1DQEA

Bombyx mori pheromone binding protein
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
137
structure length
137
Chain Sequence
SQEVMKNLSLNFGKALDECKKEMTLTDAINEDFYNFWKEGYEIKNRETGCAIMCLSTKLNMLDPEGNLHHGNAMEFAKKHGADETMAQQLIDIVHGCEKSTPANDDKCIWTLGVATCFKAEIHKLNWAPSMDVAVGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords PHEROMONE-BINDING PROTEIN
publication title Sexual attraction in the silkworm moth: structure of the pheromone-binding-protein-bombykol complex.
pubmed doi rcsb
source organism Bombyx mori
total genus 48
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 1dqeA00
3FE6A 3B86A 3S0FA 1GM0A 3FE9A 3S0GA 3CZ2A 4OZDA 2PQLA 3BFBA 1TWOA 3B7AA 3PJIA 3S0AA 3D73A 3QMEA 1DQEA 2WCJA 3NHIA 3R1VA 3BJHA 2WCLA 3VB1A 3CDNA 3R1OA 3DZTA 2H8VA 3CYZA 3N7HA 3S0BA 1C3ZA 4INXA 1LS8A 4FQTA 3NGVA 3D76A 3OGNA 2QEOA 1P28A 2GTEA 4PT1A 3L47A 2WCHA 3V2LA 4JD9A 3RZSA 2P70A 3CZ1A 2QDIA 3DY9A 3CZ0A 2P71A 5EL2A 3R1PA 3R72A 3L4AA 1ORGA 2QEBA 3K1EA 1QWVA 3NHTA 1OW4A 3DXLA 2ERBA 2QEHA 3S0DA 2WC6A 1TUJA 2WCKA 3D78A 3Q8IA 2L2CA 2KPHA 3D77A 2WC5A 2JPOA 2WCMA 3BFAA 3CABA 4INWA 2FJYA 5DICA 3DYEA 3BFHA 1OOHA 1OOIX 3B88A 3B6XA 3D74A 1T14A 2QEVA 3D75A 3L4LA 1C3YA 4F7FA 1OOFA 3S0EA 3FE8A 1OOGA 1XFRA 3B87A
chains in the Genus database with same CATH superfamily
4I5NB 1IRJA 2WC8A 3O6BA 4PHNA 2NCOA 3EK7A 5AANA 2SCPA 2M0RA 3LK1A 1QATA 1YRTB 2MAZA 4PHMA 4BY5A 4L9MA 2BCXA 2E6WA 1KFXL 2BKHB 1RFJA 1R2UA 2M49B 1KK8C 2OPOA 2JXLA 4ORCB 3EVRA 4MEWA 1B47A 1DC1A 4DRWA 5KSZA 2WCJA 3KEVA 4R1EA 2LVVA 4UPGA 2L4IA 1WRKA 2WORA 5CPVA 1CFCA 1OZSA 3M0WA 1FI6A 1K96A 2JPTA 1BOCA 2QACA 4XJKA 1TNWA 5ER5A 2HPSA 3NSIA 1YR5A 1ALVA 3CYZA 2E30A 1TNPA 3CS1A 3N7HA 4USLA 1C3ZA 2KBMA 1CDMA 1OMRA 3FWBA 2ISDA 1SKTA 1CNPA 4AQJA 2NLNA 4FTGA 1NIWA 3K21A 3O2PA 3DVKA 1YUSA 3NGVA 1AJ4A 1NX1A 3D76A 4MZKA 2KAXA 4PDZA 3TS5B 1B1GA 2H61C 3BUWB 2RGIA 2GTEA 1CLBA 3VRQA 1XFWO 1XVJA 3CWGA 1SRAA 4OR9B 2BCBA 3L47A 2M97A 2KI6D 2WCHA 1S6JA 3SG7A 3EVVA 1QIWA 3CR2A 4N5XA 1CB1A 3NSOA 1HQVA 1DJZA 1A4PA 1PVAA 4OV2A 2P70A 1MXLC 4YBHB 1AK8A 3O78A 1NCYA 4TNCA 2COLB 1YUTA 2L0PA 1JFJA 2P71A 1UHJA 2PSRA 2Q91A 1BU3A 1WRLA 1KK7Y 5FYXA 1IWQA 1VRKA 1KFXS 4ORBB 4CIDA 3E3RA 3KO0A 1SW8A 2QEBA 1EG4A 5CSJA 5I2LA 1CFDA 2LCPA 1K9KA 4HRHA 4DUQA 3TDUA 3AAJA 3DF0B 2PASA 3EK4A 1K9UA 2LMTA 3S0DA 2Y5IA 1S5GY 1IJ6A 4PE4A 4AOMA 1BR4B 3LCPC 3RLZA 1K9PA 1YURA 2BE6A 4ETOA 2HETA 2LM5A 1DVIA 2KPHA 1JSAA 4YGBB 1DEKA 4JQ0D 1DJIA 4PCWA 3PALA 1J1DA 1FI5A 2F3YA 3PN7B 1DT7B 2LANA 1YVLA 3A4UB 4DCKA 2FOTA 3BFAA 1SNLA 3CABA 1CTRA 2EC6C 1DJWA 1NX3A 2K2FA 4INWA 1QV1A 4MVFA 2ZRTA 2FJYA 4PALA 1LA0A 1M39A 3BFHA 1LINA 1OOHA 1SK6D 3B88A 3TUYB 3B6XA 3D75A 1T14A 2JNFA 1DJYA 1C3YA 4F7FA 3S0EA 1DGUA 5DKNA 1IG5A 1N65A 1KSOA 3CGAA 3B87A 4IL1A 4ZCUA 2HQ8A 3FE6A 1W7IB 2EHBA 1B7TY 1XFUO 3EK8A 2JTTA 1XYDA 2Y1NA 1AJ5A 3CZTX 1TRFA 3LL8B 2I18A 4N1FA 2G2BA 1DELA 2K7BA 2I94A 2KHNA 1QLKA 1WDCB 2G9BA 1HT9A 2BECA 3S0GA 2DOQA 3EKHA 4GGFC 2JT3A 5FI7A 1C7WA 1B8LA 1WY9A 3RM1A 2PQLA 5CSNA 1F55A 2LNKA 3FS7A 1AHRA 1QIVA 2LHIA 1B8RA 1KWOB 1D1OA 3FWCA 3OB2B 1CDPA 3SS3A 1DJXA 2YGUA 5KU1A 4PE7A 3KPXA 3VB1A 2FJUB 2ZNEA 2LE9B 3WHUB 1ZMZA 4CPVA 1K2HA 3IQOA 3QRXA 1Y1XA 2KLEA 1QLSA 2KGRA 1QASA 1RK9A 4NQGA 1OMVA 2AMIA 3TDIA 4MLWA 1JWDA 1JF2A 1RJVA 3I5HB 4YRUA 2F2PA 1NP8A 1QXPA 3D0YA 3PN7C 1PRWA 5I94A 1IQ3A 5CSIA 1QX7A 2QEOA 3WXAA 1YX8A 2AUCA 1OOJA 1A75A 1F4QA 1JUOA 1M45A 4YGDB 1SL7A 1SR6B 4PT1A 1TNXA 1LA3A 5AEQA 2K7OA 1A03A 1F4OA 1OSAA 5HLOA 3TUYC 2KLDA 4JD9A 1Z4HA 1QV0A 2JWWA 2KI4B 3VRNA 3VROA 3RZSA 1EL4A 1TN4A 2BKIB 3IF7A 4YI9A 3DY9A 1PVBA 2D8NA 2BL0C 2WCEA 3BUXB 4HREE 4PHJA 3SS5A 1IQ5A 4U8DA 3HX4A 3R1PA 3UO9A 1XFZO 2OTGB 2BBMA 4JPZB 1ORGA 1SSEB 2OS8B 4WRIA 3BUMB 1XK4C 4P2YB 1WDCC 4A4BA 2K7CA 1M31A 1W9ZA 3WHTB 1E8AA 1QVIY 1M63B 4FQOA 2K60A 2JT8A 3BOWA 5K89A 1TUJA 4F0ZB 1PALA 1U5IA 1N0YA 2H61A 2AAOA 3D78A 4OKHA 3I5GB 2KNEA 2LLTA 1RTP1 2FCDA 2LP2A 1UWOA 3VGOA 2LP3A 2M29A 2NXQA 3D77A 1QS7A 3OP0A 1J7QA 4I5LB 4E68A 4WQ2A 2MJWB 4HRGA 2NZ0A 3H4SE 1NYAA 5DICA 1G8IA 3KF9A 1S1EA 1IH0A 4P5OE 3O4XA 1OOIX 3I5HC 1DF0A 3I5FB 3L4LA 5HKWA 2ZN8A 2IS9A 1Y1AA 2MLEC 4JWQA 1XFRA 1CLMA 1KCYA 1CMFA 3B86A 3S0FA 1GJYA 3CR4X 1EG3A 1SR6C 4GFTA 1LVCD 5AERA 1NUBA 1SYMA 1MF8B 1SL9A 2JOJA 1B7TZ 1K8UA 2K61A 3CTNA 1JF0A 4I5KA 1L7ZA 1ZOTB 2KI4C 1NPQA 1TOPA 3FE9A 1GGWA 5AXIA 4NDDA 3GOFA 2M7LA 3EG5B 3SIBA 4AQIA 1CDNA 1NCZA 1KQMB 1WLMA 1XA5A 2JULA 4GBAA 1MXEA 4OZDA 2HQWA 3SG3A 5HL1A 1YRUB 5I2OA 5KTYA 1CFPA 3OB1B 1S3PA 2L50A 2ZNDA 3BFBA 1UUSA 2LUXA 4GGNA 1ZACA 2SASA 1CFFA 1F8HA 1FW4A 2OTGC 1R6PA 1DTLA 3O4YA 1NWDA 1YX7A 1Y6WA 1DQEA 4GAOA 4PHKA 2OS8C 4MRYA 4MBEA 3BYAA 1SY9A 3JTDB 2ZFDA 3I5IB 3R1VA 4YGCB 1AVSA 2PVBA 1JC2A 3IQQA 1B4CA 1J55A 5HLVA 1GQMA 2WCLA 3LLEA 3TS5C 4MZLA 5D69A 3DD4A 5HKYA 3PLFB 5J3XA 1NX0A 3DZTA 2F2OA 2H8VA 2JRFA 2WNDA 5JJGA 2WCBA 4HSZA 2F33A 1DGVA 3AKBA 5F6TA 3S0BA 1V1FA 1CM4A 2TN4A 2LV7A 3AAKA 3I5GC 5D3OA 1RWYA 3TDZA 5FI2A 1K95A 2I7AA 2LVKA 4XJKB 1LS8A 1W7JB 2KAYA 4FQTA 1Q80A 3SJSA 3SS4A 3OGNA 1IGVA 3PSRA 2KOTA 5AFPA 1XFYO 1OE9B 4GGFA 1K93D 1SPYA 2GV5A 4M2PA 1TUZA 3PFVA 1SL8A 3V2LA 1FF1A 2M8UA 3TZ1A 5CSFA 1PULA 2R2IA 2QPTA 4MN0A 2CCMA 5DKQA 5D7FA 3HCMA 1TTXA 2CNPA 2M1KB 1IJ5A 5ER4X 2LAPA 1AP4A 1DMOA 2F3ZA 4MZJA 1S6IA 2HF5A 3CZ0A 2O60A 3GK2A 1NSHA 2BBNA 1NCXA 4NDBA 1B8CA 1U5IB 1JBAA 2LLSA 2JXCA 2GGMA 2L2EA 3CLNA 3DVMA 3R72A 2JT0A 2LVIA 1SCVA 4DIRA 3K1EA 1EH2A 3NSLA 4CFQA 1KQMC 1QWVA 2JQ6A 1BF5A 1OZOA 1QJTA 2I2RE 2MLFC 4A4CA 1OW4A 4D1EA 2GGZA 2LC5A 3DXLA 2NCPA 2Y1MA 1XO5A 1IIOA 3SIAA 4CLNA 3D10A 1QVIZ 1F71A 2KBIA 2LMUA 2KGBC 2WCKA 1CLLA 3Q8IA 1IKUA 4YGAA 1J7RA 3JTDC 3I5IC 4BY4A 1DF0B 1BG1A 1CKKA 2ZKMX 3OHMB 1QTXA 1RROA 4CFRA 1S36A 1SCMB 3ZNIA 1C07A 2MA2A 1C7VA 2KAVA 2JTZA 1H4BA 1KK7Z 1BT6A 2KSPA 4GNKB 1FPWA 1WRZA 5IBWA 4QJ3B 4MRXA 2PALA 1PSRA 1GGZA 1WLZA 2CXJA 3D74A 2M1UA 2QEVA 1LKJA 4C0JA 2BCAA 2ZN9A 2PRUA 1PSBA 2Y4QA 3FE8A 3OX6A 3VRPA 2K7DA 1XK4A 1J7PA 1MUXA 3BXKA 4QJ5B 4C0LA 1DJHA 1S5GZ 3VRRA 1GM0A 1KWOC 1RECA 1BODA 2A4JA 2KDHA 2JU0A 2BAPA 4WQ3A 1LXFC 5PALA 1A2XA 1PK0D 2EC6B 1KSMA 3SG6A 3ZWHA 2EGDA 3AKAA 4NDCA 1CMGA 4ICBA 5DKRA 2M3WA 1SMGA 2JC2A 3KHEA 3CZ2A 2BE4A 5JOLA 3UNWA 1ZFSA 1MQ1A 1TWOA 2K2AA 5G08A 3B7AA 5TNCA 3PJIA 3S0AA 4IJ7A 3D73A 3WNXB 1NX2A 3QMEA 1TCOB 1S6CA 2VRGA 5GQQC 2JZIA 3NHIA 3SG5A 3EVUA 5I8NA 2F8PA 3GK4X 2LUCA 1K90D 1K94A 1XFXO 2B1UA 3BJHA 4ZCVA 3CDNA 1BLQA 1X02A 1MR8A 3R1OA 1YVHA 1L2OB 2ZRSA 2KFGA 2O5GA 1A29A 2L5XB 4INXA 1UP5A 1UHNA 1EXRA 2MRDA 2KYFA 1KFUL 1J1EA 3JVTB 4PE1A 2MBXA 1SCMC 1UURA 3DVEA 3OX5A 4KYNA 1TIZA 1CM1A 1P28A 1YTZC 3EKJA 3NXAA 1EJ3A 1DJGA 4YI8A 1MHOA 2CTNA 3CR5X 1B9AA 1JFKA 2K8MB 2FCEA 2KI6C 2Q4UA 2PMYA 4C0KA 5BPJA 3LK0A 2BNXA 3D0YB 2KQYA 1M46A 1Z2CB 3PATA 3PM2A 2PYQA 1OMDA 1A75B 3GK1A 3CZ1A 4MSPA 1V1GA 2K0JA 2LMVA 2QDIA 3OBVA 5B8IB 1TCFA 1G4YR 3IVTA 4Q04A 1G33A 2P6BB 1QX2A 1KK8B 5EL2A 2KQ6A 4DS7A 1QX5B 5HYDA 1MWNA 1ALWA 3L4AA 2L98A 5HKZA 2L4HA 4OVNF 3FIAA 3A8RA 4N1GA 1AUIB 2WOSA 1BJFA 3NHTA 1UHHA 2L51A 4M2QA 1F70A 1FBVA 2ERBA 2KFHA 2QEHA 2KYCA 3DVJA 1SBJA 3SG2A 2WC6A 1OQPA 4PE0A 4QJ4B 2M7NA 2H2KA 2LVJA 4OCIA 3C1VA 1TNQA 2BL0B 1ZUZA 2L2CA 3I5FC 1Y1UA 3ICBA 1KQVA 4XYNA 2CT9A 4GUKA 3F45A 2M9GA 3SG4A 3PM8A 2WCFA 4YGEB 5FI6A 3MSEB 1UHKA 3BOWB 3BQ3A 1N2DA 1KFUS 2CBLA 1H8BA 2WC5A 1UHIA 1CDLA 1S26D 1Y0VH 3DF0A 2JPOA 2WCMA 2KFFA 2LLUA 1L2OC 4I5JA 4M2OA 2JNXA 3BUOB 3BUNB 1BR1B 3DYEA 4JKTA 1BMOA 1YUUA 4ORAB 2MHHA 3JVTC 1XFVO 1J7OA 3NSKA 2L5YA 1ODBA 1OOFA 4GPLB 1OOGA 2LHLA 2V53A 5I2QA 1F54A
chains in the Genus database with same CATH topology
3FE6A 3B86A 3S0FA 1GM0A 3FE9A 3S0GA 3CZ2A 4OZDA 2PQLA 3BFBA 1TWOA 3B7AA 3PJIA 3S0AA 3D73A 3QMEA 1DQEA 2WCJA 3NHIA 3R1VA 3BJHA 2WCLA 3VB1A 3CDNA 3R1OA 3DZTA 2H8VA 3CYZA 3N7HA 3S0BA 1C3ZA 4INXA 1LS8A 4FQTA 3NGVA 3D76A 3OGNA 2QEOA 1P28A 2GTEA 4PT1A 3L47A 2WCHA 3V2LA 4JD9A 3RZSA 2P70A 3CZ1A 2QDIA 3DY9A 3CZ0A 2P71A 5EL2A 3R1PA 3R72A 3L4AA 1ORGA 2QEBA 3K1EA 1QWVA 3NHTA 1OW4A 3DXLA 2ERBA 2QEHA 3S0DA 2WC6A 1TUJA 2WCKA 3D78A 3Q8IA 2L2CA 2KPHA 3D77A 2WC5A 2JPOA 2WCMA 3BFAA 3CABA 4INWA 2FJYA 5DICA 3DYEA 3BFHA 1OOHA 1OOIX 3B88A 3B6XA 3D74A 1T14A 2QEVA 3D75A 3L4LA 1C3YA 4F7FA 1OOFA 3S0EA 3FE8A 1OOGA 1XFRA 3B87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FE6 A;  3B86 A;  3S0F A;  1GM0 A;  3FE9 A;  3S0G A;  3CZ2 A;  4OZD A;  2PQL A;  3BFB A;  1TWO A;  3B7A A;  3PJI A;  3S0A A;  3D73 A;  3QME A;  1DQE A;  2WCJ A;  3NHI A;  3R1V A;  3BJH A;  2WCL A;  3VB1 A;  3CDN A;  3R1O A;  3DZT A;  2H8V A;  3CYZ A;  3N7H A;  3S0B A;  1C3Z A;  4INX A;  1LS8 A;  4FQT A;  3NGV A;  3D76 A;  3OGN A;  2QEO A;  1P28 A;  2GTE A;  4PT1 A;  3L47 A;  2WCH A;  3V2L A;  4JD9 A;  3RZS A;  2P70 A;  3CZ1 A;  2QDI A;  3DY9 A;  3CZ0 A;  2P71 A;  5EL2 A;  3R1P A;  3R72 A;  3L4A A;  1ORG A;  2QEB A;  3K1E A;  1QWV A;  3NHT A;  1OW4 A;  3DXL A;  2ERB A;  2QEH A;  3S0D A;  2WC6 A;  1TUJ A;  2WCK A;  3D78 A;  3Q8I A;  2L2C A;  2KPH A;  3D77 A;  2WC5 A;  2JPO A;  2WCM A;  3BFA A;  3CAB A;  4INW A;  2FJY A;  5DIC A;  3DYE A;  3BFH A;  1OOH A;  1OOI X;  3B88 A;  3B6X A;  3D74 A;  1T14 A;  2QEV A;  3D75 A;  3L4L A;  1C3Y A;  4F7F A;  1OOF A;  3S0E A;  3FE8 A;  1OOG A;  1XFR A;  3B87 A; 
#chains in the Genus database with same CATH topology
 4I5N B;  1IRJ A;  2WC8 A;  3O6B A;  4PHN A;  2NCO A;  3EK7 A;  5AAN A;  2SCP A;  2M0R A;  3LK1 A;  1QAT A;  1YRT B;  2MAZ A;  4PHM A;  4BY5 A;  4L9M A;  2BCX A;  2E6W A;  1KFX L;  2BKH B;  1RFJ A;  1R2U A;  2M49 B;  1KK8 C;  2OPO A;  2JXL A;  4ORC B;  3EVR A;  4MEW A;  1B47 A;  1DC1 A;  4DRW A;  5KSZ A;  2WCJ A;  3KEV A;  4R1E A;  2LVV A;  4UPG A;  2L4I A;  1WRK A;  2WOR A;  5CPV A;  1CFC A;  1OZS A;  3M0W A;  1FI6 A;  1K96 A;  2JPT A;  1BOC A;  2QAC A;  4XJK A;  1TNW A;  5ER5 A;  2HPS A;  3NSI A;  1YR5 A;  1ALV A;  3CYZ A;  2E30 A;  1TNP A;  3CS1 A;  3N7H A;  4USL A;  1C3Z A;  2KBM A;  1CDM A;  1OMR A;  3FWB A;  2ISD A;  1SKT A;  1CNP A;  4AQJ A;  2NLN A;  4FTG A;  1NIW A;  3K21 A;  3O2P A;  3DVK A;  1YUS A;  3NGV A;  1AJ4 A;  1NX1 A;  3D76 A;  4MZK A;  2KAX A;  4PDZ A;  3TS5 B;  1B1G A;  2H61 C;  3BUW B;  2RGI A;  2GTE A;  1CLB A;  3VRQ A;  1XFW O;  1XVJ A;  3CWG A;  1SRA A;  4OR9 B;  2BCB A;  3L47 A;  2M97 A;  2KI6 D;  2WCH A;  1S6J A;  3SG7 A;  3EVV A;  1QIW A;  3CR2 A;  4N5X A;  1CB1 A;  3NSO A;  1HQV A;  1DJZ A;  1A4P A;  1PVA A;  4OV2 A;  2P70 A;  1MXL C;  4YBH B;  1AK8 A;  3O78 A;  1NCY A;  4TNC A;  2COL B;  1YUT A;  2L0P A;  1JFJ A;  2P71 A;  1UHJ A;  2PSR A;  2Q91 A;  1BU3 A;  1WRL A;  1KK7 Y;  5FYX A;  1IWQ A;  1VRK A;  1KFX S;  4ORB B;  4CID A;  3E3R A;  3KO0 A;  1SW8 A;  2QEB A;  1EG4 A;  5CSJ A;  5I2L A;  1CFD A;  2LCP A;  1K9K A;  4HRH A;  4DUQ A;  3TDU A;  3AAJ A;  3DF0 B;  2PAS A;  3EK4 A;  1K9U A;  2LMT A;  3S0D A;  2Y5I A;  1S5G Y;  1IJ6 A;  4PE4 A;  4AOM A;  1BR4 B;  3LCP C;  3RLZ A;  1K9P A;  1YUR A;  2BE6 A;  4ETO A;  2HET A;  2LM5 A;  1DVI A;  2KPH A;  1JSA A;  4YGB B;  1DEK A;  4JQ0 D;  1DJI A;  4PCW A;  3PAL A;  1J1D A;  1FI5 A;  2F3Y A;  3PN7 B;  1DT7 B;  2LAN A;  1YVL A;  3A4U B;  4DCK A;  2FOT A;  3BFA A;  1SNL A;  3CAB A;  1CTR A;  2EC6 C;  1DJW A;  1NX3 A;  2K2F A;  4INW A;  1QV1 A;  4MVF A;  2ZRT A;  2FJY A;  4PAL A;  1LA0 A;  1M39 A;  3BFH A;  1LIN A;  1OOH A;  1SK6 D;  3B88 A;  3TUY B;  3B6X A;  3D75 A;  1T14 A;  2JNF A;  1DJY A;  1C3Y A;  4F7F A;  3S0E A;  1DGU A;  5DKN A;  1IG5 A;  1N65 A;  1KSO A;  3CGA A;  3B87 A;  4IL1 A;  4ZCU A;  2HQ8 A;  3FE6 A;  1W7I B;  2EHB A;  1B7T Y;  1XFU O;  3EK8 A;  2JTT A;  1XYD A;  2Y1N A;  1AJ5 A;  3CZT X;  1TRF A;  3LL8 B;  2I18 A;  4N1F A;  2G2B A;  1DEL A;  2K7B A;  2I94 A;  2KHN A;  1QLK A;  1WDC B;  2G9B A;  1HT9 A;  2BEC A;  3S0G A;  2DOQ A;  3EKH A;  4GGF C;  2JT3 A;  5FI7 A;  1C7W A;  1B8L A;  1WY9 A;  3RM1 A;  2PQL A;  5CSN A;  1F55 A;  2LNK A;  3FS7 A;  1AHR A;  1QIV A;  2LHI A;  1B8R A;  1KWO B;  1D1O A;  3FWC A;  3OB2 B;  1CDP A;  3SS3 A;  1DJX A;  2YGU A;  5KU1 A;  4PE7 A;  3KPX A;  3VB1 A;  2FJU B;  2ZNE A;  2LE9 B;  3WHU B;  1ZMZ A;  4CPV A;  1K2H A;  3IQO A;  3QRX A;  1Y1X A;  2KLE A;  1QLS A;  2KGR A;  1QAS A;  1RK9 A;  4NQG A;  1OMV A;  2AMI A;  3TDI A;  4MLW A;  1JWD A;  1JF2 A;  1RJV A;  3I5H B;  4YRU A;  2F2P A;  1NP8 A;  1QXP A;  3D0Y A;  3PN7 C;  1PRW A;  5I94 A;  1IQ3 A;  5CSI A;  1QX7 A;  2QEO A;  3WXA A;  1YX8 A;  2AUC A;  1OOJ A;  1A75 A;  1F4Q A;  1JUO A;  1M45 A;  4YGD B;  1SL7 A;  1SR6 B;  4PT1 A;  1TNX A;  1LA3 A;  5AEQ A;  2K7O A;  1A03 A;  1F4O A;  1OSA A;  5HLO A;  3TUY C;  2KLD A;  4JD9 A;  1Z4H A;  1QV0 A;  2JWW A;  2KI4 B;  3VRN A;  3VRO A;  3RZS A;  1EL4 A;  1TN4 A;  2BKI B;  3IF7 A;  4YI9 A;  3DY9 A;  1PVB A;  2D8N A;  2BL0 C;  2WCE A;  3BUX B;  4HRE E;  4PHJ A;  3SS5 A;  1IQ5 A;  4U8D A;  3HX4 A;  3R1P A;  3UO9 A;  1XFZ O;  2OTG B;  2BBM A;  4JPZ B;  1ORG A;  1SSE B;  2OS8 B;  4WRI A;  3BUM B;  1XK4 C;  4P2Y B;  1WDC C;  4A4B A;  2K7C A;  1M31 A;  1W9Z A;  3WHT B;  1E8A A;  1QVI Y;  1M63 B;  4FQO A;  2K60 A;  2JT8 A;  3BOW A;  5K89 A;  1TUJ A;  4F0Z B;  1PAL A;  1U5I A;  1N0Y A;  2H61 A;  2AAO A;  3D78 A;  4OKH A;  3I5G B;  2KNE A;  2LLT A;  1RTP 1;  2FCD A;  2LP2 A;  1UWO A;  3VGO A;  2LP3 A;  2M29 A;  2NXQ A;  3D77 A;  1QS7 A;  3OP0 A;  1J7Q A;  4I5L B;  4E68 A;  4WQ2 A;  2MJW B;  4HRG A;  2NZ0 A;  3H4S E;  1NYA A;  5DIC A;  1G8I A;  3KF9 A;  1S1E A;  1IH0 A;  4P5O E;  3O4X A;  1OOI X;  3I5H C;  1DF0 A;  3I5F B;  3L4L A;  5HKW A;  2ZN8 A;  2IS9 A;  1Y1A A;  2MLE C;  4JWQ A;  1XFR A;  1CLM A;  1KCY A;  1CMF A;  3B86 A;  3S0F A;  1GJY A;  3CR4 X;  1EG3 A;  1SR6 C;  4GFT A;  1LVC D;  5AER A;  1NUB A;  1SYM A;  1MF8 B;  1SL9 A;  2JOJ A;  1B7T Z;  1K8U A;  2K61 A;  3CTN A;  1JF0 A;  4I5K A;  1L7Z A;  1ZOT B;  2KI4 C;  1NPQ A;  1TOP A;  3FE9 A;  1GGW A;  5AXI A;  4NDD A;  3GOF A;  2M7L A;  3EG5 B;  3SIB A;  4AQI A;  1CDN A;  1NCZ A;  1KQM B;  1WLM A;  1XA5 A;  2JUL A;  4GBA A;  1MXE A;  4OZD A;  2HQW A;  3SG3 A;  5HL1 A;  1YRU B;  5I2O A;  5KTY A;  1CFP A;  3OB1 B;  1S3P A;  2L50 A;  2ZND A;  3BFB A;  1UUS A;  2LUX A;  4GGN A;  1ZAC A;  2SAS A;  1CFF A;  1F8H A;  1FW4 A;  2OTG C;  1R6P A;  1DTL A;  3O4Y A;  1NWD A;  1YX7 A;  1Y6W A;  1DQE A;  4GAO A;  4PHK A;  2OS8 C;  4MRY A;  4MBE A;  3BYA A;  1SY9 A;  3JTD B;  2ZFD A;  3I5I B;  3R1V A;  4YGC B;  1AVS A;  2PVB A;  1JC2 A;  3IQQ A;  1B4C A;  1J55 A;  5HLV A;  1GQM A;  2WCL A;  3LLE A;  3TS5 C;  4MZL A;  5D69 A;  3DD4 A;  5HKY A;  3PLF B;  5J3X A;  1NX0 A;  3DZT A;  2F2O A;  2H8V A;  2JRF A;  2WND A;  5JJG A;  2WCB A;  4HSZ A;  2F33 A;  1DGV A;  3AKB A;  5F6T A;  3S0B A;  1V1F A;  1CM4 A;  2TN4 A;  2LV7 A;  3AAK A;  3I5G C;  5D3O A;  1RWY A;  3TDZ A;  5FI2 A;  1K95 A;  2I7A A;  2LVK A;  4XJK B;  1LS8 A;  1W7J B;  2KAY A;  4FQT A;  1Q80 A;  3SJS A;  3SS4 A;  3OGN A;  1IGV A;  3PSR A;  2KOT A;  5AFP A;  1XFY O;  1OE9 B;  4GGF A;  1K93 D;  1SPY A;  2GV5 A;  4M2P A;  1TUZ A;  3PFV A;  1SL8 A;  3V2L A;  1FF1 A;  2M8U A;  3TZ1 A;  5CSF A;  1PUL A;  2R2I A;  2QPT A;  4MN0 A;  2CCM A;  5DKQ A;  5D7F A;  3HCM A;  1TTX A;  2CNP A;  2M1K B;  1IJ5 A;  5ER4 X;  2LAP A;  1AP4 A;  1DMO A;  2F3Z A;  4MZJ A;  1S6I A;  2HF5 A;  3CZ0 A;  2O60 A;  3GK2 A;  1NSH A;  2BBN A;  1NCX A;  4NDB A;  1B8C A;  1U5I B;  1JBA A;  2LLS A;  2JXC A;  2GGM A;  2L2E A;  3CLN A;  3DVM A;  3R72 A;  2JT0 A;  2LVI A;  1SCV A;  4DIR A;  3K1E A;  1EH2 A;  3NSL A;  4CFQ A;  1KQM C;  1QWV A;  2JQ6 A;  1BF5 A;  1OZO A;  1QJT A;  2I2R E;  2MLF C;  4A4C A;  1OW4 A;  4D1E A;  2GGZ A;  2LC5 A;  3DXL A;  2NCP A;  2Y1M A;  1XO5 A;  1IIO A;  3SIA A;  4CLN A;  3D10 A;  1QVI Z;  1F71 A;  2KBI A;  2LMU A;  2KGB C;  2WCK A;  1CLL A;  3Q8I A;  1IKU A;  4YGA A;  1J7R A;  3JTD C;  3I5I C;  4BY4 A;  1DF0 B;  1BG1 A;  1CKK A;  2ZKM X;  3OHM B;  1QTX A;  1RRO A;  4CFR A;  1S36 A;  1SCM B;  3ZNI A;  1C07 A;  2MA2 A;  1C7V A;  2KAV A;  2JTZ A;  1H4B A;  1KK7 Z;  1BT6 A;  2KSP A;  4GNK B;  1FPW A;  1WRZ A;  5IBW A;  4QJ3 B;  4MRX A;  2PAL A;  1PSR A;  1GGZ A;  1WLZ A;  2CXJ A;  3D74 A;  2M1U A;  2QEV A;  1LKJ A;  4C0J A;  2BCA A;  2ZN9 A;  2PRU A;  1PSB A;  2Y4Q A;  3FE8 A;  3OX6 A;  3VRP A;  2K7D A;  1XK4 A;  1J7P A;  1MUX A;  3BXK A;  4QJ5 B;  4C0L A;  1DJH A;  1S5G Z;  3VRR A;  1GM0 A;  1KWO C;  1REC A;  1BOD A;  2A4J A;  2KDH A;  2JU0 A;  2BAP A;  4WQ3 A;  1LXF C;  5PAL A;  1A2X A;  1PK0 D;  2EC6 B;  1KSM A;  3SG6 A;  3ZWH A;  2EGD A;  3AKA A;  4NDC A;  1CMG A;  4ICB A;  5DKR A;  2M3W A;  1SMG A;  2JC2 A;  3KHE A;  3CZ2 A;  2BE4 A;  5JOL A;  3UNW A;  1ZFS A;  1MQ1 A;  1TWO A;  2K2A A;  5G08 A;  3B7A A;  5TNC A;  3PJI A;  3S0A A;  4IJ7 A;  3D73 A;  3WNX B;  1NX2 A;  3QME A;  1TCO B;  1S6C A;  2VRG A;  5GQQ C;  2JZI A;  3NHI A;  3SG5 A;  3EVU A;  5I8N A;  2F8P A;  3GK4 X;  2LUC A;  1K90 D;  1K94 A;  1XFX O;  2B1U A;  3BJH A;  4ZCV A;  3CDN A;  1BLQ A;  1X02 A;  1MR8 A;  3R1O A;  1YVH A;  1L2O B;  2ZRS A;  2KFG A;  2O5G A;  1A29 A;  2L5X B;  4INX A;  1UP5 A;  1UHN A;  1EXR A;  2MRD A;  2KYF A;  1KFU L;  1J1E A;  3JVT B;  4PE1 A;  2MBX A;  1SCM C;  1UUR A;  3DVE A;  3OX5 A;  4KYN A;  1TIZ A;  1CM1 A;  1P28 A;  1YTZ C;  3EKJ A;  3NXA A;  1EJ3 A;  1DJG A;  4YI8 A;  1MHO A;  2CTN A;  3CR5 X;  1B9A A;  1JFK A;  2K8M B;  2FCE A;  2KI6 C;  2Q4U A;  2PMY A;  4C0K A;  5BPJ A;  3LK0 A;  2BNX A;  3D0Y B;  2KQY A;  1M46 A;  1Z2C B;  3PAT A;  3PM2 A;  2PYQ A;  1OMD A;  1A75 B;  3GK1 A;  3CZ1 A;  4MSP A;  1V1G A;  2K0J A;  2LMV A;  2QDI A;  3OBV A;  5B8I B;  1TCF A;  1G4Y R;  3IVT A;  4Q04 A;  1G33 A;  2P6B B;  1QX2 A;  1KK8 B;  5EL2 A;  2KQ6 A;  4DS7 A;  1QX5 B;  5HYD A;  1MWN A;  1ALW A;  3L4A A;  2L98 A;  5HKZ A;  2L4H A;  4OVN F;  3FIA A;  3A8R A;  4N1G A;  1AUI B;  2WOS A;  1BJF A;  3NHT A;  1UHH A;  2L51 A;  4M2Q A;  1F70 A;  1FBV A;  2ERB A;  2KFH A;  2QEH A;  2KYC A;  3DVJ A;  1SBJ A;  3SG2 A;  2WC6 A;  1OQP A;  4PE0 A;  4QJ4 B;  2M7N A;  2H2K A;  2LVJ A;  4OCI A;  3C1V A;  1TNQ A;  2BL0 B;  1ZUZ A;  2L2C A;  3I5F C;  1Y1U A;  3ICB A;  1KQV A;  4XYN A;  2CT9 A;  4GUK A;  3F45 A;  2M9G A;  3SG4 A;  3PM8 A;  2WCF A;  4YGE B;  5FI6 A;  3MSE B;  1UHK A;  3BOW B;  3BQ3 A;  1N2D A;  1KFU S;  2CBL A;  1H8B A;  2WC5 A;  1UHI A;  1CDL A;  1S26 D;  1Y0V H;  3DF0 A;  2JPO A;  2WCM A;  2KFF A;  2LLU A;  1L2O C;  4I5J A;  4M2O A;  2JNX A;  3BUO B;  3BUN B;  1BR1 B;  3DYE A;  4JKT A;  1BMO A;  1YUU A;  4ORA B;  2MHH A;  3JVT C;  1XFV O;  1J7O A;  3NSK A;  2L5Y A;  1ODB A;  1OOF A;  4GPL B;  1OOG A;  2LHL A;  2V53 A;  5I2Q A;  1F54 A; 
#chains in the Genus database with same CATH homology
 3FE6 A;  3B86 A;  3S0F A;  1GM0 A;  3FE9 A;  3S0G A;  3CZ2 A;  4OZD A;  2PQL A;  3BFB A;  1TWO A;  3B7A A;  3PJI A;  3S0A A;  3D73 A;  3QME A;  1DQE A;  2WCJ A;  3NHI A;  3R1V A;  3BJH A;  2WCL A;  3VB1 A;  3CDN A;  3R1O A;  3DZT A;  2H8V A;  3CYZ A;  3N7H A;  3S0B A;  1C3Z A;  4INX A;  1LS8 A;  4FQT A;  3NGV A;  3D76 A;  3OGN A;  2QEO A;  1P28 A;  2GTE A;  4PT1 A;  3L47 A;  2WCH A;  3V2L A;  4JD9 A;  3RZS A;  2P70 A;  3CZ1 A;  2QDI A;  3DY9 A;  3CZ0 A;  2P71 A;  5EL2 A;  3R1P A;  3R72 A;  3L4A A;  1ORG A;  2QEB A;  3K1E A;  1QWV A;  3NHT A;  1OW4 A;  3DXL A;  2ERB A;  2QEH A;  3S0D A;  2WC6 A;  1TUJ A;  2WCK A;  3D78 A;  3Q8I A;  2L2C A;  2KPH A;  3D77 A;  2WC5 A;  2JPO A;  2WCM A;  3BFA A;  3CAB A;  4INW A;  2FJY A;  5DIC A;  3DYE A;  3BFH A;  1OOH A;  1OOI X;  3B88 A;  3B6X A;  3D74 A;  1T14 A;  2QEV A;  3D75 A;  3L4L A;  1C3Y A;  4F7F A;  1OOF A;  3S0E A;  3FE8 A;  1OOG A;  1XFR A;  3B87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...