  1EJ3 A;  2QEB A;  1ZMZ A;  2Y5I A;  1CMG A;  2Q91 A;  1DJH A;  1YR5 A;  4YGA A;  4HRE E;  5CPV A;  1J1E A;  1WLM A;  2KAV A;  1F8H A;  1CFC A;  2HPS A;  1ALV A;  1XA5 A;  3BFH A;  2KYF A;  1PSB A;  2KGR A;  2PSR A;  3BUN B;  1PK0 D;  1KQM B;  1L2O B;  1ZAC A;  2JNX A;  3TS5 C;  1FI6 A;  1NPQ A;  2MRD A;  3CAB A;  2MBX A;  3VRN A;  1TNQ A;  3NSK A;  2M9G A;  1TN4 A;  1SR6 B;  3SS4 A;  1MXE A;  4GGF C;  4PHM A;  4AQI A;  2BCA A;  1V1G A;  4OV2 A;  3OX6 A;  2LUX A;  3SG6 A;  2OS8 B;  4GFT A;  1KFU S;  2O5G A;  5G08 A;  2LAN A;  1BG1 A;  1F55 A;  3S0E A;  1S3P A;  3DVE A;  2QPT A;  2EGD A;  1RRO A;  4M2P A;  4YGC B;  3PJI A;  2WCF A;  5DKN A;  1DTL A;  1KFU L;  1CFD A;  3DVK A;  2L4I A;  2L51 A;  2V53 A;  2WCL A;  3GK1 A;  4GUK A;  3DZT A;  5ER5 A;  3O78 A;  1RTP 1;  4M2Q A;  1PVB A;  1X02 A;  2BCX A;  2Y4Q A;  2EC6 B;  4MEW A;  3DF0 A;  1RJV A;  2K61 A;  4I5K A;  1FW4 A;  1NCX A;  1YVL A;  3A8R A;  1SSE B;  1W9Z A;  4MZK A;  1SBJ A;  1NSH A;  4PHN A;  2FCE A;  1DF0 A;  3EVU A;  2ZRT A;  4YI8 A;  5DKR A;  1FF1 A;  2ZN8 A;  1MUX A;  1KK7 Y;  3ICB A;  5HLV A;  1RFJ A;  4C0K A;  4QJ4 B;  4C0J A;  2HQ8 A;  1B7T Z;  2CNP A;  3TUY C;  1K2H A;  1EXR A;  1B47 A;  1FBV A;  4JWQ A;  3I5I B;  2BKH B;  1XFW O;  3CGA A;  1XFZ O;  1CFP A;  2BEC A;  1SL9 A;  3O6B A;  4P2Y B;  2WC8 A;  1JUO A;  2M0R A;  1XFU O;  1QX7 A;  5CSI A;  3D77 A;  3JTD C;  1SW8 A;  2BAP A;  2KGB C;  2NCO A;  5ER4 X;  3RZS A;  4INW A;  1UUR A;  2L4H A;  1BMO A;  1N2D A;  3SIB A;  1QVI Z;  1R2U A;  1OOJ A;  5FYX A;  2LHL A;  1VRK A;  2JRF A;  1CLL A;  3MSE B;  3E3R A;  1TRF A;  4ICB A;  1NP8 A;  1TOP A;  3WHT B;  3OGN A;  2K7O A;  1SCM C;  4CID A;  4GPL B;  3S0F A;  4PCW A;  1TUJ A;  2JPT A;  2JUL A;  1D1O A;  2Q4U A;  2E6W A;  1DJW A;  3PFV A;  1DVI A;  3S0A A;  2KSP A;  1RWY A;  3TDU A;  2LV7 A;  4XJK B;  3SG7 A;  2JXC A;  1UHN A;  2A4J A;  2LNK A;  1KSO A;  1SR6 C;  1B4C A;  1U5I A;  1XO5 A;  2BBN A;  2F2P A;  2K2F A;  2F2O A;  4JKT A;  3R1O A;  2JT3 A;  3L4A A;  3D76 A;  1QLS A;  2Y1N A;  3S0G A;  4WQ3 A;  2RGI A;  3FE9 A;  4C0L A;  1UP5 A;  1QX5 B;  1LXF C;  1JFK A;  1OW4 A;  3OB2 B;  3EKH A;  1DQE A;  2AMI A;  5PAL A;  1SMG A;  5D3O A;  1JF2 A;  2KNE A;  1YUT A;  1TCO B;  2KPH A;  3KEV A;  3WXA A;  4QJ5 B;  3BJH A;  5GQQ C;  1R6P A;  1B9A A;  3OBV A;  4N1G A;  4CLN A;  2LMU A;  1XFX O;  1XK4 A;  1BR4 B;  3BFB A;  5CSN A;  1BOC A;  1WDC B;  3EVR A;  3KHE A;  2LVJ A;  4PHK A;  1OZO A;  1KQV A;  1OOF A;  4DRW A;  4YGD B;  4OZD A;  3PAT A;  4ZCU A;  3CYZ A;  1IQ3 A;  1OSA A;  1S5G Y;  5B8I B;  2MJW B;  3BQ3 A;  2F8P A;  4NDB A;  2KHN A;  1DJZ A;  3NSO A;  4GGN A;  3CZ2 A;  3D0Y A;  2QEO A;  1KWO C;  3F45 A;  3PN7 C;  1LA0 A;  5TNC A;  4CFR A;  1F70 A;  2ISD A;  4HSZ A;  4AOM A;  2JXL A;  2L98 A;  1JSA A;  1OQP A;  1YVH A;  2M1K B;  5J3X A;  2QEH A;  1ZFS A;  5HKZ A;  3GK4 X;  3SG3 A;  4ORB B;  1M31 A;  4HRH A;  1WRL A;  3BUO B;  1CDM A;  4IJ7 A;  4P5O E;  1W7I B;  1A2X A;  1YRU B;  3K1E A;  5AEQ A;  1TNW A;  1QX2 A;  1SY9 A;  3D10 A;  4M2O A;  2KBM A;  4OCI A;  1LIN A;  2F33 A;  1K90 D;  2NZ0 A;  1OMR A;  1MWN A;  1LKJ A;  1YTZ C;  3CR2 A;  1QTX A;  1MHO A;  1DGU A;  2ZN9 A;  2QDI A;  3EKJ A;  3FS7 A;  3S0B A;  3SS5 A;  3LK0 A;  3DF0 B;  1UHK A;  1AJ4 A;  4NDC A;  3SG4 A;  1V1F A;  2QAC A;  4N1F A;  5HKY A;  4L9M A;  1Y0V H;  2BL0 C;  1DF0 B;  3SS3 A;  1K94 A;  3HCM A;  1ALW A;  1M63 B;  1QV0 A;  4D1E A;  4JQ0 D;  2LLT A;  1REC A;  4NQG A;  1EG4 A;  1DJI A;  2BNX A;  2JWW A;  4TNC A;  2BKI B;  1BJF A;  1J1D A;  2OTG C;  5DKQ A;  3RM1 A;  3DYE A;  3B88 A;  1TNP A;  3KO0 A;  5DIC A;  1JBA A;  3NSL A;  1TIZ A;  2JT8 A;  2KLD A;  4ORA B;  2K7D A;  1Z4H A;  1CTR A;  1CB1 A;  1K9P A;  2H2K A;  2LE9 B;  1M46 A;  4IL1 A;  1SKT A;  3I5F C;  3NSI A;  3OHM B;  2ZND A;  2BE4 A;  3AAK A;  3DXL A;  2KQY A;  4PHJ A;  1ORG A;  2WCJ A;  2PYQ A;  3UO9 A;  1C07 A;  3VGO A;  2JZI A;  3CDN A;  4MSP A;  3EVV A;  1MQ1 A;  3ZNI A;  1OOG A;  2CCM A;  4JD9 A;  3ZWH A;  1F71 A;  2BCB A;  1ZUZ A;  3H4S E;  2LHI A;  4INX A;  4XYN A;  4BY4 A;  1A4P A;  1B7T Y;  2K7C A;  3IQO A;  2CTN A;  1DEK A;  1PAL A;  4MZL A;  1QLK A;  2I18 A;  2MHH A;  2ZKM X;  3FE6 A;  3PLF B;  1QV1 A;  2LAP A;  2MLE C;  2NLN A;  3C1V A;  2LP2 A;  1YX8 A;  2AUC A;  1CNP A;  4FQT A;  2LCP A;  1XYD A;  1KK8 B;  5D69 A;  2FOT A;  1CDP A;  1UHH A;  3VRR A;  1LS8 A;  3I5G B;  1K95 A;  1N65 A;  1UWO A;  2KFF A;  3CLN A;  1QVI Y;  2JU0 A;  3FIA A;  4E68 A;  1A29 A;  2L2C A;  3BUW B;  2ZNE A;  1W7J B;  4NDD A;  1KQM C;  1L2O C;  1K93 D;  3B7A A;  2P6B B;  1S1E A;  3VB1 A;  2M29 A;  4CPV A;  1NX0 A;  1ODB A;  2KI4 B;  2HET A;  1G33 A;  1M45 A;  1CLM A;  4DUQ A;  2G9B A;  2CXJ A;  2OS8 C;  3NHT A;  3NHI A;  1CDN A;  2LMV A;  3CR5 X;  1GGZ A;  4DS7 A;  5KU1 A;  1NX2 A;  2WC6 A;  3FWB A;  4MRX A;  1GQM A;  1N0Y A;  2P70 A;  3PM2 A;  1K9U A;  3BXK A;  1K9K A;  2WOS A;  4KYN A;  3OP0 A;  3SIA A;  1GGW A;  2WCB A;  4Q04 A;  2WND A;  3IQQ A;  3L47 A;  1CM4 A;  2NXQ A;  1K96 A;  1S26 D;  2EC6 C;  1P28 A;  1WRZ A;  1MR8 A;  2NCP A;  2ZRS A;  5HYD A;  1DC1 A;  4FQO A;  3RLZ A;  1QJT A;  1QS7 A;  4MN0 A;  4MZJ A;  3CWG A;  5KSZ A;  5I2Q A;  2KFH A;  3O4Y A;  4YGB B;  3PSR A;  1NX3 A;  3TZ1 A;  2L2E A;  1B8L A;  3CZT X;  1NYA A;  3BUX B;  4YBH B;  1NIW A;  2ZFD A;  5F6T A;  2F3Y A;  3I5I C;  1UHJ A;  1NUB A;  2KBI A;  4XJK A;  3SG5 A;  1IIO A;  5FI2 A;  3AKA A;  4MBE A;  4DIR A;  2WC5 A;  3D73 A;  1DJG A;  2JOJ A;  3CR4 X;  2WCM A;  1C7W A;  1SYM A;  1SRA A;  2KYC A;  3B6X A;  3CTN A;  2L5X B;  4N5X A;  4HRG A;  1S6I A;  4JPZ B;  1TCF A;  2MAZ A;  4F0Z B;  2ERB A;  4WQ2 A;  2LM5 A;  2FJU B;  4GGF A;  1OMD A;  1EL4 A;  2MA2 A;  4USL A;  2JNF A;  1SL8 A;  1KK8 C;  1J55 A;  3VRQ A;  1IJ6 A;  2KFG A;  3EK8 A;  1Z2C B;  1S6J A;  2JT0 A;  3R1P A;  1GM0 A;  1IKU A;  4MRY A;  1C3Z A;  1WY9 A;  2K7B A;  2BE6 A;  2M3W A;  3R72 A;  2COL B;  3TUY B;  1F54 A;  4OVN F;  2I94 A;  2PMY A;  1G4Y R;  1AJ5 A;  1B8R A;  1QWV A;  3LCP C;  2KI4 C;  4YI9 A;  2KI6 D;  4PT1 A;  1A75 A;  1GJY A;  1Y1U A;  3JTD B;  2KAY A;  1TWO A;  4PE0 A;  5EL2 A;  1AHR A;  3AAJ A;  2TN4 A;  5HLO A;  5HL1 A;  1ZOT B;  1DJY A;  3PAL A;  2FJY A;  2JC2 A;  3IF7 A;  2H61 C;  4PDZ A;  2LVI A;  1NCZ A;  4UPG A;  1C3Y A;  2M97 A;  3BOW A;  1SCM B;  4A4B A;  1FI5 A;  5K89 A;  1PSR A;  1TTX A;  2I7A A;  2M7N A;  1S36 A;  1OMV A;  1RK9 A;  1UUS A;  3VRP A;  4I5J A;  3R1V A;  1BF5 A;  3CZ0 A;  2M1U A;  2PAS A;  2PRU A;  1G8I A;  1CM1 A;  1MXL C;  1Y6W A;  2CT9 A;  2JTT A;  1OZS A;  1WDC C;  3PM8 A;  1DMO A;  3EK7 A;  5I2L A;  1HQV A;  1PVA A;  2D8N A;  1IRJ A;  1SPY A;  1UHI A;  4MLW A;  2WCE A;  3FWC A;  2SCP A;  2HF5 A;  1C7V A;  1JC2 A;  1QIW A;  2LVV A;  1B1G A;  5AER A;  3GK2 A;  1SCV A;  3AKB A;  3DY9 A;  1NCY A;  1T14 A;  1DT7 B;  1YX7 A;  2CBL A;  3L4L A;  1DEL A;  2LLU A;  1CKK A;  1IH0 A;  4GNK B; 
#chains in the Genus database with same CATH homology
 5CSJ A;  1F4O A;  2BBM A;  1BOD A;  4YRU A;  1KK7 Z;  1OE9 B;  2K8M B;  2DOQ A;  4R1E A;  2R2I A;  3DD4 A;  1EG3 A;  3OX5 A;  1A03 A;  1BR1 B;  2WOR A;  1IQ5 A;  1DGV A;  2GGZ A;  3HX4 A;  4PE4 A;  1U5I B;  3WNX B;  1YUU A;  1F4Q A;  1QXP A;  4AQJ A;  3LLE A;  1BU3 A;  1YUR A;  2HQW A;  3KPX A;  1BLQ A;  3KF9 A;  2OPO A;  4MVF A;  2FCD A;  1FPW A;  1CMF A;  1Y1X A;  4I5N B;  2LUC A;  3I5H B;  5D7F A;  2M8U A;  2GGM A;  4YGE B;  3TDI A;  2PVB A;  1HT9 A;  1DJX A;  1J7R A;  2KDH A;  1KWO B;  1PRW A;  3PN7 B;  3O2P A;  2PAL A;  1PUL A;  5BPJ A;  3JVT B;  2L0P A;  4ORC B;  3LL8 B;  4ZCV A;  1B8C A;  5I8N A;  1JFJ A;  5IBW A;  1QAS A;  1SL7 A;  1EH2 A;  5AXI A;  5CSF A;  3SJS A;  1QAT A;  5JJG A;  1KFX S;  2JQ6 A;  2LMT A;  1AK8 A;  2K0J A;  2MLF C;  3LK1 A;  1CLB A;  2KI6 C;  3WHU B;  3CS1 A;  3VRO A;  4QJ3 B;  1M39 A;  1KFX L;  5I2O A;  1NWD A;  3TDZ A;  4GAO A;  3NXA A;  2O60 A;  1S6C A;  3D0Y B;  1MF8 B;  2KQ6 A;  3SG2 A;  3TS5 B;  1K8U A;  1AUI B;  1J7Q A;  2LLS A;  1SK6 D;  1TNX A;  2LVK A;  2EHB A;  3QRX A;  2LP3 A;  1IG5 A;  2Y1M A;  2I2R E;  1IWQ A;  1NX1 A;  1CDL A;  4PE7 A;  2M7L A;  1XFV O;  3BYA A;  5AFP A;  1WRK A;  4I5L B;  3M0W A;  2LC5 A;  4WRI A;  1KCY A;  3DVJ A;  4GBA A;  2BL0 B;  5AAN A;  2KOT A;  1XVJ A;  1BT6 A;  3A4U B;  1J7O A;  4DCK A;  1IJ5 A;  2KAX A;  1YUS A;  2L50 A;  5JOL A;  1JWD A;  4CFQ A;  3BUM B;  2JTZ A;  1JF0 A;  2G2B A;  1S5G Z;  2OTG B;  3GOF A;  1Y1A A;  2E30 A;  4OR9 B;  2SAS A;  2K2A A;  1QIV A;  1H8B A;  1WLZ A;  1J7P A;  5HKW A;  1KSM A;  1A75 B;  2H61 A;  2VRG A;  4PAL A;  4OKH A;  3EK4 A;  4PE1 A;  1L7Z A;  3OB1 B;  1CFF A;  3I5G C;  2M49 B;  3I5F B;  1YRT B;  4U8D A;  3I5H C;  4BY5 A;  1LA3 A;  3DVM A;  3BOW B;  1AP4 A;  3K21 A;  1Q80 A;  3JVT C;  1E8A A;  2IS9 A;  1H4B A;  1IGV A;  1XFY O;  2B1U A;  4ETO A;  4A4C A;  4FTG A;  1AVS A;  2GV5 A;  5KTY A;  1LVC D;  2AAO A;  1XK4 C;  1SNL A;  2F3Z A;  2Y5I A;  1EJ3 A;  1CMG A;  1ZMZ A;  2Q91 A;  1DJH A;  1YR5 A;  4YGA A;  4HRE E;  5CPV A;  1J1E A;  1WLM A;  2KAV A;  1F8H A;  1CFC A;  2HPS A;  1ALV A;  1XA5 A;  2KYF A;  1PSB A;  2KGR A;  2PSR A;  3BUN B;  1PK0 D;  1KQM B;  1L2O B;  1ZAC A;  2JNX A;  3TS5 C;  1FI6 A;  1NPQ A;  2MRD A;  2MBX A;  3VRN A;  1TNQ A;  3NSK A;  2M9G A;  1TN4 A;  1SR6 B;  4AQI A;  1MXE A;  4GGF C;  4PHM A;  2BCA A;  1V1G A;  4OV2 A;  3OX6 A;  2LUX A;  3SG6 A;  2OS8 B;  4GFT A;  1KFU S;  2O5G A;  5G08 A;  2LAN A;  1BG1 A;  1F55 A;  1S3P A;  3DVE A;  2QPT A;  2EGD A;  1RRO A;  4M2P A;  4YGC B;  2WCF A;  5DKN A;  1DTL A;  1KFU L;  1CFD A;  3DVK A;  2L4I A;  2L51 A;  2V53 A;  3GK1 A;  4GUK A;  5ER5 A;  3O78 A;  1RTP 1;  4M2Q A;  1PVB A;  1X02 A;  2BCX A;  2Y4Q A;  2EC6 B;  4MEW A;  3DF0 A;  1RJV A;  2K61 A;  4I5K A;  1FW4 A;  1NCX A;  1YVL A;  3A8R A;  4MZK A;  4PHN A;  1SBJ A;  1NSH A;  2FCE A;  1DF0 A;  3EVU A;  2ZRT A;  4YI8 A;  5DKR A;  1FF1 A;  2ZN8 A;  1MUX A;  1KK7 Y;  3ICB A;  5HLV A;  1RFJ A;  4C0K A;  4QJ4 B;  4C0J A;  2HQ8 A;  1B7T Z;  2CNP A;  3TUY C;  1K2H A;  1EXR A;  1B47 A;  1FBV A;  4JWQ A;  3I5I B;  2BKH B;  1XFW O;  3CGA A;  1XFZ O;  1CFP A;  2BEC A;  1SL9 A;  3O6B A;  4P2Y B;  2WC8 A;  1JUO A;  2M0R A;  1XFU O;  1QX7 A;  5CSI A;  3JTD C;  1SW8 A;  2KGB C;  2NCO A;  5ER4 X;  1UUR A;  2L4H A;  1BMO A;  1N2D A;  3SIB A;  1QVI Z;  1R2U A;  1OOJ A;  5FYX A;  2LHL A;  1VRK A;  2JRF A;  1CLL A;  3MSE B;  3E3R A;  1TRF A;  4ICB A;  1NP8 A;  1TOP A;  3WHT B;  2K7O A;  1SCM C;  4CID A;  4GPL B;  4PCW A;  2JPT A;  2JUL A;  1D1O A;  2E6W A;  1DJW A;  3PFV A;  1DVI A;  2KSP A;  1RWY A;  3TDU A;  2LV7 A;  4XJK B;  3SG7 A;  2JXC A;  1UHN A;  2A4J A;  2LNK A;  1KSO A;  1SR6 C;  1B4C A;  1U5I A;  1XO5 A;  2BBN A;  2F2P A;  2K2F A;  2F2O A;  2JT3 A;  1QLS A;  2Y1N A;  4WQ3 A;  2RGI A;  4C0L A;  1UP5 A;  1QX5 B;  1LXF C;  1JFK A;  3OB2 B;  3EKH A;  5PAL A;  2AMI A;  1SMG A;  1JF2 A;  2KNE A;  1YUT A;  1TCO B;  3KEV A;  3WXA A;  4QJ5 B;  5GQQ C;  1R6P A;  1B9A A;  4N1G A;  4CLN A;  2LMU A;  1XFX O;  1XK4 A;  1BR4 B;  5CSN A;  1BOC A;  1WDC B;  3EVR A;  3KHE A;  2LVJ A;  4PHK A;  1OZO A;  1KQV A;  4DRW A;  4YGD B;  3PAT A;  4ZCU A;  1IQ3 A;  1OSA A;  1S5G Y;  5B8I B;  2MJW B;  3BQ3 A;  2F8P A;  4NDB A;  2KHN A;  1DJZ A;  3NSO A;  4GGN A;  3D0Y A;  3F45 A;  1KWO C;  3PN7 C;  1LA0 A;  5TNC A;  4CFR A;  1F70 A;  2ISD A;  4HSZ A;  4AOM A;  2JXL A;  2L98 A;  1JSA A;  1OQP A;  1YVH A;  2M1K B;  5J3X A;  1ZFS A;  5HKZ A;  3GK4 X;  3SG3 A;  4ORB B;  1M31 A;  4HRH A;  1WRL A;  3BUO B;  1CDM A;  4P5O E;  1W7I B;  1A2X A;  1YRU B;  5AEQ A;  1TNW A;  1QX2 A;  1SY9 A;  3D10 A;  4M2O A;  2KBM A;  4OCI A;  1LIN A;  2F33 A;  1K90 D;  2NZ0 A;  1OMR A;  1MWN A;  1LKJ A;  1YTZ C;  3CR2 A;  1QTX A;  1MHO A;  1DGU A;  2ZN9 A;  3FS7 A;  3EKJ A;  3LK0 A;  3DF0 B;  1UHK A;  1AJ4 A;  4NDC A;  3SG4 A;  1V1F A;  2QAC A;  4N1F A;  5HKY A;  4L9M A;  1Y0V H;  2BL0 C;  1DF0 B;  1K94 A;  3HCM A;  1ALW A;  1M63 B;  1QV0 A;  4D1E A;  4JQ0 D;  2LLT A;  1REC A;  4NQG A;  1EG4 A;  1DJI A;  2JWW A;  4TNC A;  2BKI B;  1BJF A;  1J1D A;  2OTG C;  5DKQ A;  3RM1 A;  1TNP A;  3KO0 A;  1JBA A;  3NSL A;  1TIZ A;  2JT8 A;  4ORA B;  2K7D A;  1CTR A;  1CB1 A;  1K9P A;  2H2K A;  2LE9 B;  1M46 A;  4IL1 A;  1SKT A;  3I5F C;  3NSI A;  3OHM B;  2ZND A;  2BE4 A;  3AAK A;  4PHJ A;  2KQY A;  1C07 A;  3VGO A;  2JZI A;  4MSP A;  3EVV A;  1MQ1 A;  3ZNI A;  2CCM A;  3ZWH A;  1F71 A;  2BCB A;  1ZUZ A;  3H4S E;  2LHI A;  4XYN A;  4BY4 A;  1A4P A;  1B7T Y;  2K7C A;  3IQO A;  2CTN A;  4MZL A;  1PAL A;  1QLK A;  2I18 A;  2MHH A;  2ZKM X;  3PLF B;  1QV1 A;  2LAP A;  2MLE C;  2NLN A;  3C1V A;  2LP2 A;  1YX8 A;  2AUC A;  1CNP A;  2LCP A;  1XYD A;  1KK8 B;  5D69 A;  2FOT A;  1CDP A;  1UHH A;  3VRR A;  3I5G B;  1K95 A;  1N65 A;  1UWO A;  2KFF A;  3CLN A;  1QVI Y;  2JU0 A;  3FIA A;  4E68 A;  1A29 A;  3BUW B;  2ZNE A;  1W7J B;  4NDD A;  1KQM C;  1L2O C;  1K93 D;  2P6B B;  1S1E A;  2M29 A;  4CPV A;  1NX0 A;  1ODB A;  2KI4 B;  2HET A;  1G33 A;  1M45 A;  1CLM A;  4DUQ A;  2G9B A;  2CXJ A;  2OS8 C;  1CDN A;  2LMV A;  3CR5 X;  1GGZ A;  4DS7 A;  5KU1 A;  1NX2 A;  3FWB A;  4MRX A;  1GQM A;  1N0Y A;  1K9U A;  3BXK A;  1K9K A;  2WOS A;  3SIA A;  3OP0 A;  1GGW A;  2WCB A;  4Q04 A;  2WND A;  3IQQ A;  1CM4 A;  2NXQ A;  1K96 A;  1S26 D;  2EC6 C;  1WRZ A;  1MR8 A;  2NCP A;  2ZRS A;  5HYD A;  4FQO A;  3RLZ A;  1QJT A;  1QS7 A;  4MN0 A;  4MZJ A;  3CWG A;  5KSZ A;  5I2Q A;  2KFH A;  3O4Y A;  4YGB B;  3PSR A;  1NX3 A;  3TZ1 A;  2L2E A;  1B8L A;  3CZT X;  1NYA A;  3BUX B;  4YBH B;  1NIW A;  2ZFD A;  5F6T A;  2F3Y A;  3I5I C;  1UHJ A;  1NUB A;  2KBI A;  4XJK A;  3SG5 A;  3AKA A;  4MBE A;  4DIR A;  1DJG A;  2JOJ A;  3CR4 X;  1C7W A;  1SYM A;  1SRA A;  2KYC A;  3CTN A;  4N5X A;  2L5X B;  4HRG A;  1S6I A;  4JPZ B;  1TCF A;  2MAZ A;  4F0Z B;  4WQ2 A;  2LM5 A;  2FJU B;  4GGF A;  1OMD A;  1EL4 A;  2MA2 A;  4USL A;  2JNF A;  1SL8 A;  1KK8 C;  1J55 A;  3VRQ A;  1IJ6 A;  2KFG A;  3EK8 A;  1S6J A;  2JT0 A;  1IKU A;  4MRY A;  1WY9 A;  2K7B A;  2BE6 A;  2M3W A;  2COL B;  3TUY B;  1F54 A;  4OVN F;  2I94 A;  2PMY A;  1G4Y R;  1AJ5 A;  1B8R A;  3LCP C;  2KI4 C;  4YI9 A;  2KI6 D;  1A75 A;  1GJY A;  1Y1U A;  3JTD B;  2KAY A;  4PE0 A;  1AHR A;  3AAJ A;  2TN4 A;  5HLO A;  1ZOT B;  1DJY A;  3PAL A;  2JC2 A;  3IF7 A;  2H61 C;  4PDZ A;  2LVI A;  1NCZ A;  4UPG A;  2M97 A;  3BOW A;  1SCM B;  4A4B A;  1FI5 A;  5K89 A;  1PSR A;  1TTX A;  2I7A A;  2M7N A;  1S36 A;  1OMV A;  1RK9 A;  1UUS A;  3VRP A;  4I5J A;  1BF5 A;  2M1U A;  2PAS A;  2PRU A;  1G8I A;  1CM1 A;  1MXL C;  1Y6W A;  2CT9 A;  2JTT A;  1OZS A;  1WDC C;  3PM8 A;  1DMO A;  3EK7 A;  5I2L A;  1HQV A;  1PVA A;  2D8N A;  1IRJ A;  1SPY A;  1UHI A;  4MLW A;  2WCE A;  3FWC A;  2SCP A;  2HF5 A;  1C7V A;  1JC2 A;  1QIW A;  2LVV A;  1B1G A;  5AER A;  3GK2 A;  1SCV A;  3AKB A;  1DT7 B;  1NCY A;  1YX7 A;  2CBL A;  2Q4U A;  2LLU A;  1CKK A;  1IH0 A;  4GNK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...