1DQEA

Bombyx mori pheromone binding protein
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
137
structure length
137
Chain Sequence
SQEVMKNLSLNFGKALDECKKEMTLTDAINEDFYNFWKEGYEIKNRETGCAIMCLSTKLNMLDPEGNLHHGNAMEFAKKHGADETMAQQLIDIVHGCEKSTPANDDKCIWTLGVATCFKAEIHKLNWAPSMDVAVGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHEROMONE-BINDING PROTEIN
publication title Sexual attraction in the silkworm moth: structure of the pheromone-binding-protein-bombykol complex.
pubmed doi rcsb
source organism Bombyx mori
molecule tags Transport protein
total genus 48
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 1dqeA00
1C3ZA 1TUJA 3DY9A 3FE8A 3NGVA 3BJHA 4INWA 3PJIA 2PQLA 1TWOA 3CDNA 4JD9A 3K1EA 5DICA 3S0AA 1OOGA 1ORGA 1C3YA 2L2CA 3NHIA 4F7FA 3B6XA 3S0BA 3CZ1A 3CZ0A 3D78A 3CABA 3S0DA 3BFAA 3D77A 1P28A 1GM0A 2KPHA 3B86A 3N7HA 2P70A 2WC5A 2GTEA 3OGNA 3NHTA 3QMEA 3R1OA 2WC6A 2WCJA 3FE6A 2WCMA 4INXA 1T14A 3R72A 3DYEA 3B88A 3L4AA 3L4LA 2WCLA 2H8VA 4PT1A 3V2LA 3B87A 2QEOA 3S0FA 3BFHA 3D75A 3D74A 2QDIA 3S0EA 2ERBA 1OOHA 3L47A 1OW4A 3BFBA 2WCHA 1OOIX 4OZDA 1DQEA 3D76A 3S0GA 3Q8IA 3D73A 2QEBA 1OOFA 3VB1A 2FJYA 2QEVA 3R1VA 2P71A 1QWVA 3FE9A 3DXLA 3B7AA 4FQTA 1XFRA 3CZ2A 3CYZA 2QEHA 2WCKA 3RZSA 3DZTA 3R1PA 2JPOA 1LS8A 5EL2A
chains in the Genus database with same CATH superfamily
2M29A 1EG4A 1H4BA 3FE8A 1SL9A 1B4CA 1SCMC 2LNKA 1KQMC 1DGVA 2LAPA 1IJ6A 2OPOA 5AFPA 1J7PA 1WRZA 1TWOA 1Z2CB 3E3RA 1SPYA 1G8IA 2LM5A 2B1UA 2KBMA 1ORGA 3LK0A 4MEWA 1KWOC 1A29A 1HT9A 1VRKA 2OS8B 2VRGA 3I5IC 4PHKA 5HLOA 3S0BA 3CZ1A 1WRLA 3D78A 1JF0A 1G33A 4GGFC 3SS5A 1C7WA 3WHUB 1OMVA 4A4BA 3QRXA 3PN7B 3EK8A 3SG4A 1S26D 1QJTA 3D77A 2BE4A 1PALA 1H8BA 5HLVA 1EXRA 1BR1B 5I8NA 1TCOB 1MUXA 4HRHA 2MA2A 1QASA 4R1EA 3N7HA 3C1VA 5DKNA 1OE9B 2L0PA 2P70A 3EKHA 3LK1A 2WC5A 2LVKA 1TUZA 3TUYC 1LVCD 3QMEA 3A4UB 4D1EA 2JQ6A 1L2OC 3DVKA 4JPZB 2WCJA 2PRUA 1U5IA 5HL1A 5FI2A 4GGFA 3PM8A 1MHOA 2M1KB 2JZIA 2ZFDA 4GGNA 1DELA 4PDZA 1J7RA 2QACA 1BOCA 3HCMA 4ETOA 3O2PA 1ALVA 2H8VA 4PT1A 2CBLA 4OKHA 1JSAA 3WHTB 1K90D 2RGIA 3V2LA 4MSPA 1DGUA 1K9KA 3BFHA 5IBWA 1A03A 4ICBA 2LCPA 4M2PA 2K7DA 2KI4B 3BUNB 3SJSA 4C0JA 3SG5A 2EGDA 1CLBA 2JT8A 1NX2A 4MLWA 4AOMA 1BLQA 1SCMB 1V1FA 1ODBA 2BL0B 5FI6A 2M8UA 1CDMA 1KQMB 1UURA 1JF2A 2WC8A 4OZDA 1S5GY 1PRWA 1NIWA 3SIBA 1IWQA 1BJFA 2L51A 2MRDA 2ZKMX 3VGOA 1DQEA 1N65A 4IL1A 5G08A 5CSFA 4N5XA 3SIAA 2BE6A 1KK7Y 3D0YA 5HKZA 3Q8IA 4NQGA 2F3YA 3EG5B 1IRJA 1K96A 3RLZA 4A4CA 1PK0D 1A2XA 1S6IA 3AAJA 3VB1A 1AJ4A 2HPSA 1KWOB 2QEVA 2CT9A 1E8AA 2MBXA 3R1VA 1U5IB 2K2AA 5GQQC 4PALA 1IGVA 4XYNA 3SG7A 2L98A 1JFJA 4CFRA 3PM2A 1V1GA 2YGUA 2JWWA 3PFVA 2AAOA 3EK7A 2JOJA 3GK1A 4IJ7A 3GOFA 4FTGA 1RWYA 1BODA 3BUOB 1CDNA 1CFPA 1SR6C 1DEKA 4DS7A 3BUWB 2M0RA 4YGBB 1CNPA 1CLMA 5ER4X 1BU3A 4DRWA 4U8DA 1L2OB 2M9GA 2JXLA 1SBJA 2M49B 3BOWA 1DMOA 1PVBA 2LVJA 5EL2A 1C3ZA 1J55A 2CNPA 4YI9A 3BJHA 4INWA 3NSIA 2JXCA 3K21A 1BMOA 4F0ZB 1KCYA 1ZFSA 1CMFA 4MZKA 3WNXB 1M63B 2WCFA 2Y1NA 1YR5A 3D0YB 2LMTA 3CGAA 3I5FB 1J7QA 2AUCA 2NXQA 4QJ4B 4M2QA 2JTZA 1UWOA 1C3YA 1ZACA 2L2CA 3NHIA 1DT7B 2WCBA 1QX5B 2JTTA 1DC1A 2LMUA 2L4HA 3VRNA 1MQ1A 3B6XA 1QVIY 4N1FA 1L7ZA 2CXJA 4N1GA 1QX2A 3TS5B 1IQ3A 1W7IB 3S0DA 4C0LA 4GFTA 3AKAA 1N2DA 1GQMA 2BL0C 1MXLC 2JULA 3M0WA 2Q91A 1SL8A 5J3XA 1GM0A 4BY5A 4DCKA 2LUXA 1F54A 1LKJA 2LV7A 1NUBA 1JBAA 1UHJA 3NHTA 3BUMB 1GJYA 3FWCA 4GNKB 2LLTA 5AERA 1R2UA 4USLA 4CFQA 3BOWB 1B8RA 1WLZA 2JC2A 2KHNA 2L5YA 3OBVA 1OZOA 4HRGA 3NXAA 1TOPA 1S36A 1WRKA 4INXA 1J1DA 1Z4HA 2I18A 1DVIA 3R72A 3L4AA 1OQPA 2BECA 1AJ5A 2G2BA 2MAZA 5I2LA 2BBMA 2R2IA 1B8CA 4DUQA 3HX4A 1CB1A 4TNCA 3OB2B 2ZNDA 4PHJA 5CSNA 5D7FA 2QEOA 1SR6B 2JT3A 3VRPA 1TNWA 2K60A 4P5OE 3D74A 3S0EA 5K89A 1HQVA 3OHMB 4QJ3B 1NP8A 2IS9A 2LLUA 3KPXA 5HYDA 4BY4A 2GGMA 5HKWA 2LLSA 1MWNA 3BYAA 1IIOA 1RROA 1LA0A 2L5XB 4I5JA 1W9ZA 2KGBC 2LP2A 5AEQA 2CCMA 2KQ6A 4OV2A 4AQIA 1BG1A 1M39A 2LHLA 2H61C 1C7VA 2WCEA 1KQVA 2GGZA 3VRRA 1K93D 2KI6C 5I94A 3F45A 3OP0A 2KI6D 4NDBA 3AKBA 3O4YA 1SMGA 1CFFA 1Y1XA 1NYAA 2KFFA 3IVTA 3PALA 2L2EA 1SY9A 4WRIA 1Y6WA 3IF7A 2LP3A 1TIZA 3H4SE 1WDCC 1XK4C 2I94A 2BNXA 3I5FC 1XFYO 3OX5A 4MN0A 4PE0A 2P71A 1TNPA 3BQ3A 1NCXA 1JUOA 5CSIA 3VROA 4FQOA 1SKTA 1KK8C 1XFWO 1K94A 1QWVA 3IQOA 3DVMA 3FE9A 3UNWA 3DXLA 1S3PA 1ZOTB 1FI6A 4PE4A 1B1GA 4HSZA 1QIVA 1R6PA 1XFRA 2H61A 3CZ2A 3CYZA 5JOLA 3DF0B 1K95A 2KLDA 3TS5C 3NSOA 1CMGA 1ZMZA 2QEHA 3ZWHA 3IQQA 2KLEA 1CM1A 1SCVA 2JT0A 2Y4QA 3DZTA 1EJ3A 2LANA 1SSEB 4WQ2A 2MLEC 1K2HA 1XK4A 1NSHA 1LS8A 1AVSA 4CIDA 1CFCA 1TUJA 3NGVA 1EG3A 2JRFA 3PJIA 1GGZA 1EL4A 2Q4UA 4MVFA 3WXAA 1QXPA 2PQLA 3TDUA 1A4PA 1XFUO 4ZCUA 3SS4A 1S5GZ 3FS7A 2F8PA 1IG5A 4XJKA 5I2OA 3I5GB 2HQWA 2CTNA 2Y1MA 3AAKA 2LHIA 1UHKA 1K8UA 1PSRA 4UPGA 2BKHB 2PSRA 1AP4A 2M7NA 1K9UA 2E6WA 2EHBA 3FIAA 3LCPC 4JKTA 3PSRA 1N0YA 1AHRA 2OTGC 3CZ0A 2H2KA 1SW8A 4ZCVA 2MLFC 3CABA 2L4IA 2PALA 1QLKA 2M7LA 2K7CA 3SG2A 4MZJA 1P28A 3CR4X 2FCEA 4GBAA 4YI8A 3SG6A 3O6BA 2O60A 4PCWA 4I5NB 5KTYA 1KFXL 2GTEA 3BXKA 1M46A 2KAYA 5ER5A 3TDIA 1PSBA 2F33A 3NSKA 1PULA 4ORBB 1YVLA 1WDCB 1RTP1 1CDPA 1B7TY 3R1OA 5D69A 5D3OA 1NX1A 2WC6A 4OR9B 1QLSA 2WCMA 1A75A 1KK8B 1T14A 1FI5A 4ORCB 5AANA 1ALWA 1AUIB 2BKIB 2WNDA 2M3WA 2NCOA 5HKYA 2ZN8A 2Y5IA 4XJKB 2K8MB 1WY9A 2BCBA 2PASA 1M45A 3S0FA 2M1UA 1GGWA 3D75A 4NDDA 2JNFA 2QDIA 2I7AA 2KNEA 2K61A 3EK4A 3I5HC 5BPJA 3EVRA 3CR2A 4CPVA 4E68A 2ERBA 1S6CA 1DTLA 2M97A 4DIRA 4AQJA 1OOHA 1F71A 1UHHA 1OW4A 5FYXA 1QS7A 1SL7A 2HF5A 1Q80A 2WCHA 1OOIX 4YGCB 3SS3A 2KFHA 1NX0A 1KSMA 1LA3A 5DKQA 2SASA 2ZNEA 3EVUA 1UHIA 3PATA 5KU1A 1YUUA 5CSJA 1Y0VH 1YURA 1F4QA 2COLB 1XFVO 3KHEA 3OB1B 3RM1A 5DKRA 3S0GA 3ZNIA 2KQYA 2QEBA 4JWQA 1JC2A 1RJVA 1CLLA 2JPTA 2FJYA 3TDZA 1QATA 1X02A 3DF0A 3I5GC 1FPWA 1TTXA 1OMRA 2F2PA 3NSLA 2OTGB 2KGRA 2ISDA 1DJZA 1LXFC 3KO0A 1A75B 2ZRSA 2BCAA 3OX6A 2LC5A 4YGDB 2FJUB 4FQTA 1OSAA 1CM4A 3JTDC 1NPQA 1FF1A 4MRXA 3KEVA 4L9MA 2E30A 1YX8A 1EH2A 5AXIA 1J7OA 5JJGA 2KBIA 2WCKA 2F2OA 1CKKA 2O5GA 3CTNA 2K7BA 1KFXS 1DJXA 1UUSA 3CR5X 3JVTC 1JFKA 4M2OA 2KOTA 1NWDA 3DY9A 1JWDA 1XVJA 3UO9A 2BAPA 1FBVA 1PVAA 1QV1A 2HETA 4NDCA 1XO5A 1M31A 3MSEB 5CPVA 2PVBA 4YGAA 1XYDA 1QX7A 1J1EA 2NLNA 3CDNA 4JD9A 3K1EA 5DICA 2SCPA 1OOGA 3KF9A 3I5HB 1SRAA 4I5LB 4P2YB 3S0AA 3LLEA 1TCFA 3A8RA 4F7FA 2WOSA 4OCIA 1OZSA 4Q04A 1C07A 3LL8B 1KFUS 2HQ8A 2F3ZA 4ORAB 4PHMA 2KAXA 4PE7A 1K9PA 1F4OA 3BFAA 1DJGA 3CWGA 3GK2A 1D1OA 2EC6C 2PMYA 1MXEA 4MRYA 1DJWA 1AK8A 2KPHA 3B86A 3FWBA 2KAVA 1YRUB 1DF0A 1CDLA 1TRFA 3OGNA 1S1EA 3EKJA 1G4YR 4I5KA 5FI7A 2KDHA 2NZ0A 1ZUZA 2JNXA 1SK6D 1UP5A 4GUKA 1YVHA 4GAOA 3FE6A 1IQ5A 1KK7Z 4PE1A 1SNLA 1IH0A 4C0KA 4QJ5B 1QV0A 3DVEA 2L50A 1IKUA 1FW4A 1IJ5A 1WLMA 1XA5A 2LUCA 4JQ0D 3DYEA 3B88A 1RFJA 2G9BA 1QTXA 3PLFB 1QIWA 3L4LA 2WCLA 3JTDB 4YBHB 5F6TA 2K2FA 3B87A 3I5IB 2ZN9A 5I2QA 2BBNA 3O78A 3O4XA 1DJYA 4YGEB 1YUSA 1RECA 1BT6A 2LMVA 3CZTX 3JVTB 4KYNA 5TNCA 2LE9B 2LVIA 2QPTA 2MJWB 2OS8C 3L47A 4OVNF 1MF8B 3BFBA 4MZLA 2ZRTA 2K7OA 5B8IB 4YRUA 1Y1UA 1S6JA 1B8LA 3CLNA 4MBEA 3PN7C 1Y1AA 3DD4A 3TUYB 1F70A 1MR8A 1TNXA 2BCXA 2P6BB 1OOJA 1F8HA 2PYQA 2JU0A 2LVVA 1UHNA 2KYCA 4PHNA 1OMDA 1YUTA 1TNQA 3D76A 1DF0B 3TZ1A 1NCZA 1YX7A 3D73A 1OOFA 2A4JA 1DJIA 3CS1A 3EVVA 4GPLB 1KSOA 2MHHA 2GV5A 2KFGA 5PALA 5KSZA 2FCDA 3GK4X 1B7TZ 1RK9A 1DJHA 3DVJA 1KFUL 3SG3A 1TN4A 1BR4B 1W7JB 1CTRA 1NX3A 1XFXO 1SYMA 1YRTB 2EC6B 2I2RE 2V53A 3B7AA 1YTZC 1F55A 1CFDA 2K0JA 1QVIZ 3ICBA 4HREE 1XFZO 3VRQA 4WQ3A 3D10A 2D8NA 1BF5A 2NCPA 2KYFA 4CLNA 3RZSA 1NCYA 1B9AA 2TN4A 2WORA 2AMIA 2DOQA 2KSPA 3R1PA 2JPOA 1B47A 2KI4C 1LINA 3BUXB 2FOTA
chains in the Genus database with same CATH topology
1C3ZA 1TUJA 3DY9A 3FE8A 3NGVA 3BJHA 4INWA 3PJIA 2PQLA 1TWOA 3CDNA 4JD9A 3K1EA 5DICA 3S0AA 1OOGA 1ORGA 1C3YA 2L2CA 3NHIA 4F7FA 3B6XA 3S0BA 3CZ1A 3CZ0A 3D78A 3CABA 3S0DA 3BFAA 3D77A 1P28A 1GM0A 2KPHA 3B86A 3N7HA 2P70A 2WC5A 2GTEA 3OGNA 3NHTA 3QMEA 3R1OA 2WC6A 2WCJA 3FE6A 2WCMA 4INXA 1T14A 3R72A 3DYEA 3B88A 3L4AA 3L4LA 2WCLA 2H8VA 4PT1A 3V2LA 3B87A 2QEOA 3S0FA 3BFHA 3D75A 3D74A 2QDIA 3S0EA 2ERBA 1OOHA 3L47A 1OW4A 3BFBA 2WCHA 1OOIX 4OZDA 1DQEA 3D76A 3S0GA 3Q8IA 3D73A 2QEBA 1OOFA 3VB1A 2FJYA 2QEVA 3R1VA 2P71A 1QWVA 3FE9A 3DXLA 3B7AA 4FQTA 1XFRA 3CZ2A 3CYZA 2QEHA 2WCKA 3RZSA 3DZTA 3R1PA 2JPOA 1LS8A 5EL2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C3Z A;  1TUJ A;  3DY9 A;  3FE8 A;  3NGV A;  3BJH A;  4INW A;  3PJI A;  2PQL A;  1TWO A;  3CDN A;  4JD9 A;  3K1E A;  5DIC A;  3S0A A;  1OOG A;  1ORG A;  1C3Y A;  2L2C A;  3NHI A;  4F7F A;  3B6X A;  3S0B A;  3CZ1 A;  3CZ0 A;  3D78 A;  3CAB A;  3S0D A;  3BFA A;  3D77 A;  1P28 A;  1GM0 A;  2KPH A;  3B86 A;  3N7H A;  2P70 A;  2WC5 A;  2GTE A;  3OGN A;  3NHT A;  3QME A;  3R1O A;  2WC6 A;  2WCJ A;  3FE6 A;  2WCM A;  4INX A;  1T14 A;  3R72 A;  3DYE A;  3B88 A;  3L4A A;  3L4L A;  2WCL A;  2H8V A;  4PT1 A;  3V2L A;  3B87 A;  2QEO A;  3S0F A;  3BFH A;  3D75 A;  3D74 A;  2QDI A;  3S0E A;  2ERB A;  1OOH A;  3L47 A;  1OW4 A;  3BFB A;  2WCH A;  1OOI X;  4OZD A;  1DQE A;  3D76 A;  3S0G A;  3Q8I A;  3D73 A;  2QEB A;  1OOF A;  3VB1 A;  2FJY A;  2QEV A;  3R1V A;  2P71 A;  1QWV A;  3FE9 A;  3DXL A;  3B7A A;  4FQT A;  1XFR A;  3CZ2 A;  3CYZ A;  2QEH A;  2WCK A;  3RZS A;  3DZT A;  3R1P A;  2JPO A;  1LS8 A;  5EL2 A; 
#chains in the Genus database with same CATH topology
 2M29 A;  1EG4 A;  1H4B A;  3FE8 A;  1SL9 A;  1B4C A;  1SCM C;  2LNK A;  1KQM C;  1DGV A;  2LAP A;  1IJ6 A;  2OPO A;  5AFP A;  1J7P A;  1WRZ A;  1TWO A;  1Z2C B;  3E3R A;  1SPY A;  1G8I A;  2LM5 A;  2B1U A;  2KBM A;  1ORG A;  3LK0 A;  4MEW A;  1KWO C;  1A29 A;  1HT9 A;  1VRK A;  2OS8 B;  2VRG A;  3I5I C;  4PHK A;  5HLO A;  3S0B A;  3CZ1 A;  1WRL A;  3D78 A;  1JF0 A;  1G33 A;  4GGF C;  3SS5 A;  1C7W A;  3WHU B;  1OMV A;  4A4B A;  3QRX A;  3PN7 B;  3EK8 A;  3SG4 A;  1S26 D;  1QJT A;  3D77 A;  2BE4 A;  1PAL A;  1H8B A;  5HLV A;  1EXR A;  1BR1 B;  5I8N A;  1TCO B;  1MUX A;  4HRH A;  2MA2 A;  1QAS A;  4R1E A;  3N7H A;  3C1V A;  5DKN A;  1OE9 B;  2L0P A;  2P70 A;  3EKH A;  3LK1 A;  2WC5 A;  2LVK A;  1TUZ A;  3TUY C;  1LVC D;  3QME A;  3A4U B;  4D1E A;  2JQ6 A;  1L2O C;  3DVK A;  4JPZ B;  2WCJ A;  2PRU A;  1U5I A;  5HL1 A;  5FI2 A;  4GGF A;  3PM8 A;  1MHO A;  2M1K B;  2JZI A;  2ZFD A;  4GGN A;  1DEL A;  4PDZ A;  1J7R A;  2QAC A;  1BOC A;  3HCM A;  4ETO A;  3O2P A;  1ALV A;  2H8V A;  4PT1 A;  2CBL A;  4OKH A;  1JSA A;  3WHT B;  1K90 D;  2RGI A;  3V2L A;  4MSP A;  1DGU A;  1K9K A;  3BFH A;  5IBW A;  1A03 A;  4ICB A;  2LCP A;  4M2P A;  2K7D A;  2KI4 B;  3BUN B;  3SJS A;  4C0J A;  3SG5 A;  2EGD A;  1CLB A;  2JT8 A;  1NX2 A;  4MLW A;  4AOM A;  1BLQ A;  1SCM B;  1V1F A;  1ODB A;  2BL0 B;  5FI6 A;  2M8U A;  1CDM A;  1KQM B;  1UUR A;  1JF2 A;  2WC8 A;  4OZD A;  1S5G Y;  1PRW A;  1NIW A;  3SIB A;  1IWQ A;  1BJF A;  2L51 A;  2MRD A;  2ZKM X;  3VGO A;  1DQE A;  1N65 A;  4IL1 A;  5G08 A;  5CSF A;  4N5X A;  3SIA A;  2BE6 A;  1KK7 Y;  3D0Y A;  5HKZ A;  3Q8I A;  4NQG A;  2F3Y A;  3EG5 B;  1IRJ A;  1K96 A;  3RLZ A;  4A4C A;  1PK0 D;  1A2X A;  1S6I A;  3AAJ A;  3VB1 A;  1AJ4 A;  2HPS A;  1KWO B;  2QEV A;  2CT9 A;  1E8A A;  2MBX A;  3R1V A;  1U5I B;  2K2A A;  5GQQ C;  4PAL A;  1IGV A;  4XYN A;  3SG7 A;  2L98 A;  1JFJ A;  4CFR A;  3PM2 A;  1V1G A;  2YGU A;  2JWW A;  3PFV A;  2AAO A;  3EK7 A;  2JOJ A;  3GK1 A;  4IJ7 A;  3GOF A;  4FTG A;  1RWY A;  1BOD A;  3BUO B;  1CDN A;  1CFP A;  1SR6 C;  1DEK A;  4DS7 A;  3BUW B;  2M0R A;  4YGB B;  1CNP A;  1CLM A;  5ER4 X;  1BU3 A;  4DRW A;  4U8D A;  1L2O B;  2M9G A;  2JXL A;  1SBJ A;  2M49 B;  3BOW A;  1DMO A;  1PVB A;  2LVJ A;  5EL2 A;  1C3Z A;  1J55 A;  2CNP A;  4YI9 A;  3BJH A;  4INW A;  3NSI A;  2JXC A;  3K21 A;  1BMO A;  4F0Z B;  1KCY A;  1ZFS A;  1CMF A;  4MZK A;  3WNX B;  1M63 B;  2WCF A;  2Y1N A;  1YR5 A;  3D0Y B;  2LMT A;  3CGA A;  3I5F B;  1J7Q A;  2AUC A;  2NXQ A;  4QJ4 B;  4M2Q A;  2JTZ A;  1UWO A;  1C3Y A;  1ZAC A;  2L2C A;  3NHI A;  1DT7 B;  2WCB A;  1QX5 B;  2JTT A;  1DC1 A;  2LMU A;  2L4H A;  3VRN A;  1MQ1 A;  3B6X A;  1QVI Y;  4N1F A;  1L7Z A;  2CXJ A;  4N1G A;  1QX2 A;  3TS5 B;  1IQ3 A;  1W7I B;  3S0D A;  4C0L A;  4GFT A;  3AKA A;  1N2D A;  1GQM A;  2BL0 C;  1MXL C;  2JUL A;  3M0W A;  2Q91 A;  1SL8 A;  5J3X A;  1GM0 A;  4BY5 A;  4DCK A;  2LUX A;  1F54 A;  1LKJ A;  2LV7 A;  1NUB A;  1JBA A;  1UHJ A;  3NHT A;  3BUM B;  1GJY A;  3FWC A;  4GNK B;  2LLT A;  5AER A;  1R2U A;  4USL A;  4CFQ A;  3BOW B;  1B8R A;  1WLZ A;  2JC2 A;  2KHN A;  2L5Y A;  3OBV A;  1OZO A;  4HRG A;  3NXA A;  1TOP A;  1S36 A;  1WRK A;  4INX A;  1J1D A;  1Z4H A;  2I18 A;  1DVI A;  3R72 A;  3L4A A;  1OQP A;  2BEC A;  1AJ5 A;  2G2B A;  2MAZ A;  5I2L A;  2BBM A;  2R2I A;  1B8C A;  4DUQ A;  3HX4 A;  1CB1 A;  4TNC A;  3OB2 B;  2ZND A;  4PHJ A;  5CSN A;  5D7F A;  2QEO A;  1SR6 B;  2JT3 A;  3VRP A;  1TNW A;  2K60 A;  4P5O E;  3D74 A;  3S0E A;  5K89 A;  1HQV A;  3OHM B;  4QJ3 B;  1NP8 A;  2IS9 A;  2LLU A;  3KPX A;  5HYD A;  4BY4 A;  2GGM A;  5HKW A;  2LLS A;  1MWN A;  3BYA A;  1IIO A;  1RRO A;  1LA0 A;  2L5X B;  4I5J A;  1W9Z A;  2KGB C;  2LP2 A;  5AEQ A;  2CCM A;  2KQ6 A;  4OV2 A;  4AQI A;  1BG1 A;  1M39 A;  2LHL A;  2H61 C;  1C7V A;  2WCE A;  1KQV A;  2GGZ A;  3VRR A;  1K93 D;  2KI6 C;  5I94 A;  3F45 A;  3OP0 A;  2KI6 D;  4NDB A;  3AKB A;  3O4Y A;  1SMG A;  1CFF A;  1Y1X A;  1NYA A;  2KFF A;  3IVT A;  3PAL A;  2L2E A;  1SY9 A;  4WRI A;  1Y6W A;  3IF7 A;  2LP3 A;  1TIZ A;  3H4S E;  1WDC C;  1XK4 C;  2I94 A;  2BNX A;  3I5F C;  1XFY O;  3OX5 A;  4MN0 A;  4PE0 A;  2P71 A;  1TNP A;  3BQ3 A;  1NCX A;  1JUO A;  5CSI A;  3VRO A;  4FQO A;  1SKT A;  1KK8 C;  1XFW O;  1K94 A;  1QWV A;  3IQO A;  3DVM A;  3FE9 A;  3UNW A;  3DXL A;  1S3P A;  1ZOT B;  1FI6 A;  4PE4 A;  1B1G A;  4HSZ A;  1QIV A;  1R6P A;  1XFR A;  2H61 A;  3CZ2 A;  3CYZ A;  5JOL A;  3DF0 B;  1K95 A;  2KLD A;  3TS5 C;  3NSO A;  1CMG A;  1ZMZ A;  2QEH A;  3ZWH A;  3IQQ A;  2KLE A;  1CM1 A;  1SCV A;  2JT0 A;  2Y4Q A;  3DZT A;  1EJ3 A;  2LAN A;  1SSE B;  4WQ2 A;  2MLE C;  1K2H A;  1XK4 A;  1NSH A;  1LS8 A;  1AVS A;  4CID A;  1CFC A;  1TUJ A;  3NGV A;  1EG3 A;  2JRF A;  3PJI A;  1GGZ A;  1EL4 A;  2Q4U A;  4MVF A;  3WXA A;  1QXP A;  2PQL A;  3TDU A;  1A4P A;  1XFU O;  4ZCU A;  3SS4 A;  1S5G Z;  3FS7 A;  2F8P A;  1IG5 A;  4XJK A;  5I2O A;  3I5G B;  2HQW A;  2CTN A;  2Y1M A;  3AAK A;  2LHI A;  1UHK A;  1K8U A;  1PSR A;  4UPG A;  2BKH B;  2PSR A;  1AP4 A;  2M7N A;  1K9U A;  2E6W A;  2EHB A;  3FIA A;  3LCP C;  4JKT A;  3PSR A;  1N0Y A;  1AHR A;  2OTG C;  3CZ0 A;  2H2K A;  1SW8 A;  4ZCV A;  2MLF C;  3CAB A;  2L4I A;  2PAL A;  1QLK A;  2M7L A;  2K7C A;  3SG2 A;  4MZJ A;  1P28 A;  3CR4 X;  2FCE A;  4GBA A;  4YI8 A;  3SG6 A;  3O6B A;  2O60 A;  4PCW A;  4I5N B;  5KTY A;  1KFX L;  2GTE A;  3BXK A;  1M46 A;  2KAY A;  5ER5 A;  3TDI A;  1PSB A;  2F33 A;  3NSK A;  1PUL A;  4ORB B;  1YVL A;  1WDC B;  1RTP 1;  1CDP A;  1B7T Y;  3R1O A;  5D69 A;  5D3O A;  1NX1 A;  2WC6 A;  4OR9 B;  1QLS A;  2WCM A;  1A75 A;  1KK8 B;  1T14 A;  1FI5 A;  4ORC B;  5AAN A;  1ALW A;  1AUI B;  2BKI B;  2WND A;  2M3W A;  2NCO A;  5HKY A;  2ZN8 A;  2Y5I A;  4XJK B;  2K8M B;  1WY9 A;  2BCB A;  2PAS A;  1M45 A;  3S0F A;  2M1U A;  1GGW A;  3D75 A;  4NDD A;  2JNF A;  2QDI A;  2I7A A;  2KNE A;  2K61 A;  3EK4 A;  3I5H C;  5BPJ A;  3EVR A;  3CR2 A;  4CPV A;  4E68 A;  2ERB A;  1S6C A;  1DTL A;  2M97 A;  4DIR A;  4AQJ A;  1OOH A;  1F71 A;  1UHH A;  1OW4 A;  5FYX A;  1QS7 A;  1SL7 A;  2HF5 A;  1Q80 A;  2WCH A;  1OOI X;  4YGC B;  3SS3 A;  2KFH A;  1NX0 A;  1KSM A;  1LA3 A;  5DKQ A;  2SAS A;  2ZNE A;  3EVU A;  1UHI A;  3PAT A;  5KU1 A;  1YUU A;  5CSJ A;  1Y0V H;  1YUR A;  1F4Q A;  2COL B;  1XFV O;  3KHE A;  3OB1 B;  3RM1 A;  5DKR A;  3S0G A;  3ZNI A;  2KQY A;  2QEB A;  4JWQ A;  1JC2 A;  1RJV A;  1CLL A;  2JPT A;  2FJY A;  3TDZ A;  1QAT A;  1X02 A;  3DF0 A;  3I5G C;  1FPW A;  1TTX A;  1OMR A;  2F2P A;  3NSL A;  2OTG B;  2KGR A;  2ISD A;  1DJZ A;  1LXF C;  3KO0 A;  1A75 B;  2ZRS A;  2BCA A;  3OX6 A;  2LC5 A;  4YGD B;  2FJU B;  4FQT A;  1OSA A;  1CM4 A;  3JTD C;  1NPQ A;  1FF1 A;  4MRX A;  3KEV A;  4L9M A;  2E30 A;  1YX8 A;  1EH2 A;  5AXI A;  1J7O A;  5JJG A;  2KBI A;  2WCK A;  2F2O A;  1CKK A;  2O5G A;  3CTN A;  2K7B A;  1KFX S;  1DJX A;  1UUS A;  3CR5 X;  3JVT C;  1JFK A;  4M2O A;  2KOT A;  1NWD A;  3DY9 A;  1JWD A;  1XVJ A;  3UO9 A;  2BAP A;  1FBV A;  1PVA A;  1QV1 A;  2HET A;  4NDC A;  1XO5 A;  1M31 A;  3MSE B;  5CPV A;  2PVB A;  4YGA A;  1XYD A;  1QX7 A;  1J1E A;  2NLN A;  3CDN A;  4JD9 A;  3K1E A;  5DIC A;  2SCP A;  1OOG A;  3KF9 A;  3I5H B;  1SRA A;  4I5L B;  4P2Y B;  3S0A A;  3LLE A;  1TCF A;  3A8R A;  4F7F A;  2WOS A;  4OCI A;  1OZS A;  4Q04 A;  1C07 A;  3LL8 B;  1KFU S;  2HQ8 A;  2F3Z A;  4ORA B;  4PHM A;  2KAX A;  4PE7 A;  1K9P A;  1F4O A;  3BFA A;  1DJG A;  3CWG A;  3GK2 A;  1D1O A;  2EC6 C;  2PMY A;  1MXE A;  4MRY A;  1DJW A;  1AK8 A;  2KPH A;  3B86 A;  3FWB A;  2KAV A;  1YRU B;  1DF0 A;  1CDL A;  1TRF A;  3OGN A;  1S1E A;  3EKJ A;  1G4Y R;  4I5K A;  5FI7 A;  2KDH A;  2NZ0 A;  1ZUZ A;  2JNX A;  1SK6 D;  1UP5 A;  4GUK A;  1YVH A;  4GAO A;  3FE6 A;  1IQ5 A;  1KK7 Z;  4PE1 A;  1SNL A;  1IH0 A;  4C0K A;  4QJ5 B;  1QV0 A;  3DVE A;  2L50 A;  1IKU A;  1FW4 A;  1IJ5 A;  1WLM A;  1XA5 A;  2LUC A;  4JQ0 D;  3DYE A;  3B88 A;  1RFJ A;  2G9B A;  1QTX A;  3PLF B;  1QIW A;  3L4L A;  2WCL A;  3JTD B;  4YBH B;  5F6T A;  2K2F A;  3B87 A;  3I5I B;  2ZN9 A;  5I2Q A;  2BBN A;  3O78 A;  3O4X A;  1DJY A;  4YGE B;  1YUS A;  1REC A;  1BT6 A;  2LMV A;  3CZT X;  3JVT B;  4KYN A;  5TNC A;  2LE9 B;  2LVI A;  2QPT A;  2MJW B;  2OS8 C;  3L47 A;  4OVN F;  1MF8 B;  3BFB A;  4MZL A;  2ZRT A;  2K7O A;  5B8I B;  4YRU A;  1Y1U A;  1S6J A;  1B8L A;  3CLN A;  4MBE A;  3PN7 C;  1Y1A A;  3DD4 A;  3TUY B;  1F70 A;  1MR8 A;  1TNX A;  2BCX A;  2P6B B;  1OOJ A;  1F8H A;  2PYQ A;  2JU0 A;  2LVV A;  1UHN A;  2KYC A;  4PHN A;  1OMD A;  1YUT A;  1TNQ A;  3D76 A;  1DF0 B;  3TZ1 A;  1NCZ A;  1YX7 A;  3D73 A;  1OOF A;  2A4J A;  1DJI A;  3CS1 A;  3EVV A;  4GPL B;  1KSO A;  2MHH A;  2GV5 A;  2KFG A;  5PAL A;  5KSZ A;  2FCD A;  3GK4 X;  1B7T Z;  1RK9 A;  1DJH A;  3DVJ A;  1KFU L;  3SG3 A;  1TN4 A;  1BR4 B;  1W7J B;  1CTR A;  1NX3 A;  1XFX O;  1SYM A;  1YRT B;  2EC6 B;  2I2R E;  2V53 A;  3B7A A;  1YTZ C;  1F55 A;  1CFD A;  2K0J A;  1QVI Z;  3ICB A;  4HRE E;  1XFZ O;  3VRQ A;  4WQ3 A;  3D10 A;  2D8N A;  1BF5 A;  2NCP A;  2KYF A;  4CLN A;  3RZS A;  1NCY A;  1B9A A;  2TN4 A;  2WOR A;  2AMI A;  2DOQ A;  2KSP A;  3R1P A;  2JPO A;  1B47 A;  2KI4 C;  1LIN A;  3BUX B;  2FOT A; 
#chains in the Genus database with same CATH homology
 1C3Z A;  1TUJ A;  3DY9 A;  3FE8 A;  3NGV A;  3BJH A;  4INW A;  3PJI A;  2PQL A;  1TWO A;  3CDN A;  4JD9 A;  3K1E A;  5DIC A;  3S0A A;  1OOG A;  1ORG A;  1C3Y A;  2L2C A;  3NHI A;  4F7F A;  3B6X A;  3S0B A;  3CZ1 A;  3CZ0 A;  3D78 A;  3CAB A;  3S0D A;  3BFA A;  3D77 A;  1P28 A;  1GM0 A;  2KPH A;  3B86 A;  3N7H A;  2P70 A;  2WC5 A;  2GTE A;  3OGN A;  3NHT A;  3QME A;  3R1O A;  2WC6 A;  2WCJ A;  3FE6 A;  2WCM A;  4INX A;  1T14 A;  3R72 A;  3DYE A;  3B88 A;  3L4A A;  3L4L A;  2WCL A;  2H8V A;  4PT1 A;  3V2L A;  3B87 A;  2QEO A;  3S0F A;  3BFH A;  3D75 A;  3D74 A;  2QDI A;  3S0E A;  2ERB A;  1OOH A;  3L47 A;  1OW4 A;  3BFB A;  2WCH A;  1OOI X;  4OZD A;  1DQE A;  3D76 A;  3S0G A;  3Q8I A;  3D73 A;  2QEB A;  1OOF A;  3VB1 A;  2FJY A;  2QEV A;  3R1V A;  2P71 A;  1QWV A;  3FE9 A;  3DXL A;  3B7A A;  4FQT A;  1XFR A;  3CZ2 A;  3CYZ A;  2QEH A;  2WCK A;  3RZS A;  3DZT A;  3R1P A;  2JPO A;  1LS8 A;  5EL2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...